2EA0A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli in complex with ap-site containing dna substrate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
254
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrate and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 84
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ea0A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2ea0A01
4PD2A 4G4NA 4DR5M 1MX0A 3SATA 5FLXS 1IBKM 4DR4M 1FJGM 2UXBM 4JV5M 3SAUA 2VQEM 4KHPM 1Z5CA 1L2DA 4DUYM 2HHHM 4LFBM 4ITQA 3U6SA 4DR1M 2F5SA 3GQ5A 4JI0M 2UUCM 3VK7A 4LF7M 3U6PA 2ZM6M 1Z5AA 1IBMM 3J81S 4LF5M 2UUAM 4MB7A 3GO8A 1HNXM 1XMQM 4JI2M 4X65M 4B3MM 4NXMM 3SAVA 5ITXE 2Q2EB 1NNJA 4PCZA 2F5OA 3GQ4A 4OX9M 1R2ZA 5ITUA 5IWAM 1N36M 2XZFA 4PDGA 1K82A 1K3WA 4GKKM 1TDHA 1L2BA 1Q39A 3DOAA 4DR6M 3GP1A 2OQ4A 4LFAM 2UXDM 4DUZM 4DV0M 2F5NA 4LF4M 4LF8M 1L1ZA 3SAWA 1Q3CA 1J5EM 2UU9M 4X66M 4NRWA 4YHHM 3VK8A 1XNQM 3TWKA 2F5QA 4NRVA 1XMOM 5ITQA 4DV4M 3JR4A 4DR2M 4AQYM 1HR0M 4DV2M 4G4RA 4X62M 4DV5M 4B3SM 3TWLA 4B3RM 3A46A 2UXCM 5ITRA 4DV7M 3U6QA 3A45A 3T1HM 3SASA 3W0FA 4GKJM 3J80S 5ITXA 1KFVA 5LMUM 3TWMA 4JYAM 2ZBKB 4X64M 5ITYA 3U6DA 3OTOM 1N33M 1XC8A 5BR8M 3GPYA 4JI1M 4JI6M 2HKJA 4JI3M 2VQFM 2EA0A 5LMNM 3SARA 3U6MA 4JI8M 4G4OA 4CISA 4LF6M 3GPPA 3J7AS 3GQ3A 1PJIA 1N34M 1K3XA 3JR5A 3U6LA 3C58A 4JI5M 4DV1M 1HNWM 3GPXA 5IT9S 4K0KM 5ITTA 3U6CA 2XZUA 3U6EA 1TDZA 4YY3M 1L2CA 4JI7M 3GPUA 1XNRM 4DV6M 1R2YA 2UUBM 4DV3M 4G4QA 1L1TA 2E5LM 1Q3BA 4LFCM 4B3TM 1Z59A 1I94M 1Z5BA 3SBJA 2OPFA 1EE8A 4NXNM 1PJJA 3JAMS 4DR7M 4JI4M 5A2QS 2F5PA 1MU5A 4DR3M 3A42A 1HNZM 4LF9M 1PM5A 1IBLM 2F4VM 4PDIA 1N32M 3T1YM 3U6OA
chains in the Genus database with same CATH superfamily
2MROB 1IXSA 1QAQA 3LQQA 3M6AA 2KHHA 4LY6A 4W5WA 4G4NA 3U5ZA 1I4WA 3SATA 2Y20A 4XK8F 2FOIC 3GLGA 1WGNA 4IJEA 5FLXS 2N35A 5BPVA 1VEJA 4B7GA 3RFWA 3WHKA 2Z7JA 1FJGM 3W0LB 1GABA 2OOBA 3SC3A 4KHPM 1NHWC 1L2DA 3E9SA 2CWBA 2KDLA 4LFBM 2JUJA 1IN8A 2W82A 4IBGA 3K92A 2LNHC 1CUKA 1HQCA 3QYEA 2F5SA 2DI0A 4LJ7A 4JI0M 4I4LA 2UUCM 2LXEA 2KRKA 3U6PA 3FUVA 4A3VB 3SMSA 1HT1E 2LBCA 3Q8XA 1WGLA 3BOSA 3HJQA 4I8OA 4MGYE 4GHLA 4AKGA 1IXZA 5EXTA 1T3TA 2WSEF 3GO8A 4LZJA 2FNAA 4NSRA 2LH0A 4JI2M 1TH2A 4X65M 1OKSA 4NXMM 1R5LA 5ITXE 1R7RA 2Q2EB 2C5RA 2F5OA 1NNUC 3AFHA 4OX9M 1XB2B 2L7IA 1QZEA 8CATA 2VF8A 5EP1A 1C1KA 1IFYA 2DZNB 4TUWA 3I4VA 2C96A 3FRIA 4DR6M 1TH3A 2CFOA 2OQ4A 1GJTA 5FSWA 1MN3A 2F5NA 2XSZD 3HU1A 4LF4M 5C1BA 2UU9M 1W5TA 3I04M 4X66M 3L25A 1J7KA 1G8PA 1EFUB 5FTKA 4LJ5A 3F92A 1N78A 3L29A 2DVWB 5ITQA 4LRTA 1NY5A 1VDDA 3PVSA 3RGSA 1OIPA 2KEBA 1DGBA 4NOOB 4B3SM 2OO9A 3BXWA 2QZ4A 2FH0A 4I5SA 2MJ5B 3B9PA 3HHYA 5ITRA 2ZAMA 3A45A 2J5YA 3L26A 4GKJM 3CF0A 2JNHA 2WSFF 1D0KA 1SXJB 2CHGA 3HY5A 3U60A 4NSOB 5ITYA 3T15A 3ILKA 3OTOM 3C3EA 1XC8A 3KS4A 3VFDA 4MGZE 3DZDA 1IN6A 3U61B 2KNVA 1QDTA 1S3SA 2FFJA 4Z8XA 5LMNM 3FUXA 4Y28F 3VKGA 4L8RC 1QDRA 3GPPA 3J7AS 3AL0C 3GQ3A 1PJIA 2RRUA 1K3XA 3JR5A 4JI5M 4IBKA 4DV1M 2Y21A 5IT9S 3KOYE 1GL7A 4AG5A 2DWZB 1ZAEA 4JN6A 4RKUF 3GPUA 3CF2A 4IBEA 4MH0E 2LHGA 1GKIA 1Z6TA 4QNMA 1QYRA 2G5GX 2WSCF 5E6JA 2JWSA 3GRUA 4CJ6A 5KPRA 2LVQD 1R6BX 5EJCA 1NJFA 1T6OA 1I94M 1Z5BA 2R6FA 1TGUA 5DYGA 1DO0A 1E32A 1Y8GA 5DFLA 2RKOA 4DR3M 1ZMVA 3KS8A 2H5XA 4LF9M 4FCTA 4QOSA 3GLIA 3T38A 2Z4SA 1UFZA 4F2LA 5KO3A 1TH4A 1IBLM 3T1YM 3AOGA 4FCWA 2CV2A 1IXRC 3K1JA 2DWNA 3UJNA 3TQSA 3FTCA 1DV0A 4DR5M 4B7HA 3T6PA 4BLCA 2R62A 2KZUA 1IBKM 2LWXA 4L78A 4XBOA 1PGYA 4R7GA 2ZTDA 1G4AE 2MH8A 1PJTA 4DUYM 2ZAOA 1V92A 1YSYA 4LJ4A 2D7HA 4KLNA 1ZMUA 4P16A 3KXEC 3VK7A 2JXNA 4LGMA 1D2NA 1Z5AA 2JY5A 4PT5A 2ZM6M 3HZJA 1JR3D 1BVSA 2QP9X 2UUAM 3RGPA 4M9ZA 2JZ1A 3HHWA 3HU2A 4GIPA 3SAVA 4LJAA 3PNVA 3J7BA 3NBXX 2L4FA 4GRIA 3MMPA 4M9SA 3E46A 3EIEA 1D0LA 3HWSA 5IWAM 1N36M 2K9DA 2EKKA 4BB9A 1FNNA 4GKKM 2BNKA 