2DWNA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase/dna
molecule keywords Primosomal protein N'
total genus 17
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwnA01
2D7HA 2DWNA 2D7GA 2DWLA 4NL4H 2DWMA 2D7EA
chains in the Genus database with same CATH superfamily
5DYIA 4M0WA 4DR7M 4KODA 2FOIC 2Y20A 4PD2A 3FTFA 1KYIA 3K9PA 3HU1A 1D0MA 2EKKA 1PGYA 1ZMWA 4F2LA 3U6LA 3MMPA 1G71A 2FH0A 2L7HA 2DKLA 4LF5M 4D82A 2OQ4A 1GO5A 1JB0F 4BBAA 2AHMA 2L09A 2O5RA 2QP9X 5FTJA 2KHHA 1NY6A 3IECA 3GLFA 4B7FA 3KOZE 2UXDM 1AIPC 2LVPC 3Q8XA 4QNRA 1XMOM 3KP1E 1OJLA 3B89A 3OTOM 2A5YB 1UFZA 3HWSA 1D2NA 3WHLA 1NO1A 3HU2A 1DGHA 5C18A 1ZAEA 3M0EA 4P16A 2Y21A 1HR0M 2G3QA 4IBDA 1IY2A 2RGOA 4JXJA 2KZSA 4R3DA 3T1YM 2LH0A 3GLGB 3E4RA 5DYGA 1IBMM 3U60B 5KO3A 3GRUA 4MGKE 4GC9A 4R7GA 3U6QA 1LTMA 1F4IA 1OKSA 3JR4A 3FE3A 3I4YA 2HWJA 3GLFB 3UZUA 4FWHA 4DV2M 1WHCA 3LMMA 3F92A 1JR3A 2UUBM 2XEPA 2MR9A 1R2YA 3GQ3A 2UUCM 3RGSA 1ZMVA 4Z6YA 1EIJA 1DGHB 4JI7M 1Z5CA 3DA1A 4FD2A 2LBCA 4AQYM 5FTKA 3L2AA 4FW9A 3HX3A 4BB9A 2QHOB 3D8LA 3LVWA 3L25A 1GABA 5IREB 5H37D 1QAMA 2MGWA 2G8LA 3H4JA 4DUZM 4M9ZA 1VDLA 2QPAA 4FVMA 2DAKA 3U6EA 2DENA 2LXEA 3SAWA 1IXZA 1KSFX 2V1CA 2XH9A 2F5PA 3SARA 2C99A 1QZMA 3HGIA 3NBXX 2KA6B 1GKIA 3SMPA 4IBBA 3MJ5A 1C1KA 3KP0E 1XXHE 3HJQA 3SC3A 5KPZA 1ZV1A 4GEWA 2QBYB 2FS1A 2VDBB 2F5SA 3CGWA 4M9SA 1R4GA 4R71A 4IBKA 3Q8GA 2UU9M 1NY5A 4RF1A 4B3TM 1GJTA 3GLGE 2YFQA 8CATA 2Y0TA 1E32A 2XF3A 3U60A 4NRWA 4KHPM 1P3QQ 4HL4A 5ITXA 4DR3M 2Z7JA 3VDPA 3A42A 3ZQJA 2W82A 1DV0A 2CV2A 5DFLA 3CF0A 3PNVA 1WXQA 3TWMA 1V92A 4GMQA 3SAVA 5KPRA 1IY0A 1Y8GA 3HU3A 4IJEA 3VK8A 1IBLM 2VF7A 1IY1A 4II7A 3HKPA 2J5YA 2MJ5B 1IM2A 1XC8A 1TTEA 4MB7A 4TUWA 5EP3A 2DWZB 1PJIA 1NV8A 4WP2A 1ORYB 3RGPA 5IWAM 2M5ZA 4CIZA 2Z3XA 4M0DA 3FUXA 3K2LA 5A2QS 2R45A 5L8RF 2DZLA 3KSXA 3NBIA 1Z59A 4JI5M 2ZAMA 4DV5M 2F5NA 4FWGA 1HQCA 4DV7M 4QOZC 1YSYA 4Y28F 2QQ8A 2CHQA 2H1RA 3I4VA 1QYRA 4X65M 2R4JA 3GQ5A 2CHVA 4KLNA 3PFIA 3I51A 3LQRA 3U61A 4AG5A 3B74A 3FYDA 1EFUB 3W68A 4ANRA 2DAMA 2LHCA 4GRIA 1IFYA 5EP1A 3GP1A 1QVRA 1WGNA 5C1BA 2XSZD 1L1TA 2JY7A 5IT9S 2MROB 3KOYE 4LJ5A 4LRTA 3AKZA 1QUTA 2DI0A 4IIWA 2LNHC 1G59A 1T6OA 4ZPXA 3TQSA 2QNJA 1NVMA 4G4RA 2CRUA 2KZUA 4ITQA 2LVQD 3KDSE 5EXSA 1T3TA 2FFJA 1R5LA 4AZFA 1ZMUA 4AG6A 3AFHA 4LJ9A 3T6PA 3HHYA 2P5TA 2KNZA 4A3VB 4UN2B 3I01M 4RNAA 4JI1M 4DV1M 3L28A 1L1ZA 2EA0A 2M60A 3JAMS 1YLAA 2JZ0A 2DNAA 4LG2A 3ZH9B 2WSEF 4QHSA 1V33A 2H5XA 3VFDA 1R6BX 4GH9A 4L78A 2OO9A 1QQWA 5E6JA 4DR4M 1TDHA 3UGJA 1QDRA 3U5ZA 3GPXA 1IN8A 1VEJA 3W67A 2L7IA 4I5SA 1OAIA 1S3SA 3HHXA 4OVZB 3U6SA 3UJNA 3VKGA 4I4LA 2D7HA 4KT0F 4G4QA 4DR2M 2KW0A 2RRUA 3B9PA 4P17A 1G8PA 3AOGA 4LF6M 4AKGA 5EJCA 1RU3A 3VLFB 2Q2EB 3U6MA 4B3SM 2LVNC 1HT2E 1IN5A 1W5SA 2XZFA 4LRSA 3GLIB 4LF9M 2G5GX 4XGIA 1D0LA 4L8RC 2QCUA 3CF6E 1Q39A 4JI3M 2CUZA 2KNAA 5LMUM 1E9SA 2V6ZM 3KOWE 1Z6TA 4PDGA 2C9CA 3A46A 4AI6A 1WIVA 1TGUA 2O01F 1XMQM 2XLJA 3V76A 4AW4A 2ZM6M 3HY5A 2CP8A 3J27B 4BLCA 3IG8A 5LMNM 3CTWB 2DZNB 2CV1A 2EO2A 3SMSA 1NHWC 4NOOB 3K8ZA 4DR1M 3B7QA 3KOXE 1R2ZA 4DR6M 3AOEC 5ITQA 3LVVA 2UXBM 5IZ7D 1TH2A 1NJFA 3TWKA 4X64M 3GPYA 3U6CA 3I04M 3R9XB 1XWIA 3QYBA 4RKUF 4LJAA 3E46A 1GLNA 3SHGB 1VEKA 4DV6M 1KFVA 1MX0A 4WURA 3GQ4A 4OX9M 3QWLA 1IQPA 2K9DA 4M9XA 3L26A 3HZJA 3GLHB 2BJWA 3FTCA 4Z8XA 2Z4RA 5ITTA 1Z5BA 5JI3E 1H6UA 3LCUA 2XSZA 2KRUA 1W5TA 3LQQA 4OVZA 4X62M 3K92A 2QSFX 3SBJA 2JP7A 5FTLA 3VDUA 4I8OA 1XXHB 2CE7A 4YHHM 5EP4A 3QAUA 2OOBA 1OAOC 1QANA 1FJGM 4CGYB 2DWLA 1NNJA 1IN6A 2KDLA 2KNVA 2APLA 