2DWNA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 17
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwnA01
2DWMA 2DWNA 2DWLA 2D7HA 4NL4H 2D7GA 2D7EA
chains in the Genus database with same CATH superfamily
5EP1A 3CTWB 3EIEA 4CISA 1OFIA 2D7HA 3HX3A 4CIZA 1E94E 4JN6A 4OX9M 2XEPA 3LW5F 4DR5M 3U6PA 3CF2A 3KDSE 3U61B 2CHVA 2UXCM 4RF1A 3J81S 2BWEA 1GKIA 3GLFE 2R62A 1N75A 2KNVA 1IN7A 4F2LA 1IN8A 1IY0A 3SATA 1W5SA 4B7HA 1QUTA 1L1TA 2K47A 4FD2A 1QAOA 2R44A 5JI3E 4X62M 2LVQD 1NNUC 1TR8A 1RU3A 3B89A 2L6OA 4F1IA 3AV0A 1D2NA 3UGJA 3GLHA 4QNRA 3KXEC 3GLFA 4M9SA 2I7NA 3K8ZA 2QP9X 3JR5A 4DR1M 2CV1A 4JI2M 4JI5M 2UXDM 3AOEA 1BVSA 4B7GA 1J5EM 1AUAA 2X4AA 3RE8A 1CUKA 3FUUA 1G59A 1VDDA 1MN3A 4AKGA 4JI6M 1SXJA 4PDIA 1NY5A 2CRUA 2DWZB 3RFWA 1QUSA 4FWDA 4RKUF 3QYBA 2EJSA 3U60A 2FS1A 3IG8A 4TUWA 4Y28F 2DZLA 4DR4M 4GC9A 4R3DA 3VKGA 4Q7JA 3SARA 1OFHA 2W82A 1QQWA 2Z4RA 4JXJA 4REZA 2OQ4A 2E5LM 2LBCA 3KSXA 2R4JA 2XFSA 4X65M 3D8BA 4JI1M 4GRIA 3GRUA 1FJGM 2B3TA 3L29A 2KXEA 3UK6A 3A46A 3SAWA 5F3WA 2QCUA 4PDGA 2QBYB 4OU7A 1YLAA 4LZZA 1VDLA 1C1KA 5FTNA 3KS8A 3J2PB 3K9PA 3KOWE 3LVWA 2O5RA 4LJ9A 2CHGA 3A98B 3W67A 4XK8F 1WIVA 4L6V6 3F92A 3AOGA 4LRTA 1N34M 1SG9A 2M60A 3GLIB 3MMPA 3LQQA 1K82A 3U6EA 5JI2E 2ZM6M 1WJ7A 1R7RA 3VK7A 2UUCM 5ITUA 2CV0A 3FTCA 1JR3E 2F5PA 2XH9A 1NVMA 2XZFA 1DV0A 1K3WA 2L4EA 4L8RC 1T43A 3U6QA 1N78A 1VEJA 1DGGA 2QBYA 2EKFA 2GNOA 3L27A 2L09A 4PCZA 1KFVA 1IXSB 2C5RA 1L8QA 3FYCA 3VFDA 1DGBA 3DOAA 2ZTDA 2DXIA 5L8RF 2XSZD 2UUAM 1KSFX 1G3IA 1GL7A 4R71A 3GLIA 3BXWA 4I4LA 1IN5A 3DFZA 2CFOA 3K9OA 5DNYA 1ZMVA 4GKJM 4AI6A 1IBLM 2KA6B 4MGIE 4DV0M 1GL6A 2LVNC 2QNJA 3FE3A 2RGHA 4GMQA 2QPAA 3FYDA 1IXZA 1NNJA 3FUXA 4W5WA 3SYKA 2YNMD 4IJFA 3KVWA 1TH3A 1Q39A 4FW9A 4M0DA 3UMMA 2X8AA 3FTFA 2MROB 1Z5CA 4DV1M 4YHHM 2LVOC 1L1ZA 2JUJA 2QENA 1D0KA 2DI0A 3B9PA 1IXRC 3GPYA 2BJVA 5E26A 2XGNA 4JI0M 3C58A 2GQFA 5KO3A 3TL4X 4JV5M 5ITXE 2J5YA 2JP7A 2RRUA 4JI7M 3GRYA 1X37A 3AOEC 3U6LA 1IY2A 3WHKA 5ITRA 2XSZA 4BB9A 3AKZA 4KO8A 2HL7A 2Z4SA 4EIWA 5EP3A 2K9DA 3W68A 3W0FA 3E21A 2KDLA 3H4JA 1Z5AA 2C9OA 3RGSA 1G4AE 4IBCA 2C96A 2C9CA 3SHFA 3TQSA 4GH9A 2ZTCA 1QANA 2KHHA 1N32M 3PFIA 3HHYA 2YQZA 3PNVA 2N35A 3GLHB 3GLFB 4LJ6A 4DUYM 2DHYA 2Y0QA 2G8LA 4OVZA 4LRSA 3TPZA 2VQEM 3SFZA 1QZMA 4ITQA 2FE8A 2LNHC 1Z59A 3L2AA 4MGZE 2P5TA 3U6SA 4DBGB 2F5OA 4IBFA 1VEGA 3DA1A 1SXJB 3GRRA 5EXPA 4AZFA 1J09A 3QWLA 5E6JA 2EA0A 3U60B 2JXNA 2QHOB 2VF7A 3BOSA 4P17A 3PXGA 4ANRA 1PJJA 4GHAA 3KP0E 4DV5M 1NY6A 4LF9M 4B3MM 3NWLA 1PM5A 1R2YA 4LJ4A 1XNQM 4PD2A 1HNZM 5FTLA 1XXHE 1T3TA 4G4NA 2O25A 3L28A 4QNMA 3I01M 2MR9A 4LCBA 1NSFA 1NJGA 1QAQA 2J7NA 4B7FA 5BR8M 2JWSA 4HEOA 4DV6M 1Z5BA 4Z8XA 4JI3M 1PGYA 3GPXA 1HR0M 4K0KM 1XXHA 4LF5M 1NO1A 1IM2A 1AIPC 2FNAA 3TWKA 2LVAA 3FTEA 4GEWA 3U5ZA 3MHVC 3FUVA 1XMOM 1JR3D 2MJ5B 4LJ7A 4OW0A 3HHXA 2V1UA 4A3VB 3J7AS 3LCUA 4JI8M 1PRBA 5EJCA 4IBKA 2H1RA 4JYAM 1HNXM 1Q02A 5FLXS 5A2QS 3THGA 2VIIA 3D8LA 2JZ0A 4LJ5A 3SMSA 3FD9A 1OJLA 2ZANA 3FUWA 4FWGA 2OPFA 2UUBM 1QAMA 2R4EA 1J7KA 2ZAOA 2OO9A 2DENA 2X49A 1HQCA 1OTRA 2L7IA 1KYIA 2Y20A 3HU3A 4L4UA 4D81A 3RGPA 2LH0A 2EUCA 4GC5A 1HNWM 2UXBM 4HLQA 4D80A 3UJNA 5FTJA 1ZV1A 3U6OA 3IG5A 1DO2A 1Q3CA 4ZPXA 1L2DA 3VKHA 1EIJA 2DWMA 3VDUA 2LTUA 3KSJA 1JR3A 3GPUA 4DV7M 3W0LB 2JY6B 3T38A 1LTMA 4I81A 5C18A 2FFJA 2KEBA 3CF0A 3LQRA 2K0BX 2DWLA 3FUTA 4UN2B 2YR0A 2OOAA 3JAMS 2WZJA 2YFQA 4NSOB 4FVMA 4LF4M 1QYRA 2VDBB 2L7HA 3HU1A 4DR2M 2XFTA 1YSYA 4LY6A 4LF7M 1OAOC 2HCBA 1OIZA 3J27B 4LFBM 4LJ8A 2LVPC 2XZUA 