2KHHA

Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural requirements for the ubiquitin-associated domain of the mRNA export factor Mex67 to bind its specific targets, the transcription elongation THO complex component Hpr1 and nucleoporin FXFG repeats
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords mRNA export factor MEX67
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2khhA00
2DAIA 1G41A 2CWBA 5DFLA 1F4IA 3LCVB 4F1IA 2DNAA 3FE3A 2QHOB 2EKFA 3BBZA 1WR1B 3K9PA 3MMPA 2DKLA 1HT2E 1VG5A 3LCUA 2KNZA 1NV9A 2R0IA 1ZMWA 2EJSA 2OOAA 2L4EA 2QNJA 1P3QQ 2H5XA 2HAKA 2OO9A 1ZV1A 2KNVA 4WP2A 2DHYA 1CUKA 4UN2B 1PGYA 2JZ0A 1VDLA 2DI0A 1DO2A 2OOBA 1OQYA 2G3QA 5JI2E 2DAMA 2CP8A 1SG9A 2BWEA 3FRIA 3GLIE 1ZMUA 1OTRA 1XXHE 3GLHE 1IM2A 2WZJA 2BWBA 1V92A 1C7YA 2DAKA 1YLAA 1IFYA 2JY5A 2LVPC 1T6OA 2EKKA 3B89A 1NV8A 1VEKA 2LBCA 3K9OA 2ZTCA 1DV0A 1Q02A 2JP7A 2MGWA 2JNHA 1Y8GA 1G4AE 2LVOC 1DO0A 3H4JA 1T43A 4HEOA 4DBGB 2DAGA 1KYIA 1WHCA 2KHHA 2DENA 1TTEA 1GO5A 1WGLA 2KNAA 1WIVA 2LVQD 2RRUA 3F92A 1BVSA 1HQYE 2L4FA 3IECA 4Q7JA 1VEGA 3IHPA 2JY7A 1VEJA 3T6PA 1AIPC 2DAEA 1E94E 2K9DA 2JUJA 3E46A 2DZLA 2ZTDA 2LVNC 1WGNA 2JY8A 1A5TA 1G3IA 1TR8A 2QSFX 3GLGE 2LTUA 1ZMVA 2JY6B 4GEWA 2B3TA 1EFUB 2HWJA 1HJPA 1MN3A 2JZ1A 3E21A 1QZEA 1VQ1A 2L2DA 1WJ7A 1JR3E 1OKSA 1UFZA 4F2LA 2MJ5B 2O25A 1IXSA 2MROB 3FRHA 1OAIA 3GLFE 1HT1E 2MR9A 4R71A 1XB2B 4G3OA 2LVAA 1R4GA 2K0BX
chains in the Genus database with same CATH superfamily
2VF7A 4JI8M 3EIEA 2Y20A 3LMMA 4M9XA 5DFLA 4CIZA 4LF6M 1F4IA 4F1IA 5KQ8A 4KODA 1Z5AA 1EE8A 3IG5A 3IG8A 4LFAM 2EKFA 1E9SA 1JQJC 3HJ8A 1WR1B 3W0FA 2KEBA 4LFCM 4G4OA 4NRVA 1JR3D 2C9OA 4GRIA 2W82A 3HX3A 1R7RA 4LCBA 4LJ5A 4RF1A 3ZH9B 3GQ3A 5ITXA 1FJGM 4GMQA 3D8BA 3DOAA 1R2YA 2XSZA 1HT2E 2CEAA 3LCUA 2KNZA 4LFBM 4LJAA 3SMSA 4MH0E 3KXEC 5KPRA 4B3RM 4FW9A 2K6BA 3FD9A 4DR5M 3NBXX 1TDHA 4ZPXA 2F5QA 1QAOA 3K8ZA 3ZC7B 2R4JA 3GRVA 1CUKA 2YQZA 3FUUA 3DA1A 1Z5CA 4CGYB 2DI0A 3I51A 4JI4M 1ZAEA 1PJIA 2Y0QA 3HGIA 3FRIA 4OVZA 3T38A 3GLIE 3U5ZA 3RGSA 1IM2A 1J5EM 2BWBA 1V92A 3GLFB 1IQPA 4LJ4A 1YLAA 3UMMA 3TE6A 1HR0M 3KSJA 1TF0B 2JY5A 4MGYE 4ITQA 2M60A 2EUCA 3B89A 4DV0M 3K9OA 3AJIB 2KA6B 1OJLA 4AI6A 3UK6A 1Q02A 1YSYA 1NJFA 3U6PA 3M7GA 2HKJA 1NY5A 3M6AA 3H4JA 2LHGA 5FTKA 1NHWC 2QP9X 3T1HM 2Z7JA 1QUSA 2ZAMA 3THGA 4CJ6A 3U6QA 1XXHA 2XFTA 3H4MA 5IWAM 5A2QS 4Z8XA 2X49A 3FUTA 4DR1M 3SC3A 4DR7M 2FS1A 2JXNA 3C3EA 4AG5A 2L6OA 3F92A 1MX0A 5EXTA 4JI6M 1HQYE 4JV5M 3GLGA 5DYIA 4DR4M 3VKHA 3AOEA 4II7A 3GRUA 2CV2A 4KT0F 1QQWA 1VEJA 2DAEA 2JUJA 3Q8GA 1Z5BA 3TL4X 4W5WA 3W67A 2ZTDA 3HKPA 2DHRA 1PJSA 2LH0A 3MJ5A 4XGIA 4D80A 3U6DA 4IBKA 3U6MA 1EIJA 1A5TA 3C9PA 