2KHHA

Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA export factor MEX67
publication title Structural requirements for the ubiquitin-associated domain of the mRNA export factor Mex67 to bind its specific targets, the transcription elongation THO complex component Hpr1 and nucleoporin FXFG repeats
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2khhA00
2O25A 2LTUA 4Q7JA 5DFLA 2QSFX 1Y8GA 1GO5A 2QNJA 1OAIA 3FRHA 1KYIA 1VEGA 3T6PA 2DI0A 1WR1B 1P3QQ 2B3TA 2K0BX 2L2DA 1HT2E 1OTRA 2CWBA 1WGLA 2ZTDA 2HWJA 2LVQD 1V92A 1HT1E 2WZJA 3B89A 3GLIE 2LVAA 1VEKA 3GLFE 1DV0A 1G3IA 2KNZA 2HAKA 3FRIA 2DAIA 1A5TA 2DENA 3LCVB 2R0IA 1CUKA 3F92A 2DNAA 1ZV1A 2BWEA 2LBCA 2DAEA 5JI2E 2JY8A 1IM2A 1OKSA 1QZEA 1VG5A 1UFZA 2MROB 2KHHA 4R71A 1MN3A 1VDLA 1G4AE 2L4FA 2OOAA 2LVPC 3K9OA 4GEWA 2LVNC 1EFUB 2L4EA 4DBGB 1AIPC 1ZMUA 1WJ7A 2JY5A 1NV9A 1G41A 2EKFA 2MR9A 1TR8A 1DO0A 2JZ1A 2DAMA 4F2LA 2CP8A 1C7YA 2K9DA 2JY6B 3GLGE 3FE3A 2JZ0A 1ZMWA 2OO9A 4G3OA 3IHPA 1HJPA 2KNAA 1E94E 1WGNA 1BVSA 1XXHE 1SG9A 2DHYA 1OQYA 2KNVA 2EKKA 2MJ5B 3BBZA 3LCUA 1R4GA 1JR3E 2RRUA 1IFYA 1VEJA 3H4JA 4HEOA 2QHOB 1Q02A 2G3QA 3K9PA 1WHCA 1T6OA 2H5XA 3E46A 1TTEA 2JP7A 2JY7A 2JUJA 1F4IA 1WIVA 2DAGA 4UN2B 1HQYE 2BWBA 3GLHE 4WP2A 2JNHA 4F1IA 1VQ1A 3E21A 1PGYA 1YLAA 1NV8A 1ZMVA 2DAKA 2EJSA 2OOBA 2MGWA 1T43A 2DZLA 3IECA 1IXSA 1DO2A 2ZTCA 2LVOC 1XB2B 2DKLA 3MMPA
chains in the Genus database with same CATH superfamily
2O25A 3VLFB 4JI6M 3SAUA 4FVMA 1IBMM 4IBFA 2QSFX 1HR0M 4XGIA 4LF6M 4B3MM 3PXGA 2ERCA 1IY0A 2UUCM 1QUTA 3AOEC 2UUBM 1RU3A 3J7AS 2Z4RA 1N32M 1DGBA 3B7NA 4AG5A 2FH0A 3A98B 3M6AA 4JYAM 4MB7A 3L27A 1OTRA 1Q3CA 2CWBA 1WGLA 4RNAA 4DV0M 3A45A 4M0WA 2LVQD 1GKIA 3VDPA 3U6DA 1OIZA 4FD2A 1PJIA 4LY6A 4ANRA 1UM8A 2JA2A 4X66M 4GKJM 2J7OA 1IY1A 1ORYB 2KNZA 3KOYE 2GQFA 3QYEA 3U6MA 2HAKA 4M9XA 4GIPA 2V6ZM 3KP1E 3W0LB 2DENA 3HJQA 4OW0A 5EP1A 2F5QA 2CUZA 4ITQA 3LCVB 4DV5M 3L26A 2XSZA 2EUCA 4R7GA 1R2ZA 4QHSA 1AUAA 3UK6A 3LQRA 2DWZB 3KP0E 2JY8A 4P17A 5EXPA 3HHYA 4LF7M 4IBBA 1UFZA 1X37A 2NQ8C 3CF0A 3GRVA 1NJGA 1D0MA 4MH0E 2DWLA 3RGSA 4L8RC 2ZM6M 3HU2A 5DYIA 1XNQM 3D8LA 2F4VM 1EFUB 1IN4A 2D7GA 3BXWA 1ZMUA 5EXTA 3THGA 3HKPA 2EKFA 3T1YM 2MR9A 4WW0A 3U6LA 2DWNA 4F2LA 3KSXA 4FCWA 4G6ZA 1IBLM 3JR4A 2XEPA 3AFHA 3AOEA 4X64M 2CV1A 3U6CA 2K9DA 2JY6B 3EIEA 1XHBA 3FE3A 2JZ0A 2XZUA 3FD9A 5ITTA 5ITRA 1H6UA 3I4YA 3I51A 3U6EA 3KFUG 2BJVA 2KRUA 1BVSA 2N35A 2DXIA 4GHAA 1R2YA 3I04M 1LV7A 1SG9A 3FUUA 4DR7M 2KNVA 2EKKA 2KXEA 3ZCBB 4EIWA 2MJ5B 1W5SA 3V76A 1R4GA 1VEJA 3H4JA 4HEOA 4LJ6A 3U6QA 5EXSA 2APLA 3HY5A 4MGYE 4QOSA 4LFBM 2HCBA 1W5TA 1TTEA 3Q8XA 4KO8A 4B7HA 3K1JA 1NNJA 2C96A 3SATA 2DAGA 