2CRUA

Solution structure of programmed cell death 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GSSGSSGLRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of programmed cell death 5
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 5
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2cruA01
2FH0A 2K6BA 1EIJA 2JXNA 2CRUA
chains in the Genus database with same CATH superfamily
3JR5A 3GRVA 4CIZA 5EXTA 4DR2M 2CEAA 1OQYA 2HL7A 2M5ZA 2R44A 4MH0E 2XFSA 3FKEA 3V76A 1N32M 3J2PB 2K0BX 3AFHA 3A45A 1YLAA 4Z6YA 3GPUA 5LMNM 1NY5A 1VDDA 1IY2A 1NVMA 1UM8A 3HGIA 3HU2A 4R3DA 3RGPA 2VQEM 3EIHA 3GQ3A 2DHRA 5DYGA 3VDPA 1G59A 5DNYA 2XSZA 2G8LA 4IBGA 3J80S 1HR0M 3AL0C 1WGNA 2GNOA 3U6QA 5EQTA 1R6BX 4NSOB 5C18A 3FUUA 3J81S 5ITRA 2DAEA 2UXBM 4AKIA 4Z8XA 3GLFA 1OIZA 1SXJE 4XGIA 1XXHB 1R2ZA 2RRUA 2G5GX 3UK6A 4GHAA 2EJSA 5EXSA 1XMQM 2UXDM 4GHLA 3RFWA 2L2DA 4LRSA 1FJGM 1EIJA 2J7NA 3LCUA 2DVWB 4AQYM 2NQ8C 2WSEF 2DAGA 3E4RA 5C1BA 4I5SA 3VK8A 2C5RA 1VDLA 5ITXE 3U6SA 3L25A 1YSYA 4X66M 1OFIA 3MJ5A 1HT2E 2R6FA 2Z4SA 2UU9M 2JUJA 2JY8A 1N77A 1PJIA 2R45A 2LVOC 3MK6A 1RU3A 1E9RA 4KLNA 4FVMA 1NJFA 3JR4A 2MGWA 2FS1A 1SG9A 2DAMA 4Q7JA 3I01M 3FD9A 3L28A 5DFLA 2Y0TA 3CF0A 3K9PA 3RGSA 2X8AA 1GVNA 3PFIA 5FTNA 3WHLA 4Y28F 2WSFF 1GJTA 3U6MA 3HU3A 3LMMA 3SC3A 4IBFA 1N36M 1XXHA 3AV0A 4OW0A 5KPRA 3UGJA 3LCVB 1S3SA 3TE6A 1C1KA 2CHGA 3LVWA 4L4UA 3M7GA 3L26A 1IBLM 2CRUA 1R4GA 3BXWA 3SMPA 3TL4X 3GLHE 5LMUM 1GABA 3KVWA 4LF7M 2QNJA 2OO9A 2YQZA 3C3EA 1MJGM 1E32A 2H1RA 2H5XA 2O01F 3E21A 4KODA 2CV0A 1IFYA 2JZ1A 2APLA 3H4MA 4PDGA 4DV7M 4FCTA 4L15A 2V1UA 3CGWA 2F5PA 5ITQA 3SARA 4PCZA 4LFBM 2JZ0A 2L09A 4BLCA 4JI5M 4QNRA 2CUZA 2F5NA 4FCVA 4I4LA 1E9SA 1QANA 2QSFX 1NY6A 1C7YA 3AOGA 4AKGA 4L6V6 4B7GA 1XNRM 3GLGE 2CV1A 1Q39A 4B7FA 4RNAA 4L78A 2DXIA 3GQ5A 4QOSA 3FTDA 1PJJA 4P17A 2CP8A 2OQ4A 4A3VB 3SATA 5EP1A 1NV9A 3U6LA 3DA1A 3IG5A 3F92A 4G4OA 4IBIA 4QNMA 1NJGA 3LQQA 1N78A 2JXNA 2KHHA 3IG8A 1DO2A 1DGGA 1HQCA 2QP9X 4FWHA 4IBBA 4ZPXA 4P16A 4DV5M 2W82A 3B89A 1L8QA 2JY6B 4OVZB 