3E9SA 4GIPA 3VDUA 3JR5A 4GKKM 2I7PA 2M5ZA 1RU3A 2LTUA 3QYEA 4L16A 2JY6B 2CE7A 4B3MM 2CV1A 3GPPA 2CHVA 1GL7A 1VQ1A 4AKGA 2D7GA 4IBBA 2P5TA 4GHAA 2R6FA 3GRRA 1L8QA 2AHMA 2L2DA 3KOZE 4K0KM 2DWZB 4HLQA 1DGBA 3SAWA 4Z6YA 1OKSA 3GLHB 4X64M 1XC8A 5EP4A 2VQFM 4FD2A 3MK6A 4PCZA 2X4AA 1R4GA 3KP0E 4FCWA 1LV7A 3HU2A 1XNRM 4KO8A 2WSCF 1QAQA 1N78A 1IN5A 4I5SA 4MGZE 4IJEA 5DYGA 2FNAA 3SMPA 4JI7M 1HNZM 3K1JA 5ITQA 1ZQ9A 2QHOB 2J7OA 3I04M 1NY6A 3VK7A 3AOGA 3CF0A 2RGHA 3QWLA 3UJNA 3K9PA 4OW0A 2QBYA 1LTMA 2EO2A 3RGPA 4MM3B 4IBJA 1IXSB 2D7EA 3AL0C 4FWHA 5FLXS 4LGYA 2QZ4A 4M9SA 1NV9A 2LWXA 1L1TA 1J7KA 4QNMA 3GLIA 4AQYM 2OOAA 5GKNA 2L4EA 4LJ7A 5L8RF 2H5XA 1NSFA 2YFQA 4B7GA 1ZV1A 1GVNA 3C3DA 4DV7M 2KNVA 1QDTA 2XEPA 4DV3M 4R3DA 2VF8A 4UN2B 3TWMA 1GL6A 2Y0TA 2QQ8A 1DO2A 2QBYB 3B7ZA 4DR2M 3L2AA 2F5OA 2BWEA 3I01M 4M0WA 1OTRA 2RGOA 5BR8M 4LJ9A 4DV1M 3TWKA 2G8LA 2WZJA 5FTMA 3GQ5A 1XMQM 1C7YA 3KOWE 2UXCM 2DAKA 3HJSA 4IIWA 3I4YA 1R5LA 1GJTA 2L7HA 2LVPC 4M0DA 1OFHA 4JN6A 2V1UA 3FYDA 3SFZA 1L2CA 2ZTCA 2BJWA 2CHGA 2A5YB 4EIWA 1PRBA 3KDSE 4AKHA 1UM8A 4D82A 2JNHA 2YNMD 2XLJA 2LVOC 1HQCA 1DO0A 4DBGB 1T43A 1HNXM 3FTDA 4OVZB 3GPUA 1KYIA 2CUZA 3KOXE 4IJFA 1QVRA 2DWMA 4GH9A 1WHCA 5EP1A 2DXIA 4I81A 1QAMA 1TTEA 1GO5A 2NQ8C 1WGLA 3PXGA 3GRYA 1IXRC 2J5YA 3HU1A 3SARA 2K47A 4L78A 1XNQM 4TUWA 2L4FA 1IBKM 4Q7JA 1VEGA 2DVWB 3IHPA 1N77A 1IY0A 3R9XB 2JY7A 4RF0A 1IN7A 1AIPC 3J7BA 1E94E 1GLNA 1JR3A 1NHGC 1NNJA 1G71A 2KZUA 5H37D 1MU5A 5DNYA 1WXQA 1R2ZA 2ZBKB 2GNOA 2LVNC 4I4LA 4A3VB 2RKOA 3AV0A 2JY8A 1QANA 1G3IA 1TR8A 3CTWB 3KW6A 4DV6M 3PFIA 7CATA 3SAUA 4JI5M 3JAMS 4IBFA 4QHSA 3DFZA 4G4QA 1YE9A 1E9RA 5ITYA 3FUXA 1I4WA 3EIHA 2XZUA 4FWGA 1XMOM 1TH3A 1OIZA 3KS8A 2Y21A 4GKJM 1SXJD 3GO8A 2L7IA 2O01F 4DV2M 1WJ7A 4LJ6A 4RKUF 1JR3E 3ZCBB 3SYKA 4IBGA 2O25A 4DV4M 3FRHA 1OAIA 3GLFE 1DGHA 4NSRA 1SXJC 2GQFA 1XB2B 1S3SA 3J80S 2LVAA 5EXPA 5KQDA 2DAIA 4LZZA 2V6ZM 3KFUG 1G41A 2R4EA 2ZAOA 5KO3A 4GITA 3LCVB 3FUVA 1Q3BA 2QPAA 4LRSA 5EXXA 2ZANA 4LF4M 1TH4A 4MGHA 1V34A 1T3TA 1PM5A 4JXJA 1K82A 4NXMM 4YHHM 2HCBA 4B7FA 4L8RC 4LG2A 3AFHA 3FKEA 2JA2A 2YR0A 2F5NA 4IBEA 3HHXA 2DKLA 4BB9A 4G4RA 4B7HA 1XXHB 1VG5A 1OIPA 1X37A 1OFIA 2EJSA 5FSWA 3L25A 4BBAA 2QNJA 2KW0A 2HAKA 2OO9A 2R45A 4NXNM 2CV0A 1OAOC 2O5RA 4L15A 1KFVA 3CGWA 2X8AA 4B3SM 3D8LA 1IBMM 2JZ0A 4RNAA 2OOBA 5JI2E 1L2DA 1L2BA 1L1ZA 3SHGB 1SG9A 2DWNA 4D81A 2UXDM 1ZMUA 1QUTA 5LMNM 2HHHM 4B08A 2OPFA 3KOYE 3ZQJA 2H1RA 5LMUM 1PJJA 3PNYA 2XGNA 2C99A 1IFYA 4XK8F 5F3WA 4NRWA 2XH9A 3U6CA 2EKKA 3U6LA 1E32A 4LZJA 3V76A 1TH2A 2FFJA 4PT5A 3LQQA 2L09A 3SATA 4MGKE 3J2PB 3BXWA 3Q8XA 2QENA 4QOZC 2UXBM 2KZSA 2KDLA 2JP7A 2C96A 4G6ZA 1DV0A 3VLFB 3A45A 