2FE8A 1IN4A 1OQYA 4GC5A 3W0LB 2R18A 1SXJE 3AV0A 3WHKA 4LF7M 2CHGA 3J7AS 1X37A 2L2DA 1IXRC 4LZZA 3RE8A 5KPTA 2JZ1A 4DUYM 1K3XA 4FWDA 3CF2A 1GVNA 2L6OA 4NC6A 3PXGA 1K3WA 3MK6A 3W0FA 3SATA 1L8QA 5KQ8A 2F4VM 3B7NA 2XFSA 4LJ8A 1DGGA 1GL7A 1L2CA 2Z8YM 4IBJA 2R6FA 3EIHA 2N35A 3MHVC 4I81A 1NJGA 2DWNA 3J7BA 1SXJD 2R0IA 4IJFA 1Q3BA 2C9OA 3GPUA 4IBEA 4IBFA 4B08A 4CJ6A 2EJSA 1XNRM 3GO8A 4NRVA 1R7RA 3T1HM 3U6DA 3ZC7B 3FYCA 1J7KA 3C3EA 4PT5A 2Z4SA 1AUAA 1PRBA 2DXIA 3ILKA 2WSCF 4XBOA 1IXSB 1SXJB 1N75A 3TPZA 3U61B 3DFZA 3M6AA 4QHTA 1NNUC 1YUBA 2CV0A 3BXWA 2ZAOA 2XGNA 4JI6M 1TH3A 2I7PA 2L4FA 4NL4H 3K9OA 1E94E 2KEBA 2X49A 4B7GA 2LVAA 4JI8M 3FRHA 1HNWM 4RF0A 1I94M 3FUUA 1PM5A 3HJSA 4G6ZA 4IBGA 1XNQM 3AL0C 4GHLA 4L16A 4LJ6A 2YQZA 2I7NA 1N32M 1DO2A 4X66M 1NSFA 1HQYE 2ZANA 4JN6A 1IBKM 3J2PB 2LTUA 1MU5A 1OFIA 5EXXA 3JR5A 3GLFE 2CEAA 3THGA 1OTRA 5ITYA 3B7ZA 3E21A 1N77A 1TF0B 2OPFA 2DWMA 1IN7A 4LFBM 1IXSA 1SXJA 3FUTA 2FNAA 5FLXS 1I4WA 1QAQA 4OU7A 1TDZA 1GJSA 5FTNA 4LCBA 1UM8A 3C58A 2D7EA 2QBYA 2K0BX 2X4AA 3QYEA 5F3WA 2J7OA 4B3RM 3TE6A 2HCBA 1G41A 3K1JA 3D8BA 2BNKA 4LFCM 3KW6A 1N33M 3PNYA 2WSFF 2HL7A 3GRYA 4LFAM 2JY5A 1EE8A 4W5WA 4EIWA 4LZJA 1JQJC 3GLIE 2ERCA 5EQTA 3LCVB 2NQ8C 1PJJA 5EXPA 1CUKA 2R46A 4NSRA 3H4MA 2X8AA 4HEOA 4D81A 3GPPA 2LHGA 4LJ7A 2VQFM 2E5LM 5DNYA 3FTEA 2JUJA 1WGLA 2DAEA 4LF4M 4DR5M 4D80A 2ZTDA 4B3MM 4JI4M 4L4UA 3HHZA 3GLIA 1T43A 2UUAM 1XB2B 3PVSA 2R62A 3UK6A 3KS8A 3GRVA 3DZDA 4L15A 1N36M 3KVWA 3NWLA 2VF8A 4MGIE 3RFWA 4KO8A 3KSJA 4QOSA 1VDDA 3T38A 1VEGA 4NXMM 2J7NA 3SYKA 1TH4A 3C9PA 2GQFA 3A98B 1Q3CA 2DZOB 1K82A 2V1UA 4MM3B 1OIZA 3VKHA 2LWXA 1VQ1A 2JY6B 1PJSA 4QNMA 1Z5AA 3FD9A 4IBCA 2XZUA 2Y0QA 1SXJC 5BPVA 5FTMA 2DVWB 4LGMA 4NSOB 4LGYA 2JY8A 5EP2A 2JWSA 4FCVA 3A45A 1MN3A 1QUSA 2GNOA 3GLHE 1Q02A 4JI0M 4GKKM 2HAKA 4G4NA 3AOEA 4DV4M 1TR8A 2HHHM 1QAOA 1J09A 2L4EA 5EXTA 1FNNA 1XXHA 2BJVA 1BVSA 2OOAA 2JXNA 3IHPA 5GKNA 3U6OA 3U6PA 4JYAM 5ITUA 1HNZM 4LY6A 3KFUG 2YR0A 1OFHA 4PCZA 2K47A 2CFOA 2ZBKB 2O25A 1WJ7A 4MH0E 4WW0A 1PJQA 3FUWA 4AKIA 3FRIA 4DBGB 5KQDA 4Q7JA 1XHBA 2R44A 3FUVA 3EIEA 1E9RA 1MJGM 4CHTB 4REZA 2MH8A 4FCTA 4DV0M 4G3OA 3J80S 4YY3M 2C96A 1D0KA 4NXNM 3SYLA 3SAUA 3KXEC 3IG5A 5E26A 5FSWA 1PJTA 1A5TA 4OW0A 2DHRA 3SASA 4LJ4A 3L29A 3KS4A 3L27A 1LV7A 4MGZE 4PDIA 2C98A 1NV9A 2DAGA 4FCWA 1L2DA 2XFTA 3SFZA 4JV5M 2VQEM 4K0KM 2DAIA 5ITRA 1J5EM 4MGHA 3AJIB 2JNHA 1N34M 1VG5A 1DO0A 5ITXE 4DV3M 2EUCA 2WZJA 1L2BA 5JI2E 1HNXM 3TWLA 4GHAA 5BR8M 3R8FA 2BWBA 1WR1B 2RKOA 1JR3D 2BWEA 3LW5F 2R4EA 2ZTCA 2QENA 1DGBA 1QDTA 2CWBA 3M7GA 3VK7A 4HLQA 2D7GA 3T15A 4F1IA 3BBZA 4AKHA 1G4AE 3GRRA 3FTDA 2QZ4A 1G3IA 4S12A 3TL4X 1SG9A 2B3TA 4L6V6 3C3DA 3DOAA 1JR3E 4B7HA 2F5QA 3HJ8A 4LF8M 2HKJA 4GITA 1DGFA 1C7YA 2R65A 1ZQ9A 4CISA 4GIPA 3UMMA 4JI2M 2F5OA 3E9SA 2JA2A 4G4OA 2UXCM 1HJPA 1OIPA 1YE9A 2EKFA 2DHYA 1QZEA 3HHWA 1HT1E 3J81S 1NHGC 2K6BA 2VIIA 2C5RA 3ZCBB 7CATA 1GL6A 2YNMD 1N78A 4GKJM 4IBIA 3BOSA 2KXEA 3GLGA 3GLHA 4MGYE 2RGHA 3U5ZB 2LVOC 3FKEA 1V34A 2KRKA 4XK8F 3SHFA
chains in the Genus database with same CATH topology
