2EA0A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli in complex with ap-site containing dna substrate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
254
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 5'-D(P*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrate and mutations of critical residues
rcsb
source organism Escherichia coli
total genus 84
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ea0A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2ea0A01
5LMNM 3U6MA 4JI3M 3GO8A 5ITXE 1TDHA 4DR2M 1MU5A 4X62M 4DR3M 4MB7A 4DR7M 3W0FA 1Z5AA 3J80S 3U6CA 4KHPM 3OTOM 1XC8A 2UXBM 3SAVA 1XNQM 4NXNM 5IT9S 2UXCM 4JI6M 2F5SA 4JI1M 3SAUA 3GQ3A 3GQ4A 3SASA 2F5QA 3SAWA 3VK7A 3TWKA 3JAMS 4B3RM 1KFVA 3U6OA 4JI5M 1Z5CA 3JR4A 2HKJA 1J5EM 1PM5A 3A46A 4JI7M 2UU9M 4X64M 1N34M 4LF6M 4G4OA 4LF5M 4LF9M 1N33M 4JYAM 4DV5M 3T1YM 4PDIA 1TDZA 4NRWA 3U6QA 4JI0M 5BR8M 3GP1A 4G4QA 2F5PA 1EE8A 4DUYM 4JI4M 4DV4M 4LF8M 2OPFA 4B3TM 1XMOM 2HHHM 1PJJA 4B3MM 1HR0M 4OX9M 1FJGM 2F4VM 4G4RA 1L1ZA 3SARA 1HNWM 4DR1M 4GKKM 2UXDM 1I94M 4X65M 4G4NA 1K3XA 4PCZA 4YY3M 1L1TA 1MX0A 3J81S 3JR5A 1L2CA 4ITQA 2ZBKB 2OQ4A 3U6EA 3SATA 3U6LA 4LF7M 5IWAM 1IBMM 1IBKM 3C58A 2EA0A 1Q3BA 1L2BA 5ITTA 4LFBM 4DV6M 1R2YA 2XZFA 1XNRM 4DR6M 4DR5M 4JI2M 3U6DA 3VK8A 1K82A 4DV7M 1XMQM 1N36M 3GQ5A 3U6PA 3T1HM 5ITQA 4PD2A 4NXMM 4LFAM 4JI8M 3GPXA 1N32M 3GPPA 3A45A 4B3SM 3U6SA 5ITYA 5A2QS 5FLXS 2XZUA 3TWLA 4K0KM 4DV0M 2UUCM 5ITUA 4X66M 1PJIA 5ITXA 2F5NA 2Q2EB 2VQFM 2UUAM 4AQYM 3J7AS 3GPUA 5LMUM 3GPYA 1NNJA 1R2ZA 4GKJM 1Z59A 2E5LM 4CISA 1HNXM 4DV3M 4NRVA 4JV5M 4DUZM 4DV2M 1Q39A 1K3WA 1Z5BA 2VQEM 1HNZM 3TWMA 4DR4M 3SBJA 3A42A 4YHHM 4LF4M 2F5OA 4DV1M 5ITRA 2ZM6M 1IBLM 2UUBM 1Q3CA 4LFCM 3DOAA 1L2DA 4PDGA
chains in the Genus database with same CATH superfamily
3U61B 4B7GA 3GO8A 5ITXE 4LCBA 1TDHA 2CEAA 2QP9X 3B89A 3NBIA 4X62M 1GJTA 4MB7A 1VEKA 2I7PA 1SXJD 1T43A 2M5ZA 3AJIB 3MMPA 5C1BA 2JNHA 4FCVA 4KODA 5BPVA 3M6AA 3B7ZA 3HY5A 3NWLA 3PVSA 1T6OA 4LGMA 3UGJA 3T38A 1GO5A 1GVNA 3E9SA 1IN7A 1VEGA 4MM3B 3WHLA 2CV2A 3T1YM 3AFHA 4FCTA 2KNZA 1G3IA 1HT1E 2CHVA 1D2NA 1QAQA 2F5QA 3ZC7B 1NJFA 2R6FA 3FE3A 3KDSE 4F2LA 3I01M 1OAOC 1Z5CA 4CGYB 3JR4A 1J5EM 1Q02A 1PM5A 2UU9M 2CE7A 2O01F 5KO3A 1OAIA 1N34M 1N33M 2FE8A 2MJ5B 1UFZA 1KSFX 4MGHA 1GL6A 2MH8A 3U6QA 2OO9A 2F5PA 1X37A 3GP1A 3ILKA 1EE8A 4JI4M 4IBGA 3CTWB 5DYGA 2DI0A 4W5WA 3A98B 1XMOM 3FKEA 2HHHM 2L4EA 4B3MM 5C18A 4XBOA 1JQJC 3MHVC 5L8RF 1RU3A 2G5GX 3CF2A 5FTKA 2CHQA 4KT0F 1HNWM 1ZMUA 2UXDM 1QDTA 4G6ZA 4BB9A 1E9SA 2HAKA 4MGKE 2RGHA 1L1TA 1YUBA 1MX0A 2RGOA 4Q7JA 4BBAA 3FUWA 4B7FA 3J81S 3JR5A 2ZBKB 2OQ4A 4FW9A 4L78A 5E26A 2O25A 1EFUB 4M9ZA 4AG6A 4L6V6 2X8AA 4WW0A 3GLGA 5KQDA 1WGLA 4D82A 1Q3BA 1JR3A 3BBZA 1H6UA 3Q8XA 2OOAA 4AW4A 4DR5M 2KRUA 2FNAA 3GLIA 3GLFA 2DAIA 3C9PA 1WXQA 4XGIA 3VK8A 1GJSA 3PNYA 4MH0E 3L26A 3J7BA 3T15A 1ZMVA 4UN2B 2Z8YM 4R3DA 1QYRA 3AOGA 3Q8GA 1V92A 4GC9A 2ZANA 1G41A 3L25A 3KOXE 1VG5A 2KNVA 4FCWA 4LJ5A 4B3SM 5FLXS 3LW5F 2XSZA 1FNNA 2ZAMA 1XXHB 3J27B 2K0BX 1PJIA 1T3TA 5JI3E 1N75A 2BNKA 3GLHA 2R45A 4PT5A 4L15A 4RNAA 5DNYA 1PJSA 2R44A 3U60A 1QAMA 4JN6A 2EO2A 2QBYB 1R2ZA 1QUTA 1Z59A 5FTMA 3K1JA 2KRKA 4L4UA 2DWLA 4CISA 1OKSA 4LY6A 4DV3M 4JV5M 1IM2A 1DGFA 2LVPC 2R4JA 4D80A 3TWMA 3M0EA 4GMQA 4DR4M 2J7OA 5EXXA 3R9XB 2JA2A 5FTJA 2QQ8A 3CF0A 3HZJA 2UUBM 2DAMA 4CIZA 3DA1A 3HHWA 1ZMWA 1VEJA 3R8FA 2CWBA 1TH2A 3U6MA 4JXJA 1AUAA 2BJVA 1J7KA 3MJ5A 2HWJA 2Z4SA 4B7HA 4QOSA 2Z7JA 2KXEA 2CHGA 1IN5A 4KHPM 2UXBM 4IBIA 1D0MA 2BWEA 4XK8F 1UM8A 1ZV1A 2CV0A 2LNHC 3GLHB 2AHMA 4NXNM 2DAEA 3B7NA 1E94E 2UXCM 4JI1M 2LTUA 2XGNA 3GQ3A 2L7IA 2H1RA 3SASA 4NC6A 3SAWA 4B3RM 4IBKA 2LVAA 1IXSB 1G59A 2XFSA 2JY7A 1D0LA 4JI5M 3HJ8A 4QHSA 2LVQD 2XEPA 3A46A 3VLFB 2DZNB 1TF0B 2A5YB 2GNOA 3KP0E 4X64M 2QSFX 4LF5M 4R7GA 3D8LA 4OVZA 2G8LA 4AKIA 3GRUA 5EP2A 4G4QA 3BOSA 3AOEA 2L2DA 3HU2A 2OPFA 4LF8M 2NQ8C 3FRHA 3QWLA 4R71A 2JY5A 