2CRUA

Solution structure of programmed cell death 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GSSGSSGLRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 5
publication title Solution structure of programmed cell death 5
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2cruA01
2CRUA 2JXNA 1EIJA 2K6BA 2FH0A
chains in the Genus database with same CATH superfamily
1GVNA 4CIZA 5EP2A 2DAIA 4DBGB 4OX9M 1YSYA 4LF4M 1L1ZA 2KXEA 4S12A 3SMPA 4QHTA 4GKJM 1J09A 5ITUA 3A42A 3CF0A 3D8BA 4HLQA 4LFAM 4LZJA 4JI0M 2CE7A 3GLGA 2APLA 2K47A 3FKEA 1G59A 1DGBA 2DZOB 2ZTCA 2CP8A 1IM2A 1UM8A 4UN2B 5DYGA 1SXJB 3A45A 4XK8F 3E4RA 2R4EA 1HNWM 4NSOB 4JI6M 2KRKA 4LJ7A 4CGYB 3HJQA 1DGFA 3BXWA 4LG2A 3GO8A 4LJAA 2ZM6M 4MGKE 3HX3A 4KODA 5EXPA 2DAKA 4DR1M 2UUCM 2C9CA 3ZCBB 1IXRC 7CATA 3DOAA 2MGWA 2XH9A 1AIPC 4IBKA 3K8ZA 3U5ZB 3VDPA 4OW0A 3FTEA 4GC5A 1Z6TA 4GC9A 2KZUA 2CHQA 2C98A 3UMMA 4NXMM 1Q39A 4RF1A 1XNQM 3SMSA 4CISA 2Y21A 3SC3A 3SYKA 1DO2A 3KFUG 3I04M 4Q7JA 2VF8A 4DR5M 4NL4H 4GH9A 4NRVA 2KNAA 2DWLA 1R4GA 3FYDA 1IFYA 3PNVA 3RGSA 2XZUA 2O25A 2LBCA 1IN6A 5EQTA 1C1KA 3GLFB 2Z8YM 2E5LM 2V1CA 1R2YA 3SASA 2M5ZA 1NJFA 4FWHA 1HQCA 1E9RA 2L7HA 3U6EA 3U60B 1PM5A 3I51A 1QUSA 2G3QA 4L16A 2EJSA 3KOZE 1G4AE 3NBXX 4ITQA 2DKLA 1XNRM 2JY6B 5ITRA 2CFOA 2R18A 2RKOA 2KHHA 3L26A 3GPUA 4B3SM 3B9PA 1K82A 2YQZA 3AOEA 1IBMM 8CATA 4G6ZA 1EE8A 1XWIA 2CV1A 1NHWC 2DWMA 5KQDA 1KFVA 2H5XA 1W5TA 3KP1E 4MGYE 1KSFX 3GQ5A 4AW4A 2CRUA 3SBJA 2Y20A 3AV0A 3B74A 1Z59A 2DNAA 2JZ0A 2L4FA 1NSFA 1XB2B 5JI3E 1JR3E 2L2DA 4IJEA 5GKNA 5EP3A 3PNYA 5C1BA 1N78A 3T38A 3ILKA 2W82A 3FTFA 2D7HA 3ZQJA 2KNZA 2R62A 3Q8GA 2BNKA 3E46A 2NQ8C 1GJSA 5FSWA 3CF6E 4LGMA 4QOSA 4B3TM 4AG5A 1IQPA 1IN8A 2HAKA 4R3DA 4X65M 1RU3A 2UUBM 4GIPA 4HEOA 3D8LA 2L7IA 4JI4M 3MJ5A 2BWEA 3K9PA 4LGYA 1Q3BA 3GLHE 3OTOM 3MK6A 2QNJA 3GLIB 1ZMWA 3LCUA 3L29A 1I4WA 3PFIA 4F2LA 4FCWA 1F4IA 4PDGA 4LY6A 1IXZA 2D7GA 3BOSA 1OJLA 3U60A 3FRIA 4R7GA 4K0KM 3SHGB 3J81S 2R46A 3SAVA 2CEAA 1XXHE 4LJ5A 1QDTA 3HGIA 5EJCA 1PJJA 4LJ6A 1HNZM 1Z5BA 