4RF0A 2Y0QA 4ITQA 1NNUC 2DKLA 3HKPA 1KYIA 4WW0A 1WGLA 3THGA 4M9XA 3SASA 2LHGA 3CF2A 1DGHB 1VEGA 4X62M 3L27A 1FNNA 4GMQA 3I4YA 4JV5M 2V6ZM 3DOAA 4NRVA 3U6OA 3GQ4A 1EFUB 5IREB 1G71A 2D7EA 4OX9M 3D8LA 2ZM6M 3HHXA 3GO8A 4X65M 4LRTA 3KSXA 2KA6B 4FD2A 4GEWA 4CJ6A 2F5QA 2N35A 3EIEA 4JI3M 2EO2A 4LF4M 1Q3BA 2X4AA 4QHTA 2KRKA 4NRWA 4NOOB 2AHMA 3PVSA 5EP4A 1NO1A 1XWIA 3U6PA 2LBCA 3GP1A 1ZMWA 3HHWA 1K3WA 2CHQA 1D0MA 3TWLA 2JY7A 1GL6A 2A5YB 2M60A 4G3OA 1OIPA 4M9SA 2I7PA 3LVVA 4AG5A 2KNAA 4D82A 4DBGB 5ITXA 1L2BA 4LY6A 1DGFA 2KNVA 3ZH9B 4KO8A 1SXJD 1WJ7A 3QWLA 2ERCA 1J5EM 4K0KM 3I4VA 3KDSE 3AJIB 1TDHA 2BNKA 5IWAM 4AI6A 4M0DA 2FH0A 1IXZA 1D2NA 3GLGB 2C9OA 2ZAMA 1QDRA 1PJSA 3I51A 3HJSA 1OJLA 4LGYA 2FE8A 4WP2A 1WXQA 3E9SA 3J27B 2B3TA 1HQYE 5EXPA 4AG6A 1OAOC 1V33A 2DI0A 1P3QQ 1AUAA 1HNZM 1ZMVA 1NHGC 3HWSA 1D0LA 2DNAA 3VFDA 5EP3A 4TUWA 4M0WA 2XZFA 1Q02A 2YFQA 1IN5A 3U6EA 4LJ9A 4PDIA 1GL7A 2JNHA 3NWLA 4LJAA 5FTJA 5FTKA 1L1TA 3FTFA 4L16A 4MM3B 3QYEA 2HCBA 3Q8GA 1TR8A 5GKNA 1T3TA 3GLIE 3J7BA 1YE9A 3ZQJA 4IBDA 5EJCA 3GPPA 2HAKA 2LVPC 2CWBA 2R65A 3GLHA 2XH9A 1Z5AA 3SFZA 1NV8A 4JI6M 1GKIA 5EXXA 1J7KA 1WR1B 1JR3A 1IXRC 4LG2A 3FUWA 4CGYB 3R9XB 3PXGA 1HNXM 4G4QA 4F1IA 1IN8A 4R7GA 4LJ4A 4AZFA 1KFVA 1TGUA 3GRYA 1EE8A 2JY5A 4B7HA 4MGYE 1OFHA 1R7RA 3FUXA 1R2YA 1XC8A 1F4IA 3TQSA 2CV2A 4LFCM 1DGBA 3K92A 4GIPA 4G4NA 1N75A 2MROB 4R71A 3T1HM 4DR1M 2LXEA 3FYDA 2KZUA 2ZAOA 4D80A 4GKKM 3TPZA 4BBAA 2R18A 3AOEA 4MGHA 1CUKA 2FNAA 2LNHC 4W5WA 4DR5M 4LJ8A 2P5TA 3Q8XA 3NBXX 3K9OA 2VDBB 3B7ZA 4DR7M 2GQFA 2QHOB 4JI8M 2VF8A 2DZOB 3B7NA 1H6UA 2X49A 2HWJA 5FTMA 1NHWC 2BJWA 2D7GA 1IQPA 2O5RA 4IBJA 1W5SA 5EP2A 4D81A 4AKHA 3VK7A 1AIPC 3KFUG 4MGZE 1UFZA 1X37A 1TDZA 2Z8YM 3SYKA 4OU7A 1PM5A 4B08A 4LJ7A 2Y20A 4IBEA 1L2CA 1E94E 1SXJA 2KXEA 3W67A 3AKZA 4B3SM 2R0IA 3HY5A 4FCWA 3QYBA 2DAIA 5E6JA 1ZV1A 1QAQA 5FLXS 3U60A 1G3IA 1Y8GA 2D7HA 4QHSA 4L8RC 4RF1A 3W0FA 1PJQA 3L2AA 3GPXA 1BVSA 1Q3CA 3GLIA 1I4WA 2LVNC 3C9PA 5KQ8A 3LQRA 1VG5A 3GPYA 3KP0E 4FWDA 3SAUA 1N34M 2CFOA 3IECA 3KS4A 3U5ZA 3HJ8A 