2DWNA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase/dna
molecule keywords Primosomal protein N'
total genus 17
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwnA01
2D7HA 4NL4H 2DWLA 2D7EA 2D7GA 2DWNA 2DWMA
chains in the Genus database with same CATH superfamily
2D7HA 3SHGB 4DV4M 4CJ6A 1QUSA 3FUUA 3GLGE 3A98B 2XSZD 4FWGA 4DV1M 3M6AA 2DZLA 2WSEF 3L28A 4M0DA 1HNZM 4GC9A 3FKEA 3HU2A 4LG2A 4NXMM 5EXTA 2UXBM 3HHZA 2X8AA 3D8LA 2F5OA 1T43A 1D2NA 3UJNA 3EIEA 4W5WA 4AKIA 2C9OA 2VDBB 3TWMA 5H37D 3SC3A 3SAUA 3KXEC 2L4FA 1YE9A 1QAMA 4G6ZA 2R4EA 1Z5BA 3I04M 1IN4A 2JA2A 4DBGB 3U5ZB 4TUWA 2LNHC 2XH9A 3PNVA 5EQTA 4QOSA 1X37A 2DVWB 3KS8A 2F5QA 3SASA 2UXCM 4PCZA 1G71A 2DAGA 3HGIA 1L2CA 2L7IA 4JXJA 3RE8A 2LXEA 4DR4M 5ITRA 2EUCA 2YNMD 3GLHB 3DFZA 2RGHA 5C1BA 2X49A 2ZBKB 1C7YA 2VQFM 4R3DA 1XC8A 2QP9X 3U6PA 3CF6E 4G3OA 1XB2B 3E21A 2DI0A 3I51A 3AOGA 3KW6A 2DZNB 2I7NA 1HNWM 3TQSA 5DNYA 4DR2M 3GPPA 2FOIC 1V34A 4LF4M 1L1TA 2DAEA 1EIJA 2XLJA 2H1RA 1BVSA 5F3WA 2KZUA 2G5GX 2J7NA 1IXSB 4B3SM 1XHBA 1IY0A 1QZMA 5KQDA 2JY7A 1IFYA 4GHLA 2LBCA 1W5TA 2YFQA 3HHXA 3SBJA 2MJ5B 3SFZA 4I8OA 2LHGA 2XZUA 4B3RM 3T1YM 2W82A 3SYKA 3GLFB 5LMNM 1GVNA 2R44A 3FTCA 2UXDM 4CHTB 2DNAA 2H5XA 3KOYE 4GH9A 2Y21A 1WIVA 5EXSA 3ZH9B 2LVOC 3LCUA 3LVVA 1EFUB 3HU1A 3TWKA 4PDGA 1NV8A 4LZJA 4S12A 3GP1A 5LMUM 1WJ7A 3VK8A 2QNJA 2R45A 4G4NA 1A5TA 3FE3A 4RF0A 4DR1M 3E46A 2CUZA 4M0WA 3QYEA 1IQPA 3FTFA 4DV3M 4QOZC 1SXJD 1XNQM 3F92A 2KNZA 2C98A 4L15A 3HWSA 4P16A 5KPRA 3FYCA 4PDIA 3T1HM 2G3QA 1WGLA 4LJ4A 1GJSA 3CF2A 4G4OA 1Q02A 2R46A 4D80A 5FTJA 2BJWA 2DAIA 2R4JA 4GITA 3HX3A 3SHFA 3ZCBB 1D0LA 3A42A 3GRYA 4B08A 3AOEC 1IN6A 2Z4RA 4I4LA 1OAOC 1NVMA 1G41A 1MU5A 1OIZA 1D0MA 1YLAA 2MH8A 3I4YA 4FVMA 4HEOA 4M9XA 5C18A 2KW0A 1H6UA 1N75A 3TWLA 2JNHA 1R2ZA 3QYBA 3LQRA 2CV1A 5KO3A 2RRUA 3KFUG 4DV7M 2Q2EB 2B3TA 4WURA 4L6V6 3K92A 3KDSE 4ZPXA 2DXIA 4JI4M 4AKHA 1ZMUA 2XZFA 2LWXA 2XFSA 2O01F 4G4QA 4B3TM 7CATA 4Q7JA 3FUXA 1OIPA 3VKGA 1NV9A 4B7GA 4JI6M 5JI2E 2YR0A 4LFAM 1Z5AA 1L8QA 2JY5A 2DKLA 3PXGA 5FTMA 1DO2A 2UUCM 4KHPM 1JR3D 1XXHA 2QZ4A 3A46A 2QCUA 4L78A 3ZQJA 2DHRA 1SXJA 2F4VM 4XBOA 1SXJB 2DHYA 1TH2A 1ZV1A 4NSRA 1IBMM 2J5YA 1NJGA 1GL6A 2QPAA 2F5SA 5JI3E 4NC6A 3J80S 5GKNA 3NWLA 4LGMA 2DZOB 3FUVA 1C1KA 1MJGM 1QDRA 3IHPA 5EP3A 2G8LA 3ZC7B 1T6OA 1DGGA 2OOBA 3NBIA 4GC5A 4II7A 2CHGA 3EIHA 5EP4A 5ITYA 3GQ5A 4JI1M 1OTRA 1DGBA 2JXNA 1NSFA 3RGSA 1OKSA 2CFOA 3JR5A 1SXJC 2V1UA 1IN7A 2RGOA 3GPUA 3FD9A 2R62A 3HY5A 1TF0B 3U5ZA 1OQYA 4JI7M 2XF3A 4M9SA 4AKGA 1R6BX 1NHWC 2Z4SA 3U6CA 2JZ1A 3GPYA 2HKJA 1LTMA 3U6DA 3TL4X 1E94E 5DFLA 1TTEA 3GLHA 2ZAOA 4LJ9A 1S3SA 4IBGA 1QUTA 3JR4A 3KSJA 2ZM6M 1G8PA 3SARA 3L27A 4JN6A 8CATA 4DV6M 1QYRA 1WXQA 4L16A 3VLFB 2L6OA 4GKKM 2HCBA 2P5TA 4IBDA 2JY6B 3I4VA 2JP7A 4Y28F 4WP2A 3PFIA 2FNAA 3HU3A 4LJ8A 3W0FA 4DV0M 1K3XA 4NRWA 3GLGA 3HJQA 3W68A 3B7ZA 5FTNA 1DGHA 2EKKA 2ZTDA 2Y20A 4FW9A 3M0EA 2GNOA 1J7KA 4IJFA 2CWBA 1IXSA 2J7OA 4HLQA 3U6OA 2BWEA 4JI8M 5A2QS 4AG5A 4QHSA 2KXEA 1DV0A 2YQZA 5IREB 3GQ3A 4R71A 3WHLA 3J27B 1N77A 1XMOM 1HT1E 2KRKA 3GLIA 4IBJA 4DV2M 2HHHM 4DV5M 3FRHA 3KS4A 4L8RC 4P17A 3RGPA 1GABA 1I4WA 4DR7M 2F5PA 1IN5A 3U6MA 2CP8A 3UZUA 2EA0A 1QANA 4YY3M 1Y8GA 1IXRC 2C9CA 5IWAM 3RFWA 4BBAA 2GQFA 1J5EM 1P3QQ 4KT0F 2VF7A 4LJ6A 2KZSA 4LGYA 3IG8A 5EXXA 1GLNA 2K6BA 4JI3M 1VEGA 3J81S 2DENA 1UM8A 3SAVA 3FUTA 2RKOA 2FFJA 2MGWA 1V92A 1HQCA 3VDUA 2QBYA 1QAOA 2QBYB 4X65M 3FTEA 4GKJM 4BB9A 5ITUA 5EP2A 5EXPA 3W0LB 3T38A 1YUBA 3B7QA 3HJ8A 2N35A 4RF1A 3AKZA 1K82A 