4G3OA 1OTRA 2ZTCA 3IHPA 1JQJC 4IIWA 1NV8A 2XF3A 5FTNA 3SMPA 3H4JA 3VDUA 3VDPA 4DV0M 1L1ZA 2LVAA 3SAWA 4REZA 2CV1A 4RNAA 3VK8A 5KPTA 1NV9A 5KQDA 3TWKA 3QWLA 3ZCBB 2LHCA 5DNYA 4NRVA 2F5QA 4LJ6A 5IREB 4AG6A 1XMOM 3IG8A 3BBZA 1HR0M 3MHVC 4QNRA 3A98B 3DFZA 1OJLA 2BJVA 1OAOC 1Q02A 4LGYA 3FUTA 1WIVA 1IXSB 4WP2A 2UXCM 3U5ZB 4DV7M 1J09A 4LRSA 1GLNA 3GLGB 3T1HM 3W0FA 2XSZA 5L8RF 3K2LA 2ZBKB 1IN7A 2Y0TA 2KNZA 1PJSA 3GLIE 1OIZA 4M0DA 1WHCA 2MGWA 1DGHA 3LVVA 1GJSA 2C99A 1QAMA 4JI6M 2HKJA 2VQFM 3SARA 3HKPA 2LVOC 4IBCA 4CISA 3K9PA 3HHZA 3VKHA 3LQRA 3U6LA 1SXJC 3C58A 4OVZA 4K0KM 3LMMA 5ITTA 2WZJA 3NWLA 4GEWA 3I01M 2JA2A 3HJSA 4NL4H 4Z6YA 2EUCA 3U6EA 2DKLA 4IBDA 3B7QA 3B7NA 5EXSA 1R2YA 3LCUA 3ZH9B 2UUBM 1XXHA 1ZQ9A 2D7GA 3NBIA 1E9RA 1E9SA 1L1TA 3M0EA 2E5LM 2YNMD 2QBYA 4LFCM 3PXGA 2X8AA 4B3TM 2VIIA 2QNJA 1SXJD 4LJ9A 3FKEA 2V1UA 3SBJA 1EE8A 4GITA 1PJJA 3SYKA 3AKZA 5A2QS 2F5PA 1MU5A 2A5YB 2QENA 2RGOA 4ANRA 1HNZM 4IBIA 4RF0A 4UN2B 2GNOA 3GRVA 2LTUA 4QHTA 4PDIA 1N32M 2KA6B 3FRHA 3FYDA 3GLFA 4Q7JA 2DAEA 2DHRA 2EJSA 2EKFA 2HWJA 1VQ1A 2QQ8A 3KDSE 2YFQA 3KOXE 3U6OA 5C18A 1VEGA 1QUTA 2AHMA 3AV0A 2FS1A 2UXBM 4JV5M 5DYIA 1VG5A 2K47A 3KOZE 5JI3E 2HHHM 3R8FA 4ZPXA 5EXXA 4OW0A 3U60B 4L15A 3U6SA 1OFIA 3GQ5A 1H6UA 4LF7M 3I4YA 1DGFA 2RGHA 4NC6A 3AOEC 1HQYE 5EXPA 3PFIA 3J81S 1D0MA 4FWHA 2XLJA 4LF5M 1GO5A 1G41A 2QSFX 5F3WA 3Q8GA 4P17A 1IN5A 3KP1E 1KSFX 3QAUA 1HNXM 5EQTA 1NNJA 3K8ZA 2O5RA 3SHGB 1G3IA 3B7ZA 3SFZA 3GQ4A 1R2ZA 1A5TA 2HCBA 4JXJA 1ZMWA 2JY6B 2KXEA 3M7GA 1NSFA 4XGIA 5E26A 4PDGA 2Z3XA 1K82A 3GRYA 1L2BA 1IQPA 2X49A 3DOAA 3L27A 4FD2A 4GH9A 2XH9A 2L7HA 4WW0A 3CF6E 3GP1A 4B7FA 2R44A 2G8LA 1JR3A 4DUZM 1TR8A 3UZUA 2MR9A 3HU3A 1XWIA 1L8QA 3V76A 1J5EM 1E94E 4NRWA 1QQWA 4YHHM 3ZC7B 3R9XB 2B3TA 3FTEA 3B74A 3C9PA 2DNAA 3MK6A 2G3QA 3CGWA 4LCBA 3GLIB 4DV4M 2ERCA 1XXHE 2M60A 4MM3B 1VDLA 4GMQA 4G4RA 5H37D 2EO2A 2CRUA 3B89A 3A46A 3IECA 2DXIA 2KRUA 2DZOB 3FE3A 2I7PA 1AIPC 3FUWA 1IY2A 2XGNA 1KFVA 4IJFA 2CHQA 5LMUM 2VDBB 2APLA 4FWGA 2FE8A 4L16A 3UGJA 3E21A 1QVRA 3MJ5A 3W67A 4QHSA 3KW6A 4JI1M 4I81A 4JI3M 3GLFE 2EA0A 4D81A 1NJGA 2CUZA 3KVWA 4LF6M 2DENA 4G6ZA 4FWDA 4AKHA 2M5ZA 2BWBA 1G59A 2I7NA 2K6BA 2H1RA 4L4UA 2JZ0A 1IY1A 1HJPA 1N34M 2L4EA 2R0IA 3PNYA 2J7OA 2XZUA 2C9CA 1TDZA 3GLHE 1C7YA 1PRBA 2O25A 4YY3M 4JI7M 1OAIA 2R18A 1XNRM 4DV6M 5IZ7D 3FTFA 4D82A 2J7NA 2DAGA 2JP7A 5FTMA 4DV3M 5KQ8A 2CP8A 1SG9A 3VLFB 3K9OA 4BBAA 2XFTA 1G71A 3I51A 4NXNM 3ZQJA 3JAMS 2L6OA 2R4JA 4FW9A 4JI4M 1N77A 2NQ8C 3A42A 1T43A 2DAMA 5JI2E 4R71A 1PM5A 2V6ZM 2R4EA 2XFSA 4MGHA 4IBFA 3IG5A 4MGKE 1AUAA 3KSJA 3TL4X 1NY6A 1XHBA 4PD2A 1MX0A 1RU3A 1X37A 2YQZA 3GRRA 3J27B 5KPZA 2C98A 1JR3E 4DR4M 3TE6A 1DGGA 1SXJA 4QOZC 2Z4RA 3SAUA 2VQEM 1R4GA 4II7A 1Z5CA 3LW5F 2Y0QA 3FYCA 4ITQA 2C9OA 3U61A 2BWEA 2VF7A 4DR1M 2L2DA 4KO8A 3THGA 1QAOA 1MJGM 1DGHB 1WJ7A 1IBMM 4LG2A 2CHVA 2DHYA 3UMMA 2YR0A 1KYIA 4AI6A 4MB7A 2Z8YM 3DA1A 2O01F 3FUUA 3D8BA 1XMQM 2KW0A 3HX3A 4B3MM 2BJWA 3D8LA 1ORYB 4S12A 4PCZA 1YUBA 5GKNA 4OVZB 2P5TA 2DAIA 2D7EA 3KSXA 2CEAA 3EIHA 7CATA 5ITUA 2XZFA 4IBJA 4WURA 1N75A 1K3WA 1NO1A 2QCUA 3FD9A 4AZFA 4GHAA 1TDHA 3L28A 5EP4A 1Q39A 1XXHB 2V1CA 1F4IA 2QBYB 3GLHA 4LFAM 2R65A 1VEKA 2UXDM 3H4MA 4LF8M 3LVWA 4HLQA 4EIWA 2DWMA 4KT0F 2CV0A 1Q3CA 4L6V6 2LVPC 4AKIA 1XNQM 4R3DA 3GLGE 4OU7A 3CTWB 1P3QQ 3HHXA 1TTEA 3C3DA 3HJ8A 3JR4A 3FTDA 4DR2M 4AQYM 1PJQA 2XEPA 4HL4A 4D80A 4FVMA 2OOAA 4DV2M 4X62M 4DV5M 2HL7A 3AOEA 3TWLA 3GLFB 1HT2E 4B3RM 3LCVB 4MGIE 1OQYA 1QANA 1GL6A 4AW4A 4B08A 3U6QA 2DWLA 1GVNA 1WXQA 2R45A 1LV7A 3SASA 1NVMA 2JY7A 2JY8A 3J80S 5ITXA 3TWMA 1IY0A 4JYAM 4GC9A 1NHGC 1JB0F 4X64M 3U6DA 3QYBA 1N33M 3GLHB 5BR8M 3GPYA 4M9XA 2LVNC 5FTJA 3WHLA 2GQFA 1UM8A 2DAKA 4G4OA 3U6MA 4JI8M 2ZANA 1WR1B 4GC5A 3RE8A 3E4RA 3KFUG 1TF0B 1IM2A 2K0BX 1SXJE 3AJIB 3GPXA 1HNWM 2HAKA 5FTLA 4CIZA 4KODA 1V33A 3U6CA 3KOWE 1DO2A 3SHFA 1L2CA 3J2PB 4CGYB 1YE9A 2L09A 4DBGB 5EP3A 4G4QA 2QHOB 1Q3BA 2QPAA 2DZLA 4CHTB 1V34A 4IBBA 2KNAA 2KZSA 4RF1A 4LZZA 1Z59A 1EIJA 4HEOA 1QZMA 4LJ8A 3L2AA 2OPFA 3KP0E 1ZV1A 1OFHA 4DR7M 1IN4A 1YLAA 1W5SA 2CE7A 4M0WA 3SYLA 3W68A 2F4VM 2X4AA 2R46A 3HGIA 5EP2A 4F1IA 1QUSA 4FCVA 3TPZA 1LTMA 3UK6A
