2CRUA

Solution structure of programmed cell death 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGLRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 5
publication title Solution structure of programmed cell death 5
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2cruA01
1EIJA 2FH0A 2JXNA 2CRUA 2K6BA
chains in the Genus database with same CATH superfamily
3SAUA 2CV2A 4B7FA 2JP7A 1NY6A 4JN6A 3GLGE 4FD2A 1DGGA 3TWKA 1HT2E 4G4NA 1XXHE 1W5SA 4KT0F 4B3TM 2C5RA 1P3QQ 2L4EA 5KPRA 4DV0M 2XLJA 3KW6A 4JXJA 4FWHA 3U6PA 2MH8A 2DAGA 3IG8A 1GVNA 2F5NA 1YLAA 1K82A 4DR7M 4M9ZA 3PNYA 2L2DA 4M9SA 2G8LA 3Q8GA 1ORYB 4IBJA 3GLHA 3VDUA 1PJQA 2RKOA 4NRVA 1NHWC 2KHHA 2I7PA 2NQ8C 2Y21A 2UU9M 4D81A 4MGIE 2F5OA 5DYIA 4JI4M 3HU1A 3HU3A 1PJJA 3E9SA 4OU7A 2CP8A 4G4OA 2HCBA 2Y20A 2ZTCA 5EP4A 2DZNB 3AL0C 4NSOB 4AI6A 1TDHA 1Z5CA 2N35A 3W0FA 2Y0TA 4R71A 2KEBA 2YNMD 2ZAMA 2BJWA 2K47A 4GHLA 3I51A 2JWSA 1DGBA 3HGIA 3HY5A 5E26A 3W67A 1XXHB 4LF4M 4F2LA 3J2PB 3J81S 4LY6A 4QNMA 5IT9S 4WW0A 3U5ZB 1R2YA 1QZMA 2FFJA 1Z59A 4GITA 4M9XA 3KVWA 2RRUA 3FUVA 3HKPA 2JY5A 3KP1E 5ITYA 2FNAA 2OPFA 4G3OA 5EQTA 1V34A 1KYIA 4MGKE 3GPXA 1I94M 4AKGA 4I8OA 3JR4A 4P17A 7CATA 4ZPXA 3L27A 3MHVC 3VK8A 2DAEA 1DO2A 3GQ4A 3U6SA 1MX0A 2JNHA 3RFWA 2CHVA 3GPPA 4PDIA 1QDRA 4KHPM 1YUBA 2XSZD 3OTOM 1G3IA 4JI0M 1ZMVA 4NXNM 1MJGM 3TWLA 5GKNA 2WSFF 2MGWA 1X37A 3K9PA 3F92A 1R6BX 3HZJA 4GH9A 4QHSA 2O5RA 2OOAA 5E6JA 3GLGA 4IBDA 1XXHA 2EKKA 4ANRA 5FTKA 5H37D 1KFVA 5JI3E 1E94E 3D8LA 2DWNA 2BNKA 3U5ZA 4R3DA 1XC8A 2QZ4A 3CF2A 3KSXA 1QANA 2L4FA 3M6AA 1R2ZA 2VQFM 4RF1A 3U6QA 3A98B 2JA2A 3SARA 1SXJD 1IXZA 2C96A 2Z4SA 4QNRA 2D7GA 4AQYM 2CRUA 1G4AE 3THGA 3GLIB 1QAMA 4LRTA 3E4RA 3KOWE 4IBBA 4Q7JA 2UUAM 1AIPC 3K2LA 1Z6TA 3UGJA 4FCTA 3TWMA 5JI2E 4NOOB 4IJFA 3B89A 3HX3A 1OKSA 4PCZA 5FTMA 3RGSA 3L2AA 1G59A 2QBYB 3J7BA 3K1JA 1NHGC 4B3RM 3HHYA 1MN3A 2OOBA 1L1TA 1TGUA 2KNVA 1ZAEA 4MGZE 3U60B 4UN2B 3FUUA 3HJ8A 3E46A 1H6UA 1NVMA 3M7GA 5FSWA 1IXSB 1N36M 2XZUA 2EJSA 3T38A 2XZFA 4JI2M 4YHHM 4B3SM 1WXQA 1C7YA 