4B3TM 2F4VM 1Y8GA 4LF9M 1C1KA 4HEOA 3U60A 4WW0A 3KS4A 4NSOB 2APLA 3A42A 2KHHA 4DUZM 2DENA 3HJQA 2DZOB 4AKIA 3LW5F 5EQTA 4DR6M 2F5PA 3FTEA 3VK8A 4CHTB 3HZJA 1WIVA 2Q2EB 2LVQD 2FH0A 3SBJA 3R8FA 3IECA 4AG6A 1TGUA 1XHBA 2WSEF 3W0LB 3JR4A 3B7QA 5FTNA 3U6EA 5EP2A 3OTOM 3T6PA 4DR3M 1D0LA 3HY5A 5EJCA 3SAVA 1TDZA 3FTFA 1N36M 4Y28F 2R62A 1QDRA 3B9PA 5IREB 4CISA 5ITXE 4WURA 4REZA 2ZM6M 1N75A 3AOEC 3GLIB 1NNUC 1I94M 3GPXA 2QSFX 2BNKA 3L27A 3SHFA 1NO1A 2BJVA 1ZMVA 4LJ8A 2B3TA 4JI3M 1EFUB 1Q39A 2R44A 3K92A 3J81S 3K2LA 2UUAM 4GHLA 1MN3A 3TWLA 3E4RA 4PD2A 1QZEA 2UUBM 4OX9M 1Q3CA 3C58A 1H6UA 2FOIC 2VDBB 4LF5M 3ILKA 1J09A 1MJGM 2XF3A 3FTCA 4F2LA 2MJ5B 2J7NA 2MROB 4FWDA 1HT1E 3HHWA 4JI2M 2MR9A 2V1CA 4QHTA 4G3OA 1K3WA 4IBIA 3GPYA 1N32M 2K0BX 1NVMA 3NWLA 3HHYA 3L26A 1PJQA 2CWBA 1GABA 3TPZA 3I4VA 4DUYM 2CHQA 2DNAA 3FE3A 3UZUA 3AKZA 4AZFA 2C9CA 4GC9A 1N34M 4QOSA 1G59A 3WHKA 3BBZA 4JYAM 5KPZA 2R18A 1V33A 1SXJB 2R46A 2KRUA 3MMPA 3LQRA 3NBIA 4XBOA 1SXJE 1NJGA 1W5TA 2CRUA 3M0EA 4HL4A 2OQ4A 1AUAA 4FCVA 3U6SA 2E5LM 3T15A 2R0IA 5C1BA 1ZMWA 2Z4SA 4DV5M 1FNNA 3SASA 2XFSA 3QAUA 2JWSA 4IBDA 1P3QQ 3B7NA 1JB0F 2UU9M 1XWIA 3J7AS 3LVVA 4PDGA 1W5SA 2LNHC 5IZ7D 4WP2A 2DHYA 5E6JA 4X62M 1PGYA 5EP3A 1QYRA 2EA0A 1VDLA 1GKIA 3TQSA 1OQYA 2WSFF 2G3QA 2G5GX 5BPVA 1D0MA 5IT9S 4NC6A 2DAMA 5C18A 4X65M 2CP8A 3QYBA 3T1YM 1HNWM 5FTLA 2XSZD 3GLHE 1XXHE 1IXZA 2CFOA 3WHLA 1KSFX 2ERCA 2LXEA 2D7HA 5EXSA 4BLCA 3PNVA 2C98A 4KHPM 1D2NA 1T6OA 4ANRA 1N33M 1IY1A 1NV8A 1VEKA 2LBCA 4L4UA 3U6OA 2C5RA 3GLGB 4IBCA 3J27B 1GJSA 4G4NA 4FCTA 2KXEA 4NL4H 2MGWA 2MH8A 2Z8YM 3U61B 3GLHA 4QNRA 1G4AE 4M9ZA 3UGJA 3VKGA 4LGMA 2DAGA 2Z4RA 3PVSA 1D0KA 4I8OA 2XZFA 3HHZA 4X66M 3VDPA 5E26A 1IBLM 5FTJA 3B74A 2N35A 4JI0M 2VIIA 3RE8A 2KNAA 4YY3M 2Z3XA 4JI1M 2DZNB 2RRUA 2VQEM 8CATA 1BVSA 5KPTA 1IN6A 1ORYB 1DGGA 3L29A 4PDIA 5ITRA 1QZMA 3W68A 4MB7A 4LF7M 4MGIE 3FYCA 3MHVC 1Z6TA 5ITUA 5JI3E 1K3XA 3U61A 3LVWA 2K9DA 3BOSA 1VDDA 3HWSA 1IN4A 4NOOB 3RFWA 3DZDA 2DZLA 3E46A 4LRTA 3U60B 2KRKA 3GQ4A 1WGNA 1DGHB 4GC5A 3KP1E 2HL7A 1PJTA 3SYLA 2QCUA 3A98B 3FUWA 1YUBA 3L28A 1IN8A 3KVWA 4AW4A 4FVMA 3GLFA 3GLGE 1G8PA 1IY2A 4LY6A 3GP1A 2FE8A 4GEWA 4P16A 3KSXA 2HWJA 1HJPA 2I7NA 4S12A 2LHCA 2JZ1A 3E21A 2F5SA 3CF2A 3A46A 3CF6E 2R65A 1SXJA 4P17A 1UFZA 1DGFA 1Z59A 5ITTA 3U5ZB 2DWLA 1IXSA 4OU7A 4L6V6 1R6BX 2UUCM 3VFDA 4R7GA 4R71A 4LF8M 3HU3A 4KLNA
chains in the Genus database with same CATH topology