1QAQA 4X66M 5FTLA 4GIPA 1AIPC 4GEWA 3U60A 3GRVA 1NY6A 3AV0A 4AW4A 1RU3A 3U60B 4I5SA 1PJIA 4NOOB 1XMQM 4MGHA 3U6LA 5E6JA 1N78A 1DO0A 3HHWA 2LVNC 1HR0M 2ERCA 1IXZA 4JYAM 2CRUA 3V76A 1ZMWA 4A3VB 4IJEA 5EP1A 3K9OA 3THGA 3AL0C 5E26A 1G4AE 1ORYB 1Z6TA 4LZZA 2ZAMA 2LVAA 4FWHA 2LVQD 3C3DA 4ANRA 1VQ1A 4LJ7A 3Q8GA 4KLNA 2DAMA 3K1JA 4AI6A 3MMPA 2VQEM 1G3IA 2JZ0A 1QQWA 4FCVA 4REZA 1Q3CA 2KHHA 4B3MM 2V6ZM 3PNYA 2C99A 2M60A 3KOWE 4NSOB 2OOAA 4Z6YA 3BBZA 2F5NA 3B7NA 3GRUA 4B7FA 3UMMA 4LCBA 1PJTA 4UN2B 2WSCF 4RNAA 2X4AA 2XGNA 1N33M 4FD2A 2I7PA 2Z3XA 4QHTA 1CUKA 3T6PA 4OU7A 4LF7M 3R9XB 2UU9M 4LFBM 4GHAA 2O5RA 1R2YA 3DA1A 1TDHA 1GL7A 4LF9M 3Q8XA 3KP0E 3GQ4A 4MH0E 4BLCA 3LW5F 3IECA 3GLFE 4LF5M 1HT2E 5L8RF 5KPZA 3MK6A 4YHHM 1OFIA 3KVWA 1AUAA 1TGUA 4LJ5A 4WW0A 4MB7A 2LH0A 4XGIA 5ITXE 1I94M 1Q3BA 1NNUC 1KFVA 1XNRM 3HHYA 2A5YB 1PRBA 2K47A 4R7GA 2R18A 2MR9A 3GLFA 2KNVA 5BPVA 1PJQA 1HNXM 1F4IA 2D7GA 1NNJA 2BJVA 2L7HA 1GJTA 4KODA 1HQYE 2VF8A 1N34M 5KPTA 2Z8YM 2EJSA 5FLXS 2WZJA 1W5SA 3B74A 4IBKA 3U61B 3U61A 5IT9S 2CE7A 4IBEA 1E32A 2WSFF 1MX0A 5DYIA 1IN8A 1JR3E 3AOEA 1PM5A 3HKPA 4F2LA 3CF0A 3T15A 2Z7JA 1VDLA 1OFHA 3GPXA 1G59A 2UUBM 4IIWA 4QNRA 4DR5M 3HJSA 2QQ8A 3LVWA 2L2DA 3FUWA 3C9PA 5FSWA 4ITQA 4FWDA 4JI5M 2KEBA 2EO2A 1JR3A 2QHOB 2Y0TA 2LHCA 4I81A 4MM3B 3VK7A 2C96A 2R65A 4FCTA 2FS1A 2ZTCA 3U6EA 2CHVA 2V1CA 3FTDA 3JAMS 3M7GA 1V33A 3KOXE 3IG5A 4DUZM 4PT5A 2DWZB 4K0KM 1NY5A 1UFZA 1OAIA 2Y0QA 3KP1E 4NRVA 4CGYB 4PD2A 2OPFA 3J7AS 1N32M 1DGHB 1KYIA 4IBBA 1K3WA 1PGYA 1GO5A 2K0BX 4LFCM 4MGZE 3K9PA 3QWLA 2CV2A 3DZDA 3B9PA 4OVZA 4LRTA 4JV5M 3VFDA 4DR3M 5ITTA 3W67A 1FNNA 1VEJA 2QENA 1VG5A 3BOSA 3SMPA 3R8FA 2MROB 1OJLA 4KO8A 4LJAA 4LRSA 4Z8XA 4X62M 3ILKA 3GLIB 4IBIA 4LY6A 4B7HA 3VDPA 4CISA 2LTUA 1DGFA 1T3TA 2HAKA 3LMMA 2HL7A 2KNAA 3D8BA 3K8ZA 3MHVC 1XXHB 1IM2A 1ZAEA 1HJPA 1PJSA 5EJCA 3TE6A 2AHMA 2APLA 3VKHA 1R5LA 1NO1A 1QZEA 4DUYM 2CV0A 4G4RA 2CHQA 3KOZE 2BNKA 2VIIA 3TPZA 1FJGM 3LQQA 3E4RA 1L1ZA 2DAKA 2R0IA 5ITXA 3I01M 3J7BA 4EIWA 2C5RA 1D0KA 3NBXX 1WR1B 2UUAM 3KSXA 1PJJA 1IBKM 2XSZA 3HZJA 1TR8A 3SAWA 5FTKA 1ZMVA 3QAUA 3UK6A 4QNMA 1EE8A 2K9DA 2L4EA 3GO8A 1L2BA 2CEAA 2DWLA 4NL4H 3L26A 1IBLM 3GLHE 1IY1A 1J09A 3L2AA 5ITQA 3OTOM 3H4JA 3MJ5A 1R4GA 2ZANA 3L25A 1SG9A 4XK8F 4F1IA 2NQ8C 3SYLA 2FE8A 2LVPC 1SXJE 1LV7A 4LF6M 1R7RA 4JI0M 3SATA 4DR6M 2E5LM 1MN3A 4HL4A 4IBFA 3C58A 4OX9M 4LF8M 2EKFA 1QVRA 1IY2A 3SMSA 3A45A 2KRUA 4GRIA 1KSFX 2BWBA 1ZQ9A 3BXWA 3DOAA 4MGKE 2L09A 4D81A 2D7EA 3GLGB 2OO9A 4AQYM 2FH0A 1E9SA 1XWIA 1WHCA 3L29A 1TH4A 2JWSA 1Q39A 1Z59A 4JI2M 2R6FA 4M9ZA 3CTWB 4AZFA 4L4UA 2JUJA 2DWMA 1QDTA 1NHGC 2XFTA 5IZ7D 3U6SA 1YSYA 3B89A 4OVZB 2QSFX 1E9RA 1VDDA 2KDLA 2KA6B 4OW0A 3FYDA 1Z5CA 2DWNA 3LCVB 3WHKA 3UGJA 3J2PB 1JB0F 1VEKA 2JY8A 4RKUF 5KQ8A 3GLIE 3AFHA 2M5ZA 3FRIA 1NJFA 2XEPA 4MGIE 3E9SA 4NXNM 4D82A 4AG6A 2O25A 4FCWA 3AJIB 3K2LA 1XXHE 3C3EA 3GRRA 4GMQA 4IBCA 1JQJC 1TDZA 3PVSA 1N36M 1GKIA 5BR8M 1WGNA 4X64M 1L2DA 3CGWA 4MGYE 3H4MA 1TH3A 2OQ4A 5DYGA 3U6QA 4CIZA 2HWJA
chains in the Genus database with same CATH topology
