2DWNA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase/dna
total genus 17
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwnA01
4NL4H 2DWMA 2DWLA 2D7EA 2D7HA 2D7GA 2DWNA
chains in the Genus database with same CATH superfamily
1D2NA 2R0IA 2XGNA 3K8ZA 1QAMA 2D7EA 1WGLA 4JYAM 3FTCA 3SMPA 5LMUM 2DVWB 5BPVA 3I4VA 4QHTA 1V92A 4FD2A 3U60B 2CV1A 2V1UA 1J7KA 2G8LA 1GL6A 2P5TA 3KXEC 3GO8A 4NXMM 4G4NA 1LV7A 2JZ1A 1IXSA 2XEPA 4CIZA 2GNOA 2ZANA 1HQYE 2G3QA 3THGA 2JXNA 4B7HA 2XFTA 4Q7JA 1NV9A 3GLHA 3MMPA 1ZMWA 3A98B 1N33M 2MGWA 1QUTA 4JI4M 1AUAA 1IXSB 3KP1E 1IY2A 2UXCM 4LF4M 2H5XA 2VDBB 4I81A 5FTNA 1IY1A 2LWXA 2L4FA 3CF2A 1WIVA 3GLIA 2DHRA 3U6EA 3SARA 1QAQA 3FRIA 2FE8A 2LVPC 4MB7A 3TPZA 1Z6TA 3U6SA 2LBCA 2Q2EB 5E6JA 5GKNA 3BBZA 4B3TM 3FYCA 5EXXA 1QANA 2BWBA 4L78A 4AZFA 4JI0M 1XNRM 4GEWA 2QCUA 2Y0QA 1PJTA 2XFSA 4ZPXA 4FVMA 1J09A 2WSFF 1DGFA 1EE8A 1VQ1A 2D7GA 2XSZD 4LFCM 2CUZA 1QAOA 5DNYA 4RKUF 1OJLA 2DWZB 4II7A 3PVSA 3TL4X 2YFQA 4FWDA 1VEJA 2F5QA 2QQ8A 1Z5CA 1I4WA 4LFAM 1IN4A 3RGSA 1K82A 5L8RF 5ITRA 3SHFA 3FRHA 4NRWA 5C1BA 1T6OA 2C99A 2BWEA 1QQWA 2MR9A 1JR3A 2HWJA 3MK6A 4M9ZA 1Q39A 2UU9M 2LHCA 4G4OA 3HZJA 2APLA 1G41A 1ZMUA 4DV4M 3I01M 1C7YA 2C9CA 1OFHA 1PJJA 1EIJA 4LJ5A 1N36M 2L7HA 1A5TA 2QBYA 1UM8A 5EJCA 3Q8GA 4KO8A 4QOZC 4M9SA 3GRRA 3KOZE 2K9DA 4KHPM 2UXDM 3M0EA 3H4MA 3AOGA 3L28A 4OVZB 1YSYA 2FOIC 2X49A 3B74A 3DFZA 4BLCA 3GLGE 4YHHM 2LVAA 4L6V6 3FUUA 2ZBKB 3ZH9B 1G59A 3EIEA 1C1KA 2FFJA 2JY8A 4MGYE 2V1CA 1DO2A 1NHGC 1VDLA 4S12A 4X62M 2GQFA 3J2PB 1OAIA 5KPTA 2F4VM 3W68A 1DGBA 1YE9A 4AG5A 5KPZA 1VEKA 2R46A 3AL0C 4W5WA 4LJAA 2MH8A 2EUCA 4DUZM 3KOYE 4DV0M 3HHYA 4IBJA 4OU7A 1RU3A 3HWSA 2JNHA 2LVNC 1G3IA 2EKKA 3ZC7B 3M7GA 1HJPA 2LVOC 1L2DA 1NY6A 1SXJA 4AKHA 1PJSA 1HR0M 3E4RA 4FWGA 4R71A 2JWSA 2ZAOA 2KHHA 3LCVB 1TH3A 3U5ZB 1GKIA 3GLFA 3HX3A 4OX9M 3KW6A 4ITQA 3L26A 3VK8A 2Z4SA 4LF7M 2Y21A 4IBIA 1NJGA 4PCZA 3U6OA 3VK7A 3SHGB 1V33A 2VQFM 5IT9S 2OOAA 2CV0A 4GH9A 2F5NA 1QZMA 3GRUA 4JI3M 4GC9A 4P17A 1ZMVA 3LVWA 2O25A 4WP2A 4GHLA 3H4JA 5FSWA 2VF8A 2UUCM 5KO3A 3SYKA 2KW0A 5EP3A 4B3SM 1XXHE 2WSCF 4BBAA 2UUBM 3FTDA 2XF3A 1DO0A 3ILKA 1GLNA 1T43A 3GLHE 4FW9A 4X64M 3U60A 4WW0A 1SG9A 3SYLA 3SFZA 3SAUA 1NVMA 2OPFA 3JR4A 4ANRA 3GLIE 4A3VB 4DR2M 1IN5A 1T3TA 5ITUA 1QVRA 2KRKA 4M0WA 4R7GA 2CV2A 1QDTA 2JY6B 1IBLM 4D80A 2L2DA 2LNHC 4MGIE 4AG6A 4AQYM 2QPAA 2FNAA 2ZAMA 1IQPA 1R5LA 2B3TA 4IBDA 1ZQ9A 1N77A 3VKGA 1L1TA 1IFYA 2HL7A 2R65A 2XSZA 4QHSA 5IZ7D 3JR5A 2JA2A 3GQ4A 2F5OA 1OFIA 4LJ4A 2DI0A 4LY6A 1TR8A 3KFUG 3IG5A 3MHVC 3SBJA 3GP1A 3RE8A 4CGYB 1FJGM 3CF6E 3T6PA 3VLFB 2JUJA 4LF6M 2ZTCA 3PXGA 1IN8A 3CTWB 3T38A 4LG2A 3HU2A 3FUXA 2BNKA 4B3MM 3K92A 1VEGA 4HEOA 3PFIA 4L4UA 2DAMA 2BJWA 4GIPA 3RGPA 1TGUA 1E32A 3IG8A 1HQCA 1OAOC 2DZNB 4LF9M 1QYRA 1JB0F 1PRBA 4DV7M 3FTFA 5KQ8A 1PJQA 2X8AA 3E9SA 1PM5A 3C9PA 1R2ZA 2LTUA 3U6LA 1IBMM 3LVVA 3R9XB 1OTRA 1XXHB 3QYBA 1QDRA 3VFDA 2DAGA 2CHVA 3AV0A 4JN6A 3FD9A 1KSFX 2KZSA 3E46A 3U6DA 3HY5A 4DV1M 3D8LA 1R4GA 2DAIA 1N32M 4OVZA 2K47A 3DZDA 2R6FA 3UK6A 3VDPA 4JV5M 2Y20A 3FE3A 5KPRA 2CE7A 1QUSA 4IJFA 1MX0A 1OKSA 1Q02A 1N78A 2CFOA 1NO1A 2DHYA 4Z8XA 1Y8GA 1NV8A 2KNAA 3HU1A 1TF0B 4MH0E 2UUAM 4MM3B 3QYEA 2DKLA 2YNMD 2XLJA 3GRYA 4IBKA 5C18A 1SXJE 1Z5BA 3IHPA 3NWLA 2R4EA 4LJ8A 3GLFE 2VIIA 3W0FA 3HJQA 4L15A 1TH2A 3KS4A 3W67A 4D81A 1ZV1A 2KEBA 4JI2M 2D7HA 1DV0A 4CHTB 3GQ5A 3B89A 2LH0A 2I7NA 1G71A 1N75A 1Z59A 3EIHA 1DGGA 2JP7A 2O01F 4B3RM 3WHLA 2VF7A 4DR6M 4LRTA 1VDDA 3U5ZA 3AOEA 3U6MA 1R2YA 4CISA 4AW4A 