2K6BA

Solution structure of 1-112 fragment of human programmed cell death 5 protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
GSADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 5
publication title Structure-function correlation of human programmed cell death 5 protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2008-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2k6bA01
2CRUA 2K6BA 2FH0A 2JXNA 1EIJA
chains in the Genus database with same CATH superfamily
2DENA 1IXSB 2CHVA 1N77A 4IBFA 2QP9X 2QBYA 4CISA 1YUBA 2F5SA 2DZOB 2OOBA 3AOEC 2MH8A 3QYEA 3UMMA 3RGPA 3SHFA 4DR2M 3B7NA 3GLGE 2YQZA 5JI3E 2LVNC 3HHWA 3FTFA 4JN6A 1H6UA 3J27B 4NSRA 2JY7A 3I4YA 3L2AA 1G59A 4NXMM 4QOZC 3FYDA 3LCVB 1NHWC 3GRRA 3LQRA 2HAKA 5KQ8A 1E9SA 2Z4RA 1JB0F 2CRUA 1D0KA 1SXJA 2EO2A 1S3SA 2QQ8A 4GIPA 4I8OA 4LY6A 4LJ8A 3C3DA 2RGOA 4DUYM 5EQTA 2E5LM 4FWGA 4A3VB 1C1KA 3KS8A 3HKPA 5KPTA 1T6OA 1L8QA 2KW0A 4TUWA 1IN8A 1VEJA 4IBGA 2AHMA 3TWMA 2ZAMA 3C58A 4JI2M 3KW6A 2EUCA 4AKHA 1OTRA 2QCUA 3U6SA 2V6ZM 3GLGB 3R9XB 2C9CA 2JNHA 4F1IA 1LV7A 1TH2A 1Q3CA 1OIZA 4RKUF 2A5YB 3U6PA 3U6OA 1R6BX 2KEBA 1HNZM 4PCZA 5EP1A 3PFIA 1K82A 2VIIA 3T38A 3L29A 3TWLA 4FD2A 4EIWA 5ITUA 2M60A 3K2LA 3KXEC 4WW0A 1ZAEA 3IHPA 2QSFX 2R65A 2UUAM 2I7NA 5E6JA 2KRKA 3SMPA 5IREB 4LF6M 1D0LA 2R0IA 4HEOA 3W68A 2L4EA 1TH3A 3BBZA 3BXWA 2UXCM 2L7HA 2KNZA 2DVWB 2HWJA 2K0BX 1PRBA 2KXEA 3E46A 3FUTA 3NBXX 4GMQA 1IXRC 4L78A 5IWAM 2G5GX 1VDLA 2JXNA 4X64M 2XZUA 4LGMA 4XBOA 2JZ0A 2R44A 4QHSA 4Z6YA 1JR3E 2UUCM 3JR5A 4LF8M 3VDPA 1P3QQ 4GH9A 1QAMA 3VFDA 3SBJA 1WGNA 1IQPA 3KOYE 3TE6A 1PGYA 2XLJA 1QVRA 2K6BA 5KPRA 1VDDA 1TTEA 4LJ5A 2L4FA 3HX3A 1G4AE 5EP3A 4NSOB 5FTJA 5L8RF 3VKGA 2XEPA 4FW9A 4PDIA 1FNNA 1QDRA 3FTEA 1K3WA 2EKFA 4OW0A 1IY2A 1DO0A 3GQ3A 1D2NA 5C1BA 4FWHA 2OO9A 1XMQM 3K8ZA 2JY6B 2MROB 2LBCA 1NJFA 4IBDA 4DBGB 3TPZA 4P17A 4GEWA 3GRVA 1ZV1A 3KSJA 3LCUA 1W5TA 4RF1A 4FCTA 1IN6A 4LCBA 1QUSA 4RNAA 2CHGA 2RKOA 3FRIA 5KO3A 2Y21A 1OQYA 3B7QA 4IBCA 3HHYA 3WHKA 3T15A 4D82A 3JR4A 3U5ZB 2EKKA 3HJSA 2XFTA 