3A45A 2JY7A 4G3OA 4LGMA 2DWNA 5IZ7D 1QZEA 2DAMA 8CATA 5EXTA 1IFYA 4IBBA 1MX0A 4M9XA 1XC8A 3FRHA 3LVVA 4L16A 1GABA 4NRVA 5IREB 5KQDA 1E32A 1IBKM 3HHWA 5EQTA 2NQ8C 3I4YA 3U6MA 1MJGM 3H4MA 3I4VA 4Z6YA 5EP2A 2L2DA 2CE7A 4XBOA 1H6UA 4FCWA 4M0WA 4OVZB 4YY3M 1UFZA 2L4FA 3MK6A 3TWLA 3KP1E 3HZJA 1IQPA 2Y0TA 4KT0F 2Z8YM 3SHGB 1SXJC 3ILKA 1Q3BA 1C7YA 5ITXA 3VDPA 4DR3M 3VLFB 2UU9M 5ITYA 4G4QA 1OQYA 4GKKM 4LFCM 1QDTA 3HJSA 4L78A 3TE6A 4NSRA 1TH2A 2H5XA 3SAUA 4DV3M 1GJSA 2JA2A 1K3XA 5EXXA 1G41A 3T6PA 3GLGE 4CGYB 1ZQ9A 3E46A 4I5SA 4DV4M 1YE9A 2EKKA 3CGWA 4IBDA 4LFAM 3HWSA 2XLJA 2JZ1A 1N33M 1VQ1A 1XB2B 5IWAM 1R2ZA 3AJIB 1I4WA 3HJQA 4G4OA 3B7NA 5EP4A 2A5YB 2CV2A 3SAVA 4NRWA 3M7GA 3GLGA 5DFLA 1I94M 1DGHA 1HT2E 2DHRA 1XXHB 3I04M 1MU5A 1E9RA 2FOIC 5DYGA 2BWBA 4LJAA 3U5ZB 4GITA 1L2CA 2RKOA 2KRKA 1R4GA 4B3RM 3K2LA 1S3SA 2G5GX 3SBJA 2O01F 3T15A 1V33A 2HAKA 2C99A 3ZC7B 4FCVA 3A42A 4LF6M 4KHPM 4I8OA 2HHHM 2MGWA 1OIPA 1IN4A 1EE8A 3TWMA 2EO2A 3VK8A 3K92A 4KODA 3ZH9B 3WHLA 4BLCA 3U6DA 1V92A 4QOZC 4MGKE 3J80S 3GLHE 2LWXA 1P3QQ 4IBJA 4LGYA 1VG5A 2JNHA 2ZBKB 1D0MA 1PJIA 1PJSA 4B3SM 5EXSA 1FNNA 3KOYE 2F5NA 3SASA 4WURA 4GIPA 2HWJA 1SXJE 2VQFM 1WHCA 3K1JA 3OTOM 4DV2M 4X66M 5LMNM 1GJTA 1NHWC 1NHGC 2DZNB 4QOSA 3SYLA 1IN6A 3GQ3A 1JB0F 3HY5A 2D7EA 1UM8A 3I51A 4IJEA 3GQ4A 3FKEA 3GQ5A 4P16A 3U61A 3C3EA 4AKHA 1EFUB 1PJQA 4PT5A 4KLNA 4NC6A 2KNZA 1Y8GA 2R6FA 3FRIA 4DR6M 3GRVA 4LG2A 4GHLA 1OAIA 1XWIA 3FTDA 4AG5A 1DGFA 5C1BA 5KQ8A 1WR1B 1D0LA 4HL4A 4NL4H 1E9SA 2LXEA 3NBXX 1ORYB 1TDHA 4RNAA 1G8PA 1WXQA 1W5TA 4G6ZA 4L15A 1XMQM 3U6CA 3KFUG 2BNKA 2D7GA 2ERCA 1TGUA 1QVRA 2DAGA 3B7ZA 7CATA 2APLA 3KOXE 2WSFF 5KPZA 4M9ZA 2F4VM 3KOZE 4WP2A 4AW4A 1JQJC 5BPVA 1QDRA 4R7GA 2LHCA 2R18A 1IY1A 2Z7JA 2AHMA 2R45A 3L25A 1VEKA 1DO0A 2QSFX 1LV7A 1GVNA 1PJTA 2CHQA 3QAUA 4FCTA 5KPRA 3AFHA 3T1YM 3B74A 1R5LA 2I7PA 3B7QA 4FWHA 2DNAA 1NJFA 2KRUA 4IBGA 1GLNA 2J7OA 1IBMM 4B3TM 1NV9A 2VF8A 1WGLA 3E4RA 3KW6A 3MJ5A 3C3DA 3SMPA 4CJ6A 3GLIE 2RGOA 3LCVB 3HGIA 3JR4A 4AQYM 1TF0B 1V34A 2V6ZM 2WSEF 3Q8GA 5FTKA 4RF0A 3R9XB 1G71A 1T6OA 1Z6TA 2JY5A 3C9PA 2Y21A 4QHTA 2F5SA 3IHPA 1ZMWA 2Q2EB 3HJ8A 3AL0C 3EIHA 1YUBA 2CUZA 1NV8A 3IECA 1XHBA 1HJPA 3V76A 1GO5A 1TTEA 2QZ4A 1ZMUA 2CEAA 2ZAMA 5FSWA 1XNRM 3GPPA 1ZAEA 1N77A 1HT1E 3LMMA 3Q8XA 4AG6A 3T1HM 3E9SA 5ITQA 3R8FA 4MGHA 4MM3B 5LMUM 4B08A 3GLGB 2DVWB 2FH0A 2DAIA 1DGHB 2DZOB 4IIWA 4D82A 3J7BA 2XF3A 2JY8A 1IXSA 3DZDA 4NOOB 5KPTA 4LF8M 3UZUA 4S12A 1F4IA 3CF6E 2HKJA 1A5TA 2MH8A 2OOBA 3L26A 2CWBA 2WSCF 4XGIA 1WGNA 3PVSA 1TH4A 3HU2A 4NXNM 3HHZA 4G4RA 2BJWA 4LZJA 2KNAA 2KZSA 5DYIA 5H37D 2M5ZA 2Z3XA 3KS4A 3ZCBB 5ITTA 4DR7M 2DAKA 2F5QA 3NBIA 3HKPA 4MGYE 1HQYE 4IBEA 5FTMA 2LHGA 2QQ8A 4BBAA 4CHTB 4X64M 4DUZM 2R0IA 1TDZA 1L2BA 2K6BA 3M0EA 2R46A 2CP8A 2KZUA 3PNYA 3QYEA 2R65A 3ZQJA 4NXMM 3BBZA 1OKSA 2C98A 1N36M 4MH0E 4QHSA 4IBIA 4MB7A 4JI4M 4WW0A 5IT9S 2V1CA 3M6AA 3SC3A 2DAEA 1R6BX 3GP1A 2DKLA 2G3QA 1SXJD 2KW0A 4AKIA 3GO8A 4II7A 5GKNA
chains in the Genus database with same CATH topology