3DOAA 2BWBA 4WP2A 1YE9A 1OJLA 4AW4A 4B7GA 5BR8M 4LF8M 1K3XA 4QOZC 3GPPA 4NL4H 2EO2A 1NY6A 1VQ1A 4GC9A 8CATA 1YSYA 3ZH9B 4RKUF 1N77A 1NV8A 2HKJA 4LG2A 2R18A 1R5LA 3IECA 4GKKM 3HJSA 3I4VA 2XF3A 4JI1M 4K0KM 2LVOC 2P5TA 3L28A 1PM5A 1XB2B 1IXZA 1GLNA 1D0LA 5BPVA 4NSOB 1SXJC 4HLQA 4IBKA 4D81A 2F5NA 1GJTA 1L2CA 2LTUA 4Q7JA 3HHZA 4L15A 1GO5A 2QNJA 4YHHM 4JI4M 1KYIA 4FWHA 1JR3A 4G4NA 3M0EA 2QPAA 3GPUA 2UXCM 2FOIC 2Z7JA 3E4RA 4IBDA 3T38A 3GO8A 1TH4A 4G4QA 3TQSA 4LF5M 4II7A 3NBXX 3J81S 5FTLA 5E6JA 3B74A 5L8RF 3GLIE 4NXNM 2LVAA 2YR0A 3AJIB 3HWSA 2XSZD 2XFSA 3GLFE 3MK6A 1J09A 2YFQA 3HHXA 2KZSA 2Z3XA 1QAOA 3B7ZA 2W82A 3PNYA 2VQEM 1NHGC 2CE7A 2LHGA 3SBJA 4ZPXA 4NC6A 1N78A 3ILKA 2BJWA 4DV7M 1N75A 4CJ6A 1NSFA 1CUKA 2LH0A 3F92A 3UJNA 5IWAM 3KVWA 3FUWA 1QAQA 2F5PA 2DHRA 5JI2E 3OTOM 1IM2A 5C18A 3J7BA 2HHHM 1VG5A 2GNOA 4IJEA 3FYCA 1GABA 3LMMA 2JWSA 3W68A 1SXJE 1GL6A 4DV1M 2KDLA 2L4FA 3AKZA 4B7FA 2XLJA 4IIWA 3GRUA 5IREB 4G4RA 3W67A 2XZFA 1QUSA 1EIJA 2CEAA 3SYKA 4NRVA 2ZANA 4KT0F 1AIPC 4DR2M 1WJ7A 4DR6M 1FJGM 4WURA 1NV9A 1G8PA 2Q2EB 2R65A 3DZDA 4LJ9A 3TL4X 3GP1A 3KXEC 1NO1A 4PDGA 1DGHA 2DAMA 2XH9A 2CV2A 4NSRA 2J5YA 2OPFA 4GHLA 1TDHA 3I01M 4LF4M 3VKGA 4MM3B 3KOZE 4D82A 3R9XB 2J7NA 1ZMWA 3WHKA 3LVWA 3DFZA 1XXHE 3SMSA 1S3SA 3RE8A 2DZOB 3VFDA 1PJTA 2DHYA 3CF2A 4DR3M 5IT9S 5E26A 2XGNA 4RF0A 1MU5A 3BBZA 5IZ7D 1NHWC 4L16A 2RRUA 4A3VB 5JI3E 1IFYA 4BLCA 1IN7A 1VDDA 1Q02A 1XMQM 2E5LM 1WHCA 2FS1A 4IBJA 3K2LA 2JUJA 4PD2A 3CF6E 3SFZA 4I81A 2F5SA 4UN2B 3GLHE 4B3SM 4JV5M 1EE8A 3TWLA 1KSFX 3A42A 4JN6A 3W0FA 2FNAA 1ZMVA 2HL7A 2UU9M 4B3TM 3FTEA 3HHWA 4LJ8A 1V33A 3QYBA 3L29A 2OOBA 3U6OA 3AV0A 1JR3D 3RGPA 2WSEF 2R44A 3HJ8A 1NNUC 4LFCM 4REZA 4GC5A 1L2DA 5H37D 3HX3A 4JI3M 4YY3M 1IN8A 1WXQA 2C9OA 3KOWE 5LMNM 4FWGA 3A46A 5ITYA 3VK7A 3FRHA 1MJGM 2C98A 2JXNA 5KQ8A 1Z5AA 2F5OA 3GRYA 1QYRA 3CGWA 3WHLA 3CTWB 3T6PA 2DI0A 1Z5CA 1P3QQ 2CFOA 1IN6A 2L6OA 2LNHC 2B3TA 2K0BX 4IJFA 3U6SA 2VF8A 3K92A 4M0DA 4LZZA 4CISA 2BNKA 2ZTDA 2HWJA 2C9CA 1V92A 2QP9X 2FE8A 3TPZA 2UXDM 4PDIA 2I7PA 2DVWB 1HT1E 2YQZA 3BOSA 3B9PA 3JR5A 4DUYM 1N34M 4NXMM 3B89A 3QWLA 3MHVC 3AOGA 1VEKA 2KZUA 3SHFA 3IG5A 3KOXE 1G3IA 4RF1A 3RFWA 2KRKA 3M7GA 4QHTA 3C58A 2D7EA 1K3WA 3FYDA 3FRIA 4LJ5A 3SARA 4NOOB 2L09A 4GH9A 4JI7M 1J7KA 2DAIA 1A5TA 2R45A 3SAVA 1Z6TA 3VKHA 2Y0TA 3GLIB 3SMPA 3HU3A 2R0IA 3H4MA 4I4LA 4Z6YA 1D0KA 2YNMD 3GLFB 4AI6A 2LHCA 2Z8YM 2DNAA 2Z4SA 1PRBA 1ZV1A 1I94M 1E9RA 2DAEA 2UUAM 1XWIA 3C3DA 1OKSA 2OQ4A 1E32A 3SYLA 2MH8A 3ZQJA 2MROB 2KHHA 4LJAA 1Z59A 4R71A 1VDLA 2FFJA 4TUWA 1G4AE 5FTKA 4BB9A 3U5ZB 2LVPC 3GRRA 4DV3M 4NRWA 4FWDA 4GEWA 1XC8A 1HQCA 1OFIA 4CIZA 1IN5A 2L4EA 4DBGB 3GQ4A 5KPTA 