5DYIA 4M0WA 4DR7M 4KODA 2FOIC 2Y20A 4PD2A 3FTFA 1KYIA 3HU1A 3U6LA 2L7HA 4LF5M 4D82A 2OQ4A 4BBAA 2AHMA 2L09A 2O5RA 2QP9X 5FTJA 1NY6A 3GLFA 4B7FA 3KOZE 2UXDM 3Q8XA 4QNRA 1XMOM 3KP1E 1OJLA 3OTOM 2A5YB 3HWSA 1D2NA 3WHLA 3HU2A 1DGHA 5C18A 1ZAEA 3M0EA 4P16A 2Y21A 1HR0M 4IBDA 1IY2A 2RGOA 4JXJA 2KZSA 4R3DA 3T1YM 2LH0A 3GLGB 3E4RA 5DYGA 1IBMM 3U60B 5KO3A 3GRUA 4MGKE 4GC9A 4R7GA 3U6QA 3JR4A 3I4YA 3GLFB 3UZUA 4FWHA 4DV2M 3LMMA 2UUBM 1JR3A 2XEPA 1R2YA 3GQ3A 2UUCM 3RGSA 4Z6YA 1DGHB 4JI7M 1Z5CA 3DA1A 4FD2A 4AQYM 5FTKA 3L2AA 4FW9A 4BB9A 3D8LA 3LVWA 3L25A 5IREB 5H37D 1QAMA 2G8LA 4DUZM 4M9ZA 2QPAA 4FVMA 3U6EA 3SAWA 2LXEA 2F5PA 1IXZA 1KSFX 2V1CA 2XH9A 3SARA 2C99A 1QZMA 3HGIA 2KA6B 1GKIA 3SMPA 4IBBA 3MJ5A 1C1KA 3KP0E 3HJQA 3SC3A 5KPZA 2QBYB 2F5SA 4M9SA 4IBKA 2UU9M 1NY5A 4RF1A 4B3TM 2YFQA 8CATA 2Y0TA 1E32A 2XF3A 3U60A 4NRWA 4KHPM 4DR3M 4HL4A 5ITXA 2Z7JA 3VDPA 3A42A 2W82A 2CV2A 3CF0A 3PNVA 1WXQA 3TWMA 4GMQA 3SAVA 5KPRA 1IY0A 1IBLM 3HU3A 4IJEA 3VK8A 1IY1A 4II7A 3HKPA 1IM2A 1XC8A 4MB7A 4TUWA 5EP3A 2DWZB 1PJIA 1ORYB 3RGPA 5IWAM 2M5ZA 2Z3XA 4M0DA 3FUXA 3K2LA 5A2QS 2R45A 3KSXA 3NBIA 1Z59A 4JI5M 2ZAMA 4DV5M 2F5NA 4FWGA 1HQCA 4DV7M 4QOZC 1YSYA 2CHQA 2H1RA 3I4VA 1QYRA 4X65M 2R4JA 3GQ5A 2CHVA 4KLNA 3PFIA 3I51A 3LQRA 3U61A 4AG5A 3FYDA 4GRIA 5EP1A 3GP1A 1QVRA 5C1BA 2XSZD 1L1TA 5IT9S 3KOYE 4LJ5A 4LRTA 3AKZA 4IIWA 2LNHC 1G59A 4ZPXA 3TQSA 1NVMA 4G4RA 2KZUA 4ITQA 3KDSE 5EXSA 1T3TA 2FFJA 4AZFA 4AG6A 3AFHA 4LJ9A 3HHYA 2P5TA 4A3VB 4RNAA 4JI1M 4DV1M 3L28A 1L1ZA 2EA0A 2M60A 3JAMS 4LG2A 3ZH9B 4QHSA 3VFDA 1R6BX 4GH9A 4L78A 1QQWA 5E6JA 4DR4M 1TDHA 3UGJA 3U5ZA 3GPXA 1IN8A 2L7IA 4I5SA 1S3SA 3HHXA 4OVZB 3U6SA 3UJNA 3VKGA 4I4LA 2D7HA 4G4QA 4DR2M 2KW0A 3B9PA 1G8PA 3AOGA 4LF6M 4AKGA 5EJCA 3VLFB 2Q2EB 3U6MA 4B3SM 1HT2E 1W5SA 1IN5A 2XZFA 4LRSA 3GLIB 4LF9M 2G5GX 4XGIA 4L8RC 2QCUA 3CF6E 1Q39A 4JI3M 2CUZA 5LMUM 1E9SA 2V6ZM 3KOWE 1Z6TA 4PDGA 2C9CA 3A46A 4AI6A 1TGUA 1XMQM 2XLJA 4AW4A 2ZM6M 4BLCA 3J27B 3IG8A 5LMNM 3CTWB 2DZNB 2CV1A 2EO2A 3SMSA 1NHWC 4NOOB 3K8ZA 4DR1M 3KOXE 1R2ZA 4DR6M 3AOEC 5ITQA 3LVVA 2UXBM 5IZ7D 1TH2A 1NJFA 3TWKA 4X64M 3GPYA 3U6CA 3R9XB 1XWIA 3SHGB 4LJAA 1GLNA 4DV6M 1KFVA 1MX0A 4WURA 3GQ4A 4OX9M 3QWLA 1IQPA 4M9XA 3L26A 3GLHB 2BJWA 3FTCA 4Z8XA 2Z4RA 5ITTA 1Z5BA 5JI3E 1H6UA 2XSZA 2KRUA 1W5TA 3LQQA 4OVZA 4X62M 3K92A 3SBJA 5FTLA 3VDUA 4I8OA 1XXHB 2CE7A 4YHHM 5EP4A 3QAUA 1FJGM 1QANA 4CGYB 2DWLA 1NNJA 1IN6A 2FE8A 1IN4A 4GC5A 3W0LB 2R18A 1SXJE 3AV0A 3WHKA 4LF7M 2CHGA 3J7AS 1X37A 4LZZA 1IXRC 3RE8A 5KPTA 4DUYM 1K3XA 4FWDA 3CF2A 1GVNA 2L6OA 3PXGA 1K3WA 3MK6A 3W0FA 3SATA 1L8QA 5KQ8A 2F4VM 2XFSA 4LJ8A 1DGGA 1GL7A 1L2CA 4IBJA 3EIHA 4I81A 3MHVC 2DWNA 1NJGA 3J7BA 1SXJD 4IJFA 3GPUA 1Q3BA 2C9OA 4IBEA 4IBFA 4B08A 1XNRM 3GO8A 4NRVA 1R7RA 3T1HM 3U6DA 3ZC7B 3FYCA 1J7KA 4PT5A 2Z4SA 2DXIA 3ILKA 4XBOA 1IXSB 1SXJB 1N75A 3TPZA 3U61B 3DFZA 3M6AA 4QHTA 1NNUC 1YUBA 2CV0A 2ZAOA 2XGNA 4JI6M 1TH3A 2I7PA 4NL4H 4B7GA 1E94E 2KEBA 2X49A 4JI8M 1HNWM 4RF0A 1I94M 3FUUA 1PM5A 3HJSA 4G6ZA 4IBGA 1XNQM 3AL0C 4GHLA 4L16A 4LJ6A 2YQZA 2I7NA 1N32M 1DO2A 4X66M 1NSFA 1HQYE 2ZANA 4JN6A 1IBKM 3J2PB 1MU5A 1OFIA 5EXXA 3JR5A 2CEAA 3THGA 5ITYA 1N77A 2OPFA 2DWMA 1IN7A 4LFBM 1SXJA 3FUTA 2FNAA 5FLXS 1I4WA 1QAQA 4OU7A 1TDZA 5FTNA 4LCBA 1UM8A 3C58A 2D7EA 2QBYA 2X4AA 5F3WA 2J7OA 4B3RM 3TE6A 2HCBA 1G41A 3K1JA 3D8BA 2BNKA 4LFCM 3KW6A 1N33M 3PNYA 2HL7A 3GRYA 4LFAM 1EE8A 4W5WA 4EIWA 4LZJA 1JQJC 2ERCA 5EQTA 2NQ8C 1PJJA 5EXPA 2R46A 4NSRA 3H4MA 2X8AA 4D81A 3GPPA 4LJ7A 2VQFM 2E5LM 5DNYA 3FTEA 4LF4M 4DR5M 4D80A 4B3MM 4JI4M 4L4UA 3HHZA 3GLIA 2UUAM 3PVSA 2R62A 3UK6A 3KS8A 3GRVA 3DZDA 4L15A 1N36M 3KVWA 3NWLA 4MGIE 3RFWA 4KO8A 3KSJA 4QOSA 1VDDA 3T38A 4NXMM 2J7NA 3SYKA 1TH4A 3A98B 1Q3CA 2DZOB 1K82A 2V1UA 4MM3B 3VKHA 2LWXA 4QNMA 1Z5AA 3FD9A 4IBCA 2XZUA 2Y0QA 1SXJC 5BPVA 5FTMA 2DVWB 4LGMA 4NSOB 4LGYA 5EP2A 4FCVA 3A45A 4JI0M 4GKKM 4G4NA 3AOEA 4DV4M 2HHHM 1QAOA 1J09A 5EXTA 1FNNA 1XXHA 2BJVA 5GKNA 3U6OA 3U6PA 4JYAM 5ITUA 