2DWNA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase/dna
total genus 17
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwnA01
2D7HA 2D7GA 2DWLA 2DWMA 2DWNA 4NL4H 2D7EA
chains in the Genus database with same CATH superfamily
4RNAA 4DR6M 1PJQA 3LW5F 5C18A 1MX0A 3U5ZB 4GEWA 4WURA 1EIJA 1JR3A 2ZAMA 2CRUA 4JYAM 4JI5M 3FUXA 4BLCA 1GKIA 1HQYE 1N36M 1I4WA 5EP1A 2ERCA 2R18A 3L25A 2X49A 2L7IA 3I51A 3T38A 2XLJA 3CF6E 4S12A 3EIEA 3Q8GA 1IN6A 5EJCA 3J27B 4M0DA 3WHLA 4BB9A 1IFYA 3GRYA 2QNJA 3LVWA 1E9RA 4AKHA 2R65A 3U6CA 3C3DA 4LF4M 1GJTA 1ZMUA 3HJ8A 4XK8F 1UFZA 2LVNC 1DV0A 4JV5M 3TWLA 1Q3CA 2YQZA 2DKLA 2LNHC 3FTCA 3GLGE 2V1UA 4QOZC 2OQ4A 1HNZM 4AKGA 3U6MA 5FTLA 1XXHE 3KSXA 4QOSA 2V6ZM 2YNMD 3U60A 1S3SA 3J81S 4DV7M 1Z6TA 2ZTCA 4LJ8A 4NOOB 4D82A 2C5RA 1GVNA 1IY1A 3GLHE 5LMUM 2KRUA 1VEGA 4ITQA 2EO2A 2WSFF 4B3RM 4PDGA 1IY0A 1VEJA 3KOWE 1XNQM 2VIIA 3ZH9B 3HWSA 3GLFB 1N75A 1SXJB 1XWIA 4IBIA 2XSZD 1DGHB 1IY2A 1NO1A 1SXJC 4I4LA 4RKUF 3RE8A 4GKKM 3UMMA 3A42A 1WHCA 3GRVA 3M0EA 1G59A 2Y0QA 2G5GX 4I8OA 3FUTA 4G3OA 5DYIA 1HQCA 3JAMS 1GO5A 3AJIB 3B7NA 4YHHM 1D0MA 3GLGA 1QAQA 3VDUA 1R6BX 5KO3A 3SMSA 1QDTA 4PCZA 5EQTA 3CF2A 3VLFB 1DO2A 3TE6A 2OOAA 2UU9M 2C98A 5KPTA 4LZJA 4F1IA 3GPYA 3J80S 4IJEA 3GLHA 2D7GA 4I5SA 1EE8A 1D0LA 2HL7A 1BVSA 4IBCA 5IWAM 2JY5A 5FLXS 1NV9A 2Z7JA 3E4RA 3PNVA 3QYEA 1L2BA 4LF5M 1OIZA 1IM2A 2L09A 4GMQA 5ITYA 2V1CA 3FD9A 4ANRA 2KHHA 2HKJA 3CF0A 3A46A 2QP9X 4JI6M 1H6UA 3U5ZA 3FKEA 2KXEA 4LRSA 1NV8A 1QANA 1KFVA 1NJFA 2JZ0A 2UUAM 1QAOA 4L6V6 2L4EA 4G4NA 1VQ1A 3PFIA 1WGLA 2D7HA 1R2YA 2XGNA 4A3VB 2QCUA 2JY6B 2QENA 1WJ7A 3HZJA 3KP1E 2M5ZA 3KOYE 4LJAA 5BR8M 2VQEM 1Z5AA 3C9PA 2DWLA 4FCTA 3TWKA 1TTEA 2R6FA 2ZTDA 4CHTB 1SXJE 2KNAA 4LJ5A 2WZJA 3GPPA 1PJJA 4B3TM 1F4IA 1R2ZA 1IN8A 3UJNA 3L28A 4LJ7A 3B7ZA 2DWNA 3KS8A 3ZQJA 3TWMA 3RGPA 4EIWA 3VKHA 4OVZB 2K9DA 1NHWC 3BBZA 4XBOA 2HCBA 1T43A 3PNYA 4HL4A 3SASA 5ITQA 1E32A 3AOGA 5DFLA 3SYKA 5EXTA 1L2CA 1QAMA 1ZAEA 1JR3E 3KOXE 3K9OA 4QHTA 3W68A 5EP3A 4GC5A 1XMQM 1XNRM 3GRUA 2L6OA 2Y0TA 4FD2A 3GPUA 3J2PB 3SFZA 1K3XA 2APLA 2R62A 4P17A 4HEOA 4JI0M 1J09A 3KSJA 3RGSA 4KLNA 3ZC7B 3I4VA 4FVMA 4GHAA 4DR7M 4IJFA 1SXJA 4GRIA 5L8RF 1RU3A 1DGHA 1W5TA 4DV6M 5KPRA 3JR4A 3DOAA 4GHLA 1QVRA 5ITRA 2AHMA 2JUJA 4KODA 1R5LA 3ZCBB 3KOZE 1Q3BA 2BNKA 1V92A 2LH0A 4II7A 4LJ4A 5DYGA 5EP4A 4B7HA 3HU3A 2KZUA 3DA1A 1PGYA 2N35A 3E46A 2CV1A 7CATA 4DV5M 2I7PA 1SG9A 2RKOA 4Z6YA 1PJIA 2EUCA 1ORYB 3SHGB 4LF8M 2F5NA 2DHYA 1OTRA 1QQWA 4GKJM 1PJTA 2OOBA 4DR5M 3FE3A 1NSFA 3K2LA 4CISA 1Y8GA 5JI2E 2MJ5B 2LVOC 1ZMVA 2Y21A 4DR2M 1VEKA 1T6OA 2JY7A 3KW6A 3SHFA 2BJWA 3U6DA 2ZANA 4JI4M 5FTMA 2VDBB 1DGGA 3MJ5A 4LJ6A 3THGA 1JR3D 2BJVA 3HU2A 5A2QS 4X62M 3AFHA 3J7AS 1GJSA 4FWHA 4FWDA 1LTMA 3W67A 3K9PA 1IN7A 1TGUA 4L16A 4NXNM 1NNJA 2DZOB 2LVPC 2F5SA 1KYIA 1J7KA 4MGIE 3M7GA 3F92A 4KHPM 2GNOA 3UZUA 3A45A 2XFSA 1IBKM 3KDSE 3LQRA 3NBIA 3R8FA 3FTDA 4LGMA 3FRHA 4D80A 1VDLA 2EKFA 3R9XB 2QSFX 4LCBA 2LXEA 4DBGB 1QYRA 4CGYB 1VG5A 2WSCF 2WSEF 3HHXA 1C1KA 2ZM6M 2F5OA 4OVZA 1UM8A 2JZ1A 4NXMM 3SYLA 2XF3A 2RRUA 1Z59A 2B3TA 3KP0E 4IIWA 3GPXA 2G8LA 3T1YM 2KW0A 2DWMA 4JXJA 3I01M 2E5LM 1E9SA 1Q02A 3M6AA 3U61A 4DUYM 1T3TA 1IXZA 1K82A 3AOEC 3HHYA 3GO8A 4MH0E 4Y28F 4FCVA 2O25A 2DHRA 4IBBA 1R7RA 1V33A 4LJ9A 1HR0M 2UUCM 2CP8A 3MHVC 2J7NA 3W0FA 3I4YA 1N77A 1WR1B 2ZBKB 3HJQA 3KS4A 2YR0A 2C99A 3VKGA 4NRVA 2XFTA 1R4GA 3CGWA 3L2AA 2I7NA 5DNYA 2W82A 1TH4A 4L8RC 1ZMWA 3CTWB 2UUBM 3K8ZA 3RFWA 2Z8YM 2MROB 4PDIA 1XHBA 2O5RA 2C96A 2R0IA 3LQQA 