2CRUA

Solution structure of programmed cell death 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GSSGSSGLRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 5
publication title Solution structure of programmed cell death 5
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2cruA01
2FH0A 2K6BA 1EIJA 2JXNA 2CRUA
chains in the Genus database with same CATH superfamily
2BWBA 2YFQA 2LVNC 4CIZA 7CATA 4P17A 5A2QS 3D8BA 3U6PA 4LF6M 3AL0C 2D7GA 1NSFA 2Z7JA 4XBOA 3SASA 4IJFA 3TE6A 1HQYE 1G41A 2CUZA 2CV0A 2R44A 3TWMA 3GLFB 3UJNA 2HAKA 2QCUA 3DA1A 1N78A 3PVSA 3R9XB 3U6MA 2LHGA 3T15A 3U5ZA 1E94E 1FNNA 1G71A 4M0DA 2KHHA 2ZBKB 2Z3XA 3U61B 4AI6A 2ERCA 3BOSA 4LF4M 1IN5A 4D80A 4KODA 3GQ3A 1OTRA 1Q02A 4IJEA 3U6QA 3K2LA 1IBMM 2CV1A 3SFZA 5KPRA 5KPTA 1I94M 4JI5M 4M9XA 3TPZA 1RU3A 1DO0A 1EIJA 3HGIA 4LF9M 1MN3A 3K9OA 2CEAA 3GRUA 3LQQA 3MHVC 5KPZA 4BBAA 3KP1E 5ITXE 3U5ZB 4NOOB 2OOAA 1NHWC 1TDHA 4PCZA 3I01M 3L27A 1DO2A 1LV7A 2O5RA 2KW0A 4G4OA 4DV7M 2C9OA 4R71A 1G3IA 3ILKA 4FCWA 3U60B 3E4RA 2JXNA 2JY6B 2QBYA 2KA6B 4IBGA 4ZPXA 1AUAA 1S3SA 1IN4A 2DAMA 3SARA 4JI1M 2XH9A 1TH2A 2VF8A 1TF0B 4DR1M 4B3TM 1VDDA 4TUWA 1HT1E 2R45A 3AJIB 2HCBA 3QYEA 4FVMA 1QVRA 5EP1A 2CHGA 1WGLA 1P3QQ 3KOXE 4GC9A 5FTJA 4D81A 2UUAM 2CP8A 2KXEA 1XC8A 2F5QA 3AOGA 4CGYB 1YUBA 4AKHA 3AKZA 5E6JA 3F92A 2QBYB 3VKHA 4M9SA 3A42A 3RGSA 4GKKM 3IHPA 2BJVA 3W0LB 1WXQA 2FS1A 4F1IA 4P16A 3HHWA 2OPFA 1HT2E 4S12A 5C18A 3UMMA 1E9RA 1YE9A 3E21A 2XGNA 1NV9A 4LJAA 3CF2A 3E9SA 1SXJA 4UN2B 4HL4A 1N34M 4B08A 4DUZM 3B7QA 3JR4A 3I4VA 4LF8M 3VKGA 2JP7A 2LBCA 3PFIA 3HU2A 3RE8A 2CE7A 1TH3A 1TR8A 3HX3A 4MGIE 2V6ZM 4B7GA 2XFTA 5EXSA 2EUCA 3LCUA 4AG5A 5DNYA 3B7ZA 2M60A 2C96A 1QANA 1TGUA 1ZQ9A 4NXMM 1QDTA 2DAEA 4JI2M 2EO2A 2D7EA 3FTCA 1HJPA 1ZAEA 3EIEA 4NSRA 4DUYM 3A98B 2DNAA 4JV5M 4NRVA 4QNMA 4LY6A 1OIZA 2L4FA 3MK6A 4LJ9A 4LGYA 1IQPA 2EKKA 3JAMS 4LJ8A 4D82A 1W5SA 2XEPA 1WIVA 4JXJA 1PJJA 2Y0QA 4B3RM 3DZDA 4OVZA 2DZNB 2JUJA 3SMPA 4DV6M 1PM5A 4HLQA 5ITXA 3DOAA 3THGA 2HHHM 2UXBM 1MX0A 1OJLA 4LJ7A 5EXPA 