1HNZM 4LY6A 3KFUG 2YR0A 1OFHA 4PCZA 2K47A 2CFOA 2ZBKB 4MH0E 4WW0A 3FUWA 4AKIA 5KQDA 1XHBA 3FUVA 3EIEA 1E9RA 4CHTB 4REZA 4FCTA 4DV0M 3J80S 4YY3M 2C96A 3SYLA 4NXNM 3SAUA 3KXEC 3IG5A 5E26A 5FSWA 4OW0A 2DHRA 3SASA 4LJ4A 3L29A 3L27A 3KS4A 1LV7A 4MGZE 4PDIA 2C98A 4FCWA 1L2DA 2XFTA 3SFZA 4JV5M 2VQEM 4K0KM 5ITRA 1J5EM 4MGHA 3AJIB 1N34M 1DO0A 5ITXE 4DV3M 2EUCA 1L2BA 4GHAA 5JI2E 1HNXM 3TWLA 5BR8M 3R8FA 2RKOA 1JR3D 2R4EA 2QENA 1DGBA 3M7GA 3VK7A 4HLQA 2D7GA 3T15A 4AKHA 1G4AE 3GRRA 3FTDA 2QZ4A 1G3IA 4S12A 3TL4X 3DOAA 4B7HA 2F5QA 3HJ8A 4LF8M 2HKJA 4GITA 1DGFA 2R65A 1ZQ9A 4CISA 4GIPA 3UMMA 4JI2M 2F5OA 3E9SA 2JA2A 4G4OA 2UXCM 1YE9A 3HHWA 1HT1E 3J81S 1NHGC 2VIIA 2C5RA 3ZCBB 7CATA 1GL6A 2YNMD 1N78A 4GKJM 4IBIA 3BOSA 2KXEA 3GLGA 3GLHA 4MGYE 2RGHA 3U5ZB 3FKEA 2KRKA 3SHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7H A;  2DWN A;  2D7G A;  2DWL A;  4NL4 H;  2DWM A;  2D7E A; 
#chains in the Genus database with same CATH topology
 5DYI A;  4M0W A;  4DR7 M;  4KOD A;  2FOI C;  2Y20 A;  4PD2 A;  3FTF A;  1KYI A;  3K9P A;  3HU1 A;  1D0M A;  2EKK A;  1PGY A;  1ZMW A;  4F2L A;  3U6L A;  3MMP A;  1G71 A;  2FH0 A;  2L7H A;  2DKL A;  4LF5 M;  4D82 A;  2OQ4 A;  1GO5 A;  1JB0 F;  4BBA A;  2AHM A;  2L09 A;  2O5R A;  2QP9 X;  5FTJ A;  2KHH A;  1NY6 A;  3IEC A;  3GLF A;  4B7F A;  3KOZ E;  2UXD M;  1AIP C;  2LVP C;  3Q8X A;  4QNR A;  1XMO M;  3KP1 E;  1OJL A;  3B89 A;  3OTO M;  2A5Y B;  1UFZ A;  3HWS A;  1D2N A;  3WHL A;  1NO1 A;  3HU2 A;  1DGH A;  5C18 A;  1ZAE A;  3M0E A;  4P16 A;  2Y21 A;  1HR0 M;  2G3Q A;  4IBD A;  1IY2 A;  2RGO A;  4JXJ A;  2KZS A;  4R3D A;  3T1Y M;  2LH0 A;  3GLG B;  3E4R A;  5DYG A;  1IBM M;  3U60 B;  5KO3 A;  3GRU A;  4MGK E;  4GC9 A;  4R7G A;  3U6Q A;  1LTM A;  1F4I A;  1OKS A;  3JR4 A;  3FE3 A;  3I4Y A;  2HWJ A;  3GLF B;  3UZU A;  4FWH A;  4DV2 M;  1WHC A;  3LMM A;  3F92 A;  1JR3 A;  2UUB M;  2XEP A;  2MR9 A;  1R2Y A;  3GQ3 A;  2UUC M;  3RGS A;  1ZMV A;  4Z6Y A;  1EIJ A;  1DGH B;  4JI7 M;  1Z5C A;  3DA1 A;  4FD2 A;  2LBC A;  4AQY M;  5FTK A;  3L2A A;  4FW9 A;  3HX3 A;  4BB9 A;  2QHO B;  3D8L A;  3LVW A;  3L25 A;  1GAB A;  5IRE B;  5H37 D;  1QAM A;  2MGW A;  2G8L A;  3H4J A;  4DUZ M;  4M9Z A;  1VDL A;  2QPA A;  4FVM A;  2DAK A;  3U6E A;  2DEN A;  2LXE A;  3SAW A;  1IXZ A;  1KSF X;  2V1C A;  2XH9 A;  2F5P A;  3SAR A;  2C99 A;  1QZM A;  3HGI A;  3NBX X;  2KA6 B;  1GKI A;  3SMP A;  4IBB A;  3MJ5 A;  1C1K A;  3KP0 E;  1XXH E;  3HJQ A;  3SC3 A;  5KPZ A;  1ZV1 A;  4GEW A;  2QBY B;  2FS1 A;  2VDB B;  2F5S A;  3CGW A;  4M9S A;  1R4G A;  4R71 A;  4IBK A;  3Q8G A;  2UU9 M;  1NY5 A;  4RF1 A;  4B3T M;  1GJT A;  3GLG E;  2YFQ A;  8CAT A;  2Y0T A;  1E32 A;  2XF3 A;  3U60 A;  4NRW A;  4KHP M;  1P3Q Q;  4HL4 A;  5ITX A;  4DR3 M;  2Z7J A;  3VDP A;  3A42 A;  3ZQJ A;  2W82 A;  1DV0 A;  2CV2 A;  5DFL A;  3CF0 A;  3PNV A;  1WXQ A;  3TWM A;  1V92 A;  4GMQ A;  3SAV A;  5KPR A;  1IY0 A;  1Y8G A;  3HU3 A;  4IJE A;  3VK8 A;  1IBL M;  2VF7 A;  1IY1 A;  4II7 A;  3HKP A;  2J5Y A;  2MJ5 B;  1IM2 A;  1XC8 A;  1TTE A;  4MB7 A;  4TUW A;  5EP3 A;  2DWZ B;  1PJI A;  1NV8 A;  4WP2 A;  1ORY B;  3RGP A;  5IWA M;  2M5Z A;  4CIZ A;  2Z3X A;  4M0D A;  3FUX A;  3K2L A;  5A2Q S;  2R45 A;  5L8R F;  2DZL A;  3KSX A;  3NBI A;  1Z59 A;  4JI5 M;  2ZAM A;  4DV5 M;  2F5N A;  4FWG A;  1HQC A;  4DV7 M;  4QOZ C;  1YSY A;  4Y28 F;  2QQ8 A;  2CHQ A;  2H1R A;  3I4V A;  1QYR A;  4X65 M;  2R4J A;  3GQ5 A;  2CHV A;  4KLN A;  3PFI A;  3I51 A;  3LQR A;  3U61 