2KHHA

Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
b'RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export factor MEX67
molecule tags Transport protein
source organism Saccharomyces cerevisiae
publication title Structural requirements for the ubiquitin-associated domain of the mRNA export factor Mex67 to bind its specific targets, the transcription elongation THO complex component Hpr1 and nucleoporin FXFG repeats
pubmed doi rcsb
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2khhA00
2JNHA 3H4JA 1Q02A 4UN2B 1WIVA 4F1IA 1DV0A 1G3IA 1VDLA 3K9OA 1VG5A 1ZMUA 1YLAA 1IFYA 1WR1B 2MGWA 1Y8GA 2LVQD 2ZTDA 2MJ5B 1NV9A 1WJ7A 2K0BX 2QNJA 1E94E 5JI2E 3B89A 2JY7A 2L2DA 2OOBA 1EFUB 1WHCA 2DAIA 1ZV1A 2KNVA 1TR8A 3GLFE 1OQYA 2JZ0A 3K9PA 2BWEA 3LCUA 2JY8A 3T6PA 2DKLA 3E46A 3GLIE 1HJPA 1F4IA 2K9DA 1UFZA 2LTUA 2DENA 1T6OA 2EKKA 2DAEA 1QZEA 1OKSA 1XB2B 2DAMA 1G4AE 1DO0A 2L4FA 4HEOA 1CUKA 2BWBA 1BVSA 1IM2A 1G41A 1IXSA 1VQ1A 3FE3A 1ZMVA 3FRHA 2HAKA 3GLGE 2DI0A 2OO9A 2DAGA 1SG9A 2KHHA 1VEKA 2QHOB 1HT2E 1XXHE 1PGYA 3MMPA 2KNAA 1DO2A 3LCVB 1MN3A 2G3QA 1TTEA 2LVAA 1OTRA 2JUJA 4WP2A 5DFLA 1KYIA 1JR3E 3E21A 1HT1E 3IHPA 2JZ1A 2EJSA 2H5XA 2DAKA 3F92A 2LVNC 1NV8A 2LVPC 1A5TA 1P3QQ 3BBZA 3IECA 2EKFA 2WZJA 1R4GA 1WGNA 2LVOC 2JY6B 2DZLA 2HWJA 2L4EA 2JY5A 2MROB 1HQYE 3FRIA 4GEWA 2R0IA 4DBGB 1T43A 2CWBA 2DNAA 2ZTCA 4F2LA 2O25A 2JP7A 2OOAA 2MR9A 1VEJA 2DHYA 2B3TA 1OAIA 4R71A 4Q7JA 4G3OA 2KNZA 1V92A 2QSFX 2CP8A 1GO5A 1WGLA 3GLHE 1C7YA 1ZMWA 1VEGA 1AIPC 2RRUA 2LBCA
chains in the Genus database with same CATH superfamily
2Y0TA 3B74A 3W0FA 2XSZA 4LGMA 3I4YA 4LJAA 2F4VM 1DV0A 4B08A 4OU7A 4P17A 2JWSA 1SXJC 1Z5BA 4NRWA 3HZJA 1MJGM 3U6MA 4JI5M 1WR1B 4MGHA 2V6ZM 2D7HA 1Y8GA 3GRUA 5LMNM 1D0MA 1G8PA 1HR0M 2Y0QA 3SFZA 2K0BX 1XMQM 2QNJA 3T1YM 3ZC7B 4JYAM 1EFUB 3U5ZA 1NJFA 1N78A 2ZBKB 2KEBA 3QAUA 2D7EA 1OQYA 4MB7A 2CFOA 4WURA 4ZPXA 2JZ0A 3GLHB 3KP1E 2BWEA 3ZH9B 1XMOM 1QZMA 3A46A 5EXXA 3GLIE 2OPFA 4B3MM 1JQJC 2K9DA 4GKKM 3KOYE 1YSYA 3T38A 3SASA 4JI2M 3GPYA 1GL7A 1TH2A 3J81S 1NNJA 1HQCA 1MU5A 3CF6E 1XB2B 2DAMA 1HNZM 3KW6A 1K82A 2WSFF 3GPUA 3RGSA 3C9PA 3DZDA 2L4FA 3HJSA 3KP0E 4CISA 2C99A 8CATA 1IM2A 2YQZA 2L6OA 3IG8A 4G4OA 4FVMA 4YHHM 1IXSA 3E4RA 4GH9A 3FE3A 2LHGA 4G4QA 4QOZC 3FRHA 3HHZA 4IBIA 1Z5CA 2ZAMA 2LWXA 3I04M 4KLNA 3J80S 2KHHA 5ITYA 4LRSA 3TL4X 5ITUA 4DV4M 3KSJA 3U6EA 4LG2A 3VLFB 1J5EM 3GLGA 2QBYB 2HL7A 1PJIA 1MN3A 3CTWB 1IBKM 1XHBA 1FNNA 3QYEA 3KXEC 2DVWB 3J2PB 4AG6A 5ITRA 4B3SM 2GQFA 4JI0M 2JZ1A 2H5XA 3M6AA 1IN6A 3SAVA 1PJJA 4DR7M 1NV8A 2XF3A 4X65M 4KO8A 3H4MA 3ILKA 4JI7M 4JI8M 2APLA 4LJ6A 4M9SA 5EP4A 4NC6A 2BNKA 4B3RM 4AQYM 2Z7JA 4LRTA 4QNRA 