4LF8M 1E9RA 2EKFA 3U61B 2UXCM 1NO1A 4RKUF 2JY7A 5KO3A 2WSEF 1Q3CA 3KP0E 3GRUA 5ITXA 2OO9A 2DAMA 3A42A 2LXEA 2CHGA 3I4YA 4LGMA 3VLFB 4GKKM 2G5GX 4AG5A 4D80A 4CHTB 2KNZA 4NRWA 4LFBM 1OTRA 5L8RF 4IJEA 3VDPA 4I4LA 2ZANA 2R62A 4HL4A 4PDGA 1TH2A 1XHBA 3U6MA 3I4VA 1AUAA 1TR8A 1OJLA 3SBJA 3TE6A 1NY5A 1DGHA 1QUSA 2QENA 4FW9A 2LHGA 5EXPA 2DWLA 1N34M 3C9PA 2QCUA 1IN6A 2DZLA 3QAUA 2LWXA 4X65M 1L2DA 2QBYA 1HNWM 2KRUA 4BLCA 4GEWA 4S12A 3FTDA 1NSFA 4WP2A 1IBMM 1Q39A 1T43A 4LG2A 3U60A 3KOYE 3JAMS 5EP2A 2L09A 2DZOB 2DWMA 2F5QA 3HJQA 3FYDA 1PJSA 2RGOA 3VFDA 3C3DA 1GABA 1I4WA 2QHOB 3KOXE 3AKZA 3SAVA 1VDDA 4JI8M 2KA6B 1WGNA 3U61A 2Q2EB 4MB7A 2DAIA 4DV6M 2JY8A 5FTNA 5LMNM 4Z6YA 1XB2B 4LJ5A 2MROB 5KPTA 2KZUA 4GIPA 2L7HA 3GO8A 1UM8A 1WR1B 4BB9A 1WGLA 5LMUM 4DR5M 3U6LA 1NV9A 4ITQA 1R5LA 1QYRA 3B9PA 1HJPA 4XBOA 1EFUB 4AW4A 2R4JA 4WURA 4IBIA 4F1IA 2DVWB 3DA1A 1N78A 4KO8A 4GRIA 4YY3M 3VK7A 1EIJA 2FH0A 3K9OA 2YFQA 1R7RA 4Z8XA 3ZC7B 4X62M 1SXJB 1CUKA 1SG9A 4XK8F 4DR4M 4JYAM 1NJFA 4IBFA 3J27B 2P5TA 4IBGA 2WSCF 4JI7M 1QQWA 3FD9A 4LJAA 4W5WA 1J5EM 2VDBB 2ZM6M 2KXEA 3SYKA 5IZ7D 5F3WA 4AG6A 3GLIE 1L2BA 1VG5A 4IBEA 2XF3A 4NXMM 1T3TA 1XNRM 2YR0A 3HJSA 2AHMA 4B08A 3KS8A 3U6EA 3BXWA 3FYCA 3SAWA 2RGHA 2R6FA 2D7EA 1ZV1A 2UUCM 2I7NA 3U6OA 2R45A 1DGFA 5EP3A 2A5YB 4FWGA 4DV5M 1Y8GA 1VEGA 2R18A 3LQRA 2J7NA 1GJTA 2FOIC 3HWSA 4MH0E 5IWAM 2Z7JA 3Q8XA 3K92A 5EXSA 2JY6B 1IBKM 1V92A 1JR3D 2Y0QA 1GO5A 4NL4H 4BBAA 1OAIA 3BOSA 5ITUA 1DV0A 3NBIA 4AKHA 5FLXS 2XFTA 3DOAA 5EXXA 2CE7A 4PD2A 3MJ5A 2DENA 4OX9M 3MK6A 5ITRA 2HAKA 2FE8A 3AJIB 3R8FA 1V33A 4FCWA 2LVNC 4A3VB 5KQ8A 1QUTA 1IY0A 2UXDM 4DBGB 1E32A 4AKIA 3B7ZA 3QYEA 3D8BA 1L8QA 3L28A 2MJ5B 4JI3M 1Q3BA 4OW0A 4DUYM 2ZBKB 4B7GA 4QOZC 2K0BX 2QQ8A 3CGWA 2EA0A 1GJSA 3K8ZA 2XH9A 4P16A 4LJ6A 4GHAA 2HL7A 5DFLA 2M5ZA 3FUTA 1MU5A 3JR5A 1VEKA 1ZMUA 3NBXX 3U6CA 3T1YM 1N33M 2Z4RA 3C3EA 2VQEM 2DXIA 1ZMWA 3FKEA 1L2CA 3T6PA 2CUZA 2R4EA 2H5XA 1NV8A 4L78A 4JV5M 1G41A 2VF8A 1NNJA 2C9CA 3IG5A 3B7QA 3KOZE 2R0IA 3UK6A 4EIWA 2F5PA 2JZ0A 2GQFA 2JXNA 