2CRUA

Solution structure of programmed cell death 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GSSGSSGLRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 5
publication title Solution structure of programmed cell death 5
rcsb
source organism Homo sapiens
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2cruA01
1EIJA 2JXNA 2K6BA 2CRUA 2FH0A
chains in the Genus database with same CATH superfamily
3RFWA 3E9SA 4DR2M 1IM2A 3GLIB 8CATA 3IG5A 1V34A 3KFUG 4PT5A 3HHWA 4LFAM 4PDGA 3KS4A 1PJSA 1NY5A 4GEWA 1KFVA 4X64M 2Y0TA 1FNNA 2XFSA 2UU9M 4QHTA 4QHSA 4G4QA 2M60A 3SARA 2DZNB 2DZOB 2FS1A 2FE8A 4WW0A 1L2DA 1D0KA 1VDLA 2MGWA 4XBOA 2DAEA 3LW5F 3T1YM 3T6PA 1DGFA 2LVNC 4I4LA 4IBBA 4RF0A 1HQCA 1OTRA 2CHGA 4DR7M 3H4MA 2R62A 4LJ4A 2QBYA 1J09A 1D2NA 4IBJA 1N32M 1G4AE 3WHLA 2CV2A 1T43A 2RGOA 3A42A 1JR3A 3BOSA 4KO8A 4LJ7A 3GLHE 3T1HM 5BR8M 2CV1A 2KNAA 1HNXM 3VKHA 2KHHA 3K92A 1F4IA 3SATA 1EIJA 3B89A 4DV3M 2JNHA 3ZQJA 3FTCA 2X4AA 4WP2A 1PRBA 1NO1A 4DV1M 4DR6M 3CF6E 4DR5M 1IQPA 1G8PA 3A98B 3FYCA 4RNAA 4DUZM 1RU3A 3GRVA 4KODA 2F5SA 1CUKA 4JI5M 4B7HA 2DHRA 1G41A 3LVWA 4JI0M 4DV6M 2EA0A 2R0IA 4LJAA 5EJCA 5F3WA 1I94M 3L29A 5IREB 4UN2B 4CHTB 3I04M 5KQ8A 1EE8A 2KNZA 3U6LA 4FVMA 4L15A 4B08A 2MROB 2Z7JA 2EKFA 2L4FA 1GO5A 5ITXE 4B3TM 5JI2E 1TH2A 3UZUA 2QBYB 3TE6A 3B7QA 3C9PA 2LNHC 4X62M 2R4JA 1XWIA 2CRUA 3FUVA 4X66M 2CP8A 2M5ZA 2G3QA 5KPZA 3UJNA 1VEJA 1HR0M 1YSYA 3PNVA 4G4OA 3M0EA 4Y28F 2HWJA 5KPRA 3D8BA 4JI8M 1NY6A 1SXJD 2CEAA 2XSZA 3KOZE 3AOEC 2HHHM 2KNVA 2JY6B 1E94E 3FUWA 1IBMM 2JZ0A 2O25A 1R5LA 5A2QS 3VK7A 4ZPXA 4M0DA 2Q2EB 1ZQ9A 3TQSA 4B7GA 5LMNM 1EFUB 3LVVA 1D0MA 2K47A 2R6FA 5EP4A 2DKLA 2EO2A 1DO0A 2JXNA 3C3EA 3M7GA 1G71A 3GPPA 1T6OA 3QYBA 2DWZB 5DYGA 4AG6A 1IY1A 2EUCA 2C99A 4FCWA 4MB7A 3VK8A 3U6CA 2F5QA 4JI2M 5L8RF 5DYIA 1QAOA 4F1IA 1MU5A 3KW6A 4IJFA 1C7YA 3PVSA 5EP1A 4PDIA 2J5YA 2DAGA 4AQYM 1YE9A 2K9DA 3KVWA 1QDRA 3TWMA 1ZAEA 4B3MM 2XLJA 4GHAA 4XGIA 3U6OA 3RGPA 4LJ9A 1PGYA 4DV2M 4WURA 5FTNA 4LF4M 4LGYA 2YQZA 3L28A 3KOWE 3GLGE 1DGBA 1R2ZA 