2D7HA 3SHGB 4DV4M 3FUUA 3A98B 2XSZD 4FWGA 4DV1M 3M6AA 3L28A 4M0DA 1HNZM 4GC9A 3FKEA 3HU2A 4LG2A 4NXMM 5EXTA 2UXBM 3HHZA 2X8AA 3D8LA 2F5OA 1D2NA 3UJNA 3EIEA 4W5WA 4AKIA 2C9OA 3TWMA 5H37D 3SC3A 3SAUA 3KXEC 1YE9A 1QAMA 4G6ZA 2R4EA 1Z5BA 3U5ZB 1IN4A 2JA2A 4TUWA 2LNHC 2XH9A 3PNVA 5EQTA 4QOSA 1X37A 2DVWB 3KS8A 2F5QA 3SASA 2UXCM 4PCZA 3HGIA 1L2CA 2L7IA 4JXJA 3RE8A 2LXEA 4DR4M 5ITRA 2EUCA 2YNMD 3GLHB 3DFZA 2RGHA 5C1BA 2X49A 2ZBKB 2VQFM 4R3DA 1XC8A 2QP9X 3U6PA 3CF6E 3I51A 3AOGA 3KW6A 2DZNB 2I7NA 1HNWM 3TQSA 5DNYA 4DR2M 3GPPA 2FOIC 4LF4M 1L1TA 2XLJA 2H1RA 5F3WA 2KZUA 2G5GX 2J7NA 1IXSB 4B3SM 1XHBA 1IY0A 1QZMA 5KQDA 4GHLA 1W5TA 2YFQA 3HHXA 3SBJA 3SFZA 4I8OA 2XZUA 4B3RM 3T1YM 2W82A 3SYKA 3GLFB 5LMNM 1GVNA 3FTCA 2UXDM 4CHTB 3KOYE 4GH9A 2Y21A 5EXSA 3ZH9B 3LVVA 3TWKA 3HU1A 4PDGA 4LZJA 4S12A 3GP1A 5LMUM 3VK8A 2R45A 4G4NA 4RF0A 4DR1M 2CUZA 4M0WA 1IQPA 3FTFA 4DV3M 4QOZC 1SXJD 1XNQM 2C98A 4L15A 3HWSA 4P16A 5KPRA 3FYCA 4PDIA 3T1HM 4LJ4A 3CF2A 4G4OA 2R46A 4D80A 5FTJA 2BJWA 2R4JA 4GITA 3SHFA 3ZCBB 3A42A 3GRYA 4B08A 3AOEC 1IN6A 2Z4RA 4I4LA 1G41A 1NVMA 1MU5A 5C18A 3I4YA 4FVMA 4M9XA 2KW0A 1H6UA 1N75A 3TWLA 1R2ZA 3LQRA 2CV1A 5KO3A 3KFUG 4DV7M 2Q2EB 4WURA 3K92A 3KDSE 4ZPXA 2DXIA 4JI4M 4AKHA 2XZFA 2LWXA 2XFSA 4G4QA 4B3TM 7CATA 3FUXA 3VKGA 4B7GA 4JI6M 5JI2E 2YR0A 4LFAM 1Z5AA 1L8QA 3PXGA 5FTMA 1DO2A 2UUCM 4KHPM 1JR3D 1XXHA 2QZ4A 3A46A 2QCUA 4L78A 2DHRA 1SXJA 2F4VM 4XBOA 1SXJB 1TH2A 4NSRA 1IBMM 1NJGA 1GL6A 2QPAA 2F5SA 5JI3E 3J80S 5GKNA 3NWLA 4LGMA 2DZOB 3FUVA 1C1KA 5EP3A 2G8LA 3ZC7B 4II7A 1DGGA 4GC5A 3NBIA 2CHGA 3EIHA 5EP4A 5ITYA 3GQ5A 4JI1M 1DGBA 1NSFA 3RGSA 2CFOA 3JR5A 1SXJC 2V1UA 1IN7A 2RGOA 3GPUA 3FD9A 2R62A 3U5ZA 4JI7M 2XF3A 4M9SA 4AKGA 1R6BX 1NHWC 2Z4SA 3U6CA 3GPYA 2HKJA 3U6DA 3TL4X 1E94E 3GLHA 2ZAOA 4LJ9A 1S3SA 4IBGA 3JR4A 3KSJA 2ZM6M 1G8PA 3SARA 3L27A 4JN6A 8CATA 4DV6M 1QYRA 1WXQA 4L16A 3VLFB 2L6OA 4GKKM 2HCBA 2P5TA 4IBDA 3I4VA 3PFIA 2FNAA 3HU3A 4LJ8A 3W0FA 4DV0M 1K3XA 4NRWA 3GLGA 3HJQA 5FTNA 1DGHA 2Y20A 4FW9A 3M0EA 1J7KA 4IJFA 2J7OA 4HLQA 3U6OA 4JI8M 5A2QS 4AG5A 4QHSA 2KXEA 2YQZA 5IREB 3GQ3A 3WHLA 3J27B 1N77A 1XMOM 1HT1E 2KRKA 3GLIA 4IBJA 4DV2M 2HHHM 4DV5M 3KS4A 4L8RC 3RGPA 1I4WA 4DR7M 2F5PA 1IN5A 3U6MA 3UZUA 2EA0A 1QANA 4YY3M 1IXRC 2C9CA 5IWAM 3RFWA 4BBAA 1J5EM 4LJ6A 2KZSA 4LGYA 3IG8A 5EXXA 1GLNA 4JI3M 3J81S 1UM8A 3SAVA 3FUTA 2RKOA 2FFJA 3VDUA 1HQCA 2QBYA 1QAOA 2QBYB 4X65M 3FTEA 4GKJM 4BB9A 5ITUA 5EP2A 5EXPA 3W0LB 3T38A 1YUBA 3HJ8A 4RF1A 3AKZA 1K82A 1QAQA 4X66M 5FTLA 4GIPA 3U60A 3GRVA 1NY6A 3AV0A 4AW4A 3U60B 4I5SA 1PJIA 4NOOB 1XMQM 4MGHA 3U6LA 5E6JA 1N78A 1DO0A 3HHWA 1HR0M 2ERCA 1IXZA 4JYAM 4A3VB 4IJEA 5EP1A 3THGA 3AL0C 5E26A 1G4AE 1ORYB 1Z6TA 4LZZA 2ZAMA 4FWHA 4LJ7A 4KLNA 3K1JA 4AI6A 2VQEM 1G3IA 4REZA 1QQWA 4FCVA 4B3MM 1Q3CA 2V6ZM 3PNYA 2C99A 2M60A 3KOWE 4NSOB 4Z6YA 2F5NA 4B7FA 3GRUA 3UMMA 4LCBA 4RNAA 2X4AA 2XGNA 1N33M 4FD2A 2I7PA 2Z3XA 4QHTA 4LF7M 3R9XB 4OU7A 2UU9M 4LFBM 4GHAA 2O5RA 1R2YA 3DA1A 1TDHA 1GL7A 4LF9M 3Q8XA 3KP0E 3GQ4A 4MH0E 4BLCA 4LF5M 1HT2E 5KPZA 3MK6A 4YHHM 1OFIA 3KVWA 1TGUA 4LJ5A 4WW0A 4MB7A 2LH0A 4XGIA 5ITXE 1I94M 1Q3BA 1NNUC 1KFVA 1XNRM 3HHYA 2A5YB 2K47A 4R7GA 2R18A 3GLFA 5BPVA 1HNXM 2D7GA 1NNJA 2BJVA 2L7HA 4KODA 1HQYE 1N34M 5KPTA 5FLXS 4IBKA 1W5SA 3U61B 3U61A 5IT9S 2CE7A 4IBEA 1E32A 1MX0A 5DYIA 1IN8A 3AOEA 1PM5A 3HKPA 3CF0A 3T15A 2Z7JA 3GPXA 1OFHA 1G59A 2UUBM 4IIWA 4QNRA 4DR5M 3HJSA 3LVWA 3FUWA 5FSWA 4ITQA 4FWDA 4JI5M 2KEBA 2EO2A 1JR3A 4MM3B 2Y0TA 4I81A 3VK7A 2C96A 2R65A 4FCTA 3U6EA 2CHVA 2V1CA 3FTDA 3JAMS 3M7GA 3KOXE 4K0KM 3IG5A 4DUZM 4PT5A 2DWZB 1NY5A 3KP1E 2Y0QA 4PD2A 4NRVA 4CGYB 2OPFA 3J7AS 1N32M 1DGHB 1KYIA 4IBBA 1K3WA 4LFCM 4MGZE 3QWLA 2CV2A 3DZDA 3B9PA 4OVZA 4LRTA 4JV5M 3VFDA 4DR3M 5ITTA 1FNNA 2QENA 3BOSA 3SMPA 3R8FA 1OJLA 4KO8A 4LJAA 4LRSA 4Z8XA 4X62M 3ILKA 3GLIB 4IBIA 4LY6A 4B7HA 3VDPA 4CISA 1DGFA 1T3TA 3LMMA 2HL7A 3D8BA 3K8ZA 3MHVC 1XXHB 1IM2A 1ZAEA 5EJCA 3TE6A 2AHMA 3VKHA 4DUYM 2CV0A 4G4RA 2CHQA 