2KHHA

Structural requirements for the uba domain of the mrna export factor mex67 to bind its specific targets, the transcription elongation tho complex component hpr1 and nucleoporin fxfg repeats
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords mRNA export factor MEX67
publication title Structural requirements for the ubiquitin-associated domain of the mRNA export factor Mex67 to bind its specific targets, the transcription elongation THO complex component Hpr1 and nucleoporin FXFG repeats
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2khhA00
2RRUA 3FRHA 1HQYE 4UN2B 1HT2E 3B89A 3FRIA 1OTRA 1WIVA 1CUKA 1IM2A 2HAKA 4WP2A 2JZ1A 1Q02A 1G3IA 2MR9A 2CP8A 4GEWA 2ZTDA 1QZEA 1XXHE 2QNJA 3E21A 3IECA 2BWEA 2JP7A 2QHOB 2KNAA 1G41A 2LBCA 3H4JA 1SG9A 2MJ5B 1NV9A 3LCVB 2LVNC 2ZTCA 1XB2B 1VQ1A 2DENA 2JY5A 2K0BX 1HJPA 1VDLA 2LTUA 1ZV1A 4G3OA 1V92A 2LVPC 1IXSA 1OQYA 2KNZA 2EKFA 1TR8A 2JUJA 2CWBA 3IHPA 1DO0A 2KHHA 2EJSA 1ZMVA 2DAKA 1KYIA 2DNAA 1OKSA 1UFZA 1IFYA 3GLFE 1Y8GA 3BBZA 3MMPA 2G3QA 1DO2A 2DAEA 2JZ0A 2JY6B 3FE3A 1MN3A 2O25A 2L2DA 3K9PA 3GLGE 1E94E 1JR3E 1WGNA 1WR1B 2DI0A 2HWJA 2MROB 1VEJA 4DBGB 2H5XA 3LCUA 3E46A 4HEOA 3T6PA 3GLIE 2QSFX 2EKKA 4Q7JA 1R4GA 4F1IA 1VEKA 2L4FA 2DKLA 3K9OA 2JY7A 1AIPC 1G4AE 1WGLA 2LVQD 2OO9A 4R71A 2B3TA 2OOAA 1VEGA 2JNHA 1C7YA 3F92A 1EFUB 1BVSA 2DAGA 5JI2E 1OAIA 2DHYA 2OOBA 1NV8A 2LVOC 2DAIA 2MGWA 3GLHE 5DFLA 2K9DA 1DV0A 2DAMA 4F2LA 2DZLA 1A5TA 1ZMWA 1GO5A 1WHCA 1T6OA 2L4EA 1TTEA 1YLAA 1T43A 2JY8A 2KNVA 2WZJA 1P3QQ 1VG5A 1WJ7A 2LVAA 1PGYA 1ZMUA 2R0IA 1F4IA 1HT1E 2BWBA
chains in the Genus database with same CATH superfamily
4NC6A 5FTKA 1GKIA 1YUBA 3L28A 4BBAA 2UXCM 3GLGA 3FRIA 2DWZB 5FTJA 4X62M 1IY0A 2VDBB 1CUKA 3HY5A 1IM2A 3GQ4A 3U6QA 2XZFA 2D7GA 4PDIA 2BJWA 5ITTA 1L2CA 3GPYA 3SASA 2ZTDA 2K47A 1QZEA 2EO2A 4DR3M 3U6CA 4LG2A 1XXHE 3THGA 1GABA 3E21A 3IECA 2G8LA 4IBDA 4LY6A 4DUYM 3H4JA 1G41A 1PRBA 3AL0C 1NV9A 4GITA 2XFSA 4BB9A 4LFCM 4NRVA 4LJ8A 4Z8XA 1VQ1A 4DV6M 2K0BX 3R8FA 2UUBM 4B3MM 3FTEA 2UUAM 4REZA 3AJIB 5KQDA 1K82A 1V92A 2KZSA 1V34A 3LVVA 1Q3CA 2XZUA 4K0KM 1N34M 4AI6A 3LQRA 2JUJA 2CWBA 4RKUF 3GLHB 4B3SM 2ZBKB 2JWSA 2C5RA 3U61B 3PFIA 4GC5A 5KQ8A 2DWLA 4R3DA 2KHHA 5FTNA 3ZC7B 1PJJA 2WSEF 4AW4A 3AKZA 2MH8A 1ZMVA 1NJFA 1OIZA 2L7HA 2F5QA 3U60B 1EIJA 3UMMA 3GO8A 1I94M 1KSFX 3C58A 2DXIA 3KS8A 4YHHM 2X4AA 1IN5A 2W82A 1Y8GA 5ITUA 3UZUA 1QDTA 1SXJB 5GKNA 2XEPA 1Z5CA 3QAUA 3CF2A 2CHVA 4JXJA 3U5ZA 3KOZE 1X37A 2C99A 2O25A 3AV0A 3GPXA 4JI1M 2L2DA 3KSJA 4JYAM 2GQFA 3GLGE 3K8ZA 4FCTA 4OVZB 1E9SA 3QYEA 2F4VM 1L8QA 1XWIA 1S3SA 1QVRA 3RFWA 4L4UA 4M9SA 4DBGB 5FSWA 3T6PA 1RU3A 3E46A 3SMPA 3HHYA 4DV1M 2QSFX 2EKKA 