5EP1A 3CTWB 3EIEA 4CISA 1OFIA 2D7HA 1E94E 4JN6A 4OX9M 2XEPA 4DR5M 3U6PA 3CF2A 3KDSE 3U61B 2CHVA 2UXCM 4RF1A 3J81S 1GKIA 2R62A 1N75A 1IN7A 1IY0A 1IN8A 3SATA 1W5SA 4B7HA 1L1TA 2K47A 4FD2A 1QAOA 5JI3E 4X62M 1NNUC 2L6OA 3UGJA 3AV0A 1D2NA 3GLHA 4QNRA 3KXEC 3GLFA 4M9SA 2I7NA 3K8ZA 2QP9X 3JR5A 4DR1M 2CV1A 4JI2M 4JI5M 2UXDM 3AOEA 1J5EM 4B7GA 2X4AA 3RE8A 3FUUA 1G59A 1VDDA 4AKGA 4JI6M 1SXJA 4PDIA 1NY5A 2DWZB 3RFWA 4FWDA 3U60A 3IG8A 4TUWA 4DR4M 4GC9A 4R3DA 3VKGA 3SARA 1OFHA 2W82A 1QQWA 2Z4RA 4JXJA 4REZA 2OQ4A 2E5LM 3KSXA 2R4JA 2XFSA 4X65M 3D8BA 4JI1M 4GRIA 3GRUA 1FJGM 3L29A 2KXEA 3UK6A 3A46A 3SAWA 5F3WA 2QCUA 4PDGA 2QBYB 4OU7A 4LZZA 1C1KA 5FTNA 3KS8A 3J2PB 3KOWE 3LVWA 4LJ9A 2O5RA 2CHGA 3A98B 3AOGA 4LRTA 1N34M 2M60A 3GLIB 1K82A 3LQQA 3U6EA 5JI2E 2ZM6M 1R7RA 3VK7A 2UUCM 5ITUA 2CV0A 3FTCA 2F5PA 2XH9A 1NVMA 2XZFA 1K3WA 4L8RC 3U6QA 1N78A 1DGGA 2QBYA 3L27A 2L09A 4PCZA 1KFVA 1IXSB 2C5RA 1L8QA 3FYCA 3VFDA 1DGBA 3DOAA 2DXIA 2XSZD 2UUAM 1KSFX 1G3IA 1GL7A 3GLIA 4I4LA 1IN5A 3DFZA 2CFOA 5DNYA 4AI6A 4GKJM 1IBLM 2KA6B 4MGIE 4DV0M 1GL6A 2RGHA 4GMQA 2QPAA 3FYDA 1IXZA 1NNJA 3FUXA 4W5WA 3SYKA 2YNMD 4IJFA 3KVWA 1TH3A 1Q39A 4FW9A 4M0DA 3UMMA 2X8AA 3FTFA 1Z5CA 4DV1M 4YHHM 1L1ZA 2QENA 3B9PA 1IXRC 3GPYA 2BJVA 5E26A 2XGNA 4JI0M 3C58A 5KO3A 3TL4X 4JV5M 5ITXE 4JI7M 3GRYA 1X37A 3AOEC 3U6LA 1IY2A 3WHKA 5ITRA 2XSZA 4BB9A 3AKZA 4KO8A 2HL7A 2Z4SA 4EIWA 5EP3A 3W0FA 1Z5AA 2C9OA 3RGSA 1G4AE 4IBCA 2C96A 2C9CA 3SHFA 3TQSA 4GH9A 1QANA 1N32M 3PFIA 3HHYA 2YQZA 3PNVA 3GLHB 3GLFB 4LJ6A 4DUYM 4OVZA 2Y0QA 2G8LA 3TPZA 4LRSA 2VQEM 3SFZA 1QZMA 4ITQA 2FE8A 2LNHC 1Z59A 3L2AA 4MGZE 2P5TA 3U6SA 2F5OA 4IBFA 3GRRA 3DA1A 1SXJB 5EXPA 4AZFA 1J09A 3QWLA 5E6JA 2EA0A 3U60B 3BOSA 3PXGA 1PJJA 4GHAA 3KP0E 4DV5M 1NY6A 4LF9M 4B3MM 3NWLA 1PM5A 1R2YA 4LJ4A 1XNQM 4PD2A 1HNZM 5FTLA 1T3TA 4G4NA 3L28A 4QNMA 4LCBA 1NSFA 1NJGA 1QAQA 2J7NA 4B7FA 5BR8M 4DV6M 1Z5BA 4Z8XA 4JI3M 3GPXA 1HR0M 4K0KM 1XXHA 4LF5M 1IM2A 2FNAA 3TWKA 3FTEA 3U5ZA 3MHVC 3FUVA 1XMOM 1JR3D 4LJ7A 4OW0A 3HHXA 2V1UA 4A3VB 3J7AS 4JI8M 5EJCA 4IBKA 2H1RA 4JYAM 1HNXM 5FLXS 5A2QS 3THGA 2VIIA 3D8LA 4LJ5A 3SMSA 3FD9A 1OJLA 2ZANA 3FUWA 4FWGA 2OPFA 2UUBM 1QAMA 2R4EA 1J7KA 2ZAOA 2X49A 1HQCA 2L7IA 2Y20A 1KYIA 3HU3A 4L4UA 4D81A 3RGPA 2LH0A 2EUCA 4GC5A 1HNWM 2UXBM 4HLQA 4D80A 3UJNA 5FTJA 3U6OA 3IG5A 1DO2A 1Q3CA 4ZPXA 1L2DA 3VKHA 2DWMA 3VDUA 3KSJA 1JR3A 3GPUA 4DV7M 3W0LB 3T38A 4I81A 5C18A 2FFJA 2KEBA 3CF0A 3LQRA 2DWLA 3FUTA 2YR0A 3JAMS 2YFQA 4NSOB 4FVMA 4LF4M 1QYRA 2L7HA 3HU1A 4DR2M 2XFTA 1YSYA 4LY6A 4LF7M 2HCBA 3J27B 4LFBM 4LJ8A 2XZUA 3A45A 4LGMA 2DWNA 5IZ7D 8CATA 5EXTA 4IBBA 1MX0A 4M9XA 1XC8A 4L16A 3LVVA 4NRVA 5IREB 5KQDA 1E32A 1IBKM 3HHWA 5EQTA 2NQ8C 3I4YA 3U6MA 3H4MA 3I4VA 4Z6YA 5EP2A 2CE7A 4XBOA 1H6UA 4FCWA 4M0WA 4OVZB 4YY3M 3MK6A 3TWLA 3KP1E 1IQPA 2Y0TA 3SHGB 1SXJC 3ILKA 1Q3BA 5ITXA 3VDPA 4DR3M 3VLFB 2UU9M 5ITYA 4G4QA 4GKKM 4LFCM 4L78A 3HJSA 3TE6A 4NSRA 1TH2A 3SAUA 4DV3M 2JA2A 1K3XA 5EXXA 1G41A 4CGYB 1ZQ9A 4I5SA 4DV4M 1YE9A 4IBDA 4LFAM 3HWSA 2XLJA 1N33M 5IWAM 1R2ZA 3AJIB 1I4WA 3HJQA 4G4OA 5EP4A 2A5YB 2CV2A 3SAVA 4NRWA 3M7GA 3GLGA 1I94M 1DGHA 1HT2E 2DHRA 1XXHB 1MU5A 1E9RA 2FOIC 5DYGA 4LJAA 3U5ZB 4GITA 1L2CA 2RKOA 2KRKA 4B3RM 3K2LA 1S3SA 2G5GX 3SBJA 3T15A 2C99A 3ZC7B 4FCVA 3A42A 4LF6M 4KHPM 4I8OA 2HHHM 1IN4A 1EE8A 3TWMA 2EO2A 3VK8A 3K92A 4KODA 3ZH9B 3WHLA 4BLCA 3U6DA 4QOZC 4MGKE 3J80S 2LWXA 4IBJA 4LGYA 2ZBKB 1PJIA 4B3SM 5EXSA 1FNNA 3KOYE 2F5NA 3SASA 4WURA 4GIPA 2VQFM 1SXJE 3K1JA 3OTOM 4DV2M 4X66M 5LMNM 1NHGC 1NHWC 2DZNB 3SYLA 4QOSA 3GQ3A 1IN6A 2D7EA 1UM8A 3I51A 4IJEA 3GQ4A 3FKEA 3GQ5A 4P16A 3U61A 4AKHA 4PT5A 4KLNA 4DR6M 3GRVA 4LG2A 4GHLA 1XWIA 3FTDA 4AG5A 1DGFA 5C1BA 5KQ8A 4HL4A 4NL4H 1E9SA 2LXEA 1ORYB 1TDHA 4RNAA 1G8PA 1WXQA 1W5TA 4G6ZA 4L15A 1XMQM 3U6CA 3KFUG 2BNKA 2D7GA 2ERCA 1TGUA 1QVRA 7CATA 3KOXE 5KPZA 4M9ZA 2F4VM 3KOZE 4AW4A 1JQJC 5BPVA 4R7GA 2R18A 1IY1A 2Z7JA 2AHMA 2R45A 3L25A 1DO0A 1LV7A 1GVNA 2CHQA 3QAUA 4FCTA 5KPRA 3AFHA 3T1YM 4FWHA 2I7PA 4IBGA 1NJFA 2KRUA 