1OIPA 2Z4RA 3U61B 1TF0B 2LTUA 3U6DA 3I4YA 3H4MA 4M0DA 1I94M 1OQYA 3FTDA 2RGHA 1EFUB 4GMQA 2HWJA 3K9OA 2LVOC 4FCTA 4DV5M 2ZAOA 1SXJC 1OTRA 2LVPC 4GHAA 3FUUA 2DXIA 1WXQA 1ZMVA 5ITQA 4AKGA 3KS8A 4L4UA 5EXSA 3B7QA 2FFJA 1YE9A 2XSZA 5BR8M 4OU7A 2UUAM 2QBYA 1VDDA 5KPZA 3L27A 3THGA 3U6LA 2WSEF 2WZJA 1TR8A 2DHYA 5KPTA 1WJ7A 2OO9A 1G41A 5F3WA 1NO1A 1SXJE 3HKPA 3C3DA 5KPRA 2K0BX 1R7RA 3JR5A 3U6QA 2R4JA 4I8OA 1NY6A 4BLCA 1OFIA 4YY3M 2Q2EB 5L8RF 1V92A 3GPYA 1T6OA 3GPXA 1IY0A 3QYEA 4PD2A 1JR3A 1HR0M 2CWBA 2CV2A 3MHVC 1IY2A 3HHWA 3VLFB 4CHTB 1VEGA 2JY5A 4IBEA 4EIWA 1QVRA 3J7BA 2DZNB 3E9SA 4JI1M 4QHSA 2O5RA 1DGHA 1HNXM 1S3SA 3J80S 1L1TA 3T6PA 1OKSA 3GQ4A 3GLFE 4AI6A 2VF7A 4DUZM 2J5YA 3HU3A 1VDLA 1Z5AA 3GLHA 4DUYM 3BBZA 5C18A 2HHHM 3CTWB 1MJGM 1CUKA 3KXEC 4LRSA 5IZ7D 4DR6M 3L25A 5EXXA 4GITA 3U6OA 1QYRA 3RGPA 2WSCF 3R8FA 3KOWE 4JXJA 1XXHA 1YUBA 1L8QA 3QAUA 1PJSA 2JA2A 3T1YM 1DV0A 2FE8A 3WHKA 3T15A 3SARA 4G4RA 3W68A 3FTCA 5FLXS 2YNMD 4L6V6 1T43A 3C9PA 4XBOA 4AZFA 2D7EA 1E94E 3V76A 2J7NA 2H1RA 4JI5M 4IBIA 3GPPA 1D2NA 1V33A 2JY7A 3FUTA 3QWLA 3ZC7B 3C58A 5JI2E 3ZH9B 2DAMA 5FTKA 4B3RM 3U6MA 2RRUA 2R45A 3PXGA 1TH3A 3K2LA 4NC6A 1GJTA 4DV1M 2GQFA 3NWLA 2UXDM 4WURA 2AHMA 2P5TA 2JNHA 3KSJA 4D82A 3DFZA 2F5NA 2CV0A 4KHPM 3SFZA 3K1JA 4AKHA 1QANA 4DV4M 1SXJA 5DNYA 2WSFF 1N34M 3I01M 1QQWA 1R5LA 1E9SA 1IXSB 2X8AA 1LV7A 4OVZB 1JB0F 3FD9A 3GLIE 1OIZA 4FD2A 2YR0A 1W5SA 2BJVA 2FS1A 5H37D 1XMQM 4W5WA 2L4EA 2K9DA 4GKKM 2DAGA 1K3XA 1VEJA 1GABA 5DFLA 3JR4A 2KDLA 2OOBA 5KQ8A 2XSZD 3U5ZA 4X66M 1TH4A 1NY5A 2LH0A 4FW9A 4FWDA 4IJFA 2Z3XA 4B08A 4FVMA 3IG5A 4KO8A 3CGWA 3FUXA 3AOGA 4MM3B 1QDRA 3U6PA 1QUTA 2QCUA 2KEBA 1GKIA 2MR9A 2R44A 2YFQA 3HHXA 4GEWA 4NRWA 2UXBM 4A3VB 3HZJA 3GLFA 1ORYB 2KRUA 3SYLA 3GQ3A 2DZLA 2DVWB 2M60A 3J2PB 3TQSA 1D0LA 3KDSE 5IREB 3KSXA 2G5GX 3I4VA 5ITYA 2HL7A 4LRTA 2A5YB 4BBAA 1Y8GA 5EP4A 3SAUA 5LMUM 3TPZA 4KLNA 5BPVA 1WR1B 3UJNA 4DV3M 1TDZA 2B3TA 4LCBA 4DR7M 2I7NA 1NVMA 1N36M 4WW0A 4I81A 4LF6M 4LFCM 2KZSA 2FNAA 5FTLA 3K92A 3UK6A 5FTJA 1J7KA 2OOAA 