4MGKE 4JI3M 4DV0M 1Q39A 2XH9A 3KVWA 2FE8A 4W5WA 4I81A 1HT1E 2JXNA 5E26A 5FSWA 4OX9M 1GLNA 2L2DA 2UXBM 1QDRA 4JI1M 1EFUB 3U6QA 1OJLA 1FNNA 3L26A 4LF6M 5FTJA 4AKIA 3GQ3A 3GLFE 4M9XA 1GL6A 1YSYA 1G71A 4L15A 4G4RA 2NQ8C 4LF7M 1IBMM 3AL0C 3IECA 2DZNB 4DR1M 1A5TA 1N34M 4WW0A 3JR5A 3PVSA 4LFBM 2OO9A 4LG2A 2FOIC 4NSOB 5IZ7D 2FH0A 3SC3A 4HLQA 5ITUA 1OAIA 2FFJA 1IN4A 1HNWM 3SBJA 5LMNM 3C58A 2C9CA 2LHCA 3FTEA 3HJSA 2VQFM 4LFAM 1XC8A 1TDHA 2KA6B 1NY5A 1V34A 1Z5BA 2KNVA 3H4JA 4X64M 1XMOM 3TL4X 4CIZA 2J5YA 3L29A 4LRTA 1HJPA 5EP2A 2K6BA 1HNXM 2CUZA 5JI3E 3GLFA 4R3DA 3UGJA 2F5QA 1N33M 1GL7A 1JQJC 1OQYA 3SMPA 3V76A 2CFOA 3W0LB 4DV1M 2R44A 4M9SA 4G4QA 4D81A 4MGHA 2RGOA 2LWXA 4AG6A 4IBEA 3HY5A 4B7FA 3SARA 3B9PA 3ILKA 4RF0A 5GKNA 2G3QA 3TQSA 4DR4M 4K0KM 1TF0B 3K1JA 1WGNA 3GLGB 4RF1A 4DR3M 3AOEA 2D7EA 3I04M 3QYBA 1IN5A 1XXHB 1L1TA 1SXJD 2DAKA 4IBKA 1W5SA 1G41A 1VDDA 4GIPA 4DV2M 5E6JA 2CHVA 2Z4SA 3GQ5A 2BWEA 4KO8A 1OKSA 1HT2E 4B08A 1ZQ9A 3NWLA 1PM5A 2MH8A 3UK6A 1YE9A 2LHGA 2R4JA 3HU1A 4FCWA 1G4AE 1WIVA 3FYCA 4Q7JA 3GP1A 2DAIA 4G4OA 3LCVB 4X65M 4X66M 1MU5A 4OW0A 1NY6A 3GLIB 1QZMA 4AG5A 4L78A 3VK7A 3U6OA 3T1HM 3EIHA 2DAGA 2P5TA 4IBJA 2KEBA 3IG5A 4M9ZA 3SAUA 3FUVA 3Q8XA 4LFCM 5EXXA 3HKPA 3LCUA 2DI0A 2XEPA 3NBXX 3KXEC 4NSRA 1L1ZA 1QUTA 4B3MM 1NNUC 2QHOB 1P3QQ 1TDZA 4MM3B 4MGZE 1QUSA 1AIPC 5FTKA 3D8LA 1TR8A 2KNZA 4REZA 3T15A 2JNHA 4LZZA 1DO0A 2LTUA 3FUUA 2QBYB 3FTFA 1TH2A 2ZAOA 3GRRA 3DZDA 1YUBA 4DUZM 3J7BA 2JA2A 1G3IA 2M60A 2XSZA 1IBLM 1YLAA 3D8BA 4NL4H 4B3SM 2CWBA 2Z4RA 1ZV1A 3AKZA 2R46A 5EXPA 2R4EA 4KT0F 4JI7M 1I94M 3U6LA 1IQPA 4AZFA 4R7GA 1NVMA 2H5XA 3DFZA 3E21A 2GQFA 4JI8M 1LV7A 2Q2EB 5KQDA 4JN6A 4F2LA 3U6PA 2KZSA 1IXRC 1J5EM 4QNRA 2H1RA 5FTNA 1AUAA 1IXSB 2KDLA 2X8AA 3C3EA 4WP2A 3U6SA 3B74A 2O01F 4JI2M 3HGIA 1N78A 3SAWA 4GC9A 2QZ4A 3B89A 3GLIE 4LY6A 2EJSA 2FS1A 2XZFA 2XZUA 2JWSA 5ITXE 2CV2A 1MN3A 2DXIA 4YY3M 3E9SA 2Z3XA 4AW4A 4LGYA 3QAUA 2Y20A 3SAVA 1E94E 2KRKA 1XXHA 1X37A 4UN2B 4Z8XA 3VK8A 1K3WA 3KFUG 2DAMA 4AQYM 1DGBA 2HWJA 2VF8A 4ZPXA 2L7HA 4XGIA 3WHKA 2QQ8A 1QZEA 2YFQA 4NRWA 2A5YB 2HHHM 4IBDA 3H4MA 4PD2A 1NJGA 3SATA 1NHGC 2RGHA 5IT9S 3HHWA 1CUKA 4QNMA 5KQ8A 4AI6A 2DNAA 1C7YA 3BOSA 4IBFA 5BPVA 2MGWA 4G6ZA 3IHPA 3IG8A 1JB0F 3TPZA 3GLIA 1FJGM 2C9OA 4OU7A 2JP7A 2K0BX 1G8PA 2MR9A 2LBCA 2CEAA 4IBGA 5ITXA 2CHGA 4BBAA 4LF9M 1PJSA 1PRBA 2DVWB 4NC6A 2EA0A 2LVAA 3FUWA 3U60B 2CV0A 2F5PA 3PXGA 1MJGM 1OAOC 1OIPA 3VDPA 2OPFA 5EXSA 5H37D 3VFDA 2HAKA 2L4FA 2LVQD 2X4AA 2QBYA 2DZLA 5ITTA 1D0KA 3FRIA 2EKKA 3MMPA 3L27A 1TH3A 2J7OA 3LVVA 4R71A 3GQ4A 1L2DA 3LMMA 3HHZA 3K92A 4CJ6A 4TUWA 1OFIA 4PT5A 5IREB 5C1BA 4P16A 2F4VM 3MK6A 1N32M 3FYDA 1KSFX 3U6EA 3OTOM 4DV4M 1Z5CA 4MGYE 2DAEA 2JY8A 1OFHA 4GH9A 1WXQA 2R45A 4L4UA 2BWBA 5KPZA 3U61B 3T6PA 3QWLA 4GITA 2K47A 2DENA 3BXWA 3AV0A 4B7GA 3B7QA 4QHSA 4FW9A 2CE7A 4FWGA 2UXDM 1IXSA 2CHQA 1XB2B 1L8QA 2DWZB 3GLHB 4DV3M 1DGFA 3A98B 2UXCM 2QPAA 1D2NA 2FNAA 2VF7A 4MB7A 1GABA 5F3WA 3HX3A 8CATA 4M0WA
chains in the Genus database with same CATH topology