A;  4AG5 A;  3B74 A;  3FYD A;  1EFU B;  3W68 A;  4ANR A;  2DAM A;  2LHC A;  4GRI A;  1IFY A;  5EP1 A;  3GP1 A;  1QVR A;  1WGN A;  5C1B A;  2XSZ D;  1L1T A;  2JY7 A;  5IT9 S;  2MRO B;  3KOY E;  4LJ5 A;  4LRT A;  3AKZ A;  1QUT A;  2DI0 A;  4IIW A;  2LNH C;  1G59 A;  1T6O A;  4ZPX A;  3TQS A;  2QNJ A;  1NVM A;  4G4R A;  2CRU A;  2KZU A;  4ITQ A;  2LVQ D;  3KDS E;  5EXS A;  1T3T A;  2FFJ A;  1R5L A;  4AZF A;  1ZMU A;  4AG6 A;  3AFH A;  4LJ9 A;  3T6P A;  3HHY A;  2P5T A;  2KNZ A;  4A3V B;  4UN2 B;  3I01 M;  4RNA A;  4JI1 M;  4DV1 M;  3L28 A;  1L1Z A;  2EA0 A;  2M60 A;  3JAM S;  1YLA A;  2JZ0 A;  2DNA A;  4LG2 A;  3ZH9 B;  2WSE F;  4QHS A;  1V33 A;  2H5X A;  3VFD A;  1R6B X;  4GH9 A;  4L78 A;  2OO9 A;  1QQW A;  5E6J A;  4DR4 M;  1TDH A;  3UGJ A;  1QDR A;  3U5Z A;  3GPX A;  1IN8 A;  1VEJ A;  3W67 A;  2L7I A;  4I5S A;  1OAI A;  1S3S A;  3HHX A;  4OVZ B;  3U6S A;  3UJN A;  3VKG A;  4I4L A;  2D7H A;  4KT0 F;  4G4Q A;  4DR2 M;  2KW0 A;  2RRU A;  3B9P A;  4P17 A;  1G8P A;  3AOG A;  4LF6 M;  4AKG A;  5EJC A;  1RU3 A;  3VLF B;  2Q2E B;  3U6M A;  4B3S M;  2LVN C;  1HT2 E;  1IN5 A;  1W5S A;  2XZF A;  4LRS A;  3GLI B;  4LF9 M;  2G5G X;  4XGI A;  1D0L A;  4L8R C;  2QCU A;  3CF6 E;  1Q39 A;  4JI3 M;  2CUZ A;  2KNA A;  5LMU M;  1E9S A;  2V6Z M;  3KOW E;  1Z6T A;  4PDG A;  2C9C A;  3A46 A;  4AI6 A;  1WIV A;  1TGU A;  2O01 F;  1XMQ M;  2XLJ A;  3V76 A;  4AW4 A;  2ZM6 M;  3HY5 A;  2CP8 A;  3J27 B;  4BLC A;  3IG8 A;  5LMN M;  3CTW B;  2DZN B;  2CV1 A;  2EO2 A;  3SMS A;  1NHW C;  4NOO B;  3K8Z A;  4DR1 M;  3B7Q A;  3KOX E;  1R2Z A;  4DR6 M;  3AOE C;  5ITQ A;  3LVV A;  2UXB M;  5IZ7 D;  1TH2 A;  1NJF A;  3TWK A;  4X64 M;  3GPY A;  3U6C A;  3I04 M;  3R9X B;  1XWI A;  3QYB A;  4RKU F;  4LJA A;  3E46 A;  1GLN A;  3SHG B;  1VEK A;  4DV6 M;  1KFV A;  1MX0 A;  4WUR A;  3GQ4 A;  4OX9 M;  3QWL A;  1IQP A;  2K9D A;  4M9X A;  3L26 A;  3HZJ A;  3GLH B;  2BJW A;  3FTC A;  4Z8X A;  2Z4R A;  5ITT A;  1Z5B A;  5JI3 E;  1H6U A;  3LCU A;  2XSZ A;  2KRU A;  1W5T A;  3LQQ A;  4OVZ A;  4X62 M;  3K92 A;  2QSF X;  3SBJ A;  2JP7 A;  5FTL A;  3VDU A;  4I8O A;  1XXH B;  2CE7 A;  4YHH M;  5EP4 A;  3QAU A;  2OOB A;  1OAO C;  1QAN A;  1FJG M;  4CGY B;  2DWL A;  1NNJ A;  1IN6 A;  2KDL A;  2KNV A;  2APL A;  2FE8 A;  1IN4 A;  1OQY A;  4GC5 A;  3W0L B;  2R18 A;  1SXJ E;  3AV0 A;  3WHK A;  4LF7 M;  2CHG A;  3J7A S;  1X37 A;  2L2D A;  1IXR C;  4LZZ A;  3RE8 A;  5KPT A;  2JZ1 A;  4DUY M;  1K3X A;  4FWD A;  3CF2 A;  1GVN A;  2L6O A;  4NC6 A;  3PXG A;  1K3W A;  3MK6 A;  3W0F A;  3SAT A;  1L8Q A;  5KQ8 A;  2F4V M;  3B7N A;  2XFS A;  4LJ8 A;  1DGG A;  1GL7 A;  1L2C A;  2Z8Y M;  4IBJ A;  2R6F A;  3EIH A;  2N35 A;  3MHV C;  4I81 A;  1NJG A;  2DWN A;  3J7B A;  1SXJ D;  2R0I A;  4IJF A;  1Q3B A;  2C9O A;  3GPU A;  4IBE A;  4IBF A;  4B08 A;  4CJ6 A;  2EJS A;  1XNR M;  3GO8 A;  4NRV A;  1R7R A;  3T1H M;  3U6D A;  3ZC7 B;  3FYC A;  1J7K A;  3C3E A;  4PT5 A;  2Z4S A;  1AUA A;  1PRB A;  2DXI A;  3ILK A;  2WSC F;  4XBO A;  1IXS B;  1SXJ B;  1N75 A;  3TPZ A;  3U61 B;  3DFZ A;  3M6A A;  4QHT A;  1NNU C;  1YUB A;  2CV0 A;  3BXW A;  2ZAO A;  2XGN A;  4JI6 M;  1TH3 A;  2I7P A;  2L4F A;  4NL4 H;  3K9O A;  1E94 E;  2KEB A;  2X49 A;  4B7G A;  2LVA A;  4JI8 M;  3FRH A;  1HNW M;  4RF0 A;  1I94 M;  3FUU A;  1PM5 A;  3HJS A;  4G6Z A;  4IBG A;  1XNQ M;  3AL0 C;  4GHL A;  4L16 A;  4LJ6 A;  2YQZ A;  2I7N A;  1N32 M;  1DO2 A;  4X66 M;  1NSF A;  1HQY E;  2ZAN A;  4JN6 A;  1IBK M;  3J2P