1JQJC 4JI4M 2AHMA 2DHRA 4NSRA 3VDPA 2N35A 4PCZA 1HNWM 1N78A 1KFVA 8CATA 3I4YA 2VIIA 4IJEA 4JI2M 3VDUA 1WGLA 4FCWA 4QNRA 3T15A 4OU7A 2VQFM 4ZPXA 1VEGA 1GLNA 1TH4A 3FYCA 3FTFA 2EUCA 3F92A 4MGHA 5JI2E 2LHGA 2OOBA 3IG8A 1NV8A 3NWLA 3ILKA 4JI7M 5DFLA 4S12A 3TL4X 1I4WA 4GHLA 1MX0A 2LWXA 4M0WA 2FE8A 3BOSA 2UU9M 2I7NA 2R18A 2CV0A 2DWNA 4RNAA 3Q8GA 1QQWA 3TWLA 3SAWA 3A45A 2FH0A 1D0LA 3HGIA 3MK6A 2D7HA 1T6OA 2R4EA 5LMNM 1YLAA 3MJ5A 1T43A 5DNYA 2KNVA 3L29A 3CF0A 2C98A 3GLFA 1T3TA 1NNJA 1WJ7A 4DR7M 4AZFA 1PGYA 1ZMUA 4LGMA 1IXSB 4FVMA 2QPAA 1F4IA 2H1RA 2BWBA 3FRHA 2F5OA 3SARA 1DGBA 4R7GA 5EXXA 4B7GA 4DV7M 2X49A 3KXEC 3AOGA 3GQ3A 4QHTA 1HNXM 3SFZA 4RF1A 4I81A 4LCBA 2HAKA 5F3WA 3ZH9B 5IWAM 4LF8M 2MR9A 3GRYA 3GLIA 1R2ZA 2ZM6M 4DR4M 2V1UA 4JI5M 2UXDM 1W5TA 2YFQA 4NSOB 5EXSA 2BWEA 5ITXA 4JI8M 3SAVA 2R65A 2LBCA 2QQ8A 2CE7A 2Z4RA 1Z6TA 4GC9A 1NNUC 1Z59A 3H4MA 2ZANA 2ZTCA 4X66M 1AUAA 4X65M 3SBJA 4QNMA 2M60A 1G71A 1HJPA 4XGIA 2KXEA 1VDLA 3EIHA 4NOOB 1OJLA 4G3OA 4HLQA 3WHLA 1DGHA 2QP9X 3K2LA 4KODA 5KO3A 3HHZA 2EKFA 3SC3A 4LJ6A 3U6SA 4MGKE 4CIZA 4YY3M 2QBYA 4LFBM 2V6ZM 1QANA 2LHCA 3K1JA 1FNNA 2CV1A 1D2NA 4LJ9A 1OKSA 1XXHB 1UFZA 2DZNB 2GNOA 2JA2A 4XK8F 4CGYB 4IBBA 3GLFE 3HHXA 1JB0F 1SXJA 3PNYA 3J7BA 4KLNA 5FTLA 3M7GA 3T38A 2DAEA 1ORYB 2JZ0A 4I8OA 4NXNM 1N36M 3K9PA 5EQTA 1TDZA 1QAOA 4LJ4A 3L25A 2DI0A 4G4OA 2HWJA 4P16A 2ZAOA 1VEJA 3TWMA 4L15A 1MU5A 2H5XA 3GLIE 2FOIC 2Y21A 4B7FA 1R4GA 3HJ8A 4L6V6 5ITXE 1XMQM 1IBLM 1R6BX 4M9XA 2UUCM 1V33A 1VEKA 1D0MA 4WW0A 4LFAM 4ANRA 5E6JA 1E9RA 2X8AA 2Z8YM 3E4RA 2JY7A 3HJQA 1NSFA 1QUSA 2VF8A 2QZ4A 4DR6M 2OOAA 3B9PA 4GIPA 2L7IA 4QHSA 1R2YA 4HL4A 2F5NA 2BNKA 1EFUB 3LVWA 4AKGA 2DHYA 4JI3M 3GLGB 2LVOC 2DAIA 3GLHE 3U6DA 2K9DA 1WXQA 2Z7JA 3MHVC 1XMOM 5EXPA 4F2LA 2HHHM 4MGZE 2FS1A 4CJ6A 3UJNA 2EA0A 1J5EM 5C1BA 4Z6YA 1GL7A 4I5SA 1PJQA 1WHCA 5E26A 2RGOA 1GJTA 4IBKA 5ITYA 2J7NA 1HNZM 1PJTA 1TTEA 2I7PA 3HZJA 1G8PA 3OTOM 1SXJE 3SATA 3SHFA 4PDGA 2K6BA 2YNMD 3KDSE 3KW6A 4KT0F 2Y0QA 4KO8A 1LV7A 2HL7A 3SYLA 4DV0M 4KHPM 3J80S 3PVSA 1L1TA 4MGIE 1TGUA 3HU2A 1NJGA 1FJGM 3A46A 5ITQA 1HQYE 2HKJA 1IN7A 3ZQJA 3VK8A 1HT2E 2O5RA 3JAMS 2CUZA 2KDLA 1QYRA 3KOXE 2RGHA 1JR3A 1OTRA 1OFIA 1QAQA 3HKPA 1DGFA 3J27B 1WIVA 3WHKA 4I4LA 4DV2M 2XH9A 2RKOA 3HU1A 2JZ1A 1Q02A 4WP2A 1G3IA 4BLCA 3FD9A 1IN6A 3GQ5A 4FWHA 4AKIA 3K92A 4GEWA 3LQQA 3U6EA 3JR5A 3QWLA 1PM5A 4G4QA 3SAUA 2XSZD 3B74A 2JP7A 3LMMA 5EP3A 2KNAA 4FD2A 5ITRA 1Q3BA 2Z4SA 3KVWA 1NY5A 4CHTB 2LVNC 4EIWA 4L8RC 4IBIA 1IXRC 2CV2A 1XB2B 2JY5A 2DENA 5KPTA 3U5ZB 2F5PA 1NHWC 5IT9S 1PJSA 3B7ZA 1R5LA 1PJIA 3C3DA 1OFHA 2LVPC 2XSZA 3FTCA 3SMSA 1OQYA 1EE8A 2YQZA 2KNZA 2WSCF 2KRKA 4CISA 5FTMA 4MM3B 3JR4A 3IHPA 3GPUA 