2XF3A 4M9ZA 2XFTA 4LF7M 3VKHA 3LVWA 5ITTA 2ZBKB 1VQ1A 3B89A 3AKZA 1PJTA 4IBBA 2QP9X 3GLGB 3TE6A 2FH0A 2R6FA 1ZV1A 3HU2A 4P17A 1G3IA 3VK7A 4D81A 2XEPA 1NNJA 4GHLA 1YLAA 2Z4SA 1HQYE 2CUZA 1MX0A 4IBGA 2QSFX 1TTEA 2JWSA 1BVSA 2VDBB 5DYIA 5ITXE 3IG8A 2BJWA 1OAIA 2DI0A 2ZTDA 3RFWA 2CHGA 2HKJA 2F5PA 4JI8M 2L6OA 2X4AA 4PDIA 1FNNA 3EIEA 3FUWA 3H4JA 2DWNA 2KW0A 4IIWA 3KOYE 3GLIA 1IN7A 4TUWA 2N35A 2R0IA 3DZDA 4IBCA 4M9XA 3RE8A 3HHYA 1QZMA 3VFDA 4DR3M 3HU1A 3J7AS 2F5OA 4NXNM 4FWGA 4IBJA 4L15A 2FOIC 4AKIA 4WP2A 2EKFA 3HJ8A 4Y28F 1R6BX 4MB7A 4L78A 1IY1A 1ZAEA 2Y0QA 5KO3A 1FJGM 3GP1A 1L2DA 3U6CA 3LW5F 1SXJD 3LQRA 3U61A 1NV8A 1WHCA 3W0LB 3UGJA 4G4NA 2OQ4A 2LNHC 4MGHA 2BWBA 4X64M 2UXCM 2X49A 2F4VM 2MJ5B 4AG6A 3AL0C 1WIVA 1IBKM 2XFSA 4PCZA 2VQFM 3GRYA 1TH2A 1UFZA 2EKKA 3M0EA 3TWMA 4CJ6A 4FCVA 3UZUA 1V34A 2LXEA 2QQ8A 4RKUF 1HT1E 4BB9A 1ZQ9A 3SATA 2Z7JA 2XGNA 4B7HA 4I5SA 3VK8A 1J5EM 3FRHA 1JQJC 4DR2M 2C9OA 1DGGA 1EIJA 1T3TA 1VG5A 3LVVA 3GRRA 3TWKA 2V6ZM 2Y0TA 2MH8A 4Z8XA 3KOXE 2G8LA 2ERCA 1L2BA 1N77A 2HCBA 2DWZB 4MH0E 3IECA 5EXTA 3DA1A 4HL4A 3QYBA 3WHLA 4DR4M 5IT9S 1Z5CA 4L8RC 2F5QA 3CF2A 4MGIE 2EO2A 1IN4A 1PRBA 2QENA 1P3QQ 5E6JA 1WGLA 1G8PA 4G4QA 4D80A 3GRUA 4DV0M 4G3OA 3HHZA 1N33M 2JUJA 1R2ZA 1KYIA 1OFHA 3M7GA 3L2AA 3HWSA 3Q8XA 1H6UA 1GL7A 1VEKA 5ITXA 4B7GA 1GO5A 5FTMA 4DV7M 3LQQA 2EUCA 2XZFA 4B7FA 1D0KA 1NNUC 1Q02A 1QAMA 4Z6YA 1LTMA 2JP7A 3W0FA 4QNMA 1PGYA 2ZAMA 1PJIA 1A5TA 1WGNA 2QZ4A 3C3EA 3MMPA 4RF0A 2OPFA 3L28A 2GNOA 1GLNA 3IHPA 2CHVA 3HY5A 2I7PA 1AUAA 3LCVB 2VIIA 4QOZC 3TL4X 4LF9M 1HJPA 4LJ9A 4IBFA 1NV9A 2LVNC 2J7OA 5LMNM 3VKGA 4LF8M 2KNVA 2LWXA 2KA6B 1OAOC 4LFBM 3LMMA 1Q3CA 1MN3A 4II7A 1N32M 1IN5A 2C5RA 1XC8A 4MGZE 2LHGA 4DV6M 2LVQD 2QBYB 3B7NA 2LHCA 1XMOM 3GLGE 1JR3D 1HT2E 1L2CA 2UU9M 1K3WA 1E32A 3GRVA 3M6AA 4JI3M 1QAOA 4JV5M 2C99A 4RNAA 5E26A 4XGIA 4LJ8A 2QPAA 4JYAM 1IBLM 2DAEA 4PT5A 4M0WA 3KVWA 1C7YA 1DO0A 2MROB 3PVSA 1G71A 3J27B 4LJ4A 4NOOB 5IWAM 4B3MM 3B7ZA 4NSRA 2LVAA 4IBDA 1XHBA 2L09A 3VDUA 3KS4A 1D0MA 1IXSA 3R9XB 2O01F 4F1IA 