3SAUA 2JZ1A 2JY7A 2KRKA 2Y20A 1N36M 4LG2A 2R46A 1GKIA 4GITA 3QAUA 4OVZA 3LQQA 1AIPC 1QUTA 3J7BA 4M9XA 4LZZA 3LCUA 4MGYE 4ANRA 5FTLA 2YFQA 2LH0A 2XZFA 1UFZA 3SAVA 4LCBA 1KSFX 4MGIE 4DV5M 3SYLA 2V6ZM 4GIPA 1NJGA 2ZANA 1ZMWA 2V1UA 1MN3A 2EJSA 3AV0A 3U61A 1HNWM 2G8LA 4KT0F 4M0WA 3AL0C 3HY5A 2JWSA 3W0FA 4HLQA 3RE8A 1XMOM 2C5RA 4QOZC 4LJ8A 4QNMA 1VG5A 4GH9A 2XGNA 1H6UA 3OTOM 4AZFA 4LF8M 1R4GA 3GLHA 2QHOB 1VQ1A 2G5GX 4B3SM 3K1JA 5FSWA 2B3TA 4OW0A 2X8AA 4DV0M 4JI1M 2DZLA 3LQRA 4Z6YA 2Z8YM 4MGKE 3BBZA 4OVZB 2KEBA 1DO2A 2BWEA 3AFHA 3KOYE 4L4UA 3H4JA 3VDPA 3NBIA 1J7KA 1SXJE 3MMPA 3PNYA 2DNAA 3FUUA 1J5EM 2BWBA 5GKNA 4JI7M 2YNMD 3SMPA 5E26A 3AJIB 4LFBM 3GLFE 2BJVA 2L7IA 3U6QA 2R45A 3KSJA 2VF7A 3MK6A 3U61B 1N77A 1OFIA 3ZH9B 2UXCM 4GC9A 5ITXA 4CGYB 5ITUA 2Z4RA 4LJ6A 1WHCA 3E4RA 1N75A 1YUBA 2BNKA 2L6OA 2KDLA 3C58A 3GLHB 3DOAA 4REZA 3IG8A 2C96A 4IBIA 3AKZA 1QANA 1P3QQ 1NHWC 4D82A 4QOSA 4JV5M 1C1KA 1IXSA 5ITTA 4LF6M 1ZMVA 2K6BA 2CE7A 4FWHA 5IT9S 3SYKA 3B9PA 4LJ5A 5FTJA 3U5ZA 4YHHM 2F5PA 4MM3B 1DGGA 2GNOA 2XH9A 1IN7A 1XC8A 3WHKA 4W5WA 1NNUC 5ITYA 2I7NA 1DGHB 2RKOA 3KSXA 4D80A 2UUAM 4BB9A 2D7EA 2N35A 2CUZA 4DUYM 3JAMS 1GVNA 4K0KM 2I7PA 1T3TA 1IXZA 3CF2A 2XF3A 3U6SA 2L4EA 3J81S 4DV7M 1ZMUA 2Z3XA 1W5TA 5EXSA 3L27A 3W0LB 1E9RA 1QQWA 1OIPA 2NQ8C 3I4YA 4NL4H 3GP1A 4G4RA 2OQ4A 2XEPA 3U6DA 3B7NA 2QNJA 4AKGA 1XNQM 2WSEF 4MGZE 4ITQA 3HJ8A 1IXSB 1NHGC 3ZC7B 4AG5A 2ZM6M 3GQ3A 1ORYB 4DV4M 3Q8GA 4B7FA 2FFJA 5IWAM 2R44A 3SHFA 3GLGA 3U5ZB 2ZTCA 1GLNA 2BJWA 2Z4SA 4B3RM 4IBEA 1TTEA 2KA6B 3DZDA 2UUBM 2LVOC 2LHCA 3GPYA 5JI3E 4KHPM 4I8OA 3DFZA 1K3WA 2OPFA 1GL7A 4IBGA 5EXXA 3HU3A 3MHVC 4IIWA 5DFLA 4LY6A 2A5YB 4I81A 3AOEA 2VF8A 3FE3A 2ZAOA 4II7A 4LGMA 4L78A 1OQYA 1W5SA 2XZUA 3TWLA 3ZCBB 2UXDM 3HX3A 2O01F 5LMUM 2P5TA 1GJTA 1SXJC 2KZUA 4S12A 2KZSA 4LRTA 4G3OA 4MGHA 2AHMA 2GQFA 2QP9X 5DNYA 2HAKA 3W67A 3ILKA 4FWGA 1VEGA 2LWXA 3LCVB 3L2AA 3W68A 2MH8A 4L16A 1E9SA 4JI4M 2DAMA 2JA2A 2W82A 3GLGB 2KRUA 2EKKA 3BXWA 3JR5A 2QCUA 5C1BA 2L7HA 1L1TA 3J80S 4GKKM 1NV9A 3RGSA 4OX9M 1WJ7A 