4LGYA 5C18A 2HKJA 2R65A 3HHWA 3LQQA 4LJ4A 2VIIA 1VQ1A 4KLNA 4Y28F 4CGYB 2JZ1A 1LV7A 1TH4A 2CFOA 1IN7A 1OQYA 2W82A 3L29A 3IECA 4G4QA 1PJIA 3H4JA 1N32M 2LVQD 1HNXM 1TTEA 5A2QS 4R7GA 2EUCA 1PGYA 2O01F 1JR3E 5ITTA 5FTLA 4M0WA 3L25A 2YQZA 1TH3A 2DHRA 2LTUA 1SXJC 4CISA 2ERCA 4PT5A 4CJ6A 5DNYA 1GLNA 3LCVB 3GLIA 4II7A 4DV3M 2V6ZM 2F4VM 3ILKA 2BWEA 3W68A 3UZUA 1HR0M 3FTEA 2DKLA 3A46A 1OFIA 3SATA 1PJTA 4LFCM 1S3SA 4L6V6 1SXJE 2BJVA 3TPZA 1G71A 2ZAOA 3M0EA 3RGPA 2V1UA 2DHYA 4NSRA 2OQ4A 2F5SA 1D0LA 4DR3M 2KDLA 1GKIA 4FWDA 4DUZM 1IXSA 4HEOA 3GQ3A 2LHCA 1QAOA 2H1RA 4DR2M 1OIPA 3FUXA 4I81A 1Z5BA 3GLFE 3FTCA 2QPAA 3SASA 1QAQA 4DV7M 4REZA 2BWBA 2CHQA 4L8RC 2DI0A 3T15A 3J80S 2X49A 3EIEA 2E5LM 3L26A 2L6OA 4IBCA 1UFZA 5C1BA 1FNNA 4L15A 4DR1M 1QZEA 2Z8YM 4LCBA 3B74A 2QP9X 3IHPA 3UJNA 1R4GA 5FTJA 2J5YA 8CATA 4G4RA 3A45A 3BBZA 3HU2A 5EXTA 3ZQJA 2X4AA 1YE9A 1XMQM 4XGIA 1G8PA 4G6ZA 3LVVA 2KW0A 5BR8M 4CIZA 2ZTDA 4LF9M 2LNHC 3KFUG 1IY1A 2Z3XA 3LW5F 3W0LB 4GKJM 4KODA 3VKHA 3FE3A 3FUWA 1A5TA 3GRYA 1IN5A 1IQPA 1JQJC 4LF5M 3GQ5A 2UXBM 3GLGB 3GLFB 1D2NA 2DAKA 5KPZA 3AOEC 2LBCA 3LCUA 1EE8A 4QHTA 5IREB 4HLQA 4LFAM 4JI6M 1J7KA 3CTWB 3T1HM 4LJ8A 5ITXE 1WHCA 1D0KA 2XSZA 1VDLA 3SHGB 2CV1A 2VF7A 2XEPA 2GNOA 1PRBA 4NC6A 2FS1A 5ITQA 1HNZM 3GRVA 3QWLA 1ZQ9A 4LZJA 3PVSA 1HT1E 4GC5A 3PXGA 1JR3A 2APLA 2MR9A 1PM5A 4JI5M 2G3QA 4LF7M 2QNJA 4IBKA 4IIWA 3MMPA 4DR6M 2LVOC 1HQCA 4DV4M 3KDSE 1VEJA 4I5SA 4B3MM 4RF0A 1WIVA 2XFSA 1L1ZA 3SMPA 3WHKA 1E9SA 2M60A 3FRHA 1N75A 4MGHA 3FTFA 2V1CA 3KS4A 2R44A 1SXJA 2KZSA 2LH0A 4QOSA 1TDZA 3J7AS 1OFHA 3PNVA 4X66M 1XMOM 3HHZA 3GLHE 1IN8A 1OAOC 1NNUC 1XWIA 3H4MA 2LVPC 2DNAA 3AV0A 3B7NA 1NJGA 1Z5AA 3V76A 4OVZB 4B7HA 3GLFA 1XNQM 2C9OA 3SYLA 2O25A 3EIHA 1IXRC 3GRRA 1DO0A 2D7HA 3ZCBB 1T6OA 2C98A 3AFHA 4DV2M 5DYGA 2CWBA 3GPYA 3SMSA 3WHLA 1BVSA 2LVAA 4FCVA 2CV0A 2WZJA 4LJ7A 1JB0F 1Q02A 3NWLA 4TUWA 3SC3A 3TQSA 2K6BA 1DGHB 4X64M 3FRIA 3SFZA 3VKGA 1F4IA 3KSJA 2X8AA 4LZZA 5EJCA 1K3XA 3QYBA 2CEAA 1TF0B 3LVWA 4L16A 3RE8A 2K9DA 2KNAA 4LRSA 1OIZA 2C99A 