4DV1M 3DFZA 3W0FA 1QZEA 4MGZE 2HKJA 2EJSA 1N32M 1VG5A 2XFSA 4D80A 4DR1M 4FCVA 2K47A 4Z8XA 3VDUA 1Q39A 3ZH9B 2W82A 3CGWA 4B3MM 2Z3XA 4BB9A 1QZMA 2OPFA 4DV6M 3AV0A 4F2LA 4MGYE 3AL0C 4UN2B 2XH9A 3K92A 3K9PA 1XB2B 2F5NA 3SASA 3U6CA 1SXJE 3HWSA 1NVMA 4OVZB 2LXEA 4W5WA 1YLAA 3AKZA 1WR1B 2DWMA 3SYKA 1ORYB 3UJNA 4YHHM 1NY5A 1G8PA 4IIWA 5ITTA 1NV8A 4LF4M 5EXXA 1EE8A 2R4JA 3GLIE 2KZUA 3NWLA 4R71A 2F4VM 3RGSA 1IFYA 2QBYB 4IBKA 1IN4A 1KFVA 4MM3B 3U61A 3SMSA 1OKSA 2ZTDA 4K0KM 4NOOB 4IBIA 4M0WA 5BR8M 3QAUA 2CV0A 5ITRA 1NNJA 2Y0TA 4M0DA 1IXZA 1QYRA 4B3TM 2Q2EB 5DYIA 4NRWA 3T1YM 1J7KA 3B74A 3J7BA 1F4IA 1PJSA 3HGIA 3I51A 4G3OA 4NRVA 1WHCA 2BJWA 2KNVA 2XSZD 4S12A 4DV2M 1NY6A 1IXSA 4DV7M 2ZTCA 3GLIB 2QPAA 3GLFE 3T1HM 1TR8A 3JAMS 2ZANA 1OJLA 3T6PA 1HR0M 4B08A 2LHCA 2YR0A 1NO1A 3CTWB 2K9DA 1W5SA 2ERCA 3VKHA 1XXHE 4JI8M 5EP4A 2G3QA 1A5TA 2BWBA 1R2YA 1MU5A 1V92A 2GNOA 3KOZE 3LQQA 1QAQA 1AIPC 2D7GA 2R62A 1L2BA 3L28A 2DI0A 1HNXM 1IY1A 4MGKE 3GLHE 3D8BA 2M5ZA 1C7YA 2DWNA 2F5QA 5EXPA 4LFCM 1QANA 2YNMD 5EXTA 3ZC7B 1GJSA 5JI2E 1SG9A 5GKNA 3D8LA 3KVWA 3R8FA 4JI3M 2VF8A 1PJQA 3GLFB 2ZAOA 2P5TA 2WZJA 3OTOM 2JY5A 3ZQJA 1TDHA 4GHLA 2UXBM 2DKLA 2FS1A 2MGWA 2RRUA 3B9PA 3FKEA 3M6AA 4KLNA 2KZSA 2C9OA 1EIJA 3KS4A 1XXHB 4WURA 1E94E 7CATA 3UZUA 4M9XA 3AOGA 2OQ4A 2DAKA 1DV0A 4QOSA 2LNHC 3U6MA 4QNRA 3GLHB 3EIEA 4DR7M 2V1UA 1HQCA 1ZQ9A 1RU3A 2G8LA 3KDSE 3PNYA 4LZZA 2DHRA 3DA1A 3A46A 2VQFM 1N78A 4BLCA 4GHAA 2C96A 4FWDA 2KRUA 2KDLA 4I4LA 4L8RC 2R4EA 3SAUA 1HQYE 1SXJC 2FFJA 4DR3M 4LJAA 2BJVA 2DHYA 2DWZB 2LVQD 4I5SA 3SHGB 4DV5M 1ZMVA 2DAMA 2RGHA 4MH0E 4JI1M 1Z5AA 3J7AS 3HU1A 1Q02A 1IBMM 3GPPA 4LG2A 5C18A 3SAVA 1IN5A 1Y8GA 1N75A 1QQWA 2O25A 2QENA 3ZCBB 4FVMA 3KP1E 3AOEA 4X62M 3GQ4A 1G41A 2FE8A 2UXDM 1QAOA 1DGHB 2DAEA 3HHXA 1YSYA 2XZFA 3J81S 4DUZM 1OFHA 2CFOA 1GLNA 3E9SA 2F5OA 1V33A 1L2DA 4XGIA 2LTUA 2HCBA 3AJIB 3C9PA 2WSEF 2XSZA 1GJTA 3A45A 3B7ZA 1G71A 4LJ4A 3H4MA 3GO8A 3L25A 2XF3A 1L1ZA 2X4AA 2CV2A 3SATA 2JA2A 4YY3M 1Z6TA 4AI6A 2H5XA 2Z4SA 3BOSA 5H37D 4LF7M 3FUXA 2JZ1A 3LMMA 3HJQA 1GVNA 