1IBMM 4FWDA 4LRSA 2LXEA 4GKJM 1TDHA 2XFTA 4A3VB 1L2DA 2EJSA 3FUWA 5IZ7D 2DAKA 4AG5A 4LF7M 3TWKA 3CTWB 5KPZA 5EP2A 4IBGA 2CEAA 4L16A 3HHWA 4M0DA 4DR2M 2JXNA 4FW9A 3BBZA 4DV4M 1OAOC 1Q39A 2CRUA 2R62A 1Z5BA 2KA6B 3U6OA 1L2BA 1XHBA 5C18A 2XLJA 2JY6B 3FE3A 2OQ4A 4MH0E 5LMUM 3Q8XA 1MN3A 5DYIA 5DYGA 3GPPA 4JI6M 1Z5AA 4LF6M 4Y28F 2P5TA 3SYKA 3UK6A 1JR3E 4ITQA 3KP1E 1WGNA 1WR1B 3W68A 4PD2A 2KRUA 2F5SA 5L8RF 5A2QS 3GLHA 1J09A 4GH9A 2CHGA 1QDRA 3LCUA 1SXJD 4HEOA 3U61A 3KFUG 2YR0A 3IG5A 4M9ZA 4F1IA 1N33M 1SXJC 3U60A 2LH0A 3HX3A 3EIEA 2DKLA 3C3EA 4JV5M 3GLFB 2Z3XA 3VKGA 5KPRA 1G4AE 2LVQD 1W5SA 4OW0A 2OO9A 3LW5F 4R71A 2B3TA 3GP1A 3L27A 4AQYM 1C7YA 4QOZC 4DR5M 1GJSA 2APLA 2DZOB 1HQCA 2DAGA 2FNAA 4GRIA 1LTMA 2MGWA 4WURA 3RE8A 1N77A 2ZAMA 2R4JA 3KSXA 3DOAA 4OVZA 2Q2EB 3E9SA 2R46A 1ZMWA 1IQPA 4IIWA 5FLXS 3GLIB 4IBEA 2VQEM 2CHQA 2BJVA 1IBKM 3AOEC 3FKEA 4LZZA 1N75A 2L4EA 2Y20A 3U6PA 4IBFA 3J7AS 1NY6A 4DV5M 4AKHA 3RGPA 1IY1A 1ZAEA 2KZUA 4XBOA 3RGSA 4G4RA 4P17A 1XNRM 3AOEA 4LF4M 3GRVA 1QAMA 1VG5A 2LVAA 3DA1A 4LRTA 4MB7A 4D82A 2HCBA 1DGHB 2R0IA 3I04M 5EJCA 2RRUA 2R45A 1QUTA 2J7OA 4UN2B 5EXTA 2E5LM 5BR8M 2QENA 3T1HM 4GHAA 3FTDA 3B89A 5H37D 3NBXX 4DV3M 3TE6A 2QCUA 3FUUA 4LGYA 3CGWA 2QBYB 3ZCBB 3B7NA 4B08A 2FFJA 4LF5M 4IBJA 1K3XA 2CP8A 1L1ZA 2A5YB 4LF9M 1C1KA 4OX9M 1YSYA 2QNJA 3U6MA 2QHOB 4RF0A 1D0KA 1SG9A 2LNHC 3W0LB 2MJ5B 3AFHA 3GRRA 3LCVB 2ERCA 1QZMA 1JR3D 2XGNA 2M5ZA 2G5GX 5BPVA 2LTUA 1TH2A 1ZV1A 4L78A 1IY2A 3NBIA 3KOYE 1IXSA 3VLFB 2UXBM 2Y0TA 1ZQ9A 3D8LA 3FUVA 4IJFA 1TR8A 4LJ5A 4MGYE 4II7A 3W67A 1GVNA 2D7EA 1DO0A 4QOSA 4FCVA 3BXWA 3SHGB 3J81S 2DWMA 1KYIA 2DNAA 2XF3A 4NL4H 7CATA 3FUTA 3HWSA 3I01M 3L2AA 3TPZA 4NXMM 3DZDA 3QYBA 1IFYA 4FWGA 3I4VA 1UM8A 4X64M 1TF0B 3MMPA 1XC8A 3FUXA 2G3QA 1YE9A 4D80A 3T1YM 2R44A 1DO2A 1N32M 2DVWB 4B3TM 2C9CA 3HU3A 4PT5A 3B7QA 5IREB 3A42A 1DGGA 1G59A 2OPFA 1E94E 4DR1M 4B3RM 3DFZA 2C9OA 3U6LA 2MROB 1IXZA 1H6UA 3V76A 3VKHA 3D8BA 4Q7JA 2WSFF 3KOWE 1NO1A 4W5WA 3J2PB 2V1CA 1XNQM 4G6ZA 1XXHA 2L4FA 2KEBA 3K9OA 5EP4A 4AG6A 4TUWA 3KP0E 3A98B 1AIPC 3PNVA 3HJSA 4D81A 3VFDA 2JNHA 3UGJA 4B7HA 2J5YA 3PXGA 3M0EA 4G4NA 4GMQA 1R7RA 1BVSA 2NQ8C 2O01F 4DUZM 1OAIA 1NHGC 4GKKM 3I51A 3M6AA 1DV0A 2DAMA 1GL6A 3TQSA 2DZLA 4LJ7A 2R6FA 1A5TA 4LZJA 5EP1A 3CF6E 1GO5A 2CFOA 2L6OA 4LJAA 1TH3A 1IN8A 1IN4A 2C96A 1VDDA 4JN6A 3KS4A 3L26A 3R9XB 3VK7A 4NRWA 1J7KA 2JY8A 4IBCA 2L09A 2KW0A 2WZJA 1P3QQ 3GRUA 1MJGM 1HR0M 1E32A 4JI0M 1OIPA 3W0FA 2VF7A 5JI3E 3C9PA 1NVMA 1K3WA 1HT1E 3FYDA
chains in the Genus database with same CATH topology
2RRUA 3FRHA 1HQYE 4UN2B 1HT2E 3B89A 3FRIA 1OTRA 1WIVA 1CUKA 1IM2A 2HAKA 4WP2A 2JZ1A 1Q02A 1G3IA 2MR9A 2CP8A 4GEWA 2ZTDA 1QZEA 1XXHE 2QNJA 3E21A 3IECA 2BWEA 2JP7A 2QHOB 2KNAA 1G41A 2LBCA 3H4JA 1SG9A 2MJ5B 1NV9A 3LCVB 2LVNC 2ZTCA 1XB2B 1VQ1A 2DENA 2JY5A 2K0BX 1HJPA 1VDLA 2LTUA 1ZV1A 4G3OA 1V92A 2LVPC 1IXSA 1OQYA 2KNZA 2EKFA 1TR8A 2JUJA 2CWBA 3IHPA 1DO0A 2KHHA 2EJSA 1ZMVA 2DAKA 1KYIA 2DNAA 1OKSA 1UFZA 1IFYA 3GLFE 1Y8GA 3BBZA 3MMPA 2G3QA 1DO2A 2DAEA 2JZ0A 2JY6B 3FE3A 1MN3A 2O25A 2L2DA 3K9PA 3GLGE 1E94E 1JR3E 1WGNA 1WR1B 2DI0A 2HWJA 2MROB 1VEJA 4DBGB 2H5XA 3LCUA 3E46A 4HEOA 3T6PA 3GLIE 2QSFX 2EKKA 4Q7JA 1R4GA 4F1IA 1VEKA 2L4FA 2DKLA 3K9OA 2JY7A 1AIPC 1G4AE 1WGLA 2LVQD 2OO9A 4R71A 2B3TA 2OOAA 1VEGA 2JNHA 1C7YA 3F92A 1EFUB 1BVSA 2DAGA 5JI2E 1OAIA 2DHYA 2OOBA 1NV8A 2LVOC 2DAIA 2MGWA 3GLHE 5DFLA 2K9DA 1DV0A 2DAMA 4F2LA 2DZLA 1A5TA 1ZMWA 1GO5A 1WHCA 1T6OA 2L4EA 1TTEA 1YLAA 1T43A 2JY8A 2KNVA 2WZJA 1P3QQ 1VG5A 1WJ7A 2LVAA 1PGYA 1ZMUA 2R0IA 1F4IA 1HT1E 2BWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRU A;  3FRH A;  1HQY E;  4UN2 B;  1HT2 E;  3B89 A;  3FRI A;  1OTR A;  1WIV A;  1CUK A;  1IM2 A;  2HAK A;  4WP2 A;  2JZ1 A;  1Q02 A;  1G3I A;  2MR9 A;  2CP8 A;  4GEW A;  2ZTD A;  1QZE A;  1XXH E;  2QNJ A;  3E21 A;  3IEC A;  2BWE A;  2JP7 A;  2QHO B;  2KNA A;  1G41 A;  2LBC A;  3H4J A;  1SG9 A;  2MJ5 B;  1NV9 A;  3LCV B;  2LVN C;  2ZTC A;  1XB2 B;  1VQ1 A;  2DEN A;  2JY5 A;  2K0B X;  1HJP A;  1VDL A;  2LTU A;  1ZV1 A;  4G3O A;  1V92 A;  2LVP C;  1IXS A;  1OQY A;  2KNZ A;  2EKF A;  1TR8 A;  2JUJ A;  2CWB A;  3IHP A;  1DO0 A;  2KHH A;  2EJS A;  1ZMV A;  2DAK A;  1KYI A;  2DNA A;  1OKS A;  1UFZ A;  1IFY A;  3GLF E;  1Y8G A;  3BBZ A;  3MMP A;  2G3Q A;  1DO2 A;  2DAE A;  2JZ0 A;  2JY6 B;  3FE3 A;  1MN3 A;  2O25 A;  2L2D A;  3K9P A;  3GLG E;  1E94 E;  1JR3 E;  1WGN A;  1WR1 B;  2DI0 A;  2HWJ A;  2MRO B;  1VEJ A;  4DBG B;  2H5X A;  3LCU A;  3E46 A;  4HEO A;  3T6P A;  3GLI E;  2QSF X;  2EKK A;  4Q7J A;  1R4G A;  4F1I A;  1VEK A;  2L4F A;  2DKL A;  3K9O A;  2JY7 A;  1AIP C;  1G4A E;  1WGL A;  2LVQ D;  2OO9 A;  4R71 A;  2B3T A;  2OOA A;  1VEG A;  2JNH A;  1C7Y A;  3F92 A;  1EFU B;  1BVS A;  2DAG A;  5JI2 E;  1OAI A;  2DHY A;  2OOB A;  1NV8 A;  2LVO C;  2DAI A;  2MGW A;  3GLH E;  5DFL A;  2K9D A;  1DV0 A;  2DAM A;  4F2L A;  2DZL A;  1A5T A;  1ZMW A;  1GO5 A;  1WHC A;  1T6O A;  2L4E A;  1TTE A;  1YLA A;  1T43 A;  2JY8 A;  2KNV A;  2WZJ A;  1P3Q Q;  1VG5 A;  1WJ7 A;  2LVA A;  1PGY A;  1ZMU A;  2R0I A;  1F4I A;  1HT1 E;  2BWB A; 
#chains in the Genus database with same CATH topology