1C1KA 3GP1A 1RU3A 5EP1A 1N77A 1QVRA 2KRKA 3GPUA 4JI1M 1FJGM 5BPVA 2XGNA 1IY2A 3CF6E 3LMMA 4GC9A 2HWJA 4D82A 3U6DA 3I01M 3R9XB 4K0KM 3SHFA 1J09A 4AZFA 2L7IA 1HQYE 4L4UA 3GLHB 3HHXA 3C58A 1IM2A 4GMQA 5KQDA 4DV1M 2DWZB 2J7OA 3TL4X 3DZDA 4MM3B 3CF0A 3ZH9B 4LF6M 1KSFX 1QDTA 1IN4A 4OVZA 1GL7A 2HHHM 2QSFX 1W5TA 2JUJA 3AOGA 4MGYE 1K3WA 4FVMA 1YSYA 2EO2A 1IFYA 1LTMA 4LJ9A 3KXEC 1GL6A 2B3TA 3E21A 4M0DA 3UMMA 3AOEA 1WJ7A 1D0MA 3PFIA 2UUBM 2R46A 1IBLM 4RNAA 3I04M 3DFZA
chains in the Genus database with same CATH topology
1EIJA 2FH0A 2JXNA 2CRUA 2K6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIJ A;  2FH0 A;  2JXN A;  2CRU A;  2K6B A; 
#chains in the Genus database with same CATH topology
 3SAU A;  2CV2 A;  4B7F A;  2JP7 A;  1NY6 A;  4JN6 A;  3GLG E;  4FD2 A;  1DGG A;  3TWK A;  1HT2 E;  4G4N A;  1XXH E;  1W5S A;  4KT0 F;  4B3T M;  2C5R A;  1P3Q Q;  2L4E A;  5KPR A;  4DV0 M;  2XLJ A;  3KW6 A;  4JXJ A;  4FWH A;  3U6P A;  2MH8 A;  2DAG A;  3IG8 A;  1GVN A;  2F5N A;  1YLA A;  1K82 A;  4DR7 M;  4M9Z A;  3PNY A;  2L2D A;  4M9S A;  2G8L A;  3Q8G A;  1ORY B;  4IBJ A;  3GLH A;  3VDU A;  1PJQ A;  2RKO A;  4NRV A;  1NHW C;  2KHH A;  2I7P A;  2NQ8 C;  2Y21 A;  2UU9 M;  4D81 A;  4MGI E;  2F5O A;  5DYI A;  4JI4 M;  3HU1 A;  3HU3 A;  1PJJ A;  3E9S A;  4OU7 A;  2CP8 A;  4G4O A;  2HCB A;  2Y20 A;  2ZTC A;  5EP4 A;  2DZN B;  3AL0 C;  4NSO B;  4AI6 A;  1TDH A;  1Z5C A;  2N35 A;  3W0F A;  2Y0T A;  4R71 A;  2KEB A;  2YNM D;  2ZAM A;  2BJW A;  2K47 A;  4GHL A;  3I51 A;  2JWS A;  1DGB A;  3HGI A;  3HY5 A;  5E26 A;  3W67 A;  1XXH B;  4LF4 M;  4F2L A;  3J2P B;  3J81 S;  4LY6 A;  4QNM A;  5IT9 S;  4WW0 A;  3U5Z B;  1R2Y A;  1QZM A;  2FFJ A;  1Z59 A;  4GIT A;  4M9X A;  3KVW A;  2RRU A;  3FUV A;  3HKP A;  2JY5 A;  3KP1 E;  5ITY A;  2FNA A;  2OPF A;  4G3O A;  5EQT A;  1V34 A;  1KYI A;  4MGK E;  3GPX A;  1I94 M;  4AKG A;  4I8O A;  3JR4 A;  4P17 A;  7CAT A;  4ZPX A;  3L27 A;  3MHV C;  3VK8 A;  2DAE A;  1DO2 A;  3GQ4 A;  3U6S A;  1MX0 A;  2JNH A;  3RFW A;  