5FSWA 3SYKA 1R6BX 2F4VM 3SFZA 1QAOA 1L1ZA 1R5LA 1XXHE 2FOIC 3SC3A 2APLA 2V1CA 3FUXA 3VFDA 1IN8A 3FYDA 3ZH9B 1GL7A 1TH3A 3FUUA 1C1KA 1D0KA 2C96A 2R18A 3LVWA 1KYIA 3RGPA 3GLGE 2J7NA 1R7RA 4LZZA 1TR8A 5IWAM 4IJEA 2Z3XA 1JR3E 1HJPA 2MGWA 3UZUA 3BXWA 1QZEA 2XLJA 1L2BA 4IBCA 2V1UA 1DO0A 4LJ4A 4AZFA 1IY1A 4LRSA 3UMMA 2YR0A 3RE8A 2M60A 3L28A 1TH4A 3GLFE 3KVWA 4DV6M 2XZFA 4GHLA 2JY8A 1NV9A 1OIPA 2KHHA 1OFHA 4FWGA 2D7EA 4DV7M 2EKFA 1G8PA 3FRIA 4FD2A 4NSRA 1N36M 2R4EA 3IG8A 5DYIA 4LFAM 4L16A 4JI8M 3TQSA 3HHZA 1G4AE 3H4JA 2V6ZM 1DGHA 3TPZA 3HGIA 1YSYA 3U6SA 5ITYA 1PGYA 2C9CA 2XZUA 3GLHE 1PJTA 1V33A 1GKIA 2DWZB 2P5TA 4A3VB 4DV0M 4K0KM 2Y0QA 3H4MA 5ITUA 1HT2E 5ITXA 2KDLA 2UUAM 4AQYM 4Z8XA 3GPUA 3HJQA 3K9OA 3GPYA 1TTEA 1NHGC 2JP7A 4HEOA 4M9SA 1NNJA 1OIZA 1VDDA 2ZTCA 2C5RA 3KOWE 2KEBA 3FYCA 4D81A 3DZDA 4NRVA 1P3QQ 1ZAEA 2BJWA 2LWXA 4KLNA 2VQEM 1HNZM 4CHTB 1OJLA 1OQYA 3SBJA 1TGUA 3TL4X 2BWBA 2X49A 3KSJA 2F5OA 5ITRA 2C99A 4EIWA 1IBLM 1PRBA 3HWSA 4LFCM 4KO8A 2DZOB 4LF6M 2WSEF 5LMNM 2FH0A 1WR1B 4JI3M 2L4FA 3TE6A 2B3TA 2WZJA 1DGGA 4IBEA 4DR3M 2LH0A 3RFWA 3W0FA 4Z6YA 2XH9A 1XB2B 3LVVA 3FUVA 3U6CA 1SXJA 1XC8A 5EJCA 3SAVA 1QZMA 3L2AA 1Z6TA 2DWMA 1XNQM 1XWIA 2ZTDA 3FD9A 4LGYA 2HCBA 3AOEC 3GLGB 3ZQJA 3LQQA 3HJSA 4S12A 5EQTA 3HX3A 5EP3A 4ANRA 1C7YA 4IIWA 5E6JA 4FWDA 2MR9A 3VK7A 2G3QA 3W68A 1ORYB 3JAMS 2XFTA 3GLFB 3GLIB 2D7GA 2R0IA 4P16A 3U6OA 1WIVA 4HLQA 2HKJA 4NL4H 5EXTA 3AV0A 2CP8A 4JI7M 1L8QA 3GRVA 5DFLA 2CFOA 2XF3A 3L29A 3I4YA 3LCVB 1E9RA 4JYAM 1WJ7A 2LHGA 1LTMA 4HL4A 1QVRA 4PDIA 4DV5M 2YNMD 2DZLA 4LJ6A 5BR8M 4DUYM 3FTDA 3IHPA 4NSOB 2YFQA 3QYBA 3PXGA 1R2YA 1QUSA 4TUWA 5EP1A 2DKLA 3LMMA 1MJGM 1PJJA 1JB0F 4OX9M 1FJGM 3QAUA 1GABA 3EIHA 2J5YA 4G4RA 4LJ9A 4GKKM 2WSCF 2LHCA 4QOZC 2QPAA 4M0DA 2CRUA 3U61A 2K6BA 3HU1A 2CUZA 4G4NA 2JY6B 3U60B 3U5ZA 4OW0A 3FTFA 3B7QA 1J09A 2QCUA 1W5SA 3HU3A 3KSXA 4ITQA 3KOYE 3SATA 2D7HA 3QYEA 3VKGA 4LF7M 1NJGA 5KPRA 2KA6B 3E21A 4P17A 1JR3D 4OU7A 2H5XA 2K9DA 5ITTA 2EKKA 2WSFF 3AL0C 2JZ1A 4DR6M 3KS8A 1PJQA 2I7NA 2L09A 4JI2M 2JXNA 2DHYA 3SHFA 4LRTA 4LJ8A 1IN4A 3GRYA 2LVOC 4GHAA 1K82A 3GQ5A 4I4LA 3U6PA 3T1HM 1EIJA 4PD2A 4LJAA 4QNMA 4MGZE 5GKNA 4WP2A 2KZSA 1XHBA 4IJFA 4AKGA 1IQPA 1G71A 3DFZA 4LZJA 3GPPA 3HHXA 3I04M 2XSZD 3THGA 3W67A 4G3OA 1CUKA 3E4RA 2MROB 3TWLA 3U5ZB 2Y20A 1VDLA 2O5RA 2F5NA 2VDBB 2Q2EB 3LCUA 2VIIA 4II7A 5IZ7D 4WURA 2VQFM 4B08A 3KXEC 3GLIE 4MGIE 3L27A 2DVWB 1SXJC 1A5TA 2E5LM 1WHCA 1IXRC 4OVZB 4CJ6A 2EUCA 4GRIA 4DUZM 1YE9A 5EXSA 2FFJA 5F3WA 1K3WA 1Z5BA 3FUTA 5KQ8A 3NBXX 4DBGB 3M7GA 4LF4M 2KNAA 3PNVA 3KW6A 3HKPA 5H37D 4IBFA 2ZM6M 3RGSA 3WHKA 4FVMA 1LV7A 4IBDA 3UK6A 2VF7A 4AI6A 3FTCA 3C3DA 3VDPA 3K92A 5IREB 7CATA 1MU5A 4DR2M 1VQ1A 2R65A 1SXJE 2OOBA 4DR7M 1Z5AA 2DNAA 3J80S 1E32A 5FTNA 3C3EA 2ERCA 1N78A 3OTOM 1IFYA 2C9OA 3J2PB 2CV1A 3GRRA 1Y8GA 2LXEA 3F92A 1NSFA 2Z4RA 4L8RC 1QQWA 2RKOA 5EXPA 5IT9S 3SMSA 4JI6M 4I81A 2F5SA 2Y0TA 2HL7A 3IG5A 3SAUA 4AKHA 1V34A 3GQ4A 2KW0A 3AKZA 1XXHA 4LJ7A 2FS1A 3K8ZA 1NO1A 1W5TA 3TWKA 4F1IA 1NVMA 1R4GA 2K47A 4RF1A 1KFVA 3D8BA 4GEWA 4ZPXA 2JWSA 2R62A 4M9XA 3SYLA 2GQFA 4G4OA 4RF0A 2QBYA 4LF9M 2L7HA 4QNRA 1BVSA 4QHTA 2L6OA 1DGHB 2R46A 1HQYE 1TDZA 4NRWA 2ZAOA 2JZ0A 4JI0M 4GITA 4DV4M 5EP4A 4B3TM 1QDRA 4FWHA 1HR0M 5JI2E 3K2LA 1WGNA 2DHRA 3T6PA 3SARA 4DR1M 3MK6A 1NV8A 1I94M 4X65M 1AIPC 2DAKA 2Y21A 4PCZA 4YY3M 1K3XA 2QZ4A 4GIPA 2X4AA 3EIEA 1L2CA 3U6EA 2C98A 3W0LB 3U6LA 1IN6A 2KZUA 3KP1E 2W82A 5FTLA 2VF8A 3KFUG 2EJSA 1OTRA 3E46A 3IECA 3KOZE 4I5SA 1IBMM 1IBKM 3C58A 2EA0A 8CATA 4REZA 3FTEA 2DXIA 1XNRM 4GH9A 1DGBA 3KS4A 3SHGB 5KPTA 1MN3A 3CF6E 2QNJA 1IY2A 3B74A 4BLCA 1IXSA 2DENA 3U6DA 2YQZA 1I4WA 2QENA 3UJNA 1SXJB 1XMQM 2QHOB 5ITQA 4NXMM 3ZCBB 3GPXA 1N32M 2DAGA 1NY6A 3A45A 4M0WA 2N35A 1DO2A 5A2QS 3HHYA 4I8OA 5KPZA 3VKHA 2UUCM 4X66M 1N77A 3I51A 3SMPA 3V76A 3J7AS 3B9PA 1IY0A 2RRUA 3I4VA 1NY5A 5LMUM 1QANA 1OFIA 1YLAA 2JUJA 4NOOB 4GKJM 1F4IA 1S3SA 1HNXM 3LQRA 2LBCA 4DV2M 2DWNA 1Q39A 4LG2A 1NNUC 1ZQ9A 4Y28F 3A42A 4YHHM 1NHWC 4LFBM 1IXZA 2LVNC 3VDUA 4DV1M 1HQCA 1SG9A 3PFIA 4GC5A 4IBJA 1GLNA 3K9PA 4MGYE 4AG5A 3CGWA 1DV0A 1Q3CA 4IBBA 3DOAA 1L2DA 4PDGA 4RKUF
