2KHHA

Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural requirements for the ubiquitin-associated domain of the mRNA export factor Mex67 to bind its specific targets, the transcription elongation THO complex component Hpr1 and nucleoporin FXFG repeats
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords mRNA export factor MEX67
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2khhA00
1R4GA 1VEJA 2JUJA 2DHYA 2KHHA 1E94E 2OOAA 3GLIE 1OKSA 1AIPC 3BBZA 1OTRA 3E21A 2MGWA 2OO9A 1F4IA 1WHCA 1IXSA 4WP2A 1YLAA 1XXHE 2DZLA 2MJ5B 1DV0A 1HT2E 2JP7A 3IHPA 2BWBA 4G3OA 4HEOA 3B89A 2DNAA 2G3QA 1G4AE 1NV8A 2KNVA 1HJPA 2QSFX 3MMPA 1QZEA 3LCUA 1SG9A 1WJ7A 2CWBA 2DKLA 1ZV1A 1T43A 1TTEA 1VQ1A 1CUKA 2RRUA 1NV9A 2DI0A 1VDLA 2HWJA 2LVPC 3T6PA 2QHOB 2JZ0A 3IECA 1G3IA 1DO2A 2ZTCA 2LBCA 1WGLA 2CP8A 1WGNA 1C7YA 1UFZA 1V92A 1VEGA 2L4FA 3LCVB 3GLGE 2JZ1A 1P3QQ 3FRHA 1HT1E 4DBGB 1OQYA 3GLHE 2DENA 1T6OA 4F1IA 5DFLA 2WZJA 2DAEA 1A5TA 1IM2A 2BWEA 2LTUA 3E46A 5JI2E 2H5XA 2JY5A 2MR9A 1KYIA 3K9OA 1GO5A 1WIVA 1BVSA 2LVQD 2JNHA 1HQYE 2LVOC 2KNZA 3FRIA 1Q02A 2ZTDA 3K9PA 1JR3E 2KNAA 2L4EA 2EKFA 2K9DA 4R71A 3FE3A 2DAKA 2HAKA 1ZMUA 3F92A 1WR1B 2EJSA 2LVAA 2DAIA 1OAIA 1IFYA 2B3TA 1EFUB 1VG5A 1G41A 2DAMA 2JY6B 2EKKA 2QNJA 2JY7A 1TR8A 1ZMWA 2L2DA 2K0BX 2LVNC 2JY8A 1PGYA 1MN3A 2MROB 1ZMVA 2O25A 1VEKA 3H4JA 2OOBA 2R0IA 3GLFE 1Y8GA 4Q7JA 4GEWA 4UN2B 4F2LA 2DAGA 1XB2B 1DO0A
chains in the Genus database with same CATH superfamily
4JYAM 3L26A 4DR7M 2APLA 3GPXA 3H4MA 4GHAA 4LJ9A 2VDBB 1VEJA 4PT5A 3T15A 4FW9A 3GLGA 1MX0A 1GKIA 5KQDA 3GPUA 2C98A 4R3DA 1N32M 4FCTA 3VFDA 3NBXX 1N78A 3BBZA 3NBIA 5FTLA 1XMOM 2I7PA 4DR1M 4WP2A 1XXHE 3C3EA 1K82A 2JP7A 2RGHA 3IHPA 2WSEF 1NJFA 1KSFX 3UK6A 4G3OA 1TGUA 1OFIA 4B7GA 1PJQA 4OVZA 4P16A 3B89A 3TPZA 4BB9A 2XZUA 4AQYM 4B3SM 2ZBKB 2G3QA 3GLHB 1FNNA 1I4WA 1WXQA 1X37A 2J7NA 1HJPA 3ZH9B 3AOGA 1SG9A 1QDTA 5KPTA 1Z5CA 1HNWM 1LV7A 2CFOA 1ORYB 1XNQM 1T43A 1TTEA 4X64M 1CUKA 1EE8A 4LZZA 1QAQA 2RRUA 5EJCA 2E5LM 4LG2A 2XGNA 4MGKE 1GLNA 1QZMA 4XK8F 3UGJA 1VDLA 2XEPA 2LVPC 4KO8A 4FD2A 3TWKA 3SAVA 2Z8YM 4G4OA 2JZ0A 3IECA 4K0KM 2R6FA 4M0DA 4JI1M 5E26A 1DO2A 4G6ZA 1Z5BA 2LBCA 4NOOB 1V92A 1H6UA 5ITRA 2L4FA 4GHLA 2I7NA 2O01F 3A98B 4DR5M 1R2YA 2LWXA 3ZC7B 2JZ1A 1IY1A 2ZAMA 2NQ8C 3FTDA 4GC9A 2M5ZA 3AOEA 2R45A 1HR0M 3QYBA 3GLHE 4YHHM 2C9CA 2WZJA 4GKKM 1A5TA 5JI3E 2BWEA 3LVWA 2M60A 4CGYB 2VQFM 3E46A 3SAUA 1NHGC 2C99A 2JA2A 3MHVC 4FCWA 3GQ3A 1GO5A 2Q2EB 3D8LA 3W67A 2L7HA 2UU9M 1I94M 3KOYE 5E6JA 2DWNA 4CISA 2LVOC 4LF7M 3GLIA 4NRWA 1OIPA 2ZTDA 3K9PA 2KZUA 2CEAA 4LF5M 3I51A 1JR3E 2KNAA 3GQ4A 3FTCA 3SAWA 2XZFA 1XHBA 4LF4M 3SMSA 3KFUG 1ZMUA 