2CHV A;  3GPP A;  4PDI A;  1QDR A;  4KHP M;  1YUB A;  2XSZ D;  3OTO M;  1G3I A;  4JI0 M;  1ZMV A;  4NXN M;  1MJG M;  3TWL A;  5GKN A;  2WSF F;  2MGW A;  1X37 A;  3K9P A;  3F92 A;  1R6B X;  3HZJ A;  4GH9 A;  4QHS A;  2O5R A;  2OOA A;  5E6J A;  3GLG A;  4IBD A;  1XXH A;  2EKK A;  4ANR A;  5FTK A;  5H37 D;  1KFV A;  5JI3 E;  1E94 E;  3D8L A;  2DWN A;  2BNK A;  3U5Z A;  4R3D A;  1XC8 A;  2QZ4 A;  3CF2 A;  3KSX A;  1QAN A;  2L4F A;  3M6A A;  1R2Z A;  2VQF M;  4RF1 A;  3U6Q A;  3A98 B;  2JA2 A;  3SAR A;  1SXJ D;  1IXZ A;  2C96 A;  2Z4S A;  4QNR A;  2D7G A;  4AQY M;  2CRU A;  1G4A E;  3THG A;  3GLI B;  1QAM A;  4LRT A;  3E4R A;  3KOW E;  4IBB A;  4Q7J A;  2UUA M;  1AIP C;  3K2L A;  1Z6T A;  3UGJ A;  4FCT A;  3TWM A;  5JI2 E;  4NOO B;  4IJF A;  3B89 A;  3HX3 A;  1OKS A;  4PCZ A;  5FTM A;  3RGS A;  3L2A A;  1G59 A;  2QBY B;  3J7B A;  3K1J A;  1NHG C;  4B3R M;  3HHY A;  1MN3 A;  2OOB A;  1L1T A;  1TGU A;  2KNV A;  1ZAE A;  4MGZ E;  3U60 B;  4UN2 B;  3FUU A;  3HJ8 A;  3E46 A;  1H6U A;  1NVM A;  3M7G A;  5FSW A;  1IXS B;  1N36 M;  2XZU A;  2EJS A;  3T38 A;  2XZF A;  4JI2 M;  4YHH M;  4B3S M;  1WXQ A;  1C7Y A;  4LF8 M;  1E9R A;  2EKF A;  3U61 B;  2UXC M;  1NO1 A;  4RKU F;  2JY7 A;  5KO3 A;  2WSE F;  1Q3C A;  3KP0 E;  3GRU A;  5ITX A;  2OO9 A;  2DAM A;  3A42 A;  2LXE A;  2CHG A;  3I4Y A;  4LGM A;  3VLF B;  4GKK M;  2G5G X;  4AG5 A;  4D80 A;  4CHT B;  2KNZ A;  4NRW A;  4LFB M;  1OTR A;  5L8R F;  4IJE A;  3VDP A;  4I4L A;  2ZAN A;  2R62 A;  4HL4 A;  4PDG A;  1TH2 A;  1XHB A;  3U6M A;  3I4V A;  1AUA A;  1TR8 A;  1OJL A;  3SBJ A;  3TE6 A;  1NY5 A;  1DGH A;  1QUS A;  2QEN A;  4FW9 A;  2LHG A;  5EXP A;  2DWL A;  1N34 M;  3C9P A;  2QCU A;  1IN6 A;  2DZL A;  3QAU A;  2LWX A;  4X65 M;  1L2D A;  2QBY A;  1HNW M;  2KRU A;  4BLC A;  4GEW A;  4S12 A;  3FTD A;  1NSF A;  4WP2 A;  1IBM M;  1Q39 A;  1T43 A;  4LG2 A;  3U60 A;  3KOY E;  3JAM S;  5EP2 A;  2L09 A;  2DZO B;  2DWM A;  2F5Q A;  3HJQ A;  3FYD A;  1PJS A;  2RGO A;  3VFD A;  3C3D A;  1GAB A;  1I4W