4RNAA 4DR6M 5C18A 1MX0A 3U5ZB 4WURA 1JR3A 2ZAMA 4JYAM 4JI5M 3FUXA 4BLCA 1GKIA 1HQYE 1N36M 1I4WA 5EP1A 2ERCA 2R18A 3L25A 2X49A 2L7IA 3I51A 3T38A 2XLJA 3CF6E 4S12A 3EIEA 5EJCA 1IN6A 4BB9A 3J27B 4M0DA 3WHLA 3GRYA 3LVWA 1E9RA 4AKHA 2R65A 3U6CA 4LF4M 3HJ8A 4JV5M 3TWLA 1Q3CA 2YQZA 2LNHC 3FTCA 2V1UA 4QOZC 2OQ4A 1HNZM 4AKGA 3U6MA 5FTLA 3KSXA 4QOSA 2V6ZM 2YNMD 3U60A 1S3SA 3J81S 4DV7M 1Z6TA 4LJ8A 4NOOB 4D82A 2C5RA 1GVNA 1IY1A 5LMUM 4ITQA 2KRUA 2EO2A 4B3RM 4PDGA 1IY0A 3KOWE 1XNQM 2VIIA 3ZH9B 3HWSA 3GLFB 1N75A 1SXJB 1XWIA 4IBIA 2XSZD 1DGHB 1IY2A 1SXJC 4I4LA 3RE8A 4GKKM 3UMMA 3A42A 3GRVA 3M0EA 1G59A 2Y0QA 2G5GX 4I8OA 3FUTA 5DYIA 1HQCA 3JAMS 3AJIB 4YHHM 3GLGA 1QAQA 3VDUA 1R6BX 5KO3A 3SMSA 4PCZA 5EQTA 3CF2A 3VLFB 1DO2A 3TE6A 2UU9M 2C98A 5KPTA 4LZJA 3GPYA 3J80S 4IJEA 3GLHA 2D7GA 4I5SA 1EE8A 2HL7A 4IBCA 5IWAM 5FLXS 3PNVA 2Z7JA 3E4RA 1L2BA 4LF5M 2L09A 1IM2A 4GMQA 5ITYA 2V1CA 3FD9A 2HKJA 3CF0A 3A46A 2QP9X 4JI6M 1H6UA 3U5ZA 3FKEA 2KXEA 4LRSA 1QANA 1KFVA 1NJFA 2UUAM 1QAOA 4G4NA 3PFIA 2D7HA 1R2YA 2XGNA 4A3VB 2QCUA 2QENA 3KP1E 5BR8M 3KOYE 2M5ZA 4LJAA 2DWLA 2VQEM 1Z5AA 4FCTA 3TWKA 4CHTB 1SXJE 4LJ5A 3GPPA 1PJJA 4B3TM 1R2ZA 1IN8A 3UJNA 3L28A 4LJ7A 2DWNA 3KS8A 3TWMA 3RGPA 4EIWA 3VKHA 4OVZB 4XBOA 1NHWC 2HCBA 3PNYA 4HL4A 3SASA 5ITQA 1E32A 3AOGA 3SYKA 1L2CA 5EXTA 1QAMA 1ZAEA 3KOXE 4QHTA 5EP3A 4GC5A 1XMQM 1XNRM 3GRUA 2L6OA 2Y0TA 4FD2A 3GPUA 3J2PB 3SFZA 1K3XA 2R62A 4JI0M 1J09A 3KSJA 3RGSA 4KLNA 3ZC7B 3I4VA 4FVMA 4GHAA 4DR7M 4IJFA 1SXJA 4GRIA 1DGHA 1W5TA 4DV6M 5KPRA 3JR4A 3DOAA 4GHLA 1QVRA 5ITRA 2AHMA 4KODA 3ZCBB 3KOZE 1Q3BA 2BNKA 4B7HA 2LH0A 4II7A 4LJ4A 5DYGA 5EP4A 3HU3A 2KZUA 3DA1A 2CV1A 7CATA 4DV5M 2I7PA 2RKOA 4Z6YA 1PJIA 2EUCA 1ORYB 3SHGB 4LF8M 2F5NA 1QQWA 4GKJM 4DR5M 1NSFA 3K2LA 4CISA 5JI2E 4DR2M 2Y21A 3KW6A 3SHFA 2BJWA 3U6DA 2ZANA 4JI4M 5FTMA 1DGGA 3MJ5A 4LJ6A 3THGA 1JR3D 2BJVA 3HU2A 5A2QS 4X62M 3AFHA 3J7AS 4FWHA 4FWDA 1NNJA 1IN7A 1TGUA 4L16A 4NXNM 2DZOB 2F5SA 1KYIA 1J7KA 4MGIE 3M7GA 4KHPM 3UZUA 3A45A 2XFSA 1IBKM 3KDSE 3LQRA 3NBIA 3R8FA 3FTDA 4LGMA 4D80A 3R9XB 4LCBA 2LXEA 1QYRA 4CGYB 3HHXA 1C1KA 2ZM6M 2F5OA 4OVZA 1UM8A 4NXMM 3SYLA 2XF3A 1Z59A 3KP0E 4IIWA 3GPXA 2G8LA 3T1YM 2KW0A 2DWMA 4JXJA 2E5LM 1E9SA 3M6AA 3U61A 4DUYM 1T3TA 1IXZA 1K82A 3AOEC 3HHYA 3GO8A 4MH0E 4FCVA 2DHRA 4IBBA 1R7RA 4LJ9A 1HR0M 2UUCM 3MHVC 2J7NA 3W0FA 3I4YA 1N77A 2ZBKB 3HJQA 3KS4A 2YR0A 2C99A 3VKGA 4NRVA 2XFTA 3L2AA 5DNYA 2I7NA 2W82A 1TH4A 4L8RC 3CTWB 2UUBM 3K8ZA 3RFWA 4PDIA 1XHBA 2O5RA 2C96A 4MGKE 3LQQA 4DV0M 4JI3M 1Q39A 2XH9A 3KVWA 2FE8A 4W5WA 4I81A 1HT1E 5E26A 4OX9M 5FSWA 1GLNA 2UXBM 4JI1M 3U6QA 4AKIA 1OJLA 1FNNA 3L26A 4LF6M 5FTJA 3GQ3A 4M9XA 1GL6A 1YSYA 4L15A 4G4RA 2NQ8C 4LF7M 1IBMM 3AL0C 2DZNB 4DR1M 1N34M 4WW0A 3JR5A 3PVSA 4LFBM 4LG2A 2FOIC 4NSOB 5IZ7D 3SC3A 4HLQA 5ITUA 2FFJA 1IN4A 1HNWM 3SBJA 5LMNM 3C58A 2C9CA 3FTEA 3HJSA 2VQFM 4LFAM 1XC8A 1TDHA 2KA6B 1NY5A 1Z5BA 1XMOM 4X64M 3TL4X 5EP2A 3L29A 4LRTA 1HNXM 2CUZA 5JI3E 3GLFA 4R3DA 3UGJA 2F5QA 1N33M 1GL7A 1JQJC 3SMPA 2CFOA 3W0LB 4DV1M 4M9SA 4G4QA 4D81A 4MGHA 2RGOA 2LWXA 4AG6A 4IBEA 4B7FA 3SARA 3B9PA 3ILKA 4RF0A 5GKNA 3TQSA 4DR4M 4K0KM 3K1JA 3GLGB 4RF1A 4DR3M 3AOEA 2D7EA 1IN5A 1XXHB 1L1TA 1SXJD 4IBKA 1W5SA 1G41A 1VDDA 4GIPA 4DV2M 5E6JA 2CHVA 2Z4SA 3GQ5A 4KO8A 1HT2E 4B08A 1ZQ9A 3NWLA 1PM5A 3UK6A 1YE9A 2R4JA 3HU1A 4FCWA 1G4AE 3FYCA 3GP1A 4G4OA 4X65M 4X66M 1MU5A 4OW0A 1NY6A 3GLIB 1QZMA 4AG5A 4L78A 3VK7A 3U6OA 3T1HM 3EIHA 2P5TA 4IBJA 4M9ZA 2KEBA 3IG5A 3SAUA 3FUVA 3Q8XA 4LFCM 5EXXA 3HKPA 2XEPA 4NSRA 3KXEC 1L1ZA 4B3MM 1NNUC 1TDZA 4MM3B 4MGZE 5FTKA 3D8LA 4REZA 3T15A 4LZZA 1DO0A 3FUUA 2QBYB 3FTFA 1TH2A 2ZAOA 3GRRA 3DZDA 1YUBA 4DUZM 3J7BA 2JA2A 1G3IA 2M60A 2XSZA 1IBLM 3D8BA 4NL4H 4B3SM 2Z4RA 3AKZA 2R46A 5EXPA 2R4EA 4JI7M 1I94M 3U6LA 1IQPA 4AZFA 4R7GA 1NVMA 3DFZA 4JI8M 1LV7A 2Q2EB 5KQDA 4JN6A 3U6PA 2KZSA 1IXRC 1J5EM 4QNRA 2H1RA 5FTNA 1IXSB 2X8AA 3U6SA 4JI2M 3HGIA 1N78A 3SAWA 4GC9A 2QZ4A 4LY6A 2XZFA 2XZUA 5ITXE 2CV2A 2DXIA 4YY3M 3E9SA 2Z3XA 4AW4A 