1OIPA 4MGIE 4PT5A 2JY5A 1TH3A 3GLIA 3AL0C 3U60B 1SXJB 4BBAA 3GLFA 4FCVA 4QNRA 1DGGA 2VDBB 2VF7A 4HL4A 4LGMA 2CP8A 4DR5M 3SAWA 1C7YA 3SHGB 2CRUA 3ZC7B 1G59A 1QAMA 1J5EM 3GLGE 1DGHB 2G8LA 2OO9A 2C99A 5EP4A 1XMOM 2AHMA 3C9PA 2XFTA 2KNAA 4KHPM 1WGNA 4LFAM 1QQWA 5KQDA 4S12A 1OQYA 4L4UA 4D80A 3VK8A 1OFHA 4XBOA 5C1BA 3FUXA 1IXSB 3LCUA 3R8FA 3SASA 5EP3A 2M60A 1L1ZA 4AKIA 4R3DA 4I5SA 1HNWM 3K9PA 2G3QA 3J2PB 3U60A 5FSWA 1Q3BA 1SXJA 2H5XA 3E46A 2QZ4A 1C1KA 4IBCA 4X62M 3PVSA 2JP7A 1XXHB 2JY7A 3U61B 3UMMA 4DV2M 4DR1M 3LQQA 1F4IA 4L78A 1HQYE 3K8ZA 3TE6A 5ITXE 3FUVA 4CHTB 1QZMA 3L25A 2X4AA 4F1IA 7CATA 1ZAEA 3E21A 4GMQA 3J80S 1PGYA 1YLAA 5ITXA 2Y20A 2EJSA 2MGWA 1T43A 2DZLA 3FKEA 1QVRA 2VQFM 3GLHB 1IXSA 3JAMS 1L1TA 1XNRM 3QAUA 4Z8XA 4FW9A 5ITUA 2DKLA 1GL7A 4FCTA 5KO3A 3T1HM 3C3EA 4AKHA 4B3RM 2L7IA 3U6PA 2DWMA 3TWKA 3PFIA 1NJFA 1XXHA 3U61A 5DFLA 2K6BA 1I4WA 1N33M 5A2QS 1LTMA 1Y8GA 2WSFF 5LMUM 4Y28F 1OAIA 4LGYA 4GITA 1IQPA 3SC3A 4I8OA 1VEGA 1ZQ9A 3UZUA 1R6BX 1QDRA 3T15A 4PCZA 1WR1B 3NBIA 5EXXA 4LZJA 3L2AA 4OVZB 1V34A 2L2DA 3DA1A 1HT2E 4IBEA 4OU7A 3J27B 4IBGA 3GQ3A 4JI5M 3EIHA 3GLHA 5KPZA 3E9SA 4QNMA 4DV4M 2QENA 3LVVA 4GRIA 4DV6M 2Y21A 3HGIA 2R4EA 2WZJA 2K47A 3B7QA 4LRSA 4LF9M 3FTFA 1HNZM 2R6FA 1DV0A 3KDSE 5FTNA 4AZFA 1T3TA 4LJ4A 1NY5A 1PJQA 5KPRA 2QBYB 2M5ZA 5DYGA 1IBKM 2R62A 2H1RA 2QQ8A 3FTDA 4G4OA 4OVZA 4XK8F 3KS4A 1TDZA 1MX0A 4JI0M 5ITQA 4MGKE 3D8BA 4MGHA 1TF0B 3UGJA 2BWEA 2LBCA 3LW5F 5EP2A 1JQJC 2Y0QA 3NWLA 4P16A 1HNXM 1QZEA 3GPXA 2O01F 2R4JA 1K82A 3FUTA 2I7NA 4LRTA 4DUZM 1MN3A 2CHGA 2OOAA 3VDUA 2WSCF 2V1CA 3K9OA 1QDTA 4M9SA 2QBYA 2KW0A 2LVNC 2UXBM 4AQYM 4JXJA 2EA0A 4JI8M 2CHQA 2ZBKB 4IBIA 4LJ7A 1FNNA 5FLXS 2X49A 1G41A 1TGUA 2A5YB 1TR8A 1TH2A 4LCBA 2V1UA 1DO0A 2JZ1A 1PJSA 5FTJA 3GPYA 2CV0A 3MJ5A 4M9ZA 2G5GX 4JI2M 2CHVA 3FTCA 1L2BA 3KW6A 2RGHA 3TWMA 2KEBA 4OX9M 2QCUA 4G3OA 1JB0F 1OAOC 1SXJD 2LXEA 3IHPA 1HJPA 4W5WA 1E94E 2RGOA 5DNYA 3HU1A 3HZJA 2X8AA 4MGZE 4CGYB 1E9SA 2KA6B 1IY2A 3KS8A 1L8QA 2ZAMA 1R7RA 2VIIA 3KSJA 4B08A 3GLGB 1JR3E 1G71A 3Q8GA 2O5RA 5GKNA 2DZNB 2QHOB 2L7HA 2RKOA 1T6OA 3IG8A 1N36M 4AKGA 4L6V6 1Q39A 1KFVA 5EJCA 1WIVA 2C5RA 1PJJA 1DGFA 1D2NA 1YUBA 2JNHA 2LWXA 3U5ZA 2ZAOA 5EQTA 4X65M 3GQ5A 2R46A 3PNVA 4KLNA 1NVMA 2D7HA 4KODA 1GVNA 2DAKA 4DR4M 4AG6A 1DO2A 2ZTCA 1IXRC 3GLGA 1GJSA 3MMPA 5F3WA 1Z5BA 5FTMA 1QANA
chains in the Genus database with same CATH topology