chains in the Genus database with same CATH topology
3M6AA 1QAQA 3LQQA 4G4NA 4LY6A 4W5WA 3U5ZA 3SATA 1I4WA 2Y20A 2FOIC 3GLGA 4IJEA 5FLXS 5BPVA 4B7GA 3RFWA 3WHKA 2Z7JA 1FJGM 3W0LB 3SC3A 4KHPM 1NHWC 1L2DA 3E9SA 4LFBM 1IN8A 2W82A 4IBGA 3K92A 2LNHC 1HQCA 2F5SA 4LJ7A 4JI0M 2UUCM 4I4LA 2LXEA 2KRKA 3U6PA 3FUVA 4A3VB 3SMSA 1HT1E 3Q8XA 3BOSA 3HJQA 4I8OA 4MGYE 4GHLA 4AKGA 1IXZA 5EXTA 1T3TA 3GO8A 4LZJA 2FNAA 4NSRA 2LH0A 4JI2M 1TH2A 4X65M 4NXMM 5ITXE 1R7RA 2Q2EB 2C5RA 2F5OA 1NNUC 3AFHA 4OX9M 2L7IA 8CATA 5EP1A 1C1KA 2DZNB 4TUWA 3I4VA 2C96A 4DR6M 1TH3A 2CFOA 2OQ4A 5FSWA 2F5NA 4LF4M 2XSZD 3HU1A 5C1BA 2UU9M 1W5TA 4X66M 3L25A 1J7KA 1G8PA 5FTKA 4LJ5A 1N78A 3L29A 2DVWB 5ITQA 4LRTA 1NY5A 1VDDA 3PVSA 3RGSA 4NOOB 2KEBA 1DGBA 4B3SM 2QZ4A 4I5SA 3B9PA 3HHYA 5ITRA 2ZAMA 3A45A 4GKJM 3L26A 3CF0A 1SXJB 2CHGA 3U60A 4NSOB 5ITYA 3T15A 3ILKA 3OTOM 1XC8A 3KS4A 3VFDA 4MGZE 3DZDA 1IN6A 3U61B 1S3SA 2FFJA 4Z8XA 5LMNM 3FUXA 3VKGA 4L8RC 3GPPA 3J7AS 3AL0C 3GQ3A 1PJIA 1K3XA 3JR5A 4JI5M 4IBKA 4DV1M 2Y21A 5IT9S 3KOYE 1GL7A 4AG5A 2DWZB 1ZAEA 4JN6A 3GPUA 3CF2A 4IBEA 4MH0E 1GKIA 1Z6TA 4QNMA 1QYRA 2G5GX 5E6JA 3GRUA 5KPRA 1R6BX 5EJCA 1NJFA 1I94M 1Z5BA 1TGUA 5DYGA 1DO0A 1E32A 2RKOA 4DR3M 3KS8A 4LF9M 4FCTA 4QOSA 3GLIA 3T38A 2Z4SA 5KO3A 1IBLM 1TH4A 3T1YM 3AOGA 4FCWA 2CV2A 1IXRC 3K1JA 2DWNA 3UJNA 3TQSA 3FTCA 4DR5M 4B7HA 4BLCA 2R62A 2KZUA 1IBKM 2LWXA 4L78A 4XBOA 4R7GA 1G4AE 4DUYM 2ZAOA 1YSYA 4LJ4A 2D7HA 4KLNA 4P16A 3VK7A 3KXEC 4LGMA 1D2NA 1Z5AA 4PT5A 2ZM6M 1JR3D 2QP9X 2UUAM 3RGPA 4M9ZA 3HHWA 3HU2A 4GIPA 3SAVA 4LJAA 3PNVA 3J7BA 4GRIA 4M9SA 3EIEA 3HWSA 5IWAM 1N36M 4BB9A 1FNNA 4GKKM 2BNKA 1JQJC 4IIWA 2XF3A 5FTNA 3SMPA 3VDUA 3VDPA 4DV0M 1L1ZA 3SAWA 4REZA 2CV1A 4RNAA 3VK8A 5KPTA 5KQDA 3TWKA 3QWLA 3ZCBB 5DNYA 2F5QA 4NRVA 4LJ6A 5IREB 4AG6A 1XMOM 3IG8A 1HR0M 3MHVC 4QNRA 3A98B 3DFZA 1OJLA 2BJVA 4LGYA 3FUTA 1IXSB 2UXCM 3U5ZB 4DV7M 1J09A 4LRSA 1GLNA 3GLGB 3T1HM 3W0FA 2XSZA 3K2LA 2ZBKB 1IN7A 2Y0TA 4M0DA 1DGHA 3LVVA 2C99A 1QAMA 4JI6M 2HKJA 2VQFM 3SARA 3HKPA 4IBCA 4CISA 3HHZA 3VKHA 3LQRA 3U6LA 1SXJC 3C58A 4OVZA 4K0KM 3LMMA 5ITTA 3NWLA 2JA2A 3HJSA 4NL4H 4Z6YA 2EUCA 3U6EA 4IBDA 1R2YA 5EXSA 2UUBM 3ZH9B 1XXHA 1ZQ9A 2D7GA 3NBIA 1E9RA 1E9SA 1L1TA 3M0EA 2E5LM 2YNMD 2QBYA 4LFCM 3PXGA 2X8AA 4B3TM 2VIIA 1SXJD 4LJ9A 3FKEA 2V1UA 3SBJA 1EE8A 4GITA 1PJJA 3SYKA 3AKZA 5A2QS 2F5PA 1MU5A 2A5YB 2QENA 2RGOA 1HNZM 4IBIA 4RF0A 3GRVA 4QHTA 4PDIA 1N32M 2KA6B 3FYDA 3GLFA 2DHRA 3KOXE 3KDSE 3U6OA 2YFQA 5C18A 2AHMA 3AV0A 2UXBM 4JV5M 5DYIA 2K47A 3KOZE 5JI3E 2HHHM 3R8FA 4ZPXA 5EXXA 4OW0A 3U60B 4L15A 3U6SA 1OFIA 3GQ5A 1H6UA 4LF7M 3I4YA 1DGFA 2RGHA 3AOEC 1HQYE 5EXPA 3PFIA 3J81S 2XLJA 4FWHA 4LF5M 1G41A 5F3WA 1IN5A 3KP1E 1KSFX 3QAUA 1HNXM 5EQTA 1NNJA 3K8ZA 2O5RA 3SHGB 1G3IA 3SFZA 3GQ4A 1R2ZA 2HCBA 4JXJA 2Z3XA 2KXEA 3M7GA 1NSFA 4XGIA 5E26A 4PDGA 1K82A 3GRYA 1L2BA 1IQPA 2X49A 3DOAA 3L27A 4FD2A 4GH9A 2XH9A 2L7HA 4WW0A 3CF6E 3GP1A 4B7FA 2G8LA 1JR3A 4DUZM 3UZUA 3HU3A 1XWIA 1L8QA 1J5EM 1E94E 4NRWA 1QQWA 4YHHM 3ZC7B 3R9XB 3FTEA 3MK6A 4DV4M 4LCBA 3GLIB 2ERCA 2M60A 4MM3B 4G4RA 4GMQA 5H37D 2EO2A 3A46A 2DXIA 2KRUA 2DZOB 2I7PA 3FUWA 1IY2A 2XGNA 1KFVA 4IJFA 2CHQA 5LMUM 4FWGA 2FE8A 4L16A 3UGJA 1QVRA 3MJ5A 4QHSA 3KW6A 4JI1M 4I81A 4JI3M 2EA0A 4D81A 1NJGA 2CUZA 3KVWA 4LF6M 4AKHA 4G6ZA 4FWDA 2M5ZA 1G59A 2I7NA 1N34M 2H1RA 4L4UA 1IY1A 3PNYA 2J7OA 2XZUA 2C9CA 1TDZA 4YY3M 4JI7M 2R18A 1XNRM 4DV6M 5IZ7D 3FTFA 4D82A 2J7NA 4DV3M 5FTMA 5KQ8A 3VLFB 4BBAA 2XFTA 3I51A 4NXNM 3JAMS 