3KSXA 2LHCA 3T38A 3K9PA 1N32M 5EJCA 1XMOM 3GRVA 5IT9S 1IFYA 1T3TA 2VF7A 1NVMA 1IY1A 2O01F 3KW6A 4G6ZA 2F5OA 1G8PA 1IXZA 3GP1A 1HNWM 2JZ1A 2Y21A 5JI3E 1G59A 2ZTDA 1YSYA 3K8ZA 3FYDA 4Z6YA 4L8RC 4G4QA 5ITYA 2KZSA 1PRBA 4I5SA 4OW0A 2W82A 3EIHA 2HWJA 4FWHA 4OVZB 1SXJD 1HR0M 2J5YA 4LFCM 2LXEA 3J27B 1F4IA 4KLNA 4IBJA 3SYKA 4DV1M 4R7GA 2F5NA 4GKJM 1IN8A 1IBKM 2F5PA 2RKOA 1R5LA 4BLCA 4JI6M 3JR5A 3J80S 2F4VM 2JWSA 2R4EA 2JZ0A 3KSJA 2FOIC 2KZUA 4FCTA 2MR9A 2J7OA 3AOEC 1QZEA 1NY6A 2X8AA 2R18A 3NBXX 2KEBA 2XZFA 4DV5M 3IECA 5H37D 1G4AE 2DHYA 2DAKA 3FUUA 1H6UA 2G5GX 4MB7A 5JI2E 3J81S 3D8LA 3J2PB 1HQCA 3ZH9B 3GLIE 1VDLA 1NJGA 4IBKA 4RF1A 1TH4A 2JY7A 3HWSA 1PJSA 1PJTA 4GIPA 4GC5A 1XNRM 1WR1B 3DFZA 4G4RA 3WHLA 4MGZE 3TQSA 1QUSA 1QZMA 3FUXA 3RGPA 5FSWA 3UGJA 4FWDA 3B7NA 2Y20A 4NC6A 1QAOA 3HJSA 4G3OA 5KQ8A 2QHOB 2D7HA 4LZZA 4MH0E 4DV3M 5EXXA 3IG5A 2XF3A 2DAGA 4GH9A 4A3VB 3M0EA 3VK8A 2DZLA 4CISA 2LTUA 1GKIA 1WGNA 2QP9X 2B3TA 3CF0A 4DR3M 2DENA 3MMPA 3VK7A 2J7NA 4IBCA 1ZMVA 1VQ1A 1OKSA 1VEJA 3SAUA 1L2DA 3QWLA 3PXGA 4LRTA 3KOZE 1NJFA 4L6V6 1L1ZA 4FWGA 1L2CA 2ZAOA 5E26A 3SYLA 4MGYE 3GRRA 5FLXS 3Q8XA 3C3DA 5F3WA 1D2NA 4I8OA 1MU5A 4LCBA 1Z5AA 5FTMA 1Z59A 2H1RA 2VQEM 3LW5F 4PT5A 5GKNA 3IG8A 1V34A 3GLGE 1SG9A 2YR0A 1DGBA 3KXEC 3ZCBB 1XXHE 1ZV1A 4AZFA 4X65M 5BR8M 3FTEA 3FYCA 1GL7A 4I81A 3VDPA 2BNKA 4YY3M 4DR4M 3A46A 3GPPA 2Q2EB 1TTEA 1XNQM 3UK6A 2DWNA 4JI4M 3QYBA 3GLFE 3K1JA 1JR3E 2C99A 3FE3A 3C9PA 3W68A 4W5WA 1IN7A 1WHCA 3GO8A 2EKFA 1TDZA 1L1TA 2R0IA 2UUBM 4Y28F 3FTDA 4LFBM 4AW4A 2X4AA 1OIPA 4L78A 4YHHM 4KO8A 4XGIA 5ITTA 2QNJA 4NSOB 4AQYM 4RNAA 4JI0M 3V76A 1OAOC 3KFUG 1DGHA 3B89A 4LF5M 2LVQD 2XSZA 3VFDA 4DR7M 2E5LM 1MJGM 4OU7A 2O25A 2QZ4A 3GLIA 1PJQA 3L28A 1GJSA 1NHGC 2DWZB 1L8QA 1SXJB 2KRKA 4IBBA 3RFWA 2L2DA 4JI3M 2VQFM 5FTNA 4DV4M 1UFZA 4B7HA 3GPUA 1C7YA 2K9DA 4M0WA 4ITQA 4LG2A 1KYIA 1VEGA 3CTWB 1OQYA 2VIIA 2Z4RA 1HNXM 5FTKA 1DGHB 2LNHC 1BVSA 4L16A 5IREB 2KNAA 3W67A 4NXNM 3FD9A 3U6LA 3FUWA 2L09A 2MH8A 2XLJA 1QYRA 2UUCM 3NBIA 4LGMA 3SAVA 1EFUB 3HHXA 