5FTLA 3CF0A 1QUTA 2JUJA 3KOXE 3MJ5A 4QNMA 3HY5A 5ITYA 4RF0A 3W0LB 1OIPA 4LGYA 3KOWE 3FD9A 1OFIA 3U5ZA 1J5EM 3IG8A 4NC6A 1PJIA 4DR5M 1BVSA 1Z59A 1HT1E 1R7RA 3WHLA 1TH4A 2Y0QA 3U60B 4KHPM 1GL6A 1AUAA 2J7NA 1PJTA 2LWXA 3SYLA 4JI5M 4OX9M 2KHHA 4GC5A 5LMNM 3GRYA 5E26A 4BBAA 2C99A 3U60A 3RE8A 3I4VA 2X49A 4NXNM 1NJGA 2J5YA 4OVZA 3HZJA 4G4NA 1IM2A 1SXJB 4KT0F 3GP1A 5IZ7D 2J7OA 3I01M 2Z7JA 4IBEA 1V34A 2LH0A 3K1JA 4LFAM 2DXIA 4JYAM 1QDTA 1XNQM 4G4QA 4HL4A 4LZJA 1JQJC 1E32A 3HU3A 3A98B 2H1RA 3ILKA 5KQDA 1WXQA 1OAOC 3HU2A 5EXSA 1WJ7A 2DAGA 3J2PB 1JR3D 2D7EA 4AG5A 3UGJA 3NBIA 3TQSA 4CIZA 1XNRM 3TL4X 2QZ4A 2ZM6M 2DNAA 4ZPXA 4B3SM 3FUWA 3W67A 1VEKA 3Q8GA 5LMUM 2D7HA 4GKJM 2Z8YM 5ITXA 2QHOB 3TWKA 4LJ7A 4PT5A 1ZMUA 1GABA 4AW4A 4LJ9A 2DAIA 2I7PA 2DWLA 3J80S 3GLIA 3AFHA 4OU7A 2MJ5B 4G6ZA 3CF2A 1DO2A 1KYIA 2Y20A 3Q8XA 1MJGM 3THGA 1MN3A 1WGLA 2R6FA 4IJFA 4LRTA 4JI0M 1Q3BA 2O01F 3GLGA 1PJJA 3PNVA 3MMPA 2L2DA 4CHTB 2LVPC 2QNJA 3FE3A 5DYGA 1IBLM 4L16A 5FTKA 1WIVA 1XWIA 4B3RM 2R45A 4ITQA 2CEAA 1L2CA 4AKGA 1I94M 4IBBA 4M9ZA 3UK6A 2YFQA 1NV9A 3IECA 3HJ8A 4M9SA 2CUZA 3GQ5A 3U6QA 4MB7A 4P16A 1UFZA 2LVOC 1DGBA 1DGFA 1XHBA 4FCWA 2X8AA 4LFBM 5IT9S 1R2ZA 4Q7JA 1R4GA 4GKKM 3GLFA 1NNUC 1HJPA 5FTNA 1TF0B 3GPUA 3GPYA 2F5PA 1Z5CA 5FSWA 4JI4M 1T43A 1UM8A 2R46A 4REZA 4LRSA 3VLFB 3DZDA 3MK6A 1XXHA 4GC9A 2MR9A 5FLXS 4AQYM 2JWSA 4MGIE 1SXJD 2O5RA 4CJ6A 4PDGA 4G4OA 3PVSA 4L15A 3LW5F 1CUKA 3VK8A 1PM5A 1N34M 5BPVA 2GQFA 1L1TA 2BNKA 4L4UA 3SFZA 4KO8A 5ITQA 4WP2A 3PXGA 4AKIA 2VF7A 3GLHA 1HNWM 1IY0A 3GRUA 1LTMA 3M7GA 2V1CA 1K3XA 4JI7M 3CF6E 2CV1A 3KFUG 2FNAA 2LHGA 2CWBA 4DR6M 4KODA 2L7IA 1MX0A 3SAWA 1N36M 3IG5A 5KPZA 8CATA 2ZBKB 3E4RA 4I81A 3A42A 4Y28F 4B7GA 5EP2A 3EIHA 1NSFA 1ZMWA 4XK8F 1GKIA 1Z5BA 4II7A 3E21A 2OOAA 3GPXA 1D0MA 1KSFX 2UU9M 1GO5A 4AG6A 1YE9A 1VEGA 2UUBM 4IJEA 2JY8A 3FUUA 3QYBA 2KA6B 4CGYB 4LF5M 2CE7A 1N33M 4D81A 2LVAA 3C3EA 3U6DA 2R18A 4R3DA 2XGNA 3M0EA 1JR3A 4ANRA 2L09A 1R5LA 3FUVA 4DV4M 5FTMA 4JI6M 1DGHA 1IBKM 2N35A 3FTDA 1T3TA 2CP8A 3MHVC 4JV5M 4G4RA 4NL4H 4DV3M 