chains in the Genus database with same CATH topology
3U61B 4B7GA 3GO8A 5ITXE 4LCBA 1TDHA 2CEAA 2QP9X 3NBIA 4X62M 4MB7A 2I7PA 1SXJD 2M5ZA 3AJIB 5C1BA 4FCVA 4KODA 5BPVA 3M6AA 3PVSA 3NWLA 4LGMA 3UGJA 3T38A 1GVNA 3E9SA 1IN7A 3WHLA 4MM3B 2CV2A 3AFHA 4FCTA 1G3IA 1HT1E 2CHVA 1D2NA 1QAQA 2F5QA 3ZC7B 1NJFA 3KDSE 1Z5CA 4CGYB 3JR4A 1J5EM 1PM5A 2UU9M 2CE7A 5KO3A 1N34M 1N33M 2FE8A 1KSFX 4MGHA 1GL6A 3U6QA 2F5PA 1X37A 3GP1A 3ILKA 1EE8A 4JI4M 4IBGA 3CTWB 5DYGA 4W5WA 3A98B 1XMOM 3FKEA 2HHHM 4B3MM 5C18A 4XBOA 1JQJC 3MHVC 2G5GX 3CF2A 1HNWM 5FTKA 2CHQA 2UXDM 4G6ZA 4BB9A 1E9SA 4MGKE 2RGHA 1L1TA 1YUBA 1MX0A 2RGOA 3J81S 4BBAA 3FUWA 4B7FA 3JR5A 2ZBKB 2OQ4A 4FW9A 4L78A 5E26A 4AG6A 4M9ZA 2X8AA 4WW0A 3GLGA 5KQDA 4D82A 1Q3BA 1JR3A 1H6UA 3Q8XA 4AW4A 4DR5M 2KRUA 2FNAA 3GLIA 3GLFA 1WXQA 4XGIA 3VK8A 3PNYA 4MH0E 3L26A 3J7BA 3T15A 4R3DA 1QYRA 3AOGA 4GC9A 2ZANA 1G41A 3L25A 3KOXE 4LJ5A 4FCWA 4B3SM 5FLXS 2XSZA 1FNNA 2ZAMA 1XXHB 3J27B 1PJIA 1T3TA 5JI3E 1N75A 2BNKA 3GLHA 2R45A 4PT5A 4L15A 4RNAA 5DNYA 3U60A 1QAMA 4JN6A 2EO2A 2QBYB 1R2ZA 1Z59A 5FTMA 3K1JA 2KRKA 4L4UA 2DWLA 4CISA 4LY6A 4DV3M 4JV5M 1IM2A 1DGFA 2R4JA 4D80A 3TWMA 3M0EA 4GMQA 4DR4M 2J7OA 5EXXA 3R9XB 2JA2A 5FTJA 3CF0A 2UUBM 3DA1A 3HHWA 3R8FA 1TH2A 3U6MA 4JXJA 2BJVA 1J7KA 3MJ5A 2Z4SA 4B7HA 4QOSA 2Z7JA 2KXEA 2CHGA 1IN5A 4KHPM 2UXBM 4IBIA 2CV0A 1UM8A 2LNHC 3GLHB 2AHMA 4NXNM 1E94E 2UXCM 4JI1M 2XGNA 3GQ3A 2L7IA 2H1RA 3SASA 3SAWA 4B3RM 4IBKA 1IXSB 1G59A 2XFSA 4JI5M 3HJ8A 4QHSA 2XEPA 3A46A 3VLFB 2DZNB 2A5YB 4X64M 3KP0E 4LF5M 4R7GA 3D8LA 4OVZA 2G8LA 4AKIA 3GRUA 5EP2A 4G4QA 3BOSA 3AOEA 4LF8M 3HU2A 2OPFA 2NQ8C 3QWLA 5FSWA 3SYKA 1R6BX 2F4VM 3SFZA 1QAOA 1L1ZA 2FOIC 3SC3A 2V1CA 3FUXA 3VFDA 1IN8A 3FYDA 3ZH9B 1GL7A 1TH3A 3FUUA 1C1KA 2R18A 2C96A 3LVWA 1KYIA 3RGPA 2J7NA 1R7RA 4LZZA 5IWAM 4IJEA 2Z3XA 3UZUA 2XLJA 1L2BA 4IBCA 2V1UA 1DO0A 4LJ4A 4AZFA 1IY1A 4LRSA 3UMMA 2YR0A 3RE8A 2M60A 3L28A 1TH4A 4DV6M 3KVWA 2XZFA 1R2YA 4GHLA 1OFHA 4FWGA 2D7EA 4DV7M 1N36M 1G8PA 4NSRA 4FD2A 2R4EA 3IG8A 5DYIA 4LFAM 4L16A 4JI8M 3TQSA 3HHZA 1G4AE 2V6ZM 1DGHA 3TPZA 3HGIA 1YSYA 3U6SA 5ITYA 2C9CA 2XZUA 2DWZB 4A3VB 1GKIA 2P5TA 4K0KM 4DV0M 2Y0QA 3H4MA 5ITUA 1HT2E 5ITXA 2UUAM 4AQYM 4Z8XA 3GPUA 3HJQA 3GPYA 4M9SA 1NHGC 1NNJA 1VDDA 2C5RA 3KOWE 2KEBA 3FYCA 4D81A 3DZDA 4NRVA 1ZAEA 2BJWA 2LWXA 4KLNA 2VQEM 1HNZM 4CHTB 1OJLA 3SBJA 1TGUA 3TL4X 2X49A 3KSJA 2F5OA 5ITRA 2C99A 4EIWA 1IBLM 3HWSA 4LFCM 4KO8A 2DZOB 4LF6M 5LMNM 4JI3M 3TE6A 4IBEA 1DGGA 4DR3M 2LH0A 3RFWA 3W0FA 4Z6YA 2XH9A 3LVVA 3FUVA 3U6CA 1SXJA 1XC8A 5EJCA 3SAVA 1QZMA 3L2AA 1Z6TA 2DWMA 1XNQM 1XWIA 3FD9A 4LGYA 2HCBA 3AOEC 3GLGB 3LQQA 3HJSA 4S12A 5EQTA 5EP3A 4IIWA 5E6JA 4FWDA 3VK7A 1ORYB 3JAMS 2XFTA 3GLFB 3GLIB 2D7GA 4P16A 3U6OA 4HLQA 2HKJA 4NL4H 5EXTA 3AV0A 4JI7M 1L8QA 3GRVA 2CFOA 2XF3A 3L29A 3I4YA 1E9RA 4JYAM 4DV5M 3T1YM 4HL4A 4PDIA 1QVRA 2YNMD 4LJ6A 5BR8M 4DUYM 3FTDA 4NSOB 2YFQA 3PXGA 4TUWA 5EP1A 3LMMA 1PJJA 4OX9M 1FJGM 3QAUA 3EIHA 4G4RA 4LJ9A 4GKKM 4QOZC 2QPAA 4M0DA 3U61A 3U60B 3HU1A 2CUZA 4G4NA 3U5ZA 4OW0A 3FTFA 1J09A 2QCUA 1W5SA 3HU3A 3KSXA 4ITQA 3KOYE 3SATA 2D7HA 3VKGA 4LF7M 1NJGA 5KPRA 2KA6B 1JR3D 4OU7A 5ITTA 3AL0C 4DR6M 3KS8A 2I7NA 2L09A 4JI2M 3SHFA 4LRTA 4LJ8A 1IN4A 3GRYA 4GHAA 1K82A 3GQ5A 4I4LA 3U6PA 3T1HM 4PD2A 4LJAA 4QNMA 4MGZE 5GKNA 4AKGA 2KZSA 1XHBA 4IJFA 1IQPA 3DFZA 4LZJA 3GPPA 3HHXA 2XSZD 3THGA 3E4RA 3TWLA 3U5ZB 2Y20A 2O5RA 2F5NA 2Q2EB 5IZ7D 2VIIA 4II7A 2VQFM 4WURA 4B08A 3KXEC 4MGIE 3L27A 2DVWB 1SXJC 2E5LM 1IXRC 4OVZB 2EUCA 4GRIA 4DUZM 1YE9A 5EXSA 2FFJA 5F3WA 1K3WA 1Z5BA 3FUTA 5KQ8A 3M7GA 4LF4M 3PNVA 3KW6A 3HKPA 5H37D 4IBFA 2ZM6M 3RGSA 3WHKA 4FVMA 1LV7A 4IBDA 3UK6A 4AI6A 3FTCA 3VDPA 3K92A 5IREB 7CATA 1MU5A 4DR2M 2R65A 1SXJE 4DR7M 1Z5AA 3J80S 1E32A 5FTNA 2ERCA 