B;  2LTU A;  1MU5 A;  1OFI A;  5EXX A;  3JR5 A;  3GLF E;  2CEA A;  3THG A;  1OTR A;  5ITY A;  3B7Z A;  3E21 A;  1N77 A;  1TF0 B;  2OPF A;  2DWM A;  1IN7 A;  4LFB M;  1IXS A;  1SXJ A;  3FUT A;  2FNA A;  5FLX S;  1I4W A;  1QAQ A;  4OU7 A;  1TDZ A;  1GJS A;  5FTN A;  4LCB A;  1UM8 A;  3C58 A;  2D7E A;  2QBY A;  2K0B X;  2X4A A;  3QYE A;  5F3W A;  2J7O A;  4B3R M;  3TE6 A;  2HCB A;  1G41 A;  3K1J A;  3D8B A;  2BNK A;  4LFC M;  3KW6 A;  1N33 M;  3PNY A;  2WSF F;  2HL7 A;  3GRY A;  4LFA M;  2JY5 A;  1EE8 A;  4W5W A;  4EIW A;  4LZJ A;  1JQJ C;  3GLI E;  2ERC A;  5EQT A;  3LCV B;  2NQ8 C;  1PJJ A;  5EXP A;  1CUK A;  2R46 A;  4NSR A;  3H4M A;  2X8A A;  4HEO A;  4D81 A;  3GPP A;  2LHG A;  4LJ7 A;  2VQF M;  2E5L M;  5DNY A;  3FTE A;  2JUJ A;  1WGL A;  2DAE A;  4LF4 M;  4DR5 M;  4D80 A;  2ZTD A;  4B3M M;  4JI4 M;  4L4U A;  3HHZ A;  3GLI A;  1T43 A;  2UUA M;  1XB2 B;  3PVS A;  2R62 A;  3UK6 A;  3KS8 A;  3GRV A;  3DZD A;  4L15 A;  1N36 M;  3KVW A;  3NWL A;  2VF8 A;  4MGI E;  3RFW A;  4KO8 A;  3KSJ A;  4QOS A;  1VDD A;  3T38 A;  1VEG A;  4NXM M;  2J7N A;  3SYK A;  1TH4 A;  3C9P A;  2GQF A;  3A98 B;  1Q3C A;  2DZO B;  1K82 A;  2V1U A;  4MM3 B;  1OIZ A;  3VKH A;  2LWX A;  1VQ1 A;  2JY6 B;  1PJS A;  4QNM A;  1Z5A A;  3FD9 A;  4IBC A;  2XZU A;  2Y0Q A;  1SXJ C;  5BPV A;  5FTM A;  2DVW B;  4LGM A;  4NSO B;  4LGY A;  2JY8 A;  5EP2 A;  2JWS A;  4FCV A;  3A45 A;  1MN3 A;  1QUS A;  2GNO A;  3GLH E;  1Q02 A;  4JI0 M;  4GKK M;  2HAK A;  4G4N A;  3AOE A;  4DV4 M;  1TR8 A;  2HHH M;  1QAO A;  1J09 A;  2L4E A;  5EXT A;  1FNN A;  1XXH A;  2BJV A;  1BVS A;  2OOA A;  2JXN A;  3IHP A;  5GKN A;  3U6O A;  3U6P A;  4JYA M;  5ITU A;  1HNZ M;  4LY6 A;  3KFU G;  2YR0 A;  1OFH A;  4PCZ A;  2K47 A;  2CFO A;  2ZBK B;  2O25 A;  1WJ7 A;  4MH0 E;  4WW0 A;  1PJQ A;  3FUW A;  4AKI A;  3FRI A;  4DBG B;  5KQD A;  4Q7J A;  1XHB A;  2R44 A;  3FUV A;  3EIE A;  1E9R A;  1MJG M;  4CHT B;  4REZ A;  2MH8 A;  4FCT A;  4DV0 M;  4G3O A;  3J80 S;  4YY3 M;  2C96 A;  1D0K A;  4NXN M;  3SYL A;  3SAU A;  3KXE C;  3IG5 A;  5E26 A;  5FSW A;  1PJT A;  1A5T A;  4OW0 A;  2DHR A;  3SAS A;  4LJ4 A;  3L29 A;  3KS4 A;  3L27 A;  1LV7 A;  4MGZ E;  4PDI A;  2C98 A;  1NV9 A;  2DAG A;  4FCW A;  1L2D A;  2XFT A;  3SFZ A;  4JV5 M;  2VQE M;  4K0K M;  2DAI A;  5ITR A;  1J5E M;  4MGH A;  3AJI B;  2JNH A;  1N34 M;  1VG5 A;  1DO0 A;  5ITX E;  4DV3 M;  2EUC A;  2WZJ A;  1L2B A;  5JI2 E;  1HNX M;  3TWL A;  4GHA A;  5BR8 M;  3R8F A;  2BWB A;  1WR1 B;  2RKO A;  1JR3 D;  2BWE A;  3LW5 F;  2R4E A;  2ZTC A;  2QEN A;  1DGB A;  1QDT A;  2CWB A;  3M7G A;  3VK7 A;  4HLQ A;  2D7G A;  3T15 A;  4F1I A;  3BBZ A;  4AKH A;  1G4A E;  3GRR A;  3FTD A;  2QZ4 A;  1G3I A;  4S12 A;  3TL4 X;  1SG9 A;  2B3T A;  4L6V 6;  3C3D A;  3DOA A;  1JR3 E;  4B7H A;  2F5Q A;  3HJ8 A;  4LF8 M;  2HKJ A;  4GIT A;  1DGF A;  1C7Y A;  2R65 A;  1ZQ9 A;  4CIS A;  4GIP A;  3UMM A;  4JI2 M;  2F5O A;  3E9S A;  2JA2 A;  4G4O A;  2UXC M;  1HJP A;  1OIP A;  1YE9 A;  2EKF A;  2DHY A;  1QZE A;  3HHW A;  1HT1 E;  3J81 S;  1NHG C;  2K6B A;  2VII A;  2C5R A;  3ZCB B;  7CAT A;  1GL6 A;  2YNM D;  1N78 A;  4GKJ M;  4IBI A;  3BOS A;  2KXE A;  3GLG A;  3GLH A;  4MGY E;  2RGH A;  3U5Z B;  2LVO C;  3FKE A;  1V34 A;  2KRK A;  4XK8 F;  3SHF A; 
#chains in the Genus database with same CATH homology