3M6AA 1IXSA 2RGOA 2DWNA 3U61A 2C99A 2L4EA 4NSRA 4NXNM 1QUTA 2R62A 1YUBA 1VEJA 4M9ZA 5KPTA 3W68A 4LF8M 1TH3A 1N33M 1OKSA 3DZDA 3K8ZA 3KP1E 2K9DA 1K82A 2XEPA 3RE8A 4DV2M 1VQ1A 4LZZA 3U61B 4HEOA 4ANRA 1IXSB 3W0LB 3B74A 3SHFA 1NNJA 1J09A 4GKJM 2HKJA 3L29A 4RKUF 1T43A 4KHPM 1TH2A 4NC6A 3GRUA 3SBJA 4LF9M 4QOZC 1Z6TA 4FWGA 4UN2B 4DR6M 5IT9S 3WHKA 2EKFA 2DWLA 2K6BA 2JP7A 3FUVA 4KT0F 3T1YM 1T6OA 3SHGB 1GLNA 2XF3A 3HZJA 2C98A 2FFJA 3KSJA 1XXHE 3A42A 1IBMM 1SXJB 2QBYB 2C96A 4MGIE 1VEKA 2E5LM 1OTRA 4LGMA 2DHYA 3A46A 1QDTA 4DV3M 3C3DA 3GRRA 4GH9A 5L8RF 3KOXE 4XK8F 3ZC7B 4LFAM 2RGHA 2V1CA 3UZUA 2Y21A 3UJNA 2LHCA 3HX3A 3GLFE 3NBIA 2K47A 2FOIC 2QBYA 3ZCBB 1LV7A 5F3WA 1IM2A 1PGYA 3PNVA 1A5TA 5DYIA 3CTWB 1XB2B 4DR4M 2Z4RA 2C9CA 1WIVA 1HNWM 4REZA 2XSZD 4DV0M 2LVQD 3CF6E 3UMMA 3R8FA 3FYCA 2DWMA 1LTMA 3B9PA 4I81A 3I04M 5ITYA 4F2LA 2EKKA 2KZSA 2RKOA 4GITA 2VQFM 1TH4A 3VLFB 5KQDA 2MJ5B 3E46A 2LTUA 2VF7A 2QPAA 1JB0F 1G4AE 4II7A 3T38A 5IZ7D 3AOEC 3OTOM 1G8PA 3MHVC 2F5SA 3HJQA 1V92A 2XFTA 4JXJA 3FRIA 1W5TA 2ZBKB 1GO5A 4BB9A 4LF6M 4YY3M 2DENA 2ZTCA 5ITUA 3HU1A 1HJPA 2DAKA 5KPZA 2EA0A 4I8OA 4PD2A 1IN4A 2R4EA 3U5ZB 5A2QS 3FE3A 1PRBA 3VDUA 1G41A 1I94M 3ILKA 2LH0A 3T15A 5FTLA 1SXJC 2BWEA 2OOAA 1XNQM 3GLIB 2QENA 2R4JA 4JI1M 1XMOM 5BR8M 2KNZA 2L7IA 4JI0M 4JYAM 1QVRA 2QCUA 1QZEA 3U60B 4LCBA 2WZJA 2ZTDA 2MR9A 1IBKM 3FRHA 2O25A 4NL4H 4CISA 1ZMUA 4IIWA 1ORYB 7CATA 2MH8A 2UUAM 2UUCM 3KS8A 3J7AS 4AW4A 5H37D 4DV6M 3KXEC 5JI2E 2DZLA 2YNMD 3MMPA 4IBCA 2ZANA 3GLGA 4IJFA 1JR3E 2BWBA 4X64M 1JQJC 1GJSA 1TTEA 1V34A 2KW0A 1NSFA 1ZAEA 3HHYA 4GRIA 2UUBM 1QAMA 3FUTA 1QAOA 1QZMA 1PJTA 2JA2A 4LZJA 4OVZA 3TWMA 3K1JA 3KOWE 4JI4M 3SAWA 2Z7JA 4GC5A 4GC9A 4MGKE 2LWXA 3VKHA 1QQWA 3B7QA 1D0KA 5ITTA 4G4RA 2WSCF 3SMSA 4CHTB 1ZQ9A 4LJ6A 2CE7A 3FTCA 3SAVA 3VKGA 3SYLA 2XLJA 2DWZB 3LW5F 5BPVA 2OOBA 2OPFA 1DV0A 1KSFX 2BJVA 3A98B 3BOSA 3IHPA 3TWKA 4DV4M 1MX0A 2DZNB 4HL4A 3KOZE 3KW6A 4LJ5A 2I7NA 2Z3XA 2YR0A 3U6DA 5E26A 3JAMS 4JI2M 4G6ZA 4B3TM 5FSWA 2XGNA 3H4JA 3QAUA 3T6PA 2XZUA 2QQ8A 1L2DA 