3L25A 3JAMS 3KOXE 2NQ8C 4NRVA 4K0KM 1D0MA 4HL4A 2YR0A 2K0BX 2EA0A 2DXIA 1XC8A 5FTKA 2XH9A 2KRUA 4I8OA 3L29A 4DV6M 4OW0A 1E9RA 2R44A 1GL7A 1TTEA 2HKJA 3OTOM 2CRUA 3CF0A 2OQ4A 3BOSA 2QNJA 4LZZA 5EP4A 3VDUA 4X66M 3L27A 1BVSA 3UZUA 3U61B 4MGHA 2JY5A 3K1JA 4NXNM 2M60A 5EXSA 5FLXS 1G8PA 2QSFX 5KQDA 4LF8M 2DAEA 1HT2E 4DR4M 1NY5A 4M0DA 2LHGA 4AKGA 3TQSA 1GO5A 4LFBM 3T1YM 1J5EM 2V6ZM 4JI8M 5F3WA 3E21A 2CWBA 3TWMA 2LVQD 1F4IA 1IY0A 3GLGB 2HAKA 4GHAA 2J5YA 2Z7JA 4GC5A 3I51A 1E94E 4IBBA 5IWAM 5IREB 4DV5M 3LMMA 3IECA 3R8FA 2R18A 2DWLA 3A45A 3L2AA 3ZQJA 4L8RC 1K3XA 4LGYA 1LTMA 3GPPA 4RF0A 3Q8XA 2CHQA 5ITXA 3PNYA 4JI7M 4EIWA 2C96A 4KODA 2MJ5B 3GPXA 1HNXM 3SASA 1NSFA 1GJTA 3AKZA 2RKOA 4GITA 3HKPA 4GKKM 4LJ9A 5LMNM 2K6BA 2RGHA 2DWMA 2KNVA 1D0KA 1XHBA 2EKFA 4B7FA 3UGJA 5FTMA 3UJNA 3J7BA 3B7NA 1L1ZA 4F1IA 1HT1E 1QZEA 4KLNA 1MU5A 3DOAA 4KT0F 3K9OA 5EXPA 3T15A 5A2QS 1X37A 1SXJC 1WHCA 1R6BX 2DZLA 2YQZA 4AKIA 1E9SA 1V34A 3C3DA 2WZJA 4Z6YA 2WSEF 3DA1A 2R45A 3A42A 4PT5A 1W5TA 4WURA 2AHMA 3GQ3A 4DR1M 3AJIB 4R3DA 1IBKM 1JR3E 1TH4A 4FCTA 5DYIA 1K3WA 4DR7M 3TWKA 2LXEA 1P3QQ 4G4RA 4LJ6A 5E26A 3J81S 1VG5A 1XXHA 4IBFA 3GPYA 4FCVA 4DR3M 1KFVA 4FCWA 4GMQA 2A5YB 1GVNA 4LF5M 1FNNA 2C9OA 1MN3A 2QP9X 3SATA 5EXTA 2J7OA 1GABA 4IBEA 4DV3M 2X4AA 2Z8YM 3U6CA 2L09A 4XK8F 4JI5M 4PD2A 1IM2A 1Q3BA 4IBCA 3GLHB 4NL4H 1L2CA 4L16A 4Y28F 3W0LB 3B7QA 3TWLA 5ITTA 2XZFA 3SMSA 3GRVA 3LCUA 1ORYB 3HJSA 1CUKA 4M9XA 3BXWA 4F2LA 2CHGA 3GLIB 1OQYA 1WXQA 1I94M 4LRSA 3J80S 3HHZA 3KP0E 2KNZA 3V76A 4DBGB 2HCBA 4QNRA 4PDGA 4REZA 2DAKA 2CEAA 1EFUB 1OIPA 2KA6B 2OO9A 3FUTA 2C5RA 1PGYA 1MJGM 1R7RA 3KVWA 2O5RA 2QZ4A 3HU3A 3LW5F 4NSRA 4GKJM 4NOOB 3RFWA 3J7AS 2FH0A 2KZUA 2DENA 5DYGA 1NHWC 3K9PA 3KSJA 1Z5AA 3F92A 1XMQM 1IXZA 2BJVA 3KS8A 5JI3E 1WR1B 5BR8M 1IXRC 2RGOA 4XBOA 1OIZA 2ZM6M 1HNZM 1UFZA 1XWIA 4DUYM 3M6AA 2ERCA 5JI2E 5FTJA 2HHHM 3KSXA 4LZJA 4RF1A 3FYDA 4IJEA 5FTLA 3T1HM 1GJSA 4NC6A 3HGIA 3WHKA 2QHOB 8CATA 3GPUA 2KDLA 3D8BA 3KOWE 3AFHA 4P16A 2QBYB 3NBIA 4FWHA 4QOSA 3KDSE 1NNUC 1H6UA 5DFLA 2R4JA 2L4EA 3U61A 1WGNA 2W82A 2J7NA 4LCBA 1N34M 4YY3M 3PNVA 4NSOB 4XGIA 1DGHA 3C3EA 1JR3D 1XMOM 1ZAEA 3QWLA 5ITYA 2RRUA 1W5SA 3QAUA 4IIWA 3U6PA 2KXEA 7CATA 4TUWA 4MGKE 2FS1A 3I4YA 2QENA 3LQQA 5ITXE 1DGHB 4IBGA 5H37D 2OOBA 3SC3A 5EQTA 4B7GA 3GLGA 3HJ8A 1G4AE 1YUBA 2L6OA 2Z4RA 4JI1M 3U6QA 4MGZE 1TDHA 1PJIA 2JY7A 2L7IA 2VQEM 1Q3CA 3NBXX 4I5SA 5EP2A 3UMMA 2H1RA 3J27B 5ITQA 3A46A 4JI6M 4AI6A 3B7ZA 4HLQA 4G6ZA 4BB9A 3SAWA 3MJ5A 1KYIA 3K2LA 3ZCBB 4JXJA 4DR5M 4LJ7A 1JQJC 1SXJB 2R62A 2Y0TA 4B08A 2F5SA 4I4LA 2F5PA 3FTEA 1AIPC 1TDZA 2I7PA 1NNJA 3C58A 1HNWM 2JZ0A 1IN7A 2MROB 4D82A 4PDIA 2ZTDA 2EO2A 3GLFB 4UN2B 1IN6A 1YLAA 2N35A 3TE6A 4CJ6A 3CGWA 4DV2M 2CP8A 2XZUA 2G5GX 3LQRA 3B9PA 3HHWA 2DNAA 2Z3XA 3FKEA 3HHXA 1S3SA 2EJSA 3I04M 4G3OA 2M5ZA 1L2BA 4QNMA 4G4QA 1SXJD 1WJ7A 3FUVA 1XB2B 3AOEC 2C98A 1XNQM 2UXBM 1L8QA 3FUWA 4GRIA 4RNAA 1D0LA 1NJFA 2DZOB 2E5LM 3VKHA 5EP1A 4X65M 3SAVA 4LGMA 2DWNA
chains in the Genus database with same CATH topology