1N78A 3OTOM 2C9OA 3J2PB 2CV1A 3GRRA 2LXEA 1NSFA 2Z4RA 4L8RC 1QQWA 2RKOA 5EXPA 5IT9S 3SMSA 4JI6M 4I81A 2F5SA 2Y0TA 2HL7A 3IG5A 3SAUA 4AKHA 3GQ4A 2KW0A 3AKZA 1XXHA 4LJ7A 3K8ZA 1W5TA 3TWKA 1NVMA 2K47A 4RF1A 1KFVA 3D8BA 4ZPXA 2R62A 4M9XA 3SYLA 4G4OA 4RF0A 2QBYA 4LF9M 2L7HA 4QNRA 4QHTA 2L6OA 1DGHB 2R46A 1HQYE 1TDZA 4NRWA 2ZAOA 4JI0M 4GITA 4DV4M 5EP4A 4B3TM 4FWHA 1HR0M 5JI2E 3K2LA 2DHRA 3SARA 4DR1M 3MK6A 1I94M 4X65M 1K3XA 2Y21A 4PCZA 4YY3M 2QZ4A 4GIPA 2X4AA 3EIEA 1L2CA 3U6EA 2C98A 3W0LB 3U6LA 1IN6A 2KZUA 3KP1E 2W82A 5FTLA 3KFUG 4I5SA 3KOZE 1IBMM 1IBKM 3C58A 2EA0A 8CATA 4REZA 3FTEA 2DXIA 1XNRM 4GH9A 1DGBA 3KS4A 3SHGB 5KPTA 3CF6E 4BLCA 1IY2A 3U6DA 2YQZA 1I4WA 2QENA 3UJNA 1SXJB 1XMQM 5ITQA 4NXMM 3ZCBB 3GPXA 1N32M 4M0WA 1NY6A 3A45A 1DO2A 5A2QS 3HHYA 4I8OA 5KPZA 3VKHA 2UUCM 4X66M 1N77A 3I51A 3SMPA 3J7AS 3B9PA 1IY0A 3I4VA 1NY5A 5LMUM 1QANA 1OFIA 4NOOB 4GKJM 1S3SA 1HNXM 3LQRA 4DV2M 2DWNA 1Q39A 4LG2A 1NNUC 1ZQ9A 3A42A 4YHHM 1NHWC 4LFBM 1IXZA 3VDUA 4DV1M 1HQCA 3PFIA 4GC5A 4MGYE 4IBJA 1GLNA 4AG5A 1Q3CA 4IBBA 3DOAA 1L2DA 4PDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN M;  3U6M A;  4JI3 M;  3GO8 A;  5ITX E;  1TDH A;  4DR2 M;  1MU5 A;  4X62 M;  4DR3 M;  4MB7 A;  4DR7 M;  3W0F A;  1Z5A A;  3J80 S;  3U6C A;  4KHP M;  3OTO M;  1XC8 A;  2UXB M;  3SAV A;  1XNQ M;  4NXN M;  5IT9 S;  2UXC M;  4JI6 M;  2F5S A;  4JI1 M;  3SAU A;  3GQ3 A;  3GQ4 A;  3SAS A;  2F5Q A;  3SAW A;  3VK7 A;  3TWK A;  3JAM S;  4B3R M;  1KFV A;  3U6O A;  4JI5 M;  1Z5C A;  3JR4 A;  2HKJ A;  1J5E M;  1PM5 A;  3A46 A;  4JI7 M;  2UU9 M;  4X64 M;  1N34 M;  4LF6 M;  4G4O A;  4LF5 M;  4LF9 M;  1N33 M;  4JYA M;  4DV5 M;  3T1Y M;  4PDI A;  1TDZ A;  4NRW A;  3U6Q A;  4JI0 M;  5BR8 M;  3GP1 A;  4G4Q A;  2F5P A;  1EE8 A;  4DUY M;  4JI4 M;  4DV4 M;  4LF8 M;  2OPF A;  4B3T M;  1XMO M;  2HHH M;  1PJJ A;  4B3M M;  1HR0 M;  4OX9 M;  1FJG M;  2F4V M;  4G4R A;  1L1Z A;  3SAR A;  1HNW M;  4DR1 M;  4GKK M;  2UXD M;  1I94 M;  4X65 M;  4G4N A;  1K3X A;  4PCZ A;  4YY3 M;  1L1T A;  1MX0 A;  3J81 S;  3JR5 A;  1L2C A;  4ITQ A;  2ZBK B;  2OQ4 A;  3U6E A;  3SAT A;  3U6L A;  4LF7 M;  5IWA M;  1IBM M;  1IBK M;  3C58 A;  2EA0 A;  1Q3B A;  1L2B A;  5ITT A;  4LFB M;  4DV6 M;  1R2Y A;  2XZF A;  1XNR M;  4DR6 M;  4DR5 M;  4JI2 M;  3U6D A;  3VK8 A;  1K82 A;  4DV7 M;  1XMQ M;  1N36 M;  3GQ5 A;  3U6P A;  3T1H M;  5ITQ A;  4PD2 A;  4NXM M;  4LFA M;  4JI8 M;  3GPX A;  1N32 M;  3GPP A;  3A45 A;  4B3S M;  3U6S A;  5ITY A;  5A2Q S;  5FLX S;  2XZU A;  3TWL A;  4K0K M;  4DV0 M;  2UUC M;  5ITU A;  4X66 M;  1PJI A;  5ITX A;  2F5N A;  2Q2E B;  2VQF M;  2UUA M;  4AQY M;  3J7A S;  3GPU A;  5LMU M;  3GPY A;  1NNJ A;  1R2Z A;  4GKJ M;  1Z59 A;  2E5L M;  4CIS A;  1HNX M;  4DV3 M;  4NRV A;  4JV5 M;  4DUZ M;  4DV2 M;  1Q39 A;  1K3W A;  1Z5B A;  2VQE M;  1HNZ M;  3TWM A;  4DR4 M;  3SBJ A;  3A42 A;  4YHH M;  4LF4 M;  2F5O A;  4DV1 M;  5ITR A;  2ZM6 M;  1IBL M;  2UUB M;  1Q3C A;  4LFC M;  3DOA A;  1L2D A;  4PDG A; 
#chains in the Genus database with same CATH topology
 3U61 B;  4B7G A;  3GO8 A;  5ITX E;  4LCB A;  1TDH A;  2CEA A;  2QP9 X;  3B89 A;  3NBI A;  4X62 M;  1GJT A;  4MB7 A;  1VEK A;  2I7P A;  1SXJ D;  1T43 A;  2M5Z A;  3AJI B;  3MMP A;  5C1B A;  2JNH A;  4FCV A;  4KOD A;  5BPV A;  3M6A A;  3B7Z A;  3HY5 A;  3NWL A;  3PVS A;  1T6O A;  4LGM A;  3UGJ A;  3T38 A;  1GO5 A;  1GVN A;  3E9S A;  1IN7 A;  1VEG A;  4MM3 B;  3WHL A;  2CV2 A;  3T1Y M;  3AFH A;  4FCT A;  2KNZ A;  1G3I A;  1HT1 E;  2CHV A;  1D2N A;  1QAQ A;  2F5Q A;  3ZC7 B;  1NJF A;  2R6F A;  3FE3 A;  3KDS E;  4F2L A;  3I01 M;  1OAO C;  1Z5C A;  4CGY B;  3JR4 A;  1J5E M;  1Q02 A;  1PM5 A;  2UU9 M;  2CE7 A;  2O01 F;  5KO3 A;  1OAI A;  1N34 M;  1N33 M;  2FE8 A;  2MJ5 B;  1UFZ A;  1KSF X;  4MGH A;  1GL6 A;  2MH8 A;  3U6Q A;  2OO9 A;  2F5P A;  1X37 A;  3GP1 A;  3ILK A;  1EE8 A;  4JI4 M;  4IBG A;  3CTW B;  5DYG A;  2DI0 A;  4W5W