1GLNA 2J7OA 1IBMM 4B3TM 3MJ5A 3KW6A 3E4RA 3SMPA 4AQYM 2RGOA 3JR4A 3HGIA 2V6ZM 5FTKA 4RF0A 3R9XB 1Z6TA 2Y21A 4QHTA 2F5SA 2Q2EB 3HJ8A 3AL0C 3EIHA 1YUBA 2CUZA 1XHBA 2QZ4A 2CEAA 2ZAMA 5FSWA 1XNRM 3GPPA 1ZAEA 1N77A 1HT1E 3LMMA 3Q8XA 4AG6A 3T1HM 3E9SA 5ITQA 3R8FA 4MGHA 4MM3B 5LMUM 4B08A 3GLGB 2DVWB 1DGHB 2DZOB 4IIWA 4D82A 3J7BA 2XF3A 4NOOB 3DZDA 5KPTA 4LF8M 3UZUA 4S12A 3CF6E 2HKJA 3L26A 4XGIA 3PVSA 1TH4A 3HU2A 4NXNM 3HHZA 4G4RA 2BJWA 4LZJA 5DYIA 2KZSA 5H37D 2Z3XA 2M5ZA 3KS4A 3ZCBB 5ITTA 4DR7M 2F5QA 3NBIA 3HKPA 4MGYE 1HQYE 4IBEA 5FTMA 4CHTB 4X64M 4BBAA 4DUZM 1TDZA 1L2BA 3M0EA 2R46A 2KZUA 3PNYA 4NXMM 2R65A 2C98A 1N36M 4MH0E 4QHSA 4IBIA 4MB7A 4JI4M 4WW0A 5IT9S 2V1CA 3M6AA 3SC3A 3GP1A 1R6BX 1SXJD 2KW0A 4AKIA 3GO8A 4II7A 5GKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWM A;  2DWN A;  2DWL A;  2D7H A;  4NL4 H;  2D7G A;  2D7E A; 
#chains in the Genus database with same CATH topology
 5EP1 A;  3CTW B;  3EIE A;  4CIS A;  1OFI A;  2D7H A;  3HX3 A;  4CIZ A;  1E94 E;  4JN6 A;  4OX9 M;  2XEP A;  3LW5 F;  4DR5 M;  3U6P A;  3CF2 A;  3KDS E;  3U61 B;  2CHV A;  2UXC M;  4RF1 A;  3J81 S;  2BWE A;  1GKI A;  3GLF E;  2R62 A;  1N75 A;  2KNV A;  1IN7 A;  4F2L A;  1IN8 A;  1IY0 A;  3SAT A;  1W5S A;  4B7H A;  1QUT A;  1L1T A;  2K47 A;  4FD2 A;  1QAO A;  2R44 A;  5JI3 E;  4X62 M;  2LVQ D;  1NNU C;  1TR8 A;  1RU3 A;  3B89 A;  2L6O A;  4F1I A;  3AV0 A;  1D2N A;  3UGJ A;  3GLH A;  4QNR A;  3KXE C;  3GLF A;  4M9S A;  2I7N A;  3K8Z A;  2QP9 X;  3JR5 A;  4DR1 M;  2CV1 A;  4JI2 M;  4JI5 M;  2UXD M;  3AOE A;  1BVS A;  4B7G A;  1J5E M;  1AUA A;  2X4A A;  3RE8 A;  1CUK A;  3FUU A;  1G59 A;  1VDD A;  1MN3 A;  4AKG A;  4JI6 M;  1SXJ A;  4PDI A;  1NY5 A;  2CRU A;  2DWZ B;  3RFW A;  1QUS A;  4FWD A;  4RKU F;  3QYB A;  2EJS A;  3U60 A;  2FS1 A;  3IG8 A;  4TUW A;  4Y28 F;  2DZL A;  4DR4 M;  4GC9 A;  4R3D A;  3VKG A;  4Q7J A;  3SAR A;  1OFH A;  2W82 A;  1QQW A;  2Z4R A;  4JXJ A;  4REZ A;  2OQ4 A;  2E5L M;  2LBC A;  3KSX A;  2R4J A;  2XFS A;  4X65 M;  3D8B A;  4JI1 M;  4GRI A;  3GRU A;  1FJG M;  2B3T A;  3L29 A;  2KXE A;  3UK6 A;  3A46 A;  3SAW A;  5F3W A;  2QCU A;  4PDG A;  2QBY B;  4OU7 A;  1YLA A;  4LZZ A;  1VDL A;  1C1K A;  5FTN A;  3KS8 A;  3J2P B;  3K9P A;  3KOW E;  3LVW A;  2O5R A;  4LJ9 A;  2CHG A;  3A98 B;  3W67 A;  4XK8 F;  1WIV A;  4L6V 6;  3F92 A;  3AOG A;  4LRT A;  1N34 M;  1SG9 A;  2M60 A;  3GLI B;  3MMP A;  3LQQ A;  1K82 A;  3U6E A;  5JI2 E;  2ZM6 M;  1WJ7 A;  1R7R A;  3VK7 A;  2UUC M;  5ITU A;  2CV0 A;  3FTC A;  1JR3 E;  2F5P A;  2XH9 A;  1NVM A;  2XZF A;  1DV0 A;  1K3W A;  2L4E A;  4L8R C;  1T43 A;  3U6Q A;  1N78 A;  1VEJ A;  1DGG A;  2QBY A;  2EKF A;  2GNO A;  3L27 A;  2L09 A;  4PCZ A;  1KFV A;  1IXS B;  2C5R A;  1L8Q A;  3FYC A;  3VFD A;  1DGB A;  3DOA A;  2ZTD A;  2DXI A;  5L8R F;  2XSZ D;  2UUA M;  1KSF X;  1G3I A;  1GL7 A;  4R71 A;  3GLI A;  3BXW A;  4I4L A;  1IN5 A;  3DFZ A;  2CFO A;  3K9O A;  5DNY A;  1ZMV A;  4GKJ M;  4AI6 A;  1IBL M;  2KA6 B;  4MGI E;  4DV0 M;  1GL6 A;  2LVN C;  2QNJ A;  3FE3 A;  2RGH A;  4GMQ A;  2QPA A;  3FYD A;  1IXZ A;  1NNJ A;  3FUX A;  4W5W A;  3SYK A;  2YNM D;  4IJF A;  3KVW A;  1TH3 A;  1Q39 A;  4FW9 A;  4M0D A;  3UMM A;  2X8A A;  3FTF A;  2MRO B;  1Z5C A;  4DV1 M;  4YHH M;  2LVO C;  1L1Z A;  2JUJ A;  2QEN A;  1D0K A;  2DI0 A;  3B9P A;  1IXR C;  3GPY A;  2BJV A;  5E26 A;  2XGN A;  4JI0 M;  3C58 A;  2GQF A;  5KO3 A;  3TL4 X;  4JV5 M;  5ITX E;  2J5Y A;  2JP7 A;  2RRU A;  4JI7 M;  