1D2NA 2XGNA 3K8ZA 1QAMA 2D7EA 3FTCA 3SMPA 5LMUM 2DVWB 5BPVA 3I4VA 4QHTA 4FD2A 3U60B 2V1UA 2CV1A 1J7KA 2G8LA 1GL6A 2P5TA 3KXEC 3GO8A 4NXMM 4G4NA 1LV7A 2XEPA 2ZANA 1HQYE 3THGA 4B7HA 2XFTA 3GLHA 3A98B 1N33M 4JI4M 1IXSB 3KP1E 1IY2A 2UXCM 4LF4M 4I81A 5FTNA 1IY1A 2LWXA 3CF2A 3GLIA 2DHRA 3U6EA 3SARA 1QAQA 2FE8A 4MB7A 3TPZA 1Z6TA 3U6SA 2Q2EB 5E6JA 5GKNA 4B3TM 3FYCA 5EXXA 1QANA 4L78A 4AZFA 4JI0M 1XNRM 2QCUA 2Y0QA 2XFSA 4ZPXA 4FVMA 1J09A 1DGFA 1EE8A 2D7GA 4LFCM 2XSZD 2CUZA 1QAOA 5DNYA 1OJLA 2DWZB 4II7A 3PVSA 3TL4X 2YFQA 4FWDA 2F5QA 1Z5CA 1I4WA 4LFAM 1IN4A 3RGSA 1K82A 5ITRA 3SHFA 4NRWA 5C1BA 2C99A 1QQWA 1JR3A 4M9ZA 3MK6A 1Q39A 2UU9M 4G4OA 1G41A 4DV4M 2C9CA 1OFHA 1PJJA 4LJ5A 1N36M 2L7HA 2QBYA 1UM8A 5EJCA 4KO8A 4QOZC 4M9SA 3GRRA 3KOZE 4KHPM 2UXDM 3M0EA 3H4MA 3AOGA 3L28A 4OVZB 1YSYA 2FOIC 2X49A 3DFZA 4BLCA 4YHHM 3FUUA 2ZBKB 3ZH9B 1G59A 3EIEA 1C1KA 2FFJA 4MGYE 2V1CA 1DO2A 1NHGC 4S12A 4X62M 3J2PB 5KPTA 2F4VM 1DGBA 1YE9A 4AG5A 5KPZA 2R46A 3AL0C 4W5WA 4LJAA 2EUCA 4DUZM 3KOYE 4DV0M 3HHYA 4IBJA 4OU7A 3HWSA 1G3IA 3ZC7B 3M7GA 1L2DA 1NY6A 1SXJA 4AKHA 1HR0M 3E4RA 4FWGA 2ZAOA 1TH3A 3U5ZB 1GKIA 3GLFA 4OX9M 3KW6A 4ITQA 3L26A 3VK8A 2Z4SA 4LF7M 2Y21A 4IBIA 1NJGA 4PCZA 3U6OA 3VK7A 3SHGB 2VQFM 5IT9S 2CV0A 4GH9A 2F5NA 1QZMA 3GRUA 4JI3M 4GC9A 3LVWA 4GHLA 5FSWA 2UUCM 5KO3A 3SYKA 2KW0A 5EP3A 4B3SM 4BBAA 2UUBM 3FTDA 2XF3A 1DO0A 3ILKA 1GLNA 4X64M 4FW9A 3U60A 4WW0A 3SYLA 3SFZA 3SAUA 1NVMA 2OPFA 3JR4A 4A3VB 4DR2M 1IN5A 1T3TA 5ITUA 1QVRA 2KRKA 4M0WA 4R7GA 2CV2A 1IBLM 4D80A 2LNHC 4MGIE 4AG6A 4AQYM 2QPAA 2FNAA 2ZAMA 1IQPA 4IBDA 1ZQ9A 1N77A 3VKGA 1L1TA 2HL7A 2R65A 2XSZA 4QHSA 5IZ7D 3JR5A 2JA2A 3GQ4A 2F5OA 1OFIA 4LJ4A 4LY6A 3KFUG 3IG5A 3MHVC 3SBJA 3GP1A 3RE8A 4CGYB 1FJGM 3CF6E 3VLFB 4LF6M 3PXGA 1IN8A 3CTWB 3T38A 4LG2A 3HU2A 3FUXA 2BNKA 4B3MM 3K92A 3PFIA 4L4UA 3RGPA 2BJWA 4GIPA 1TGUA 1E32A 3IG8A 1HQCA 2DZNB 4LF9M 1QYRA 4DV7M 3FTFA 5KQ8A 2X8AA 3E9SA 1PM5A 1R2ZA 1IBMM 3U6LA 3R9XB 3LVVA 1XXHB 3VFDA 2CHVA 3AV0A 4JN6A 3FD9A 1KSFX 2KZSA 3U6DA 4DV1M 3D8LA 1N32M 4OVZA 2K47A 3DZDA 3UK6A 3VDPA 4JV5M 2Y20A 5KPRA 2CE7A 4IJFA 1MX0A 1N78A 2CFOA 4Z8XA 4MH0E 3HU1A 2UUAM 4MM3B 2YNMD 2XLJA 3GRYA 4IBKA 5C18A 1SXJE 1Z5BA 3NWLA 2R4EA 4LJ8A 2VIIA 3W0FA 3HJQA 4L15A 1TH2A 3KS4A 4D81A 4JI2M 2KEBA 2D7HA 4CHTB 3GQ5A 3EIHA 2LH0A 2I7NA 1N75A 1Z59A 1DGGA 4B3RM 3WHLA 4DR6M 4LRTA 1VDDA 3U5ZA 3AOEA 3U6MA 1R2YA 4CISA 4AW4A 3L25A 3JAMS 3KOXE 2NQ8C 4NRVA 4K0KM 4HL4A 2YR0A 2EA0A 2DXIA 1XC8A 5FTKA 2XH9A 2KRUA 4I8OA 3L29A 4DV6M 4OW0A 1E9RA 1GL7A 2HKJA 3OTOM 3CF0A 2OQ4A 3BOSA 4LZZA 5EP4A 3VDUA 4X66M 3L27A 3UZUA 3U61B 4MGHA 3K1JA 4NXNM 2M60A 5EXSA 5FLXS 1G8PA 4LF8M 5KQDA 1HT2E 4DR4M 1NY5A 4M0DA 4AKGA 3TQSA 4LFBM 3T1YM 1J5EM 2V6ZM 4JI8M 5F3WA 3TWMA 1IY0A 3GLGB 4GHAA 2Z7JA 4GC5A 4IBBA 3I51A 1E94E 4DV5M 5IWAM 5IREB 3LMMA 3R8FA 2R18A 2DWLA 3A45A 3L2AA 4L8RC 1K3XA 4LGYA 3GPPA 4RF0A 3Q8XA 2CHQA 5ITXA 3PNYA 4JI7M 4EIWA 2C96A 4KODA 3GPXA 1HNXM 3SASA 1NSFA 3AKZA 2RKOA 4GITA 3HKPA 4GKKM 4LJ9A 5LMNM 2RGHA 2DWMA 4B7FA 1XHBA 3UGJA 5FTMA 3UJNA 3J7BA 1L1ZA 1HT1E 4KLNA 1MU5A 3DOAA 5EXPA 3T15A 5A2QS 1X37A 1SXJC 1R6BX 2YQZA 4AKIA 1E9SA 4Z6YA 3DA1A 2R45A 3A42A 4PT5A 1W5TA 4WURA 2AHMA 3GQ3A 4DR1M 3AJIB 4R3DA 1IBKM 4FCTA 1TH4A 5DYIA 1K3WA 4DR7M 3TWKA 2LXEA 4G4RA 4LJ6A 5E26A 3J81S 1XXHA 4IBFA 3GPYA 4FCVA 4DR3M 1KFVA 4FCWA 4GMQA 2A5YB 1GVNA 4LF5M 1FNNA 2C9OA 2QP9X 3SATA 5EXTA 2J7OA 4IBEA 4DV3M 2X4AA 3U6CA 2L09A 4JI5M 4PD2A 1IM2A 1Q3BA 4IBCA 3GLHB 4NL4H 1L2CA 4L16A 3W0LB 5ITTA 3TWLA 2XZFA 3SMSA 3GRVA 1ORYB 3HJSA 4M9XA 2CHGA 3GLIB 1WXQA 1I94M 4LRSA 3J80S 3HHZA 3KP0E 2HCBA 4QNRA 4PDGA 4REZA 2CEAA 2KA6B 3FUTA 2C5RA 1R7RA 3KVWA 2O5RA 2QZ4A 3HU3A 4NSRA 4GKJM 4NOOB 3RFWA 3J7AS 2KZUA 5DYGA 1NHWC 3KSJA 1Z5AA 3KS8A 1XMQM 1IXZA 2BJVA 5JI3E 5BR8M 4JYAM 1IXRC 2RGOA 4XBOA 2ZM6M 1HNZM 1XWIA 4DUYM 3M6AA 2ERCA 5JI2E 5FTJA 2HHHM 3KSXA 4LZJA 4RF1A 3FYDA 4IJEA 5FTLA 3T1HM 3HGIA 3WHKA 8CATA 3GPUA 3D8BA 3KOWE 3AFHA 4P16A 2QBYB 3NBIA 4FWHA 4QOSA 3KDSE 1NNUC 