2F4VM 3GLFB 3M0EA 3PNYA 1IN6A 2LVAA 3C58A 3FTEA 4B3RM 3DFZA 3U6CA 2F5OA 3K2LA 1IN7A 4B3MM 1HT1E 1Z5CA 2HHHM 3GLHB 1Z59A 2L4FA 1DGHA 1TF0B 4EIWA 1WHCA 2VIIA 5KO3A 2L6OA 3KOYE 4WURA 4HLQA 4IBKA 4S12A 4NXMM 2J5YA 2EUCA 1QYRA 1Z5BA 2R46A 2QZ4A 4FW9A 3D8BA 4DUZM 4JN6A 1IY0A 1XHBA 4DR3M 5JI3E 4YHHM 1MN3A 3HHZA 4IJEA 4LF5M 1L1ZA 3BBZA 2Q2EB 1QUSA 1IY1A 2KDLA 4DUYM 1DO0A 1R5LA 1OAIA 4DV1M 2CHVA 8CATA 2J7OA 4XBOA 2KRUA 2JWSA 2G3QA 2L7HA 4JI7M 4MB7A 1MU5A 1JR3D 2KEBA 1K3XA 2UXCM 4PT5A
chains in the Genus database with same CATH topology
2FH0A 2K6BA 1EIJA 2JXNA 2CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH0 A;  2K6B A;  1EIJ A;  2JXN A;  2CRU A; 
#chains in the Genus database with same CATH topology
 3JR5 A;  3GRV A;  4CIZ A;  5EXT A;  4DR2 M;  2CEA A;  1OQY A;  2HL7 A;  2M5Z A;  2R44 A;  4MH0 E;  2XFS A;  3FKE A;  3V76 A;  1N32 M;  3J2P B;  2K0B X;  3AFH A;  3A45 A;  1YLA A;  4Z6Y A;  3GPU A;  5LMN M;  1NY5 A;  1VDD A;  1IY2 A;  1NVM A;  1UM8 A;  3HGI A;  3HU2 A;  4R3D A;  3RGP A;  2VQE M;  3EIH A;  3GQ3 A;  2DHR A;  5DYG A;  3VDP A;  1G59 A;  5DNY A;  2XSZ A;  2G8L A;  4IBG A;  3J80 S;  1HR0 M;  3AL0 C;  1WGN A;  2GNO A;  3U6Q A;  5EQT A;  1R6B X;  4NSO B;  5C18 A;  3FUU A;  3J81 S;  5ITR A;  2DAE A;  2UXB M;  4AKI A;  4Z8X A;  3GLF A;  1OIZ A;  1SXJ E;  4XGI A;  1XXH B;  1R2Z A;  2RRU A;  2G5G X;  3UK6 A;  4GHA A;  2EJS A;  5EXS A;  1XMQ M;  2UXD M;  4GHL A;  3RFW A;  2L2D A;  4LRS A;  1FJG M;  1EIJ A;  2J7N A;  3LCU A;  2DVW B;  4AQY M;  2NQ8 C;  2WSE F;  2DAG A;  3E4R A;  5C1B A;  4I5S A;  3VK8 A;  2C5R A;  1VDL A;  5ITX E;  3U6S A;  3L25 A;  1YSY A;  4X66 M;  1OFI A;  3MJ5 A;  1HT2 E;  2R6F A;  2Z4S A;  2UU9 M;  2JUJ A;  2JY8 A;  1N77 A;  1PJI A;  2R45 A;  2LVO C;  3MK6 A;  1RU3 A;  1E9R A;  4KLN A;  4FVM A;  1NJF A;  3JR4 A;  2MGW A;  2FS1 A;  1SG9 A;  2DAM A;  4Q7J A;  3I01 M;  3FD9 A;  3L28 A;  5DFL A;  2Y0T A;  3CF0 A;  3K9P A;  3RGS A;  2X8A A;  1GVN A;  3PFI A;  5FTN A;  3WHL A;  4Y28 F;  2WSF F;  1GJT A;  3U6M A;  