5F3WA 2DZLA 4DR4M 1J09A 4L6V6 1G3IA 4X66M 1IN7A 3DOAA 3F92A 2HL7A 1VQ1A 2APLA 3FYCA 4X65M 2JP7A 3L27A 3LVWA 2VDBB 3K9OA 2WSCF 1GL7A 4B7HA 2B3TA 2WSFF 3HHZA 3FTCA 2CHQA 3H4JA 2DZNB 3RFWA 5EJCA 4QHTA 3KSXA 4AZFA 2KNAA 5DNYA 3U61B 1TDZA 3B89A 3KP0E 3QWLA 2BWEA 2NQ8C 3SARA 5A2QS 4HLQA 4IBJA 3L26A 3VK7A 1HT2E 4DV0M 2C5RA 4LF9M 3I04M 1DGGA 3FRHA 4PD2A 1E9RA 2FH0A 2C98A 3U6EA 1EFUB 1FJGM 4JXJA 5ITXE 2VQEM 4MGHA 2HHHM 4LJ6A 4R7GA 3SC3A 1XC8A 1NHGC 1TGUA 1I4WA 3LVVA 2FOIC 4GRIA 4B7FA 1XMOM 4GITA 2EA0A 5DFLA 1X37A 1OAIA 3U6LA 2L6OA 3V76A
chains in the Genus database with same CATH topology
2CRUA 2K6BA 2FH0A 2JXNA 1EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRU A;  2K6B A;  2FH0 A;  2JXN A;  1EIJ A; 
#chains in the Genus database with same CATH topology
 2DEN A;  1IXS B;  2CHV A;  1N77 A;  4IBF A;  2QP9 X;  2QBY A;  4CIS A;  1YUB A;  2F5S A;  2DZO B;  2OOB A;  3AOE C;  2MH8 A;  3QYE A;  3UMM A;  3RGP A;  3SHF A;  4DR2 M;  3B7N A;  3GLG E;  2YQZ A;  5JI3 E;  2LVN C;  3HHW A;  3FTF A;  4JN6 A;  1H6U A;  3J27 B;  4NSR A;  2JY7 A;  3I4Y A;  3L2A A;  1G59 A;  4NXM M;  4QOZ C;  3FYD A;  3LCV B;  1NHW C;  3GRR A;  3LQR A;  2HAK A;  5KQ8 A;  1E9S A;  2Z4R A;  1JB0 F;  2CRU A;  1D0K A;  1SXJ A;  2EO2 A;  1S3S A;  2QQ8 A;  4GIP A;  4I8O A;  4LY6 A;  4LJ8 A;  3C3D A;  2RGO A;  4DUY M;  5EQT A;  2E5L M;  4FWG A;  4A3V B;  1C1K A;  3KS8 A;  3HKP A;  5KPT A;  1T6O A;  1L8Q A;  2KW0 A;  4TUW A;  1IN8 A;  1VEJ A;  4IBG A;  2AHM A;  3TWM A;  2ZAM A;  3C58 A;  4JI2 M;  3KW6 A;  2EUC A;  4AKH A;  1OTR A;  2QCU A;  3U6S A;  2V6Z M;  3GLG B;  3R9X B;  2C9C A;  2JNH A;  4F1I A;  1LV7 A;  1TH2 A;  1Q3C A;  1OIZ A;  4RKU F;  2A5Y B;  3U6P A;  3U6O A;  1R6B X;  2KEB A;  1HNZ M;  4PCZ A;  5EP1 A;  3PFI A;  1K82 A;  2VII A;  3T38 A;  3L29 A;  3TWL A;  4FD2 A;  4EIW A;  5ITU A;  2M60 A;  3K2L A;  3KXE C;  4WW0 A;  1ZAE A;  3IHP A;  2QSF X;  2R65 A;  2UUA M;  2I7N A;  5E6J A;  2KRK A;  3SMP A;  5IRE B;  4LF6 M;  1D0L A;  2R0I A;  4HEO A;  3W68 A;  2L4E A;  1TH3 A;  