4LGYA 3QAUA 2Y20A 3SAVA 1E94E 2KRKA 1XXHA 1X37A 4Z8XA 3VK8A 1K3WA 3KFUG 4AQYM 1DGBA 4ZPXA 2L7HA 4XGIA 3WHKA 2YFQA 4NRWA 2A5YB 2HHHM 4IBDA 3H4MA 4PD2A 1NJGA 3SATA 1NHGC 2RGHA 5IT9S 3HHWA 4QNMA 5KQ8A 4AI6A 3BOSA 4IBFA 5BPVA 4G6ZA 3IG8A 3TPZA 3GLIA 1FJGM 2C9OA 4OU7A 5ITXA 1G8PA 2CEAA 4IBGA 2CHGA 4BBAA 4LF9M 2DVWB 2EA0A 3FUWA 3U60B 2CV0A 2F5PA 3PXGA 3VDPA 2OPFA 5EXSA 5H37D 3VFDA 2X4AA 2QBYA 5ITTA 3L27A 1TH3A 2J7OA 3LVVA 3GQ4A 1L2DA 3LMMA 3HHZA 3K92A 4TUWA 1OFIA 4PT5A 5IREB 5C1BA 4P16A 2F4VM 3MK6A 1N32M 3FYDA 1KSFX 3U6EA 3OTOM 4DV4M 1Z5CA 4MGYE 1OFHA 4GH9A 1WXQA 2R45A 4L4UA 3U61B 5KPZA 3QWLA 4GITA 2K47A 3AV0A 4B7GA 4QHSA 4FW9A 2CE7A 4FWGA 2UXDM 2CHQA 1L8QA 2DWZB 3GLHB 4DV3M 1DGFA 3A98B 2UXCM 2QPAA 1D2NA 2FNAA 4MB7A 5F3WA 8CATA 4M0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7H A;  2D7G A;  2DWL A;  2DWM A;  2DWN A;  4NL4 H;  2D7E A; 
#chains in the Genus database with same CATH topology
 4RNA A;  4DR6 M;  1PJQ A;  3LW5 F;  5C18 A;  1MX0 A;  3U5Z B;  4GEW A;  4WUR A;  1EIJ A;  1JR3 A;  2ZAM A;  2CRU A;  4JYA M;  4JI5 M;  3FUX A;  4BLC A;  1GKI A;  1HQY E;  1N36 M;  1I4W A;  5EP1 A;  2ERC A;  2R18 A;  3L25 A;  2X49 A;  2L7I A;  3I51 A;  3T38 A;  2XLJ A;  3CF6 E;  4S12 A;  3EIE A;  3Q8G A;  1IN6 A;  5EJC A;  3J27 B;  4M0D A;  3WHL A;  4BB9 A;  1IFY A;  3GRY A;  2QNJ A;  3LVW A;  1E9R A;  4AKH A;  2R65 A;  3U6C A;  3C3D A;  4LF4 M;  1GJT A;  1ZMU A;  3HJ8 A;  4XK8 F;  1UFZ A;  2LVN C;  1DV0 A;  4JV5 M;  3TWL A;  1Q3C A;  2YQZ A;  2DKL A;  2LNH C;  3FTC A;  3GLG E;  2V1U A;  4QOZ C;  2OQ4 A;  1HNZ M;  4AKG A;  3U6M A;  5FTL A;  1XXH E;  3KSX A;  4QOS A;  2V6Z M;  2YNM D;  3U60 A;  1S3S A;  3J81 S;  4DV7 M;  1Z6T A;  2ZTC A;  4LJ8 A;  4NOO B;  4D82 A;  2C5R A;  1GVN A;  1IY1 A;  3GLH E;  5LMU M;  2KRU A;  1VEG A;  4ITQ A;  2EO2 A;  2WSF F;  4B3R M;  4PDG A;  1IY0 A;  1VEJ A;  3KOW E;  1XNQ M;  2VII A;  3ZH9 B;  3HWS A;  3GLF B;  1N75 A;  1SXJ B;  1XWI A;  4IBI A;  2XSZ D;  1DGH B;  1IY2 A;  1NO1 A;  1SXJ C;  4I4L A;  4RKU F;  3RE8 A;  4GKK M;  3UMM A;  3A42 A;  1WHC A;  3GRV A;  3M0E A;  1G59 A;  2Y0Q A;  2G5G X;  4I8O A;  3FUT A;  4G3O A;  5DYI A;  1HQC A;  3JAM S;  1GO5 A;  3AJI B;  3B7N A;  4YHH M;  1D0M A;  3GLG A;  1QAQ A;  3VDU A;  1R6B X;  5KO3 A;  3SMS A;  1QDT A;  4PCZ A;  5EQT A;  3CF2 A;  3VLF B;  1DO2 A;  3TE6 A;  2OOA A;  2UU9 M;  2C98 A;  5KPT A;  4LZJ A;  4F1I A;  3GPY A;  3J80 S;  4IJE A;  3GLH A;  2D7G A;  4I5S A;  1EE8 A;  1D0L A;  2HL7 A;  1BVS A;  4IBC A;  5IWA M;  2JY5 A;  5FLX S;  1NV9 A;  2Z7J A;  3E4R A;  3PNV A;  3QYE A;  1L2B A;  4LF5 M;  1OIZ A;  1IM2 A;  2L09 A;  4GMQ A;  5ITY A;  2V1C A;  3FD9 A;  4ANR A;  2KHH A;  2HKJ A;  3CF0 A;  3A46 A;  2QP9 X;  4JI6 M;  1H6U A;  3U5Z A;  3FKE A;  2KXE A;  4LRS A;  1NV8 A;  1QAN A;  1KFV A;  1NJF A;  2JZ0 A;  2UUA M;  1QAO A;  4L6V 6;  2L4E A;  4G4N A;  1VQ1 A;  3PFI A;  1WGL A;  2D7H A;  1R2Y A;  2XGN A;  4A3V B;  2QCU A;  2JY6 B;  2QEN A;  1WJ7 A;  3HZJ A;  3KP1 E;  2M5Z A;  3KOY E;  4LJA A;  5BR8 M;  2VQE M;  1Z5A A;  3C9P A;  2DWL A;  4FCT A;  3TWK A;  1TTE A;  2R6F A;  2ZTD A;  4CHT B;  1SXJ E;  2KNA A;  4LJ5 A;  2WZJ A;  3GPP A;  1PJJ A;  4B3T M;  1F4I A;  1R2Z A;  1IN8 A;  3UJN A;  3L28 A;  4LJ7 A;  3B7Z A;  2DWN A;  3KS8 A;  3ZQJ A;  3TWM A;  3RGP A;  4EIW A;  3VKH A;  4OVZ B;  2K9D A;  1NHW C;  3BBZ A;  4XBO A;  2HCB A;  1T43 A;  3PNY A;  4HL4 A;  3SAS A;  5ITQ A;  1E32 A;  3AOG A;  5DFL A;  3SYK A;  5EXT A;  1L2C A;  