3HU3 A;  3LMM A;  3SC3 A;  4IBF A;  1N36 M;  1XXH A;  3AV0 A;  4OW0 A;  5KPR A;  3UGJ A;  3LCV B;  1S3S A;  3TE6 A;  1C1K A;  2CHG A;  3LVW A;  4L4U A;  3M7G A;  3L26 A;  1IBL M;  2CRU A;  1R4G A;  3BXW A;  3SMP A;  3TL4 X;  3GLH E;  5LMU M;  1GAB A;  3KVW A;  4LF7 M;  2QNJ A;  2OO9 A;  2YQZ A;  3C3E A;  1MJG M;  1E32 A;  2H1R A;  2H5X A;  2O01 F;  3E21 A;  4KOD A;  2CV0 A;  1IFY A;  2JZ1 A;  2APL A;  3H4M A;  4PDG A;  4DV7 M;  4FCT A;  4L15 A;  2V1U A;  3CGW A;  2F5P A;  5ITQ A;  3SAR A;  4PCZ A;  4LFB M;  2JZ0 A;  2L09 A;  4BLC A;  4JI5 M;  4QNR A;  2CUZ A;  2F5N A;  4FCV A;  4I4L A;  1E9S A;  1QAN A;  2QSF X;  1NY6 A;  1C7Y A;  3AOG A;  4AKG A;  4L6V 6;  4B7G A;  1XNR M;  3GLG E;  2CV1 A;  1Q39 A;  4B7F A;  4RNA A;  4L78 A;  2DXI A;  3GQ5 A;  4QOS A;  3FTD A;  1PJJ A;  4P17 A;  2CP8 A;  2OQ4 A;  4A3V B;  3SAT A;  5EP1 A;  1NV9 A;  3U6L A;  3DA1 A;  3IG5 A;  3F92 A;  4G4O A;  4IBI A;  4QNM A;  1NJG A;  3LQQ A;  1N78 A;  2JXN A;  2KHH A;  3IG8 A;  1DO2 A;  1DGG A;  1HQC A;  2QP9 X;  4FWH A;  4IBB A;  4ZPX A;  4P16 A;  4DV5 M;  2W82 A;  3B89 A;  1L8Q A;  2JY6 B;  4OVZ B;  4RF0 A;  2Y0Q A;  4ITQ A;  1NNU C;  2DKL A;  3HKP A;  1KYI A;  4WW0 A;  1WGL A;  3THG A;  4M9X A;  3SAS A;  2LHG A;  3CF2 A;  1DGH B;  1VEG A;  4X62 M;  3L27 A;  1FNN A;  4GMQ A;  3I4Y A;  4JV5 M;  2V6Z M;  3DOA A;  4NRV A;  3U6O A;  3GQ4 A;  1EFU B;  5IRE B;  1G71 A;  2D7E A;  4OX9 M;  3D8L A;  2ZM6 M;  3HHX A;  3GO8 A;  4X65 M;  4LRT A;  3KSX A;  2KA6 B;  4FD2 A;  4GEW A;  4CJ6 A;  2F5Q A;  2N35 A;  3EIE A;  4JI3 M;  2EO2 A;  4LF4 M;  1Q3B A;  2X4A A;  4QHT A;  2KRK A;  4NRW A;  4NOO B;  2AHM A;  3PVS A;  5EP4 A;  1NO1 A;  1XWI A;  3U6P A;  2LBC A;  3GP1 A;  1ZMW A;  3HHW A;  1K3W A;  2CHQ A;  1D0M A;  3TWL A;  2JY7 A;  1GL6 A;  2A5Y B;  2M60 A;  4G3O A;  1OIP A;  4M9S A;  2I7P A;  3LVV A;  4AG5 A;  2KNA A;  4D82 A;  4DBG B;  5ITX A;  1L2B A;  4LY6 A;  1DGF A;  2KNV A;  3ZH9 B;  4KO8 A;  1SXJ D;  1WJ7 A;  3QWL A;  2ERC A;  1J5E M;  4K0K M;  3I4V A;  3KDS