2DAIA 1G41A 2CWBA 5DFLA 1F4IA 3LCVB 4F1IA 2DNAA 3FE3A 2QHOB 2EKFA 3BBZA 1WR1B 3K9PA 3MMPA 2DKLA 1HT2E 1VG5A 3LCUA 2KNZA 1NV9A 2R0IA 1ZMWA 2EJSA 2OOAA 2L4EA 2QNJA 1P3QQ 2H5XA 2HAKA 2OO9A 1ZV1A 2KNVA 4WP2A 2DHYA 1CUKA 4UN2B 1PGYA 2JZ0A 1VDLA 2DI0A 1DO2A 2OOBA 1OQYA 2G3QA 5JI2E 2DAMA 2CP8A 1SG9A 2BWEA 3FRIA 3GLIE 1ZMUA 1OTRA 1XXHE 3GLHE 1IM2A 2WZJA 2BWBA 1V92A 1C7YA 2DAKA 1YLAA 1IFYA 2JY5A 2LVPC 1T6OA 2EKKA 3B89A 1NV8A 1VEKA 2LBCA 3K9OA 2ZTCA 1DV0A 1Q02A 2JP7A 2MGWA 2JNHA 1Y8GA 1G4AE 2LVOC 1DO0A 3H4JA 1T43A 4HEOA 4DBGB 2DAGA 1KYIA 1WHCA 2KHHA 2DENA 1TTEA 1GO5A 1WGLA 2KNAA 1WIVA 2LVQD 2RRUA 3F92A 1BVSA 1HQYE 2L4FA 3IECA 4Q7JA 1VEGA 3IHPA 2JY7A 1VEJA 3T6PA 1AIPC 2DAEA 1E94E 2K9DA 2JUJA 3E46A 2DZLA 2ZTDA 2LVNC 1WGNA 2JY8A 1A5TA 1G3IA 1TR8A 2QSFX 3GLGE 2LTUA 1ZMVA 2JY6B 4GEWA 2B3TA 1EFUB 2HWJA 1HJPA 1MN3A 2JZ1A 3E21A 1QZEA 1VQ1A 2L2DA 1WJ7A 1JR3E 1OKSA 1UFZA 4F2LA 2MJ5B 2O25A 1IXSA 2MROB 3FRHA 1OAIA 3GLFE 1HT1E 2MR9A 4R71A 1XB2B 4G3OA 2LVAA 1R4GA 2K0BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAI A;  1G41 A;  2CWB A;  5DFL A;  1F4I A;  3LCV B;  4F1I A;  2DNA A;  3FE3 A;  2QHO B;  2EKF A;  3BBZ A;  1WR1 B;  3K9P A;  3MMP A;  2DKL A;  1HT2 E;  1VG5 A;  3LCU A;  2KNZ A;  1NV9 A;  2R0I A;  1ZMW A;  2EJS A;  2OOA A;  2L4E A;  2QNJ A;  1P3Q Q;  2H5X A;  2HAK A;  2OO9 A;  1ZV1 A;  2KNV A;  4WP2 A;  2DHY A;  1CUK A;  4UN2 B;  1PGY A;  2JZ0 A;  1VDL A;  2DI0 A;  1DO2 A;  2OOB A;  1OQY A;  2G3Q A;  5JI2 E;  2DAM A;  2CP8 A;  1SG9 A;  2BWE A;  3FRI A;  3GLI E;  1ZMU A;  1OTR A;  1XXH E;  3GLH E;  1IM2 A;  2WZJ A;  2BWB A;  1V92 A;  1C7Y A;  2DAK A;  1YLA A;  1IFY A;  2JY5 A;  2LVP C;  1T6O A;  2EKK A;  3B89 A;  1NV8 A;  1VEK A;  2LBC A;  3K9O A;  2ZTC A;  1DV0 A;  1Q02 A;  2JP7 A;  2MGW A;  2JNH A;  1Y8G A;  1G4A E;  2LVO C;  1DO0 A;  3H4J A;  1T43 A;  4HEO A;  4DBG B;  2DAG A;  1KYI A;  1WHC A;  2KHH A;  2DEN A;  1TTE A;  1GO5 A;  1WGL A;  2KNA A;  1WIV A;  2LVQ D;  2RRU A;  3F92 A;  1BVS A;  1HQY E;  2L4F A;  3IEC A;  4Q7J A;  1VEG A;  3IHP A;  2JY7 A;  1VEJ A;  3T6P A;  1AIP C;  2DAE A;  1E94 E;  2K9D A;  2JUJ A;  3E46 A;  2DZL A;  2ZTD A;  2LVN C;  1WGN A;  2JY8 A;  1A5T A;  1G3I A;  1TR8 A;  2QSF X;  3GLG E;  2LTU A;  1ZMV A;  2JY6 B;  4GEW A;  2B3T A;  1EFU B;  2HWJ A;  1HJP A;  1MN3 A;  2JZ1 A;  3E21 A;  1QZE A;  1VQ1 A;  2L2D A;  1WJ7 A;  1JR3 E;  1OKS A;  1UFZ A;  4F2L A;  2MJ5 B;  2O25 A;  1IXS A;  2MRO B;  3FRH A;  1OAI A;  3GLF E;  1HT1 E;  2MR9 A;  4R71 A;  1XB2 B;  4G3O A;  2LVA A;  1R4G A;  2K0B X; 
#chains in the Genus database with same CATH topology