2Y0TA 1NNJA 2RGHA 1DGGA 2LVPC 3VLFB 3SAWA 1ZMWA 2JY5A 1QAQA 4GHAA 2C9CA 2K6BA 4I4LA 3HU3A 4X64M 3GLHE 1IM2A 2X49A 1R7RA 2G3QA 2QPAA 4ANRA 2UXCM 5DFLA 4LFAM 5KQDA 2VDBB 3B9PA 4AG6A 2APLA 2ZM6M 4DV0M 5C1BA 3GLGA 1FJGM 1YLAA 2DWLA 1XXHA 4OX9M 1R4GA 1N77A 5DYIA 4F2LA 3TWLA 4PDIA 5EP3A 1PGYA 4DR2M 3KOYE 4JN6A 3QAUA 4FW9A 1EE8A 2XSZD 5ITUA 4FD2A 3KVWA 2AHMA 4L4UA 4WW0A 4KHPM 1IXRC 2RRUA 3FTFA 2CHVA 4CHTB 1XMQM 3LVWA 1Z6TA 5DYGA 3H4JA 4L15A 3SATA 4FCVA 1N33M 3GLFA 2MJ5B 1JR3A 5FTLA 1L2BA 3LQRA 1R2ZA 2R4JA 3NWLA 3C3EA 2P5TA 2DHRA 1XXHB 1GJTA 3T1HM 4M9ZA 3LVVA 2L4EA 4QNRA 3U61A 2FE8A 2R46A 3WHKA 2N35A 3CF6E 4X66M 1D0MA 3U6CA 3U6DA 3I4YA 3K92A 4Z8XA 2LVAA 1HNZM 4AKGA 4JYAM 2CRUA 1T43A 5EQTA 1OFIA 1SXJC 2DAIA 1NV8A 2DVWB 2R62A 2OO9A 3U6OA 3B74A 4B3SM 3FRIA 2WSFF 1CUKA 2WSEF 4LRSA 4GITA 3U6SA 4LJ5A 1W5TA 1UM8A 1QUTA 3VDUA 4QOZC 1E32A 1DGFA 2V1CA 2MROB 2HL7A 2KRUA 3PNVA 3L2AA 1NNUC 3U60A 1JQJC 4GRIA 3LCVB 3TWKA 1OAIA 3PNYA 3T6PA 5L8RF 4QOSA 4NRWA 3AV0A 1PJIA 3KP0E 3HJQA 4NL4H 3SBJA 2QENA 1J09A 2ZANA 3MJ5A 2A5YB 4X62M 2G8LA 2R65A 4B3MM 4DBGB 4QHSA 3U6EA 4LF7M 1GO5A 2C98A 2OQ4A 2LVOC 3HY5A 3J7AS 3A45A 5KO3A 3CGWA 1QDRA 2QQ8A 2C5RA 4K0KM 3L25A 4QHTA 1OFHA 3GLHA 3HHYA 4REZA 1JR3D 2BJWA 1V33A 5EP4A 1GABA 2H5XA 3TL4X 3AOEA 1D0KA 1ORYB 3HU1A 3UZUA 2KNVA 1KSFX 3LMMA 4JI7M 4DR6M 2DZOB 2UXDM 1IXSA 1LTMA 2RGOA 2WZJA 2CFOA 2ZAMA 4LJ4A 4IBEA 5ITQA 2YQZA 1A5TA 3L29A 2K0BX 3AFHA 4GEWA 4R3DA 4RF0A 3BXWA 4MM3B 1VEKA 3HKPA 2F5SA 5IZ7D 3GQ4A 1V92A 4KT0F 1K82A 3I04M 2YNMD 3GLHB 4LZJA 1Q39A 4DR5M 3SMSA 4WURA 4PDGA 2KDLA 3HHZA 5LMUM 3L26A 1Q3CA 2Z4SA 3KOWE 2FNAA 4BB9A 1K3XA 2JY8A 2M5ZA 3GRYA 1AIPC 3SC3A 1I4WA 1K3WA 1J5EM 1IXSB 2Z8YM 3C58A 4II7A 1IY0A 3T1YM 1Y8GA 3FRHA 4IBDA 1ZMUA 5LMNM 1XB2B 1Q3BA 2FH0A 4CJ6A 4GMQA 3M7GA 4Q7JA 3H4MA 5EP2A 5ITRA 4XK8F 2WSCF 1N36M 4DV2M 3KS8A 2NQ8C 2GNOA 1VG5A 1R2YA 2DWMA 2EA0A 5BPVA 3GLIB 2R6FA 3FUVA 3M6AA 1KFVA 3HZJA 1XWIA 2L6OA 4IBIA 2LH0A 3GQ5A 3BBZA 4IBFA 2FFJA 1GLNA 3KS4A 3FUTA 4G4NA 2UU9M 3FKEA 2QSFX 4GHLA 1J7KA 1DV0A 