2O25A 2LTUA 4Q7JA 5DFLA 2QSFX 1Y8GA 1GO5A 2QNJA 1OAIA 3FRHA 1KYIA 1VEGA 3T6PA 2DI0A 1WR1B 1P3QQ 2B3TA 2K0BX 2L2DA 1HT2E 1OTRA 2CWBA 1WGLA 2ZTDA 2HWJA 2LVQD 1V92A 1HT1E 2WZJA 3B89A 3GLIE 2LVAA 1VEKA 3GLFE 1DV0A 1G3IA 2KNZA 2HAKA 3FRIA 2DAIA 1A5TA 2DENA 3LCVB 2R0IA 1CUKA 3F92A 2DNAA 1ZV1A 2BWEA 2LBCA 2DAEA 5JI2E 2JY8A 1IM2A 1OKSA 1QZEA 1VG5A 1UFZA 2MROB 2KHHA 4R71A 1MN3A 1VDLA 1G4AE 2L4FA 2OOAA 2LVPC 3K9OA 4GEWA 2LVNC 1EFUB 2L4EA 4DBGB 1AIPC 1ZMUA 1WJ7A 2JY5A 1NV9A 1G41A 2EKFA 2MR9A 1TR8A 1DO0A 2JZ1A 2DAMA 4F2LA 2CP8A 1C7YA 2K9DA 2JY6B 3GLGE 3FE3A 2JZ0A 1ZMWA 2OO9A 4G3OA 3IHPA 1HJPA 2KNAA 1E94E 1WGNA 1BVSA 1XXHE 1SG9A 2DHYA 1OQYA 2KNVA 2EKKA 2MJ5B 3BBZA 3LCUA 1R4GA 1JR3E 2RRUA 1IFYA 1VEJA 3H4JA 4HEOA 2QHOB 1Q02A 2G3QA 3K9PA 1WHCA 1T6OA 2H5XA 3E46A 1TTEA 2JP7A 2JY7A 2JUJA 1F4IA 1WIVA 2DAGA 4UN2B 1HQYE 2BWBA 3GLHE 4WP2A 2JNHA 4F1IA 1VQ1A 3E21A 1PGYA 1YLAA 1NV8A 1ZMVA 2DAKA 2EJSA 2OOBA 2MGWA 1T43A 2DZLA 3IECA 1IXSA 1DO2A 2ZTCA 2LVOC 1XB2B 2DKLA 3MMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O25 A;  2LTU A;  4Q7J A;  5DFL A;  2QSF X;  1Y8G A;  1GO5 A;  2QNJ A;  1OAI A;  3FRH A;  1KYI A;  1VEG A;  3T6P A;  2DI0 A;  1WR1 B;  1P3Q Q;  2B3T A;  2K0B X;  2L2D A;  1HT2 E;  1OTR A;  2CWB A;  1WGL A;  2ZTD A;  2HWJ A;  2LVQ D;  1V92 A;  1HT1 E;  2WZJ A;  3B89 A;  3GLI E;  2LVA A;  1VEK A;  3GLF E;  1DV0 A;  1G3I A;  2KNZ A;  2HAK A;  3FRI A;  2DAI A;  1A5T A;  2DEN A;  3LCV B;  2R0I A;  1CUK A;  3F92 A;  2DNA A;  1ZV1 A;  2BWE A;  2LBC A;  2DAE A;  5JI2 E;  2JY8 A;  1IM2 A;  1OKS A;  1QZE A;  1VG5 A;  1UFZ A;  2MRO B;  2KHH A;  4R71 A;  1MN3 A;  1VDL A;  1G4A E;  2L4F A;  2OOA A;  2LVP C;  3K9O A;  4GEW A;  2LVN C;  1EFU B;  2L4E A;  4DBG B;  1AIP C;  1ZMU A;  1WJ7 A;  2JY5 A;  1NV9 A;  1G41 A;  2EKF A;  2MR9 A;  1TR8 A;  1DO0 A;  2JZ1 A;  2DAM A;  4F2L A;  2CP8 A;  1C7Y A;  2K9D A;  2JY6 B;  3GLG E;  3FE3 A;  2JZ0 A;  1ZMW A;  2OO9 A;  4G3O A;  3IHP A;  1HJP A;  2KNA A;  1E94 E;  1WGN A;  1BVS A;  1XXH E;  1SG9 A;  2DHY A;  1OQY A;  2KNV A;  2EKK A;  2MJ5 B;  3BBZ A;  3LCU A;  1R4G A;  1JR3 E;  2RRU A;  1IFY A;  1VEJ A;  3H4J A;  4HEO A;  2QHO B;  1Q02 A;  2G3Q A;  3K9P A;  1WHC A;  1T6O A;  2H5X A;  3E46 A;  1TTE A;  2JP7 A;  2JY7 A;  2JUJ A;  1F4I A;  1WIV A;  2DAG A;  4UN2 B;  1HQY E;  2BWB A;  3GLH E;  4WP2 A;  2JNH A;  4F1I A;  1VQ1 A;  3E21 A;  1PGY A;  1YLA A;  1NV8 A;  1ZMV A;  2DAK A;  2EJS A;  2OOB A;  2MGW A;  1T43 A;  2DZL A;  3IEC A;  1IXS A;  1DO2 A;  2ZTC A;  2LVO C;  1XB2 B;  2DKL A;  3MMP A; 
#chains in the Genus database with same CATH topology