2A5YB 1XNRM 2XSZD 2R4EA 1N75A 5IWAM 1PRBA 2CHGA 1J09A 3ZQJA 1QDRA 3AV0A 1EFUB 2KRUA 4JXJA 5ITUA 4I8OA 4MH0E 4DV4M 4M9ZA 1G41A 2DAMA 1UM8A 4MGYE 3MJ5A 4KT0F 4OU7A 1SXJB 1JR3A 2CE7A 2FFJA 3HX3A 2L2DA 3GLFB 2RGOA 2J7OA 4NSRA 1E32A 3B7QA 2EO2A 4R7GA 2Z3XA 1IN6A 1J7KA 3BXWA 2QQ8A 2OOBA 2HHHM 1EIJA 4ITQA 2R0IA 3KP1E 1GVNA 3U6CA 4DV5M 4B7HA 3SBJA 2EUCA 1OAOC 1Q3CA 3HHWA 1LTMA 4RNAA 5EQTA 2JY6B 2L4EA 1XB2B 2R44A 2K6BA 4Z8XA 5FTMA 4RF0A 1S3SA 3RGSA 2CUZA 4JV5M 1NY5A 3GLHA 1Q39A 1SXJC 1QAOA 1E9RA 4PCZA 2R18A 2C9OA 3M7GA 3FTFA 3HZJA 1E94E 2OOAA 3ILKA 4ANRA 1OKSA 1HQCA 1JQJC 2QP9X 3U6SA 1QUSA 1AIPC 5EP4A 4AKIA 1OTRA 4W5WA 2OO9A 2DXIA 1QAMA 4LRSA 4LF6M 1F4IA 1IXSA 1YLAA 2VF7A 2ZAOA 4LFBM 1DV0A 1HT2E 2QPAA 2R4JA 1QANA 2BWBA 3CF0A 3V76A 1SXJD 2ZM6M 4PDGA 5LMUM 4HEOA 3VDPA 1N34M 3FYDA 4M9SA 5KQ8A 1PJTA 3K2LA 3PVSA 2VIIA 2F5QA 2YR0A 3AKZA 1NV8A 4CJ6A 2BJVA 2QSFX 1D0KA 1IBMM 3MMPA 1IN5A 3FD9A 4IBGA 2FNAA 2KW0A 3KOZE 3KW6A 3U6MA 4DR2M 3UJNA 4GKJM 4IBCA 1NV9A 1XWIA 2UXCM 2YQZA 4DV2M 4RF1A 4IBFA 4JI6M 2CHQA 1XXHA 3T6PA 2RKOA 4G4QA 3K1JA 3M0EA 3GP1A 3DOAA 4Z6YA 4DUZM 3GO8A 3WHKA 3HHYA 5F3WA 1G3IA 2Y0TA 2Z4SA 5EXTA 3SARA 3GLGB 5A2QS 3U61A 1WGLA 1WGNA 1VEGA 1TF0B 1TDHA 4NXNM 2C96A 3GLGE 3FKEA 3AFHA 4AI6A 5C1BA 3KOWE 1RU3A 4G4RA 4L4UA 3A42A 2DENA 1T6OA 4JI0M 2ZANA 7CATA 2DAEA 4X66M 4BLCA 1HNZM 3T38A 2LTUA 1R6BX 2H1RA 1FJGM 3EIEA 5JI2E 4TUWA 2L7IA 3CF2A 2JY5A 2KZSA 3L2AA 3T1YM 1DGGA 1SXJA 3K9OA 3KSXA 4B7FA 4B3RM 1BVSA 3GLFA 1PM5A 2WSCF 1JR3D 2LVQD 3PFIA 4L16A 2LHCA 3LMMA 2JNHA 1HQYE 2KNZA 3HWSA 4MB7A 1N33M 2V6ZM 2F5PA 3SATA 5IT9S 3FUUA 1V34A 3B9PA 3W0FA 1DGHB 2K9DA 3SASA 4R71A 3TL4X 3T1HM 2DAKA 2HAKA 1NY6A 4RKUF 2EJSA 2LVAA 4GC5A 4FWGA 4JI2M 1YE9A 1OAIA 4NXMM 1GL7A 1C1KA 5L8RF 1IN8A 2UXDM 3FYCA 2R65A 3PNVA 2R62A 5BR8M 4OW0A 2G8LA 2G5GX 5ITYA 2Z4RA 2QNJA 2VQEM 4JI4M 2P5TA 3VKHA 1NJGA 3CF6E 3DA1A 4PD2A 4DV7M 2LVNC 2BJWA 4GIPA 5ITQA 2KA6B 5ITXE 1ZMVA 2O25A 1VEKA 3GLIB 1XC8A 2XFSA 4AG5A 4LRTA 4XGIA 5FTNA 2F5NA 3U6QA 4UN2B 4F2LA 1D0MA 5EP1A 1Q3BA 2KEBA 3D8BA 3EIHA 4X65M 4I81A 1L1TA 1QUTA 4HL4A 1Z59A 2X4AA 1PJJA 2GNOA 4A3VB 5H37D 2XSZA 1Z6TA 2YNMD 3HY5A 2JUJA 2EA0A 3FTEA 3I4YA 2V1UA 3PNYA 3B7NA 2X49A 3C58A 2KHHA 5FLXS 3GQ5A 2HCBA 2UUBM 1L2DA 3GRVA 1DGBA 1L1ZA 1SXJE 4B3TM 3JR4A 3C3DA 3QAUA 1IBKM 1WHCA 2L09A 4ZPXA 3LVVA 1MU5A 2MJ5B 4L78A 5EP3A 3W0LB 5ITTA 1N36M 3R9XB 4GH9A 4GITA 3U6DA 1R5LA 5DNYA 4NRVA 2DNAA 3LQRA 3KXEC 4DV0M 4L15A 3TWLA 3U60B 4JI5M 3KSJA 5FSWA 1IN7A 3FUVA 1ZAEA 3FUWA 3KS8A 2KNVA 3RFWA 3FUTA 4D81A 5EP2A 1QZEA 4IJEA 2CV0A 1WJ7A 4LGMA 2W82A 3JR5A 1NO1A 4Y28F 4GMQA 4D80A 3GPPA 2CWBA 3TQSA 1ZV1A 3OTOM 1PJIA 1TH2A 1TH3A 3DFZA 