1QAMA 2EJSA 2CV2A 3Q8GA 2L7HA 1Z5CA 2I7NA 3HJ8A 3SHGB 1GVNA 2HKJA 1NY5A 2XZUA 1Z5BA 4LJ6A 1IBLM 1JB0F 4MGHA 2DI0A 3GPXA 4MGKE 1C1KA 1N75A 2GQFA 3E46A 4WP2A 1E9SA 1D0LA 2JA2A 4IIWA 3ZC7B 1QQWA 5IWAM 5EXTA 3W0FA 4RKUF 2JNHA 4B7FA 1IN6A 1R6BX 1T6OA 1X37A 3KDSE 4PD2A 4AKIA 3SHFA 2CHQA 1IY2A 2OOBA 4HEOA 2L7IA 1GL6A 2DKLA 3GPYA 2CWBA 2I7PA 2LWXA 2KNZA 3GLGB 2K47A 2XFSA 2ZTCA 3J7BA 1XHBA 2DXIA 8CATA 3I51A 2V1UA 1SXJE 1WJ7A 4JI8M 2MGWA 1NO1A 3R8FA 3ZQJA 3OTOM 4EIWA 2BWEA
chains in the Genus database with same CATH topology
2FH0A 2K6BA 1EIJA 2JXNA 2CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH0 A;  2K6B A;  1EIJ A;  2JXN A;  2CRU A; 
#chains in the Genus database with same CATH topology
 2BWB A;  2YFQ A;  2LVN C;  4CIZ A;  7CAT A;  4P17 A;  5A2Q S;  3D8B A;  3U6P A;  4LF6 M;  3AL0 C;  2D7G A;  1NSF A;  2Z7J A;  4XBO A;  3SAS A;  4IJF A;  3TE6 A;  1HQY E;  1G41 A;  2CUZ A;  2CV0 A;  2R44 A;  3TWM A;  3GLF B;  3UJN A;  2HAK A;  2QCU A;  3DA1 A;  1N78 A;  3PVS A;  3R9X B;  3U6M A;  2LHG A;  3T15 A;  3U5Z A;  1E94 E;  1FNN A;  1G71 A;  4M0D A;  2KHH A;  2ZBK B;  2Z3X A;  3U61 B;  4AI6 A;  2ERC A;  3BOS A;  4LF4 M;  1IN5 A;  4D80 A;  4KOD A;  3GQ3 A;  1OTR A;  1Q02 A;  4IJE A;  3U6Q A;  3K2L A;  1IBM M;  2CV1 A;  3SFZ A;  5KPR A;  5KPT A;  1I94 M;  4JI5 M;  4M9X A;  3TPZ A;  1RU3 A;  1DO0 A;  1EIJ A;  3HGI A;  4LF9 M;  1MN3 A;  3K9O A;  2CEA A;  3GRU A;  3LQQ A;  3MHV C;  5KPZ A;  4BBA A;  3KP1 E;  5ITX E;  3U5Z B;  4NOO B;  2OOA A;  1NHW C;  1TDH A;  4PCZ A;  3I01 M;  3L27 A;  1DO2 A;  1LV7 A;  2O5R A;  2KW0 A;  4G4O A;  4DV7 M;  2C9O A;  4R71 A;  1G3I A;  3ILK A;  4FCW A;  3U60 B;  3E4R A;  2JXN A;  2JY6 B;  2QBY A;  2KA6 B;  4IBG A;  4ZPX A;  1AUA A;  1S3S A;  1IN4 A;  2DAM A;  3SAR A;  4JI1 M;  2XH9 A;  1TH2 A;  2VF8 A;  1TF0 B;  4DR1 M;  4B3T M;  1VDD A;  4TUW A;  1HT1 E;  2R45 A;  3AJI B;  2HCB A;  3QYE A;  4FVM A;  1QVR A;  5EP1 A;  2CHG A;  1WGL A;  1P3Q Q;  3KOX E;  4GC9 A;  5FTJ A;  4D81 A;  2UUA M;  2CP8 A;  2KXE A;  