2L6OA 2R4JA 4FW9A 4JI4M 1N77A 2NQ8C 3A42A 5JI2E 1PM5A 2V6ZM 2R4EA 2XFSA 4MGHA 4IBFA 3IG5A 4MGKE 3KSJA 3TL4X 1NY6A 1XHBA 4PD2A 1MX0A 1X37A 3GRRA 2YQZA 3J27B 5KPZA 2C98A 4DR4M 3TE6A 1DGGA 1SXJA 4QOZC 2Z4RA 3SAUA 2VQEM 4II7A 1Z5CA 2Y0QA 3FYCA 4ITQA 2C9OA 3U61A 4DR1M 4KO8A 3THGA 1QAOA 1DGHB 1IBMM 4LG2A 2CHVA 3UMMA 2YR0A 1KYIA 4AI6A 4MB7A 3DA1A 3FUUA 3D8BA 1XMQM 2KW0A 4B3MM 2BJWA 3D8LA 1ORYB 4S12A 4PCZA 1YUBA 5GKNA 4OVZB 2P5TA 2D7EA 3KSXA 2CEAA 3EIHA 7CATA 5ITUA 2XZFA 4IBJA 4WURA 1N75A 1K3WA 2QCUA 3FD9A 4AZFA 4GHAA 1TDHA 3L28A 5EP4A 1Q39A 1XXHB 2V1CA 2QBYB 3GLHA 4LFAM 2R65A 2UXDM 3H4MA 4LF8M 3LVWA 4HLQA 4EIWA 2DWMA 2CV0A 1Q3CA 4AKIA 1XNQM 4R3DA 4OU7A 3CTWB 3HHXA 3HJ8A 3JR4A 3FTDA 4DR2M 4AQYM 2XEPA 4HL4A 4D80A 4FVMA 4DV2M 4X62M 4DV5M 2HL7A 3AOEA 3TWLA 3GLFB 1HT2E 4B3RM 4MGIE 1QANA 1GL6A 4AW4A 4B08A 3U6QA 2DWLA 1GVNA 1WXQA 2R45A 1LV7A 3SASA 1NVMA 3J80S 5ITXA 4JYAM 3TWMA 1IY0A 4GC9A 1NHGC 4X64M 3U6DA 1N33M 3GLHB 5BR8M 3GPYA 4M9XA 5FTJA 3WHLA 3U6MA 1UM8A 4JI8M 4G4OA 2ZANA 4GC5A 3RE8A 3E4RA 3KFUG 1IM2A 1SXJE 3AJIB 3GPXA 1HNWM 5FTLA 4KODA 3U6CA 3KOWE 1DO2A 3SHFA 1L2CA 3J2PB 4CGYB 1YE9A 2L09A 5EP3A 4G4QA 1Q3BA 2QPAA 4CHTB 4IBBA 2KZSA 4RF1A 4LZZA 1Z59A 1QZMA 4LJ8A 3L2AA 2OPFA 3KP0E 1OFHA 4DR7M 1IN4A 1W5SA 2CE7A 4M0WA 3SYLA 2F4VM 2X4AA 2R46A 3HGIA 5EP2A 4FCVA 3TPZA 3UK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD2 A;  4G4N A;  4DR5 M;  1MX0 A;  3SAT A;  5FLX S;  1IBK M;  4DR4 M;  1FJG M;  2UXB M;  4JV5 M;  3SAU A;  2VQE M;  4KHP M;  1Z5C A;  1L2D A;  4DUY M;  2HHH M;  4LFB M;  4ITQ A;  3U6S A;  4DR1 M;  2F5S A;  3GQ5 A;  4JI0 M;  2UUC M;  3VK7 A;  4LF7 M;  3U6P A;  2ZM6 M;  1Z5A A;  1IBM M;  3J81 S;  4LF5 M;  2UUA M;  4MB7 A;  3GO8 A;  1HNX M;  1XMQ M;  4JI2 M;  4X65 M;  4B3M M;  4NXM M;  3SAV A;  5ITX E;  2Q2E B;  1NNJ A;  4PCZ A;  2F5O A;  3GQ4 A;  4OX9 M;  1R2Z A;  5ITU A;  5IWA M;  1N36 M;  2XZF A;  4PDG A;  1K82 A;  1K3W A;  4GKK M;  1TDH A;  1L2B A;  1Q39 A;  3DOA A;  4DR6 M;  3GP1 A;  2OQ4 A;  4LFA M;  2UXD M;  4DUZ M;  4DV0 M;  2F5N A;  4LF4 M;  4LF8 M;  1L1Z A;  3SAW A;  1Q3C A;  1J5E M;  2UU9 M;  4X66 M;  4NRW A;  4YHH M;  3VK8 A;  1XNQ M;  3TWK A;  2F5Q A;  4NRV A;  1XMO M;  5ITQ A;  4DV4 M;  3JR4 A;  4DR2 M;  4AQY M;  1HR0 M;  4DV2 M;  4G4R A;  4X62 M;  4DV5 M;  4B3S M;  3TWL A;  4B3R M;  3A46 A;  2UXC M;  5ITR A;  4DV7 M;  3U6Q A;  3A45 A;  3T1H M;  3SAS A;  3W0F A;  4GKJ M;  3J80 S;  5ITX A;  1KFV A;  5LMU M;  3TWM A;  4JYA M;  2ZBK B;  4X64 M;  5ITY A;  3U6D A;  3OTO M;  1N33 M;  1XC8 A;  5BR8 M;  3GPY A;  4JI1 M;  4JI6 M;  2HKJ A;  4JI3 M;  2VQF M;  2EA0 A;  5LMN M;  3SAR A;  3U6M A;  4JI8 M;  4G4O A;  4CIS A;  4LF6 M;  3GPP A;  3J7A S;  3GQ3 A;  1PJI A;  1N34 M;  1K3X A;  3JR5 A;  3U6L A;  3C58 A;  4JI5 M;  4DV1 M;  1HNW M;  3GPX A;  5IT9 S;  4K0K M;  5ITT A;  3U6C A;  2XZU A;  3U6E A;  1TDZ A;  4YY3 M;  1L2C A;  4JI7 M;  3GPU A;  1XNR M;  4DV6 M;  1R2Y A;  2UUB M;  4DV3 M;  4G4Q A;  1L1T A;  2E5L M;  1Q3B A;  4LFC M;  4B3T M;  1Z59 A;  1I94 M;  1Z5B A;  3SBJ A;  2OPF A;  1EE8 A;  4NXN M;  1PJJ A;  3JAM S;  4DR7 M;  4JI4 M;  5A2Q S;  2F5P A;  1MU5 A;  4DR3 M;  3A42 A;  1HNZ M;  4LF9 M;  1PM5 A;  1IBL M;  2F4V M;  4PDI A;  1N32 M;  3T1Y M;  3U6O A; 
#chains in the Genus database with same CATH topology