4JI3M 4MGZE 3B7QA 1NJGA 2UUBM 3L2AA 3U6OA 3HHXA 1HQYE 2QQ8A 2RKOA 3U60B 2R0IA 1I4WA 3VDPA 3SBJA 1K3XA 1T43A 1R7RA 2DNAA 2ZTCA 1L2BA 2L09A 2JP7A 2DWNA 2P5TA 3B7NA 1VEJA 2LH0A 2B3TA 4MGKE 4Q7JA 3TE6A 5KO3A 1QAOA 4IBFA 1V92A 2YFQA 1DGGA 4DUYM 2F5QA 4QHSA 4I81A 2QBYA 1YE9A 2DHRA 3KDSE 1C7YA 5EP3A 5IWAM 4DV1M 1SXJA 2F5NA 4FCWA 2ZAOA 4R3DA 1QUTA 2Z3XA 4LF9M 1XNRM 1N32M 3GO8A 2JXNA 3R8FA 3M7GA 4I8OA 3GLIB 3H4JA 4JI1M 1UM8A 1T3TA 4F1IA 3A42A 4DR4M 1VDLA 4P16A 3AOGA 2VIIA 3FUXA 3Q8XA 1VG5A 4YY3M 3ZQJA 3TPZA 1XC8A 1ZMUA 1OAOC 4NSOB 5FTLA 1NVMA 3NWLA 1YLAA 3U61B 2XGNA 3J7AS 2MGWA 2ZTDA 3FTCA 3HWSA 1WJ7A 4JN6A 2WSCF 1LV7A 1N34M 4LFAM 1IXRC 4FD2A 3A98B 4AG5A 4HLQA 4MGYE 2KDLA 2WSEF 2Z4RA 2JY7A 3J7BA 1NHGC 4DV7M 4AKIA 3U60A 1WHCA 3GQ4A 2LNHC 3L29A 2KNVA 4LF4M 1TR8A 5EJCA 3LVWA 5EXTA 2X8AA 2XFSA 1QQWA 2C9OA 1PJSA 3QWLA 1XNQM 4NSRA 5ITTA 4LF5M 1HJPA 1F4IA 3VFDA 4GC9A 2LTUA 2CHQA 1OFHA 3PNVA 2R18A 2DAEA 2EUCA 3JAMS 4PDIA 1QAMA 1W5SA 1G4AE 1N33M 4IBEA 3FKEA 3AKZA 4KHPM 5ITXE 5E6JA 4AKGA 3HKPA 2QZ4A 3Q8GA 1BVSA 2J7NA 1JR3A 4IBGA 1FJGM 4QNMA 5ITXA 1L8QA 3UGJA 3LW5F 2RGHA 3AV0A 3B9PA 1NY5A 1ZMVA 5LMUM 2X49A 2DI0A 1RU3A 3EIHA 3BOSA 2UXCM 2OO9A 2DAGA 1HNXM 3M0EA 4AI6A 1VEKA 3HU3A 4DV3M 3UZUA 3KOWE 2KNAA 4REZA 3GPPA 2QP9X 3LCVB 1SXJE 2J5YA 2G3QA 2I7PA 1TDZA 1AUAA 2Z8YM 4CGYB 2R65A 1IN5A 1NNUC 2DZNB 2CEAA 5E26A 4WP2A 5DFLA 1QDRA 3SHFA 1G71A 2GNOA 5IREB 1N77A 2W82A 3IHPA 3I4VA 4Z8XA 4B3TM 2EJSA 3VK7A 4GHLA 3K2LA 2R45A 1TGUA 3HJ8A 4R7GA 1ZAEA 2A5YB 3RGPA 3E9SA 3MJ5A 4FCVA 2EA0A 2KZUA 3GP1A 3IECA 3TQSA 2EKFA 3RE8A 5FLXS 2XEPA 4LFCM 3MHVC 3GLFA 4LJ7A 3HY5A 2WZJA 3KOXE 1R4GA 1ORYB 1SXJB 2JY6B 3K8ZA 2ZM6M 4QHTA 5FTMA 3D8BA 1IN8A 2C9CA 4XK8F 3NBIA 2CV1A 2HHHM 1XXHA 3FRIA 2H1RA 3AJIB 4FCTA 4GEWA 2CWBA 3UK6A 4F2LA 4LFBM 2O25A 3L28A 4X66M 5C18A 4ITQA 2CV0A 3U5ZB 2KA6B 4II7A 3SYKA 4L16A 4G3OA 2KNZA 1Q3CA 1TH4A 2QSFX 3GLFB 3T1HM 2UXDM 3L27A 1JB0F 4L15A 3GLHE 5KPTA 4IBKA 1Q3BA 1VEGA 4RKUF 1GJSA 4IIWA 2LBCA 3A45A 2VF8A 4CIZA 1Q02A 4OVZB 1WIVA 3L25A 4Z6YA 4LY6A 2VDBB 1G3IA 3CF0A 3C3EA 4Y28F 3U6CA 2UUAM 3K9OA 4DV6M 1D2NA 4EIWA 4DV5M 2FH0A 1L1TA 1IFYA 2FFJA 3U6QA 1NSFA 2UU9M 2LVQD 2O5RA 2KRUA 3FUUA 2MJ5B 4LJ4A 4RF0A 4D82A 2R6FA 5KPRA 3FYCA 4LJ8A 1IY1A 4D81A 1GLNA 3B89A 5JI2E 2L2DA 4DR5M 2OOBA 1QVRA 3U61A 2DAIA 1ZV1A 2XSZD 4GHAA 3U6DA 3BXWA 3C3DA 3GLIA 4AZFA 4OX9M 1GJTA 1TH3A 3LCUA 3KFUG 3T6PA 2DWMA 2G8LA 2RGOA 4GMQA 1V34A 4LZJA 2XZUA 4L8RC 2D7GA 3KS8A 4OW0A 4DR6M 3HHWA 2EKKA 3PNYA 5EXPA 1L2DA 1QZEA 4LF6M 2XZFA 1PJQA 1W5TA 1DGFA 2CUZA 4NRVA 3GQ3A 2HCBA 5DYIA 1GABA 2C96A 4I4LA 3U6LA 3VKGA 2BWBA 2LXEA 1C1KA 1QUSA 2FNAA 1IY0A 3PVSA 4LF8M 3GLHA 4W5WA 2O01F 4GIPA 