3GRRA 2F4VM 1L8QA 4B08A 3HHZA 2DI0A 3I04M 2DZOB 3GRUA 2QHOB 4M9XA 4LCBA 4IBDA 4AKHA 1W5TA 4LJ6A 3BOSA 3C9PA 4XBOA 3I01M 1DGFA 3J7AS 2CP8A 4IBBA 4JI3M 3SHFA 1NNUC 1UFZA 1K3XA 1OIZA 3J7BA 3VK7A 3LCVB 1NSFA 1P3QQ 1IY0A 2BNKA 3MK6A 4DBGB 4DV1M 2X8AA 2MH8A 1N77A 1K3WA 4QOZC 4S12A 3FUXA 2OPFA 4LF8M 3HU3A 3I4VA 4B3MM 3B74A 2QZ4A 4JN6A 2MR9A 3SYKA 4JI7M 1KYIA 3QYEA 1WIVA 3HHXA 1TH4A 2CV2A 3E4RA 1Z5AA 3E9SA 5BPVA 3FRIA 3W68A 3NWLA 4AG6A 1Q02A 1R7RA 4NSOB 2JWSA 4G4NA 4KLNA 1QQWA 3TE6A 3THGA 1TDZA 2GQFA 4OX9M 1NVMA 3VDUA 3KP0E 2DZNB 5KO3A 4LFAM 3FE3A 5LMNM 4FVMA 2O5RA 5KPZA 4IIWA 3WHLA 3F92A 3UMMA 5FTKA 2QENA 2B3TA 4JI8M 3A45A 4IBIA 4KODA 4L6V6 1NNJA 1IBLM 1IXRC 4L8RC 1IY2A 3U5ZA 3Q8GA 3U61B 4CHTB 2EKKA 3U60A 1G59A 2KRKA 2FOIC 4LJ5A 3HKPA 2K0BX 3HJ8A 1D0LA 1QVRA 1MN3A 3IG8A 2V1CA 2LHGA 3UZUA 1Y8GA 2D7EA 1E9SA 2VF8A 3SYLA 4NC6A 5KPRA 3U5ZB 2DAGA 4OVZB 4YY3M 4QHSA 1GL6A 1DO0A 3J80S 5DYGA 3LW5F 3J81S 2DWZB 1HNXM 3KVWA 4LZJA 1NHWC 1AUAA 1R4GA 2LNHC 5IREB 2OQ4A 3U6PA 3KS4A 3KOXE 2DHYA 3GLIE 1OJLA 3HJSA 2XH9A 3PXGA 3TWMA 2CHVA 4BBAA 3LQQA 4QOSA 3E21A 2MGWA 3U6EA 4MGHA 3SC3A 2KXEA 1VDDA 2DZLA 4DV6M 2XFTA 4FCVA 4II7A 2HKJA 4AKGA 2C5RA 5EXPA 3RGPA 4FWHA 4I4LA 4IBKA 2J5YA 5FTJA 3U6LA 3CGWA 1GJTA 2Y0QA 4IJFA 3HU2A 1G4AE 3L25A 1D2NA 3ZCBB 3J27B 4M0WA 4DV3M 4X62M 2QBYB 2DVWB 2R46A 3LCUA 4QNMA 1GJSA 3DZDA 1IXZA 2WSFF 4DR4M 4I5SA 4WURA 4EIWA 3GPYA 3B7ZA 2KDLA 3M6AA 2DKLA 2UUAM 3R8FA 3HU1A 2N35A 1VQ1A 1IQPA 2L6OA 1G8PA 3Q8XA 4DR6M 3SMPA 2FS1A 4LY6A 3VKGA 2HWJA 2D7HA 1V33A 3AJIB 2Z7JA 3J2PB 4MGZE 2Y20A 2XF3A 3CTWB 2ZTCA 4KHPM 2FH0A 4QHTA 1C7YA 4MM3B 4P17A 4LJ4A 4LJ8A 3HJQA 3VLFB 4AW4A 1YSYA 4FWDA 3FRHA 2LXEA 1HT1E 3L27A 1OQYA 4NL4H 4D82A 4F1IA 2F5SA 5DFLA 2D7GA 2HL7A 3U6OA 3VK8A 1IM2A 1G71A 2UXBM 2LH0A 4LFCM 2H5XA 4PDIA 5DYIA 2FE8A 2Y21A 2F5OA 2AHMA 5EXXA 4DUYM 2JXNA 4CIZA 4LF9M 5IZ7D 1KFVA 2YFQA 2DWLA 4QNRA 3KDSE 5C18A 4REZA 5ITXA 4GRIA 1J5EM 1R2ZA 1GABA 5EXSA 1QYRA 3K92A 5GKNA 1IN4A 2EKFA 3IG5A 3JAMS 2QCUA 4DR3M 3AL0C 8CATA 3RE8A 4LJ7A 1JB0F 1PJSA 1WR1B 2K47A 4AZFA 2DAIA 4IBEA 2DWMA 3SFZA 1IFYA 1W5SA 1L2BA 2CRUA 3K8ZA 1ZQ9A 2ERCA 1VG5A 3L28A 4WW0A 3L29A 2XLJA 4LJAA 3GRYA 1YUBA 1DGHA 2JY7A 4HLQA 1TR8A 1ZMWA 1T3TA 4LGYA 3QWLA 1XXHB 2JY8A 1PGYA 2QBYA 2DHRA 4MGIE 2MROB 1MJGM 3H4JA 3SHGB 3A46A 4IBJA 1IXSB 3GLFE 2CV1A 1OFHA 4Q7JA 4GEWA 1L2CA 2UUCM 3AOEC 1XMQM 3HGIA
chains in the Genus database with same CATH topology