3BBZ A;  3BXW A;  2UXC M;  2L7H A;  2KNZ A;  2DVW B;  2HWJ A;  2K0B X;  1PRB A;  2KXE A;  3E46 A;  3FUT A;  3NBX X;  4GMQ A;  1IXR C;  4L78 A;  5IWA M;  2G5G X;  1VDL A;  2JXN A;  4X64 M;  2XZU A;  4LGM A;  4XBO A;  2JZ0 A;  2R44 A;  4QHS A;  4Z6Y A;  1JR3 E;  2UUC M;  3JR5 A;  4LF8 M;  3VDP A;  1P3Q Q;  4GH9 A;  1QAM A;  3VFD A;  3SBJ A;  1WGN A;  1IQP A;  3KOY E;  3TE6 A;  1PGY A;  2XLJ A;  1QVR A;  2K6B A;  5KPR A;  1VDD A;  1TTE A;  4LJ5 A;  2L4F A;  3HX3 A;  1G4A E;  5EP3 A;  4NSO B;  5FTJ A;  5L8R F;  3VKG A;  2XEP A;  4FW9 A;  4PDI A;  1FNN A;  1QDR A;  3FTE A;  1K3W A;  2EKF A;  4OW0 A;  1IY2 A;  1DO0 A;  3GQ3 A;  1D2N A;  5C1B A;  4FWH A;  2OO9 A;  1XMQ M;  3K8Z A;  2JY6 B;  2MRO B;  2LBC A;  1NJF A;  4IBD A;  4DBG B;  3TPZ A;  4P17 A;  4GEW A;  3GRV A;  1ZV1 A;  3KSJ A;  3LCU A;  1W5T A;  4RF1 A;  4FCT A;  1IN6 A;  4LCB A;  1QUS A;  4RNA A;  2CHG A;  2RKO A;  3FRI A;  5KO3 A;  2Y21 A;  1OQY A;  3B7Q A;  4IBC A;  3HHY A;  3WHK A;  3T15 A;  4D82 A;  3JR4 A;  3U5Z B;  2EKK A;  3HJS A;  2XFT A;  4DV1 M;  3DFZ A;  3W0F A;  1QZE A;  4MGZ E;  2HKJ A;  2EJS A;  1N32 M;  1VG5 A;  2XFS A;  4D80 A;  4DR1 M;  4FCV A;  2K47 A;  4Z8X A;  3VDU A;  1Q39 A;  3ZH9 B;  2W82 A;  3CGW A;  4B3M M;  2Z3X A;  4BB9 A;  1QZM A;  2OPF A;  4DV6 M;  3AV0 A;  4F2L A;  4MGY E;  3AL0 C;  4UN2 B;  2XH9 A;  3K92 A;  3K9P A;  1XB2 B;  2F5N A;  3SAS A;  3U6C A;  1SXJ E;  3HWS A;  1NVM A;  4OVZ B;  2LXE A;  4W5W A;  1YLA A;  3AKZ A;  1WR1 B;  2DWM A;  3SYK A;  1ORY B;  3UJN A;  4YHH M;  1NY5 A;  1G8P A;  4IIW A;  5ITT A;  1NV8 A;  4LF4 M;  5EXX A;  1EE8 A;  2R4J A;  3GLI E;  2KZU A;  3NWL A;  4R71 A;  2F4V M;  3RGS A;  1IFY A;  2QBY B;  4IBK A;  1IN4 A;  1KFV A;  4MM3 B;  3U61 A;  3SMS A;  1OKS A;  2ZTD A;  4K0K M;  4NOO B;  4IBI A;  4M0W A;  5BR8 M;  3QAU A;  2CV0 A;  5ITR A;  1NNJ A;  2Y0T A;  4M0D A;  1IXZ A;  1QYR A;  4B3T M;  2Q2E B;  5DYI A;  4NRW A;  3T1Y M;  1J7K A;  3B74 A;  3J7B A;  1F4I A;  1PJS A;  3HGI A;  3I51 A;  4G3O A;  4NRV A;  1WHC A;  2BJW A;  