4M9XA 3UMMA 2HAKA 3HGIA 4BB9A 3VKHA 1SXJD 3U6PA 2MH8A 2V1CA 1SG9A 4LJ5A 2QHOB 1PRBA 1PGYA 1XXHE 2L7IA 1Z59A 5BR8M 1G59A 1EIJA 2F5SA 5A2QS 4X62M 1TTEA 1S3SA 2LVAA 3V76A 4JI4M 3FTEA 4KT0F 5KPZA 5EP1A 1QDTA 2BJVA 5IZ7D 1KYIA 1JR3E 3FTDA 1YUBA 2VQFM 2I7NA 1HT1E 1NHWC 2R4JA 4MH0E 1R6BX 5FTJA 4XBOA 2C98A 1V33A 3VDUA 2DAKA 1QAQA 3CF2A 3F92A 3W68A 7CATA 3SAUA 2FE8A 3J27B 2LVNC 2N35A 4JI6M 2DWZB 1JR3D 1P3QQ 3GPXA 3U6SA 4HL4A 2E5LM 3GLGB 3R9XB 4NL4H 2M60A 1TF0B 3KOZE 4B7GA 1WGNA 2LVOC 3AFHA 4K0KM 2DZLA 2R44A 2YNMD 4GRIA 2XFTA 2UXBM 2HWJA 2CE7A 1QYRA 4KODA 2NQ8C 5EP2A 4GC5A 4IJFA 2FS1A 3JR4A 4G4RA 4S12A 4PT5A 1TDHA 4DBGB 3GRYA 3QYBA 1IN7A 4IBBA 3AOEC 2YR0A 1WXQA 2FOIC 3SC3A 3L26A 2DHYA 4X64M 4B7FA 1J09A 4DR3M 3DA1A 4NXNM 3HU2A 4L4UA 5IT9S 1GO5A 1WGLA 1MX0A 2V1UA 1DGHB 2KXEA 3SMSA 3GQ5A 1GKIA 1ZMWA 2Y20A 5EXSA 4DR2M 2RRUA 3W67A 1E9RA 2LHCA 3LQRA 4GITA 3RFWA 1R2ZA 3FTFA 2JNHA 3GRRA 5JI3E 3I51A 4UN2B 4BLCA 4WW0A 4IBJA 3MK6A 4XGIA 5H37D 2F5PA 1E9SA 4OVZA 1R2YA 2R62A 4B7HA 4DV0M 4JXJA 4RNAA 5KQDA 1IN4A 4L78A 2K6BA 3UJNA 1D0LA 3W0LB 1Q39A 1NV9A 2CV2A 3HHYA 4DR1M 1DGHA 5GKNA 1E94E 5DYGA 1IXSB 3NBXX 1KSFX 1GL6A 1Z5AA 4LF7M 4AKHA 2R4EA 2QCUA 4PCZA 2UUCM 1HNWM 3GLFE 1D0KA 4PD2A 1QANA 3K9PA 3LQQA 1K3WA 1VDDA 4PDGA 2JY8A 4MGIE 2DKLA 3E46A 3LVVA 4RF1A 2F5OA 3SARA 3KS4A 1UFZA 3THGA 5KQ8A 2DENA 1T6OA 2X4AA 2XH9A 4LJ9A 2CHGA 1OKSA 5L8RF 3SATA 4LGYA 2HKJA 2DXIA 4TUWA 1H6UA 3LMMA 3GRVA 1DO0A 1ZQ9A 4FW9A 3SYLA 3JR5A 2OQ4A 4JV5M 1N75A 2J7OA 4HEOA 2JA2A 1CUKA 5ITQA 3HU1A 3K92A 1G41A 5FSWA 4G4NA 1KFVA 3HJQA 4IJEA 3TWKA 1VQ1A 1OIZA 1XWIA 1DGBA 3PFIA 2Z4SA 4IBDA 2G5GX 3GLGE 3AL0C 2KW0A 2KRKA 1IXZA 1OIPA 2VQEM 3WHKA 1HT2E 3MMPA 1PM5A 1LTMA 2L7HA 3D8LA 3K1JA 1NY6A 1DO2A 5C1BA 3VK8A 3HX3A 5FTKA 2DZOB 1E32A 1OTRA 2CRUA 2JUJA 2QPAA 3KSXA 4DV2M 3T15A 4FWDA 1OJLA 3E21A 4A3VB 5FTNA 3FD9A 4D80A 4LZZA 4LCBA 1I94M 4QOSA 4BBAA 3DFZA 3FUWA 4FWHA 1XXHB 2ERCA 1IY2A 3SHGB 1IQPA 2LVPC 3WHLA 2EO2A 1A5TA 5BPVA 3BBZA 3TWLA 1IBLM 4ANRA 1PJTA 1N36M 2AHMA 5F3WA 2Q2EB 3C58A 1NO1A 1Z6TA 1L2CA 4MM3B 3AOEA 4CHTB 2QENA 1X37A 2L4EA 2ZANA 3EIEA 4FWGA 2JY5A 1GVNA 2C5RA 2MROB 3KVWA 2K47A 3CGWA 4DUZM 1OFIA 1EE8A 2BJWA 3PXGA 2Y21A 4L6V6 4GKJM 3OTOM 3DOAA 4G6ZA 3IG5A 3FUVA 1IBMM 3TWMA 2OOAA 4M9ZA 2MR9A 3FUTA 2R46A 4NOOB 4AW4A 4CJ6A 1OAIA 5EQTA 4R71A 3I01M 2KZSA 4M0DA 3SAWA 4IBCA 1R5LA 2CP8A 3SMPA 5DNYA 2CHVA 1L1ZA 2XLJA 3B7ZA 2VF7A 4M0WA 1AIPC 3FYDA 3ZCBB 4I5SA 1J7KA 2DWLA 4NXMM 2M5ZA
chains in the Genus database with same CATH topology