1H6UA 2R4JA 3U61A 2W82A 2J7NA 4LCBA 1N34M 4YY3M 3PNVA 4NSOB 4XGIA 1DGHA 1JR3D 1XMOM 1ZAEA 3QWLA 5ITYA 3U6PA 1W5SA 3QAUA 4IIWA 4TUWA 2KXEA 7CATA 4MGKE 3I4YA 2QENA 3LQQA 5ITXE 1DGHB 4IBGA 5H37D 3SC3A 5EQTA 4B7GA 3GLGA 3HJ8A 1G4AE 1YUBA 2L6OA 2Z4RA 4JI1M 3U6QA 4MGZE 1TDHA 1PJIA 2L7IA 2VQEM 1Q3CA 4JI6M 4I5SA 5EP2A 3UMMA 2H1RA 3J27B 5ITQA 3A46A 4AI6A 4HLQA 4G6ZA 4BB9A 3SAWA 3MJ5A 1KYIA 3K2LA 3ZCBB 4JXJA 4DR5M 4LJ7A 1JQJC 1SXJB 2R62A 2Y0TA 4B08A 2F5SA 4I4LA 2F5PA 3FTEA 1TDZA 2I7PA 1NNJA 3C58A 1HNWM 1IN7A 4D82A 4PDIA 2EO2A 3GLFB 1IN6A 3TE6A 4DV2M 2XZUA 2G5GX 3LQRA 3B9PA 3HHWA 2Z3XA 3FKEA 3HHXA 1S3SA 2M5ZA 1L2BA 4QNMA 4G4QA 1SXJD 3FUVA 3AOEC 1XNQM 2C98A 2UXBM 1L8QA 3FUWA 4GRIA 4RNAA 2E5LM 1NJFA 2DZOB 3VKHA 5EP1A 4X65M 3SAVA 4LGMA 2DWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL4 H;  2DWM A;  2DWL A;  2D7E A;  2D7H A;  2D7G A;  2DWN A; 
#chains in the Genus database with same CATH topology
 1D2N A;  2R0I A;  2XGN A;  3K8Z A;  1QAM A;  2D7E A;  1WGL A;  4JYA M;  3FTC A;  3SMP A;  5LMU M;  2DVW B;  5BPV A;  3I4V A;  4QHT A;  1V92 A;  4FD2 A;  3U60 B;  2CV1 A;  2V1U A;  1J7K A;  2G8L A;  1GL6 A;  2P5T A;  3KXE C;  3GO8 A;  4NXM M;  4G4N A;  1LV7 A;  2JZ1 A;  1IXS A;  2XEP A;  4CIZ A;  2GNO A;  2ZAN A;  1HQY E;  2G3Q A;  3THG A;  2JXN A;  4B7H A;  2XFT A;  4Q7J A;  1NV9 A;  3GLH A;  3MMP A;  1ZMW A;  3A98 B;  1N33 M;  2MGW A;  1QUT A;  4JI4 M;  1AUA A;  1IXS B;  3KP1 E;  1IY2 A;  2UXC M;  4LF4 M;  2H5X A;  2VDB B;  4I81 A;  5FTN A;  1IY1 A;  2LWX A;  2L4F A;  3CF2 A;  1WIV A;  3GLI A;  2DHR A;  3U6E A;  3SAR A;  1QAQ A;  3FRI A;  2FE8 A;  2LVP C;  4MB7 A;  3TPZ A;  1Z6T A;  3U6S A;  2LBC A;  2Q2E B;  5E6J A;  5GKN A;  3BBZ A;  4B3T M;  3FYC A;  5EXX A;  1QAN A;  2BWB A;  4L78 A;  4AZF A;  4JI0 M;  1XNR M;  4GEW A;  2QCU A;  2Y0Q A;  1PJT A;  2XFS A;  4ZPX A;  4FVM A;  1J09 A;  2WSF F;  1DGF A;  1EE8 A;  1VQ1 A;  2D7G A;  2XSZ D;  4LFC M;  2CUZ A;  1QAO A;  5DNY A;  4RKU F;  1OJL A;  2DWZ B;  4II7 A;  3PVS A;  3TL4 X;  2YFQ A;  4FWD A;  1VEJ A;  2F5Q A;  2QQ8 A;  1Z5C A;  1I4W A;  4LFA M;  1IN4 A;  3RGS A;  1K82 A;  5L8R F;  5ITR A;  3SHF A;  3FRH A;  4NRW A;  5C1B A;  1T6O A;  2C99 A;  2BWE A;  1QQW A;  2MR9 A;  1JR3 A;  2HWJ A;  3MK6 A;  4M9Z A;  1Q39 A;  2UU9 M;  2LHC A;  4G4O A;  3HZJ A;  2APL A;  1G41 A;  1ZMU A;  4DV4 M;  3I01 M;  1C7Y A;  2C9C A;  1OFH A;  1PJJ A;  1EIJ A;  4LJ5 A;  1N36 M;  2L7H A;  1A5T A;  2QBY A;  1UM8 A;  5EJC A;  3Q8G A;  4KO8 A;  4QOZ C;  4M9S A;  3GRR A;  3KOZ E;  2K9D A;  4KHP M;  2UXD M;  3M0E A;  3H4M A;  3AOG A;  3L28 A;  4OVZ B;  1YSY A;  2FOI C;  2X49 A;  3B74 A;  3DFZ A;  4BLC A;  3GLG E;  4YHH M;  2LVA A;  4L6V 6;  3FUU A;  2ZBK B;  3ZH9 B;  1G59 A;  3EIE A;  1C1K A;  2FFJ A;  2JY8 A;  4MGY E;  2V1C A;  1DO2 A;  1NHG C;  1VDL A;  4S12 A;  4X62 M;  2GQF A;  3J2P B;  1OAI A;  5KPT A;  2F4V M;  3W68 A;  1DGB A;  1YE9 A;  4AG5 A;  5KPZ A;  1VEK A;  2R46 A;  3AL0 C;  4W5W A;  4LJA A;  2MH8 A;  2EUC A;  4DUZ M;  3KOY E;  4DV0 M;  3HHY A;  4IBJ A;  4OU7 A;  1RU3 A;  3HWS A;  2JNH A;  2LVN C;  1G3I A;  2EKK A;  3ZC7 B;  3M7G A;  1HJP A;  2LVO C;  1L2D A;  1NY6 A;  1SXJ A;  4AKH A;  1PJS A;  1HR0 M;  3E4R A;  4FWG A;  4R71 A;  2JWS A;  2ZAO A;  2KHH A;  3LCV B;  1TH3 A;  3U5Z B;  1GKI A;  3GLF A;  3HX3 A;  4OX9 M;  3KW6 A;  4ITQ A;  3L26 A;  3VK8 A;  2Z4S A;  4LF7 M;  2Y21 A;  4IBI A;  1NJG A;  4PCZ A;  3U6O A;  3VK7 A;  3SHG B;  1V33 A;  2VQF M;  5IT9 S;  2OOA A;  