4OVZA 4X62M 1N75A 1TDHA 4JN6A 1DGHB 3KP0E 4JI7M 4ANRA 4GRIA 4YHHM 3AFHA 2ZANA 3SAWA 2EA0A 3FE3A 3JAMS 3FUVA 4DV2M 1PJQA 4R71A 1NJGA 5A2QS 1ZMUA 3E21A 1QZEA 3FYCA 3GLHB 3AOEC 4M9SA 2C96A 4QNRA 4REZA 3HJSA 2DENA 4KT0F 3U6SA 3T1HM 1SG9A 3TWLA 3SHFA 4JI2M 2V1UA 2R65A 1TGUA 3EIHA 2DHRA 5EP1A 2QHOB 3A98B 2JY8A 2K6BA 2XLJA 1XXHB 3KW6A 1QAQA 2VQEM 1MU5A 2RGOA 4I4LA 2JXNA 3NBIA 3A46A 1NHGC 4AQYM 4LZZA 5FTNA 4G4OA 4LF5M 2JZ1A 3AJIB 1X37A 2F5SA 3F92A 4ZPXA 3W67A 1GL6A 4P16A
chains in the Genus database with same CATH topology
2CRUA 2JXNA 1EIJA 2K6BA 2FH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRU A;  2JXN A;  1EIJ A;  2K6B A;  2FH0 A; 
#chains in the Genus database with same CATH topology
 1GVN A;  4CIZ A;  5EP2 A;  2DAI A;  4DBG B;  4OX9 M;  1YSY A;  4LF4 M;  1L1Z A;  2KXE A;  4S12 A;  3SMP A;  4QHT A;  4GKJ M;  1J09 A;  5ITU A;  3A42 A;  3CF0 A;  3D8B A;  4HLQ A;  4LFA M;  4LZJ A;  4JI0 M;  2CE7 A;  3GLG A;  2APL A;  2K47 A;  3FKE A;  1G59 A;  1DGB A;  2DZO B;  2ZTC A;  2CP8 A;  1IM2 A;  1UM8 A;  4UN2 B;  5DYG A;  1SXJ B;  3A45 A;  4XK8 F;  3E4R A;  2R4E A;  1HNW M;  4NSO B;  4JI6 M;  2KRK A;  4LJ7 A;  4CGY B;  3HJQ A;  1DGF A;  3BXW A;  4LG2 A;  3GO8 A;  4LJA A;  2ZM6 M;  4MGK E;  3HX3 A;  4KOD A;  5EXP A;  2DAK A;  4DR1 M;  2UUC M;  2C9C A;  3ZCB B;  1IXR C;  7CAT A;  3DOA A;  2MGW A;  2XH9 A;  1AIP C;  4IBK A;  3K8Z A;  3U5Z B;  3VDP A;  4OW0 A;  3FTE A;  4GC5 A;  1Z6T A;  4GC9 A;  2KZU A;  2CHQ A;  2C98 A;  3UMM A;  4NXM M;  1Q39 A;  4RF1 A;  1XNQ M;  3SMS A;  4CIS A;  2Y21 A;  3SC3 A;  3SYK A;  1DO2 A;  3KFU G;  3I04 M;  4Q7J A;  2VF8 A;  4DR5 M;  4NL4 H;  4GH9 A;  4NRV A;  2KNA A;  2DWL A;  1R4G A;  3FYD A;  1IFY A;  3PNV A;  3RGS A;  2XZU A;  2O25 A;  2LBC A;  1IN6 A;  5EQT A;  1C1K A;  3GLF B;  2Z8Y M;  2E5L M;  2V1C A;  1R2Y A;  3SAS A;  2M5Z A;  1NJF A;  4FWH A;  1HQC A;  1E9R A;  2L7H A;  3U6E A;  3U60 B;  1PM5 A;  3I51 A;  1QUS A;  2G3Q A;  4L16 A;  2EJS A;  3KOZ E;  1G4A E;  3NBX X;  4ITQ A;  2DKL A;  1XNR M;  