2K0BX 1IN5A 3VKGA 1QYRA 3C3DA 2QENA 5FLXS 1XMQM 3E46A 4X65M 1SXJA 4EIWA 2UXBM 1QZEA 1WGNA 2L09A 3GRRA 3I01M 1K3XA 1HT1E 2J7NA 4AKIA 2C9OA 3GLFA 2D7HA 3R8FA 1Y8GA 3QYEA 2CWBA 3U60A 5IZ7D 1PJIA 1MJGM 1YLAA 3HWSA 4P16A 1R2YA 1JR3D 2DAKA 3GRYA 3FRHA 2F4VM 4IBFA 1IN6A 3SMSA 3GO8A 2CV0A 3HHYA 4XK8F 1WXQA 3K9PA 1PM5A 3U6MA 1XXHE 1X37A 1Z59A 4JI6M 4CIZA 3SAWA 3GRUA 3Q8XA 3FUXA 5FTKA 3VFDA 4BBAA 4G4NA 3U6PA 4FCTA 1QZMA 7CATA 1QAQA 4QNRA 3E21A 4DR1M 1IXRC 3L25A 3K8ZA 3KP0E 4DR3M 2DHYA 1IN8A 4JI3M 1SXJB 1L1ZA 2APLA 1Z6TA 1DGHA 3GLIE 3A45A 1UM8A 1FJGM 3U6EA 3GLFB 3TWKA 1D0LA 3FD9A 2LBCA 4GMQA 2UUCM 3U60B 4AW4A 4NRVA 3T15A 2OO9A 1HQYE 1WR1B 1IFYA 1TR8A 4GC5A 4L8RC 3L26A 2LVQD 1G3IA 3HU2A 1Q02A 1Q3BA 3A46A 4D81A 2XSZD 1HT2E 1Q39A 4Q7JA 5ITRA 2JUJA 2QPAA 4FD2A 4RF1A 1TGUA 1GJSA 3J7AS 3QWLA 2E5LM 4LRSA 4CJ6A 1IY2A 2F5OA 1TH3A 3KXEC 2OOBA 2O5RA 3AOGA 4HL4A 4JXJA 5FTMA 3FTDA 3GQ5A 1K82A 3HHXA 4I5SA 1GABA 2R18A 3J2PB 4M9ZA 1TH4A 2J7OA 3FRIA 4LF9M 4LF5M 2WZJA 3VLFB 1WIVA 1L2CA 2VQFM 5EXTA 1A5TA 5EXPA 4NRWA 3KS8A 1NNJA 2DI0A 4LF7M 3NWLA 4BLCA 3TL4X 3B7ZA 2DWNA 3NBXX 3CF0A 2JP7A 1QAMA 1Z5AA 4JN6A 4AI6A 1Z5BA 4LFCM 3SC3A 4NSRA 1OJLA 5KO3A 1WGLA 2QZ4A 1KYIA 1NV8A 2WSFF 2KW0A 4NOOB 5EP3A 2KXEA 1QUSA 3HJSA 2C98A 3PFIA 4M9SA 2DXIA 1TDHA 1DV0A 3HZJA 2LTUA 3B74A 2QSFX 2QQ8A 1HNZM 4A3VB 3KDSE 3IHPA 4R71A 1JR3E 2ERCA 5KPTA 3FTEA 3FYDA 1QVRA 4GRIA 2XFTA 1N78A 1S3SA 4FWDA 3UMMA 4DR4M 2YR0A 2WSCF 3DA1A 3GPUA 3HHZA 2FNAA 3FTFA 3GPXA 2DVWB 3JR4A 2OOAA 2CFOA 1NJFA 4NSOB 3K9OA 1OFHA 2CHVA 3SFZA 3SBJA 2DWLA 2LVPC 1L8QA 1TDZA 1ZV1A 4L6V6 4FW9A 4YY3M 4RKUF 3M6AA 1OAOC 4MH0E 1G59A 1IN4A 4PD2A 4GKJM 4JYAM 3I51A 2ZAMA 1IBLM 2H1RA 1JB0F 3IECA 5EQTA 1JQJC 2HKJA 2ZTDA 1OKSA 2FOIC 4NXNM 4F2LA 3UGJA 2VQEM 1PJQA 3KOXE 3HU1A 4IBDA 1AUAA 1MX0A 2D7GA 3I4VA 4R3DA 3SHGB 4PCZA 4LZJA 3UK6A 2LXEA 3HGIA 2MR9A 4DBGB 4FCVA 2MJ5B 3PXGA 1XXHA 2FH0A 2DENA 4IJEA 4IBCA 4Z8XA 3F92A 5EP2A 3VDUA 1N34M 4P17A 3HKPA 1L2BA 1Z5CA 3V76A 4NXMM 3KP1E 5ITQA 1OAIA 2Y21A 5C18A 2ZBKB 1I4WA 3J27B 3FUTA 3K2LA 