 5DYI A;  4M0W A;  4DR7 M;  4KOD A;  2FOI C;  2Y20 A;  4PD2 A;  3FTF A;  1KYI A;  3HU1 A;  3U6L A;  2L7H A;  4LF5 M;  4D82 A;  2OQ4 A;  4BBA A;  2AHM A;  2L09 A;  2O5R A;  2QP9 X;  5FTJ A;  1NY6 A;  3GLF A;  4B7F A;  3KOZ E;  2UXD M;  3Q8X A;  4QNR A;  1XMO M;  3KP1 E;  1OJL A;  3OTO M;  2A5Y B;  3HWS A;  1D2N A;  3WHL A;  3HU2 A;  1DGH A;  5C18 A;  1ZAE A;  3M0E A;  4P16 A;  2Y21 A;  1HR0 M;  4IBD A;  1IY2 A;  2RGO A;  4JXJ A;  2KZS A;  4R3D A;  3T1Y M;  2LH0 A;  3GLG B;  3E4R A;  5DYG A;  1IBM M;  3U60 B;  5KO3 A;  3GRU A;  4MGK E;  4GC9 A;  4R7G A;  3U6Q A;  3JR4 A;  3I4Y A;  3GLF B;  3UZU A;  4FWH A;  4DV2 M;  3LMM A;  2UUB M;  1JR3 A;  2XEP A;  1R2Y A;  3GQ3 A;  2UUC M;  3RGS A;  4Z6Y A;  1DGH B;  4JI7 M;  1Z5C A;  3DA1 A;  4FD2 A;  4AQY M;  5FTK A;  3L2A A;  4FW9 A;  4BB9 A;  3D8L A;  3LVW A;  3L25 A;  5IRE B;  5H37 D;  1QAM A;  2G8L A;  4DUZ M;  4M9Z A;  2QPA A;  4FVM A;  3U6E A;  3SAW A;  2LXE A;  2F5P A;  1IXZ A;  1KSF X;  2V1C A;  2XH9 A;  3SAR A;  2C99 A;  1QZM A;  3HGI A;  2KA6 B;  1GKI A;  3SMP A;  4IBB A;  3MJ5 A;  1C1K A;  3KP0 E;  3HJQ A;  3SC3 A;  5KPZ A;  2QBY B;  2F5S A;  4M9S A;  4IBK A;  2UU9 M;  1NY5 A;  4RF1 A;  4B3T M;  2YFQ A;  8CAT A;  2Y0T A;  1E32 A;  2XF3 A;  3U60 A;  4NRW A;  4KHP M;  4DR3 M;  4HL4 A;  5ITX A;  2Z7J A;  3VDP A;  3A42 A;  2W82 A;  2CV2 A;  3CF0 A;  3PNV A;  1WXQ A;  3TWM A;  4GMQ A;  3SAV A;  5KPR A;  1IY0 A;  1IBL M;  3HU3 A;  4IJE A;  3VK8 A;  1IY1 A;  4II7 A;  3HKP A;  1IM2 A;  1XC8 A;  4MB7 A;  4TUW A;  5EP3 A;  2DWZ B;  1PJI A;  1ORY B;  3RGP A;  5IWA M;  2M5Z A;  2Z3X A;  4M0D A;  3FUX A;  3K2L A;  5A2Q S;  2R45 A;  3KSX A;  3NBI A;  1Z59 A;  4JI5 M;  2ZAM A;  4DV5 M;  2F5N A;  4FWG A;  1HQC A;  4DV7 M;  4QOZ C;  1YSY A;  2CHQ A;  2H1R A;  3I4V A;  1QYR A;  4X65 M;  2R4J A;  3GQ5 A;  2CHV A;  4KLN A;  3PFI A;  3I51 A;  3LQR A;  3U61 A;  4AG5 A;  3FYD A;  4GRI A;  5EP1 A;  3GP1 A;  1QVR A;  5C1B A;  2XSZ D;  1L1T A;  5IT9 S;  3KOY E;  4LJ5 A;  4LRT A;  3AKZ A;  4IIW A;  2LNH C;  1G59 A;  4ZPX A;  3TQS A;  1NVM A;  4G4R A;  2KZU A;  4ITQ A;  3KDS E;  5EXS A;  1T3T A;  2FFJ A;  4AZF A;  4AG6 A;  3AFH A;  4LJ9 A;  3HHY A;  2P5T A;  4A3V B;  4RNA A;  4JI1 M;  4DV1 M;  3L28 A;  1L1Z A;  2EA0 A;  2M60 A;  3JAM S;  4LG2 A;  3ZH9 B;  4QHS A;  3VFD A;  1R6B X;  4GH9 A;  4L78 A;  1QQW A;  5E6J A;  4DR4 M;  1TDH A;  3UGJ A;  3U5Z A;  3GPX A;  1IN8 A;  2L7I A;  4I5S A;  1S3S A;  3HHX A;  4OVZ B;  3U6S A;  3UJN A;  3VKG A;  4I4L A;  2D7H A;  4G4Q A;  4DR2 M;  2KW0 A;  3B9P A;  1G8P A;  3AOG A;  4LF6 M;  4AKG A;  5EJC A;  3VLF B;  2Q2E B;  3U6M A;  4B3S M;  1HT2 E;  1W5S A;  1IN5 A;  2XZF A;  4LRS A;  3GLI B;  4LF9 M;  2G5G X;  4XGI A;  4L8R C;  2QCU A;  3CF6 E;  1Q39 A;  4JI3 M;  2CUZ A;  5LMU M;  1E9S A;  2V6Z M;  3KOW E;  1Z6T A;  4PDG A;  2C9C A;  3A46 A;  4AI6 A;  1TGU A;  1XMQ M;  2XLJ A;  4AW4 A;  2ZM6 M;  4BLC A;  3J27 B;  3IG8 A;  5LMN M;  3CTW B;  2DZN B;  2CV1 A;  2EO2 A;  3SMS A;  1NHW C;  4NOO B;  3K8Z A;  4DR1 M;  3KOX E;  1R2Z A;  4DR6 M;  3AOE C;  5ITQ A;  3LVV A;  2UXB M;  5IZ7 D;  1TH2 A;  1NJF A;  3TWK A;  4X64 M;  3GPY A;  3U6C A;  3R9X B;  1XWI A;  3SHG B;  4LJA A;  1GLN A;  4DV6 M;  1KFV A;  1MX0 A;  4WUR A;  3GQ4 A;  4OX9 M;  3QWL A;  1IQP A;  4M9X A;  3L26 A;  3GLH B;  2BJW A;  3FTC A;  4Z8X A;  2Z4R A;  5ITT A;  1Z5B A;  5JI3 E;  1H6U A;  2XSZ A;  2KRU A;  1W5T A;  3LQQ A;  4OVZ A;  4X62 M;  3K92 A;  3SBJ A;  5FTL A;  3VDU A;  4I8O A;  1XXH B;  2CE7 A;  4YHH M;  5EP4 A;  3QAU A;  1FJG M;  1QAN A;  4CGY B;  2DWL A;  1NNJ A;  1IN6 A;  2FE8 A;  1IN4 A;  4GC5 A;  3W0L B;  2R18 A;  