2JNHA 3H4JA 1Q02A 4UN2B 1WIVA 4F1IA 1DV0A 1G3IA 1VDLA 3K9OA 1VG5A 1ZMUA 1YLAA 1IFYA 1WR1B 2MGWA 1Y8GA 2LVQD 2ZTDA 2MJ5B 1NV9A 1WJ7A 2K0BX 2QNJA 1E94E 5JI2E 3B89A 2JY7A 2L2DA 2OOBA 1EFUB 1WHCA 2DAIA 1ZV1A 2KNVA 1TR8A 3GLFE 1OQYA 2JZ0A 3K9PA 2BWEA 3LCUA 2JY8A 3T6PA 2DKLA 3E46A 3GLIE 1HJPA 1F4IA 2K9DA 1UFZA 2LTUA 2DENA 1T6OA 2EKKA 2DAEA 1QZEA 1OKSA 1XB2B 2DAMA 1G4AE 1DO0A 2L4FA 4HEOA 1CUKA 2BWBA 1BVSA 1IM2A 1G41A 1IXSA 1VQ1A 3FE3A 1ZMVA 3FRHA 2HAKA 3GLGE 2DI0A 2OO9A 2DAGA 1SG9A 2KHHA 1VEKA 2QHOB 1HT2E 1XXHE 1PGYA 3MMPA 2KNAA 1DO2A 3LCVB 1MN3A 2G3QA 1TTEA 2LVAA 1OTRA 2JUJA 4WP2A 5DFLA 1KYIA 1JR3E 3E21A 1HT1E 3IHPA 2JZ1A 2EJSA 2H5XA 2DAKA 3F92A 2LVNC 1NV8A 2LVPC 1A5TA 1P3QQ 3BBZA 3IECA 2EKFA 2WZJA 1R4GA 1WGNA 2LVOC 2JY6B 2DZLA 2HWJA 2L4EA 2JY5A 2MROB 1HQYE 3FRIA 4GEWA 2R0IA 4DBGB 1T43A 2CWBA 2DNAA 2ZTCA 4F2LA 2O25A 2JP7A 2OOAA 2MR9A 1VEJA 2DHYA 2B3TA 1OAIA 4R71A 4Q7JA 4G3OA 2KNZA 1V92A 2QSFX 2CP8A 1GO5A 1WGLA 3GLHE 1C7YA 1ZMWA 1VEGA 1AIPC 2RRUA 2LBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNH A;  3H4J A;  1Q02 A;  4UN2 B;  1WIV A;  4F1I A;  1DV0 A;  1G3I A;  1VDL A;  3K9O A;  1VG5 A;  1ZMU A;  1YLA A;  1IFY A;  1WR1 B;  2MGW A;  1Y8G A;  2LVQ D;  2ZTD A;  2MJ5 B;  1NV9 A;  1WJ7 A;  2K0B X;  2QNJ A;  1E94 E;  5JI2 E;  3B89 A;  2JY7 A;  2L2D A;  2OOB A;  1EFU B;  1WHC A;  2DAI A;  1ZV1 A;  2KNV A;  1TR8 A;  3GLF E;  1OQY A;  2JZ0 A;  3K9P A;  2BWE A;  3LCU A;  2JY8 A;  3T6P A;  2DKL A;  3E46 A;  3GLI E;  1HJP A;  1F4I A;  2K9D A;  1UFZ A;  2LTU A;  2DEN A;  1T6O A;  2EKK A;  2DAE A;  1QZE A;  1OKS A;  1XB2 B;  2DAM A;  1G4A E;  1DO0 A;  2L4F A;  4HEO A;  1CUK A;  2BWB A;  1BVS A;  1IM2 A;  1G41 A;  1IXS A;  1VQ1 A;  3FE3 A;  1ZMV A;  3FRH A;  2HAK A;  3GLG E;  2DI0 A;  2OO9 A;  2DAG A;  1SG9 A;  2KHH A;  1VEK A;  2QHO B;  1HT2 E;  1XXH E;  1PGY A;  3MMP A;  2KNA A;  1DO2 A;  3LCV B;  1MN3 A;  2G3Q A;  1TTE A;  2LVA A;  1OTR A;  2JUJ A;  4WP2 A;  5DFL A;  1KYI A;  1JR3 E;  3E21 A;  1HT1 E;  3IHP A;  2JZ1 A;  2EJS A;  2H5X A;  2DAK A;  3F92 A;  2LVN C;  1NV8 A;  2LVP C;  1A5T A;  1P3Q Q;  3BBZ A;  3IEC A;  2EKF A;  2WZJ A;  1R4G A;  1WGN A;  2LVO C;  2JY6 B;  2DZL A;  2HWJ A;  2L4E A;  2JY5 A;  2MRO B;  1HQY E;  3FRI A;  4GEW A;  2R0I A;  4DBG B;  1T43 A;  2CWB A;  2DNA A;  2ZTC A;  4F2L A;  2O25 A;  2JP7 A;  2OOA A;  2MR9 A;  1VEJ A;  2DHY A;  2B3T A;  1OAI A;  4R71 A;  4Q7J A;  4G3O A;  2KNZ A;  1V92 A;  2QSF X;  2CP8 A;  1GO5 A;  1WGL A;  3GLH E;  1C7Y A;  1ZMW A;  1VEG A;  1AIP C;  2RRU A;  2LBC A; 
#chains in the Genus database with same CATH topology