2JY6 B;  5ITR A;  2CFO A;  2R18 A;  2RKO A;  2KHH A;  3L26 A;  3GPU A;  4B3S M;  3B9P A;  1K82 A;  2YQZ A;  3AOE A;  1IBM M;  8CAT A;  4G6Z A;  1EE8 A;  1XWI A;  2CV1 A;  1NHW C;  2DWM A;  5KQD A;  1KFV A;  2H5X A;  1W5T A;  3KP1 E;  4MGY E;  1KSF X;  3GQ5 A;  4AW4 A;  2CRU A;  3SBJ A;  2Y20 A;  3AV0 A;  3B74 A;  1Z59 A;  2DNA A;  2JZ0 A;  2L4F A;  1NSF A;  1XB2 B;  5JI3 E;  1JR3 E;  2L2D A;  4IJE A;  5GKN A;  5EP3 A;  3PNY A;  5C1B A;  1N78 A;  3T38 A;  3ILK A;  2W82 A;  3FTF A;  2D7H A;  3ZQJ A;  2KNZ A;  2R62 A;  3Q8G A;  2BNK A;  3E46 A;  2NQ8 C;  1GJS A;  5FSW A;  3CF6 E;  4LGM A;  4QOS A;  4B3T M;  4AG5 A;  1IQP A;  1IN8 A;  2HAK A;  4R3D A;  4X65 M;  1RU3 A;  2UUB M;  4GIP A;  4HEO A;  3D8L A;  2L7I A;  4JI4 M;  3MJ5 A;  2BWE A;  3K9P A;  4LGY A;  1Q3B A;  3GLH E;  3OTO M;  3MK6 A;  2QNJ A;  3GLI B;  1ZMW A;  3LCU A;  3L29 A;  1I4W A;  3PFI A;  4F2L A;  4FCW A;  1F4I A;  4PDG A;  4LY6 A;  1IXZ A;  2D7G A;  3BOS A;  1OJL A;  3U60 A;  3FRI A;  4R7G A;  4K0K M;  3SHG B;  3J81 S;  2R46 A;  3SAV A;  2CEA A;  1XXH E;  4LJ5 A;  1QDT A;  3HGI A;  5EJC A;  1PJJ A;  4LJ6 A;  1HNZ M;  1Z5B A;  1OIP A;  2Z4R A;  3U61 B;  1TF0 B;  2LTU A;  3U6D A;  3I4Y A;  3H4M A;  4M0D A;  1I94 M;  1OQY A;  3FTD A;  2RGH A;  1EFU B;  4GMQ A;  2HWJ A;  3K9O A;  2LVO C;  4FCT A;  4DV5 M;  2ZAO A;  1SXJ C;  1OTR A;  2LVP C;  4GHA A;  3FUU A;  2DXI A;  1WXQ A;  1ZMV A;  5ITQ A;  4AKG A;  3KS8 A;  4L4U A;  5EXS A;  3B7Q A;  2FFJ A;  1YE9 A;  2XSZ A;  5BR8 M;  4OU7 A;  2UUA M;  2QBY A;  1VDD A;  5KPZ A;  3L27 A;  3THG A;  3U6L A;  2WSE F;  2WZJ A;  1TR8 A;  2DHY A;  5KPT A;  1WJ7 A;  2OO9 A;  1G41 A;  5F3W A;  1NO1 A;  1SXJ E;  3HKP A;  3C3D A;  5KPR A;  2K0B X;  1R7R A;  3JR5 A;  3U6Q A;  2R4J A;  4I8O A;  1NY6 A;  4BLC A;  1OFI A;  4YY3 M;  2Q2E B;  5L8R F;  1V92 A;  3GPY A;  1T6O A;  3GPX A;  1IY0 A;  3QYE A;  4PD2 A;  1JR3 A;  1HR0 M;  2CWB A;  2CV2 A;  3MHV C;  1IY2 A;  3HHW A;  3VLF B;  4CHT B;  1VEG A;  2JY5 A;  4IBE A;  4EIW A;  1QVR A;  3J7B