A;  3A98 B;  1XMO M;  3FKE A;  2HHH M;  2L4E A;  4B3M M;  5C18 A;  4XBO A;  1JQJ C;  3MHV C;  5L8R F;  1RU3 A;  2G5G X;  3CF2 A;  5FTK A;  2CHQ A;  4KT0 F;  1HNW M;  1ZMU A;  2UXD M;  1QDT A;  4G6Z A;  4BB9 A;  1E9S A;  2HAK A;  4MGK E;  2RGH A;  1L1T A;  1YUB A;  1MX0 A;  2RGO A;  4Q7J A;  4BBA A;  3FUW A;  4B7F A;  3J81 S;  3JR5 A;  2ZBK B;  2OQ4 A;  4FW9 A;  4L78 A;  5E26 A;  2O25 A;  1EFU B;  4M9Z A;  4AG6 A;  4L6V 6;  2X8A A;  4WW0 A;  3GLG A;  5KQD A;  1WGL A;  4D82 A;  1Q3B A;  1JR3 A;  3BBZ A;  1H6U A;  3Q8X A;  2OOA A;  4AW4 A;  4DR5 M;  2KRU A;  2FNA A;  3GLI A;  3GLF A;  2DAI A;  3C9P A;  1WXQ A;  4XGI A;  3VK8 A;  1GJS A;  3PNY A;  4MH0 E;  3L26 A;  3J7B A;  3T15 A;  1ZMV A;  4UN2 B;  2Z8Y M;  4R3D A;  1QYR A;  3AOG A;  3Q8G A;  1V92 A;  4GC9 A;  2ZAN A;  1G41 A;  3L25 A;  3KOX E;  1VG5 A;  2KNV A;  4FCW A;  4LJ5 A;  4B3S M;  5FLX S;  3LW5 F;  2XSZ A;  1FNN A;  2ZAM A;  1XXH B;  3J27 B;  2K0B X;  1PJI A;  1T3T A;  5JI3 E;  1N75 A;  2BNK A;  3GLH A;  2R45 A;  4PT5 A;  4L15 A;  4RNA A;  5DNY A;  1PJS A;  2R44 A;  3U60 A;  1QAM A;  4JN6 A;  2EO2 A;  2QBY B;  1R2Z A;  1QUT A;  1Z59 A;  5FTM A;  3K1J A;  2KRK A;  4L4U A;  2DWL A;  4CIS A;  1OKS A;  4LY6 A;  4DV3 M;  4JV5 M;  1IM2 A;  1DGF A;  2LVP C;  2R4J A;  4D80 A;  3TWM A;  3M0E A;  4GMQ A;  4DR4 M;  2J7O A;  5EXX A;  3R9X B;  2JA2 A;  5FTJ A;  2QQ8 A;  3CF0 A;  3HZJ A;  2UUB M;  2DAM A;  4CIZ A;  3DA1 A;  3HHW A;  1ZMW A;  1VEJ A;  3R8F A;  2CWB A;  1TH2 A;  3U6M A;  4JXJ A;  1AUA A;  2BJV A;  1J7K A;  3MJ5 A;  2HWJ A;  2Z4S A;  4B7H A;  4QOS A;  2Z7J A;  2KXE A;  2CHG A;  1IN5 A;  4KHP M;  2UXB M;  4IBI A;  1D0M A;  2BWE A;  4XK8 F;  1UM8 A;  1ZV1 A;  2CV0 A;  2LNH C;  3GLH B;  2AHM A;  4NXN M;  2DAE A;  3B7N A;  1E94 E;  2UXC M;  4JI1 M;  2LTU A;  2XGN A;  3GQ3 A;  2L7I A;  2H1R A;  3SAS A;  4NC6 A;  3SAW A;  4B3R M;  4IBK A;  2LVA A;  1IXS B;  1G59 A;  2XFS A;  2JY7 A;  1D0L A;  4JI5 M;  3HJ8 A;  4QHS A;  2LVQ D;  2XEP A;  3A46 A;  3VLF B;  2DZN B;  1TF0 B;  2A5Y B;  2GNO A;  3KP0 E;  4X64 M;  2QSF X;  4LF5 M;  4R7G A;  3D8L A;  4OVZ A;  2G8L A;  4AKI A;  3GRU A;  5EP2 A;  4G4Q A;  3BOS A;  3AOE A;  2L2D A;  3HU2 A;  2OPF A;  4LF8 M;  2NQ8 C;  3FRH A;  3QWL A;  4R71 A;  2JY5 A;  5FSW A;  3SYK A;  1R6B X;  2F4V M;  3SFZ A;  1QAO A;  1L1Z A;  1R5L A;  1XXH E;  2FOI C;  3SC3 A;  2APL A;  2V1C A;  3FUX A;  3VFD A;  1IN8 A;  3FYD A;  3ZH9 B;  1GL7 A;  1TH3 A;  3FUU A;  1C1K A;  1D0K A;  2C96 A;  2R18 A;  3LVW A;  1KYI A;  3RGP A;  3GLG E;  2J7N A;  1R7R A;  4LZZ A;  1TR8 A;  5IWA M;  4IJE A;  2Z3X A;  1JR3 E;  1HJP A;  2MGW A;  3UZU A;  3BXW A;  1QZE A;  2XLJ A;  1L2B A;  4IBC A;  2V1U A;  1DO0 A;  4LJ4 A;  4AZF A;  1IY1 A;  4LRS A;  3UMM A;  2YR0 A;  3RE8 A;  2M60 A;  3L28 A;  1TH4 A;  3GLF E;  3KVW A;  4DV6 M;  2XZF A;  4GHL A;  2JY8 A;  1NV9 A;  1OIP A;  2KHH A;  1OFH A;  4FWG A;  2D7E A;  4DV7 M;  2EKF A;  1G8P A;  3FRI A;  4FD2 A;  4NSR A;  1N36 M;  2R4E A;  3IG8 A;  5DYI A;  4LFA M;  4L16 A;  4JI8 M;  3TQS A;  3HHZ A;  1G4A E;  3H4J A;  2V6Z M;  1DGH A;  3TPZ A;  3HGI A;  1YSY A;  3U6S A;  5ITY A;  1PGY A;  2C9C A;  2XZU A;  3GLH E;  1PJT A;  1V33 A;  1GKI A;  2DWZ B;  2P5T A;  4A3V B;  4DV0 M;  4K0K M;  2Y0Q A;  3H4M A;  5ITU A;  1HT2 E;  5ITX A;  2KDL A;  2UUA M;  4AQY M;  4Z8X A;  3GPU A;  3HJQ A;  3K9O A;  3GPY A;  1TTE A;  1NHG C;  2JP7 A;  4HEO A;  4M9S A;  1NNJ A;  1OIZ A;  1VDD A;  2ZTC A;  2C5R A;  3KOW E;  2KEB A;  3FYC A;  4D81 A;  3DZD A;  4NRV A;  1P3Q Q;  1ZAE A;  2BJW A;  2LWX A;  4KLN A;  2VQE M;  1HNZ M;  4CHT B;  1OJL A;  1OQY A;  3SBJ A;  1TGU A;  3TL4 X;  2BWB A;  2X49 A;  3KSJ A;  2F5O A;  5ITR A;  2C99 A;  4EIW A;  1IBL M;  1PRB A;  3HWS A;  4LFC M;  4KO8 A;  2DZO B;  4LF6 M;  2WSE F;  5LMN M;  2FH0 A;  1WR1 B;  4JI3 M;  2L4F A;  3TE6 A;  2B3T A;  2WZJ A;  1DGG A;  4IBE A;  4DR3 M;  2LH0 A;  3RFW A;  3W0F A;  4Z6Y A;  2XH9 A;  1XB2 B;  3LVV A;  3FUV A;  3U6C A;  1SXJ A;  1XC8 A;  5EJC A;  3SAV A;  1QZM A;  3L2A A;  1Z6T A;  2DWM A;  1XNQ M;  1XWI A;  2ZTD A;  3FD9 A;  4LGY A;  2HCB A;  3AOE C;  3GLG B;  3ZQJ A;  3LQQ A;  3HJS A;  4S12 A;  5EQT A;  3HX3 A;  5EP3 A;  4ANR A;  1C7Y A;  4IIW A;  5E6J A;  4FWD A;  2MR9 A;  3VK7 A;  2G3Q A;  3W68 A;  1ORY B;  3JAM S;  2XFT A;  3GLF B;  3GLI B;  2D7G A;  2R0I A;  4P16 A;  3U6O A;  1WIV A;  4HLQ A;  2HKJ A;  4NL4 H;  5EXT A;  3AV0 A;  2CP8 A;  4JI7 M;  1L8Q A;  3GRV A;  5DFL A;  2CFO A;  2XF3 A;  3L29 A;  3I4Y A;  3LCV B;  1E9R A;  4JYA M;  1WJ7 A;  2LHG A;  1LTM A;  4HL4 A;  1QVR A;  4PDI A;  4DV5 M;  2YNM D;  2DZL A;  4LJ6 A;  5BR8 M;  4DUY M;  3FTD A;  3IHP A;  4NSO B;  2YFQ A;  3QYB A;  3PXG A;  1R2Y A;  1QUS A;  4TUW A;  5EP1 A;  2DKL A;  3LMM A;  1MJG M;  1PJJ A;  1JB0 F;  4OX9 M;  1FJG M;  3QAU A;  1GAB A;  3EIH A;  2J5Y A;  4G4R A;  4LJ9 A;  4GKK M;  2WSC F;  2LHC A;  4QOZ C;  2QPA A;  4M0D A;  2CRU A;  3U61 A;  2K6B A;  3HU1 A;  2CUZ A;  4G4N A;  2JY6 B;  3U60 B;  3U5Z A;  4OW0 A;  3FTF A;  3B7Q A;  1J09 A;  2QCU A;  1W5S A;  3HU3 A;  3KSX A;  4ITQ A;  3KOY E;  3SAT A;  2D7H A;  3QYE A;  3VKG A;  4LF7 M;  1NJG A;  5KPR A;  2KA6 B;  3E21 A;  4P17 A;  1JR3 D;  4OU7 A;  2H5X A;  2K9D A;  5ITT A;  2EKK A;  2WSF F;  3AL0 C;  2JZ1 A;  4DR6 M;  3KS8 A;  1PJQ A;  2I7N A;  2L09 A;  4JI2 M;  2JXN A;  2DHY A;  3SHF A;  4LRT A;  4LJ8 A;  1IN4 A;  3GRY A;  2LVO C;  4GHA A;  1K82 A;  3GQ5 A;  4I4L A;  3U6P A;  3T1H M;  1EIJ A;  4PD2 A;  4LJA A;  4QNM A;  4MGZ E;  5GKN A;  4WP2 A;  2KZS A;  1XHB A;  4IJF A;  4AKG A;  1IQP A;  1G71 A;  3DFZ A;  4LZJ A;  3GPP A;  3HHX A;  3I04 M;  2XSZ D;  3THG A;  3W67 A;  4G3O A;  1CUK A;  3E4R A;  2MRO B;  3TWL A;  3U5Z B;  2Y20 A;  1VDL A;  2O5R A;  2F5N A;  2VDB B;  2Q2E B;  3LCU A;  2VII A;  4II7 A;  5IZ7 D;  4WUR A;  2VQF M;  4B08 A;  3KXE C;  3GLI E;  4MGI E;  3L27 A;  2DVW B;  1SXJ C;  1A5T A;  2E5L M;  1WHC A;  1IXR C;  4OVZ B;  4CJ6 A;  2EUC A;  4GRI A;  4DUZ M;  1YE9 A;  5EXS A;  2FFJ A;  5F3W A;  1K3W A;  1Z5B A;  3FUT A;  5KQ8 A;  3NBX X;  4DBG B;  3M7G A;  4LF4 M;  2KNA A;  3PNV A;  3KW6 A;  3HKP A;  5H37 D;  4IBF A;  2ZM6 M;  3RGS A;  3WHK A;  4FVM A;  1LV7 A;  4IBD A;  3UK6 A;  2VF7 A;  4AI6 A;  3FTC A;  3C3D A;  3VDP A;  3K92 A;  5IRE B;  7CAT A;  1MU5 A;  4DR2 M;  1VQ1 A;  2R65 A;  1SXJ E;  2OOB A;  4DR7 M;  1Z5A A;  2DNA A;  3J80 S;  1E32 A;  5FTN A;  3C3E A;  2ERC A;  1N78 A;  3OTO M;  1IFY A;  2C9O A;  3J2P B;  2CV1 A;  3GRR A;  1Y8G A;  2LXE A;  3F92 A;  1NSF A;  2Z4R A;  4L8R C;  1QQW A;  2RKO A;  5EXP A;  5IT9 S;  3SMS A;  4JI6 M;  4I81 A;  2F5S A;  2Y0T A;  2HL7 A;  3IG5 A;  3SAU A;  4AKH A;  1V34 A;  3GQ4 A;  2KW0 A;  3AKZ A;  1XXH A;  4LJ7 A;  2FS1 A;  3K8Z A;  1NO1 A;  1W5T A;  3TWK A;  4F1I A;  1NVM A;  1R4G A;  2K47 A;  4RF1 A;  1KFV A;  3D8B A;  4GEW A;  4ZPX A;  2JWS A;  2R62 A;  4M9X A;  3SYL A;  2GQF A;  4G4O A;  4RF0 A;  2QBY A;  4LF9 M;  2L7H A;  4QNR A;  1BVS A;  4QHT A;  2L6O A;  1DGH B;  2R46 A;  1HQY E;  1TDZ A;  4NRW A;  2ZAO A;  2JZ0 A;  4JI0 M;  4GIT A;  4DV4 M;  5EP4 A;  4B3T M;  1QDR A;  4FWH A;  1HR0 M;  5JI2 E;  3K2L A;  1WGN A;  2DHR A;  3T6P A;  3SAR A;  4DR1 M;  3MK6 A;  1NV8 A;  1I94 M;  4X65 M;  1AIP C;  2DAK A;  2Y21 A;  4PCZ A;  4YY3 M;  1K3X A;  2QZ4 A;  4GIP A;  2X4A A;  3EIE A;  1L2C A;  3U6E A;  2C98 A;  3W0L B;  3U6L A;  1IN6 A;  2KZU A;  3KP1 E;  2W82 A;  5FTL A;  2VF8 A;  3KFU G;  2EJS A;  1OTR A;  3E46 A;  3IEC A;  3KOZ E;  4I5S A;  1IBM M;  1IBK M;  3C58 A;  2EA0 A;  8CAT A;  4REZ A;  3FTE A;  2DXI A;  1XNR M;  4GH9 A;  1DGB A;  3KS4 A;  3SHG B;  5KPT A;  1MN3 A;  3CF6 E;  2QNJ A;  1IY2 A;  3B74 A;  4BLC A;  1IXS A;  2DEN A;  3U6D A;  2YQZ A;  1I4W A;  2QEN A;  3UJN A;  1SXJ B;  1XMQ M;  2QHO B;  5ITQ A;  4NXM M;  3ZCB B;  3GPX A;  1N32 M;  2DAG