 2Y0T A;  3B74 A;  3W0F A;  2XSZ A;  4LGM A;  3I4Y A;  4LJA A;  2F4V M;  1DV0 A;  4B08 A;  4OU7 A;  4P17 A;  2JWS A;  1SXJ C;  1Z5B A;  4NRW A;  3HZJ A;  1MJG M;  3U6M A;  4JI5 M;  1WR1 B;  4MGH A;  2V6Z M;  2D7H A;  1Y8G A;  3GRU A;  5LMN M;  1D0M A;  1G8P A;  1HR0 M;  2Y0Q A;  3SFZ A;  2K0B X;  1XMQ M;  2QNJ A;  3T1Y M;  3ZC7 B;  4JYA M;  1EFU B;  3U5Z A;  1NJF A;  1N78 A;  2ZBK B;  2KEB A;  3QAU A;  2D7E A;  1OQY A;  4MB7 A;  2CFO A;  4WUR A;  4ZPX A;  2JZ0 A;  3GLH B;  3KP1 E;  2BWE A;  3ZH9 B;  1XMO M;  1QZM A;  3A46 A;  5EXX A;  3GLI E;  2OPF A;  4B3M M;  1JQJ C;  2K9D A;  4GKK M;  3KOY E;  1YSY A;  3T38 A;  3SAS A;  4JI2 M;  3GPY A;  1GL7 A;  1TH2 A;  3J81 S;  1NNJ A;  1HQC A;  1MU5 A;  3CF6 E;  1XB2 B;  2DAM A;  1HNZ M;  3KW6 A;  1K82 A;  2WSF F;  3GPU A;  3RGS A;  3C9P A;  3DZD A;  2L4F A;  3HJS A;  3KP0 E;  4CIS A;  2C99 A;  8CAT A;  1IM2 A;  2YQZ A;  2L6O A;  3IG8 A;  4G4O A;  4FVM A;  4YHH M;  1IXS A;  3E4R A;  4GH9 A;  3FE3 A;  2LHG A;  4G4Q A;  4QOZ C;  3FRH A;  3HHZ A;  4IBI A;  1Z5C A;  2ZAM A;  2LWX A;  3I04 M;  4KLN A;  3J80 S;  2KHH A;  5ITY A;  4LRS A;  3TL4 X;  5ITU A;  4DV4 M;  3KSJ A;  3U6E A;  4LG2 A;  3VLF B;  1J5E M;  3GLG A;  2QBY B;  2HL7 A;  1PJI A;  1MN3 A;  3CTW B;  1IBK M;  1XHB A;  1FNN A;  3QYE A;  3KXE C;  2DVW B;  3J2P B;  4AG6 A;  5ITR A;  4B3S M;  2GQF A;  4JI0 M;  2JZ1 A;  2H5X A;  3M6A A;  1IN6 A;  3SAV A;  1PJJ A;  4DR7 M;  1NV8 A;  2XF3 A;  4X65 M;  4KO8 A;  3H4M A;  3ILK A;  4JI7 M;  4JI8 M;  2APL A;  4LJ6 A;  4M9S A;  5EP4 A;  4NC6 A;  2BNK A;  4B3R M;  4AQY M;  2Z7J A;  4LRT A;  4QNR A;  4JI3 M;  4MGZ E;  3B7Q A;  1NJG A;  2UUB M;  3L2A A;  3U6O A;  3HHX A;  1HQY E;  2QQ8 A;  2RKO A;  3U60 B;  2R0I A;  1I4W A;  3VDP A;  3SBJ A;  1K3X A;  1T43 A;  1R7R A;  2DNA A;  2ZTC A;  1L2B A;  2L09 A;  2JP7 A;  2DWN A;  2P5T A;  3B7N A;  1VEJ A;  2LH0 A;  2B3T A;  4MGK E;  4Q7J A;  3TE6 A;  5KO3 A;  1QAO A;  4IBF A;  1V92 A;  2YFQ A;  1DGG A;  4DUY M;  2F5Q A;  4QHS A;  4I81 A;  2QBY A;  1YE9 A;  2DHR A;  3KDS E;  1C7Y A;  5EP3 A;  5IWA M;  4DV1 M;  1SXJ A;  2F5N A;  4FCW A;  2ZAO A;  4R3D A;  1QUT A;  2Z3X A;  4LF9 M;  1XNR M;  1N32 M;  3GO8 A;  2JXN A;  3R8F A;  3M7G A;  4I8O A;  3GLI B;  3H4J A;  4JI1 M;  1UM8 A;  1T3T A;  4F1I A;  3A42 A;  4DR4 M;  1VDL A;  4P16 A;  3AOG A;  2VII A;  3FUX A;  3Q8X A;  1VG5 A;  4YY3 M;  3ZQJ A;  3TPZ A;  1XC8 A;  1ZMU A;  1OAO C;  4NSO B;  5FTL A;  1NVM A;  3NWL A;  1YLA A;  3U61 B;  2XGN A;  3J7A S;  2MGW A;  2ZTD A;  3FTC A;  3HWS A;  1WJ7 A;  4JN6 A;  2WSC F;  1LV7 A;  1N34 M;  4LFA M;  1IXR C;  4FD2 A;  3A98 B;  4AG5 A;  4HLQ A;  4MGY E;  2KDL A;  2WSE F;  2Z4R A;  2JY7 A;  3J7B A;  1NHG C;  4DV7 M;  4AKI A;  3U60 A;  1WHC A;  3GQ4 A;  2LNH C;  3L29 A;  2KNV A;  4LF4 M;  1TR8 A;  5EJC A;  3LVW A;  5EXT A;  2X8A A;  2XFS A;  1QQW A;  2C9O A;  1PJS A;  3QWL A;  1XNQ M;  4NSR A;  5ITT A;  4LF5 M;  1HJP A;  1F4I A;  3VFD A;  4GC9 A;  2LTU A;  2CHQ A;  1OFH A;  3PNV A;  2R18 A;  2DAE A;  2EUC A;  3JAM S;  4PDI A;  1QAM A;  1W5S A;  1G4A E;  1N33 M;  4IBE A;  3FKE A;  3AKZ A;  4KHP M;  5ITX E;  5E6J A;  4AKG A;  3HKP A;  2QZ4 A;  3Q8G A;  1BVS A;  2J7N A;  1JR3 A;  4IBG A;  1FJG M;  4QNM A;  5ITX A;  1L8Q A;  3UGJ A;  3LW5 F;  2RGH A;  3AV0 A;  3B9P A;  1NY5 A;  1ZMV A;  5LMU M;  2X49 A;  2DI0 A;  1RU3 A;  3EIH A;  3BOS A;  2UXC M;  2OO9 A;  2DAG A;  1HNX M;  3M0E A;  4AI6 A;  1VEK A;  3HU3 A;  4DV3 M;  3UZU A;  3KOW E;  2KNA A;  4REZ A;  3GPP A;  2QP9 X;  3LCV B;  1SXJ E;  2J5Y A;  2G3Q A;  2I7P A;  1TDZ A;  1AUA A;  2Z8Y M;  4CGY B;  2R65 A;  1IN5 A;  1NNU C;  2DZN B;  2CEA A;  5E26 A;  4WP2 A;  5DFL A;  1QDR A;  3SHF A;  1G71 A;  2GNO A;  5IRE B;  1N77 A;  2W82 A;  3IHP A;  3I4V A;  4Z8X A;  4B3T M;  2EJS A;  3VK7 A;  4GHL A;  3K2L A;  2R45 A;  1TGU A;  3HJ8 A;  4R7G A;  1ZAE A;  2A5Y B;  3RGP A;  3E9S A;  3MJ5 A;  4FCV A;  2EA0 A;  2KZU A;  3GP1 A;  3IEC A;  3TQS A;  2EKF A;  3RE8 A;  5FLX S;  2XEP A;  4LFC M;  3MHV C;  3GLF A;  4LJ7 A;  3HY5 A;  2WZJ A;  3KOX E;  1R4G A;  1ORY B;  1SXJ B;  2JY6 B;  3K8Z A;  2ZM6 M;  4QHT A;  5FTM A;  3D8B A;  1IN8 A;  2C9C A;  4XK8 F;  3NBI A;  2CV1 A;  2HHH M;  1XXH A;  3FRI A;  2H1R A;  3AJI B;  4FCT A;  4GEW A;  2CWB A;  3UK6 A;  4F2L A;  4LFB M;  2O25 A;  3L28 A;  4X66 M;  5C18 A;  4ITQ A;  2CV0 A;  3U5Z B;  2KA6 B;  4II7 A;  3SYK A;  4L16 A;  4G3O A;  2KNZ A;  1Q3C A;  1TH4 A;  2QSF X;  3GLF B;  3T1H M;  2UXD M;  3L27 A;  1JB0 F;  4L15 A;  3GLH E;  5KPT A;  4IBK A;  1Q3B A;  1VEG A;  4RKU F;  1GJS A;  4IIW A;  2LBC A;  3A45 A;  2VF8 A;  4CIZ A;  1Q02 A;  4OVZ B;  1WIV A;  3L25 A;  4Z6Y A;  4LY6 A;  2VDB B;  1G3I A;  3CF0 A;  3C3E A;  4Y28 F;  3U6C A;  2UUA M;  3K9O A;  4DV6 M;  1D2N A;  4EIW A;  4DV5 M;  2FH0 A;  1L1T A;  1IFY A;  2FFJ A;  3U6Q A;  1NSF A;  2UU9 M;  2LVQ D;  2O5R A;  2KRU A;  3FUU A;  2MJ5 B;  4LJ4 A;  4RF0 A;  4D82 A;  2R6F A;  5KPR A;  3FYC A;  4LJ8 A;  1IY1 A;  4D81 A;  1GLN A;  3B89 A;  5JI2 E;  2L2D A;  4DR5 M;  2OOB A;  1QVR A;  3U61 A;  2DAI A;  1ZV1 A;  2XSZ D;  4GHA A;  3U6D A;  3BXW A;  3C3D A;  3GLI A;  4AZF A;  4OX9 M;  1GJT A;  1TH3 A;  3LCU A;  3KFU G;  3T6P A;  2DWM A;  2G8L A;  2RGO A;  4GMQ A;  1V34 A;  4LZJ A;  2XZU A;  4L8R C;  2D7G A;  3KS8 A;  4OW0 A;  4DR6 M;  3HHW A;  2EKK A;  3PNY A;  5EXP A;  1L2D A;  1QZE A;  4LF6 M;  2XZF A;  1PJQ A;  1W5T A;  1DGF A;  2CUZ A;  4NRV A;  3GQ3 A;  2HCB A;  5DYI A;  1GAB A;  2C96 A;  4I4L A;  3U6L A;  3VKG A;  2BWB A;  2LXE A;  1C1K A;  1QUS A;  2FNA A;  1IY0 A;  3PVS