3GRY A;  1X37 A;  3AOE C;  3U6L A;  1IY2 A;  3WHK A;  5ITR A;  2XSZ A;  4BB9 A;  3AKZ A;  4KO8 A;  2HL7 A;  2Z4S A;  4EIW A;  5EP3 A;  2K9D A;  3W68 A;  3W0F A;  3E21 A;  2KDL A;  3H4J A;  1Z5A A;  2C9O A;  3RGS A;  1G4A E;  4IBC A;  2C96 A;  2C9C A;  3SHF A;  3TQS A;  4GH9 A;  2ZTC A;  1QAN A;  2KHH A;  1N32 M;  3PFI A;  3HHY A;  2YQZ A;  3PNV A;  2N35 A;  3GLH B;  3GLF B;  4LJ6 A;  4DUY M;  2DHY A;  2Y0Q A;  2G8L A;  4OVZ A;  4LRS A;  3TPZ A;  2VQE M;  3SFZ A;  1QZM A;  4ITQ A;  2FE8 A;  2LNH C;  1Z59 A;  3L2A A;  4MGZ E;  2P5T A;  3U6S A;  4DBG B;  2F5O A;  4IBF A;  1VEG A;  3DA1 A;  1SXJ B;  3GRR A;  5EXP A;  4AZF A;  1J09 A;  3QWL A;  5E6J A;  2EA0 A;  3U60 B;  2JXN A;  2QHO B;  2VF7 A;  3BOS A;  4P17 A;  3PXG A;  4ANR A;  1PJJ A;  4GHA A;  3KP0 E;  4DV5 M;  1NY6 A;  4LF9 M;  4B3M M;  3NWL A;  1PM5 A;  1R2Y A;  4LJ4 A;  1XNQ M;  4PD2 A;  1HNZ M;  5FTL A;  1XXH E;  1T3T A;  4G4N A;  2O25 A;  3L28 A;  4QNM A;  3I01 M;  2MR9 A;  4LCB A;  1NSF A;  1NJG A;  1QAQ A;  2J7N A;  4B7F A;  5BR8 M;  2JWS A;  4HEO A;  4DV6 M;  1Z5B A;  4Z8X A;  4JI3 M;  1PGY A;  3GPX A;  1HR0 M;  4K0K M;  1XXH A;  4LF5 M;  1NO1 A;  1IM2 A;  1AIP C;  2FNA A;  3TWK A;  2LVA A;  3FTE A;  4GEW A;  3U5Z A;  3MHV C;  3FUV A;  1XMO M;  1JR3 D;  2MJ5 B;  4LJ7 A;  4OW0 A;  3HHX A;  2V1U A;  4A3V B;  3J7A S;  3LCU A;  4JI8 M;  1PRB A;  5EJC A;  4IBK A;  2H1R A;  4JYA M;  1HNX M;  1Q02 A;  5FLX S;  5A2Q S;  3THG A;  2VII A;  3D8L A;  2JZ0 A;  4LJ5 A;  3SMS A;  3FD9 A;  1OJL A;  2ZAN A;  3FUW A;  4FWG A;  2OPF A;  2UUB M;  1QAM A;  2R4E A;  1J7K A;  2ZAO A;  2OO9 A;  2DEN A;  2X49 A;  1HQC A;  1OTR A;  2L7I A;  1KYI A;  2Y20 A;  3HU3 A;  4L4U A;  4D81 A;  3RGP A;  2LH0 A;  2EUC A;  4GC5 A;  1HNW M;  2UXB M;  4HLQ A;  4D80 A;  3UJN A;  5FTJ A;  1ZV1 A;  3U6O A;  3IG5 A;  1DO2 A;  1Q3C A;  4ZPX A;  1L2D A;  3VKH A;  1EIJ A;  2DWM A;  3VDU A;  2LTU A;  3KSJ A;  1JR3 A;  3GPU A;  4DV7 M;  3W0L B;  2JY6 B;  3T38 A;  1LTM A;  4I81 A;  5C18 A;  2FFJ A;  2KEB A;  3CF0 A;  3LQR A;  2K0B X;  2DWL A;  3FUT A;  4UN2 B;  2YR0 A;  2OOA A;  3JAM S;  2WZJ A;  2YFQ A;  4NSO B;  4FVM A;  4LF4 M;  1QYR A;  2VDB B;  2L7H A;  3HU1 A;  4DR2 M;  2XFT A;  1YSY A;  4LY6 A;  4LF7 M;  1OAO C;  2HCB A;  1OIZ A;  3J27 B;  4LFB M;  4LJ8 A;  2LVP C;  2XZU A;  3A45 A;  2JY7 A;  4G3O A;  4LGM A;  2DWN A;  5IZ7 D;  1QZE A;  2DAM A;  8CAT A;  5EXT A;  1IFY A;  4IBB A;  1MX0 A;  4M9X A;  1XC8 A;  3FRH A;  3LVV A;  4L16 A;  1GAB A;  4NRV A;  5IRE B;  5KQD A;  1E32 A;  1IBK M;  3HHW A;  5EQT A;  2NQ8 C;  3I4Y A;  3U6M A;  1MJG M;  3H4M A;  3I4V A;  4Z6Y A;  5EP2 A;  2L2D A;  2CE7 A;  4XBO A;  1H6U A;  4FCW A;  4M0W A;  4OVZ B;  4YY3 M;  1UFZ A;  2L4F A;  3MK6 A;  3TWL A;  3KP1 E;  3HZJ A;  1IQP A;  2Y0T A;  4KT0 F;  2Z8Y M;  3SHG B;  1SXJ C;  3ILK A;  1Q3B A;  1C7Y A;  5ITX A;  3VDP A;  4DR3 M;  3VLF B;  2UU9 M;  5ITY A;  4G4Q A;  1OQY A;  4GKK M;  4LFC M;  1QDT A;  3HJS A;  4L78 A;  3TE6 A;  4NSR A;  1TH2 A;  2H5X A;  3SAU A;  4DV3 M;  1GJS A;  2JA2 A;  1K3X A;  5EXX A;  1G41 A;  3T6P A;  3GLG E;  4CGY B;  1ZQ9 A;  3E46 A;  4I5S A;  4DV4 M;  1YE9 A;  2EKK A;  3CGW A;  4IBD A;  4LFA M;  3HWS A;  2XLJ A;  2JZ1 A;  1N33 M;  1VQ1 A;  1XB2 B;  5IWA M;  1R2Z A;  3AJI B;  1I4W A;  3HJQ A;  4G4O A;  3B7N A;  5EP4 A;  2A5Y B;  2CV2 A;  3SAV A;  4NRW A;  3M7G A;  3GLG A;  5DFL A;  1I94 M;  1DGH A;  1HT2 E;  2DHR A;  1XXH B;  3I04 M;  1MU5 A;  1E9R A;  2FOI C;  5DYG A;  