3KOZE 2BNKA 2VIIA 3TPZA 1FJGM 3LQQA 3E4RA 1L1ZA 5ITXA 3J7BA 4EIWA 2C5RA 2UUAM 3KSXA 1PJJA 1IBKM 2XSZA 3SAWA 5FTKA 3QAUA 3UK6A 4QNMA 1EE8A 3GO8A 1L2BA 2CEAA 2DWLA 4NL4H 3L26A 1IBLM 1IY1A 1J09A 3L2AA 5ITQA 3OTOM 3MJ5A 2ZANA 3L25A 2NQ8C 3SYLA 2FE8A 1SXJE 1LV7A 4LF6M 1R7RA 4JI0M 3SATA 4DR6M 2E5LM 4HL4A 4IBFA 3C58A 4OX9M 4LF8M 1QVRA 1IY2A 3SMSA 3A45A 2KRUA 4GRIA 1KSFX 3DOAA 1ZQ9A 4MGKE 2L09A 4D81A 2D7EA 3GLGB 4AQYM 1E9SA 1XWIA 3L29A 1TH4A 1Q39A 1Z59A 4JI2M 4M9ZA 3CTWB 4AZFA 4L4UA 2DWMA 1NHGC 2XFTA 5IZ7D 3U6SA 1YSYA 4OVZB 1E9RA 1VDDA 2KA6B 4OW0A 3FYDA 1Z5CA 2DWNA 3UGJA 3WHKA 3J2PB 5KQ8A 3AFHA 2M5ZA 1NJFA 2XEPA 4MGIE 3E9SA 4NXNM 4D82A 4AG6A 4FCWA 3AJIB 3K2LA 3GRRA 4GMQA 4IBCA 1JQJC 1TDZA 3PVSA 1N36M 1GKIA 5BR8M 4X64M 1L2DA 4MGYE 3H4MA 1TH3A 2OQ4A 5DYGA 3U6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7H A;  4NL4 H;  2DWL A;  2D7E A;  2D7G A;  2DWN A;  2DWM A; 
#chains in the Genus database with same CATH topology
 2D7H A;  3SHG B;  4DV4 M;  4CJ6 A;  1QUS A;  3FUU A;  3GLG E;  3A98 B;  2XSZ D;  4FWG A;  4DV1 M;  3M6A A;  2DZL A;  2WSE F;  3L28 A;  4M0D A;  1HNZ M;  4GC9 A;  3FKE A;  3HU2 A;  4LG2 A;  4NXM M;  5EXT A;  2UXB M;  3HHZ A;  2X8A A;  3D8L A;  2F5O A;  1T43 A;  1D2N A;  3UJN A;  3EIE A;  4W5W A;  4AKI A;  2C9O A;  2VDB B;  3TWM A;  5H37 D;  3SC3 A;  3SAU A;  3KXE C;  2L4F A;  1YE9 A;  1QAM A;  4G6Z A;  2R4E A;  1Z5B A;  3I04 M;  1IN4 A;  2JA2 A;  4DBG B;  3U5Z B;  4TUW A;  2LNH C;  2XH9 A;  3PNV A;  5EQT A;  4QOS A;  1X37 A;  2DVW B;  3KS8 A;  2F5Q A;  3SAS A;  2UXC M;  4PCZ A;  1G71 A;  2DAG A;  3HGI A;  1L2C A;  2L7I A;  4JXJ A;  3RE8 A;  2LXE A;  4DR4 M;  5ITR A;  2EUC A;  2YNM D;  3GLH B;  3DFZ A;  2RGH A;  5C1B A;  2X49 A;  2ZBK B;  1C7Y A;  2VQF M;  4R3D A;  1XC8 A;  2QP9 X;  3U6P A;  3CF6 E;  4G3O A;  1XB2 B;  3E21 A;  2DI0 A;  3I51 A;  3AOG A;  3KW6 A;  2DZN B;  2I7N A;  1HNW M;  3TQS A;  5DNY A;  4DR2 M;  3GPP A;  2FOI C;  1V34 A;  4LF4 M;  1L1T A;  2DAE A;  1EIJ A;  2XLJ A;  2H1R A;  1BVS A;  5F3W A;  2KZU A;  2G5G X;  2J7N A;  1IXS B;  4B3S M;  1XHB A;  1IY0 A;  1QZM A;  5KQD A;  2JY7 A;  1IFY A;  4GHL A;  2LBC A;  1W5T A;  2YFQ A;  3HHX A;  3SBJ A;  2MJ5 B;  3SFZ A;  4I8O A;  2LHG A;  2XZU A;  4B3R M;  3T1Y M;  2W82 A;  3SYK A;  3GLF B;  5LMN M;  1GVN A;  2R44 A;  3FTC A;  2UXD M;  4CHT B;  2DNA A;  2H5X A;  3KOY E;  4GH9 A;  2Y21 A;  1WIV A;  5EXS A;  3ZH9 B;  2LVO C;  3LCU A;  3LVV A;  1EFU B;  3HU1 A;  3TWK A;  4PDG A;  1NV8 A;  4LZJ A;  4S12 A;  3GP1 A;  5LMU M;  1WJ7 A;  3VK8 A;  2QNJ A;  2R45 A;  4G4N A;  1A5T A;  3FE3 A;  4RF0 A;  4DR1 M;  3E46 A;  2CUZ A;  4M0W A;  3QYE A;  1IQP A;  3FTF A;  4DV3 M;  4QOZ C;  1SXJ D;  1XNQ M;  3F92 A;  2KNZ A;  2C98 A;  4L15 A;  3HWS A;  4P16 A;  5KPR A;  3FYC A;  4PDI A;  3T1H M;  2G3Q A;  1WGL A;  4LJ4 A;  1GJS A;  3CF2 A;  4G4O A;  1Q02 A;  2R46 A;  4D80 A;  5FTJ A;  2BJW A;  2DAI A;  2R4J A;  4GIT A;  3HX3 A;  3SHF A;  3ZCB B;  1D0L A;  3A42 A;  3GRY A;  4B08 A;  3AOE C;  1IN6 A;  2Z4R A;  4I4L A;  1OAO C;  1NVM A;  1G41 A;  1MU5 A;  1OIZ A;  1D0M A;  1YLA A;  2MH8 A;  3I4Y A;  4FVM A;  4HEO A;  4M9X A;  5C18 A;  2KW0 A;  1H6U A;  1N75 A;  3TWL A;  2JNH A;  1R2Z A;  3QYB A;  3LQR A;  2CV1 A;  5KO3 A;  2RRU A;  3KFU G;  4DV7 M;  2Q2E B;  2B3T A;  4WUR A;  4L6V 6;  3K92 A;  3KDS E;  4ZPX A;  2DXI A;  4JI4 M;  4AKH A;  1ZMU A;  2XZF A;  2LWX A;  2XFS A;  2O01 F;  4G4Q A;  4B3T M;  7CAT A;  4Q7J A;  3FUX A;  1OIP A;  3VKG A;  1NV9 