A;  4LF8 M;  3GLH A;  4W5W A;  2O01 F;  4GIP A;  4M9X A;  3UMM A;  2HAK A;  3HGI A;  4BB9 A;  3VKH A;  1SXJ D;  3U6P A;  2MH8 A;  2V1C A;  1SG9 A;  4LJ5 A;  2QHO B;  1PRB A;  1PGY A;  1XXH E;  2L7I A;  1Z59 A;  5BR8 M;  1G59 A;  1EIJ A;  2F5S A;  5A2Q S;  4X62 M;  1TTE A;  1S3S A;  2LVA A;  3V76 A;  4JI4 M;  3FTE A;  4KT0 F;  5KPZ A;  5EP1 A;  1QDT A;  2BJV A;  5IZ7 D;  1KYI A;  1JR3 E;  3FTD A;  1YUB A;  2VQF M;  2I7N A;  1HT1 E;  1NHW C;  2R4J A;  4MH0 E;  1R6B X;  5FTJ A;  4XBO A;  2C98 A;  1V33 A;  3VDU A;  2DAK A;  1QAQ A;  3CF2 A;  3F92 A;  3W68 A;  7CAT A;  3SAU A;  2FE8 A;  3J27 B;  2LVN C;  2N35 A;  4JI6 M;  2DWZ B;  1JR3 D;  1P3Q Q;  3GPX A;  3U6S A;  4HL4 A;  2E5L M;  3GLG B;  3R9X B;  4NL4 H;  2M60 A;  1TF0 B;  3KOZ E;  4B7G A;  1WGN A;  2LVO C;  3AFH A;  4K0K M;  2DZL A;  2R44 A;  2YNM D;  4GRI A;  2XFT A;  2UXB M;  2HWJ A;  2CE7 A;  1QYR A;  4KOD A;  2NQ8 C;  5EP2 A;  4GC5 A;  4IJF A;  2FS1 A;  3JR4 A;  4G4R A;  4S12 A;  4PT5 A;  1TDH A;  4DBG B;  3GRY A;  3QYB A;  1IN7 A;  4IBB A;  3AOE C;  2YR0 A;  1WXQ A;  2FOI C;  3SC3 A;  3L26 A;  2DHY A;  4X64 M;  4B7F A;  1J09 A;  4DR3 M;  3DA1 A;  4NXN M;  3HU2 A;  4L4U A;  5IT9 S;  1GO5 A;  1WGL A;  1MX0 A;  2V1U A;  1DGH B;  2KXE A;  3SMS A;  3GQ5 A;  1GKI A;  1ZMW A;  2Y20 A;  5EXS A;  4DR2 M;  2RRU A;  3W67 A;  1E9R A;  2LHC A;  3LQR A;  4GIT A;  3RFW A;  1R2Z A;  3FTF A;  2JNH A;  3GRR A;  5JI3 E;  3I51 A;  4UN2 B;  4BLC A;  4WW0 A;  4IBJ A;  3MK6 A;  4XGI A;  5H37 D;  2F5P A;  1E9S A;  4OVZ A;  1R2Y A;  2R62 A;  4B7H A;  4DV0 M;  4JXJ A;  4RNA A;  5KQD A;  1IN4 A;  4L78 A;  2K6B A;  3UJN A;  1D0L A;  3W0L B;  1Q39 A;  1NV9 A;  2CV2 A;  3HHY A;  4DR1 M;  1DGH A;  5GKN A;  1E94 E;  5DYG A;  1IXS B;  3NBX X;  1KSF X;  1GL6 A;  1Z5A A;  4LF7 M;  4AKH A;  2R4E A;  2QCU A;  4PCZ A;  2UUC M;  1HNW M;  3GLF E;  1D0K A;  4PD2 A;  1QAN A;  3K9P A;  3LQQ A;  1K3W A;  1VDD A;  4PDG A;  2JY8 A;  4MGI E;  2DKL A;  3E46 A;  3LVV A;  4RF1 A;  2F5O A;  3SAR A;  3KS4 A;  1UFZ A;  3THG A;  5KQ8 A;  2DEN A;  1T6O A;  2X4A A;  2XH9 A;  4LJ9 A;  2CHG A;  1OKS A;  5L8R F;  3SAT A;  4LGY A;  2HKJ A;  2DXI A;  4TUW A;  1H6U A;  3LMM A;  3GRV A;  1DO0 A;  1ZQ9 A;  4FW9 A;  3SYL A;  3JR5 A;  2OQ4 A;  4JV5 M;  1N75 A;  2J7O A;  4HEO A;  2JA2 A;  1CUK A;  5ITQ A;  3HU1 A;  3K92 A;  1G41 A;  5FSW A;  4G4N A;  1KFV A;  3HJQ A;  4IJE A;  3TWK A;  1VQ1 A;  1OIZ A;  1XWI A;  1DGB A;  3PFI A;  2Z4S A;  4IBD A;  2G5G X;  3GLG E;  3AL0 C;  2KW0 A;  2KRK A;  1IXZ A;  1OIP A;  2VQE M;  3WHK A;  1HT2 E;  3MMP A;  1PM5 A;  1LTM A;  2L7H A;  3D8L A;  3K1J A;  1NY6 A;  1DO2 A;  5C1B A;  3VK8 A;  3HX3 