2KNV A;  2XSZ D;  4S12 A;  4DV2 M;  1NY6 A;  1IXS A;  4DV7 M;  2ZTC A;  3GLI B;  2QPA A;  3GLF E;  3T1H M;  1TR8 A;  3JAM S;  2ZAN A;  1OJL A;  3T6P A;  1HR0 M;  4B08 A;  2LHC A;  2YR0 A;  1NO1 A;  3CTW B;  2K9D A;  1W5S A;  2ERC A;  3VKH A;  1XXH E;  4JI8 M;  5EP4 A;  2G3Q A;  1A5T A;  2BWB A;  1R2Y A;  1MU5 A;  1V92 A;  2GNO A;  3KOZ E;  3LQQ A;  1QAQ A;  1AIP C;  2D7G A;  2R62 A;  1L2B A;  3L28 A;  2DI0 A;  1HNX M;  1IY1 A;  4MGK E;  3GLH E;  3D8B A;  2M5Z A;  1C7Y A;  2DWN A;  2F5Q A;  5EXP A;  4LFC M;  1QAN A;  2YNM D;  5EXT A;  3ZC7 B;  1GJS A;  5JI2 E;  1SG9 A;  5GKN A;  3D8L A;  3KVW A;  3R8F A;  4JI3 M;  2VF8 A;  1PJQ A;  3GLF B;  2ZAO A;  2P5T A;  2WZJ A;  3OTO M;  2JY5 A;  3ZQJ A;  1TDH A;  4GHL A;  2UXB M;  2DKL A;  2FS1 A;  2MGW A;  2RRU A;  3B9P A;  3FKE A;  3M6A A;  4KLN A;  2KZS A;  2C9O A;  1EIJ A;  3KS4 A;  1XXH B;  4WUR A;  1E94 E;  7CAT A;  3UZU A;  4M9X A;  3AOG A;  2OQ4 A;  2DAK A;  1DV0 A;  4QOS A;  2LNH C;  3U6M A;  4QNR A;  3GLH B;  3EIE A;  4DR7 M;  2V1U A;  1HQC A;  1ZQ9 A;  1RU3 A;  2G8L A;  3KDS E;  3PNY A;  4LZZ A;  2DHR A;  3DA1 A;  3A46 A;  2VQF M;  1N78 A;  4BLC A;  4GHA A;  2C96 A;  4FWD A;  2KRU A;  2KDL A;  4I4L A;  4L8R C;  2R4E A;  3SAU A;  1HQY E;  1SXJ C;  2FFJ A;  4DR3 M;  4LJA A;  2BJV A;  2DHY A;  2DWZ B;  2LVQ D;  4I5S A;  3SHG B;  4DV5 M;  1ZMV A;  2DAM A;  2RGH A;  4MH0 E;  4JI1 M;  1Z5A A;  3J7A S;  3HU1 A;  1Q02 A;  1IBM M;  3GPP A;  4LG2 A;  5C18 A;  3SAV A;  1IN5 A;  1Y8G A;  1N75 A;  1QQW A;  2O25 A;  2QEN A;  3ZCB B;  4FVM A;  3KP1 E;  3AOE A;  4X62 M;  3GQ4 A;  1G41 A;  2FE8 A;  2UXD M;  1QAO A;  1DGH B;  2DAE A;  3HHX A;  1YSY A;  2XZF A;  3J81 S;  4DUZ M;  1OFH A;  2CFO A;  1GLN A;  3E9S A;  2F5O A;  1V33 A;  1L2D A;  4XGI A;  2LTU A;  2HCB A;  3AJI B;  3C9P A;  2WSE F;  2XSZ A;  1GJT A;  3A45 A;  3B7Z A;  1G71 A;  4LJ4 A;  3H4M A;  3GO8 A;  3L25 A;  2XF3 A;  1L1Z A;  2X4A A;  2CV2 A;  3SAT A;  2JA2 A;  4YY3 M;  1Z6T A;  4AI6 A;  2H5X A;  2Z4S A;  3BOS A;  5H37 D;  4LF7 M;  3FUX