5KQDA 4TUWA 1XB2B 2HCBA 1SG9A 5E6JA 4R7GA 1PJTA 2H5XA 2DAIA 1LV7A 2Y0QA 4G6ZA 3THGA 2VIIA 1V33A 3GLIA 1V92A 2V1CA 3R9XB 2VDBB 3EIEA 4CISA 3EIHA 2R65A 1BVSA 1PJJA 1GL6A 1OIZA 1XNRM 3CTWB 3FKEA 2HL7A 2RRUA 1HJPA 2X49A 1Q3CA 1VDDA 4HEOA 1QDTA 3MJ5A 2C9CA 3HJQA 1R6BX 2R4EA 3T38A 1N33M 1VEKA 4NC6A 1XXHB 1XHBA 3GQ4A 4GHLA 2L2DA 2F5NA 2JY8A 4IBKA 4OU7A 1IY0A 1TF0B 3CGWA 2CHQA 1LTMA 3SASA 1R7RA 5BPVA 2JY5A 1NSFA 5H37D 2RGHA 4KLNA 1NVMA 2DWMA 1IBKM 4AKHA 3D8LA 3TPZA 3LMMA 1E32A 2LHGA 2LVAA
chains in the Genus database with same CATH topology
1EIJA 2JXNA 2K6BA 2CRUA 2FH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIJ A;  2JXN A;  2K6B A;  2CRU A;  2FH0 A; 
#chains in the Genus database with same CATH topology
 3RFW A;  3E9S A;  4DR2 M;  1IM2 A;  3GLI B;  8CAT A;  3IG5 A;  1V34 A;  3KFU G;  4PT5 A;  3HHW A;  4LFA M;  4PDG A;  3KS4 A;  1PJS A;  1NY5 A;  4GEW A;  1KFV A;  4X64 M;  2Y0T A;  1FNN A;  2XFS A;  2UU9 M;  4QHT A;  4QHS A;  4G4Q A;  2M60 A;  3SAR A;  2DZN B;  2DZO B;  2FS1 A;  2FE8 A;  4WW0 A;  1L2D A;  1D0K A;  1VDL A;  2MGW A;  4XBO A;  2DAE A;  3LW5 F;  3T1Y M;  3T6P A;  1DGF A;  2LVN C;  4I4L A;  4IBB A;  4RF0 A;  1HQC A;  1OTR A;  2CHG A;  4DR7 M;  3H4M A;  2R62 A;  4LJ4 A;  2QBY A;  1J09 A;  1D2N A;  4IBJ A;  1N32 M;  1G4A E;  3WHL A;  2CV2 A;  1T43 A;  2RGO A;  3A42 A;  1JR3 A;  3BOS A;  4KO8 A;  4LJ7 A;  3GLH E;  3T1H M;  5BR8 M;  2CV1 A;  2KNA A;  1HNX M;  3VKH A;  2KHH A;  3K92 A;  1F4I A;  3SAT A;  1EIJ A;  3B89 A;  4DV3 M;  2JNH A;  3ZQJ A;  3FTC A;  2X4A A;  4WP2 A;  1PRB A;  1NO1 A;  4DV1 M;  4DR6 M;  3CF6 E;  4DR5 M;  1IQP A;  1G8P A;  3A98 B;  3FYC A;  4RNA A;  4DUZ M;  1RU3 A;  3GRV A;  4KOD A;  2F5S A;  1CUK A;  4JI5 M;  4B7H A;  2DHR A;  1G41 A;  3LVW A;  4JI0 M;  4DV6 M;  2EA0 A;  2R0I A;  4LJA A;  5EJC A;  5F3W A;  1I94 M;  3L29 A;  5IRE B;  4UN2 B;  4CHT B;  3I04 M;  5KQ8 A;  1EE8 A;  2KNZ A;  3U6L A;  4FVM A;  4L15 A;  4B08 A;  2MRO B;  2Z7J A;  2EKF A;  2L4F A;  1GO5 A;  5ITX E;  4B3T M;  5JI2 E;  