E;  3AJI B;  1TDH A;  2BNK A;  5IWA M;  4AI6 A;  4M0D A;  2FH0 A;  1IXZ A;  1D2N A;  3GLG B;  2C9O A;  2ZAM A;  1QDR A;  1PJS A;  3I51 A;  3HJS A;  1OJL A;  4LGY A;  2FE8 A;  4WP2 A;  1WXQ A;  3E9S A;  3J27 B;  2B3T A;  1HQY E;  5EXP A;  4AG6 A;  1OAO C;  1V33 A;  2DI0 A;  1P3Q Q;  1AUA A;  1HNZ M;  1ZMV A;  1NHG C;  3HWS A;  1D0L A;  2DNA A;  3VFD A;  5EP3 A;  4TUW A;  4M0W A;  2XZF A;  1Q02 A;  2YFQ A;  1IN5 A;  3U6E A;  4LJ9 A;  4PDI A;  1GL7 A;  2JNH A;  3NWL A;  4LJA A;  5FTJ A;  5FTK A;  1L1T A;  3FTF A;  4L16 A;  4MM3 B;  3QYE A;  2HCB A;  3Q8G A;  1TR8 A;  5GKN A;  1T3T A;  3GLI E;  3J7B A;  1YE9 A;  3ZQJ A;  4IBD A;  5EJC A;  3GPP A;  2HAK A;  2LVP C;  2CWB A;  2R65 A;  3GLH A;  2XH9 A;  1Z5A A;  3SFZ A;  1NV8 A;  4JI6 M;  1GKI A;  5EXX A;  1J7K A;  1WR1 B;  1JR3 A;  1IXR C;  4LG2 A;  3FUW A;  4CGY B;  3R9X B;  3PXG A;  1HNX M;  4G4Q A;  4F1I A;  1IN8 A;  4R7G A;  4LJ4 A;  4AZF A;  1KFV A;  1TGU A;  3GRY A;  1EE8 A;  2JY5 A;  4B7H A;  4MGY E;  1OFH A;  1R7R A;  3FUX A;  1R2Y A;  1XC8 A;  1F4I A;  3TQS A;  2CV2 A;  4LFC M;  1DGB A;  3K92 A;  4GIP A;  4G4N A;  1N75 A;  2MRO B;  4R71 A;  3T1H M;  4DR1 M;  2LXE A;  3FYD A;  2KZU A;  2ZAO A;  4D80 A;  4GKK M;  3TPZ A;  4BBA A;  2R18 A;  3AOE A;  4MGH A;  1CUK A;  2FNA A;  2LNH C;  4W5W A;  4DR5 M;  4LJ8 A;  2P5T A;  3Q8X A;  3NBX X;  3K9O A;  2VDB B;  3B7Z A;  4DR7 M;  2GQF A;  2QHO B;  4JI8 M;  2VF8 A;  2DZO B;  3B7N A;  1H6U A;  2X49 A;  2HWJ A;  5FTM A;  1NHW C;  2BJW A;  2D7G A;  1IQP A;  2O5R A;  4IBJ A;  1W5S A;  5EP2 A;  4D81 A;  4AKH A;  3VK7 A;  1AIP C;  3KFU G;  4MGZ E;  1UFZ A;  1X37 A;  1TDZ A;  2Z8Y M;  3SYK A;  4OU7 A;  1PM5 A;  4B08 A;  4LJ7 A;  2Y20 A;  4IBE A;  1L2C A;  1E94 E;  1SXJ A;  2KXE A;  3W67 A;  3AKZ A;  4B3S M;  2R0I A;  3HY5 A;  4FCW A;  3QYB A;  2DAI A;  5E6J A;  1ZV1 A;  1QAQ A;  5FLX S;  3U60 A;  1G3I A;  1Y8G A;  2D7H A;  4QHS A;  4L8R C;  4RF1 A;  3W0F A;  1PJQ A;  3L2A A;  3GPX A;  1BVS A;  1Q3C A;  3GLI A;  1I4W A;  2LVN C;  3C9P A;  