1QAM A;  1ZAE A;  1JR3 E;  3KOX E;  3K9O A;  4QHT A;  3W68 A;  5EP3 A;  4GC5 A;  1XMQ M;  1XNR M;  3GRU A;  2L6O A;  2Y0T A;  4FD2 A;  3GPU A;  3J2P B;  3SFZ A;  1K3X A;  2APL A;  2R62 A;  4P17 A;  4HEO A;  4JI0 M;  1J09 A;  3KSJ A;  3RGS A;  4KLN A;  3ZC7 B;  3I4V A;  4FVM A;  4GHA A;  4DR7 M;  4IJF A;  1SXJ A;  4GRI A;  5L8R F;  1RU3 A;  1DGH A;  1W5T A;  4DV6 M;  5KPR A;  3JR4 A;  3DOA A;  4GHL A;  1QVR A;  5ITR A;  2AHM A;  2JUJ A;  4KOD A;  1R5L A;  3ZCB B;  3KOZ E;  1Q3B A;  2BNK A;  1V92 A;  2LH0 A;  4II7 A;  4LJ4 A;  5DYG A;  5EP4 A;  4B7H A;  3HU3 A;  2KZU A;  3DA1 A;  1PGY A;  2N35 A;  3E46 A;  2CV1 A;  7CAT A;  4DV5 M;  2I7P A;  1SG9 A;  2RKO A;  4Z6Y A;  1PJI A;  2EUC A;  1ORY B;  3SHG B;  4LF8 M;  2F5N A;  2DHY A;  1OTR A;  1QQW A;  4GKJ M;  1PJT A;  2OOB A;  4DR5 M;  3FE3 A;  1NSF A;  3K2L A;  4CIS A;  1Y8G A;  5JI2 E;  2MJ5 B;  2LVO C;  1ZMV A;  2Y21 A;  4DR2 M;  1VEK A;  1T6O A;  2JY7 A;  3KW6 A;  3SHF A;  2BJW A;  3U6D A;  2ZAN A;  4JI4 M;  5FTM A;  2VDB B;  1DGG A;  3MJ5 A;  4LJ6 A;  3THG A;  1JR3 D;  2BJV A;  3HU2 A;  5A2Q S;  4X62 M;  3AFH A;  3J7A S;  1GJS A;  4FWH A;  4FWD A;  1LTM A;  3W67 A;  3K9P A;  1IN7 A;  1TGU A;  4L16 A;  4NXN M;  1NNJ A;  2DZO B;  2LVP C;  2F5S A;  1KYI A;  1J7K A;  4MGI E;  3M7G A;  3F92 A;  4KHP M;  2GNO A;  3UZU A;  3A45 A;  2XFS A;  1IBK M;  3KDS E;  3LQR A;  3NBI A;  3R8F A;  3FTD A;  4LGM A;  3FRH A;  4D80 A;  1VDL A;  2EKF A;  3R9X B;  2QSF X;  4LCB A;  2LXE A;  4DBG B;  1QYR A;  4CGY B;  1VG5 A;  2WSC F;  2WSE F;  3HHX A;  1C1K A;  2ZM6 M;  2F5O A;  4OVZ A;  1UM8 A;  2JZ1 A;  4NXM M;  3SYL A;  2XF3 A;  2RRU A;  1Z59 A;  2B3T A;  3KP0 E;  4IIW A;  3GPX A;  2G8L A;  3T1Y M;  2KW0 A;  2DWM A;  4JXJ A;  3I01 M;  2E5L M;  1E9S A;  1Q02 A;  3M6A A;  3U61 A;  4DUY M;  1T3T A;  1IXZ A;  1K82 A;  3AOE C;  3HHY A;  3GO8 A;  4MH0 E;  4Y28 F;  4FCV A;  2O25 A;  2DHR A;  4IBB A;  1R7R A;  1V33 A;  4LJ9 A;  1HR0 M;  2UUC M;  2CP8 A;  3MHV C;  2J7N A;  3W0F A;  3I4Y A;  1N77 A;  1WR1 B;  2ZBK B;  3HJQ A;  3KS4 A;  2YR0 A;  2C99 A;  3VKG A;  4NRV A;  2XFT A;  1R4G A;  3CGW A;  3L2A A;  2I7N A;  5DNY A;  2W82 A;  1TH4 A;  4L8R C;  1ZMW A;  3CTW B;  2UUB M;  3K8Z A;  3RFW A;  2Z8Y M;  2MRO B;  4PDI A;  1XHB A;  2O5R A;  2C96 A;  2R0I A;  3LQQ A;  4MGK E;  4JI3 M;  4DV0 M;  1Q39 A;  2XH9 A;  3KVW A;  2FE8 A;  4W5W A;  4I81 A;  1HT1 E;  2JXN A;  5E26 A;  5FSW A;  4OX9 M;  1GLN A;  2L2D A;  2UXB M;  1QDR A;  4JI1 M;  1EFU B;  3U6Q A;  1OJL A;  1FNN A;  3L26 A;  4LF6 M;  5FTJ A;  4AKI A;  3GQ3 A;  3GLF E;  4M9X A;  1GL6 A;  1YSY A;  1G71 A;  4L15 A;  4G4R A;  2NQ8 C;  4LF7 M;  1IBM M;  3AL0 C;  3IEC A;  2DZN B;  4DR1 M;  1A5T A;  1N34 M;  4WW0 A;  3JR5 A;  3PVS A;  4LFB M;  2OO9 A;  4LG2 A;  2FOI C;  4NSO B;  5IZ7 D;  2FH0 A;  3SC3 A;  4HLQ A;  5ITU A;  1OAI A;  2FFJ A;  1IN4 A;  1HNW M;  3SBJ A;  5LMN M;  3C58 A;  2C9C A;  2LHC A;  3FTE A;  3HJS A;  2VQF M;  4LFA M;  1XC8 A;  1TDH A;  2KA6 B;  1NY5 A;  1V34 A;  1Z5B A;  2KNV A;  3H4J A;  4X64 M;  1XMO M;  3TL4 X;  4CIZ A;  2J5Y A;  3L29 A;  4LRT A;  1HJP A;  5EP2 A;  2K6B A;  1HNX M;  2CUZ A;  5JI3 E;  3GLF A;  4R3D A;  3UGJ A;  2F5Q A;  1N33 M;  1GL7 A;  1JQJ C;  1OQY A;  3SMP A;  3V76 A;  2CFO A;  3W0L B;  4DV1 M;  2R44 A;  4M9S A;  4G4Q A;  4D81 A;  4MGH A;  2RGO A;  2LWX A;  4AG6 A;  4IBE A;  3HY5 A;  4B7F A;  3SAR A;  3B9P A;  3ILK A;  4RF0 A;  5GKN A;  2G3Q A;  3TQS A;  4DR4 M;  4K0K M;  1TF0 B;  