A;  2DZN B;  3E9S A;  4JI1 M;  4QHS A;  2O5R A;  1DGH A;  1HNX M;  1S3S A;  3J80 S;  1L1T A;  3T6P A;  1OKS A;  3GQ4 A;  3GLF E;  4AI6 A;  2VF7 A;  4DUZ M;  2J5Y A;  3HU3 A;  1VDL A;  1Z5A A;  3GLH A;  4DUY M;  3BBZ A;  5C18 A;  2HHH M;  3CTW B;  1MJG M;  1CUK A;  3KXE C;  4LRS A;  5IZ7 D;  4DR6 M;  3L25 A;  5EXX A;  4GIT A;  3U6O A;  1QYR A;  3RGP A;  2WSC F;  3R8F A;  3KOW E;  4JXJ A;  1XXH A;  1YUB A;  1L8Q A;  3QAU A;  1PJS A;  2JA2 A;  3T1Y M;  1DV0 A;  2FE8 A;  3WHK A;  3T15 A;  3SAR A;  4G4R A;  3W68 A;  3FTC A;  5FLX S;  2YNM D;  4L6V 6;  1T43 A;  3C9P A;  4XBO A;  4AZF A;  2D7E A;  1E94 E;  3V76 A;  2J7N A;  2H1R A;  4JI5 M;  4IBI A;  3GPP A;  1D2N A;  1V33 A;  2JY7 A;  3FUT A;  3QWL A;  3ZC7 B;  3C58 A;  5JI2 E;  3ZH9 B;  2DAM A;  5FTK A;  4B3R M;  3U6M A;  2RRU A;  2R45 A;  3PXG A;  1TH3 A;  3K2L A;  4NC6 A;  1GJT A;  4DV1 M;  2GQF A;  3NWL A;  2UXD M;  4WUR A;  2AHM A;  2P5T A;  2JNH A;  3KSJ A;  4D82 A;  3DFZ A;  2F5N A;  2CV0 A;  4KHP M;  3SFZ A;  3K1J A;  4AKH A;  1QAN A;  4DV4 M;  1SXJ A;  5DNY A;  2WSF F;  1N34 M;  3I01 M;  1QQW A;  1R5L A;  1E9S A;  1IXS B;  2X8A A;  1LV7 A;  4OVZ B;  1JB0 F;  3FD9 A;  3GLI E;  1OIZ A;  4FD2 A;  2YR0 A;  1W5S A;  2BJV A;  2FS1 A;  5H37 D;  1XMQ M;  4W5W A;  2L4E A;  2K9D A;  4GKK M;  2DAG A;  1K3X A;  1VEJ A;  1GAB A;  5DFL A;  3JR4 A;  2KDL A;  2OOB A;  5KQ8 A;  2XSZ D;  3U5Z A;  4X66 M;  1TH4 A;  1NY5 A;  2LH0 A;  4FW9 A;  4FWD A;  4IJF A;  2Z3X A;  4B08 A;  4FVM A;  3IG5 A;  4KO8 A;  3CGW A;  3FUX A;  3AOG A;  4MM3 B;  1QDR A;  3U6P A;  1QUT A;  2QCU A;  2KEB A;  1GKI A;  2MR9 A;  2R44 A;  2YFQ A;  3HHX A;  4GEW A;  4NRW A;  2UXB M;  4A3V B;  3HZJ A;  3GLF A;  1ORY B;  2KRU A;  3SYL A;  3GQ3 A;  2DZL A;  2DVW B;  2M60 A;  3J2P B;  3TQS A;  1D0L A;  3KDS E;  5IRE B;  3KSX A;  2G5G X;  3I4V A;  5ITY A;  2HL7 A;  4LRT A;  2A5Y B;  4BBA A;  1Y8G A;  5EP4 A;  3SAU A;  5LMU M;  3TPZ A;  4KLN A;  5BPV A;  1WR1 B;  3UJN A;  4DV3 M;  1TDZ A;  2B3T A;  4LCB A;  4DR7 M;  2I7N