A;  4B7G A;  4JI6 M;  5JI2 E;  2YR0 A;  4LFA M;  1Z5A A;  1L8Q A;  2JY5 A;  2DKL A;  3PXG A;  5FTM A;  1DO2 A;  2UUC M;  4KHP M;  1JR3 D;  1XXH A;  2QZ4 A;  3A46 A;  2QCU A;  4L78 A;  3ZQJ A;  2DHR A;  1SXJ A;  2F4V M;  4XBO A;  1SXJ B;  2DHY A;  1TH2 A;  1ZV1 A;  4NSR A;  1IBM M;  2J5Y A;  1NJG A;  1GL6 A;  2QPA A;  2F5S A;  5JI3 E;  4NC6 A;  3J80 S;  5GKN A;  3NWL A;  4LGM A;  2DZO B;  3FUV A;  1C1K A;  1MJG M;  1QDR A;  3IHP A;  5EP3 A;  2G8L A;  3ZC7 B;  1T6O A;  1DGG A;  2OOB A;  3NBI A;  4GC5 A;  4II7 A;  2CHG A;  3EIH A;  5EP4 A;  5ITY A;  3GQ5 A;  4JI1 M;  1OTR A;  1DGB A;  2JXN A;  1NSF A;  3RGS A;  1OKS A;  2CFO A;  3JR5 A;  1SXJ C;  2V1U A;  1IN7 A;  2RGO A;  3GPU A;  3FD9 A;  2R62 A;  3HY5 A;  1TF0 B;  3U5Z A;  1OQY A;  4JI7 M;  2XF3 A;  4M9S A;  4AKG A;  1R6B X;  1NHW C;  2Z4S A;  3U6C A;  2JZ1 A;  3GPY A;  2HKJ A;  1LTM A;  3U6D A;  3TL4 X;  1E94 E;  5DFL A;  1TTE A;  3GLH A;  2ZAO A;  4LJ9 A;  1S3S A;  4IBG A;  1QUT A;  3JR4 A;  3KSJ A;  2ZM6 M;  1G8P A;  3SAR A;  3L27 A;  4JN6 A;  8CAT A;  4DV6 M;  1QYR A;  1WXQ A;  4L16 A;  3VLF B;  2L6O A;  4GKK M;  2HCB A;  2P5T A;  4IBD A;  2JY6 B;  3I4V A;  2JP7 A;  4Y28 F;  4WP2 A;  3PFI A;  2FNA A;  3HU3 A;  4LJ8 A;  3W0F A;  4DV0 M;  1K3X A;  4NRW A;  3GLG A;  3HJQ A;  3W68 A;  3B7Z A;  5FTN A;  1DGH A;  2EKK A;  2ZTD A;  2Y20 A;  4FW9 A;  3M0E A;  2GNO A;  1J7K A;  4IJF A;  2CWB A;  1IXS A;  2J7O A;  4HLQ A;  3U6O A;  2BWE A;  4JI8 M;  5A2Q S;  4AG5 A;  4QHS A;  2KXE A;  1DV0 A;  2YQZ A;  5IRE B;  3GQ3 A;  4R71 A;  3WHL A;  3J27 B;  1N77 A;  1XMO M;  1HT1 E;  2KRK A;  3GLI A;  4IBJ A;  4DV2 M;  2HHH M;  4DV5 M;  3FRH A;  3KS4 A;  4L8R C;  4P17 A;  3RGP A;  1GAB A;  1I4W A;  4DR7 M;  2F5P A;  1IN5 A;  3U6M A;  2CP8 A;  3UZU A;  2EA0 A;  1QAN A;  4YY3 M;  1Y8G A;  1IXR C;  2C9C A;  5IWA M;  3RFW A;  4BBA A;  2GQF A;  1J5E M;  1P3Q Q;  4KT0 F;  2VF7 A;  4LJ6 A;  2KZS A;  4LGY A;  3IG8 A;  5EXX A;  1GLN A;  2K6B A;  4JI3 M;  1VEG A;  3J81 S;  2DEN A;  1UM8 A;  3SAV A;  3FUT A;  2RKO A;  2FFJ A;  2MGW A;  1V92 A;  1HQC A;  3VDU A;  2QBY A;  1QAO A;  2QBY B;  4X65 M;  3FTE A;  4GKJ M;  4BB9 A;  5ITU A;  5EP2 A;  5EXP A;  3W0L B;  3T38 A;  1YUB A;  3B7Q A;  3HJ8 A;  2N35 A;  4RF1 A;  3AKZ A;  1K82 A;  1QAQ A;  4X66 M;  5FTL A;  4GIP A;  1AIP C;  4GEW A;  3U60 A;  3GRV A;  1NY6 A;  3AV0 A;  4AW4 A;  1RU3 A;  3U60 B;  4I5S A;  1PJI A;  4NOO B;  1XMQ M;  4MGH A;  3U6L A;  5E6J A;  1N78 A;  1DO0 A;  3HHW A;  2LVN C;  1HR0 M;  2ERC A;  1IXZ A;  4JYA M;  2CRU A;  3V76 A;  1ZMW A;  4A3V B;  4IJE A;  5EP1 A;  3K9O A;  3THG A;  3AL0 C;  5E26 A;  1G4A E;  1ORY B;  1Z6T A;  4LZZ A;  2ZAM A;  2LVA A;  4FWH A;  2LVQ D;  3C3D A;  4ANR A;  1VQ1 A;  4LJ7 A;  3Q8G A;  4KLN A;  2DAM A;  3K1J A;  4AI6 A;  3MMP A;  2VQE M;  1G3I A;  2JZ0 A;  1QQW A;  4FCV A;  4REZ A;  1Q3C A;  2KHH A;  4B3M M;  2V6Z M;  3PNY A;  2C99 A;  2M60 A;  3KOW E;  4NSO B;  2OOA A;  4Z6Y A;  3BBZ A;  2F5N A;  3B7N A;  3GRU A;  4B7F A;  3UMM A;  4LCB A;  1PJT A;  4UN2 B;  2WSC F;  4RNA A;  2X4A A;  2XGN A;  1N33 M;  4FD2 A;  2I7P A;  2Z3X A;  4QHT A;  1CUK A;  3T6P A;  4OU7 A;  4LF7 M;  3R9X B;  2UU9 M;  4LFB M;  4GHA A;  2O5R A;  1R2Y A;  3DA1 A;  1TDH A;  1GL7 A;  4LF9 M;  3Q8X A;  3KP0 E;  3GQ4 A;  4MH0 E;  4BLC A;  3LW5 F;  3IEC A;  3GLF E;  4LF5 M;  1HT2 E;  5L8R F;  5KPZ A;  3MK6 A;  4YHH M;  1OFI A;  3KVW A;  1AUA A;  1TGU A;  4LJ5 A;  4WW0 A;  4MB7 A;  2LH0 A;  4XGI A;  5ITX E;  1I94 