2CV0 A;  4GH9 A;  2F5N A;  1QZM A;  3GRU A;  4JI3 M;  4GC9 A;  4P17 A;  1ZMV A;  3LVW A;  2O25 A;  4WP2 A;  4GHL A;  3H4J A;  5FSW A;  2VF8 A;  2UUC M;  5KO3 A;  3SYK A;  2KW0 A;  5EP3 A;  4B3S M;  1XXH E;  2WSC F;  4BBA A;  2UUB M;  3FTD A;  2XF3 A;  1DO0 A;  3ILK A;  1GLN A;  1T43 A;  3GLH E;  4FW9 A;  4X64 M;  3U60 A;  4WW0 A;  1SG9 A;  3SYL A;  3SFZ A;  3SAU A;  1NVM A;  2OPF A;  3JR4 A;  4ANR A;  3GLI E;  4A3V B;  4DR2 M;  1IN5 A;  1T3T A;  5ITU A;  1QVR A;  2KRK A;  4M0W A;  4R7G A;  2CV2 A;  1QDT A;  2JY6 B;  1IBL M;  4D80 A;  2L2D A;  2LNH C;  4MGI E;  4AG6 A;  4AQY M;  2QPA A;  2FNA A;  2ZAM A;  1IQP A;  1R5L A;  2B3T A;  4IBD A;  1ZQ9 A;  1N77 A;  3VKG A;  1L1T A;  1IFY A;  2HL7 A;  2R65 A;  2XSZ A;  4QHS A;  5IZ7 D;  3JR5 A;  2JA2 A;  3GQ4 A;  2F5O A;  1OFI A;  4LJ4 A;  2DI0 A;  4LY6 A;  1TR8 A;  3KFU G;  3IG5 A;  3MHV C;  3SBJ A;  3GP1 A;  3RE8 A;  4CGY B;  1FJG M;  3CF6 E;  3T6P A;  3VLF B;  2JUJ A;  4LF6 M;  2ZTC A;  3PXG A;  1IN8 A;  3CTW B;  3T38 A;  4LG2 A;  3HU2 A;  3FUX A;  2BNK A;  4B3M M;  3K92 A;  1VEG A;  4HEO A;  3PFI A;  4L4U A;  2DAM A;  2BJW A;  4GIP A;  3RGP A;  1TGU A;  1E32 A;  3IG8 A;  1HQC A;  1OAO C;  2DZN B;  4LF9 M;  1QYR A;  1JB0 F;  1PRB A;  4DV7 M;  3FTF A;  5KQ8 A;  1PJQ A;  2X8A A;  3E9S A;  1PM5 A;  3C9P A;  1R2Z A;  2LTU A;  3U6L A;  1IBM M;  3LVV A;  3R9X B;  1OTR A;  1XXH B;  3QYB A;  1QDR A;  3VFD A;  2DAG A;  2CHV A;  3AV0 A;  4JN6 A;  3FD9 A;  1KSF X;  2KZS A;  3E46 A;  3U6D A;  3HY5 A;  4DV1 M;  3D8L A;  1R4G A;  2DAI A;  1N32 M;  4OVZ A;  2K47 A;  3DZD A;  2R6F A;  3UK6 A;  3VDP A;  4JV5 M;  2Y20 A;  3FE3 A;  5KPR A;  2CE7 A;  1QUS A;  4IJF A;  1MX0 A;  1OKS A;  1Q02 A;  1N78 A;  2CFO A;  1NO1 A;  2DHY A;  4Z8X A;  1Y8G A;  1NV8 A;  2KNA A;  3HU1 A;  1TF0 B;  4MH0 E;  2UUA M;  4MM3 B;  3QYE A;  2DKL A;  2YNM D;  2XLJ A;  3GRY A;  4IBK A;  5C18 A;  1SXJ E;  1Z5B A;  3IHP A;  3NWL A;  2R4E A;  4LJ8 A;  3GLF E;  2VII A;  3W0F A;  3HJQ A;  4L15 A;  1TH2 A;  3KS4 A;  3W67 A;  4D81 A;  1ZV1 A;  2KEB A;  4JI2 M;  2D7H A;  1DV0 A;  4CHT B;  3GQ5 A;  3B89 A;  2LH0 A;  2I7N A;  1G71 A;  1N75 A;  1Z59 A;  3EIH A;  1DGG A;  2JP7 A;  2O01 F;  4B3R M;  3WHL A;  2VF7 A;  4DR6 M;  4LRT A;  1VDD A;  3U5Z A;  3AOE A;  3U6M A;  1R2Y A;  4CIS A;  4AW4 A;  3L25 A;  3JAM S;  3KOX E;  2NQ8 C;  4NRV A;  4K0K M;  1D0M A;  4HL4 A;  2YR0 A;  2K0B X;  2EA0 A;  2DXI A;  1XC8 A;  5FTK A;  2XH9 A;  2KRU A;  4I8O A;  3L29 A;  4DV6 M;  4OW0 A;  1E9R A;  2R44 A;  1GL7 A;  1TTE A;  2HKJ A;  3OTO M;  2CRU A;  3CF0 A;  2OQ4 A;  3BOS A;  2QNJ A;  4LZZ A;  5EP4 A;  3VDU A;  4X66 M;  3L27 A;  1BVS A;  3UZU A;  3U61 B;  4MGH A;  2JY5 A;  3K1J A;  4NXN M;  2M60 A;  5EXS A;  5FLX S;  1G8P A;  2QSF X;  5KQD A;  4LF8 M;  2DAE A;  1HT2 E;  4DR4 M;  1NY5 A;  4M0D A;  2LHG A;  4AKG A;  3TQS A;  1GO5 A;  4LFB M;  3T1Y M;  1J5E M;  2V6Z M;  4JI8 M;  5F3W A;  3E21 A;  2CWB A;  3TWM A;  2LVQ D;  1F4I A;  1IY0 A;  3GLG B;  2HAK A;  4GHA A;  2J5Y A;  2Z7J A;  4GC5 A;  3I51 A;  1E94 E;  4IBB A;  5IWA M;  5IRE B;  4DV5 M;  3LMM A;  3IEC A;  3R8F A;  2R18 A;  2DWL A;  3A45 A;  3L2A A;  3ZQJ A;  4L8R C;  1K3X A;  4LGY A;  1LTM A;  3GPP A;  4RF0 A;  3Q8X A;  2CHQ A;  5ITX A;  3PNY A;  4JI7 M;  4EIW A;  2C96 A;  4KOD A;  2MJ5 B;  3GPX A;  1HNX M;  3SAS A;  1NSF A;  1GJT A;  3AKZ A;  2RKO A;  4GIT A;  3HKP A;  4GKK M;  4LJ9 A;  5LMN M;  2K6B A;  2RGH A;  2DWM A;  2KNV A;  1D0K A;  1XHB A;  2EKF A;  