1R4GA 1VEJA 2JUJA 2DHYA 2KHHA 1E94E 2OOAA 3GLIE 1OKSA 1AIPC 3BBZA 1OTRA 3E21A 2MGWA 2OO9A 1F4IA 1WHCA 1IXSA 4WP2A 1YLAA 1XXHE 2DZLA 2MJ5B 1DV0A 1HT2E 2JP7A 3IHPA 2BWBA 4G3OA 4HEOA 3B89A 2DNAA 2G3QA 1G4AE 1NV8A 2KNVA 1HJPA 2QSFX 3MMPA 1QZEA 3LCUA 1SG9A 1WJ7A 2CWBA 2DKLA 1ZV1A 1T43A 1TTEA 1VQ1A 1CUKA 2RRUA 1NV9A 2DI0A 1VDLA 2HWJA 2LVPC 3T6PA 2QHOB 2JZ0A 3IECA 1G3IA 1DO2A 2ZTCA 2LBCA 1WGLA 2CP8A 1WGNA 1C7YA 1UFZA 1V92A 1VEGA 2L4FA 3LCVB 3GLGE 2JZ1A 1P3QQ 3FRHA 1HT1E 4DBGB 1OQYA 3GLHE 2DENA 1T6OA 4F1IA 5DFLA 2WZJA 2DAEA 1A5TA 1IM2A 2BWEA 2LTUA 3E46A 5JI2E 2H5XA 2JY5A 2MR9A 1KYIA 3K9OA 1GO5A 1WIVA 1BVSA 2LVQD 2JNHA 1HQYE 2LVOC 2KNZA 3FRIA 1Q02A 2ZTDA 3K9PA 1JR3E 2KNAA 2L4EA 2EKFA 2K9DA 4R71A 3FE3A 2DAKA 2HAKA 1ZMUA 3F92A 1WR1B 2EJSA 2LVAA 2DAIA 1OAIA 1IFYA 2B3TA 1EFUB 1VG5A 1G41A 2DAMA 2JY6B 2EKKA 2QNJA 2JY7A 1TR8A 1ZMWA 2L2DA 2K0BX 2LVNC 2JY8A 1PGYA 1MN3A 2MROB 1ZMVA 2O25A 1VEKA 3H4JA 2OOBA 2R0IA 3GLFE 1Y8GA 4Q7JA 4GEWA 4UN2B 4F2LA 2DAGA 1XB2B 1DO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4G A;  1VEJ A;  2JUJ A;  2DHY A;  2KHH A;  1E94 E;  2OOA A;  3GLI E;  1OKS A;  1AIP C;  3BBZ A;  1OTR A;  3E21 A;  2MGW A;  2OO9 A;  1F4I A;  1WHC A;  1IXS A;  4WP2 A;  1YLA A;  1XXH E;  2DZL A;  2MJ5 B;  1DV0 A;  1HT2 E;  2JP7 A;  3IHP A;  2BWB A;  4G3O A;  4HEO A;  3B89 A;  2DNA A;  2G3Q A;  1G4A E;  1NV8 A;  2KNV A;  1HJP A;  2QSF X;  3MMP A;  1QZE A;  3LCU A;  1SG9 A;  1WJ7 A;  2CWB A;  2DKL A;  1ZV1 A;  1T43 A;  1TTE A;  1VQ1 A;  1CUK A;  2RRU A;  1NV9 A;  2DI0 A;  1VDL A;  2HWJ A;  2LVP C;  3T6P A;  2QHO B;  2JZ0 A;  3IEC A;  1G3I A;  1DO2 A;  2ZTC A;  2LBC A;  1WGL A;  2CP8 A;  1WGN A;  1C7Y A;  1UFZ A;  1V92 A;  1VEG A;  2L4F A;  3LCV B;  3GLG E;  2JZ1 A;  1P3Q Q;  3FRH A;  1HT1 E;  4DBG B;  1OQY A;  3GLH E;  2DEN A;  1T6O A;  4F1I A;  5DFL A;  2WZJ A;  2DAE A;  1A5T A;  1IM2 A;  2BWE A;  2LTU A;  3E46 A;  5JI2 E;  2H5X A;  2JY5 A;  2MR9 A;  1KYI A;  3K9O A;  1GO5 A;  1WIV A;  1BVS A;  2LVQ D;  2JNH A;  1HQY E;  2LVO C;  2KNZ A;  3FRI A;  1Q02 A;  2ZTD A;  3K9P A;  1JR3 E;  2KNA A;  2L4E A;  2EKF A;  2K9D A;  4R71 A;  3FE3 A;  2DAK A;  2HAK A;  1ZMU A;  3F92 A;  1WR1 B;  2EJS A;  2LVA A;  2DAI A;  1OAI A;  1IFY A;  2B3T A;  1EFU B;  1VG5 A;  1G41 A;  2DAM A;  2JY6 B;  2EKK A;  2QNJ A;  2JY7 A;  1TR8 A;  1ZMW A;  2L2D A;  2K0B X;  2LVN C;  2JY8 A;  1PGY A;  1MN3 A;  2MRO B;  1ZMV A;  2O25 A;  1VEK A;  3H4J A;  2OOB A;  2R0I A;  3GLF E;  1Y8G A;  4Q7J A;  4GEW A;  4UN2 B;  4F2L A;  2DAG A;  1XB2 B;  1DO0 A; 
#chains in the Genus database with same CATH topology