 2VF7 A;  4JI8 M;  3EIE A;  2Y20 A;  3LMM A;  4M9X A;  5DFL A;  4CIZ A;  4LF6 M;  1F4I A;  4F1I A;  5KQ8 A;  4KOD A;  1Z5A A;  1EE8 A;  3IG5 A;  3IG8 A;  4LFA M;  2EKF A;  1E9S A;  1JQJ C;  3HJ8 A;  1WR1 B;  3W0F A;  2KEB A;  4LFC M;  4G4O A;  4NRV A;  1JR3 D;  2C9O A;  4GRI A;  2W82 A;  3HX3 A;  1R7R A;  4LCB A;  4LJ5 A;  4RF1 A;  3ZH9 B;  3GQ3 A;  5ITX A;  1FJG M;  4GMQ A;  3D8B A;  3DOA A;  1R2Y A;  2XSZ A;  1HT2 E;  2CEA A;  3LCU A;  2KNZ A;  4LFB M;  4LJA A;  3SMS A;  4MH0 E;  3KXE C;  5KPR A;  4B3R M;  4FW9 A;  2K6B A;  3FD9 A;  4DR5 M;  3NBX X;  1TDH A;  4ZPX A;  2F5Q A;  1QAO A;  3K8Z A;  3ZC7 B;  2R4J A;  3GRV A;  1CUK A;  2YQZ A;  3FUU A;  3DA1 A;  1Z5C A;  4CGY B;  2DI0 A;  3I51 A;  4JI4 M;  1ZAE A;  1PJI A;  2Y0Q A;  3HGI A;  3FRI A;  4OVZ A;  3T38 A;  3GLI E;  3U5Z A;  3RGS A;  1IM2 A;  1J5E M;  2BWB A;  1V92 A;  3GLF B;  1IQP A;  4LJ4 A;  1YLA A;  3UMM A;  3TE6 A;  1HR0 M;  3KSJ A;  1TF0 B;  2JY5 A;  4MGY E;  4ITQ A;  2M60 A;  2EUC A;  3B89 A;  4DV0 M;  3K9O A;  3AJI B;  2KA6 B;  1OJL A;  4AI6 A;  3UK6 A;  1Q02 A;  1YSY A;  1NJF A;  3U6P A;  3M7G A;  2HKJ A;  1NY5 A;  3M6A A;  3H4J A;  2LHG A;  5FTK A;  1NHW C;  2QP9 X;  3T1H M;  2Z7J A;  1QUS A;  2ZAM A;  3THG A;  4CJ6 A;  3U6Q A;  1XXH A;  2XFT A;  3H4M A;  5IWA M;  5A2Q S;  4Z8X A;  2X49 A;  3FUT A;  4DR1 M;  3SC3 A;  4DR7 M;  2FS1 A;  2JXN A;  3C3E A;  4AG5 A;  2L6O A;  3F92 A;  1MX0 A;  5EXT A;  4JI6 M;  1HQY E;  4JV5 M;  3GLG A;  5DYI A;  4DR4 M;  3VKH A;  3AOE A;  4II7 A;  3GRU A;  2CV2 A;  4KT0 F;  1QQW A;  1VEJ A;  2DAE A;  2JUJ A;  3Q8G A;  1Z5B A;  3TL4 X;  4W5W A;  3W67 A;  2ZTD A;  3HKP A;  2DHR A;  1PJS A;  2LH0 A;  3MJ5 A;  4XGI A;  4D80 A;  3U6D A;  4IBK A;  3U6M A;  1EIJ A;  1A5T A;  3C9P A;  3E9S A;  4GIP A;  3VDU A;  3JR5 A;  4GKK M;  2I7P A;  2M5Z A;  1RU3 A;  2LTU A;  3QYE A;  4L16 A;  2JY6 B;  2CE7 A;  4B3M M;  2CV1 A;  3GPP A;  2CHV A;  1GL7 A;  1VQ1 A;  4AKG A;  2D7G A;  4IBB A;  2P5T A;  4GHA A;  2R6F A;  3GRR A;  1L8Q A;  2AHM A;  2L2D A;  3KOZ E;  4K0K M;  2DWZ B;  4HLQ A;  1DGB A;  3SAW A;  4Z6Y A;  1OKS A;  3GLH B;  4X64 M;  1XC8 A;  5EP4 A;  2VQF M;  4FD2 A;  3MK6 A;  4PCZ A;  2X4A A;  1R4G A;  3KP0 E;  4FCW A;  1LV7 A;  3HU2 A;  1XNR M;  4KO8 A;  2WSC F;  1QAQ A;  1N78 A;  1IN5 A;  4I5S A;  4MGZ E;  4IJE A;  5DYG A;  2FNA A;  3SMP A;  4JI7 M;  1HNZ M;  3K1J A;  5ITQ A;  1ZQ9 A;  2QHO B;  2J7O A;  3I04 M;  1NY6 A;  3VK7 A;  3AOG A;  3CF0 A;  2RGH A;  3QWL A;  3UJN A;  3K9P A;  4OW0 A;  2QBY A;  1LTM A;  2EO2 A;  3RGP A;  4MM3 B;  4IBJ A;  1IXS B;  2D7E A;  3AL0 C;  4FWH A;  5FLX S;  4LGY A;  2QZ4 A;  4M9S A;  1NV9 A;  2LWX A;  1L1T A;  1J7K A;  4QNM A;  3GLI A;  4AQY M;  2OOA A;  5GKN A;  2L4E A;  4LJ7 A;  5L8R F;  2H5X A;  1NSF A;  2YFQ A;  4B7G A;  1ZV1 A;  1GVN A;  3C3D A;  4DV7 M;  2KNV A;  1QDT A;  2XEP A;  4DV3 M;  4R3D A;  2VF8 A;  4UN2 B;  3TWM A;  1GL6 A;  2Y0T A;  2QQ8 A;  