 2MRO B;  1IXS A;  1QAQ A;  3LQQ A;  3M6A A;  2KHH A;  4LY6 A;  4W5W A;  4G4N A;  3U5Z A;  1I4W A;  3SAT A;  2Y20 A;  4XK8 F;  2FOI C;  3GLG A;  1WGN A;  4IJE A;  5FLX S;  2N35 A;  5BPV A;  1VEJ A;  4B7G A;  3RFW A;  3WHK A;  2Z7J A;  1FJG M;  3W0L B;  1GAB A;  2OOB A;  3SC3 A;  4KHP M;  1NHW C;  1L2D A;  3E9S A;  2CWB A;  2KDL A;  4LFB M;  2JUJ A;  1IN8 A;  2W82 A;  4IBG A;  3K92 A;  2LNH C;  1CUK A;  1HQC A;  3QYE A;  2F5S A;  2DI0 A;  4LJ7 A;  4JI0 M;  4I4L A;  2UUC M;  2LXE A;  2KRK A;  3U6P A;  3FUV A;  4A3V B;  3SMS A;  1HT1 E;  2LBC A;  3Q8X A;  1WGL A;  3BOS A;  3HJQ A;  4I8O A;  4MGY E;  4GHL A;  4AKG A;  1IXZ A;  5EXT A;  1T3T A;  2WSE F;  3GO8 A;  4LZJ A;  2FNA A;  4NSR A;  2LH0 A;  4JI2 M;  1TH2 A;  4X65 M;  1OKS A;  4NXM M;  1R5L A;  5ITX E;  1R7R A;  2Q2E B;  2C5R A;  2F5O A;  1NNU C;  3AFH A;  4OX9 M;  1XB2 B;  2L7I A;  1QZE A;  8CAT A;  2VF8 A;  5EP1 A;  1C1K A;  1IFY A;  2DZN B;  4TUW A;  3I4V A;  2C96 A;  3FRI A;  4DR6 M;  1TH3 A;  2CFO A;  2OQ4 A;  1GJT A;  5FSW A;  1MN3 A;  2F5N A;  2XSZ D;  3HU1 A;  4LF4 M;  5C1B A;  2UU9 M;  1W5T A;  3I04 M;  4X66 M;  3L25 A;  1J7K A;  1G8P A;  1EFU B;  5FTK A;  4LJ5 A;  3F92 A;  1N78 A;  3L29 A;  2DVW B;  5ITQ A;  4LRT A;  1NY5 A;  1VDD A;  3PVS A;  3RGS A;  1OIP A;  2KEB A;  1DGB A;  4NOO B;  4B3S M;  2OO9 A;  3BXW A;  2QZ4 A;  2FH0 A;  4I5S A;  2MJ5 B;  3B9P A;  3HHY A;  5ITR A;  2ZAM A;  3A45 A;  2J5Y A;  3L26 A;  4GKJ M;  3CF0 A;  2JNH A;  2WSF F;  1D0K A;  1SXJ B;  2CHG A;  3HY5 A;  3U60 A;  4NSO B;  5ITY A;  3T15 A;  3ILK A;  3OTO M;  3C3E A;  1XC8 A;  3KS4 A;  3VFD A;  4MGZ E;  3DZD A;  1IN6 A;  3U61 B;  2KNV A;  1QDT A;  1S3S A;  2FFJ A;  4Z8X A;  5LMN M;  3FUX A;  4Y28 F;  3VKG A;  4L8R C;  1QDR A;  3GPP A;  3J7A S;  3AL0 C;  3GQ3 A;  1PJI A;  2RRU A;  1K3X A;  3JR5 A;  4JI5 M;  4IBK A;  4DV1 M;  2Y21 A;  5IT9 S;  3KOY E;  1GL7 A;  4AG5 A;  2DWZ B;  1ZAE A;  4JN6 A;  4RKU F;  3GPU A;  3CF2 A;  4IBE A;  4MH0 E;  2LHG A;  1GKI A;  1Z6T A;  4QNM A;  1QYR A;  2G5G X;  2WSC F;  5E6J A;  2JWS A;  3GRU A;  4CJ6 A;  5KPR A;  2LVQ D;  1R6B X;  5EJC A;  1NJF A;  1T6O A;  1I94 M;  1Z5B A;  2R6F A;  1TGU A;  5DYG A;  1DO0 A;  1E32 A;  1Y8G A;  5DFL A;  2RKO A;  4DR3 M;  1ZMV A;  3KS8 A;  2H5X A;  4LF9 M;  4FCT A;  4QOS A;  3GLI A;  3T38 A;  2Z4S A;  1UFZ A;  4F2L A;  5KO3 A;  1TH4 A;  1IBL M;  3T1Y M;  3AOG A;  4FCW A;  2CV2 A;  1IXR C;  3K1J A;  2DWN A;  3UJN A;  3TQS A;  3FTC A;  1DV0 A;  4DR5 M;  4B7H A;  3T6P A;  4BLC A;  2R62 A;  2KZU A;  1IBK M;  2LWX A;  4L78 A;  4XBO A;  1PGY A;  4R7G A;  2ZTD A;  1G4A E;  2MH8 A;  1PJT A;  4DUY M;  2ZAO A;  1V92 A;  1YSY A;  4LJ4 A;  2D7H A;  4KLN A;  1ZMU A;  4P16 A;  3KXE C;  3VK7 A;  2JXN A;  4LGM A;  1D2N A;  1Z5A A;  2JY5 A;  4PT5 A;  2ZM6 M;  3HZJ A;  1JR3 D;  1BVS A;  2QP9 X;  2UUA M;  3RGP A;  4M9Z A;  2JZ1 A;  3HHW A;  3HU2 A;  4GIP A;  3SAV A;  4LJA A;  3PNV A;  3J7B A;  3NBX X;  2L4F A;  4GRI A;  3MMP A;  4M9S A;  3E46 A;  3EIE A;  1D0L A;  3HWS A;  5IWA M;  1N36 M;  2K9D A;  2EKK A;  4BB9 A;  1FNN A;  4GKK M;  2BNK A;  4G3O A;  1OTR A;  2ZTC A;  3IHP A;  1JQJ C;  4IIW A;  1NV8 A;  2XF3 A;  5FTN A;  3SMP A;  3H4J A;  3VDU A;  3VDP A;  4DV0 M;  1L1Z A;  2LVA A;  3SAW A;  4REZ A;  2CV1 A;  4RNA A;  3VK8 A;  5KPT A;  1NV9 A;  5KQD A;  3TWK A;  3QWL A;  3ZCB B;  2LHC A;  5DNY A;  4NRV A;  2F5Q A;  4LJ6 A;  5IRE B;  4AG6 A;  1XMO M;  3IG8 A;  3BBZ A;  1HR0 M;  3MHV C;  4QNR A;  3A98 B;  3DFZ A;  1OJL A;  2BJV A;  1OAO C;  1Q02 A;  4LGY A;  3FUT A;  1WIV A;  1IXS B;  4WP2 A;  2UXC M;  3U5Z B;  4DV7 M;  1J09 A;  4LRS A;  1GLN A;  3GLG B;  3T1H M;  3W0F A;  2XSZ A;  5L8R F;  3K2L A;  2ZBK B;  1IN7 A;  2Y0T A;  2KNZ A;  1PJS A;  3GLI E;  1OIZ A;  4M0D A;  1WHC A;  2MGW A;  1DGH A;  3LVV A;  1GJS A;  2C99 A;  1QAM A;  4JI6 M;  2HKJ A;  2VQF M;  3SAR A;  3HKP A;  2LVO C;  4IBC A;  4CIS A;  3K9P A;  3HHZ A;  3VKH A;  3LQR A;  3U6L A;  1SXJ C;  3C58 A;  4OVZ A;  4K0K M;  3LMM A;  5ITT A;  2WZJ A;  3NWL A;  4GEW A;  3I01 M;  2JA2 A;  3HJS A;  4NL4 H;  4Z6Y A;  2EUC A;  3U6E A;  2DKL A;  4IBD A;  3B7Q A;  3B7N A;  5EXS A;  1R2Y A;  3LCU A;  3ZH9 B;  2UUB M;  1XXH A;  1ZQ9 A;  2D7G A;  3NBI A;  1E9R A;  1E9S A;  1L1T A;  3M0E A;  2E5L M;  