A;  1NY6 A;  3A45 A;  4M0W A;  2N35 A;  1DO2 A;  5A2Q S;  3HHY A;  4I8O A;  5KPZ A;  3VKH A;  2UUC M;  4X66 M;  1N77 A;  3I51 A;  3SMP A;  3V76 A;  3J7A S;  3B9P A;  1IY0 A;  2RRU A;  3I4V A;  1NY5 A;  5LMU M;  1QAN A;  1OFI A;  1YLA A;  2JUJ A;  4NOO B;  4GKJ M;  1F4I A;  1S3S A;  1HNX M;  3LQR A;  2LBC A;  4DV2 M;  2DWN A;  1Q39 A;  4LG2 A;  1NNU C;  1ZQ9 A;  4Y28 F;  3A42 A;  4YHH M;  1NHW C;  4LFB M;  1IXZ A;  2LVN C;  3VDU A;  4DV1 M;  1HQC A;  1SG9 A;  3PFI A;  4GC5 A;  4IBJ A;  1GLN A;  3K9P A;  4MGY E;  4AG5 A;  3CGW A;  1DV0 A;  1Q3C A;  4IBB A;  3DOA A;  1L2D A;  4PDG A;  4RKU F; 
#chains in the Genus database with same CATH homology
 3U61 B;  4B7G A;  3GO8 A;  5ITX E;  4LCB A;  1TDH A;  2CEA A;  2QP9 X;  3NBI A;  4X62 M;  4MB7 A;  2I7P A;  1SXJ D;  2M5Z A;  3AJI B;  5C1B A;  4FCV A;  4KOD A;  5BPV A;  3M6A A;  3PVS A;  3NWL A;  4LGM A;  3UGJ A;  3T38 A;  1GVN A;  3E9S A;  1IN7 A;  3WHL A;  4MM3 B;  2CV2 A;  3AFH A;  4FCT A;  1G3I A;  1HT1 E;  2CHV A;  1D2N A;  1QAQ A;  2F5Q A;  3ZC7 B;  1NJF A;  3KDS E;  1Z5C A;  4CGY B;  3JR4 A;  1J5E M;  1PM5 A;  2UU9 M;  2CE7 A;  5KO3 A;  1N34 M;  1N33 M;  2FE8 A;  1KSF X;  4MGH A;  1GL6 A;  3U6Q A;  2F5P A;  1X37 A;  3GP1 A;  3ILK A;  1EE8 A;  4JI4 M;  4IBG A;  3CTW B;  5DYG A;  4W5W A;  3A98 B;  1XMO M;  3FKE A;  2HHH M;  4B3M M;  5C18 A;  4XBO A;  1JQJ C;  3MHV C;  2G5G X;  3CF2 A;  1HNW M;  5FTK A;  2CHQ A;  2UXD M;  4G6Z A;  4BB9 A;  1E9S A;  4MGK E;  2RGH A;  1L1T A;  1YUB A;  1MX0 A;  2RGO A;  3J81 S;  4BBA A;  3FUW A;  4B7F A;  3JR5 A;  2ZBK B;  2OQ4 A;  4FW9 A;  4L78 A;  5E26 A;  4AG6 A;  4M9Z A;  2X8A A;  4WW0 A;  3GLG A;  5KQD A;  4D82 A;  1Q3B A;  1JR3 A;  1H6U A;  3Q8X A;  4AW4 A;  4DR5 M;  2KRU A;  2FNA A;  3GLI A;  3GLF A;  1WXQ A;  4XGI A;  3VK8 A;  3PNY A;  4MH0 E;  3L26 A;  3J7B A;  3T15 A;  4R3D A;  1QYR A;  3AOG A;  4GC9 A;  2ZAN A;  1G41 A;  3L25 A;  3KOX E;  4LJ5 A;  4FCW A;  4B3S M;  5FLX S;  2XSZ A;  1FNN A;  2ZAM A;  1XXH B;  3J27 B;  1PJI A;  1T3T A;  5JI3 E;  1N75 A;  2BNK A;  3GLH A;  2R45 A;  4PT5 A;  4L15 A;  4RNA A;  5DNY A;  3U60 A;  1QAM A;  4JN6 A;  2EO2 A;  2QBY B;  1R2Z A;  1Z59 A;  5FTM A;  3K1J A;  2KRK A;  4L4U A;  2DWL A;  4CIS A;  4LY6 A;  4DV3 M;  4JV5 M;  1IM2 A;  1DGF A;  2R4J A;  4D80 A;  3TWM A;  3M0E A;  4GMQ A;  4DR4 M;  2J7O A;  5EXX A;  3R9X B;  2JA2 A;  5FTJ A;  3CF0 A;  2UUB M;  3DA1 A;  3HHW A;  3R8F A;  1TH2 A;  3U6M A;  4JXJ A;  2BJV A;  1J7K A;  3MJ5 A;  2Z4S A;  4B7H A;  4QOS A;  2Z7J A;  2KXE A;  2CHG A;  1IN5 A;  4KHP M;  2UXB M;  4IBI A;  2CV0 A;  1UM8 A;  2LNH C;  3GLH B;  2AHM A;  4NXN M;  1E94 E;  2UXC M;  4JI1 M;  2XGN A;  3GQ3 A;  2L7I A;  2H1R A;  3SAS A;  3SAW A;  4B3R M;  4IBK A;  1IXS B;  1G59 A;  2XFS A;  4JI5 M;  3HJ8 A;  4QHS A;  2XEP A;  3A46 A;  3VLF B;  2DZN B;  2A5Y B;  4X64 M;  3KP0 E;  4LF5 M;  4R7G A;  3D8L A;  4OVZ A;  2G8L A;  4AKI A;  3GRU A;  5EP2 A;  4G4Q A;  3BOS A;  3AOE A;  4LF8 M;  3HU2 A;  2OPF A;  2NQ8 C;  3QWL A;  5FSW A;  3SYK A;  1R6B X;  2F4V M;  3SFZ A;  1QAO A;  1L1Z A;  2FOI C;  3SC3 A;  2V1C A;  3FUX A;  3VFD A;  1IN8 A;  3FYD A;  3ZH9 B;  1GL7 A;  1TH3 A;  3FUU A;  1C1K A;  2R18 A;  2C96 A;  3LVW A;  1KYI A;  3RGP A;  2J7N A;  1R7R A;  4LZZ A;  5IWA M;  4IJE A;  2Z3X A;  3UZU A;  2XLJ A;  1L2B A;  4IBC A;  2V1U A;  1DO0 A;  4LJ4 A;  4AZF A;  1IY1 A;  4LRS A;  3UMM A;  2YR0 A;  3RE8 A;  2M60 A;  3L28 A;  1TH4 A;  4DV6 M;  3KVW A;  2XZF A;  1R2Y A;  4GHL A;  1OFH A;  4FWG A;  2D7E A;  4DV7 M;  1N36 M;  1G8P A;  4NSR A;  4FD2 A;  2R4E A;  3IG8 A;  5DYI A;  4LFA M;  4L16 A;  4JI8 M;  3TQS A;  3HHZ A;  1G4A E;  2V6Z M;  1DGH A;  3TPZ A;  3HGI A;  1YSY A;  3U6S A;  5ITY A;  2C9C A;  2XZU A;  2DWZ B;  4A3V B;  1GKI A;  2P5T A;  4K0K M;  4DV0 M;  2Y0Q A;  3H4M A;  5ITU A;  1HT2 E;  5ITX A;  2UUA M;  4AQY M;  4Z8X A;  3GPU A;  3HJQ A;  3GPY A;  4M9S