 2O25 A;  3VLF B;  4JI6 M;  3SAU A;  4FVM A;  1IBM M;  4IBF A;  2QSF X;  1HR0 M;  4XGI A;  4LF6 M;  4B3M M;  3PXG A;  2ERC A;  1IY0 A;  2UUC M;  1QUT A;  3AOE C;  2UUB M;  1RU3 A;  3J7A S;  2Z4R A;  1N32 M;  1DGB A;  3B7N A;  4AG5 A;  2FH0 A;  3A98 B;  3M6A A;  4JYA M;  4MB7 A;  3L27 A;  1OTR A;  1Q3C A;  2CWB A;  1WGL A;  4RNA A;  4DV0 M;  3A45 A;  4M0W A;  2LVQ D;  1GKI A;  3VDP A;  3U6D A;  1OIZ A;  4FD2 A;  1PJI A;  4LY6 A;  4ANR A;  1UM8 A;  2JA2 A;  4X66 M;  4GKJ M;  2J7O A;  1IY1 A;  1ORY B;  2KNZ A;  3KOY E;  2GQF A;  3QYE A;  3U6M A;  2HAK A;  4M9X A;  4GIP A;  2V6Z M;  3KP1 E;  3W0L B;  2DEN A;  3HJQ A;  4OW0 A;  5EP1 A;  2F5Q A;  2CUZ A;  4ITQ A;  3LCV B;  4DV5 M;  3L26 A;  2XSZ A;  2EUC A;  4R7G A;  1R2Z A;  4QHS A;  1AUA A;  3UK6 A;  3LQR A;  2DWZ B;  3KP0 E;  2JY8 A;  4P17 A;  5EXP A;  3HHY A;  4LF7 M;  4IBB A;  1UFZ A;  1X37 A;  2NQ8 C;  3CF0 A;  3GRV A;  1NJG A;  1D0M A;  4MH0 E;  2DWL A;  3RGS A;  4L8R C;  2ZM6 M;  3HU2 A;  5DYI A;  1XNQ M;  3D8L A;  2F4V M;  1EFU B;  1IN4 A;  2D7G A;  3BXW A;  1ZMU A;  5EXT A;  3THG A;  3HKP A;  2EKF A;  3T1Y M;  2MR9 A;  4WW0 A;  3U6L A;  2DWN A;  4F2L A;  3KSX A;  4FCW A;  4G6Z A;  1IBL M;  3JR4 A;  2XEP A;  3AFH A;  3AOE A;  4X64 M;  2CV1 A;  3U6C A;  2K9D A;  2JY6 B;  3EIE A;  1XHB A;  3FE3 A;  2JZ0 A;  2XZU A;  3FD9 A;  5ITT A;  5ITR A;  1H6U A;  3I4Y A;  3I51 A;  3U6E A;  3KFU G;  2BJV A;  2KRU A;  1BVS A;  2N35 A;  2DXI A;  4GHA A;  1R2Y A;  3I04 M;  1LV7 A;  1SG9 A;  3FUU A;  4DR7 M;  2KNV A;  2EKK A;  2KXE A;  3ZCB B;  4EIW A;  2MJ5 B;  1W5S A;  3V76 A;  1R4G A;  1VEJ A;  3H4J A;  4HEO A;  4LJ6 A;  3U6Q A;  5EXS A;  2APL A;  3HY5 A;  4MGY E;  4QOS A;  4LFB M;  2HCB A;  1W5T A;  1TTE A;  3Q8X A;  4KO8 A;  4B7H A;  3K1J A;  1NNJ A;  2C96 A;  3SAT A;  2DAG A;  3DOA A;  2BWB A;  4WP2 A;  1YE9 A;  1OJL A;  4AW4 A;  4B7G A;  5BR8 M;  4LF8 M;  1K3X A;  4QOZ C;  3GPP A;  4NL4 H;  2EO2 A;  1NY6 A;  1VQ1 A;  4GC9 A;  8CAT A;  1YSY A;  3ZH9 B;  4RKU F;  1N77 A;  1NV8 A;  2HKJ A;  4LG2 A;  2R18 A;  1R5L A;  3IEC A;  4GKK M;  3HJS A;  3I4V A;  2XF3 A;  4JI1 M;  4K0K M;  2LVO C;  2P5T A;  3L28 A;  1PM5 A;  1XB2 B;  1IXZ A;  1GLN A;  1D0L A;  5BPV A;  4NSO B;  1SXJ C;  4HLQ A;  4IBK A;  4D81 A;  2F5N A;  1GJT A;  1L2C A;  2LTU A;  4Q7J A;  3HHZ A;  4L15 A;  1GO5 A;  2QNJ A;  4YHH M;  4JI4 M;  1KYI A;  4FWH A;  1JR3 A;  4G4N A;  3M0E A;  2QPA A;  3GPU A;  2UXC M;  2FOI C;  2Z7J A;  3E4R A;  4IBD A;  3T38 A;  3GO8 A;  1TH4 A;  4G4Q A;  3TQS A;  4LF5 M;  4II7 A;  3NBX X;  3J81 S;  5FTL A;  5E6J A;  3B74 A;  5L8R F;  3GLI E;  4NXN M;  2LVA A;  2YR0 A;  3AJI B;  3HWS A;  2XSZ D;  2XFS A;  3GLF E;  3MK6 A;  1J09 A;  2YFQ A;  3HHX A;  2KZS A;  2Z3X A;  1QAO A;  3B7Z A;  2W82 A;  3PNY A;  2VQE M;  1NHG C;  2CE7 A;  2LHG A;  3SBJ A;  4ZPX A;  4NC6 A;  1N78 A;  3ILK A;  2BJW A;  4DV7 M;  1N75 A;  4CJ6 A;  1NSF A;  1CUK A;  2LH0 A;  3F92 A;  3UJN A;  5IWA