A;  2QHO B;  3KOX E;  3AKZ A;  3SAV A;  1VDD A;  4JI8 M;  2KA6 B;  1WGN A;  3U61 A;  2Q2E B;  4MB7 A;  2DAI A;  4DV6 M;  2JY8 A;  5FTN A;  5LMN M;  4Z6Y A;  1XB2 B;  4LJ5 A;  2MRO B;  5KPT A;  2KZU A;  4GIP A;  2L7H A;  3GO8 A;  1UM8 A;  1WR1 B;  4BB9 A;  1WGL A;  5LMU M;  4DR5 M;  3U6L A;  1NV9 A;  4ITQ A;  1R5L A;  1QYR A;  3B9P A;  1HJP A;  4XBO A;  1EFU B;  4AW4 A;  2R4J A;  4WUR A;  4IBI A;  4F1I A;  2DVW B;  3DA1 A;  1N78 A;  4KO8 A;  4GRI A;  4YY3 M;  3VK7 A;  1EIJ A;  2FH0 A;  3K9O A;  2YFQ A;  1R7R A;  4Z8X A;  3ZC7 B;  4X62 M;  1SXJ B;  1CUK A;  1SG9 A;  4XK8 F;  4DR4 M;  4JYA M;  1NJF A;  4IBF A;  3J27 B;  2P5T A;  4IBG A;  2WSC F;  4JI7 M;  1QQW A;  3FD9 A;  4LJA A;  4W5W A;  1J5E M;  2VDB B;  2ZM6 M;  2KXE A;  3SYK A;  5IZ7 D;  5F3W A;  4AG6 A;  3GLI E;  1L2B A;  1VG5 A;  4IBE A;  2XF3 A;  4NXM M;  1T3T A;  1XNR M;  2YR0 A;  3HJS A;  2AHM A;  4B08 A;  3KS8 A;  3U6E A;  3BXW A;  3FYC A;  3SAW A;  2RGH A;  2R6F A;  2D7E A;  1ZV1 A;  2UUC M;  2I7N A;  3U6O A;  2R45 A;  1DGF A;  5EP3 A;  2A5Y B;  4FWG A;  4DV5 M;  1Y8G A;  1VEG A;  2R18 A;  3LQR A;  2J7N A;  1GJT A;  2FOI C;  3HWS A;  4MH0 E;  5IWA M;  2Z7J A;  3Q8X A;  3K92 A;  5EXS A;  2JY6 B;  1IBK M;  1V92 A;  1JR3 D;  2Y0Q A;  1GO5 A;  4NL4 H;  4BBA A;  1OAI A;  3BOS A;  5ITU A;  1DV0 A;  3NBI A;  4AKH A;  5FLX S;  2XFT A;  3DOA A;  5EXX A;  2CE7 A;  4PD2 A;  3MJ5 A;  2DEN A;  4OX9 M;  3MK6 A;  5ITR A;  2HAK A;  2FE8 A;  3AJI B;  3R8F A;  1V33 A;  4FCW A;  2LVN C;  4A3V B;  5KQ8 A;  1QUT A;  1IY0 A;  2UXD M;  4DBG B;  1E32 A;  4AKI A;  3B7Z A;  3QYE A;  3D8B A;  1L8Q A;  3L28 A;  2MJ5 B;  4JI3 M;  1Q3B A;  4OW0 A;  4DUY M;  2ZBK B;  4B7G A;  4QOZ C;  2K0B X;  2QQ8 A;  3CGW A;  2EA0 A;  1GJS A;  3K8Z A;  2XH9 A;  4P16 A;  4LJ6 A;  4GHA A;  2HL7 A;  5DFL A;  2M5Z A;  3FUT A;  1MU5 A;  3JR5 A;  1VEK A;  1ZMU A;  3NBX X;  3U6C A;  3T1Y M;  1N33 M;  2Z4R A;  3C3E A;  2VQE M;  2DXI A;  1ZMW A;  3FKE A;  1L2C A;  3T6P A;  2CUZ A;  2R4E A;  2H5X A;  1NV8 A;  4L78 A;  