 4JYA M;  3L26 A;  4DR7 M;  2APL A;  3GPX A;  3H4M A;  4GHA A;  4LJ9 A;  2VDB B;  1VEJ A;  4PT5 A;  3T15 A;  4FW9 A;  3GLG A;  1MX0 A;  1GKI A;  5KQD A;  3GPU A;  2C98 A;  4R3D A;  1N32 M;  4FCT A;  3VFD A;  3NBX X;  1N78 A;  3BBZ A;  3NBI A;  5FTL A;  1XMO M;  2I7P A;  4DR1 M;  4WP2 A;  1XXH E;  3C3E A;  1K82 A;  2JP7 A;  2RGH A;  3IHP A;  2WSE F;  1NJF A;  1KSF X;  3UK6 A;  4G3O A;  1TGU A;  1OFI A;  4B7G A;  1PJQ A;  4OVZ A;  4P16 A;  3B89 A;  3TPZ A;  4BB9 A;  2XZU A;  4AQY M;  4B3S M;  2ZBK B;  2G3Q A;  3GLH B;  1FNN A;  1I4W A;  1WXQ A;  1X37 A;  2J7N A;  1HJP A;  3ZH9 B;  3AOG A;  1SG9 A;  1QDT A;  5KPT A;  1Z5C A;  1HNW M;  1LV7 A;  2CFO A;  1ORY B;  1XNQ M;  1T43 A;  1TTE A;  4X64 M;  1CUK A;  1EE8 A;  4LZZ A;  1QAQ A;  2RRU A;  5EJC A;  2E5L M;  4LG2 A;  2XGN A;  4MGK E;  1GLN A;  1QZM A;  4XK8 F;  3UGJ A;  1VDL A;  2XEP A;  2LVP C;  4KO8 A;  4FD2 A;  3TWK A;  3SAV A;  2Z8Y M;  4G4O A;  2JZ0 A;  3IEC A;  4K0K M;  2R6F A;  4M0D A;  4JI1 M;  5E26 A;  1DO2 A;  4G6Z A;  1Z5B A;  2LBC A;  4NOO B;  1V92 A;  1H6U A;  5ITR A;  2L4F A;  4GHL A;  2I7N A;  2O01 F;  3A98 B;  4DR5 M;  1R2Y A;  2LWX A;  3ZC7 B;  2JZ1 A;  1IY1 A;  2ZAM A;  2NQ8 C;  3FTD A;  4GC9 A;  2M5Z A;  3AOE A;  2R45 A;  1HR0 M;  3QYB A;  3GLH E;  4YHH M;  2C9C A;  2WZJ A;  4GKK M;  1A5T A;  5JI3 E;  2BWE A;  3LVW A;  2M60 A;  4CGY B;  2VQF M;  3E46 A;  3SAU A;  1NHG C;  2C99 A;  2JA2 A;  3MHV C;  4FCW A;  3GQ3 A;  1GO5 A;  2Q2E B;  3D8L A;  3W67 A;  2L7H A;  2UU9 M;  1I94 M;  3KOY E;  5E6J A;  2DWN A;  4CIS A;  2LVO C;  4LF7 M;  3GLI A;  4NRW A;  1OIP A;  2ZTD A;  3K9P A;  2KZU A;  2CEA A;  4LF5 M;  3I51 A;  1JR3 E;  2KNA A;  3GQ4 A;  3FTC A;  3SAW A;  2XZF A;  1XHB A;  4LF4 M;  3SMS A;  3KFU G;  1ZMU A;  2A5Y B;  1XNR M;  2XSZ D;  2R4E A;  1N75 A;  5IWA M;  1PRB A;  2CHG A;  1J09 A;  3ZQJ A;  1QDR A;  3AV0 A;  1EFU B;  2KRU A;  4JXJ A;  5ITU A;  4I8O A;  4MH0 E;  4DV4 M;  4M9Z A;  1G41 A;  2DAM A;  1UM8 A;  4MGY E;  3MJ5 A;  4KT0 F;  4OU7 A;  1SXJ B;  1JR3 A;  2CE7 A;  2FFJ A;  3HX3 A;  2L2D A;  3GLF B;  2RGO A;  2J7O A;  4NSR A;  1E32 A;  3B7Q A;  2EO2 A;  4R7G A;  2Z3X A;  1IN6 A;  1J7K A;  3BXW A;  2QQ8 A;  2OOB A;  2HHH M;  1EIJ A;  4ITQ A;  2R0I A;  3KP1 E;  1GVN A;  3U6C A;  4DV5 M;  4B7H A;  3SBJ A;  2EUC A;  1OAO C;  1Q3C A;  3HHW A;  1LTM A;  4RNA A;  5EQT A;  2JY6 B;  2L4E A;  1XB2 B;  2R44 A;  2K6B A;  4Z8X A;  5FTM A;  4RF0 A;  1S3S A;  3RGS A;  2CUZ A;  4JV5 M;  1NY5 A;  3GLH A;  1Q39 A;  1SXJ C;  1QAO A;  1E9R A;  4PCZ A;  2R18 A;  2C9O A;  3M7G A;  3FTF A;  3HZJ A;  1E94 E;  2OOA A;  3ILK A;  4ANR A;  1OKS A;  1HQC A;  1JQJ C;  2QP9 X;  3U6S A;  1QUS A;  1AIP C;  5EP4 A;  4AKI A;  1OTR A;  4W5W A;  2OO9 A;  2DXI A;  1QAM A;  4LRS A;  4LF6 M;  1F4I A;  1IXS A;  1YLA A;  2VF7 A;  2ZAO A;  4LFB M;  1DV0 A;  1HT2 E;  2QPA A;  2R4J A;  1QAN A;  2BWB A;  3CF0 A;  3V76 A;  1SXJ D;  2ZM6 M;  4PDG A;  5LMU M;  4HEO A;  3VDP A;  1N34 M;  3FYD A;  4M9S A;  5KQ8 A;  1PJT A;  3K2L A;  3PVS A;  2VII A;  2F5Q A;  2YR0 A;  3AKZ A;  1NV8 A;  4CJ6 A;  2BJV A;  2QSF X;  1D0K A;  1IBM M;  3MMP A;  1IN5 A;  3FD9 A;  4IBG A;  2FNA A;  2KW0 A;  3KOZ E;  3KW6 A;  3U6M A;  4DR2 M;  3UJN A;  4GKJ M;  4IBC A;  1NV9 A;  1XWI A;  2UXC M;  2YQZ A;  4DV2 M;  4RF1 A;  4IBF A;  4JI6 M;  2CHQ A;  1XXH A;  3T6P A;  2RKO A;  4G4Q A;  3K1J A;  3M0E A;  3GP1 A;  3DOA A;  4Z6Y A;  4DUZ M;  3GO8 A;  3WHK A;  3HHY A;  5F3W A;  1G3I A;  2Y0T A;  2Z4S A;  5EXT A;  3SAR A;  3GLG B;  5A2Q S;  3U61 A;  1WGL A;  1WGN A;  1VEG A;  1TF0 B;  1TDH A;  4NXN M;  2C96 A;  3GLG E;  3FKE A;  3AFH A;  4AI6 A;  5C1B A;  3KOW E;  1RU3 A;  4G4R A;  4L4U A;  3A42 A;  2DEN A;  1T6O A;  4JI0 M;  2ZAN A;  7CAT A;  2DAE A;  4X66 M;  4BLC A;  1HNZ M;  3T38 A;  2LTU A;  1R6B X;  2H1R A;  1FJG M;  3EIE A;  5JI2 E;  4TUW A;  2L7I A;  3CF2 A;  2JY5 A;  2KZS A;  3L2A A;  3T1Y M;  1DGG A;  1SXJ A;  3K9O A;  3KSX A;  4B7F A;  4B3R M;  1BVS A;  3GLF A;  1PM5 A;  2WSC F;  1JR3 D;  2LVQ D;  3PFI A;  4L16 A;  2LHC A;  3LMM A;  2JNH A;  1HQY E;  2KNZ A;  3HWS A;  4MB7 A;  1N33 M;  2V6Z M;  2F5P A;  3SAT A;  5IT9 S;  3FUU A;  1V34 A;  3B9P A;  3W0F A;  1DGH B;  2K9D A;  3SAS A;  4R71 A;  3TL4 X;  3T1H M;  2DAK A;  2HAK A;  1NY6 A;  4RKU F;  2EJS A;  2LVA A;  4GC5 A;  4FWG A;  4JI2 M;  1YE9 A;  1OAI A;  4NXM M;  1GL7 A;  1C1K A;  5L8R F;  1IN8 A;  2UXD M;  3FYC A;  2R65 A;  3PNV A;  2R62 A;  5BR8 M;  4OW0 A;  2G8L A;  2G5G X;  5ITY A;  2Z4R A;  2QNJ A;  2VQE M;  4JI4 M;  2P5T A;  3VKH A;  1NJG A;  3CF6 E;  3DA1 A;  4PD2 A;  4DV7 M;  2LVN C;  2BJW A;  4GIP A;  5ITQ A;  2KA6 B;  5ITX E;  1ZMV A;  2O25 A;  1VEK A;  3GLI B;  1XC8 A;  2XFS A;  4AG5 A;  4LRT A;  4XGI A;  5FTN A;  2F5N A;  3U6Q A;  4UN2 B;  4F2L A;  1D0M A;  5EP1 A;  1Q3B A;  2KEB A;  3D8B A;  3EIH A;  4X65 M;  4I81 A;  1L1T A;  1QUT A;  4HL4 A;  1Z59 A;  2X4A A;  1PJJ A;  2GNO A;  4A3V B;  5H37 D;  2XSZ A;  1Z6T A;  2YNM D;  3HY5 A;  2JUJ A;  2EA0 A;  3FTE A;  3I4Y A;  2V1U A;  3PNY A;  3B7N A;  2X49 A;  3C58 A;  2KHH A;  5FLX S;  3GQ5 A;  2HCB A;  2UUB M;  1L2D A;  3GRV A;  1DGB A;  1L1Z A;  1SXJ E;  4B3T M;  3JR4 A;  3C3D A;  3QAU A;  1IBK M;  1WHC A;  2L09 A;  4ZPX A;  3LVV A;  1MU5 A;  2MJ5 B;  4L78 A;  5EP3 A;  3W0L B;  5ITT A;  1N36 M;  3R9X B;  4GH9 A;  4GIT A;  3U6D A;  1R5L A;  5DNY A;  4NRV A;  2DNA A;  3LQR A;  3KXE C;  4DV0 M;  4L15 A;  3TWL A;  3U60 B;  4JI5 M;  3KSJ A;  5FSW A;  1IN7 A;  3FUV A;  1ZAE A;  3FUW A;  3KS8 A;  2KNV A;  3RFW A;  3FUT A;  4D81 A;  5EP2 A;  1QZE A;  4IJE A;  2CV0 A;  1WJ7 