2YNM D;  2QBY A;  4LFC M;  3PXG A;  2X8A A;  4B3T M;  2VII A;  2QNJ A;  1SXJ D;  4LJ9 A;  3FKE A;  2V1U A;  3SBJ A;  1EE8 A;  4GIT A;  1PJJ A;  3SYK A;  3AKZ A;  5A2Q S;  2F5P A;  1MU5 A;  2A5Y B;  2QEN A;  2RGO A;  4ANR A;  1HNZ M;  4IBI A;  4RF0 A;  4UN2 B;  2GNO A;  3GRV A;  2LTU A;  4QHT A;  4PDI A;  1N32 M;  2KA6 B;  3FRH A;  3FYD A;  3GLF A;  4Q7J A;  2DAE A;  2DHR A;  2EJS A;  2EKF A;  2HWJ A;  1VQ1 A;  2QQ8 A;  3KDS E;  2YFQ A;  3KOX E;  3U6O A;  5C18 A;  1VEG A;  1QUT A;  2AHM A;  3AV0 A;  2FS1 A;  2UXB M;  4JV5 M;  5DYI A;  1VG5 A;  2K47 A;  3KOZ E;  5JI3 E;  2HHH M;  3R8F A;  4ZPX A;  5EXX A;  4OW0 A;  3U60 B;  4L15 A;  3U6S A;  1OFI A;  3GQ5 A;  1H6U A;  4LF7 M;  3I4Y A;  1DGF A;  2RGH A;  4NC6 A;  3AOE C;  1HQY E;  5EXP A;  3PFI A;  3J81 S;  1D0M A;  4FWH A;  2XLJ A;  4LF5 M;  1GO5 A;  1G41 A;  2QSF X;  5F3W A;  3Q8G A;  4P17 A;  1IN5 A;  3KP1 E;  1KSF X;  3QAU A;  1HNX M;  5EQT A;  1NNJ A;  3K8Z A;  2O5R A;  3SHG B;  1G3I A;  3B7Z A;  3SFZ A;  3GQ4 A;  1R2Z A;  1A5T A;  2HCB A;  4JXJ A;  1ZMW A;  2JY6 B;  2KXE A;  3M7G A;  1NSF A;  4XGI A;  5E26 A;  4PDG A;  2Z3X A;  1K82 A;  3GRY A;  1L2B A;  1IQP A;  2X49 A;  3DOA A;  3L27 A;  4FD2 A;  4GH9 A;  2XH9 A;  2L7H A;  4WW0 A;  3CF6 E;  3GP1 A;  4B7F A;  2R44 A;  2G8L A;  1JR3 A;  4DUZ M;  1TR8 A;  3UZU A;  2MR9 A;  3HU3 A;  1XWI A;  1L8Q A;  3V76 A;  1J5E M;  1E94 E;  4NRW A;  1QQW A;  4YHH M;  3ZC7 B;  3R9X B;  2B3T A;  3FTE A;  3B74 A;  3C9P A;  2DNA A;  3MK6 A;  2G3Q A;  3CGW A;  4LCB A;  3GLI B;  4DV4 M;  2ERC A;  1XXH E;  2M60 A;  4MM3 B;  1VDL A;  4GMQ A;  4G4R A;  5H37 D;  2EO2 A;  2CRU A;  3B89 A;  3A46 A;  3IEC A;  2DXI A;  2KRU A;  2DZO B;  3FE3 A;  2I7P A;  1AIP C;  3FUW A;  1IY2 A;  2XGN A;  1KFV A;  4IJF A;  2CHQ A;  5LMU M;  2VDB B;  2APL A;  4FWG A;  2FE8 A;  4L16 A;  3UGJ A;  3E21 A;  1QVR A;  3MJ5 A;  3W67 A;  4QHS A;  3KW6 A;  4JI1 M;  4I81 A;  4JI3 M;  3GLF E;  2EA0 A;  4D81 A;  1NJG A;  2CUZ A;  3KVW A;  4LF6 M;  2DEN A;  4G6Z A;  4FWD A;  4AKH A;  2M5Z A;  2BWB A;  1G59 A;  2I7N A;  2K6B A;  2H1R A;  4L4U A;  2JZ0 A;  1IY1 A;  1HJP A;  1N34 M;  2L4E A;  2R0I A;  3PNY A;  2J7O A;  2XZU A;  2C9C A;  1TDZ A;  3GLH E;  1C7Y A;  1PRB A;  2O25 A;  4YY3 M;  4JI7 M;  1OAI A;  2R18 A;  1XNR M;  4DV6 M;  5IZ7 D;  3FTF A;  4D82 A;  2J7N A;  2DAG A;  2JP7 A;  5FTM A;  4DV3 M;  5KQ8 A;  2CP8 A;  1SG9 A;  3VLF B;  3K9O A;  4BBA A;  2XFT A;  1G71 A;  3I51 A;  4NXN M;  3ZQJ A;  3JAM S;  2L6O A;  2R4J A;  4FW9 A;  4JI4 M;  1N77 A;  2NQ8 C;  3A42 A;  1T43 A;  2DAM A;  5JI2 E;  4R71 A;  1PM5 A;  2V6Z M;  2R4E A;  2XFS A;  4MGH A;  4IBF A;  3IG5 A;  4MGK E;  1AUA A;  3KSJ A;  3TL4 X;  1NY6 A;  1XHB A;  4PD2 A;  1MX0 A;  1RU3 A;  1X37 A;  2YQZ A;  3GRR A;  3J27 B;  5KPZ A;  2C98 A;  1JR3 E;  4DR4 M;  3TE6 A;  1DGG A;  1SXJ A;  4QOZ C;  2Z4R A;  3SAU A;  2VQE M;  1R4G A;  4II7 A;  1Z5C A;  3LW5 F;  2Y0Q A;  3FYC A;  4ITQ A;  2C9O A;  3U61 A;  2BWE A;  2VF7 A;  4DR1 M;  2L2D A;  4KO8 A;  3THG A;  1QAO A;  1MJG M;  1DGH B;  1WJ7 A;  1IBM M;  4LG2 A;  2CHV A;  2DHY A;  3UMM A;  2YR0 A;  1KYI A;  4AI6 A;  4MB7 A;  2Z8Y M;  3DA1 A;  2O01 F;  3FUU A;  3D8B A;  1XMQ M;  2KW0 A;  3HX3 A;  4B3M M;  2BJW A;  3D8L A;  1ORY B;  4S12 A;  4PCZ A;  1YUB A;  5GKN A;  4OVZ B;  2P5T A;  2DAI A;  2D7E A;  3KSX A;  2CEA A;  3EIH A;  7CAT A;  5ITU A;  2XZF A;  4IBJ A;  4WUR A;  1N75 A;  1K3W A;  1NO1 A;  2QCU A;  3FD9 A;  4AZF A;  4GHA A;  1TDH A;  3L28 A;  5EP4 A;  1Q39 A;  1XXH B;  2V1C A;  1F4I A;  2QBY B;  3GLH A;  4LFA M;  2R65 A;  1VEK A;  2UXD M;  3H4M A;  4LF8 M;  3LVW A;  4HLQ A;  4EIW A;  2DWM A;  4KT0 F;  2CV0 A;  1Q3C A;  4L6V 6;  2LVP C;  4AKI A;  1XNQ M;  4R3D A;  3GLG E;  4OU7 A;  3CTW B;  1P3Q Q;  3HHX A;  1TTE A;  3C3D