A;  1NVM A;  1N36 M;  4WW0 A;  4I81 A;  4LF6 M;  4LFC M;  2KZS A;  2FNA A;  5FTL A;  3K92 A;  3UK6 A;  5FTJ A;  1J7K A;  2OOA A;  2XF3 A;  4M9Z A;  2XFT A;  4LF7 M;  3VKH A;  3LVW A;  5ITT A;  2ZBK B;  1VQ1 A;  3B89 A;  3AKZ A;  1PJT A;  4IBB A;  2QP9 X;  3GLG B;  3TE6 A;  2FH0 A;  2R6F A;  1ZV1 A;  3HU2 A;  4P17 A;  1G3I A;  3VK7 A;  4D81 A;  2XEP A;  1NNJ A;  4GHL A;  1YLA A;  2Z4S A;  1HQY E;  2CUZ A;  1MX0 A;  4IBG A;  2QSF X;  1TTE A;  2JWS A;  1BVS A;  2VDB B;  5DYI A;  5ITX E;  3IG8 A;  2BJW A;  1OAI A;  2DI0 A;  2ZTD A;  3RFW A;  2CHG A;  2HKJ A;  2F5P A;  4JI8 M;  2L6O A;  2X4A A;  4PDI A;  1FNN A;  3EIE A;  3FUW A;  3H4J A;  2DWN A;  2KW0 A;  4IIW A;  3KOY E;  3GLI A;  1IN7 A;  4TUW A;  2N35 A;  2R0I A;  3DZD A;  4IBC A;  4M9X A;  3RE8 A;  3HHY A;  1QZM A;  3VFD A;  4DR3 M;  3HU1 A;  3J7A S;  2F5O A;  4NXN M;  4FWG A;  4IBJ A;  4L15 A;  2FOI C;  4AKI A;  4WP2 A;  2EKF A;  3HJ8 A;  4Y28 F;  1R6B X;  4MB7 A;  4L78 A;  1IY1 A;  1ZAE A;  2Y0Q A;  5KO3 A;  1FJG M;  3GP1 A;  1L2D A;  3U6C A;  3LW5 F;  1SXJ D;  3LQR A;  3U61 A;  1NV8 A;  1WHC A;  3W0L B;  3UGJ A;  4G4N A;  2OQ4 A;  2LNH C;  4MGH A;  2BWB A;  4X64 M;  2UXC M;  2X49 A;  2F4V M;  2MJ5 B;  4AG6 A;  3AL0 C;  1WIV A;  1IBK M;  2XFS A;  4PCZ A;  2VQF M;  3GRY A;  1TH2 A;  1UFZ A;  2EKK A;  3M0E A;  3TWM A;  4CJ6 A;  4FCV A;  3UZU A;  1V34 A;  2LXE A;  2QQ8 A;  4RKU F;  1HT1 E;  4BB9 A;  1ZQ9 A;  3SAT A;  2Z7J A;  2XGN A;  4B7H A;  4I5S A;  3VK8 A;  1J5E M;  3FRH A;  1JQJ C;  4DR2 M;  2C9O A;  1DGG A;  1EIJ A;  1T3T A;  1VG5 A;  3LVV A;  3GRR A;  3TWK A;  2V6Z M;  2Y0T A;  2MH8 A;  4Z8X A;  3KOX E;  2G8L A;  2ERC A;  1L2B A;  1N77 A;  2HCB A;  2DWZ B;  4MH0 E;  3IEC A;  5EXT A;  3DA1 A;  4HL4 A;  3QYB A;  3WHL A;  4DR4 M;  5IT9 S;  1Z5C A;  4L8R C;  2F5Q A;  3CF2 A;  4MGI E;  2EO2 A;  1IN4 A;  1PRB A;  2QEN A;  1P3Q Q;  5E6J A;  1WGL A;  1G8P A;  4G4Q A;  4D80 A;  3GRU A;  4DV0 M;  4G3O A;  3HHZ A;  1N33 M;  2JUJ A;  1R2Z A;  1KYI A;  1OFH A;  3M7G A;  3L2A A;  