5KQ8 A;  3LQR A;  1VG5 A;  3GPY A;  3KP0 E;  4FWD A;  3SAU A;  1N34 M;  2CFO A;  3IEC A;  3KS4 A;  3U5Z A;  3HJ8 A;  3M6A A;  1IXS A;  2RGO A;  2DWN A;  3U61 A;  2C99 A;  2L4E A;  4NSR A;  4NXN M;  1QUT A;  2R62 A;  1YUB A;  1VEJ A;  4M9Z A;  5KPT A;  3W68 A;  4LF8 M;  1TH3 A;  1N33 M;  1OKS A;  3DZD A;  3K8Z A;  3KP1 E;  2K9D A;  1K82 A;  2XEP A;  3RE8 A;  4DV2 M;  1VQ1 A;  4LZZ A;  3U61 B;  4HEO A;  4ANR A;  1IXS B;  3W0L B;  3B74 A;  3SHF A;  1NNJ A;  1J09 A;  4GKJ M;  2HKJ A;  3L29 A;  4RKU F;  1T43 A;  4KHP M;  1TH2 A;  4NC6 A;  3GRU A;  3SBJ A;  4LF9 M;  4QOZ C;  1Z6T A;  4FWG A;  4UN2 B;  4DR6 M;  5IT9 S;  3WHK A;  2EKF A;  2DWL A;  2K6B A;  2JP7 A;  3FUV A;  4KT0 F;  3T1Y M;  1T6O A;  3SHG B;  1GLN A;  2XF3 A;  3HZJ A;  2C98 A;  2FFJ A;  3KSJ A;  1XXH E;  3A42 A;  1IBM M;  1SXJ B;  2QBY B;  2C96 A;  4MGI E;  1VEK A;  2E5L M;  1OTR A;  4LGM A;  2DHY A;  3A46 A;  1QDT A;  4DV3 M;  3C3D A;  3GRR A;  4GH9 A;  5L8R F;  3KOX E;  4XK8 F;  3ZC7 B;  4LFA M;  2RGH A;  2V1C A;  3UZU A;  2Y21 A;  3UJN A;  2LHC A;  3HX3 A;  3GLF E;  3NBI A;  2K47 A;  2FOI C;  2QBY A;  3ZCB B;  1LV7 A;  5F3W A;  1IM2 A;  1PGY A;  3PNV A;  1A5T A;  5DYI A;  3CTW B;  1XB2 B;  4DR4 M;  2Z4R A;  2C9C A;  1WIV A;  1HNW M;  4REZ A;  2XSZ D;  4DV0 M;  2LVQ D;  3CF6 E;  3UMM A;  3R8F A;  3FYC A;  2DWM A;  1LTM A;  3B9P A;  4I81 A;  3I04 M;  5ITY A;  4F2L A;  2EKK A;  2KZS A;  2RKO A;  4GIT A;  2VQF M;  1TH4 A;  3VLF B;  5KQD A;  2MJ5 B;  3E46 A;  2LTU A;  2VF7 A;  2QPA A;  1JB0 F;  1G4A E;  4II7 A;  3T38 A;  5IZ7 D;  3AOE C;  3OTO M;  1G8P A;  3MHV C;  2F5S A;  3HJQ A;  1V92 A;  2XFT A;  4JXJ A;  3FRI A;  1W5T A;  2ZBK B;  1GO5 A;  4BB9 A;  4LF6 M;  4YY3 M;  2DEN A;  2ZTC A;  5ITU A;  3HU1 A;  1HJP A;  2DAK A;  5KPZ A;  2EA0 A;  4I8O A;  4PD2 A;  1IN4 A;  2R4E A;  3U5Z B;  5A2Q S;  3FE3 A;  1PRB A;  3VDU A;  1G41 A;  1I94 M;  3ILK A;  2LH0 A;  3T15 A;  5FTL A;  1SXJ C;  2BWE A;  2OOA A;  1XNQ M;  3GLI B;  2QEN A;  2R4J A;  4JI1 M;  1XMO M;  5BR8 M;  2KNZ A;  