M;  1Q3B A;  1NNU C;  1KFV A;  1XNR M;  3HHY A;  2A5Y B;  1PRB A;  2K47 A;  4R7G A;  2R18 A;  2MR9 A;  3GLF A;  2KNV A;  5BPV A;  1PJQ A;  1HNX M;  1F4I A;  2D7G A;  1NNJ A;  2BJV A;  2L7H A;  1GJT A;  4KOD A;  1HQY E;  2VF8 A;  1N34 M;  5KPT A;  2Z8Y M;  2EJS A;  5FLX S;  2WZJ A;  1W5S A;  3B74 A;  4IBK A;  3U61 B;  3U61 A;  5IT9 S;  2CE7 A;  4IBE A;  1E32 A;  2WSF F;  1MX0 A;  5DYI A;  1IN8 A;  1JR3 E;  3AOE A;  1PM5 A;  3HKP A;  4F2L A;  3CF0 A;  3T15 A;  2Z7J A;  1VDL A;  1OFH A;  3GPX A;  1G59 A;  2UUB M;  4IIW A;  4QNR A;  4DR5 M;  3HJS A;  2QQ8 A;  3LVW A;  2L2D A;  3FUW A;  3C9P A;  5FSW A;  4ITQ A;  4FWD A;  4JI5 M;  2KEB A;  2EO2 A;  1JR3 A;  2QHO B;  2Y0T A;  2LHC A;  4I81 A;  4MM3 B;  3VK7 A;  2C96 A;  2R65 A;  4FCT A;  2FS1 A;  2ZTC A;  3U6E A;  2CHV A;  2V1C A;  3FTD A;  3JAM S;  3M7G A;  1V33 A;  3KOX E;  3IG5 A;  4DUZ M;  4PT5 A;  2DWZ B;  4K0K M;  1NY5 A;  1UFZ A;  1OAI A;  2Y0Q A;  3KP1 E;  4NRV A;  4CGY B;  4PD2 A;  2OPF A;  3J7A S;  1N32 M;  1DGH B;  1KYI A;  4IBB A;  1K3W A;  1PGY A;  1GO5 A;  2K0B X;  4LFC M;  4MGZ E;  3K9P A;  3QWL A;  2CV2 A;  3DZD A;  3B9P A;  4OVZ A;  4LRT A;  4JV5 M;  3VFD A;  4DR3 M;  5ITT A;  3W67 A;  1FNN A;  1VEJ A;  2QEN A;  1VG5 A;  3BOS A;  3SMP A;  3R8F A;  2MRO B;  1OJL A;  4KO8 A;  4LJA A;  4LRS A;  4Z8X A;  4X62 M;  3ILK A;  3GLI B;  4IBI A;  4LY6 A;  4B7H A;  3VDP A;  4CIS A;  2LTU A;  1DGF A;  1T3T A;  2HAK A;  3LMM A;  2HL7 A;  2KNA A;  3D8B A;  3K8Z A;  3MHV C;  1XXH B;  1IM2 A;  1ZAE A;  1HJP A;  1PJS A;  5EJC A;  3TE6 A;  2AHM A;  2APL A;  3VKH A;  1R5L A;  1NO1 A;  1QZE A;  4DUY M;  2CV0 A;  4G4R A;  2CHQ A;  3KOZ E;  2BNK A;  2VII A;  3TPZ A;  1FJG M;  3LQQ A;  3E4R A;  1L1Z A;  2DAK A;  2R0I A;  5ITX A;  3I01 M;  3J7B A;  4EIW A;  2C5R A;  1D0K A;  3NBX X;  1WR1 B;  2UUA M;  3KSX A;  1PJJ A;  1IBK M;  2XSZ A;  3HZJ A;  1TR8 A;  3SAW A;  5FTK A;  1ZMV A;  3QAU A;  3UK6 A;  4QNM A;  1EE8 A;  2K9D A;  2L4E A;  3GO8 A;  1L2B A;  2CEA A;  2DWL A;  4NL4 H;  3L26 A;  1IBL M;  3GLH E;  1IY1 A;  1J09 A;  3L2A A;  5ITQ A;  3OTO M;  3H4J A;  3MJ5 A;  1R4G A;  2ZAN A;  3L25 A;  1SG9 A;  4XK8 F;  4F1I A;  2NQ8 C;  3SYL A;  2FE8 A;  2LVP C;  1SXJ E;  1LV7 A;  4LF6 M;  1R7R A;  4JI0 M;  3SAT A;  4DR6 M;  2E5L M;  1MN3 A;  4HL4 A;  4IBF A;  3C58 A;  4OX9 M;  4LF8 M;  2EKF A;  1QVR A;  1IY2 A;  3SMS A;  3A45 A;  2KRU A;  4GRI A;  1KSF X;  2BWB A;  1ZQ9 A;  3BXW A;  3DOA A;  4MGK E;  2L09 A;  4D81 A;  2D7E A;  3GLG B;  2OO9 A;  4AQY M;  2FH0 A;  1E9S A;  1XWI A;  1WHC A;  3L29 A;  1TH4 A;  2JWS A;  1Q39 A;  1Z59 A;  4JI2 M;  2R6F A;  4M9Z A;  3CTW B;  4AZF A;  4L4U A;  2JUJ A;  2DWM A;  1QDT A;  1NHG C;  2XFT A;  5IZ7 D;  3U6S A;  1YSY A;  3B89 A;  4OVZ B;  2QSF X;  1E9R A;  1VDD A;  2KDL A;  2KA6 B;  4OW0 A;  3FYD A;  1Z5C A;  2DWN A;  3LCV B;  3WHK A;  3UGJ A;  3J2P B;  1JB0 F;  1VEK A;  2JY8 A;  4RKU F;  5KQ8 A;  3GLI E;  3AFH A;  2M5Z A;  3FRI A;  1NJF A;  2XEP A;  4MGI E;  3E9S A;  4NXN M;  4D82 A;  4AG6 A;  2O25 A;  4FCW A;  3AJI B;  3K2L A;  1XXH E;  3C3E A;  3GRR A;  4GMQ A;  4IBC A;  1JQJ C;  1TDZ A;  3PVS A;  1N36 M;  1GKI A;  5BR8 M;  1WGN A;  4X64 M;  1L2D A;  3CGW A;  4MGY E;  3H4M A;  1TH3 A;  2OQ4 A;  5DYG A;  3U6Q A;  4CIZ A;  2HWJ A; 
#chains in the Genus database with same CATH homology