1SXJ E;  3AV0 A;  3WHK A;  4LF7 M;  2CHG A;  3J7A S;  1X37 A;  4LZZ A;  1IXR C;  3RE8 A;  5KPT A;  4DUY M;  1K3X A;  4FWD A;  3CF2 A;  1GVN A;  2L6O A;  3PXG A;  1K3W A;  3MK6 A;  3W0F A;  3SAT A;  1L8Q A;  5KQ8 A;  2F4V M;  2XFS A;  4LJ8 A;  1DGG A;  1GL7 A;  1L2C A;  4IBJ A;  3EIH A;  4I81 A;  3MHV C;  2DWN A;  1NJG A;  3J7B A;  1SXJ D;  4IJF A;  3GPU A;  1Q3B A;  2C9O A;  4IBE A;  4IBF A;  4B08 A;  1XNR M;  3GO8 A;  4NRV A;  1R7R A;  3T1H M;  3U6D A;  3ZC7 B;  3FYC A;  1J7K A;  4PT5 A;  2Z4S A;  2DXI A;  3ILK A;  4XBO A;  1IXS B;  1SXJ B;  1N75 A;  3TPZ A;  3U61 B;  3DFZ A;  3M6A A;  4QHT A;  1NNU C;  1YUB A;  2CV0 A;  2ZAO A;  2XGN A;  4JI6 M;  1TH3 A;  2I7P A;  4NL4 H;  4B7G A;  1E94 E;  2KEB A;  2X49 A;  4JI8 M;  1HNW M;  4RF0 A;  1I94 M;  3FUU A;  1PM5 A;  3HJS A;  4G6Z A;  4IBG A;  1XNQ M;  3AL0 C;  4GHL A;  4L16 A;  4LJ6 A;  2YQZ A;  2I7N A;  1N32 M;  1DO2 A;  4X66 M;  1NSF A;  1HQY E;  2ZAN A;  4JN6 A;  1IBK M;  3J2P B;  1MU5 A;  1OFI A;  5EXX A;  3JR5 A;  2CEA A;  3THG A;  5ITY A;  1N77 A;  2OPF A;  2DWM A;  1IN7 A;  4LFB M;  1SXJ A;  3FUT A;  2FNA A;  5FLX S;  1I4W A;  1QAQ A;  4OU7 A;  1TDZ A;  5FTN A;  4LCB A;  1UM8 A;  3C58 A;  2D7E A;  2QBY A;  2X4A A;  5F3W A;  2J7O A;  4B3R M;  3TE6 A;  2HCB A;  1G41 A;  3K1J A;  3D8B A;  2BNK A;  4LFC M;  3KW6 A;  1N33 M;  3PNY A;  2HL7 A;  3GRY A;  4LFA M;  1EE8 A;  4W5W A;  4EIW A;  4LZJ A;  1JQJ C;  2ERC A;  5EQT A;  2NQ8 C;  1PJJ A;  5EXP A;  2R46 A;  4NSR A;  3H4M A;  2X8A A;  4D81 A;  3GPP A;  4LJ7 A;  2VQF M;  2E5L M;  5DNY A;  3FTE A;  4LF4 M;  4DR5 M;  4D80 A;  4B3M M;  4JI4 M;  4L4U A;  3HHZ A;  3GLI A;  2UUA M;  3PVS A;  2R62 A;  3UK6 A;  3KS8 A;  3GRV A;  3DZD A;  4L15 A;  1N36 M;  3KVW A;  3NWL A;  4MGI E;  3RFW A;  4KO8 A;  3KSJ A;  4QOS A;  1VDD A;  3T38 A;  4NXM M;  2J7N A;  3SYK A;  1TH4 A;  3A98 B;  1Q3C A;  2DZO B;  1K82 A;  2V1U A;  4MM3 B;  3VKH A;  2LWX A;  4QNM A;  1Z5A A;  3FD9 A;  4IBC A;  2XZU A;  2Y0Q A;  1SXJ C;  5BPV A;  5FTM A;  2DVW B;  4LGM A;  4NSO B;  4LGY A;  5EP2 A;  4FCV A;  3A45 A;  4JI0 M;  4GKK M;  4G4N A;  3AOE A;  4DV4 M;  2HHH M;  1QAO A;  1J09 A;  5EXT A;  1FNN A;  1XXH A;  2BJV A;  5GKN A;  3U6O A;  3U6P A;  4JYA M;  5ITU A;  1HNZ M;  4LY6 A;  3KFU G;  2YR0 A;  1OFH A;  4PCZ A;  2K47 A;  2CFO A;  2ZBK B;  4MH0 E;  4WW0 A;  3FUW A;  4AKI A;  5KQD A;  1XHB A;  3FUV A;  3EIE A;  1E9R A;  4CHT B;  4REZ A;  4FCT A;  4DV0 M;  3J80 S;  4YY3 M;  2C96 A;  3SYL A;  4NXN M;  3SAU A;  3KXE C;  3IG5 A;  5E26 A;  5FSW A;  4OW0 A;  2DHR A;  3SAS A;  4LJ4 A;  3L29 A;  3L27 A;  3KS4 A;  1LV7 A;  4MGZ E;  4PDI A;  2C98 A;  4FCW A;  1L2D A;  2XFT A;  3SFZ A;  4JV5 M;  2VQE M;  4K0K M;  5ITR A;  1J5E M;  4MGH A;  3AJI B;  1N34 M;  1DO0 A;  5ITX E;  4DV3 M;  2EUC A;  1L2B A;  4GHA A;  5JI2 E;  1HNX M;  3TWL A;  5BR8 M;  3R8F A;  2RKO A;  1JR3 D;  2R4E A;  2QEN A;  1DGB A;  3M7G A;  3VK7 A;  4HLQ A;  2D7G A;  3T15 A;  4AKH A;  1G4A E;  3GRR A;  3FTD A;  2QZ4 A;  1G3I A;  4S12 A;  3TL4 X;  3DOA A;  4B7H A;  2F5Q A;  3HJ8 A;  4LF8 M;  2HKJ A;  4GIT A;  1DGF A;  2R65 A;  1ZQ9 A;  4CIS A;  4GIP A;  3UMM A;  4JI2 M;  2F5O A;  3E9S A;  2JA2 A;  4G4O A;  2UXC M;  1YE9 A;  3HHW A;  1HT1 E;  3J81 S;  1NHG C;  2VII A;  2C5R A;  3ZCB B;  7CAT A;  1GL6 A;  2YNM D;  1N78 A;  4GKJ M;  4IBI A;  3BOS A;  2KXE A;  3GLG A;  3GLH A;  4MGY E;  2RGH A;  3U5Z B;  3FKE A;  2KRK A;  3SHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...