4JV5 M;  1G41 A;  2VF8 A;  1NNJ A;  2C9C A;  3IG5 A;  3B7Q A;  3KOZ E;  2R0I A;  3UK6 A;  4EIW A;  2F5P A;  2JZ0 A;  2GQF A;  2JXN A;  4LGY A;  5C18 A;  2HKJ A;  2R65 A;  3HHW A;  3LQQ A;  4LJ4 A;  2VII A;  1VQ1 A;  4KLN A;  4Y28 F;  4CGY B;  2JZ1 A;  1LV7 A;  1TH4 A;  2CFO A;  1IN7 A;  1OQY A;  2W82 A;  3L29 A;  3IEC A;  4G4Q A;  1PJI A;  3H4J A;  1N32 M;  2LVQ D;  1HNX M;  1TTE A;  5A2Q S;  4R7G A;  2EUC A;  1PGY A;  2O01 F;  1JR3 E;  5ITT A;  5FTL A;  4M0W A;  3L25 A;  2YQZ A;  1TH3 A;  2DHR A;  2LTU A;  1SXJ C;  4CIS A;  2ERC A;  4PT5 A;  4CJ6 A;  5DNY A;  1GLN A;  3LCV B;  3GLI A;  4II7 A;  4DV3 M;  2V6Z M;  2F4V M;  3ILK A;  2BWE A;  3W68 A;  3UZU A;  1HR0 M;  3FTE A;  2DKL A;  3A46 A;  1OFI A;  3SAT A;  1PJT A;  4LFC M;  1S3S A;  4L6V 6;  1SXJ E;  2BJV A;  3TPZ A;  1G71 A;  2ZAO A;  3M0E A;  3RGP A;  2V1U A;  2DHY A;  4NSR A;  2OQ4 A;  2F5S A;  1D0L A;  4DR3 M;  2KDL A;  1GKI A;  4FWD A;  4DUZ M;  1IXS A;  4HEO A;  3GQ3 A;  2LHC A;  1QAO A;  2H1R A;  4DR2 M;  1OIP A;  3FUX A;  4I81 A;  1Z5B A;  3GLF E;  3FTC A;  2QPA A;  3SAS A;  1QAQ A;  4DV7 M;  4REZ A;  2BWB A;  2CHQ A;  4L8R C;  2DI0 A;  3T15 A;  3J80 S;  2X49 A;  3EIE A;  2E5L M;  3L26 A;  2L6O A;  4IBC A;  1UFZ A;  5C1B A;  1FNN A;  4L15 A;  4DR1 M;  1QZE A;  2Z8Y M;  4LCB A;  3B74 A;  2QP9 X;  3IHP A;  3UJN A;  1R4G A;  5FTJ A;  2J5Y A;  8CAT A;  4G4R A;  3A45 A;  3BBZ A;  3HU2 A;  5EXT A;  3ZQJ A;  2X4A A;  1YE9 A;  1XMQ M;  4XGI A;  1G8P A;  4G6Z A;  3LVV A;  2KW0 A;  5BR8 M;  4CIZ A;  2ZTD A;  4LF9 M;  2LNH C;  3KFU G;  1IY1 A;  2Z3X A;  3LW5 F;  3W0L B;  4GKJ M;  4KOD A;  3VKH A;  3FE3 A;  3FUW A;  1A5T A;  3GRY A;  1IN5 A;  1IQP A;  1JQJ C;  4LF5 M;  3GQ5 A;  2UXB M;  3GLG B;  3GLF B;  1D2N A;  2DAK A;  5KPZ A;  3AOE C;  2LBC A;  3LCU A;  1EE8 A;  4QHT A;  5IRE B;  4HLQ A;  4LFA M;  4JI6 M;  1J7K A;  3CTW B;  3T1H M;  4LJ8 A;  5ITX E;  1WHC A;  1D0K A;  2XSZ A;  1VDL A;  3SHG B;  2CV1 A;  2VF7 A;  2XEP A;  2GNO A;  1PRB A;  4NC6 A;  2FS1 A;  5ITQ A;  1HNZ M;  3GRV A;  3QWL A;  1ZQ9 A;  4LZJ A;  3PVS A;  1HT1 E;  4GC5 A;  3PXG A;  1JR3 A;  2APL A;  2MR9 A;  1PM5 A;  4JI5 M;  2G3Q A;  4LF7 M;  2QNJ A;  4IBK A;  4IIW A;  3MMP A;  4DR6 M;  2LVO C;  1HQC A;  4DV4 M;  3KDS E;  1VEJ A;  4I5S A;  4B3M M;  4RF0 A;  1WIV A;  2XFS A;  1L1Z A;  3SMP A;  3WHK A;  1E9S A;  2M60 A;  3FRH A;  1N75 A;  4MGH A;  3FTF A;  2V1C A;  3KS4 A;  2R44 A;  1SXJ A;  2KZS A;  2LH0 A;  4QOS A;  1TDZ A;  3J7A S;  1OFH A;  3PNV A;  4X66 M;  1XMO M;  3HHZ A;  3GLH E;  1IN8 A;  1OAO C;  1NNU C;  1XWI A;  3H4M A;  2LVP C;  2DNA A;  3AV0 A;  3B7N A;  1NJG A;  1Z5A A;  3V76 A;  4OVZ B;  4B7H A;  3GLF A;  1XNQ M;  2C9O A;  3SYL A;  2O25 A;  3EIH A;  1IXR C;  3GRR A;  1DO0 A;  2D7H A;  3ZCB B;  1T6O A;  2C98 A;  3AFH A;  4DV2 M;  5DYG A;  2CWB A;  3GPY A;  3SMS A;  3WHL A;  1BVS A;  2LVA A;  4FCV A;  2CV0 A;  2WZJ A;  4LJ7 A;  1JB0 F;  1Q02 A;  3NWL A;  4TUW A;  3SC3 A;  3TQS A;  2K6B A;  1DGH B;  4X64 M;  3FRI A;  3SFZ A;  3VKG A;  1F4I A;  3KSJ A;  2X8A A;  4LZZ A;  5EJC A;  1K3X A;  3QYB A;  2CEA A;  1TF0 B;  3LVW A;  4L16 A;  3RE8 A;  2K9D A;  2KNA A;  4LRS A;  1OIZ A;  2C99 A;  1C1K A;  3GP1 A;  1RU3 A;  5EP1 A;  1N77 A;  1QVR A;  2KRK A;  3GPU A;  4JI1 M;  1FJG M;  5BPV A;  2XGN A;  1IY2 A;  3CF6 E;  3LMM A;  4GC9 A;  2HWJ A;  4D82 A;  3U6D A;  3I01 M;  3R9X B;  4K0K M;  3SHF A;  1J09 A;  4AZF A;  2L7I A;  1HQY E;  4L4U A;  3GLH B;  3HHX A;  3C58 A;  1IM2 A;  4GMQ A;  5KQD A;  4DV1 M;  2DWZ B;  2J7O A;  3TL4 X;  3DZD A;  4MM3 B;  3CF0 A;  3ZH9 B;  4LF6 M;  1KSF X;  1QDT A;  1IN4 A;  4OVZ A;  1GL7 A;  2HHH M;  2QSF X;  1W5T A;  2JUJ A;  3AOG A;  4MGY E;  1K3W A;  4FVM A;  1YSY A;  2EO2 A;  1IFY A;  1LTM A;  4LJ9 A;  3KXE C;  1GL6 A;  2B3T A;  3E21 A;  4M0D A;  3UMM A;  3AOE A;  1WJ7 A;  1D0M A;  3PFI A;  2UUB M;  2R46 A;  1IBL M;  4RNA A;  3I04 M;  3DFZ A; 
#chains in the Genus database with same CATH homology
 1EIJ A;  2FH0 A;  2JXN A;  2CRU A;  2K6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...