1TH2 A;  3UZU A;  2QBY B;  3TE6 A;  3B7Q A;  3C9P A;  2LNH C;  4X62 M;  2R4J A;  1XWI A;  2CRU A;  3FUV A;  4X66 M;  2CP8 A;  2M5Z A;  2G3Q A;  5KPZ A;  3UJN A;  1VEJ A;  1HR0 M;  1YSY A;  3PNV A;  4G4O A;  3M0E A;  4Y28 F;  2HWJ A;  5KPR A;  3D8B A;  4JI8 M;  1NY6 A;  1SXJ D;  2CEA A;  2XSZ A;  3KOZ E;  3AOE C;  2HHH M;  2KNV A;  2JY6 B;  1E94 E;  3FUW A;  1IBM M;  2JZ0 A;  2O25 A;  1R5L A;  5A2Q S;  3VK7 A;  4ZPX A;  4M0D A;  2Q2E B;  1ZQ9 A;  3TQS A;  4B7G A;  5LMN M;  1EFU B;  3LVV A;  1D0M A;  2K47 A;  2R6F A;  5EP4 A;  2DKL A;  2EO2 A;  1DO0 A;  2JXN A;  3C3E A;  3M7G A;  1G71 A;  3GPP A;  1T6O A;  3QYB A;  2DWZ B;  5DYG A;  4AG6 A;  1IY1 A;  2EUC A;  2C99 A;  4FCW A;  4MB7 A;  3VK8 A;  3U6C A;  2F5Q A;  4JI2 M;  5L8R F;  5DYI A;  1QAO A;  4F1I A;  1MU5 A;  3KW6 A;  4IJF A;  1C7Y A;  3PVS A;  5EP1 A;  4PDI A;  2J5Y A;  2DAG A;  4AQY M;  1YE9 A;  2K9D A;  3KVW A;  1QDR A;  3TWM A;  1ZAE A;  4B3M M;  2XLJ A;  4GHA A;  4XGI A;  3U6O A;  3RGP A;  4LJ9 A;  1PGY A;  4DV2 M;  4WUR A;  5FTN A;  4LF4 M;  4LGY A;  2YQZ A;  3L28 A;  3KOW E;  3GLG E;  1DGB A;  1R2Z A;  3SAU A;  2JZ1 A;  2JY7 A;  2KRK A;  2Y20 A;  1N36 M;  4LG2 A;  2R46 A;  1GKI A;  4GIT A;  3QAU A;  4OVZ A;  3LQQ A;  1AIP C;  1QUT A;  3J7B A;  4M9X A;  4LZZ A;  3LCU A;  4MGY E;  4ANR A;  5FTL A;  2YFQ A;  2LH0 A;  2XZF A;  1UFZ A;  3SAV A;  4LCB A;  1KSF X;  4MGI E;  4DV5 M;  3SYL A;  2V6Z M;  4GIP A;  1NJG A;  2ZAN A;  1ZMW A;  2V1U A;  1MN3 A;  2EJS A;  3AV0 A;  3U61 A;  1HNW M;  2G8L A;  4KT0 F;  4M0W A;  3AL0 C;  3HY5 A;  2JWS A;  3W0F A;  4HLQ A;  3RE8 A;  1XMO M;  2C5R A;  4QOZ C;  4LJ8 A;  4QNM A;  1VG5 A;  4GH9 A;  2XGN A;  1H6U A;  3OTO M;  4AZF A;  4LF8 M;  1R4G A;  3GLH A;  2QHO B;  1VQ1 A;  2G5G X;  4B3S M;  3K1J A;  5FSW A;  2B3T A;  4OW0 A;  2X8A A;  4DV0 M;  4JI1 M;  2DZL A;  3LQR A;  4Z6Y A;  2Z8Y M;  4MGK E;  3BBZ A;  4OVZ B;  2KEB A;  1DO2 A;  2BWE A;  3AFH A;  3KOY E;  4L4U A;  3H4J A;  3VDP A;  3NBI A;  1J7K A;  1SXJ E;  3MMP A;  3PNY A;  2DNA A;  