A;  3HJ8 A;  3JR4 A;  3FTD A;  4DR2 M;  4AQY M;  1PJQ A;  2XEP A;  4HL4 A;  4D80 A;  4FVM A;  2OOA A;  4DV2 M;  4X62 M;  4DV5 M;  2HL7 A;  3AOE A;  3TWL A;  3GLF B;  1HT2 E;  4B3R M;  3LCV B;  4MGI E;  1OQY A;  1QAN A;  1GL6 A;  4AW4 A;  4B08 A;  3U6Q A;  2DWL A;  1GVN A;  1WXQ A;  2R45 A;  1LV7 A;  3SAS A;  1NVM A;  2JY7 A;  2JY8 A;  3J80 S;  5ITX A;  3TWM A;  1IY0 A;  4JYA M;  4GC9 A;  1NHG C;  1JB0 F;  4X64 M;  3U6D A;  3QYB A;  1N33 M;  3GLH B;  5BR8 M;  3GPY A;  4M9X A;  2LVN C;  5FTJ A;  3WHL A;  2GQF A;  1UM8 A;  2DAK A;  4G4O A;  3U6M A;  4JI8 M;  2ZAN A;  1WR1 B;  4GC5 A;  3RE8 A;  3E4R A;  3KFU G;  1TF0 B;  1IM2 A;  2K0B X;  1SXJ E;  3AJI B;  3GPX A;  1HNW M;  2HAK A;  5FTL A;  4CIZ A;  4KOD A;  1V33 A;  3U6C A;  3KOW E;  1DO2 A;  3SHF A;  1L2C A;  3J2P B;  4CGY B;  1YE9 A;  2L09 A;  4DBG B;  5EP3 A;  4G4Q A;  2QHO B;  1Q3B A;  2QPA A;  2DZL A;  4CHT B;  1V34 A;  4IBB A;  2KNA A;  2KZS A;  4RF1 A;  4LZZ A;  1Z59 A;  1EIJ A;  4HEO A;  1QZM A;  4LJ8 A;  3L2A A;  2OPF A;  3KP0 E;  1ZV1 A;  1OFH A;  4DR7 M;  1IN4 A;  1YLA A;  1W5S A;  2CE7 A;  4M0W A;  3SYL A;  3W68 A;  2F4V M;  2X4A A;  2R46 A;  3HGI A;  5EP2 A;  4F1I A;  1QUS A;  4FCV A;  3TPZ A;  1LTM A;  3UK6 A; 
#chains in the Genus database with same CATH homology
 3M6A A;  1QAQ A;  3LQQ A;  4G4N A;  4LY6 A;  4W5W A;  3U5Z A;  3SAT A;  1I4W A;  2Y20 A;  2FOI C;  3GLG A;  4IJE A;  5FLX S;  5BPV A;  4B7G A;  3RFW A;  3WHK A;  2Z7J A;  1FJG M;  3W0L B;  3SC3 A;  4KHP M;  1NHW C;  1L2D A;  3E9S A;  4LFB M;  1IN8 A;  2W82 A;  4IBG A;  3K92 A;  2LNH C;  1HQC A;  2F5S A;  4LJ7 A;  4JI0 M;  2UUC M;  4I4L A;  2LXE A;  2KRK A;  3U6P A;  3FUV A;  4A3V B;  3SMS A;  1HT1 E;  3Q8X A;  3BOS A;  3HJQ A;  4I8O A;  4MGY E;  4GHL A;  4AKG A;  1IXZ A;  5EXT A;  1T3T A;  3GO8 A;  4LZJ A;  2FNA A;  4NSR A;  2LH0 A;  4JI2 M;  1TH2 A;  4X65 M;  4NXM M;  5ITX E;  1R7R A;  2Q2E B;  2C5R A;  2F5O A;  1NNU C;  3AFH A;  4OX9 M;  2L7I A;  8CAT A;  5EP1 A;  1C1K A;  2DZN B;  4TUW A;  3I4V A;  2C96 A;  4DR6 M;  1TH3 A;  2CFO A;  2OQ4 A;  5FSW A;  2F5N A;  4LF4 M;  2XSZ D;  3HU1 A;  5C1B A;  2UU9 M;  1W5T A;  4X66 M;  3L25 A;  1J7K A;  1G8P A;  5FTK A;  4LJ5 A;  1N78 A;  3L29 A;  2DVW B;  5ITQ A;  4LRT A;  1NY5 A;  1VDD A;  3PVS A;  3RGS A;  4NOO B;  2KEB A;  1DGB A;  4B3S M;  2QZ4 A;  4I5S A;  3B9P A;  3HHY A;  5ITR A;  2ZAM A;  3A45 A;  4GKJ M;  3L26 A;  3CF0 A;  1SXJ B;  2CHG A;  3U60 A;  4NSO B;  5ITY A;  3T15 A;  3ILK A;  3OTO M;  1XC8 A;  3KS4 A;  3VFD A;  4MGZ E;  3DZD A;  1IN6 A;  3U61 B;  1S3S A;  2FFJ A;  4Z8X A;  5LMN M;  3FUX A;  3VKG A;  4L8R C;  3GPP A;  3J7A S;  3AL0 C;  3GQ3 A;  1PJI A;  1K3X A;  3JR5 A;  4JI5 M;  4IBK A;  4DV1 M;  2Y21 A;  5IT9 S;  3KOY E;  1GL7 A;  4AG5 A;  2DWZ B;  1ZAE A;  4JN6 A;  3GPU A;  3CF2 A;  4IBE A;  4MH0 E;  1GKI A;  1Z6T A;  4QNM A;  1QYR A;  2G5G X;  5E6J A;  3GRU A;  5KPR A;  1R6B X;  5EJC A;  1NJF A;  1I94 M;  1Z5B A;  1TGU A;  5DYG A;  1DO0 A;  1E32 A;  2RKO A;  4DR3 M;  3KS8 A;  4LF9 M;  4FCT A;  4QOS A;  3GLI A;  3T38 A;  2Z4S A;  5KO3 A;  1IBL M;  1TH4 A;  3T1Y M;  3AOG A;  4FCW A;  2CV2 A;  1IXR C;  3K1J A;  2DWN A;  3UJN A;  3TQS A;  3FTC A;  4DR5 M;  4B7H A;  4BLC A;  2R62 A;  2KZU A;  1IBK M;  2LWX A;  4L78 A;  4XBO A;  4R7G A;  1G4A E;  4DUY M;  2ZAO A;  1YSY A;  4LJ4 A;  2D7H A;  4KLN A;  4P16 A;  3VK7 A;  3KXE C;  4LGM A;  1D2N A;  1Z5A A;  4PT5 A;  2ZM6 M;  1JR3 D;  2QP9 X;  2UUA M;  3RGP A;  4M9Z A;  3HHW A;  3HU2 A;  4GIP A;  3SAV A;  4LJA A;  3PNV A;  3J7B A;  4GRI A;  4M9S A;  3EIE A;  3HWS A;  5IWA M;  1N36 M;  4BB9 A;  1FNN A;  4GKK M;  2BNK A;  1JQJ C;  4IIW A;  2XF3 A;  5FTN A;  3SMP A;  3VDU A;  3VDP A;  4DV0 M;  1L1Z A;  3SAW A;  4REZ A;  2CV1 A;  4RNA A;  3VK8 A;  5KPT A;  