M;  3KVW A;  3FUW A;  1QAQ A;  2F5P A;  2DHR A;  5JI2 E;  3OTO M;  1IM2 A;  5C18 A;  3J7B A;  2HHH M;  1VG5 A;  2GNO A;  4IJE A;  3FYC A;  1GAB A;  3LMM A;  2JWS A;  3W68 A;  1SXJ E;  1GL6 A;  4DV1 M;  2KDL A;  2L4F A;  3AKZ A;  4B7F A;  2XLJ A;  4IIW A;  3GRU A;  5IRE B;  4G4R A;  3W67 A;  2XZF A;  1QUS A;  1EIJ A;  2CEA A;  3SYK A;  4NRV A;  2ZAN A;  4KT0 F;  1AIP C;  4DR2 M;  1WJ7 A;  4DR6 M;  1FJG M;  4WUR A;  1NV9 A;  1G8P A;  2Q2E B;  2R65 A;  3DZD A;  4LJ9 A;  3TL4 X;  3GP1 A;  3KXE C;  1NO1 A;  4PDG A;  1DGH A;  2DAM A;  2XH9 A;  2CV2 A;  4NSR A;  2J5Y A;  2OPF A;  4GHL A;  1TDH A;  3I01 M;  4LF4 M;  3VKG A;  4MM3 B;  3KOZ E;  4D82 A;  3R9X B;  2J7N A;  1ZMW A;  3WHK A;  3LVW A;  3DFZ A;  1XXH E;  3SMS A;  1S3S A;  3RE8 A;  2DZO B;  3VFD A;  1PJT A;  2DHY A;  3CF2 A;  4DR3 M;  5IT9 S;  5E26 A;  2XGN A;  4RF0 A;  1MU5 A;  3BBZ A;  5IZ7 D;  1NHW C;  4L16 A;  2RRU A;  4A3V B;  5JI3 E;  1IFY A;  4BLC A;  1IN7 A;  1VDD A;  1Q02 A;  1XMQ M;  2E5L M;  1WHC A;  2FS1 A;  4IBJ A;  3K2L A;  2JUJ A;  4PD2 A;  3CF6 E;  3SFZ A;  4I81 A;  2F5S A;  4UN2 B;  3GLH E;  4B3S M;  4JV5 M;  1EE8 A;  3TWL A;  1KSF X;  3A42 A;  4JN6 A;  3W0F A;  2FNA A;  1ZMV A;  2HL7 A;  2UU9 M;  4B3T M;  3FTE A;  3HHW A;  4LJ8 A;  1V33 A;  3QYB A;  3L29 A;  2OOB A;  3U6O A;  3AV0 A;  1JR3 D;  3RGP A;  2WSE F;  2R44 A;  3HJ8 A;  1NNU C;  4LFC M;  4REZ A;  4GC5 A;  1L2D A;  5H37 D;  3HX3 A;  4JI3 M;  4YY3 M;  1IN8 A;  1WXQ A;  2C9O A;  3KOW E;  5LMN M;  4FWG A;  3A46 A;  5ITY A;  3VK7 A;  3FRH A;  1MJG M;  2C98 A;  2JXN A;  5KQ8 A;  1Z5A A;  2F5O A;  3GRY A;  1QYR A;  3CGW A;  3WHL A;  3CTW B;  3T6P A;  2DI0 A;  1Z5C A;  1P3Q Q;  2CFO A;  1IN6 A;  2L6O A;  2LNH C;  2B3T A;  2K0B X;  4IJF A;  3U6S A;  2VF8 A;  3K92 A;  4M0D A;  4LZZ A;  4CIS A;  2BNK A;  2ZTD A;  2HWJ A;  2C9C A;  1V92 A;  2QP9 X;  2FE8 A;  3TPZ A;  2UXD M;  4PDI A;  2I7P A;  2DVW B;  1HT1 E;  2YQZ A;  3BOS A;  3B9P A;  3JR5 A;  4DUY M;  1N34 M;  4NXM M;  3B89 A;  3QWL A;  3MHV C;  3AOG A;  1VEK A;  2KZU A;  3SHF A;  3IG5 A;  3KOX E;  1G3I A;  4RF1 A;  3RFW A;  2KRK A;  3M7G A;  4QHT A;  3C58 A;  2D7E A;  1K3W A;  3FYD A;  3FRI A;  4LJ5 A;  3SAR A;  4NOO B;  2L09 A;  4GH9 A;  4JI7 M;  1J7K A;  2DAI A;  1A5T A;  2R45 A;  3SAV A;  1Z6T A;  3VKH A;  2Y0T A;  3GLI B;  3SMP A;  3HU3 A;  2R0I A;  3H4M A;  4I4L A;  4Z6Y A;  1D0K A;  2YNM D;  3GLF B;  4AI6 A;  2LHC A;  2Z8Y M;  2DNA A;  2Z4S A;  1PRB A;  1ZV1 A;  1I94 M;  1E9R A;  2DAE A;  2UUA M;  1XWI A;  3C3D A;  1OKS A;  2OQ4 A;  1E32 A;  3SYL A;  2MH8 A;  3ZQJ A;  2MRO B;  2KHH A;  4LJA A;  1Z59 A;  4R71 A;  1VDL A;  2FFJ A;  4TUW A;  1G4A E;  5FTK A;  4BB9 A;  3U5Z B;  2LVP C;  3GRR A;  4DV3 M;  4NRW A;  4FWD A;  4GEW A;  1XC8 A;  1HQC A;  1OFI A;  4CIZ A;  1IN5 A;  2L4E A;  4DBG B;  3GQ4 A;  5KPT A;  1OIP A;  4MGI E;  4PT5 A;  2JY5 A;  1TH3 A;  3GLI A;  3AL0 C;  3U60 B;  1SXJ B;  4BBA A;  3GLF A;  4FCV A;  4QNR A;  1DGG A;  2VDB B;  2VF7 A;  4HL4 A;  4LGM A;  2CP8 A;  4DR5 M;  3SAW A;  1C7Y A;  3SHG B;  2CRU A;  3ZC7 B;  1G59 A;  1QAM A;  1J5E M;  3GLG E;  1DGH B;  2G8L A;  2OO9 A;  2C99 A;  5EP4 A;  1XMO M;  2AHM A;  3C9P A;  2XFT A;  2KNA A;  4KHP M;  1WGN A;  4LFA M;  1QQW A;  5KQD A;  4S12 A;  1OQY A;  4L4U A;  4D80 A;  3VK8 A;  1OFH A;  4XBO A;  5C1B A;  3FUX A;  1IXS B;  3LCU A;  3R8F A;  3SAS A;  5EP3 A;  2M60 A;  1L1Z A;  4AKI A;  4R3D A;  4I5S A;  1HNW M;  3K9P A;  2G3Q A;  3J2P B;  3U60 A;  5FSW A;  1Q3B A;  1SXJ A;  2H5X A;  3E46 A;  2QZ4 A;  1C1K A;  4IBC A;  4X62 M;  3PVS A;  2JP7 A;  1XXH B;  2JY7 A;  3U61 B;  3UMM A;  4DV2 M;  4DR1 M;  3LQQ A;  1F4I A;  4L78 A;  1HQY E;  3K8Z A;  3TE6 A;  5ITX E;  3FUV A;  4CHT B;  1QZM A;  3L25 A;  2X4A A;  4F1I A;  7CAT A;  1ZAE A;  3E21 A;  4GMQ A;  3J80 S;  1PGY A;  1YLA A;  5ITX A;  2Y20 A;  2EJS A;  2MGW A;  1T43 A;  2DZL A;  3FKE A;  1QVR A;  2VQF M;  3GLH B;  1IXS A;  3JAM S;  1L1T A;  1XNR M;  3QAU A;  4Z8X A;  4FW9 A;  5ITU A;  2DKL A;  1GL7 A;  4FCT A;  5KO3 A;  3T1H M;  3C3E A;  4AKH A;  4B3R M;  2L7I A;  3U6P A;  2DWM A;  3TWK A;  3PFI A;  1NJF A;  1XXH A;  3U61 A;  5DFL A;  2K6B A;  1I4W A;  1N33 M;  5A2Q S;  1LTM A;  1Y8G A;  2WSF F;  5LMU M;  4Y28 F;  1OAI A;  4LGY A;  4GIT A;  1IQP A;  3SC3 A;  4I8O A;  1VEG A;  1ZQ9 A;  3UZU A;  1R6B X;  1QDR A;  3T15 A;  4PCZ A;  1WR1 B;  3NBI A;  5EXX A;  4LZJ A;  3L2A A;  4OVZ B;  1V34 A;  2L2D A;  3DA1 A;  1HT2 E;  4IBE A;  4OU7 A;  3J27 B;  4IBG A;  3GQ3 A;  4JI5 M;  3EIH A;  3GLH A;  5KPZ A;  3E9S A;  4QNM A;  4DV4 M;  2QEN A;  3LVV A;  4GRI A;  4DV6 M;  2Y21 A;  3HGI A;  2R4E A;  2WZJ A;  2K47 A;  3B7Q A;  4LRS A;  4LF9 M;  3FTF A;  1HNZ M;  2R6F A;  1DV0 A;  3KDS E;  5FTN A;  4AZF A;  1T3T A;  4LJ4 A;  1NY5 A;  1PJQ A;  5KPR A;  2QBY B;  2M5Z A;  5DYG A;  1IBK M;  2R62 A;  2H1R A;  2QQ8 A;  3FTD A;  4G4O A;  4OVZ A;  4XK8 F;  3KS4 A;  1TDZ A;  1MX0 A;  4JI0 M;  5ITQ A;  4MGK E;  3D8B A;  4MGH A;  1TF0 B;  3UGJ A;  2BWE A;  2LBC A;  3LW5 F;  5EP2 A;  1JQJ C;  2Y0Q A;  3NWL A;  4P16 A;  1HNX M;  1QZE A;  3GPX A;  2O01 F;  2R4J A;  1K82 A;  3FUT A;  2I7N A;  4LRT A;  4DUZ M;  1MN3 A;  2CHG A;  2OOA A;  3VDU A;  2WSC F;  2V1C A;  3K9O A;  1QDT A;  4M9S A;  2QBY A;  2KW0 A;  2LVN C;  2UXB M;  4AQY M;  4JXJ A;  2EA0 