4B7F A;  3UGJ A;  5FTM A;  3UJN A;  3J7B A;  3B7N A;  1L1Z A;  4F1I A;  1HT1 E;  1QZE A;  4KLN A;  1MU5 A;  3DOA A;  4KT0 F;  3K9O A;  5EXP A;  3T15 A;  5A2Q S;  1X37 A;  1SXJ C;  1WHC A;  1R6B X;  2DZL A;  2YQZ A;  4AKI A;  1E9S A;  1V34 A;  3C3D A;  2WZJ A;  4Z6Y A;  2WSE F;  3DA1 A;  2R45 A;  3A42 A;  4PT5 A;  1W5T A;  4WUR A;  2AHM A;  3GQ3 A;  4DR1 M;  3AJI B;  4R3D A;  1IBK M;  1JR3 E;  1TH4 A;  4FCT A;  5DYI A;  1K3W A;  4DR7 M;  3TWK A;  2LXE A;  1P3Q Q;  4G4R A;  4LJ6 A;  5E26 A;  3J81 S;  1VG5 A;  1XXH A;  4IBF A;  3GPY A;  4FCV A;  4DR3 M;  1KFV A;  4FCW A;  4GMQ A;  2A5Y B;  1GVN A;  4LF5 M;  1FNN A;  2C9O A;  1MN3 A;  2QP9 X;  3SAT A;  5EXT A;  2J7O A;  1GAB A;  4IBE A;  4DV3 M;  2X4A A;  2Z8Y M;  3U6C A;  2L09 A;  4XK8 F;  4JI5 M;  4PD2 A;  1IM2 A;  1Q3B A;  4IBC A;  3GLH B;  4NL4 H;  1L2C A;  4L16 A;  4Y28 F;  3W0L B;  3B7Q A;  3TWL A;  5ITT A;  2XZF A;  3SMS A;  3GRV A;  3LCU A;  1ORY B;  3HJS A;  1CUK A;  4M9X A;  3BXW A;  4F2L A;  2CHG A;  3GLI B;  1OQY A;  1WXQ A;  1I94 M;  4LRS A;  3J80 S;  3HHZ A;  3KP0 E;  2KNZ A;  3V76 A;  4DBG B;  2HCB A;  4QNR A;  4PDG A;  4REZ A;  2DAK A;  2CEA A;  1EFU B;  1OIP A;  2KA6 B;  2OO9 A;  3FUT A;  2C5R A;  1PGY A;  1MJG M;  1R7R A;  3KVW A;  2O5R A;  2QZ4 A;  3HU3 A;  3LW5 F;  4NSR A;  4GKJ M;  4NOO B;  3RFW A;  3J7A S;  2FH0 A;  2KZU A;  2DEN A;  5DYG A;  1NHW C;  3K9P A;  3KSJ A;  1Z5A A;  3F92 A;  1XMQ M;  1IXZ A;  2BJV A;  3KS8 A;  5JI3 E;  1WR1 B;  5BR8 M;  1IXR C;  2RGO A;  4XBO A;  1OIZ A;  2ZM6 M;  1HNZ M;  1UFZ A;  1XWI A;  4DUY M;  3M6A A;  2ERC A;  5JI2 E;  5FTJ A;  2HHH M;  3KSX A;  4LZJ A;  4RF1 A;  3FYD A;  4IJE A;  5FTL A;  3T1H M;  1GJS A;  4NC6 A;  3HGI A;  3WHK A;  2QHO B;  8CAT A;  3GPU A;  2KDL A;  3D8B A;  3KOW E;  3AFH A;  4P16 A;  2QBY B;  3NBI A;  4FWH A;  4QOS A;  3KDS E;  1NNU C;  1H6U A;  5DFL A;  2R4J A;  2L4E A;  3U61 A;  1WGN A;  2W82 A;  2J7N A;  4LCB A;  1N34 M;  4YY3 M;  3PNV A;  4NSO B;  4XGI A;  1DGH A;  3C3E A;  1JR3 D;  1XMO M;  1ZAE A;  3QWL A;  5ITY A;  2RRU A;  1W5S A;  3QAU A;  4IIW A;  3U6P A;  2KXE A;  7CAT A;  4TUW A;  4MGK E;  2FS1 A;  3I4Y A;  2QEN A;  3LQQ A;  5ITX E;  1DGH B;  4IBG A;  5H37 D;  2OOB A;  3SC3 A;  5EQT A;  4B7G A;  3GLG A;  3HJ8 A;  1G4A E;  1YUB A;  2L6O A;  2Z4R A;  4JI1 M;  3U6Q A;  4MGZ E;  1TDH A;  1PJI A;  2JY7 A;  2L7I A;  2VQE M;  1Q3C A;  3NBX X;  4I5S A;  5EP2 A;  3UMM A;  2H1R A;  3J27 B;  5ITQ A;  3A46 A;  4JI6 M;  4AI6 A;  3B7Z A;  4HLQ A;  4G6Z A;  4BB9 A;  3SAW A;  3MJ5 A;  1KYI A;  3K2L A;  3ZCB B;  4JXJ A;  4DR5 M;  4LJ7 A;  1JQJ C;  1SXJ B;  2R62 A;  2Y0T A;  4B08 A;  2F5S A;  4I4L A;  2F5P A;  3FTE A;  1AIP C;  1TDZ A;  2I7P A;  1NNJ A;  3C58 A;  1HNW M;  2JZ0 A;  1IN7 A;  2MRO B;  4D82 A;  4PDI A;  2ZTD A;  2EO2 A;  3GLF B;  4UN2 B;  1IN6 A;  1YLA A;  2N35 A;  3TE6 A;  4CJ6 A;  3CGW A;  4DV2 M;  2CP8 A;  2XZU A;  2G5G X;  3LQR A;  3B9P A;  3HHW A;  2DNA A;  2Z3X A;  3FKE A;  3HHX A;  1S3S A;  2EJS A;  3I04 M;  4G3O A;  2M5Z A;  1L2B A;  4QNM A;  4G4Q A;  1SXJ D;  1WJ7 A;  3FUV A;  1XB2 B;  3AOE C;  2C98 A;  1XNQ M;  2UXB M;  1L8Q A;  3FUW A;  4GRI A;  4RNA A;  1D0L A;  1NJF A;  2DZO B;  2E5L M;  3VKH A;  5EP1 A;  4X65 M;  3SAV A;  4LGM A;  2DWN A; 
#chains in the Genus database with same CATH homology