A;  4LGM A;  2W82 A;  3JR5 A;  1NO1 A;  4Y28 F;  4GMQ A;  4D80 A;  3GPP A;  2CWB A;  3TQS A;  1ZV1 A;  3OTO M;  1PJI A;  1TH2 A;  1TH3 A;  3DFZ A;  3GRR A;  2F4V M;  1L8Q A;  4B08 A;  3HHZ A;  2DI0 A;  3I04 M;  2DZO B;  3GRU A;  2QHO B;  4M9X A;  4LCB A;  4IBD A;  4AKH A;  1W5T A;  4LJ6 A;  3BOS A;  3C9P A;  4XBO A;  3I01 M;  1DGF A;  3J7A S;  2CP8 A;  4IBB A;  4JI3 M;  3SHF A;  1NNU C;  1UFZ A;  1K3X A;  1OIZ A;  3J7B A;  3VK7 A;  3LCV B;  1NSF A;  1P3Q Q;  1IY0 A;  2BNK A;  3MK6 A;  4DBG B;  4DV1 M;  2X8A A;  2MH8 A;  1N77 A;  1K3W A;  4QOZ C;  4S12 A;  3FUX A;  2OPF A;  4LF8 M;  3HU3 A;  3I4V A;  4B3M M;  3B74 A;  2QZ4 A;  4JN6 A;  2MR9 A;  3SYK A;  4JI7 M;  1KYI A;  3QYE A;  1WIV A;  3HHX A;  1TH4 A;  2CV2 A;  3E4R A;  1Z5A A;  3E9S A;  5BPV A;  3FRI A;  3W68 A;  3NWL A;  4AG6 A;  1Q02 A;  1R7R A;  4NSO B;  2JWS A;  4G4N A;  4KLN A;  1QQW A;  3TE6 A;  3THG A;  1TDZ A;  2GQF A;  4OX9 M;  1NVM A;  3VDU A;  3KP0 E;  2DZN B;  5KO3 A;  4LFA M;  3FE3 A;  5LMN M;  4FVM A;  2O5R A;  5KPZ A;  4IIW A;  3WHL A;  3F92 A;  3UMM A;  5FTK A;  2QEN A;  2B3T A;  4JI8 M;  3A45 A;  4IBI A;  4KOD A;  4L6V 6;  1NNJ A;  1IBL M;  1IXR C;  4L8R C;  1IY2 A;  3U5Z A;  3Q8G A;  3U61 B;  4CHT B;  2EKK A;  3U60 A;  1G59 A;  2KRK A;  2FOI C;  4LJ5 A;  3HKP A;  2K0B X;  3HJ8 A;  1D0L A;  1QVR A;  1MN3 A;  3IG8 A;  2V1C A;  2LHG A;  3UZU A;  1Y8G A;  2D7E A;  1E9S A;  2VF8 A;  3SYL A;  4NC6 A;  5KPR A;  3U5Z B;  2DAG A;  4OVZ B;  4YY3 M;  4QHS A;  1GL6 A;  1DO0 A;  3J80 S;  5DYG A;  3LW5 F;  3J81 S;  2DWZ B;  1HNX M;  3KVW A;  4LZJ A;  1NHW C;  1AUA A;  1R4G A;  2LNH C;  5IRE B;  2OQ4 A;  3U6P A;  3KS4 A;  3KOX E;  2DHY A;  3GLI E;  1OJL A;  3HJS A;  2XH9 A;  3PXG A;  3TWM A;  2CHV A;  4BBA A;  3LQQ A;  4QOS A;  3E21 A;  2MGW A;  3U6E A;  4MGH A;  3SC3 A;  2KXE A;  1VDD A;  2DZL A;  4DV6 M;  2XFT A;  4FCV A;  4II7 A;  2HKJ A;  4AKG A;  2C5R A;  5EXP A;  3RGP A;  4FWH A;  4I4L A;  4IBK A;  2J5Y A;  5FTJ A;  3U6L A;  3CGW A;  1GJT A;  2Y0Q A;  4IJF A;  3HU2 A;  1G4A E;  3L25 A;  1D2N A;  3ZCB B;  3J27 B;  4M0W A;  4DV3 M;  4X62 M;  2QBY B;  2DVW B;  2R46 A;  3LCU A;  4QNM A;  1GJS A;  3DZD A;  1IXZ A;  2WSF F;  4DR4 M;  4I5S A;  4WUR A;  4EIW A;  3GPY A;  3B7Z A;  2KDL A;  3M6A A;  2DKL A;  2UUA M;  3R8F A;  3HU1 A;  2N35 A;  1VQ1 A;  1IQP A;  2L6O A;  1G8P A;  3Q8X A;  4DR6 M;  3SMP A;  2FS1 A;  4LY6 A;  3VKG A;  2HWJ A;  2D7H A;  1V33 A;  3AJI B;  2Z7J A;  3J2P B;  4MGZ E;  2Y20 A;  2XF3 A;  3CTW B;  2ZTC A;  4KHP M;  2FH0 A;  4QHT A;  1C7Y A;  4MM3 B;  4P17 A;  4LJ4 A;  4LJ8 A;  3HJQ A;  3VLF B;  4AW4 A;  1YSY A;  4FWD A;  3FRH A;  