3HWS A;  3Q8X A;  1H6U A;  1GL7 A;  1VEK A;  5ITX A;  4B7G A;  1GO5 A;  5FTM A;  4DV7 M;  3LQQ A;  2EUC A;  2XZF A;  4B7F A;  1D0K A;  1NNU C;  1Q02 A;  1QAM A;  4Z6Y A;  1LTM A;  2JP7 A;  3W0F A;  4QNM A;  1PGY A;  2ZAM A;  1PJI A;  1A5T A;  1WGN A;  2QZ4 A;  3C3E A;  3MMP A;  4RF0 A;  2OPF A;  3L28 A;  2GNO A;  1GLN A;  3IHP A;  2CHV A;  3HY5 A;  2I7P A;  1AUA A;  3LCV B;  2VII A;  4QOZ C;  3TL4 X;  4LF9 M;  1HJP A;  4LJ9 A;  4IBF A;  1NV9 A;  2LVN C;  2J7O A;  5LMN M;  3VKG A;  4LF8 M;  2KNV A;  2LWX A;  2KA6 B;  1OAO C;  4LFB M;  3LMM A;  1Q3C A;  1MN3 A;  4II7 A;  1N32 M;  1IN5 A;  2C5R A;  1XC8 A;  4MGZ E;  2LHG A;  4DV6 M;  2LVQ D;  2QBY B;  3B7N A;  2LHC A;  1XMO M;  3GLG E;  1JR3 D;  1HT2 E;  1L2C A;  2UU9 M;  1K3W A;  1E32 A;  3GRV A;  3M6A A;  4JI3 M;  1QAO A;  4JV5 M;  2C99 A;  4RNA A;  5E26 A;  4XGI A;  4LJ8 A;  2QPA A;  4JYA M;  1IBL M;  2DAE A;  4PT5 A;  4M0W A;  3KVW A;  1C7Y A;  1DO0 A;  2MRO B;  3PVS A;  1G71 A;  3J27 B;  4LJ4 A;  4NOO B;  5IWA M;  4B3M M;  3B7Z A;  4NSR A;  2LVA A;  4IBD A;  1XHB A;  2L09 A;  3VDU A;  3KS4 A;  1D0M A;  1IXS A;  3R9X B;  2O01 F;  4F1I A;  4OVZ A;  4X62 M;  1N75 A;  1TDH A;  4JN6 A;  1DGH B;  3KP0 E;  4JI7 M;  4ANR A;  4GRI A;  4YHH M;  3AFH A;  2ZAN A;  3SAW A;  2EA0 A;  3FE3 A;  3JAM S;  3FUV A;  4DV2 M;  1PJQ A;  4R71 A;  1NJG A;  5A2Q S;  1ZMU A;  3E21 A;  1QZE A;  3FYC A;  3GLH B;  3AOE C;  4M9S A;  2C96 A;  4QNR A;  4REZ A;  3HJS A;  2DEN A;  4KT0 F;  3U6S A;  3T1H M;  1SG9 A;  3TWL A;  3SHF A;  4JI2 M;  2V1U A;  2R65 A;  1TGU A;  3EIH A;  2DHR A;  5EP1 A;  2QHO B;  3A98 B;  2JY8 A;  2K6B A;  2XLJ A;  1XXH B;  3KW6 A;  1QAQ A;  2VQE M;  1MU5 A;  2RGO A;  4I4L A;  2JXN A;  3NBI A;  3A46 A;  1NHG C;  4AQY M;  4LZZ A;  5FTN A;  4G4O A;  4LF5 M;  2JZ1 A;  3AJI B;  1X37 A;  2F5S A;  3F92 A;  4ZPX A;  3W67 A;  1GL6 A;  4P16 A; 
#chains in the Genus database with same CATH homology
 2CRU A;  2JXN A;  1EIJ A;  2K6B A;  2FH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...