1XC8 A;  2F5Q A;  3AOG A;  4CGY B;  1YUB A;  4AKH A;  3AKZ A;  5E6J A;  3F92 A;  2QBY B;  3VKH A;  4M9S A;  3A42 A;  3RGS A;  4GKK M;  3IHP A;  2BJV A;  3W0L B;  1WXQ A;  2FS1 A;  4F1I A;  4P16 A;  3HHW A;  2OPF A;  1HT2 E;  4S12 A;  5C18 A;  3UMM A;  1E9R A;  1YE9 A;  3E21 A;  2XGN A;  1NV9 A;  4LJA A;  3CF2 A;  3E9S A;  1SXJ A;  4UN2 B;  4HL4 A;  1N34 M;  4B08 A;  4DUZ M;  3B7Q A;  3JR4 A;  3I4V A;  4LF8 M;  3VKG A;  2JP7 A;  2LBC A;  3PFI A;  3HU2 A;  3RE8 A;  2CE7 A;  1TH3 A;  1TR8 A;  3HX3 A;  4MGI E;  2V6Z M;  4B7G A;  2XFT A;  5EXS A;  2EUC A;  3LCU A;  4AG5 A;  5DNY A;  3B7Z A;  2M60 A;  2C96 A;  1QAN A;  1TGU A;  1ZQ9 A;  4NXM M;  1QDT A;  2DAE A;  4JI2 M;  2EO2 A;  2D7E A;  3FTC A;  1HJP A;  1ZAE A;  3EIE A;  4NSR A;  4DUY M;  3A98 B;  2DNA A;  4JV5 M;  4NRV A;  4QNM A;  4LY6 A;  1OIZ A;  2L4F A;  3MK6 A;  4LJ9 A;  4LGY A;  1IQP A;  2EKK A;  3JAM S;  4LJ8 A;  4D82 A;  1W5S A;  2XEP A;  1WIV A;  4JXJ A;  1PJJ A;  2Y0Q A;  4B3R M;  3DZD A;  4OVZ A;  2DZN B;  2JUJ A;  3SMP A;  4DV6 M;  1PM5 A;  4HLQ A;  5ITX A;  3DOA A;  3THG A;  2HHH M;  2UXB M;  1MX0 A;  1OJL A;  4LJ7 A;  5EXP A;  3KSX A;  2LHC A;  3T38 A;  3K9P A;  1N32 M;  5EJC A;  1XMO M;  3GRV A;  5IT9 S;  1IFY A;  1T3T A;  2VF7 A;  1NVM A;  1IY1 A;  2O01 F;  3KW6 A;  4G6Z A;  2F5O A;  1G8P A;  1IXZ A;  3GP1 A;  1HNW M;  2JZ1 A;  2Y21 A;  5JI3 E;  1G59 A;  2ZTD A;  1YSY A;  3K8Z A;  3FYD A;  4Z6Y A;  4L8R C;  4G4Q A;  5ITY A;  2KZS A;  1PRB A;  4I5S A;  4OW0 A;  2W82 A;  3EIH A;  2HWJ A;  4FWH A;  4OVZ B;  1SXJ D;  1HR0 M;  2J5Y A;  4LFC M;  2LXE A;  3J27 B;  1F4I A;  4KLN A;  4IBJ A;  3SYK A;  4DV1 M;  4R7G A;  2F5N A;  4GKJ M;  1IN8 A;  1IBK M;  2F5P A;  2RKO A;  1R5L A;  4BLC A;  4JI6 M;  3JR5 A;  3J80 S;  2F4V M;  2JWS A;  2R4E A;  2JZ0 A;  3KSJ A;  2FOI C;  2KZU A;  4FCT A;  2MR9 A;  2J7O A;  3AOE C;  1QZE A;  1NY6 A;  2X8A A;  2R18 A;  3NBX X;  2KEB A;  2XZF A;  4DV5 M;  3IEC A;  5H37 D;  1G4A E;  2DHY A;  2DAK A;  3FUU A;  1H6U A;  2G5G X;  4MB7 A;  5JI2 