 4NC6 A;  5FTK A;  1GKI A;  1YUB A;  3L28 A;  4BBA A;  2UXC M;  3GLG A;  3FRI A;  2DWZ B;  5FTJ A;  4X62 M;  1IY0 A;  2VDB B;  1CUK A;  3HY5 A;  1IM2 A;  3GQ4 A;  3U6Q A;  2XZF A;  2D7G A;  4PDI A;  2BJW A;  5ITT A;  1L2C A;  3GPY A;  3SAS A;  2ZTD A;  2K47 A;  1QZE A;  2EO2 A;  4DR3 M;  3U6C A;  4LG2 A;  1XXH E;  3THG A;  1GAB A;  3E21 A;  3IEC A;  2G8L A;  4IBD A;  4LY6 A;  4DUY M;  3H4J A;  1G41 A;  1PRB A;  3AL0 C;  1NV9 A;  4GIT A;  2XFS A;  4BB9 A;  4LFC M;  4NRV A;  4LJ8 A;  4Z8X A;  1VQ1 A;  4DV6 M;  2K0B X;  3R8F A;  2UUB M;  4B3M M;  3FTE A;  2UUA M;  4REZ A;  3AJI B;  5KQD A;  1K82 A;  1V92 A;  2KZS A;  1V34 A;  3LVV A;  1Q3C A;  2XZU A;  4K0K M;  1N34 M;  4AI6 A;  3LQR A;  2JUJ A;  2CWB A;  4RKU F;  3GLH B;  4B3S M;  2ZBK B;  2JWS A;  2C5R A;  3U61 B;  3PFI A;  4GC5 A;  5KQ8 A;  2DWL A;  4R3D A;  2KHH A;  5FTN A;  3ZC7 B;  1PJJ A;  2WSE F;  4AW4 A;  3AKZ A;  2MH8 A;  1ZMV A;  1NJF A;  1OIZ A;  2L7H A;  2F5Q A;  3U60 B;  1EIJ A;  3UMM A;  3GO8 A;  1I94 M;  1KSF X;  3C58 A;  2DXI A;  3KS8 A;  4YHH M;  2X4A A;  1IN5 A;  2W82 A;  1Y8G A;  5ITU A;  3UZU A;  1QDT A;  1SXJ B;  5GKN A;  2XEP A;  1Z5C A;  3QAU A;  3CF2 A;  2CHV A;  4JXJ A;  3U5Z A;  3KOZ E;  1X37 A;  2C99 A;  2O25 A;  3AV0 A;  3GPX A;  4JI1 M;  2L2D A;  3KSJ A;  4JYA M;  2GQF A;  3GLG E;  3K8Z A;  4FCT A;  4OVZ B;  1E9S A;  3QYE A;  2F4V M;  1L8Q A;  1XWI A;  1S3S A;  1QVR A;  3RFW A;  4L4U A;  4M9S A;  4DBG B;  5FSW A;  3T6P A;  1RU3 A;  3E46 A;  3SMP A;  3HHY A;  4DV1 M;  2QSF X;  2EKK A;  1JQJ C;  4JI4 M;  2AHM A;  2DHR A;  4NSR A;  3VDP A;  2N35 A;  4PCZ A;  1HNW M;  1N78 A;  1KFV A;  8CAT A;  3I4Y A;  2VII A;  4IJE A;  4JI2 M;  3VDU A;  1WGL A;  4FCW A;  4QNR A;  3T15 A;  4OU7 A;  2VQF M;  4ZPX A;  1VEG A;  1GLN A;  1TH4 A;  3FYC A;  3FTF A;  2EUC A;  3F92 A;  4MGH A;  5JI2 E;  2LHG A;  2OOB A;  3IG8 A;  1NV8 A;  3NWL A;  3ILK A;  4JI7 M;  5DFL A;  4S12 A;  3TL4 X;  1I4W A;  4GHL A;  1MX0 A;  2LWX A;  4M0W A;  2FE8 A;  3BOS A;  2UU9 M;  2I7N A;  2R18 A;  2CV0 A;  2DWN A;  4RNA A;  3Q8G A;  1QQW A;  3TWL A;  3SAW A;  3A45 A;  2FH0 A;  1D0L A;  3HGI A;  3MK6 A;  2D7H A;  1T6O A;  2R4E A;  5LMN M;  1YLA A;  3MJ5 A;  1T43 A;  5DNY A;  2KNV A;  3L29 A;  3CF0 A;  2C98 A;  3GLF A;  1T3T A;  1NNJ A;  1WJ7 A;  4DR7 M;  4AZF A;  1PGY A;  1ZMU A;  4LGM A;  1IXS B;  4FVM A;  2QPA A;  1F4I A;  2H1R A;  2BWB A;  3FRH A;  2F5O A;  3SAR A;  1DGB A;  4R7G A;  5EXX A;  4B7G A;  4DV7 M;  2X49 A;  3KXE C;  3AOG A;  3GQ3 A;  4QHT A;  1HNX M;  3SFZ A;  4RF1 A;  4I81 A;  4LCB A;  2HAK A;  5F3W A;  3ZH9 B;  5IWA M;  4LF8 M;  2MR9 A;  3GRY A;  3GLI A;  1R2Z A;  2ZM6 M;  4DR4 M;  2V1U A;  4JI5 M;  2UXD M;  1W5T A;  2YFQ A;  4NSO B;  5EXS A;  2BWE A;  5ITX A;  4JI8 M;  3SAV A;  2R65 A;  2LBC A;  2QQ8 A;  2CE7 A;  2Z4R A;  1Z6T A;  4GC9 A;  1NNU C;  1Z59 A;  3H4M A;  