2BWB A;  4LJA A;  3U5Z B;  4GIT A;  1L2C A;  2RKO A;  2KRK A;  1R4G A;  4B3R M;  3K2L A;  1S3S A;  2G5G X;  3SBJ A;  2O01 F;  3T15 A;  1V33 A;  2HAK A;  2C99 A;  3ZC7 B;  4FCV A;  3A42 A;  4LF6 M;  4KHP M;  4I8O A;  2HHH M;  2MGW A;  1OIP A;  1IN4 A;  1EE8 A;  3TWM A;  2EO2 A;  3VK8 A;  3K92 A;  4KOD A;  3ZH9 B;  3WHL A;  4BLC A;  3U6D A;  1V92 A;  4QOZ C;  4MGK E;  3J80 S;  3GLH E;  2LWX A;  1P3Q Q;  4IBJ A;  4LGY A;  1VG5 A;  2JNH A;  2ZBK B;  1D0M A;  1PJI A;  1PJS A;  4B3S M;  5EXS A;  1FNN A;  3KOY E;  2F5N A;  3SAS A;  4WUR A;  4GIP A;  2HWJ A;  1SXJ E;  2VQF M;  1WHC A;  3K1J A;  3OTO M;  4DV2 M;  4X66 M;  5LMN M;  1GJT A;  1NHW C;  1NHG C;  2DZN B;  4QOS A;  3SYL A;  1IN6 A;  3GQ3 A;  1JB0 F;  3HY5 A;  2D7E A;  1UM8 A;  3I51 A;  4IJE A;  3GQ4 A;  3FKE A;  3GQ5 A;  4P16 A;  3U61 A;  3C3E A;  4AKH A;  1EFU B;  1PJQ A;  4PT5 A;  4KLN A;  4NC6 A;  2KNZ A;  1Y8G A;  2R6F A;  3FRI A;  4DR6 M;  3GRV A;  4LG2 A;  4GHL A;  1OAI A;  1XWI A;  3FTD A;  4AG5 A;  1DGF A;  5C1B A;  5KQ8 A;  1WR1 B;  1D0L A;  4HL4 A;  4NL4 H;  1E9S A;  2LXE A;  3NBX X;  1ORY B;  1TDH A;  4RNA A;  1G8P A;  1WXQ A;  1W5T A;  4G6Z A;  4L15 A;  1XMQ M;  3U6C A;  3KFU G;  2BNK A;  2D7G A;  2ERC A;  1TGU A;  1QVR A;  2DAG A;  3B7Z A;  7CAT A;  2APL A;  3KOX E;  2WSF F;  5KPZ A;  4M9Z A;  2F4V M;  3KOZ E;  4WP2 A;  4AW4 A;  1JQJ C;  5BPV A;  1QDR A;  4R7G A;  2LHC A;  2R18 A;  1IY1 A;  2Z7J A;  2AHM A;  2R45 A;  3L25 A;  1VEK A;  1DO0 A;  2QSF X;  1LV7 A;  1GVN A;  1PJT A;  2CHQ A;  3QAU A;  4FCT A;  5KPR A;  3AFH A;  3T1Y M;  3B74 A;  1R5L A;  2I7P A;  3B7Q A;  4FWH A;  2DNA A;  1NJF A;  2KRU A;  4IBG A;  1GLN A;  2J7O A;  1IBM M;  4B3T M;  1NV9 A;  2VF8 A;  1WGL A;  3E4R A;  3KW6 A;  3MJ5 A;  3C3D A;  3SMP A;  4CJ6 A;  3GLI E;  2RGO A;  3LCV B;  3HGI A;  3JR4 A;  4AQY M;  1TF0 B;  1V34 A;  2V6Z M;  2WSE F;  3Q8G A;  5FTK A;  4RF0 A;  3R9X B;  1G71 A;  1T6O A;  1Z6T A;  2JY5 A;  3C9P A;  2Y21 A;  4QHT A;  2F5S A;  3IHP A;  1ZMW A;  2Q2E B;  3HJ8 A;  3AL0 C;  3EIH A;  1YUB A;  2CUZ A;  1NV8 A;  3IEC A;  1XHB A;  1HJP A;  3V76 A;  1GO5 A;  1TTE A;  2QZ4 A;  1ZMU A;  2CEA A;  2ZAM A;  5FSW A;  1XNR M;  3GPP A;  1ZAE A;  1N77 A;  1HT1 E;  3LMM A;  3Q8X A;  4AG6 A;  3T1H M;  3E9S A;  5ITQ A;  3R8F A;  4MGH A;  4MM3 B;  5LMU M;  4B08 A;  3GLG B;  2DVW B;  2FH0 A;  2DAI A;  1DGH B;  2DZO B;  4IIW A;  4D82 A;  3J7B A;  2XF3 A;  2JY8 A;  1IXS A;  3DZD A;  4NOO B;  5KPT A;  4LF8 M;  3UZU A;  4S12 A;  1F4I A;  3CF6 E;  2HKJ A;  1A5T A;  2MH8 A;  2OOB A;  3L26 A;  2CWB A;  2WSC F;  4XGI A;  1WGN A;  3PVS A;  1TH4 A;  3HU2 A;  4NXN M;  3HHZ A;  4G4R A;  2BJW A;  4LZJ A;  2KNA A;  2KZS A;  5DYI A;  5H37 D;  2M5Z A;  2Z3X A;  3KS4 A;  3ZCB B;  5ITT A;  4DR7 M;  2DAK A;  2F5Q A;  3NBI A;  3HKP A;  4MGY E;  1HQY E;  4IBE A;  5FTM A;  2LHG A;  2QQ8 A;  4BBA A;  4CHT B;  4X64 M;  4DUZ M;  2R0I A;  1TDZ A;  1L2B A;  2K6B A;  3M0E A;  2R46 A;  2CP8 A;  2KZU A;  3PNY A;  3QYE A;  2R65 A;  3ZQJ A;  4NXM M;  3BBZ A;  1OKS A;  2C98 A;  1N36 M;  4MH0 E;  4QHS A;  4IBI A;  4MB7 A;  4JI4 M;  4WW0 A;  5IT9 S;  2V1C A;  3M6A A;  3SC3 A;  2DAE A;  1R6B X;  3GP1 A;  2DKL A;  2G3Q A;  1SXJ D;  2KW0 A;  4AKI A;  3GO8 A;  4II7 A;  5GKN A; 
#chains in the Genus database with same CATH homology