2LXE A;  1HT1 E;  3L27 A;  1OQY A;  4NL4 H;  4D82 A;  4F1I A;  2F5S A;  5DFL A;  2D7G A;  2HL7 A;  3U6O A;  3VK8 A;  1IM2 A;  1G71 A;  2UXB M;  2LH0 A;  4LFC M;  2H5X A;  4PDI A;  5DYI A;  2FE8 A;  2Y21 A;  2F5O A;  2AHM A;  5EXX A;  4DUY M;  2JXN A;  4CIZ A;  4LF9 M;  5IZ7 D;  1KFV A;  2YFQ A;  2DWL A;  4QNR A;  3KDS E;  5C18 A;  4REZ A;  5ITX A;  4GRI A;  1J5E M;  1R2Z A;  1GAB A;  5EXS A;  1QYR A;  3K92 A;  5GKN A;  1IN4 A;  2EKF A;  3IG5 A;  3JAM S;  2QCU A;  4DR3 M;  3AL0 C;  8CAT A;  3RE8 A;  4LJ7 A;  1JB0 F;  1PJS A;  1WR1 B;  2K47 A;  4AZF A;  2DAI A;  4IBE A;  2DWM A;  3SFZ A;  1IFY A;  1W5S A;  1L2B A;  2CRU A;  3K8Z A;  1ZQ9 A;  2ERC A;  1VG5 A;  3L28 A;  4WW0 A;  3L29 A;  2XLJ A;  4LJA A;  3GRY A;  1YUB A;  1DGH A;  2JY7 A;  4HLQ A;  1TR8 A;  1ZMW A;  1T3T A;  4LGY A;  3QWL A;  1XXH B;  2JY8 A;  1PGY A;  2QBY A;  2DHR A;  4MGI E;  2MRO B;  1MJG M;  3H4J A;  3SHG B;  3A46 A;  4IBJ A;  1IXS B;  3GLF E;  2CV1 A;  1OFH A;  4Q7J A;  4GEW A;  1L2C A;  2UUC M;  3AOE C;  1XMQ M;  3HGI A; 
#chains in the Genus database with same CATH homology
 1R4G A;  1VEJ A;  2JUJ A;  2DHY A;  2KHH A;  1E94 E;  2OOA A;  3GLI E;  1OKS A;  1AIP C;  3BBZ A;  1OTR A;  3E21 A;  2MGW A;  2OO9 A;  1F4I A;  1WHC A;  1IXS A;  4WP2 A;  1YLA A;  1XXH E;  2DZL A;  2MJ5 B;  1DV0 A;  1HT2 E;  2JP7 A;  3IHP A;  2BWB A;  4G3O A;  4HEO A;  3B89 A;  2DNA A;  2G3Q A;  1G4A E;  1NV8 A;  2KNV A;  1HJP A;  2QSF X;  3MMP A;  1QZE A;  3LCU A;  1SG9 A;  1WJ7 A;  2CWB A;  2DKL A;  1ZV1 A;  1T43 A;  1TTE A;  1VQ1 A;  1CUK A;  2RRU A;  1NV9 A;  2DI0 A;  1VDL A;  2HWJ A;  2LVP C;  3T6P A;  2QHO B;  2JZ0 A;  3IEC A;  1G3I A;  1DO2 A;  2ZTC A;  2LBC A;  1WGL A;  2CP8 A;  1WGN A;  1C7Y A;  1UFZ A;  1V92 A;  1VEG A;  2L4F A;  3LCV B;  3GLG E;  2JZ1 A;  1P3Q Q;  3FRH A;  1HT1 E;  4DBG B;  1OQY A;  3GLH E;  2DEN A;  1T6O A;  4F1I A;  5DFL A;  2WZJ A;  2DAE A;  1A5T A;  1IM2 A;  2BWE A;  2LTU A;  3E46 A;  5JI2 E;  2H5X A;  2JY5 A;  2MR9 A;  1KYI A;  3K9O A;  1GO5 A;  1WIV A;  1BVS A;  2LVQ D;  2JNH A;  1HQY E;  2LVO C;  2KNZ A;  3FRI A;  1Q02 A;  2ZTD A;  3K9P A;  1JR3 E;  2KNA A;  2L4E A;  2EKF A;  2K9D A;  4R71 A;  3FE3 A;  2DAK A;  2HAK A;  1ZMU A;  3F92 A;  1WR1 B;  2EJS A;  2LVA A;  2DAI A;  1OAI A;  1IFY A;  2B3T A;  1EFU B;  1VG5 A;  1G41 A;  2DAM A;  2JY6 B;  2EKK A;  2QNJ A;  2JY7 A;  1TR8 A;  1ZMW A;  2L2D A;  2K0B X;  2LVN C;  2JY8 A;  1PGY A;  1MN3 A;  2MRO B;  1ZMV A;  2O25 A;  1VEK A;  3H4J A;  2OOB A;  2R0I A;  3GLF E;  1Y8G A;  4Q7J A;  4GEW A;  4UN2 B;  4F2L A;  2DAG A;  1XB2 B;  1DO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...