A;  1NHG C;  1NNJ A;  1VDD A;  2C5R A;  3KOW E;  2KEB A;  3FYC A;  4D81 A;  3DZD A;  4NRV A;  1ZAE A;  2BJW A;  2LWX A;  4KLN A;  2VQE M;  1HNZ M;  4CHT B;  1OJL A;  3SBJ A;  1TGU A;  3TL4 X;  2X49 A;  3KSJ A;  2F5O A;  5ITR A;  2C99 A;  4EIW A;  1IBL M;  3HWS A;  4LFC M;  4KO8 A;  2DZO B;  4LF6 M;  5LMN M;  4JI3 M;  3TE6 A;  4IBE A;  1DGG A;  4DR3 M;  2LH0 A;  3RFW A;  3W0F A;  4Z6Y A;  2XH9 A;  3LVV A;  3FUV A;  3U6C A;  1SXJ A;  1XC8 A;  5EJC A;  3SAV A;  1QZM A;  3L2A A;  1Z6T A;  2DWM A;  1XNQ M;  1XWI A;  3FD9 A;  4LGY A;  2HCB A;  3AOE C;  3GLG B;  3LQQ A;  3HJS A;  4S12 A;  5EQT A;  5EP3 A;  4IIW A;  5E6J A;  4FWD A;  3VK7 A;  1ORY B;  3JAM S;  2XFT A;  3GLF B;  3GLI B;  2D7G A;  4P16 A;  3U6O A;  4HLQ A;  2HKJ A;  4NL4 H;  5EXT A;  3AV0 A;  4JI7 M;  1L8Q A;  3GRV A;  2CFO A;  2XF3 A;  3L29 A;  3I4Y A;  1E9R A;  4JYA M;  4DV5 M;  3T1Y M;  4HL4 A;  4PDI A;  1QVR A;  2YNM D;  4LJ6 A;  5BR8 M;  4DUY M;  3FTD A;  4NSO B;  2YFQ A;  3PXG A;  4TUW A;  5EP1 A;  3LMM A;  1PJJ A;  4OX9 M;  1FJG M;  3QAU A;  3EIH A;  4G4R A;  4LJ9 A;  4GKK M;  4QOZ C;  2QPA A;  4M0D A;  3U61 A;  3U60 B;  3HU1 A;  2CUZ A;  4G4N A;  3U5Z A;  4OW0 A;  3FTF A;  1J09 A;  2QCU A;  1W5S A;  3HU3 A;  3KSX A;  4ITQ A;  3KOY E;  3SAT A;  2D7H A;  3VKG A;  4LF7 M;  1NJG A;  5KPR A;  2KA6 B;  1JR3 D;  4OU7 A;  5ITT A;  3AL0 C;  4DR6 M;  3KS8 A;  2I7N A;  2L09 A;  4JI2 M;  3SHF A;  4LRT A;  4LJ8 A;  1IN4 A;  3GRY A;  4GHA A;  1K82 A;  3GQ5 A;  4I4L A;  3U6P A;  3T1H M;  4PD2 A;  4LJA A;  4QNM A;  4MGZ E;  5GKN A;  4AKG A;  2KZS A;  1XHB A;  4IJF A;  1IQP A;  3DFZ A;  4LZJ A;  3GPP A;  3HHX A;  2XSZ D;  3THG A;  3E4R A;  3TWL A;  3U5Z B;  2Y20 A;  2O5R A;  2F5N A;  2Q2E B;  5IZ7 D;  2VII A;  4II7 A;  2VQF M;  4WUR A;  4B08 A;  3KXE C;  4MGI E;  3L27 A;  2DVW B;  1SXJ C;  2E5L M;  1IXR C;  4OVZ B;  2EUC A;  4GRI A;  4DUZ M;  1YE9 A;  5EXS A;  2FFJ A;  5F3W A;  1K3W A;  1Z5B A;  3FUT A;  5KQ8 A;  3M7G A;  4LF4 M;  3PNV A;  3KW6 A;  3HKP A;  5H37 D;  4IBF A;  2ZM6 M;  3RGS A;  3WHK A;  4FVM A;  1LV7 A;  4IBD A;  3UK6 A;  4AI6 A;  3FTC A;  3VDP A;  3K92 A;  5IRE B;  7CAT A;  1MU5 A;  4DR2 M;  2R65 A;  1SXJ E;  4DR7 M;  1Z5A A;  3J80 S;  1E32 A;  5FTN A;  2ERC A;  1N78 A;  3OTO M;  2C9O A;  3J2P B;  2CV1 A;  3GRR A;  2LXE A;  1NSF A;  2Z4R A;  4L8R C;  1QQW A;  2RKO A;  5EXP A;  5IT9 S;  3SMS A;  4JI6 M;  4I81 A;  2F5S A;  2Y0T A;  2HL7 A;  3IG5 A;  3SAU A;  4AKH A;  3GQ4 A;  2KW0 A;  3AKZ A;  1XXH A;  4LJ7 A;  3K8Z A;  1W5T A;  3TWK A;  1NVM A;  2K47 A;  4RF1 A;  1KFV A;  3D8B A;  4ZPX A;  2R62 A;  4M9X A;  3SYL A;  4G4O A;  4RF0 A;  2QBY A;  4LF9 M;  2L7H A;  4QNR A;  4QHT A;  2L6O A;  1DGH B;  2R46 A;  1HQY E;  1TDZ A;  4NRW A;  2ZAO A;  4JI0 M;  4GIT A;  4DV4 M;  5EP4 A;  4B3T M;  4FWH A;  1HR0 M;  5JI2 E;  3K2L A;  2DHR A;  3SAR A;  4DR1 M;  3MK6 A;  1I94 M;  4X65 M;  1K3X A;  2Y21 A;  4PCZ A;  4YY3 M;  2QZ4 A;  4GIP A;  2X4A A;  3EIE A;  1L2C A;  3U6E A;  2C98 A;  3W0L B;  3U6L A;  1IN6 A;  2KZU A;  3KP1 E;  2W82 A;  5FTL A;  3KFU G;  4I5S A;  3KOZ E;  1IBM M;  1IBK M;  3C58 A;  2EA0 A;  8CAT A;  4REZ A;  3FTE A;  2DXI A;  1XNR M;  4GH9 A;  1DGB A;  3KS4 A;  3SHG B;  5KPT A;  3CF6 E;  4BLC A;  1IY2 A;  3U6D A;  2YQZ A;  1I4W A;  2QEN A;  3UJN A;  1SXJ B;  1XMQ M;  5ITQ A;  4NXM M;  3ZCB B;  3GPX A;  1N32 M;  4M0W A;  1NY6 A;  3A45 A;  1DO2 A;  5A2Q S;  3HHY A;  4I8O A;  5KPZ A;  3VKH A;  2UUC M;  4X66 M;  1N77 A;  3I51 A;  3SMP A;  3J7A S;  3B9P A;  1IY0 A;  3I4V A;  1NY5 A;  5LMU M;  1QAN A;  1OFI A;  4NOO B;  4GKJ M;  1S3S A;  1HNX M;  3LQR A;  4DV2 M;  2DWN A;  1Q39 A;  4LG2 A;  1NNU C;  1ZQ9 A;  3A42 A;  4YHH M;  1NHW C;  4LFB M;  1IXZ A;  3VDU A;  4DV1 M;  1HQC A;  3PFI A;  4GC5 A;  4MGY E;  4IBJ A;  1GLN A;  4AG5 A;  1Q3C A;  4IBB A;  3DOA A;  1L2D A;  4PDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...