 2D7H A;  3SHG B;  4DV4 M;  3FUU A;  3A98 B;  2XSZ D;  4FWG A;  4DV1 M;  3M6A A;  3L28 A;  4M0D A;  1HNZ M;  4GC9 A;  3FKE A;  3HU2 A;  4LG2 A;  4NXM M;  5EXT A;  2UXB M;  3HHZ A;  2X8A A;  3D8L A;  2F5O A;  1D2N A;  3UJN A;  3EIE A;  4W5W A;  4AKI A;  2C9O A;  3TWM A;  5H37 D;  3SC3 A;  3SAU A;  3KXE C;  1YE9 A;  1QAM A;  4G6Z A;  2R4E A;  1Z5B A;  3U5Z B;  1IN4 A;  2JA2 A;  4TUW A;  2LNH C;  2XH9 A;  3PNV A;  5EQT A;  4QOS A;  1X37 A;  2DVW B;  3KS8 A;  2F5Q A;  3SAS A;  2UXC M;  4PCZ A;  3HGI A;  1L2C A;  2L7I A;  4JXJ A;  3RE8 A;  2LXE A;  4DR4 M;  5ITR A;  2EUC A;  2YNM D;  3GLH B;  3DFZ A;  2RGH A;  5C1B A;  2X49 A;  2ZBK B;  2VQF M;  4R3D A;  1XC8 A;  2QP9 X;  3U6P A;  3CF6 E;  3I51 A;  3AOG A;  3KW6 A;  2DZN B;  2I7N A;  1HNW M;  3TQS A;  5DNY A;  4DR2 M;  3GPP A;  2FOI C;  4LF4 M;  1L1T A;  2XLJ A;  2H1R A;  5F3W A;  2KZU A;  2G5G X;  2J7N A;  1IXS B;  4B3S M;  1XHB A;  1IY0 A;  1QZM A;  5KQD A;  4GHL A;  1W5T A;  2YFQ A;  3HHX A;  3SBJ A;  3SFZ A;  4I8O A;  2XZU A;  4B3R M;  3T1Y M;  2W82 A;  3SYK A;  3GLF B;  5LMN M;  1GVN A;  3FTC A;  2UXD M;  4CHT B;  3KOY E;  4GH9 A;  2Y21 A;  5EXS A;  3ZH9 B;  3LVV A;  3TWK A;  3HU1 A;  4PDG A;  4LZJ A;  4S12 A;  3GP1 A;  5LMU M;  3VK8 A;  2R45 A;  4G4N A;  4RF0 A;  4DR1 M;  2CUZ A;  4M0W A;  1IQP A;  3FTF A;  4DV3 M;  4QOZ C;  1SXJ D;  1XNQ M;  2C98 A;  4L15 A;  3HWS A;  4P16 A;  5KPR A;  3FYC A;  4PDI A;  3T1H M;  4LJ4 A;  3CF2 A;  4G4O A;  2R46 A;  4D80 A;  5FTJ A;  2BJW A;  2R4J A;  4GIT A;  3SHF A;  3ZCB B;  3A42 A;  3GRY A;  4B08 A;  3AOE C;  1IN6 A;  2Z4R A;  4I4L A;  1G41 A;  1NVM A;  1MU5 A;  5C18 A;  3I4Y A;  4FVM A;  4M9X A;  2KW0 A;  1H6U A;  1N75 A;  3TWL A;  1R2Z A;  3LQR A;  2CV1 A;  5KO3 A;  3KFU G;  4DV7 M;  2Q2E B;  4WUR A;  3K92 A;  3KDS E;  4ZPX A;  2DXI A;  4JI4 M;  4AKH A;  2XZF A;  2LWX A;  2XFS A;  4G4Q A;  4B3T M;  7CAT A;  3FUX A;  3VKG A;  4B7G A;  4JI6 M;  5JI2 E;  2YR0 A;  4LFA M;  1Z5A A;  1L8Q A;  3PXG A;  5FTM A;  1DO2 A;  2UUC M;  4KHP M;  1JR3 D;  1XXH A;  2QZ4 A;  3A46 A;  2QCU A;  4L78 A;  2DHR A;  1SXJ A;  2F4V M;  4XBO A;  1SXJ B;  1TH2 A;  4NSR A;  1IBM M;  1NJG A;  1GL6 A;  2QPA A;  2F5S A;  5JI3 E;  3J80 S;  5GKN A;  3NWL A;  4LGM A;  2DZO B;  3FUV A;  1C1K A;  5EP3 A;  2G8L A;  3ZC7 B;  4II7 A;  1DGG A;  4GC5 A;  3NBI A;  2CHG A;  3EIH A;  5EP4 A;  5ITY A;  3GQ5 A;  4JI1 M;  1DGB A;  1NSF A;  3RGS A;  2CFO A;  3JR5 A;  1SXJ C;  2V1U A;  1IN7 A;  2RGO A;  3GPU A;  3FD9 A;  2R62 A;  3U5Z A;  4JI7 M;  2XF3 A;  4M9S A;  4AKG A;  1R6B X;  1NHW C;  2Z4S A;  3U6C A;  3GPY A;  2HKJ A;  3U6D A;  3TL4 X;  1E94 E;  3GLH A;  2ZAO A;  4LJ9 A;  1S3S A;  4IBG A;  3JR4 A;  3KSJ A;  2ZM6 M;  1G8P A;  3SAR A;  3L27 A;  4JN6 A;  8CAT A;  4DV6 M;  1QYR A;  1WXQ A;  4L16 A;  3VLF B;  2L6O A;  4GKK M;  2HCB A;  2P5T A;  4IBD A;  3I4V A;  3PFI A;  2FNA A;  3HU3 A;  4LJ8 A;  3W0F A;  4DV0 M;  1K3X A;  4NRW A;  3GLG A;  3HJQ A;  5FTN A;  1DGH A;  2Y20 A;  4FW9 A;  3M0E A;  1J7K A;  4IJF A;  2J7O A;  4HLQ A;  3U6O A;  4JI8 M;  5A2Q S;  4AG5 A;  4QHS A;  2KXE A;  2YQZ A;  5IRE B;  3GQ3 A;  3WHL A;  3J27 B;  1N77 A;  1XMO M;  1HT1 E;  2KRK A;  3GLI A;  4IBJ A;  4DV2 M;  2HHH M;  4DV5 M;  3KS4 A;  4L8R C;  3RGP A;  1I4W A;  4DR7 M;  2F5P A;  1IN5 A;  3U6M A;  3UZU A;  2EA0 A;  1QAN A;  4YY3 M;  1IXR C;  2C9C A;  5IWA M;  3RFW A;  4BBA A;  1J5E M;  4LJ6 A;  2KZS A;  4LGY A;  3IG8 A;  5EXX A;  1GLN A;  4JI3 M;  3J81 S;  1UM8 A;  3SAV A;  3FUT A;  2RKO A;  2FFJ A;  3VDU A;  1HQC A;  2QBY A;  1QAO A;  2QBY B;  4X65 M;  3FTE A;  4GKJ M;  4BB9 A;  5ITU A;  5EP2 A;  5EXP A;  3W0L B;  