3K1J A;  1WGN A;  3GLG B;  4RF1 A;  4DR3 M;  3AOE A;  2D7E A;  3I04 M;  3QYB A;  1IN5 A;  1XXH B;  1L1T A;  1SXJ D;  2DAK A;  4IBK A;  1W5S A;  1G41 A;  1VDD A;  4GIP A;  4DV2 M;  5E6J A;  2CHV A;  2Z4S A;  3GQ5 A;  2BWE A;  4KO8 A;  1OKS A;  1HT2 E;  4B08 A;  1ZQ9 A;  3NWL A;  1PM5 A;  2MH8 A;  3UK6 A;  1YE9 A;  2LHG A;  2R4J A;  3HU1 A;  4FCW A;  1G4A E;  1WIV A;  3FYC A;  4Q7J A;  3GP1 A;  2DAI A;  4G4O A;  3LCV B;  4X65 M;  4X66 M;  1MU5 A;  4OW0 A;  1NY6 A;  3GLI B;  1QZM A;  4AG5 A;  4L78 A;  3VK7 A;  3U6O A;  3T1H M;  3EIH A;  2DAG A;  2P5T A;  4IBJ A;  2KEB A;  3IG5 A;  4M9Z A;  3SAU A;  3FUV A;  3Q8X A;  4LFC M;  5EXX A;  3HKP A;  3LCU A;  2DI0 A;  2XEP A;  3NBX X;  3KXE C;  4NSR A;  1L1Z A;  1QUT A;  4B3M M;  1NNU C;  2QHO B;  1P3Q Q;  1TDZ A;  4MM3 B;  4MGZ E;  1QUS A;  1AIP C;  5FTK A;  3D8L A;  1TR8 A;  2KNZ A;  4REZ A;  3T15 A;  2JNH A;  4LZZ A;  1DO0 A;  2LTU A;  3FUU A;  2QBY B;  3FTF A;  1TH2 A;  2ZAO A;  3GRR A;  3DZD A;  1YUB A;  4DUZ M;  3J7B A;  2JA2 A;  1G3I A;  2M60 A;  2XSZ A;  1IBL M;  1YLA A;  3D8B A;  4NL4 H;  4B3S M;  2CWB A;  2Z4R A;  1ZV1 A;  3AKZ A;  2R46 A;  5EXP A;  2R4E A;  4KT0 F;  4JI7 M;  1I94 M;  3U6L A;  1IQP A;  4AZF A;  4R7G A;  1NVM A;  2H5X A;  3DFZ A;  3E21 A;  2GQF A;  4JI8 M;  1LV7 A;  2Q2E B;  5KQD A;  4JN6 A;  4F2L A;  3U6P A;  2KZS A;  1IXR C;  1J5E M;  4QNR A;  2H1R A;  5FTN A;  1AUA A;  1IXS B;  2KDL A;  2X8A A;  3C3E A;  4WP2 A;  3U6S A;  3B74 A;  2O01 F;  4JI2 M;  3HGI A;  1N78 A;  3SAW A;  4GC9 A;  2QZ4 A;  3B89 A;  3GLI E;  4LY6 A;  2EJS A;  2FS1 A;  2XZF A;  2XZU A;  2JWS A;  5ITX E;  2CV2 A;  1MN3 A;  2DXI A;  4YY3 M;  3E9S A;  2Z3X A;  4AW4 A;  4LGY A;  3QAU A;  2Y20 A;  3SAV A;  1E94 E;  2KRK A;  1XXH A;  1X37 A;  4UN2 B;  4Z8X A;  3VK8 A;  1K3W A;  3KFU G;  2DAM A;  4AQY M;  1DGB A;  2HWJ A;  2VF8 A;  4ZPX A;  2L7H A;  4XGI A;  3WHK A;  2QQ8 A;  1QZE A;  2YFQ A;  4NRW A;  2A5Y B;  2HHH M;  4IBD A;  3H4M A;  4PD2 A;  1NJG A;  3SAT A;  1NHG C;  2RGH A;  5IT9 S;  3HHW A;  1CUK A;  4QNM A;  5KQ8 A;  4AI6 A;  2DNA A;  1C7Y A;  3BOS A;  4IBF A;  5BPV A;  2MGW A;  4G6Z A;  3IHP A;  3IG8 A;  1JB0 F;  3TPZ A;  3GLI A;  1FJG M;  2C9O A;  4OU7 A;  2JP7 A;  2K0B X;  1G8P A;  2MR9 A;  2LBC A;  2CEA A;  4IBG A;  5ITX A;  2CHG A;  4BBA A;  4LF9 M;  1PJS A;  1PRB A;  2DVW B;  4NC6 A;  2EA0 A;  2LVA A;  3FUW A;  3U60 B;  2CV0 A;  2F5P A;  3PXG A;  1MJG M;  1OAO C;  1OIP A;  3VDP A;  2OPF A;  5EXS A;  5H37 D;  3VFD A;  2HAK A;  2L4F A;  2LVQ D;  2X4A A;  2QBY A;  2DZL A;  5ITT A;  1D0K A;  3FRI A;  2EKK A;  3MMP A;  3L27 A;  1TH3 A;  2J7O A;  3LVV A;  4R71 A;  3GQ4 A;  1L2D A;  3LMM A;  3HHZ A;  3K92 A;  4CJ6 A;  4TUW A;  1OFI A;  4PT5 A;  5IRE B;  5C1B A;  4P16 A;  2F4V M;  3MK6 A;  1N32 M;  3FYD A;  1KSF X;  3U6E A;  3OTO M;  4DV4 M;  1Z5C A;  4MGY E;  2DAE A;  2JY8 A;  1OFH A;  4GH9 A;  1WXQ A;  2R45 A;  4L4U A;  2BWB A;  5KPZ A;  3U61 B;  3T6P A;  3QWL A;  4GIT A;  2K47 A;  2DEN A;  3BXW A;  3AV0 A;  4B7G A;  3B7Q A;  4QHS A;  4FW9 A;  2CE7 A;  4FWG A;  2UXD M;  1IXS A;  2CHQ A;  1XB2 B;  1L8Q A;  2DWZ B;  3GLH B;  4DV3 M;  1DGF A;  3A98 B;  2UXC M;  2QPA A;  1D2N A;  2FNA A;  2VF7 A;  4MB7 A;  1GAB A;  5F3W A;  3HX3 A;  8CAT A;  4M0W A; 
#chains in the Genus database with same CATH homology