 5EP1 A;  3CTW B;  3EIE A;  4CIS A;  1OFI A;  2D7H A;  1E94 E;  4JN6 A;  4OX9 M;  2XEP A;  4DR5 M;  3U6P A;  3CF2 A;  3KDS E;  3U61 B;  2CHV A;  2UXC M;  4RF1 A;  3J81 S;  1GKI A;  2R62 A;  1N75 A;  1IN7 A;  1IY0 A;  1IN8 A;  3SAT A;  1W5S A;  4B7H A;  1L1T A;  2K47 A;  4FD2 A;  1QAO A;  5JI3 E;  4X62 M;  1NNU C;  2L6O A;  3UGJ A;  3AV0 A;  1D2N A;  3GLH A;  4QNR A;  3KXE C;  3GLF A;  4M9S A;  2I7N A;  3K8Z A;  2QP9 X;  3JR5 A;  4DR1 M;  2CV1 A;  4JI2 M;  4JI5 M;  2UXD M;  3AOE A;  1J5E M;  4B7G A;  2X4A A;  3RE8 A;  3FUU A;  1G59 A;  1VDD A;  4AKG A;  4JI6 M;  1SXJ A;  4PDI A;  1NY5 A;  2DWZ B;  3RFW A;  4FWD A;  3U60 A;  3IG8 A;  4TUW A;  4DR4 M;  4GC9 A;  4R3D A;  3VKG A;  3SAR A;  1OFH A;  2W82 A;  1QQW A;  2Z4R A;  4JXJ A;  4REZ A;  2OQ4 A;  2E5L M;  3KSX A;  2R4J A;  2XFS A;  4X65 M;  3D8B A;  4JI1 M;  4GRI A;  3GRU A;  1FJG M;  3L29 A;  2KXE A;  3UK6 A;  3A46 A;  3SAW A;  5F3W A;  2QCU A;  4PDG A;  2QBY B;  4OU7 A;  4LZZ A;  1C1K A;  5FTN A;  3KS8 A;  3J2P B;  3KOW E;  3LVW A;  4LJ9 A;  2O5R A;  2CHG A;  3A98 B;  3AOG A;  4LRT A;  1N34 M;  2M60 A;  3GLI B;  1K82 A;  3LQQ A;  3U6E A;  5JI2 E;  2ZM6 M;  1R7R A;  3VK7 A;  2UUC M;  5ITU A;  2CV0 A;  3FTC A;  2F5P A;  2XH9 A;  1NVM A;  2XZF A;  1K3W A;  4L8R C;  3U6Q A;  1N78 A;  1DGG A;  2QBY A;  3L27 A;  2L09 A;  4PCZ A;  1KFV A;  1IXS B;  2C5R A;  1L8Q A;  3FYC A;  3VFD A;  1DGB A;  3DOA A;  2DXI A;  2XSZ D;  2UUA M;  1KSF X;  1G3I A;  1GL7 A;  3GLI A;  4I4L A;  1IN5 A;  3DFZ A;  2CFO A;  5DNY A;  4AI6 A;  4GKJ M;  1IBL M;  2KA6 B;  4MGI E;  4DV0 M;  1GL6 A;  2RGH A;  4GMQ A;  2QPA A;  3FYD A;  1IXZ A;  1NNJ A;  3FUX A;  4W5W A;  3SYK A;  2YNM D;  4IJF A;  3KVW A;  1TH3 A;  1Q39 A;  4FW9 A;  4M0D A;  3UMM A;  2X8A A;  3FTF A;  1Z5C A;  4DV1 M;  4YHH M;  1L1Z A;  2QEN A;  3B9P A;  1IXR C;  3GPY A;  2BJV A;  5E26 A;  2XGN A;  4JI0 M;  3C58 A;  5KO3 A;  3TL4 X;  4JV5 M;  5ITX E;  4JI7 M;  3GRY A;  1X37 A;  3AOE C;  3U6L A;  1IY2 A;  3WHK A;  5ITR A;  2XSZ A;  4BB9 A;  3AKZ A;  4KO8 A;  2HL7 A;  2Z4S A;  4EIW A;  5EP3 A;  3W0F A;  1Z5A A;  2C9O A;  3RGS A;  1G4A E;  4IBC A;  2C96 A;  2C9C A;  3SHF A;  3TQS A;  4GH9 A;  1QAN A;  1N32 M;  3PFI A;  3HHY A;  2YQZ A;  3PNV A;  3GLH B;  3GLF B;  4LJ6 A;  4DUY M;  4OVZ A;  2Y0Q A;  2G8L A;  3TPZ A;  4LRS A;  2VQE M;  3SFZ A;  1QZM A;  4ITQ A;  2FE8 A;  2LNH C;  1Z59 A;  3L2A A;  4MGZ E;  2P5T A;  3U6S A;  2F5O A;  4IBF A;  3GRR A;  3DA1 A;  1SXJ B;  5EXP A;  4AZF A;  1J09 A;  3QWL A;  5E6J A;  2EA0 A;  3U60 B;  3BOS A;  3PXG A;  1PJJ A;  4GHA A;  3KP0 E;  4DV5 M;  1NY6 A;  4LF9 M;  4B3M M;  3NWL A;  1PM5 A;  1R2Y A;  4LJ4 A;  1XNQ M;  4PD2 A;  1HNZ M;  5FTL A;  1T3T A;  4G4N A;  3L28 A;  4QNM A;  4LCB A;  1NSF A;  1NJG A;  1QAQ A;  2J7N A;  4B7F A;  5BR8 M;  4DV6 M;  1Z5B A;  4Z8X A;  4JI3 M;  3GPX A;  1HR0 M;  4K0K M;  1XXH A;  4LF5 M;  1IM2 A;  2FNA A;  3TWK A;  3FTE A;  3U5Z A;  3MHV C;  3FUV A;  1XMO M;  1JR3 D;  4LJ7 A;  4OW0 A;  3HHX A;  2V1U A;  4A3V B;  3J7A S;  4JI8 M;  5EJC A;  4IBK A;  2H1R A;  4JYA M;  1HNX M;  5FLX S;  5A2Q S;  3THG A;  2VII A;  3D8L A;  4LJ5 A;  3SMS A;  3FD9 A;  1OJL A;  2ZAN A;  3FUW A;  4FWG A;  2OPF A;  2UUB M;  1QAM A;  2R4E A;  1J7K A;  2ZAO A;  2X49 A;  1HQC A;  2L7I A;  2Y20 A;  1KYI A;  3HU3 A;  4L4U A;  4D81 A;  3RGP A;  2LH0 A;  2EUC A;  4GC5 A;  1HNW M;  2UXB M;  4HLQ A;  4D80 A;  3UJN A;  5FTJ A;  3U6O A;  3IG5 A;  1DO2 A;  1Q3C A;  4ZPX A;  1L2D A;  3VKH A;  2DWM A;  3VDU A;  3KSJ A;  1JR3 A;  3GPU A;  4DV7 M;  3W0L B;  3T38 A;  4I81 A;  5C18 A;  2FFJ A;  2KEB A;  3CF0 A;  3LQR A;  2DWL A;  3FUT A;  2YR0 