1DO2 A;  2QBY B;  3B7Z A;  4DR2 M;  3L2A A;  2F5O A;  2BWE A;  3I01 M;  4M0W A;  1OTR A;  2RGO A;  5BR8 M;  4LJ9 A;  4DV1 M;  3TWK A;  2G8L A;  2WZJ A;  5FTM A;  3GQ5 A;  1XMQ M;  1C7Y A;  3KOW E;  2UXC M;  2DAK A;  3HJS A;  4IIW A;  3I4Y A;  1R5L A;  1GJT A;  2L7H A;  2LVP C;  4M0D A;  1OFH A;  4JN6 A;  2V1U A;  3FYD A;  3SFZ A;  1L2C A;  2ZTC A;  2BJW A;  2CHG A;  2A5Y B;  4EIW A;  1PRB A;  3KDS E;  4AKH A;  1UM8 A;  4D82 A;  2JNH A;  2YNM D;  2XLJ A;  2LVO C;  1HQC A;  1DO0 A;  4DBG B;  1T43 A;  1HNX M;  3FTD A;  4OVZ B;  3GPU A;  1KYI A;  2CUZ A;  3KOX E;  4IJF A;  1QVR A;  2DWM A;  4GH9 A;  1WHC A;  5EP1 A;  2DXI A;  4I81 A;  1QAM A;  1TTE A;  1GO5 A;  2NQ8 C;  1WGL A;  3PXG A;  3GRY A;  1IXR C;  2J5Y A;  3HU1 A;  3SAR A;  2K47 A;  4L78 A;  1XNQ M;  4TUW A;  2L4F A;  1IBK M;  4Q7J A;  1VEG A;  2DVW B;  3IHP A;  1N77 A;  1IY0 A;  3R9X B;  2JY7 A;  4RF0 A;  1IN7 A;  1AIP C;  3J7B A;  1E94 E;  1GLN A;  1JR3 A;  1NHG C;  1NNJ A;  1G71 A;  2KZU A;  5H37 D;  1MU5 A;  5DNY A;  1WXQ A;  1R2Z A;  2ZBK B;  2GNO A;  2LVN C;  4I4L A;  4A3V B;  2RKO A;  3AV0 A;  2JY8 A;  1QAN A;  1G3I A;  1TR8 A;  3CTW B;  3KW6 A;  4DV6 M;  3PFI A;  7CAT A;  3SAU A;  4JI5 M;  3JAM S;  4IBF A;  4QHS A;  3DFZ A;  4G4Q A;  1YE9 A;  1E9R A;  5ITY A;  3FUX A;  1I4W A;  3EIH A;  2XZU A;  4FWG A;  1XMO M;  1TH3 A;  1OIZ A;  3KS8 A;  2Y21 A;  4GKJ M;  1SXJ D;  3GO8 A;  2L7I A;  2O01 F;  4DV2 M;  1WJ7 A;  4LJ6 A;  4RKU F;  1JR3 E;  3ZCB B;  3SYK A;  4IBG A;  2O25 A;  4DV4 M;  3FRH A;  1OAI A;  3GLF E;  1DGH A;  4NSR A;  1SXJ C;  2GQF A;  1XB2 B;  1S3S A;  3J80 S;  2LVA A;  5EXP A;  5KQD A;  2DAI A;  4LZZ A;  2V6Z M;  3KFU G;  1G41 A;  2R4E A;  2ZAO A;  5KO3 A;  4GIT A;  3LCV B;  3FUV A;  1Q3B A;  2QPA A;  4LRS A;  5EXX A;  2ZAN A;  4LF4 M;  1TH4 A;  4MGH A;  1V34 A;  1T3T A;  1PM5 A;  4JXJ A;  1K82 A;  4NXM M;  4YHH M;  2HCB A;  4B7F A;  4L8R C;  4LG2 A;  3AFH A;  3FKE A;  2JA2 A;  2YR0 A;  2F5N A;  4IBE A;  3HHX A;  2DKL A;  4BB9 A;  4G4R A;  4B7H A;  1XXH B;  1VG5 A;  1OIP A;  1X37 A;  1OFI A;  2EJS A;  5FSW A;  3L25 A;  4BBA A;  2QNJ A;  2KW0 A;  2HAK A;  2OO9 A;  2R45 A;  4NXN M;  2CV0 A;  1OAO C;  2O5R A;  4L15 A;  1KFV A;  3CGW A;  2X8A A;  4B3S M;  3D8L A;  1IBM M;  2JZ0 A;  4RNA A;  2OOB A;  5JI2 E;  1L2D A;  1L2B A;  1L1Z A;  3SHG B;  1SG9 A;  2DWN A;  4D81 A;  2UXD M;  1ZMU A;  1QUT A;  5LMN M;  2HHH M;  4B08 A;  2OPF A;  3KOY E;  3ZQJ A;  2H1R A;  5LMU M;  1PJJ A;  3PNY A;  2XGN A;  2C99 A;  1IFY A;  4XK8 F;  5F3W A;  4NRW A;  2XH9 A;  3U6C A;  2EKK A;  3U6L A;  1E32 A;  4LZJ A;  3V76 A;  1TH2 A;  2FFJ A;  4PT5 A;  3LQQ A;  2L09 