2ZAN A;  2ZTC A;  4X66 M;  1AUA A;  4X65 M;  3SBJ A;  4QNM A;  2M60 A;  1G71 A;  1HJP A;  4XGI A;  2KXE A;  1VDL A;  3EIH A;  4NOO B;  1OJL A;  4G3O A;  4HLQ A;  3WHL A;  1DGH A;  2QP9 X;  3K2L A;  4KOD A;  5KO3 A;  3HHZ A;  2EKF A;  3SC3 A;  4LJ6 A;  3U6S A;  4MGK E;  4CIZ A;  4YY3 M;  2QBY A;  4LFB M;  2V6Z M;  1QAN A;  2LHC A;  3K1J A;  1FNN A;  2CV1 A;  1D2N A;  4LJ9 A;  1OKS A;  1XXH B;  1UFZ A;  2DZN B;  2GNO A;  2JA2 A;  4XK8 F;  4CGY B;  4IBB A;  3GLF E;  3HHX A;  1JB0 F;  1SXJ A;  3PNY A;  3J7B A;  4KLN A;  5FTL A;  3M7G A;  3T38 A;  2DAE A;  1ORY B;  2JZ0 A;  4I8O A;  4NXN M;  1N36 M;  3K9P A;  5EQT A;  1TDZ A;  1QAO A;  4LJ4 A;  3L25 A;  2DI0 A;  4G4O A;  2HWJ A;  4P16 A;  2ZAO A;  1VEJ A;  3TWM A;  4L15 A;  1MU5 A;  2H5X A;  3GLI E;  2FOI C;  2Y21 A;  4B7F A;  1R4G A;  3HJ8 A;  4L6V 6;  5ITX E;  1XMQ M;  1IBL M;  1R6B X;  4M9X A;  2UUC M;  1V33 A;  1VEK A;  1D0M A;  4WW0 A;  4LFA M;  4ANR A;  5E6J A;  1E9R A;  2X8A A;  2Z8Y M;  3E4R A;  2JY7 A;  3HJQ A;  1NSF A;  1QUS A;  2VF8 A;  2QZ4 A;  4DR6 M;  2OOA A;  3B9P A;  4GIP A;  2L7I A;  4QHS A;  1R2Y A;  4HL4 A;  2F5N A;  2BNK A;  1EFU B;  3LVW A;  4AKG A;  2DHY A;  4JI3 M;  3GLG B;  2LVO C;  2DAI A;  3GLH E;  3U6D A;  2K9D A;  1WXQ A;  2Z7J A;  3MHV C;  1XMO M;  5EXP A;  4F2L A;  2HHH M;  4MGZ E;  2FS1 A;  4CJ6 A;  3UJN A;  2EA0 A;  1J5E M;  5C1B A;  4Z6Y A;  1GL7 A;  4I5S A;  1PJQ A;  1WHC A;  5E26 A;  2RGO A;  1GJT A;  4IBK A;  5ITY A;  2J7N A;  1HNZ M;  1PJT A;  1TTE A;  2I7P A;  3HZJ A;  1G8P A;  3OTO M;  1SXJ E;  3SAT A;  3SHF A;  4PDG A;  2K6B A;  2YNM D;  3KDS E;  3KW6 A;  4KT0 F;  2Y0Q A;  4KO8 A;  1LV7 A;  2HL7 A;  3SYL A;  4DV0 M;  4KHP M;  3J80 S;  3PVS A;  1L1T A;  4MGI E;  1TGU A;  3HU2 A;  1NJG A;  1FJG M;  3A46 A;  5ITQ A;  1HQY E;  2HKJ A;  1IN7 A;  3ZQJ A;  3VK8 A;  1HT2 E;  2O5R A;  3JAM S;  2CUZ A;  2KDL A;  1QYR A;  3KOX E;  2RGH A;  1JR3 A;  1OTR A;  1OFI A;  1QAQ A;  3HKP A;  1DGF A;  3J27 B;  1WIV A;  3WHK A;  4I4L A;  4DV2 M;  2XH9 A;  2RKO A;  3HU1 A;  2JZ1 A;  1Q02 A;  4WP2 A;  1G3I A;  4BLC A;  3FD9 A;  1IN6 A;  3GQ5 A;  4FWH A;  4AKI A;  3K92 A;  4GEW A;  3LQQ A;  3U6E A;  3JR5 A;  3QWL A;  1PM5 A;  4G4Q A;  3SAU A;  2XSZ D;  3B74 A;  2JP7 A;  3LMM A;  5EP3 A;  2KNA A;  4FD2 A;  5ITR A;  1Q3B A;  2Z4S A;  3KVW A;  1NY5 A;  4CHT B;  2LVN C;  4EIW A;  4L8R C;  4IBI A;  1IXR C;  2CV2 A;  1XB2 B;  2JY5 A;  2DEN A;  5KPT A;  3U5Z B;  2F5P A;  1NHW C;  5IT9 S;  1PJS A;  3B7Z A;  1R5L A;  1PJI A;  3C3D A;  1OFH A;  2LVP C;  2XSZ A;  3FTC A;  3SMS A;  1OQY A;  1EE8 A;  2YQZ A;  2KNZ A;  2WSC F;  2KRK A;  4CIS A;  5FTM A;  4MM3 B;  3JR4 A;  3IHP A;  