 4RNA A;  4DR6 M;  5C18 A;  1MX0 A;  3U5Z B;  4WUR A;  1JR3 A;  2ZAM A;  4JYA M;  4JI5 M;  3FUX A;  4BLC A;  1GKI A;  1HQY E;  1N36 M;  1I4W A;  5EP1 A;  2ERC A;  2R18 A;  3L25 A;  2X49 A;  2L7I A;  3I51 A;  3T38 A;  2XLJ A;  3CF6 E;  4S12 A;  3EIE A;  5EJC A;  1IN6 A;  4BB9 A;  3J27 B;  4M0D A;  3WHL A;  3GRY A;  3LVW A;  1E9R A;  4AKH A;  2R65 A;  3U6C A;  4LF4 M;  3HJ8 A;  4JV5 M;  3TWL A;  1Q3C A;  2YQZ A;  2LNH C;  3FTC A;  2V1U A;  4QOZ C;  2OQ4 A;  1HNZ M;  4AKG A;  3U6M A;  5FTL A;  3KSX A;  4QOS A;  2V6Z M;  2YNM D;  3U60 A;  1S3S A;  3J81 S;  4DV7 M;  1Z6T A;  4LJ8 A;  4NOO B;  4D82 A;  2C5R A;  1GVN A;  1IY1 A;  5LMU M;  4ITQ A;  2KRU A;  2EO2 A;  4B3R M;  4PDG A;  1IY0 A;  3KOW E;  1XNQ M;  2VII A;  3ZH9 B;  3HWS A;  3GLF B;  1N75 A;  1SXJ B;  1XWI A;  4IBI A;  2XSZ D;  1DGH B;  1IY2 A;  1SXJ C;  4I4L A;  3RE8 A;  4GKK M;  3UMM A;  3A42 A;  3GRV A;  3M0E A;  1G59 A;  2Y0Q A;  2G5G X;  4I8O A;  3FUT A;  5DYI A;  1HQC A;  3JAM S;  3AJI B;  4YHH M;  3GLG A;  1QAQ A;  3VDU A;  1R6B X;  5KO3 A;  3SMS A;  4PCZ A;  5EQT A;  3CF2 A;  3VLF B;  1DO2 A;  3TE6 A;  2UU9 M;  2C98 A;  5KPT A;  4LZJ A;  3GPY A;  3J80 S;  4IJE A;  3GLH A;  2D7G A;  4I5S A;  1EE8 A;  2HL7 A;  4IBC A;  5IWA M;  5FLX S;  3PNV A;  2Z7J A;  3E4R A;  1L2B A;  4LF5 M;  2L09 A;  1IM2 A;  4GMQ A;  5ITY A;  2V1C A;  3FD9 A;  2HKJ A;  3CF0 A;  3A46 A;  2QP9 X;  4JI6 M;  1H6U A;  3U5Z A;  3FKE A;  2KXE A;  4LRS A;  1QAN A;  1KFV A;  1NJF A;  2UUA M;  1QAO A;  4G4N A;  3PFI A;  2D7H A;  1R2Y A;  2XGN A;  4A3V B;  2QCU A;  2QEN A;  3KP1 E;  5BR8 M;  3KOY E;  2M5Z A;  4LJA A;  2DWL A;  2VQE M;  1Z5A A;  4FCT A;  3TWK A;  4CHT B;  1SXJ E;  4LJ5 A;  3GPP A;  1PJJ A;  4B3T M;  1R2Z A;  1IN8 A;  3UJN A;  3L28 A;  4LJ7 A;  2DWN A;  3KS8 A;  3TWM A;  3RGP A;  4EIW A;  3VKH A;  4OVZ B;  4XBO A;  1NHW C;  2HCB A;  3PNY A;  4HL4 A;  3SAS A;  5ITQ A;  1E32 A;  3AOG A;  3SYK A;  1L2C A;  5EXT A;  1QAM A;  1ZAE A;  3KOX E;  4QHT A;  5EP3 A;  4GC5 A;  1XMQ M;  1XNR M;  3GRU A;  2L6O A;  2Y0T A;  4FD2 A;  3GPU A;  3J2P B;  3SFZ A;  1K3X A;  2R62 A;  4JI0 M;  1J09 A;  3KSJ A;  3RGS A;  4KLN A;  3ZC7 B;  3I4V A;  4FVM A;  4GHA A;  4DR7 M;  4IJF A;  1SXJ A;  4GRI A;  1DGH A;  1W5T A;  4DV6 M;  5KPR A;  3JR4 A;  3DOA A;  4GHL A;  1QVR A;  5ITR A;  2AHM A;  4KOD A;  3ZCB B;  3KOZ E;  1Q3B A;  2BNK A;  4B7H A;  2LH0 A;  4II7 A;  4LJ4 A;  5DYG A;  5EP4 A;  3HU3 A;  2KZU A;  3DA1 A;  2CV1 A;  7CAT A;  4DV5 M;  2I7P A;  2RKO A;  4Z6Y A;  1PJI A;  2EUC A;  1ORY B;  3SHG B;  4LF8 M;  2F5N A;  1QQW A;  4GKJ M;  4DR5 M;  1NSF A;  3K2L A;  4CIS A;  5JI2 E;  4DR2 M;  2Y21 A;  3KW6 A;  3SHF A;  2BJW A;  3U6D A;  2ZAN A;  4JI4 M;  5FTM A;  1DGG A;  3MJ5 A;  4LJ6 A;  3THG A;  1JR3 D;  2BJV A;  3HU2 A;  5A2Q S;  4X62 M;  3AFH A;  3J7A S;  4FWH A;  4FWD A;  1NNJ A;  1IN7 A;  1TGU A;  4L16 A;  4NXN M;  2DZO B;  2F5S A;  1KYI A;  1J7K A;  4MGI E;  3M7G A;  4KHP M;  3UZU A;  3A45 A;  2XFS A;  1IBK M;  3KDS E;  3LQR A;  3NBI A;  3R8F A;  3FTD A;  4LGM A;  4D80 A;  3R9X B;  4LCB A;  2LXE A;  1QYR A;  4CGY B;  3HHX A;  1C1K A;  2ZM6 M;  2F5O A;  4OVZ A;  1UM8 A;  4NXM M;  3SYL A;  2XF3 A;  1Z59 A;  3KP0 E;  4IIW A;  3GPX A;  2G8L A;  3T1Y M;  2KW0 A;  2DWM A;  4JXJ A;  2E5L M;  1E9S A;  3M6A A;  3U61 A;  4DUY M;  1T3T A;  1IXZ A;  1K82 A;  3AOE C;  3HHY A;  3GO8 A;  4MH0 E;  4FCV A;  2DHR A;  4IBB A;  1R7R A;  4LJ9 A;  1HR0 M;  2UUC M;  3MHV C;  2J7N A;  3W0F A;  3I4Y A;  1N77 A;  2ZBK B;  3HJQ A;  3KS4 A;  2YR0 A;  2C99 A;  3VKG A;  4NRV A;  2XFT A;  3L2A A;  5DNY A;  2I7N A;  2W82 A;  1TH4 A;  4L8R C;  3CTW B;  2UUB