A;  5FTK A;  2DZO B;  1E32 A;  1OTR A;  2CRU A;  2JUJ A;  2QPA A;  3KSX A;  4DV2 M;  3T15 A;  4FWD A;  1OJL A;  3E21 A;  4A3V B;  5FTN A;  3FD9 A;  4D80 A;  4LZZ A;  4LCB A;  1I94 M;  4QOS A;  4BBA A;  3DFZ A;  3FUW A;  4FWH A;  1XXH B;  2ERC A;  1IY2 A;  3SHG B;  1IQP A;  2LVP C;  3WHL A;  2EO2 A;  1A5T A;  5BPV A;  3BBZ A;  3TWL A;  1IBL M;  4ANR A;  1PJT A;  1N36 M;  2AHM A;  5F3W A;  2Q2E B;  3C58 A;  1NO1 A;  1Z6T A;  1L2C A;  4MM3 B;  3AOE A;  4CHT B;  2QEN A;  1X37 A;  2L4E A;  2ZAN A;  3EIE A;  4FWG A;  2JY5 A;  1GVN A;  2C5R A;  2MRO B;  3KVW A;  2K47 A;  3CGW A;  4DUZ M;  1OFI A;  1EE8 A;  2BJW A;  3PXG A;  2Y21 A;  4L6V 6;  4GKJ M;  3OTO M;  3DOA A;  4G6Z A;  3IG5 A;  3FUV A;  1IBM M;  3TWM A;  2OOA A;  4M9Z A;  2MR9 A;  3FUT A;  2R46 A;  4NOO B;  4AW4 A;  4CJ6 A;  1OAI A;  5EQT A;  4R71 A;  3I01 M;  2KZS A;  4M0D A;  3SAW A;  4IBC A;  1R5L A;  2CP8 A;  3SMP A;  5DNY A;  2CHV A;  1L1Z A;  2XLJ A;  3B7Z A;  2VF7 A;  4M0W A;  1AIP C;  3FYD A;  3ZCB B;  4I5S A;  1J7K A;  2DWL A;  4NXM M;  2M5Z A; 
#chains in the Genus database with same CATH homology
 2JNH A;  3H4J A;  1Q02 A;  4UN2 B;  1WIV A;  4F1I A;  1DV0 A;  1G3I A;  1VDL A;  3K9O A;  1VG5 A;  1ZMU A;  1YLA A;  1IFY A;  1WR1 B;  2MGW A;  1Y8G A;  2LVQ D;  2ZTD A;  2MJ5 B;  1NV9 A;  1WJ7 A;  2K0B X;  2QNJ A;  1E94 E;  5JI2 E;  3B89 A;  2JY7 A;  2L2D A;  2OOB A;  1EFU B;  1WHC A;  2DAI A;  1ZV1 A;  2KNV A;  1TR8 A;  3GLF E;  1OQY A;  2JZ0 A;  3K9P A;  2BWE A;  3LCU A;  2JY8 A;  3T6P A;  2DKL A;  3E46 A;  3GLI E;  1HJP A;  1F4I A;  2K9D A;  1UFZ A;  2LTU A;  2DEN A;  1T6O A;  2EKK A;  2DAE A;  1QZE A;  1OKS A;  1XB2 B;  2DAM A;  1G4A E;  1DO0 A;  2L4F A;  4HEO A;  1CUK A;  2BWB A;  1BVS A;  1IM2 A;  1G41 A;  1IXS A;  1VQ1 A;  3FE3 A;  1ZMV A;  3FRH A;  2HAK A;  3GLG E;  2DI0 A;  2OO9 A;  2DAG A;  1SG9 A;  2KHH A;  1VEK A;  2QHO B;  1HT2 E;  1XXH E;  1PGY A;  3MMP A;  2KNA A;  1DO2 A;  3LCV B;  1MN3 A;  2G3Q A;  1TTE A;  2LVA A;  1OTR A;  2JUJ A;  4WP2 A;  5DFL A;  1KYI A;  1JR3 E;  3E21 A;  1HT1 E;  3IHP A;  2JZ1 A;  2EJS A;  2H5X A;  2DAK A;  3F92 A;  2LVN C;  1NV8 A;  2LVP C;  1A5T A;  1P3Q Q;  3BBZ A;  3IEC A;  2EKF A;  2WZJ A;  1R4G A;  1WGN A;  2LVO C;  2JY6 B;  2DZL A;  2HWJ A;  2L4E A;  2JY5 A;  2MRO B;  1HQY E;  3FRI A;  4GEW A;  2R0I A;  4DBG B;  1T43 A;  2CWB A;  2DNA A;  2ZTC A;  4F2L A;  2O25 A;  2JP7 A;  2OOA A;  2MR9 A;  1VEJ A;  2DHY A;  2B3T A;  1OAI A;  4R71 A;  4Q7J A;  4G3O A;  2KNZ A;  1V92 A;  2QSF X;  2CP8 A;  1GO5 A;  1WGL A;  3GLH E;  1C7Y A;  1ZMW A;  1VEG A;  1AIP C;  2RRU A;  2LBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...