 1D2N A;  2XGN A;  3K8Z A;  1QAM A;  2D7E A;  3FTC A;  3SMP A;  5LMU M;  2DVW B;  5BPV A;  3I4V A;  4QHT A;  4FD2 A;  3U60 B;  2V1U A;  2CV1 A;  1J7K A;  2G8L A;  1GL6 A;  2P5T A;  3KXE C;  3GO8 A;  4NXM M;  4G4N A;  1LV7 A;  2XEP A;  2ZAN A;  1HQY E;  3THG A;  4B7H A;  2XFT A;  3GLH A;  3A98 B;  1N33 M;  4JI4 M;  1IXS B;  3KP1 E;  1IY2 A;  2UXC M;  4LF4 M;  4I81 A;  5FTN A;  1IY1 A;  2LWX A;  3CF2 A;  3GLI A;  2DHR A;  3U6E A;  3SAR A;  1QAQ A;  2FE8 A;  4MB7 A;  3TPZ A;  1Z6T A;  3U6S A;  2Q2E B;  5E6J A;  5GKN A;  4B3T M;  3FYC A;  5EXX A;  1QAN A;  4L78 A;  4AZF A;  4JI0 M;  1XNR M;  2QCU A;  2Y0Q A;  2XFS A;  4ZPX A;  4FVM A;  1J09 A;  1DGF A;  1EE8 A;  2D7G A;  4LFC M;  2XSZ D;  2CUZ A;  1QAO A;  5DNY A;  1OJL A;  2DWZ B;  4II7 A;  3PVS A;  3TL4 X;  2YFQ A;  4FWD A;  2F5Q A;  1Z5C A;  1I4W A;  4LFA M;  1IN4 A;  3RGS A;  1K82 A;  5ITR A;  3SHF A;  4NRW A;  5C1B A;  2C99 A;  1QQW A;  1JR3 A;  4M9Z A;  3MK6 A;  1Q39 A;  2UU9 M;  4G4O A;  1G41 A;  4DV4 M;  2C9C A;  1OFH A;  1PJJ A;  4LJ5 A;  1N36 M;  2L7H A;  2QBY A;  1UM8 A;  5EJC A;  4KO8 A;  4QOZ C;  4M9S A;  3GRR A;  3KOZ E;  4KHP M;  2UXD M;  3M0E A;  3H4M A;  3AOG A;  3L28 A;  4OVZ B;  1YSY A;  2FOI C;  2X49 A;  3DFZ A;  4BLC A;  4YHH M;  3FUU A;  2ZBK B;  3ZH9 B;  1G59 A;  3EIE A;  1C1K A;  2FFJ A;  4MGY E;  2V1C A;  1DO2 A;  1NHG C;  4S12 A;  4X62 M;  3J2P B;  5KPT A;  2F4V M;  1DGB A;  1YE9 A;  4AG5 A;  5KPZ A;  2R46 A;  3AL0 C;  4W5W A;  4LJA A;  2EUC A;  4DUZ M;  3KOY E;  4DV0 M;  3HHY A;  4IBJ A;  4OU7 A;  3HWS A;  1G3I A;  3ZC7 B;  3M7G A;  1L2D A;  1NY6 A;  1SXJ A;  4AKH A;  1HR0 M;  3E4R A;  4FWG A;  2ZAO A;  1TH3 A;  3U5Z B;  1GKI A;  3GLF A;  4OX9 M;  3KW6 A;  4ITQ A;  3L26 A;  3VK8 A;  2Z4S A;  4LF7 M;  2Y21 A;  4IBI A;  1NJG A;  4PCZ A;  3U6O A;  3VK7 A;  3SHG B;  2VQF M;  5IT9 S;  2CV0 A;  4GH9 A;  2F5N A;  1QZM A;  3GRU A;  4JI3 M;  4GC9 A;  3LVW A;  4GHL A;  5FSW A;  2UUC M;  5KO3 A;  3SYK A;  2KW0 A;  5EP3 A;  4B3S M;  4BBA A;  2UUB M;  3FTD A;  2XF3 A;  1DO0 A;  3ILK A;  1GLN A;  4X64 M;  4FW9 A;  3U60 A;  4WW0 A;  3SYL A;  3SFZ A;  3SAU A;  1NVM A;  2OPF A;  3JR4 A;  4A3V B;  4DR2 M;  1IN5 A;  1T3T A;  5ITU A;  1QVR A;  2KRK A;  4M0W A;  4R7G A;  2CV2 A;  1IBL M;  4D80 A;  2LNH C;  4MGI E;  4AG6 A;  4AQY M;  2QPA A;  2FNA A;  2ZAM A;  1IQP A;  4IBD A;  1ZQ9 A;  1N77 A;  3VKG A;  1L1T A;  2HL7 A;  2R65 A;  2XSZ A;  4QHS A;  5IZ7 D;  3JR5 A;  2JA2 A;  3GQ4 A;  2F5O A;  1OFI A;  4LJ4 A;  4LY6 A;  3KFU G;  3IG5 A;  3MHV C;  3SBJ A;  3GP1 A;  3RE8 A;  4CGY B;  1FJG M;  3CF6 E;  3VLF B;  4LF6 M;  3PXG A;  1IN8 A;  3CTW B;  3T38 A;  4LG2 A;  3HU2 A;  3FUX A;  2BNK A;  4B3M M;  3K92 A;  3PFI A;  4L4U A;  3RGP A;  2BJW A;  4GIP A;  1TGU A;  1E32 A;  3IG8 A;  1HQC A;  2DZN B;  4LF9 M;  1QYR A;  4DV7 M;  3FTF A;  5KQ8 A;  2X8A A;  3E9S A;  1PM5 A;  1R2Z A;  1IBM M;  3U6L A;  3R9X B;  3LVV A;  1XXH B;  3VFD A;  2CHV A;  3AV0 A;  4JN6 A;  3FD9 A;  1KSF X;  2KZS A;  3U6D A;  4DV1 M;  3D8L A;  1N32 M;  4OVZ A;  2K47 A;  3DZD A;  3UK6 A;  3VDP A;  4JV5 M;  2Y20 A;  5KPR A;  2CE7 A;  4IJF A;  1MX0 A;  1N78 A;  2CFO A;  4Z8X A;  4MH0 E;  3HU1 A;  2UUA M;  4MM3 B;  2YNM D;  2XLJ A;  3GRY A;  4IBK A;  5C18 A;  1SXJ E;  1Z5B A;  3NWL A;  2R4E A;  4LJ8 A;  2VII A;  3W0F A;  3HJQ A;  4L15 A;  1TH2 A;  3KS4 A;  4D81 A;  4JI2 M;  2KEB A;  2D7H A;  4CHT B;  3GQ5 A;  3EIH A;  2LH0 A;  2I7N A;  1N75 A;  1Z59 A;  1DGG A;  4B3R M;  3WHL A;  4DR6 M;  4LRT A;  1VDD A;  3U5Z A;  3AOE A;  3U6M A;  1R2Y A;  4CIS A;  4AW4 A;  3L25 A;  3JAM S;  3KOX E;  2NQ8 C;  4NRV A;  4K0K M;  4HL4 A;  2YR0 A;  2EA0 