E;  3J81 S;  3D8L A;  3J2P B;  1HQC A;  3ZH9 B;  3GLI E;  1VDL A;  1NJG A;  4IBK A;  4RF1 A;  1TH4 A;  2JY7 A;  3HWS A;  1PJS A;  1PJT A;  4GIP A;  4GC5 A;  1XNR M;  1WR1 B;  3DFZ A;  4G4R A;  3WHL A;  4MGZ E;  3TQS A;  1QUS A;  1QZM A;  3FUX A;  3RGP A;  5FSW A;  3UGJ A;  4FWD A;  3B7N A;  2Y20 A;  4NC6 A;  1QAO A;  3HJS A;  4G3O A;  5KQ8 A;  2QHO B;  2D7H A;  4LZZ A;  4MH0 E;  4DV3 M;  5EXX A;  3IG5 A;  2XF3 A;  2DAG A;  4GH9 A;  4A3V B;  3M0E A;  3VK8 A;  2DZL A;  4CIS A;  2LTU A;  1GKI A;  1WGN A;  2QP9 X;  2B3T A;  3CF0 A;  4DR3 M;  2DEN A;  3MMP A;  3VK7 A;  2J7N A;  4IBC A;  1ZMV A;  1VQ1 A;  1OKS A;  1VEJ A;  3SAU A;  1L2D A;  3QWL A;  3PXG A;  4LRT A;  3KOZ E;  1NJF A;  4L6V 6;  1L1Z A;  4FWG A;  1L2C A;  2ZAO A;  5E26 A;  3SYL A;  4MGY E;  3GRR A;  5FLX S;  3Q8X A;  3C3D A;  5F3W A;  1D2N A;  4I8O A;  1MU5 A;  4LCB A;  1Z5A A;  5FTM A;  1Z59 A;  2H1R A;  2VQE M;  3LW5 F;  4PT5 A;  5GKN A;  3IG8 A;  1V34 A;  3GLG E;  1SG9 A;  2YR0 A;  1DGB A;  3KXE C;  3ZCB B;  1XXH E;  1ZV1 A;  4AZF A;  4X65 M;  5BR8 M;  3FTE A;  3FYC A;  1GL7 A;  4I81 A;  3VDP A;  2BNK A;  4YY3 M;  4DR4 M;  3A46 A;  3GPP A;  2Q2E B;  1TTE A;  1XNQ M;  3UK6 A;  2DWN A;  4JI4 M;  3QYB A;  3GLF E;  3K1J A;  1JR3 E;  2C99 A;  3FE3 A;  3C9P A;  3W68 A;  4W5W A;  1IN7 A;  1WHC A;  3GO8 A;  2EKF A;  1TDZ A;  1L1T A;  2R0I A;  2UUB M;  4Y28 F;  3FTD A;  4LFB M;  4AW4 A;  2X4A A;  1OIP A;  4L78 A;  4YHH M;  4KO8 A;  4XGI A;  5ITT A;  2QNJ A;  4NSO B;  4AQY M;  4RNA A;  4JI0 M;  3V76 A;  1OAO C;  3KFU G;  1DGH A;  3B89 A;  4LF5 M;  2LVQ D;  2XSZ A;  3VFD A;  4DR7 M;  2E5L M;  1MJG M;  4OU7 A;  2O25 A;  2QZ4 A;  3GLI A;  1PJQ A;  3L28 A;  1GJS A;  1NHG C;  2DWZ B;  1L8Q A;  1SXJ B;  2KRK A;  4IBB A;  3RFW A;  2L2D A;  4JI3 M;  2VQF M;  5FTN A;  4DV4 M;  1UFZ A;  4B7H A;  3GPU A;  1C7Y A;  2K9D A;  4M0W A;  4ITQ A;  4LG2 A;  1KYI A;  1VEG A;  3CTW B;  1OQY A;  2VII A;  2Z4R A;  1HNX M;  5FTK A;  1DGH B;  2LNH C;  1BVS A;  4L16 A;  5IRE B;  2KNA A;  3W67 