3GPU A;  1IBM M;  4FWD A;  4LRS A;  2LXE A;  4GKJ M;  1TDH A;  2XFT A;  4A3V B;  1L2D A;  2EJS A;  3FUW A;  5IZ7 D;  2DAK A;  4AG5 A;  4LF7 M;  3TWK A;  3CTW B;  5KPZ A;  5EP2 A;  4IBG A;  2CEA A;  4L16 A;  3HHW A;  4M0D A;  4DR2 M;  2JXN A;  4FW9 A;  3BBZ A;  4DV4 M;  1OAO C;  1Q39 A;  2CRU A;  2R62 A;  1Z5B A;  2KA6 B;  3U6O A;  1L2B A;  1XHB A;  5C18 A;  2XLJ A;  2JY6 B;  3FE3 A;  2OQ4 A;  4MH0 E;  5LMU M;  3Q8X A;  1MN3 A;  5DYI A;  5DYG A;  3GPP A;  4JI6 M;  1Z5A A;  4LF6 M;  4Y28 F;  2P5T A;  3SYK A;  3UK6 A;  1JR3 E;  4ITQ A;  3KP1 E;  1WGN A;  1WR1 B;  3W68 A;  4PD2 A;  2KRU A;  2F5S A;  5L8R F;  5A2Q S;  3GLH A;  1J09 A;  4GH9 A;  2CHG A;  1QDR A;  3LCU A;  1SXJ D;  4HEO A;  3U61 A;  3KFU G;  2YR0 A;  3IG5 A;  4M9Z A;  4F1I A;  1N33 M;  1SXJ C;  3U60 A;  2LH0 A;  3HX3 A;  3EIE A;  2DKL A;  3C3E A;  4JV5 M;  3GLF B;  2Z3X A;  3VKG A;  5KPR A;  1G4A E;  2LVQ D;  1W5S A;  4OW0 A;  2OO9 A;  3LW5 F;  4R71 A;  2B3T A;  3GP1 A;  3L27 A;  4AQY M;  1C7Y A;  4QOZ C;  4DR5 M;  1GJS A;  2APL A;  2DZO B;  1HQC A;  2DAG A;  2FNA A;  4GRI A;  1LTM A;  2MGW A;  4WUR A;  3RE8 A;  1N77 A;  2ZAM A;  2R4J A;  3KSX A;  3DOA A;  4OVZ A;  2Q2E B;  3E9S A;  2R46 A;  1ZMW A;  1IQP A;  4IIW A;  5FLX S;  3GLI B;  4IBE A;  2VQE M;  2CHQ A;  2BJV A;  1IBK M;  3AOE C;  3FKE A;  4LZZ A;  1N75 A;  2L4E A;  2Y20 A;  3U6P A;  4IBF A;  3J7A S;  1NY6 A;  4DV5 M;  4AKH A;  3RGP A;  1IY1 A;  1ZAE A;  2KZU A;  4XBO A;  3RGS A;  4G4R A;  4P17 A;  1XNR M;  3AOE A;  4LF4 M;  3GRV A;  1QAM A;  1VG5 A;  2LVA A;  3DA1 A;  4LRT A;  4MB7 A;  4D82 A;  2HCB A;  1DGH B;  2R0I A;  3I04 M;  5EJC A;  2RRU A;  2R45 A;  1QUT A;  2J7O A;  4UN2 B;  5EXT A;  2E5L M;  5BR8 M;  2QEN A;  3T1H M;  4GHA A;  3FTD A;  3B89 A;  5H37 D;  3NBX X;  4DV3 M;  3TE6 A;  2QCU A;  3FUU A;  4LGY A;  3CGW A;  2QBY B;  3ZCB B;  3B7N A;  4B08 A;  2FFJ A;  4LF5 M;  4IBJ A;  1K3X A;  2CP8 A;  1L1Z A;  2A5Y B;  4LF9 M;  1C1K A;  4OX9 M;  1YSY A;  2QNJ A;  3U6M A;  2QHO B;  4RF0 A;  1D0K A;  1SG9 A;  2LNH C;  3W0L B;  2MJ5 B;  3AFH A;  3GRR A;  3LCV B;  2ERC A;  1QZM A;  1JR3 D;  2XGN A;  2M5Z A;  2G5G X;  5BPV A;  2LTU A;  1TH2 A;  1ZV1 A;  4L78 A;  1IY2 A;  3NBI A;  3KOY E;  1IXS A;  3VLF B;  2UXB M;  2Y0T A;  1ZQ9 A;  3D8L A;  3FUV A;  4IJF A;  1TR8 A;  4LJ5 A;  4MGY E;  4II7 A;  3W67 A;  1GVN A;  2D7E A;  1DO0 A;  4QOS A;  4FCV A;  3BXW A;  3SHG B;  3J81 S;  2DWM A;  1KYI A;  2DNA A;  2XF3 A;  4NL4 H;  7CAT A;  3FUT A;  3HWS A;  3I01 M;  3L2A A;  3TPZ A;  4NXM M;  3DZD A;  3QYB A;  1IFY A;  4FWG A;  3I4V A;  1UM8 A;  4X64 M;  1TF0 B;  3MMP A;  1XC8 A;  3FUX A;  2G3Q A;  1YE9 A;  4D80 A;  3T1Y M;  