3FUU A;  1J5E M;  2BWB A;  5GKN A;  4JI7 M;  2YNM D;  3SMP A;  5E26 A;  3AJI B;  4LFB M;  3GLF E;  2BJV A;  2L7I A;  3U6Q A;  2R45 A;  3KSJ A;  2VF7 A;  3MK6 A;  3U61 B;  1N77 A;  1OFI A;  3ZH9 B;  2UXC M;  4GC9 A;  5ITX A;  4CGY B;  5ITU A;  2Z4R A;  4LJ6 A;  1WHC A;  3E4R A;  1N75 A;  1YUB A;  2BNK A;  2L6O A;  2KDL A;  3C58 A;  3GLH B;  3DOA A;  4REZ A;  3IG8 A;  2C96 A;  4IBI A;  3AKZ A;  1QAN A;  1P3Q Q;  1NHW C;  4D82 A;  4QOS A;  4JV5 M;  1C1K A;  1IXS A;  5ITT A;  4LF6 M;  1ZMV A;  2K6B A;  2CE7 A;  4FWH A;  5IT9 S;  3SYK A;  3B9P A;  4LJ5 A;  5FTJ A;  3U5Z A;  4YHH M;  2F5P A;  4MM3 B;  1DGG A;  2GNO A;  2XH9 A;  1IN7 A;  1XC8 A;  3WHK A;  4W5W A;  1NNU C;  5ITY A;  2I7N A;  1DGH B;  2RKO A;  3KSX A;  4D80 A;  2UUA M;  4BB9 A;  2D7E A;  2N35 A;  2CUZ A;  4DUY M;  3JAM S;  1GVN A;  4K0K M;  2I7P A;  1T3T A;  1IXZ A;  3CF2 A;  2XF3 A;  3U6S A;  2L4E A;  3J81 S;  4DV7 M;  1ZMU A;  2Z3X A;  1W5T A;  5EXS A;  3L27 A;  3W0L B;  1E9R A;  1QQW A;  1OIP A;  2NQ8 C;  3I4Y A;  4NL4 H;  3GP1 A;  4G4R A;  2OQ4 A;  2XEP A;  3U6D A;  3B7N A;  2QNJ A;  4AKG A;  1XNQ M;  2WSE F;  4MGZ E;  4ITQ A;  3HJ8 A;  1IXS B;  1NHG C;  3ZC7 B;  4AG5 A;  2ZM6 M;  3GQ3 A;  1ORY B;  4DV4 M;  3Q8G A;  4B7F A;  2FFJ A;  5IWA M;  2R44 A;  3SHF A;  3GLG A;  3U5Z B;  2ZTC A;  1GLN A;  2BJW A;  2Z4S A;  4B3R M;  4IBE A;  1TTE A;  2KA6 B;  3DZD A;  2UUB M;  2LVO C;  2LHC A;  3GPY A;  5JI3 E;  4KHP M;  4I8O A;  3DFZ A;  1K3W A;  2OPF A;  1GL7 A;  4IBG A;  5EXX A;  3HU3 A;  3MHV C;  4IIW A;  5DFL A;  4LY6 A;  2A5Y B;  4I81 A;  3AOE A;  2VF8 A;  3FE3 A;  2ZAO A;  4II7 A;  4LGM A;  4L78 A;  1OQY A;  1W5S A;  2XZU A;  3TWL A;  3ZCB B;  2UXD M;  3HX3 A;  2O01 F;  5LMU M;  2P5T A;  1GJT A;  1SXJ C;  2KZU A;  4S12 A;  2KZS A;  4LRT A;  4G3O A;  4MGH A;  2AHM A;  2GQF A;  2QP9 X;  5DNY A;  2HAK A;  3W67 A;  3ILK A;  4FWG A;  1VEG A;  2LWX A;  3LCV B;  3L2A A;  3W68 A;  2MH8 A;  4L16 A;  1E9S A;  4JI4 M;  2DAM A;  2JA2 A;  2W82 A;  3GLG B;  2KRU A;  2EKK A;  3BXW A;  3JR5 A;  2QCU A;  5C1B A;  2L7H A;  1L1T A;  3J80 S;  4GKK M;  1NV9 A;  3RGS A;  4OX9 M;  1WJ7 A;  2K0B X;  1IN5 A;  3VKG A;  1QYR A;  3C3D A;  2QEN A;  5FLX S;  1XMQ M;  3E46 A;  4X65 M;  1SXJ A;  4EIW A;  2UXB M;  1QZE A;  1WGN A;  2L09 A;  3GRR A;  3I01 M;  1K3X A;  1HT1 E;  2J7N A;  4AKI A;  2C9O A;  3GLF A;  2D7H A;  3R8F A;  1Y8G A;  3QYE A;  2CWB A;  3U60 A;  5IZ7 D;  1PJI A;  1MJG M;  1YLA A;  3HWS A;  4P16 A;  1R2Y A;  1JR3 D;  2DAK A;  3GRY A;  3FRH A;  2F4V M;  4IBF A;  1IN6 A;  3SMS A;  3GO8 A;  2CV0 A;  3HHY A;  4XK8 F;  1WXQ A;  3K9P A;  1PM5 A;  3U6M A;  1XXH E;  1X37 A;  1Z59 A;  4JI6 M;  4CIZ A;  3SAW A;  3GRU A;  3Q8X A;  3FUX A;  5FTK A;  3VFD A;  4BBA A;  4G4N A;  3U6P A;  4FCT A;  1QZM A;  7CAT A;  1QAQ A;  4QNR A;  3E21 A;  4DR1 M;  1IXR C;  3L25 A;  3K8Z A;  3KP0 E;  4DR3 M;  2DHY A;  1IN8 A;  4JI3 M;  1SXJ B;  1L1Z A;  2APL A;  1Z6T A;  1DGH A;  3GLI E;  3A45 A;  1UM8 A;  1FJG M;  3U6E A;  3GLF B;  3TWK A;  1D0L A;  3FD9 A;  2LBC A;  4GMQ A;  2UUC M;  3U60 B;  4AW4 A;  4NRV A;  3T15 A;  2OO9 A;  1HQY E;  1WR1 B;  1IFY A;  1TR8 A;  4GC5 A;  4L8R C;  3L26 A;  2LVQ D;  1G3I A;  3HU2 A;  1Q02 A;  1Q3B A;  3A46 A;  4D81 A;  2XSZ D;  1HT2 E;  1Q39 A;  4Q7J A;  5ITR A;  2JUJ A;  2QPA A;  4FD2 A;  4RF1 A;  1TGU A;  1GJS A;  3J7A S;  3QWL A;  2E5L M;  4LRS A;  4CJ6 A;  1IY2 A;  2F5O A;  1TH3 A;  3KXE C;  2OOB A;  2O5R A;  3AOG A;  4HL4 A;  4JXJ A;  5FTM A;  3FTD A;  3GQ5 A;  1K82 A;  3HHX A;  4I5S A;  1GAB A;  2R18 A;  3J2P B;  4M9Z A;  1TH4 A;  2J7O A;  3FRI A;  4LF9 M;  4LF5 M;  2WZJ A;  3VLF B;  1WIV A;  1L2C A;  2VQF M;  5EXT A;  1A5T A;  5EXP A;  4NRW A;  3KS8 A;  1NNJ A;  2DI0 A;  4LF7 M;  3NWL A;  4BLC A;  3TL4 X;  3B7Z A;  2DWN A;  3NBX X;  3CF0 A;  2JP7 A;  1QAM A;  1Z5A A;  4JN6 A;  4AI6 A;  1Z5B A;  4LFC M;  3SC3 A;  4NSR A;  1OJL A;  5KO3 A;  1WGL A;  2QZ4 A;  1KYI A;  1NV8 A;  2WSF F;  2KW0 A;  4NOO B;  5EP3 A;  2KXE A;  1QUS A;  3HJS A;  2C98 A;  3PFI A;  4M9S A;  2DXI A;  1TDH A;  1DV0 A;  3HZJ A;  2LTU A;  3B74 A;  2QSF X;  2QQ8 A;  1HNZ M;  4A3V B;  3KDS E;  3IHP A;  4R71 A;  1JR3 E;  2ERC A;  5KPT A;  3FTE A;  3FYD A;  1QVR A;  4GRI A;  2XFT A;  1N78 A;  1S3S A;  4FWD A;  3UMM A;  4DR4 M;  2YR0 A;  2WSC F;  3DA1 A;  3GPU A;  3HHZ A;  2FNA A;  3FTF A;  3GPX A;  2DVW B;  3JR4 A;  2OOA A;  2CFO A;  1NJF A;  4NSO B;  3K9O A;  1OFH A;  2CHV A;  3SFZ A;  3SBJ A;  2DWL A;  2LVP C;  1L8Q A;  1TDZ A;  1ZV1 A;  4L6V 6;  4FW9 A;  4YY3 M;  4RKU F;  3M6A A;  1OAO C;  4MH0 E;  1G59 A;  1IN4 A;  4PD2 A;  4GKJ M;  4JYA M;  3I51 A;  2ZAM A;  1IBL M;  2H1R A;  1JB0 F;  3IEC A;  5EQT A;  1JQJ C;  2HKJ A;  2ZTD A;  1OKS A;  2FOI C;  4NXN M;  4F2L A;  3UGJ A;  2VQE M;  1PJQ A;  3KOX E;  3HU1 A;  4IBD A;  1AUA A;  1MX0 A;  2D7G A;  3I4V A;  4R3D A;  3SHG B;  4PCZ A;  4LZJ A;  3UK6 A;  2LXE A;  3HGI A;  2MR9 A;  4DBG B;  4FCV A;  2MJ5 B;  3PXG A;  1XXH A;  2FH0 A;  2DEN A;  4IJE A;  4IBC A;  4Z8X A;  3F92 A;  5EP2 A;  3VDU A;  1N34 M;  4P17 A;  3HKP A;  1L2B A;  1Z5C A;  3V76 A;  4NXM M;  3KP1 E;  5ITQ A;  1OAI A;  2Y21 A;  5C18 A;  2ZBK B;  1I4W A;  3J27 B;  3FUT A;  3K2L A;  5KQD A;  4TUW A;  1XB2 B;  2HCB A;  1SG9 A;  5E6J A;  4R7G A;  1PJT A;  2H5X A;  2DAI A;  1LV7 A;  2Y0Q A;  4G6Z A;  3THG A;  2VII A;  1V33 A;  3GLI A;  1V92 A;  2V1C A;  3R9X B;  2VDB B;  3EIE A;  4CIS A;  3EIH A;  2R65 A;  1BVS A;  1PJJ A;  1GL6 A;  1OIZ A;  1XNR M;  3CTW B;  3FKE A;  2HL7 A;  2RRU A;  1HJP A;  2X49 A;  1Q3C A;  1VDD A;  4HEO A;  1QDT A;  3MJ5 A;  2C9C A;  3HJQ A;  1R6B X;  2R4E A;  3T38 A;  1N33 M;  1VEK A;  4NC6 A;  1XXH B;  1XHB A;  3GQ4 A;  4GHL A;  2L2D A;  2F5N A;  2JY8 A;  4IBK A;  4OU7 A;  1IY0 A;  1TF0 B;  3CGW A;  2CHQ A;  1LTM A;  3SAS A;  1R7R A;  5BPV A;  2JY5 A;  1NSF A;  5H37 D;  2RGH A;  4KLN A;  1NVM A;  2DWM A;  1IBK M;  4AKH A;  3D8L A;  3TPZ A;  3LMM A;  1E32 A;  2LHG A;  2LVA A; 
#chains in the Genus database with same CATH homology
 1EIJ A;  2JXN A;  2K6B A;  2CRU A;  2FH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...