A;  2DXI A;  1XC8 A;  5FTK A;  2XH9 A;  2KRU A;  4I8O A;  3L29 A;  4DV6 M;  4OW0 A;  1E9R A;  1GL7 A;  2HKJ A;  3OTO M;  3CF0 A;  2OQ4 A;  3BOS A;  4LZZ A;  5EP4 A;  3VDU A;  4X66 M;  3L27 A;  3UZU A;  3U61 B;  4MGH A;  3K1J A;  4NXN M;  2M60 A;  5EXS A;  5FLX S;  1G8P A;  4LF8 M;  5KQD A;  1HT2 E;  4DR4 M;  1NY5 A;  4M0D A;  4AKG A;  3TQS A;  4LFB M;  3T1Y M;  1J5E M;  2V6Z M;  4JI8 M;  5F3W A;  3TWM A;  1IY0 A;  3GLG B;  4GHA A;  2Z7J A;  4GC5 A;  4IBB A;  3I51 A;  1E94 E;  4DV5 M;  5IWA M;  5IRE B;  3LMM A;  3R8F A;  2R18 A;  2DWL A;  3A45 A;  3L2A A;  4L8R C;  1K3X A;  4LGY A;  3GPP A;  4RF0 A;  3Q8X A;  2CHQ A;  5ITX A;  3PNY A;  4JI7 M;  4EIW A;  2C96 A;  4KOD A;  3GPX A;  1HNX M;  3SAS A;  1NSF A;  3AKZ A;  2RKO A;  4GIT A;  3HKP A;  4GKK M;  4LJ9 A;  5LMN M;  2RGH A;  2DWM A;  4B7F A;  1XHB A;  3UGJ A;  5FTM A;  3UJN A;  3J7B A;  1L1Z A;  1HT1 E;  4KLN A;  1MU5 A;  3DOA A;  5EXP A;  3T15 A;  5A2Q S;  1X37 A;  1SXJ C;  1R6B X;  2YQZ A;  4AKI A;  1E9S A;  4Z6Y A;  3DA1 A;  2R45 A;  3A42 A;  4PT5 A;  1W5T A;  4WUR A;  2AHM A;  3GQ3 A;  4DR1 M;  3AJI B;  4R3D A;  1IBK M;  4FCT A;  1TH4 A;  5DYI A;  1K3W A;  4DR7 M;  3TWK A;  2LXE A;  4G4R A;  4LJ6 A;  5E26 A;  3J81 S;  1XXH A;  4IBF A;  3GPY A;  4FCV A;  4DR3 M;  1KFV A;  4FCW A;  4GMQ A;  2A5Y B;  1GVN A;  4LF5 M;  1FNN A;  2C9O A;  2QP9 X;  3SAT A;  5EXT A;  2J7O A;  4IBE A;  4DV3 M;  2X4A A;  3U6C A;  2L09 A;  4JI5 M;  4PD2 A;  1IM2 A;  1Q3B A;  4IBC A;  3GLH B;  4NL4 H;  1L2C A;  4L16 A;  3W0L B;  5ITT A;  3TWL A;  2XZF A;  3SMS A;  3GRV A;  1ORY B;  3HJS A;  4M9X A;  2CHG A;  3GLI B;  1WXQ A;  1I94 M;  4LRS A;  3J80 S;  3HHZ A;  3KP0 E;  2HCB A;  4QNR A;  4PDG A;  4REZ A;  2CEA A;  2KA6 B;  3FUT A;  2C5R A;  1R7R A;  3KVW A;  2O5R A;  2QZ4 A;  3HU3 A;  4NSR A;  4GKJ M;  4NOO B;  3RFW A;  3J7A S;  2KZU A;  5DYG A;  1NHW C;  3KSJ A;  1Z5A A;  3KS8 A;  1XMQ M;  1IXZ A;  2BJV A;  5JI3 E;  5BR8 M;  4JYA M;  1IXR C;  2RGO A;  4XBO A;  2ZM6 M;  1HNZ M;  1XWI A;  4DUY M;  3M6A A;  2ERC A;  5JI2 E;  5FTJ A;  2HHH M;  3KSX A;  4LZJ A;  4RF1 A;  3FYD A;  4IJE A;  5FTL A;  3T1H M;  3HGI A;  3WHK A;  8CAT A;  3GPU A;  3D8B A;  3KOW E;  3AFH A;  4P16 A;  2QBY B;  3NBI A;  4FWH A;  4QOS A;  3KDS E;  1NNU C;  1H6U A;  2R4J A;  3U61 A;  2W82 A;  2J7N A;  4LCB A;  1N34 M;  4YY3 M;  3PNV A;  4NSO B;  4XGI A;  1DGH A;  1JR3 D;  1XMO M;  1ZAE A;  3QWL A;  5ITY A;  3U6P A;  1W5S A;  3QAU A;  4IIW A;  4TUW A;  2KXE A;  7CAT A;  4MGK E;  3I4Y A;  2QEN A;  3LQQ A;  5ITX E;  1DGH B;  4IBG A;  5H37 D;  3SC3 A;  5EQT A;  4B7G A;  3GLG A;  3HJ8 A;  1G4A E;  1YUB A;  2L6O A;  2Z4R A;  4JI1 M;  3U6Q A;  4MGZ E;  1TDH A;  1PJI A;  2L7I A;  2VQE M;  1Q3C A;  4JI6 M;  4I5S A;  5EP2 A;  3UMM A;  2H1R A;  3J27 B;  5ITQ A;  3A46 A;  4AI6 A;  4HLQ A;  4G6Z A;  4BB9 A;  3SAW A;  3MJ5 A;  1KYI A;  3K2L A;  3ZCB B;  4JXJ A;  4DR5 M;  4LJ7 A;  1JQJ C;  1SXJ B;  2R62 A;  2Y0T A;  4B08 A;  2F5S A;  4I4L A;  2F5P A;  3FTE A;  1TDZ A;  2I7P A;  1NNJ A;  3C58 A;  1HNW M;  1IN7 A;  4D82 A;  4PDI A;  2EO2 A;  3GLF B;  1IN6 A;  3TE6 A;  4DV2 M;  2XZU A;  2G5G X;  3LQR A;  3B9P A;  3HHW A;  2Z3X A;  3FKE A;  3HHX A;  1S3S A;  2M5Z A;  1L2B A;  4QNM A;  4G4Q A;  1SXJ D;  3FUV A;  3AOE C;  1XNQ M;  2C98 A;  2UXB M;  1L8Q A;  3FUW A;  4GRI A;  4RNA A;  2E5L M;  1NJF A;  2DZO B;  3VKH A;  5EP1 A;  4X65 M;  3SAV A;  4LGM A;  2DWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...