A;  3SAT A;  4MGK E;  3J2P B;  3BXW A;  3Q8X A;  2QEN A;  4QOZ C;  2UXB M;  2KZS A;  2KDL A;  2JP7 A;  2C96 A;  4G6Z A;  1DV0 A;  3VLF B;  3A45 A;  4B3T M;  2F4V M;  1Y8G A;  4LF9 M;  1C1K A;  4HEO A;  3U60 A;  4WW0 A;  3KS4 A;  4NSO B;  2APL A;  3A42 A;  2KHH A;  4DUZ M;  2DEN A;  3HJQ A;  2DZO B;  4AKI A;  3LW5 F;  5EQT A;  4DR6 M;  2F5P A;  3FTE A;  3VK8 A;  4CHT B;  3HZJ A;  1WIV A;  2Q2E B;  2LVQ D;  2FH0 A;  3SBJ A;  3R8F A;  3IEC A;  4AG6 A;  1TGU A;  1XHB A;  2WSE F;  3W0L B;  3JR4 A;  3B7Q A;  5FTN A;  3U6E A;  5EP2 A;  3OTO M;  3T6P A;  4DR3 M;  1D0L A;  3HY5 A;  5EJC A;  3SAV A;  1TDZ A;  3FTF A;  1N36 M;  4Y28 F;  2R62 A;  1QDR A;  3B9P A;  5IRE B;  4CIS A;  5ITX E;  4WUR A;  4REZ A;  2ZM6 M;  1N75 A;  3AOE C;  3GLI B;  1NNU C;  1I94 M;  3GPX A;  2QSF X;  2BNK A;  3L27 A;  3SHF A;  1NO1 A;  2BJV A;  1ZMV A;  4LJ8 A;  2B3T A;  4JI3 M;  1EFU B;  1Q39 A;  2R44 A;  3K92 A;  3J81 S;  3K2L A;  2UUA M;  4GHL A;  1MN3 A;  3TWL A;  3E4R A;  4PD2 A;  1QZE A;  2UUB M;  4OX9 M;  1Q3C A;  3C58 A;  1H6U A;  2FOI C;  2VDB B;  4LF5 M;  3ILK A;  1J09 A;  1MJG M;  2XF3 A;  3FTC A;  4F2L A;  2MJ5 B;  2J7N A;  2MRO B;  4FWD A;  1HT1 E;  3HHW A;  4JI2 M;  2MR9 A;  2V1C A;  4QHT A;  4G3O A;  1K3W A;  4IBI A;  3GPY A;  1N32 M;  2K0B X;  1NVM A;  3NWL A;  3HHY A;  3L26 A;  1PJQ A;  2CWB A;  1GAB A;  3TPZ A;  3I4V A;  4DUY M;  2CHQ A;  2DNA A;  3FE3 A;  3UZU A;  3AKZ A;  4AZF A;  2C9C A;  4GC9 A;  1N34 M;  4QOS A;  1G59 A;  3WHK A;  3BBZ A;  4JYA M;  5KPZ A;  2R18 A;  1V33 A;  1SXJ B;  2R46 A;  2KRU A;  3MMP A;  3LQR A;  3NBI A;  4XBO A;  1SXJ E;  1NJG A;  1W5T A;  2CRU A;  3M0E A;  4HL4 A;  2OQ4 A;  1AUA A;  4FCV A;  3U6S A;  2E5L M;  3T15 A;  2R0I A;  5C1B A;  1ZMW A;  2Z4S A;  4DV5 M;  1FNN A;  3SAS A;  2XFS A;  3QAU A;  2JWS A;  4IBD A;  1P3Q Q;  3B7N A;  1JB0 F;  2UU9 M;  1XWI A;  3J7A S;  3LVV A;  4PDG A;  1W5S A;  2LNH C;  5IZ7 D;  4WP2 A;  2DHY A;  5E6J A;  4X62 M;  1PGY A;  5EP3 A;  1QYR A;  2EA0 A;  1VDL A;  1GKI A;  3TQS A;  1OQY A;  2WSF F;  2G3Q A;  2G5G X;  5BPV A;  1D0M A;  5IT9 S;  4NC6 A;  2DAM A;  5C18 A;  4X65 M;  2CP8 A;  3QYB A;  3T1Y M;  1HNW M;  5FTL A;  2XSZ D;  3GLH E;  1XXH E;  1IXZ A;  2CFO A;  3WHL A;  1KSF X;  2ERC A;  2LXE A;  2D7H A;  5EXS A;  4BLC A;  3PNV A;  2C98 A;  4KHP M;  1D2N A;  1T6O A;  4ANR A;  1N33 M;  1IY1 A;  1NV8 A;  1VEK A;  2LBC A;  4L4U A;  3U6O A;  2C5R A;  3GLG B;  4IBC A;  3J27 B;  1GJS A;  4G4N A;  4FCT A;  2KXE A;  4NL4 H;  2MGW A;  2MH8 A;  2Z8Y M;  3U61 B;  3GLH A;  4QNR A;  1G4A E;  4M9Z A;  3UGJ A;  3VKG A;  4LGM A;  2DAG A;  2Z4R A;  3PVS A;  1D0K A;  4I8O A;  