2L7I A;  4JI0 M;  4JYA M;  1QVR A;  2QCU A;  1QZE A;  3U60 B;  4LCB A;  2WZJ A;  2ZTD A;  2MR9 A;  1IBK M;  3FRH A;  2O25 A;  4NL4 H;  4CIS A;  1ZMU A;  4IIW A;  1ORY B;  7CAT A;  2MH8 A;  2UUA M;  2UUC M;  3KS8 A;  3J7A S;  4AW4 A;  5H37 D;  4DV6 M;  3KXE C;  5JI2 E;  2DZL A;  2YNM D;  3MMP A;  4IBC A;  2ZAN A;  3GLG A;  4IJF A;  1JR3 E;  2BWB A;  4X64 M;  1JQJ C;  1GJS A;  1TTE A;  1V34 A;  2KW0 A;  1NSF A;  1ZAE A;  3HHY A;  4GRI A;  2UUB M;  1QAM A;  3FUT A;  1QAO A;  1QZM A;  1PJT A;  2JA2 A;  4LZJ A;  4OVZ A;  3TWM A;  3K1J A;  3KOW E;  4JI4 M;  3SAW A;  2Z7J A;  4GC5 A;  4GC9 A;  4MGK E;  2LWX A;  3VKH A;  1QQW A;  3B7Q A;  1D0K A;  5ITT A;  4G4R A;  2WSC F;  3SMS A;  4CHT B;  1ZQ9 A;  4LJ6 A;  2CE7 A;  3FTC A;  3SAV A;  3VKG A;  3SYL A;  2XLJ A;  2DWZ B;  3LW5 F;  5BPV A;  2OOB A;  2OPF A;  1DV0 A;  1KSF X;  2BJV A;  3A98 B;  3BOS A;  3IHP A;  3TWK A;  4DV4 M;  1MX0 A;  2DZN B;  4HL4 A;  3KOZ E;  3KW6 A;  4LJ5 A;  2I7N A;  2Z3X A;  2YR0 A;  3U6D A;  5E26 A;  3JAM S;  4JI2 M;  4G6Z A;  4B3T M;  5FSW A;  2XGN A;  3H4J A;  3QAU A;  3T6P A;  2XZU A;  2QQ8 A;  1L2D A;  2F4V M;  3GLF B;  3M0E A;  3PNY A;  1IN6 A;  2LVA A;  3C58 A;  3FTE A;  4B3R M;  3DFZ A;  3U6C A;  2F5O A;  3K2L A;  1IN7 A;  4B3M M;  1HT1 E;  1Z5C A;  2HHH M;  3GLH B;  1Z59 A;  2L4F A;  1DGH A;  1TF0 B;  4EIW A;  1WHC A;  2VII A;  5KO3 A;  2L6O A;  3KOY E;  4WUR A;  4HLQ A;  4IBK A;  4S12 A;  4NXM M;  2J5Y A;  2EUC A;  1QYR A;  1Z5B A;  2R46 A;  2QZ4 A;  4FW9 A;  3D8B A;  4DUZ M;  4JN6 A;  1IY0 A;  1XHB A;  4DR3 M;  5JI3 E;  4YHH M;  1MN3 A;  3HHZ A;  4IJE A;  4LF5 M;  1L1Z A;  3BBZ A;  2Q2E B;  1QUS A;  1IY1 A;  2KDL A;  4DUY M;  1DO0 A;  1R5L A;  1OAI A;  4DV1 M;  2CHV A;  8CAT A;  2J7O A;  4XBO A;  2KRU A;  2JWS A;  2G3Q A;  2L7H A;  4JI7 M;  4MB7 A;  1MU5 A;  1JR3 D;  2KEB A;  1K3X A;  2UXC M;  4PT5 A; 
#chains in the Genus database with same CATH homology
 2FH0 A;  2K6B A;  1EIJ A;  2JXN A;  2CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...