A;  4NXN M;  3FD9 A;  3U6L A;  3FUW A;  2L09 A;  2MH8 A;  2XLJ A;  1QYR A;  2UUC M;  3NBI A;  4LGM A;  3SAV A;  1EFU B;  3HHX A;  2Y0T A;  1NNJ A;  2RGH A;  1DGG A;  2LVP C;  3VLF B;  3SAW A;  1ZMW A;  2JY5 A;  1QAQ A;  4GHA A;  2C9C A;  2K6B A;  4I4L A;  3HU3 A;  4X64 M;  3GLH E;  1IM2 A;  2X49 A;  1R7R A;  2G3Q A;  2QPA A;  4ANR A;  2UXC M;  5DFL A;  4LFA M;  5KQD A;  2VDB B;  3B9P A;  4AG6 A;  2APL A;  2ZM6 M;  4DV0 M;  5C1B A;  3GLG A;  1FJG M;  1YLA A;  2DWL A;  1XXH A;  4OX9 M;  1R4G A;  1N77 A;  5DYI A;  4F2L A;  3TWL A;  4PDI A;  5EP3 A;  1PGY A;  4DR2 M;  3KOY E;  4JN6 A;  3QAU A;  4FW9 A;  1EE8 A;  2XSZ D;  5ITU A;  4FD2 A;  3KVW A;  2AHM A;  4L4U A;  4WW0 A;  4KHP M;  1IXR C;  2RRU A;  3FTF A;  2CHV A;  4CHT B;  1XMQ M;  3LVW A;  1Z6T A;  5DYG A;  3H4J A;  4L15 A;  3SAT A;  4FCV A;  1N33 M;  3GLF A;  2MJ5 B;  1JR3 A;  5FTL A;  1L2B A;  3LQR A;  1R2Z A;  2R4J A;  3NWL A;  3C3E A;  2P5T A;  2DHR A;  1XXH B;  1GJT A;  3T1H M;  4M9Z A;  3LVV A;  2L4E A;  4QNR A;  3U61 A;  2FE8 A;  2R46 A;  3WHK A;  2N35 A;  3CF6 E;  4X66 M;  1D0M A;  3U6C A;  3U6D A;  3I4Y A;  3K92 A;  4Z8X A;  2LVA A;  1HNZ M;  4AKG A;  4JYA M;  2CRU A;  1T43 A;  5EQT A;  1OFI A;  1SXJ C;  2DAI A;  1NV8 A;  2DVW B;  2R62 A;  2OO9 A;  3U6O A;  3B74 A;  4B3S M;  3FRI A;  2WSF F;  1CUK A;  2WSE F;  4LRS A;  4GIT A;  3U6S A;  4LJ5 A;  1W5T A;  1UM8 A;  1QUT A;  3VDU A;  4QOZ C;  1E32 A;  1DGF A;  2V1C A;  2MRO B;  2HL7 A;  2KRU A;  3PNV A;  3L2A A;  1NNU C;  3U60 A;  1JQJ C;  4GRI A;  3LCV B;  3TWK A;  1OAI A;  3PNY A;  3T6P A;  5L8R F;  4QOS A;  4NRW A;  3AV0 A;  1PJI A;  3KP0 E;  3HJQ A;  4NL4 H;  3SBJ A;  2QEN A;  1J09 A;  2ZAN A;  3MJ5 A;  2A5Y B;  4X62 M;  2G8L A;  2R65 A;  4B3M M;  4DBG B;  4QHS A;  3U6E A;  4LF7 M;  1GO5 A;  2C98 A;  2OQ4 A;  2LVO C;  3HY5 A;  3J7A S;  3A45 A;  5KO3 A;  3CGW A;  1QDR A;  2QQ8 A;  2C5R A;  4K0K M;  3L25 A;  4QHT A;  1OFH A;  3GLH A;  3HHY A;  4REZ A;  1JR3 D;  2BJW A;  1V33 A;  5EP4 A;  1GAB A;  2H5X A;  3TL4 X;  