A;  2JZ1 A;  3LMM A;  3HJQ A;  1GVN A;  5FTL A;  3CF0 A;  1QUT A;  2JUJ A;  3KOX E;  3MJ5 A;  4QNM A;  3HY5 A;  5ITY A;  4RF0 A;  3W0L B;  1OIP A;  4LGY A;  3KOW E;  3FD9 A;  1OFI A;  3U5Z A;  1J5E M;  3IG8 A;  4NC6 A;  1PJI A;  4DR5 M;  1BVS A;  1Z59 A;  1HT1 E;  1R7R A;  3WHL A;  1TH4 A;  2Y0Q A;  3U60 B;  4KHP M;  1GL6 A;  1AUA A;  2J7N A;  1PJT A;  2LWX A;  3SYL A;  4JI5 M;  4OX9 M;  2KHH A;  4GC5 A;  5LMN M;  3GRY A;  5E26 A;  4BBA A;  2C99 A;  3U60 A;  3RE8 A;  3I4V A;  2X49 A;  4NXN M;  1NJG A;  2J5Y A;  4OVZ A;  3HZJ A;  4G4N A;  1IM2 A;  1SXJ B;  4KT0 F;  3GP1 A;  5IZ7 D;  2J7O A;  3I01 M;  2Z7J A;  4IBE A;  1V34 A;  2LH0 A;  3K1J A;  4LFA M;  2DXI A;  4JYA M;  1QDT A;  1XNQ M;  4G4Q A;  4HL4 A;  4LZJ A;  1JQJ C;  1E32 A;  3HU3 A;  3A98 B;  2H1R A;  3ILK A;  5KQD A;  1WXQ A;  1OAO C;  3HU2 A;  5EXS A;  1WJ7 A;  2DAG A;  3J2P B;  1JR3 D;  2D7E A;  4AG5 A;  3UGJ A;  3NBI A;  3TQS A;  4CIZ A;  1XNR M;  3TL4 X;  2QZ4 A;  2ZM6 M;  2DNA A;  4ZPX A;  4B3S M;  3FUW A;  3W67 A;  1VEK A;  3Q8G A;  5LMU M;  2D7H A;  4GKJ M;  2Z8Y M;  5ITX A;  2QHO B;  3TWK A;  4LJ7 A;  4PT5 A;  1ZMU A;  1GAB A;  4AW4 A;  4LJ9 A;  2DAI A;  2I7P A;  2DWL A;  3J80 S;  3GLI A;  3AFH A;  4OU7 A;  2MJ5 B;  4G6Z A;  3CF2 A;  1DO2 A;  1KYI A;  2Y20 A;  3Q8X A;  1MJG M;  3THG A;  1MN3 A;  1WGL A;  2R6F A;  4IJF A;  4LRT A;  4JI0 M;  1Q3B A;  2O01 F;  3GLG A;  1PJJ A;  3PNV A;  3MMP A;  2L2D A;  4CHT B;  2LVP C;  2QNJ A;  3FE3 A;  5DYG A;  1IBL M;  4L16 A;  5FTK A;  1WIV A;  1XWI A;  4B3R M;  2R45 A;  4ITQ A;  2CEA A;  1L2C A;  4AKG A;  1I94 M;  4IBB A;  4M9Z A;  3UK6 A;  2YFQ A;  1NV9 A;  3IEC A;  3HJ8 A;  4M9S A;  2CUZ A;  3GQ5 A;  3U6Q A;  4MB7 A;  4P16 A;  1UFZ A;  2LVO C;  1DGB A;  1DGF A;  1XHB A;  4FCW A;  2X8A A;  4LFB M;  5IT9 S;  1R2Z A;  4Q7J A;  1R4G A;  4GKK M;  3GLF A;  1NNU C;  1HJP A;  5FTN A;  1TF0 B;  3GPU A;  3GPY A;  2F5P A;  1Z5C A;  5FSW A;  4JI4 M;  1T43 A;  1UM8 A;  2R46 A;  4REZ A;  4LRS A;  3VLF B;  3DZD A;  3MK6 A;  1XXH A;  4GC9 A;  2MR9 