A;  3JAM S;  2YFQ A;  4NSO B;  4FVM A;  4LF4 M;  1QYR A;  2L7H A;  3HU1 A;  4DR2 M;  2XFT A;  1YSY A;  4LY6 A;  4LF7 M;  2HCB A;  3J27 B;  4LFB M;  4LJ8 A;  2XZU A;  3A45 A;  4LGM A;  2DWN A;  5IZ7 D;  8CAT A;  5EXT A;  4IBB A;  1MX0 A;  4M9X A;  1XC8 A;  4L16 A;  3LVV A;  4NRV A;  5IRE B;  5KQD A;  1E32 A;  1IBK M;  3HHW A;  5EQT A;  2NQ8 C;  3I4Y A;  3U6M A;  3H4M A;  3I4V A;  4Z6Y A;  5EP2 A;  2CE7 A;  4XBO A;  1H6U A;  4FCW A;  4M0W A;  4OVZ B;  4YY3 M;  3MK6 A;  3TWL A;  3KP1 E;  1IQP A;  2Y0T A;  3SHG B;  1SXJ C;  3ILK A;  1Q3B A;  5ITX A;  3VDP A;  4DR3 M;  3VLF B;  2UU9 M;  5ITY A;  4G4Q A;  4GKK M;  4LFC M;  4L78 A;  3HJS A;  3TE6 A;  4NSR A;  1TH2 A;  3SAU A;  4DV3 M;  2JA2 A;  1K3X A;  5EXX A;  1G41 A;  4CGY B;  1ZQ9 A;  4I5S A;  4DV4 M;  1YE9 A;  4IBD A;  4LFA M;  3HWS A;  2XLJ A;  1N33 M;  5IWA M;  1R2Z A;  3AJI B;  1I4W A;  3HJQ A;  4G4O A;  5EP4 A;  2A5Y B;  2CV2 A;  3SAV A;  4NRW A;  3M7G A;  3GLG A;  1I94 M;  1DGH A;  1HT2 E;  2DHR A;  1XXH B;  1MU5 A;  1E9R A;  2FOI C;  5DYG A;  4LJA A;  3U5Z B;  4GIT A;  1L2C A;  2RKO A;  2KRK A;  4B3R M;  3K2L A;  1S3S A;  2G5G X;  3SBJ A;  3T15 A;  2C99 A;  3ZC7 B;  4FCV A;  3A42 A;  4LF6 M;  4KHP M;  4I8O A;  2HHH M;  1IN4 A;  1EE8 A;  3TWM A;  2EO2 A;  3VK8 A;  3K92 A;  4KOD A;  3ZH9 B;  3WHL A;  4BLC A;  3U6D A;  4QOZ C;  4MGK E;  3J80 S;  2LWX A;  4IBJ A;  4LGY A;  2ZBK B;  1PJI A;  4B3S M;  5EXS A;  1FNN A;  3KOY E;  2F5N A;  3SAS A;  4WUR A;  4GIP A;  2VQF M;  1SXJ E;  3K1J A;  3OTO M;  4DV2 M;  4X66 M;  5LMN M;  1NHG C;  1NHW C;  2DZN B;  3SYL A;  4QOS A;  3GQ3 A;  1IN6 A;  2D7E A;  1UM8 A;  3I51 A;  4IJE A;  3GQ4 A;  3FKE A;  3GQ5 A;  4P16 A;  3U61 A;  4AKH A;  4PT5 A;  4KLN A;  4DR6 M;  3GRV A;  4LG2 A;  4GHL A;  1XWI A;  3FTD A;  4AG5 A;  1DGF A;  5C1B A;  5KQ8 A;  4HL4 A;  4NL4 H;  1E9S A;  2LXE A;  1ORY B;  1TDH A;  4RNA A;  1G8P A;  1WXQ A;  1W5T A;  4G6Z A;  4L15 A;  1XMQ M;  3U6C A;  3KFU G;  2BNK A;  2D7G A;  2ERC A;  1TGU A;  1QVR A;  7CAT A;  3KOX E;  5KPZ A;  4M9Z A;  2F4V M;  3KOZ E;  4AW4 A;  1JQJ C;  5BPV A;  4R7G A;  2R18 A;  1IY1 A;  2Z7J A;  2AHM A;  2R45 A;  3L25 A;  1DO0 A;  1LV7 A;  1GVN A;  2CHQ A;  3QAU A;  4FCT A;  5KPR A;  3AFH A;  3T1Y M;  4FWH A;  2I7P A;  4IBG A;  1NJF A;  2KRU A;  1GLN A;  2J7O A;  1IBM M;  4B3T M;  3MJ5 A;  3KW6 A;  3E4R A;  3SMP A;  4AQY M;  2RGO A;  3JR4 A;  3HGI A;  2V6Z M;  5FTK A;  4RF0 A;  3R9X B;  1Z6T A;  2Y21 A;  4QHT A;  2F5S A;  2Q2E B;  3HJ8 A;  3AL0 C;  3EIH A;  1YUB A;  2CUZ A;  1XHB A;  2QZ4 A;  2CEA A;  2ZAM A;  5FSW A;  1XNR M;  3GPP A;  1ZAE A;  1N77 A;  1HT1 E;  3LMM A;  3Q8X A;  4AG6 A;  3T1H M;  3E9S A;  5ITQ A;  3R8F A;  4MGH A;  4MM3 B;  5LMU M;  4B08 A;  3GLG B;  2DVW B;  1DGH B;  2DZO B;  4IIW A;  4D82 A;  3J7B A;  2XF3 A;  4NOO B;  3DZD A;  5KPT A;  4LF8 M;  3UZU A;  4S12 A;  3CF6 E;  2HKJ A;  3L26 A;  4XGI A;  3PVS A;  1TH4 A;  3HU2 A;  4NXN M;  3HHZ A;  4G4R A;  2BJW A;  4LZJ A;  5DYI A;  2KZS A;  5H37 D;  2Z3X A;  2M5Z A;  3KS4 A;  3ZCB B;  5ITT A;  4DR7 M;  2F5Q A;  3NBI A;  3HKP A;  4MGY E;  1HQY E;  4IBE A;  5FTM A;  4CHT B;  4X64 M;  4BBA A;  4DUZ M;  1TDZ A;  1L2B A;  3M0E A;  2R46 A;  2KZU A;  3PNY A;  4NXM M;  2R65 A;  2C98 A;  1N36 M;  4MH0 E;  4QHS A;  4IBI A;  4MB7 A;  4JI4 M;  4WW0 A;  5IT9 S;  2V1C A;  3M6A A;  3SC3 A;  3GP1 A;  1R6B X;  1SXJ D;  2KW0 A;  4AKI A;  3GO8 A;  4II7 A;  5GKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...