3AOE A;  1D0K A;  1ORY B;  3HU1 A;  3UZU A;  2KNV A;  1KSF X;  3LMM A;  4JI7 M;  4DR6 M;  2DZO B;  2UXD M;  1IXS A;  1LTM A;  2RGO A;  2WZJ A;  2CFO A;  2ZAM A;  4LJ4 A;  4IBE A;  5ITQ A;  2YQZ A;  1A5T A;  3L29 A;  2K0B X;  3AFH A;  4GEW A;  4R3D A;  4RF0 A;  3BXW A;  4MM3 B;  1VEK A;  3HKP A;  2F5S A;  5IZ7 D;  3GQ4 A;  1V92 A;  4KT0 F;  1K82 A;  3I04 M;  2YNM D;  3GLH B;  4LZJ A;  1Q39 A;  4DR5 M;  3SMS A;  4WUR A;  4PDG A;  2KDL A;  3HHZ A;  5LMU M;  3L26 A;  1Q3C A;  2Z4S A;  3KOW E;  2FNA A;  4BB9 A;  1K3X A;  2JY8 A;  2M5Z A;  3GRY A;  1AIP C;  3SC3 A;  1I4W A;  1K3W A;  1J5E M;  1IXS B;  2Z8Y M;  3C58 A;  4II7 A;  1IY0 A;  3T1Y M;  1Y8G A;  3FRH A;  4IBD A;  1ZMU A;  5LMN M;  1XB2 B;  1Q3B A;  2FH0 A;  4CJ6 A;  4GMQ A;  3M7G A;  4Q7J A;  3H4M A;  5EP2 A;  5ITR A;  4XK8 F;  2WSC F;  1N36 M;  4DV2 M;  3KS8 A;  2NQ8 C;  2GNO A;  1VG5 A;  1R2Y A;  2DWM A;  2EA0 A;  5BPV A;  3GLI B;  2R6F A;  3FUV A;  3M6A A;  1KFV A;  3HZJ A;  1XWI A;  2L6O A;  4IBI A;  2LH0 A;  3GQ5 A;  3BBZ A;  4IBF A;  2FFJ A;  1GLN A;  3KS4 A;  3FUT A;  4G4N A;  2UU9 M;  3FKE A;  2QSF X;  4GHL A;  1J7K A;  1DV0 A;  1QAM A;  2EJS A;  2CV2 A;  3Q8G A;  2L7H A;  1Z5C A;  2I7N A;  3HJ8 A;  3SHG B;  1GVN A;  2HKJ A;  1NY5 A;  2XZU A;  1Z5B A;  4LJ6 A;  1IBL M;  1JB0 F;  4MGH A;  2DI0 A;  3GPX A;  4MGK E;  1C1K A;  1N75 A;  2GQF A;  3E46 A;  4WP2 A;  1E9S A;  1D0L A;  2JA2 A;  4IIW A;  3ZC7 B;  1QQW A;  5IWA M;  5EXT A;  3W0F A;  4RKU F;  2JNH A;  4B7F A;  1IN6 A;  1R6B X;  1T6O A;  1X37 A;  3KDS E;  4PD2 A;  4AKI A;  3SHF A;  2CHQ A;  1IY2 A;  2OOB A;  4HEO A;  2L7I A;  1GL6 A;  2DKL A;  3GPY A;  2CWB A;  2I7P A;  2LWX A;  2KNZ A;  3GLG B;  2K47 A;  2XFS A;  2ZTC A;  3J7B A;  1XHB A;  2DXI A;  8CAT A;  3I51 A;  2V1U A;  1SXJ E;  1WJ7 A;  4JI8 M;  2MGW A;  1NO1 A;  3R8F A;  3ZQJ A;  3OTO M;  4EIW A;  2BWE A; 
#chains in the Genus database with same CATH homology
 2FH0 A;  2K6B A;  1EIJ A;  2JXN A;  2CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...