M;  3K8Z A;  3RFW A;  4PDI A;  1XHB A;  2O5R A;  2C96 A;  4MGK E;  3LQQ A;  4DV0 M;  4JI3 M;  1Q39 A;  2XH9 A;  3KVW A;  2FE8 A;  4W5W A;  4I81 A;  1HT1 E;  5E26 A;  4OX9 M;  5FSW A;  1GLN A;  2UXB M;  4JI1 M;  3U6Q A;  4AKI A;  1OJL A;  1FNN A;  3L26 A;  4LF6 M;  5FTJ A;  3GQ3 A;  4M9X A;  1GL6 A;  1YSY A;  4L15 A;  4G4R A;  2NQ8 C;  4LF7 M;  1IBM M;  3AL0 C;  2DZN B;  4DR1 M;  1N34 M;  4WW0 A;  3JR5 A;  3PVS A;  4LFB M;  4LG2 A;  2FOI C;  4NSO B;  5IZ7 D;  3SC3 A;  4HLQ A;  5ITU A;  2FFJ A;  1IN4 A;  1HNW M;  3SBJ A;  5LMN M;  3C58 A;  2C9C A;  3FTE A;  3HJS A;  2VQF M;  4LFA M;  1XC8 A;  1TDH A;  2KA6 B;  1NY5 A;  1Z5B A;  1XMO M;  4X64 M;  3TL4 X;  5EP2 A;  3L29 A;  4LRT A;  1HNX M;  2CUZ A;  5JI3 E;  3GLF A;  4R3D A;  3UGJ A;  2F5Q A;  1N33 M;  1GL7 A;  1JQJ C;  3SMP A;  2CFO A;  3W0L B;  4DV1 M;  4M9S A;  4G4Q A;  4D81 A;  4MGH A;  2RGO A;  2LWX A;  4AG6 A;  4IBE A;  4B7F A;  3SAR A;  3B9P A;  3ILK A;  4RF0 A;  5GKN A;  3TQS A;  4DR4 M;  4K0K M;  3K1J A;  3GLG B;  4RF1 A;  4DR3 M;  3AOE A;  2D7E A;  1IN5 A;  1XXH B;  1L1T A;  1SXJ D;  4IBK A;  1W5S A;  1G41 A;  1VDD A;  4GIP A;  4DV2 M;  5E6J A;  2CHV A;  2Z4S A;  3GQ5 A;  4KO8 A;  1HT2 E;  4B08 A;  1ZQ9 A;  3NWL A;  1PM5 A;  3UK6 A;  1YE9 A;  2R4J A;  3HU1 A;  4FCW A;  1G4A E;  3FYC A;  3GP1 A;  4G4O A;  4X65 M;  4X66 M;  1MU5 A;  4OW0 A;  1NY6 A;  3GLI B;  1QZM A;  4AG5 A;  4L78 A;  3VK7 A;  3U6O A;  3T1H M;  3EIH A;  2P5T A;  4IBJ A;  4M9Z A;  2KEB A;  3IG5 A;  3SAU A;  3FUV A;  3Q8X A;  4LFC M;  5EXX A;  3HKP A;  2XEP A;  4NSR A;  3KXE C;  1L1Z A;  4B3M M;  1NNU C;  1TDZ A;  4MM3 B;  4MGZ E;  5FTK A;  3D8L A;  4REZ A;  3T15 A;  4LZZ A;  1DO0 A;  3FUU A;  2QBY B;  3FTF A;  1TH2 A;  2ZAO A;  3GRR A;  3DZD A;  1YUB A;  4DUZ M;  3J7B A;  2JA2 A;  1G3I A;  2M60 A;  2XSZ A;  1IBL M;  3D8B A;  4NL4 H;  4B3S M;  2Z4R A;  3AKZ A;  2R46 A;  5EXP A;  2R4E A;  4JI7 M;  1I94 M;  3U6L A;  1IQP A;  4AZF A;  4R7G A;  1NVM A;  3DFZ A;  4JI8 M;  1LV7 A;  2Q2E B;  5KQD A;  4JN6 A;  3U6P A;  2KZS A;  1IXR C;  1J5E M;  4QNR A;  2H1R A;  5FTN A;  1IXS B;  2X8A A;  3U6S A;  4JI2 M;  3HGI A;  1N78 A;  3SAW A;  4GC9 A;  2QZ4 A;  4LY6 A;  2XZF A;  2XZU A;  5ITX E;  2CV2 A;  2DXI A;  4YY3 M;  3E9S A;  2Z3X A;  4AW4 A;  4LGY A;  3QAU A;  2Y20 A;  3SAV A;  1E94 E;  2KRK A;  1XXH A;  1X37 A;  4Z8X A;  3VK8 A;  1K3W A;  3KFU G;  4AQY M;  1DGB A;  4ZPX A;  2L7H A;  4XGI A;  3WHK A;  2YFQ A;  4NRW A;  2A5Y B;  2HHH M;  4IBD A;  3H4M A;  4PD2 A;  1NJG A;  3SAT A;  1NHG C;  2RGH A;  5IT9 S;  3HHW A;  4QNM A;  5KQ8 A;  4AI6 A;  3BOS A;  4IBF A;  5BPV A;  4G6Z A;  3IG8 A;  3TPZ A;  3GLI A;  1FJG M;  2C9O A;  4OU7 A;  5ITX A;  1G8P A;  2CEA A;  4IBG A;  2CHG A;  4BBA A;  4LF9 M;  2DVW B;  2EA0 A;  3FUW A;  3U60 B;  2CV0 A;  2F5P A;  3PXG A;  3VDP A;  2OPF A;  5EXS A;  5H37 D;  3VFD A;  2X4A A;  2QBY A;  5ITT A;  3L27 A;  1TH3 A;  2J7O A;  3LVV A;  3GQ4 A;  1L2D A;  3LMM A;  3HHZ A;  3K92 A;  4TUW A;  1OFI A;  4PT5 A;  5IRE B;  5C1B A;  4P16 A;  2F4V M;  3MK6 A;  1N32 M;  3FYD A;  1KSF X;  3U6E A;  3OTO M;  4DV4 M;  1Z5C A;  4MGY E;  1OFH A;  4GH9 A;  1WXQ A;  2R45 A;  4L4U A;  3U61 B;  5KPZ A;  3QWL A;  4GIT A;  2K47 A;  3AV0 A;  4B7G A;  4QHS A;  4FW9 A;  2CE7 A;  4FWG A;  2UXD M;  2CHQ A;  1L8Q A;  2DWZ B;  3GLH B;  4DV3 M;  1DGF A;  3A98 B;  2UXC M;  2QPA A;  1D2N A;  2FNA A;  4MB7 A;  5F3W A;  8CAT A;  4M0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...