A;  5FLX S;  4AQY M;  2JWS A;  4MGI E;  1SXJ D;  2O5R A;  4CJ6 A;  4PDG A;  4G4O A;  3PVS A;  4L15 A;  3LW5 F;  1CUK A;  3VK8 A;  1PM5 A;  1N34 M;  5BPV A;  2GQF A;  1L1T A;  2BNK A;  4L4U A;  3SFZ A;  4KO8 A;  5ITQ A;  4WP2 A;  3PXG A;  4AKI A;  2VF7 A;  3GLH A;  1HNW M;  1IY0 A;  3GRU A;  1LTM A;  3M7G A;  2V1C A;  1K3X A;  4JI7 M;  3CF6 E;  2CV1 A;  3KFU G;  2FNA A;  2LHG A;  2CWB A;  4DR6 M;  4KOD A;  2L7I A;  1MX0 A;  3SAW A;  1N36 M;  3IG5 A;  5KPZ A;  8CAT A;  2ZBK B;  3E4R A;  4I81 A;  3A42 A;  4Y28 F;  4B7G A;  5EP2 A;  3EIH A;  1NSF A;  1ZMW A;  4XK8 F;  1GKI A;  1Z5B A;  4II7 A;  3E21 A;  2OOA A;  3GPX A;  1D0M A;  1KSF X;  2UU9 M;  1GO5 A;  4AG6 A;  1YE9 A;  1VEG A;  2UUB M;  4IJE A;  2JY8 A;  3FUU A;  3QYB A;  2KA6 B;  4CGY B;  4LF5 M;  2CE7 A;  1N33 M;  4D81 A;  2LVA A;  3C3E A;  3U6D A;  2R18 A;  4R3D A;  2XGN A;  3M0E A;  1JR3 A;  4ANR A;  2L09 A;  1R5L A;  3FUV A;  4DV4 M;  5FTM A;  4JI6 M;  1DGH A;  1IBK M;  2N35 A;  3FTD A;  1T3T A;  2CP8 A;  3MHV C;  4JV5 M;  4G4R A;  4NL4 H;  4DV3 M;  5F3W A;  2DZL A;  4DR4 M;  1J09 A;  4L6V 6;  1G3I A;  4X66 M;  1IN7 A;  3DOA A;  3F92 A;  2HL7 A;  1VQ1 A;  2APL A;  3FYC A;  4X65 M;  2JP7 A;  3L27 A;  3LVW A;  2VDB B;  3K9O A;  2WSC F;  1GL7 A;  4B7H A;  2B3T A;  2WSF F;  3HHZ A;  3FTC A;  2CHQ A;  3H4J A;  2DZN B;  3RFW A;  5EJC A;  4QHT A;  3KSX A;  4AZF A;  2KNA A;  5DNY A;  3U61 B;  1TDZ A;  3B89 A;  3KP0 E;  3QWL A;  2BWE A;  2NQ8 C;  3SAR A;  5A2Q S;  4HLQ A;  4IBJ A;  3L26 A;  3VK7 A;  1HT2 E;  4DV0 M;  2C5R A;  4LF9 M;  3I04 M;  1DGG A;  3FRH A;  4PD2 A;  1E9R A;  2FH0 A;  2C98 A;  3U6E A;  1EFU B;  1FJG M;  4JXJ A;  5ITX E;  2VQE M;  4MGH A;  2HHH M;  4LJ6 A;  4R7G A;  3SC3 A;  1XC8 A;  1NHG C;  1TGU A;  1I4W A;  3LVV A;  2FOI C;  4GRI A;  4B7F A;  1XMO M;  4GIT A;  2EA0 A;  5DFL A;  1X37 A;  1OAI A;  3U6L A;  2L6O A;  3V76 A; 
#chains in the Genus database with same CATH homology
 2CRU A;  2K6B A;  2FH0 A;  2JXN A;  1EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...