A;  4JI8 M;  2CHQ A;  2ZBK B;  4IBI A;  4LJ7 A;  1FNN A;  5FLX S;  2X49 A;  1G41 A;  1TGU A;  2A5Y B;  1TR8 A;  1TH2 A;  4LCB A;  2V1U A;  1DO0 A;  2JZ1 A;  1PJS A;  5FTJ A;  3GPY A;  2CV0 A;  3MJ5 A;  4M9Z A;  2G5G X;  4JI2 M;  2CHV A;  3FTC A;  1L2B A;  3KW6 A;  2RGH A;  3TWM A;  2KEB A;  4OX9 M;  2QCU A;  4G3O A;  1JB0 F;  1OAO C;  1SXJ D;  2LXE A;  3IHP A;  1HJP A;  4W5W A;  1E94 E;  2RGO A;  5DNY A;  3HU1 A;  3HZJ A;  2X8A A;  4MGZ E;  4CGY B;  1E9S A;  2KA6 B;  1IY2 A;  3KS8 A;  1L8Q A;  2ZAM A;  1R7R A;  2VII A;  3KSJ A;  4B08 A;  3GLG B;  1JR3 E;  1G71 A;  3Q8G A;  2O5R A;  5GKN A;  2DZN B;  2QHO B;  2L7H A;  2RKO A;  1T6O A;  3IG8 A;  1N36 M;  4AKG A;  4L6V 6;  1Q39 A;  1KFV A;  5EJC A;  1WIV A;  2C5R A;  1PJJ A;  1DGF A;  1D2N A;  1YUB A;  2JNH A;  2LWX A;  3U5Z A;  2ZAO A;  5EQT A;  4X65 M;  3GQ5 A;  2R46 A;  3PNV A;  4KLN A;  1NVM A;  2D7H A;  4KOD A;  1GVN A;  2DAK A;  4DR4 M;  4AG6 A;  1DO2 A;  2ZTC A;  1IXR C;  3GLG A;  1GJS A;  3MMP A;  5F3W A;  1Z5B A;  5FTM A;  1QAN A; 
#chains in the Genus database with same CATH homology
 2O25 A;  2LTU A;  4Q7J A;  5DFL A;  2QSF X;  1Y8G A;  1GO5 A;  2QNJ A;  1OAI A;  3FRH A;  1KYI A;  1VEG A;  3T6P A;  2DI0 A;  1WR1 B;  1P3Q Q;  2B3T A;  2K0B X;  2L2D A;  1HT2 E;  1OTR A;  2CWB A;  1WGL A;  2ZTD A;  2HWJ A;  2LVQ D;  1V92 A;  1HT1 E;  2WZJ A;  3B89 A;  3GLI E;  2LVA A;  1VEK A;  3GLF E;  1DV0 A;  1G3I A;  2KNZ A;  2HAK A;  3FRI A;  2DAI A;  1A5T A;  2DEN A;  3LCV B;  2R0I A;  1CUK A;  3F92 A;  2DNA A;  1ZV1 A;  2BWE A;  2LBC A;  2DAE A;  5JI2 E;  2JY8 A;  1IM2 A;  1OKS A;  1QZE A;  1VG5 A;  1UFZ A;  2MRO B;  2KHH A;  4R71 A;  1MN3 A;  1VDL A;  1G4A E;  2L4F A;  2OOA A;  2LVP C;  3K9O A;  4GEW A;  2LVN C;  1EFU B;  2L4E A;  4DBG B;  1AIP C;  1ZMU A;  1WJ7 A;  2JY5 A;  1NV9 A;  1G41 A;  2EKF A;  2MR9 A;  1TR8 A;  1DO0 A;  2JZ1 A;  2DAM A;  4F2L A;  2CP8 A;  1C7Y A;  2K9D A;  2JY6 B;  3GLG E;  3FE3 A;  2JZ0 A;  1ZMW A;  2OO9 A;  4G3O A;  3IHP A;  1HJP A;  2KNA A;  1E94 E;  1WGN A;  1BVS A;  1XXH E;  1SG9 A;  2DHY A;  1OQY A;  2KNV A;  2EKK A;  2MJ5 B;  3BBZ A;  3LCU A;  1R4G A;  1JR3 E;  2RRU A;  1IFY A;  1VEJ A;  3H4J A;  4HEO A;  2QHO B;  1Q02 A;  2G3Q A;  3K9P A;  1WHC A;  1T6O A;  2H5X A;  3E46 A;  1TTE A;  2JP7 A;  2JY7 A;  2JUJ A;  1F4I A;  1WIV A;  2DAG A;  4UN2 B;  1HQY E;  2BWB A;  3GLH E;  4WP2 A;  2JNH A;  4F1I A;  1VQ1 A;  3E21 A;  1PGY A;  1YLA A;  1NV8 A;  1ZMV A;  2DAK A;  2EJS A;  2OOB A;  2MGW A;  1T43 A;  2DZL A;  3IEC A;  1IXS A;  1DO2 A;  2ZTC A;  2LVO C;  1XB2 B;  2DKL A;  3MMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...