2R44 A;  1DO2 A;  1N32 M;  2DVW B;  4B3T M;  2C9C A;  3HU3 A;  4PT5 A;  3B7Q A;  5IRE B;  3A42 A;  1DGG A;  1G59 A;  2OPF A;  1E94 E;  4DR1 M;  4B3R M;  3DFZ A;  2C9O A;  3U6L A;  2MRO B;  1IXZ A;  1H6U A;  3V76 A;  3VKH A;  3D8B A;  4Q7J A;  2WSF F;  3KOW E;  1NO1 A;  4W5W A;  3J2P B;  2V1C A;  1XNQ M;  4G6Z A;  1XXH A;  2L4F A;  2KEB A;  3K9O A;  5EP4 A;  4AG6 A;  4TUW A;  3KP0 E;  3A98 B;  1AIP C;  3PNV A;  3HJS A;  4D81 A;  3VFD A;  2JNH A;  3UGJ A;  4B7H A;  2J5Y A;  3PXG A;  3M0E A;  4G4N A;  4GMQ A;  1R7R A;  1BVS A;  2NQ8 C;  2O01 F;  4DUZ M;  1OAI A;  1NHG C;  4GKK M;  3I51 A;  3M6A A;  1DV0 A;  2DAM A;  1GL6 A;  3TQS A;  2DZL A;  4LJ7 A;  2R6F A;  1A5T A;  4LZJ A;  5EP1 A;  3CF6 E;  1GO5 A;  2CFO A;  2L6O A;  4LJA A;  1TH3 A;  1IN8 A;  1IN4 A;  2C96 A;  1VDD A;  4JN6 A;  3KS4 A;  3L26 A;  3R9X B;  3VK7 A;  4NRW A;  1J7K A;  2JY8 A;  4IBC A;  2L09 A;  2KW0 A;  2WZJ A;  1P3Q Q;  3GRU A;  1MJG M;  1HR0 M;  1E32 A;  4JI0 M;  1OIP A;  3W0F A;  2VF7 A;  5JI3 E;  3C9P A;  1NVM A;  1K3W A;  1HT1 E;  3FYD A; 
#chains in the Genus database with same CATH homology
 2RRU A;  3FRH A;  1HQY E;  4UN2 B;  1HT2 E;  3B89 A;  3FRI A;  1OTR A;  1WIV A;  1CUK A;  1IM2 A;  2HAK A;  4WP2 A;  2JZ1 A;  1Q02 A;  1G3I A;  2MR9 A;  2CP8 A;  4GEW A;  2ZTD A;  1QZE A;  1XXH E;  2QNJ A;  3E21 A;  3IEC A;  2BWE A;  2JP7 A;  2QHO B;  2KNA A;  1G41 A;  2LBC A;  3H4J A;  1SG9 A;  2MJ5 B;  1NV9 A;  3LCV B;  2LVN C;  2ZTC A;  1XB2 B;  1VQ1 A;  2DEN A;  2JY5 A;  2K0B X;  1HJP A;  1VDL A;  2LTU A;  1ZV1 A;  4G3O A;  1V92 A;  2LVP C;  1IXS A;  1OQY A;  2KNZ A;  2EKF A;  1TR8 A;  2JUJ A;  2CWB A;  3IHP A;  1DO0 A;  2KHH A;  2EJS A;  1ZMV A;  2DAK A;  1KYI A;  2DNA A;  1OKS A;  1UFZ A;  1IFY A;  3GLF E;  1Y8G A;  3BBZ A;  3MMP A;  2G3Q A;  1DO2 A;  2DAE A;  2JZ0 A;  2JY6 B;  3FE3 A;  1MN3 A;  2O25 A;  2L2D A;  3K9P A;  3GLG E;  1E94 E;  1JR3 E;  1WGN A;  1WR1 B;  2DI0 A;  2HWJ A;  2MRO B;  1VEJ A;  4DBG B;  2H5X A;  3LCU A;  3E46 A;  4HEO A;  3T6P A;  3GLI E;  2QSF X;  2EKK A;  4Q7J A;  1R4G A;  4F1I A;  1VEK A;  2L4F A;  2DKL A;  3K9O A;  2JY7 A;  1AIP C;  1G4A E;  1WGL A;  2LVQ D;  2OO9 A;  4R71 A;  2B3T A;  2OOA A;  1VEG A;  2JNH A;  1C7Y A;  3F92 A;  1EFU B;  1BVS A;  2DAG A;  5JI2 E;  1OAI A;  2DHY A;  2OOB A;  1NV8 A;  2LVO C;  2DAI A;  2MGW A;  3GLH E;  5DFL A;  2K9D A;  1DV0 A;  2DAM A;  4F2L A;  2DZL A;  1A5T A;  1ZMW A;  1GO5 A;  1WHC A;  1T6O A;  2L4E A;  1TTE A;  1YLA A;  1T43 A;  2JY8 A;  2KNV A;  2WZJ A;  1P3Q Q;  1VG5 A;  1WJ7 A;  2LVA A;  1PGY A;  1ZMU A;  2R0I A;  1F4I A;  1HT1 E;  2BWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...