3T38 A;  1YUB A;  3HJ8 A;  4RF1 A;  3AKZ A;  1K82 A;  1QAQ A;  4X66 M;  5FTL A;  4GIP A;  3U60 A;  3GRV A;  1NY6 A;  3AV0 A;  4AW4 A;  3U60 B;  4I5S A;  1PJI A;  4NOO B;  1XMQ M;  4MGH A;  3U6L A;  5E6J A;  1N78 A;  1DO0 A;  3HHW A;  1HR0 M;  2ERC A;  1IXZ A;  4JYA M;  4A3V B;  4IJE A;  5EP1 A;  3THG A;  3AL0 C;  5E26 A;  1G4A E;  1ORY B;  1Z6T A;  4LZZ A;  2ZAM A;  4FWH A;  4LJ7 A;  4KLN A;  3K1J A;  4AI6 A;  2VQE M;  1G3I A;  4REZ A;  1QQW A;  4FCV A;  4B3M M;  1Q3C A;  2V6Z M;  3PNY A;  2C99 A;  2M60 A;  3KOW E;  4NSO B;  4Z6Y A;  2F5N A;  4B7F A;  3GRU A;  3UMM A;  4LCB A;  4RNA A;  2X4A A;  2XGN A;  1N33 M;  4FD2 A;  2I7P A;  2Z3X A;  4QHT A;  4LF7 M;  3R9X B;  4OU7 A;  2UU9 M;  4LFB M;  4GHA A;  2O5R A;  1R2Y A;  3DA1 A;  1TDH A;  1GL7 A;  4LF9 M;  3Q8X A;  3KP0 E;  3GQ4 A;  4MH0 E;  4BLC A;  4LF5 M;  1HT2 E;  5KPZ A;  3MK6 A;  4YHH M;  1OFI A;  3KVW A;  1TGU A;  4LJ5 A;  4WW0 A;  4MB7 A;  2LH0 A;  4XGI A;  5ITX E;  1I94 M;  1Q3B A;  1NNU C;  1KFV A;  1XNR M;  3HHY A;  2A5Y B;  2K47 A;  4R7G A;  2R18 A;  3GLF A;  5BPV A;  1HNX M;  2D7G A;  1NNJ A;  2BJV A;  2L7H A;  4KOD A;  1HQY E;  1N34 M;  5KPT A;  5FLX S;  4IBK A;  1W5S A;  3U61 B;  3U61 A;  5IT9 S;  2CE7 A;  4IBE A;  1E32 A;  1MX0 A;  5DYI A;  1IN8 A;  3AOE A;  1PM5 A;  3HKP A;  3CF0 A;  3T15 A;  2Z7J A;  3GPX A;  1OFH A;  1G59 A;  2UUB M;  4IIW A;  4QNR A;  4DR5 M;  3HJS A;  3LVW A;  3FUW A;  5FSW A;  4ITQ A;  4FWD A;  4JI5 M;  2KEB A;  2EO2 A;  1JR3 A;  4MM3 B;  2Y0T A;  4I81 A;  3VK7 A;  2C96 A;  2R65 A;  4FCT A;  3U6E A;  2CHV A;  2V1C A;  3FTD A;  3JAM S;  3M7G A;  3KOX E;  4K0K M;  3IG5 A;  4DUZ M;  4PT5 A;  2DWZ B;  1NY5 A;  3KP1 E;  2Y0Q A;  4PD2 A;  4NRV A;  4CGY B;  2OPF A;  3J7A S;  1N32 M;  1DGH B;  1KYI A;  4IBB A;  1K3W A;  4LFC M;  4MGZ E;  3QWL A;  2CV2 A;  3DZD A;  3B9P A;  4OVZ A;  4LRT A;  4JV5 M;  3VFD A;  4DR3 M;  5ITT A;  1FNN A;  2QEN A;  3BOS A;  3SMP A;  3R8F A;  1OJL A;  4KO8 A;  4LJA A;  4LRS A;  4Z8X A;  4X62 M;  3ILK A;  3GLI B;  4IBI A;  4LY6 A;  4B7H A;  3VDP A;  4CIS A;  1DGF A;  1T3T A;  3LMM A;  2HL7 A;  3D8B A;  3K8Z A;  3MHV C;  1XXH B;  1IM2 A;  1ZAE A;  5EJC A;  3TE6 A;  2AHM A;  3VKH A;  4DUY M;  2CV0 A;  4G4R A;  2CHQ A;  3KOZ E;  2BNK A;  2VII A;  3TPZ A;  1FJG M;  3LQQ A;  3E4R A;  1L1Z A;  5ITX A;  3J7B A;  4EIW A;  2C5R A;  2UUA M;  3KSX A;  1PJJ A;  1IBK M;  2XSZ A;  3SAW A;  5FTK A;  3QAU A;  3UK6 A;  4QNM A;  1EE8 A;  3GO8 A;  1L2B A;  2CEA A;  2DWL A;  4NL4 H;  3L26 A;  1IBL M;  1IY1 A;  1J09 A;  3L2A A;  5ITQ A;  3OTO M;  3MJ5 A;  2ZAN A;  3L25 A;  2NQ8 C;  3SYL A;  2FE8 A;  1SXJ E;  1LV7 A;  4LF6 M;  1R7R A;  4JI0 M;  3SAT A;  4DR6 M;  2E5L M;  4HL4 A;  4IBF A;  3C58 A;  4OX9 M;  4LF8 M;  1QVR A;  1IY2 A;  3SMS A;  3A45 A;  2KRU A;  4GRI A;  1KSF X;  3DOA A;  1ZQ9 A;  4MGK E;  2L09 A;  4D81 A;  2D7E A;  3GLG B;  4AQY M;  1E9S A;  1XWI A;  3L29 A;  1TH4 A;  1Q39 A;  1Z59 A;  4JI2 M;  4M9Z A;  3CTW B;  4AZF A;  4L4U A;  2DWM A;  1NHG C;  2XFT A;  5IZ7 D;  3U6S A;  1YSY A;  4OVZ B;  1E9R A;  1VDD A;  2KA6 B;  4OW0 A;  3FYD A;  1Z5C A;  2DWN A;  3UGJ A;  3WHK A;  3J2P B;  5KQ8 A;  3AFH A;  2M5Z A;  1NJF A;  2XEP A;  4MGI E;  3E9S A;  4NXN M;  4D82 A;  4AG6 A;  4FCW A;  3AJI B;  3K2L A;  3GRR A;  4GMQ A;  4IBC A;  1JQJ C;  1TDZ A;  3PVS A;  1N36 M;  1GKI A;  5BR8 M;  4X64 M;  1L2D A;  4MGY E;  3H4M A;  1TH3 A;  2OQ4 A;  5DYG A;  3U6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...