2XZF A;  3HHZ A;  4X66 M;  3VDP A;  5E26 A;  1IBL M;  5FTJ A;  3B74 A;  2N35 A;  4JI0 M;  2VII A;  3RE8 A;  2KNA A;  4YY3 M;  2Z3X A;  4JI1 M;  2DZN B;  2RRU A;  2VQE M;  8CAT A;  1BVS A;  5KPT A;  1IN6 A;  1ORY B;  1DGG A;  3L29 A;  4PDI A;  5ITR A;  1QZM A;  3W68 A;  4MB7 A;  4LF7 M;  4MGI E;  3FYC A;  3MHV C;  1Z6T A;  5ITU A;  5JI3 E;  1K3X A;  3U61 A;  3LVW A;  2K9D A;  3BOS A;  1VDD A;  3HWS A;  1IN4 A;  4NOO B;  3RFW A;  3DZD A;  2DZL A;  3E46 A;  4LRT A;  3U60 B;  2KRK A;  3GQ4 A;  1WGN A;  1DGH B;  4GC5 A;  3KP1 E;  2HL7 A;  1PJT A;  3SYL A;  2QCU A;  3A98 B;  3FUW A;  1YUB A;  3L28 A;  1IN8 A;  3KVW A;  4AW4 A;  4FVM A;  3GLF A;  3GLG E;  1G8P A;  1IY2 A;  4LY6 A;  3GP1 A;  2FE8 A;  4GEW A;  4P16 A;  3KSX A;  2HWJ A;  1HJP A;  2I7N A;  4S12 A;  2LHC A;  2JZ1 A;  3E21 A;  2F5S A;  3CF2 A;  3A46 A;  3CF6 E;  2R65 A;  1SXJ A;  4P17 A;  1UFZ A;  1DGF A;  1Z59 A;  5ITT A;  3U5Z B;  2DWL A;  1IXS A;  4OU7 A;  4L6V 6;  1R6B X;  2UUC M;  3VFD A;  4R7G A;  4R71 A;  4LF8 M;  3HU3 A;  4KLN A; 
#chains in the Genus database with same CATH homology
 2DAI A;  1G41 A;  2CWB A;  5DFL A;  1F4I A;  3LCV B;  4F1I A;  2DNA A;  3FE3 A;  2QHO B;  2EKF A;  3BBZ A;  1WR1 B;  3K9P A;  3MMP A;  2DKL A;  1HT2 E;  1VG5 A;  3LCU A;  2KNZ A;  1NV9 A;  2R0I A;  1ZMW A;  2EJS A;  2OOA A;  2L4E A;  2QNJ A;  1P3Q Q;  2H5X A;  2HAK A;  2OO9 A;  1ZV1 A;  2KNV A;  4WP2 A;  2DHY A;  1CUK A;  4UN2 B;  1PGY A;  2JZ0 A;  1VDL A;  2DI0 A;  1DO2 A;  2OOB A;  1OQY A;  2G3Q A;  5JI2 E;  2DAM A;  2CP8 A;  1SG9 A;  2BWE A;  3FRI A;  3GLI E;  1ZMU A;  1OTR A;  1XXH E;  3GLH E;  1IM2 A;  2WZJ A;  2BWB A;  1V92 A;  1C7Y A;  2DAK A;  1YLA A;  1IFY A;  2JY5 A;  2LVP C;  1T6O A;  2EKK A;  3B89 A;  1NV8 A;  1VEK A;  2LBC A;  3K9O A;  2ZTC A;  1DV0 A;  1Q02 A;  2JP7 A;  2MGW A;  2JNH A;  1Y8G A;  1G4A E;  2LVO C;  1DO0 A;  3H4J A;  1T43 A;  4HEO A;  4DBG B;  2DAG A;  1KYI A;  1WHC A;  2KHH A;  2DEN A;  1TTE A;  1GO5 A;  1WGL A;  2KNA A;  1WIV A;  2LVQ D;  2RRU A;  3F92 A;  1BVS A;  1HQY E;  2L4F A;  3IEC A;  4Q7J A;  1VEG A;  3IHP A;  2JY7 A;  1VEJ A;  3T6P A;  1AIP C;  2DAE A;  1E94 E;  2K9D A;  2JUJ A;  3E46 A;  2DZL A;  2ZTD A;  2LVN C;  1WGN A;  2JY8 A;  1A5T A;  1G3I A;  1TR8 A;  2QSF X;  3GLG E;  2LTU A;  1ZMV A;  2JY6 B;  4GEW A;  2B3T A;  1EFU B;  2HWJ A;  1HJP A;  1MN3 A;  2JZ1 A;  3E21 A;  1QZE A;  1VQ1 A;  2L2D A;  1WJ7 A;  1JR3 E;  1OKS A;  1UFZ A;  4F2L A;  2MJ5 B;  2O25 A;  1IXS A;  2MRO B;  3FRH A;  1OAI A;  3GLF E;  1HT1 E;  2MR9 A;  4R71 A;  1XB2 B;  4G3O A;  2LVA A;  1R4G A;  2K0B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...