5KQD A;  3TWK A;  3QWL A;  3ZCB B;  5DNY A;  2F5Q A;  4NRV A;  4LJ6 A;  5IRE B;  4AG6 A;  1XMO M;  3IG8 A;  1HR0 M;  3MHV C;  4QNR A;  3A98 B;  3DFZ A;  1OJL A;  2BJV A;  4LGY A;  3FUT A;  1IXS B;  2UXC M;  3U5Z B;  4DV7 M;  1J09 A;  4LRS A;  1GLN A;  3GLG B;  3T1H M;  3W0F A;  2XSZ A;  3K2L A;  2ZBK B;  1IN7 A;  2Y0T A;  4M0D A;  1DGH A;  3LVV A;  2C99 A;  1QAM A;  4JI6 M;  2HKJ A;  2VQF M;  3SAR A;  3HKP A;  4IBC A;  4CIS A;  3HHZ A;  3VKH A;  3LQR A;  3U6L A;  1SXJ C;  3C58 A;  4OVZ A;  4K0K M;  3LMM A;  5ITT A;  3NWL A;  2JA2 A;  3HJS A;  4NL4 H;  4Z6Y A;  2EUC A;  3U6E A;  4IBD A;  1R2Y A;  5EXS A;  2UUB M;  3ZH9 B;  1XXH A;  1ZQ9 A;  2D7G A;  3NBI A;  1E9R A;  1E9S A;  1L1T A;  3M0E A;  2E5L M;  2YNM D;  2QBY A;  4LFC M;  3PXG A;  2X8A A;  4B3T M;  2VII A;  1SXJ D;  4LJ9 A;  3FKE A;  2V1U A;  3SBJ A;  1EE8 A;  4GIT A;  1PJJ A;  3SYK A;  3AKZ A;  5A2Q S;  2F5P A;  1MU5 A;  2A5Y B;  2QEN A;  2RGO A;  1HNZ M;  4IBI A;  4RF0 A;  3GRV A;  4QHT A;  4PDI A;  1N32 M;  2KA6 B;  3FYD A;  3GLF A;  2DHR A;  3KOX E;  3KDS E;  3U6O A;  2YFQ A;  5C18 A;  2AHM A;  3AV0 A;  2UXB M;  4JV5 M;  5DYI A;  2K47 A;  3KOZ E;  5JI3 E;  2HHH M;  3R8F A;  4ZPX A;  5EXX A;  4OW0 A;  3U60 B;  4L15 A;  3U6S A;  1OFI A;  3GQ5 A;  1H6U A;  4LF7 M;  3I4Y A;  1DGF A;  2RGH A;  3AOE C;  1HQY E;  5EXP A;  3PFI A;  3J81 S;  2XLJ A;  4FWH A;  4LF5 M;  1G41 A;  5F3W A;  1IN5 A;  3KP1 E;  1KSF X;  3QAU A;  1HNX M;  5EQT A;  1NNJ A;  3K8Z A;  2O5R A;  3SHG B;  1G3I A;  3SFZ A;  3GQ4 A;  1R2Z A;  2HCB A;  4JXJ A;  2Z3X A;  2KXE A;  3M7G A;  1NSF A;  4XGI A;  5E26 A;  4PDG A;  1K82 A;  3GRY A;  1L2B A;  1IQP A;  2X49 A;  3DOA A;  3L27 A;  4FD2 A;  4GH9 A;  2XH9 A;  2L7H A;  4WW0 A;  3CF6 E;  3GP1 A;  4B7F A;  2G8L A;  1JR3 A;  4DUZ M;  3UZU A;  3HU3 A;  1XWI A;  1L8Q A;  1J5E M;  1E94 E;  4NRW A;  1QQW A;  4YHH M;  3ZC7 B;  3R9X B;  3FTE A;  3MK6 A;  4DV4 M;  4LCB A;  3GLI B;  2ERC A;  2M60 A;  4MM3 B;  4G4R A;  4GMQ A;  5H37 D;  2EO2 A;  3A46 A;  2DXI A;  2KRU A;  2DZO B;  2I7P A;  3FUW A;  1IY2 A;  2XGN A;  1KFV A;  4IJF A;  2CHQ A;  5LMU M;  4FWG A;  2FE8 A;  4L16 A;  3UGJ A;  1QVR A;  3MJ5 A;  4QHS A;  3KW6 A;  4JI1 M;  4I81 A;  4JI3 M;  2EA0 A;  4D81 A;  1NJG A;  2CUZ A;  3KVW A;  4LF6 M;  4AKH A;  4G6Z A;  4FWD A;  2M5Z A;  1G59 A;  2I7N A;  1N34 M;  2H1R A;  4L4U A;  1IY1 A;  3PNY A;  2J7O A;  2XZU A;  2C9C A;  1TDZ A;  4YY3 M;  4JI7 M;  2R18 A;  1XNR M;  4DV6 M;  5IZ7 D;  3FTF A;  4D82 A;  2J7N A;  4DV3 M;  5FTM A;  5KQ8 A;  3VLF B;  4BBA A;  2XFT A;  3I51 A;  4NXN M;  3JAM S;  2L6O A;  2R4J A;  4FW9 A;  4JI4 M;  1N77 A;  2NQ8 C;  3A42 A;  5JI2 E;  1PM5 A;  2V6Z M;  2R4E A;  2XFS A;  4MGH A;  4IBF A;  3IG5 A;  4MGK E;  3KSJ A;  3TL4 X;  1NY6 A;  1XHB A;  4PD2 A;  1MX0 A;  1X37 A;  3GRR A;  2YQZ A;  3J27 B;  5KPZ A;  2C98 A;  4DR4 M;  3TE6 A;  1DGG A;  1SXJ A;  4QOZ C;  2Z4R A;  3SAU A;  2VQE M;  4II7 A;  1Z5C A;  2Y0Q A;  3FYC A;  4ITQ A;  2C9O A;  3U61 A;  4DR1 M;  4KO8 A;  3THG A;  1QAO A;  1DGH B;  1IBM M;  4LG2 A;  2CHV A;  3UMM A;  2YR0 A;  1KYI A;  4AI6 A;  4MB7 A;  3DA1 A;  3FUU A;  3D8B A;  1XMQ M;  2KW0 A;  4B3M M;  2BJW A;  3D8L A;  1ORY B;  4S12 A;  4PCZ A;  1YUB A;  5GKN A;  4OVZ B;  2P5T A;  2D7E A;  3KSX A;  2CEA A;  3EIH A;  7CAT A;  5ITU A;  2XZF A;  4IBJ A;  4WUR A;  1N75 A;  1K3W A;  2QCU A;  3FD9 A;  4AZF A;  4GHA A;  1TDH A;  3L28 A;  5EP4 A;  1Q39 A;  1XXH B;  2V1C A;  2QBY B;  3GLH A;  4LFA M;  2R65 A;  2UXD M;  3H4M A;  4LF8 M;  3LVW A;  4HLQ A;  4EIW A;  2DWM A;  2CV0 A;  1Q3C A;  4AKI A;  1XNQ M;  4R3D A;  4OU7 A;  3CTW B;  3HHX A;  3HJ8 A;  3JR4 A;  3FTD A;  4DR2 M;  4AQY M;  2XEP A;  4HL4 A;  4D80 A;  4FVM A;  4DV2 M;  4X62 M;  4DV5 M;  2HL7 A;  3AOE A;  3TWL A;  3GLF B;  1HT2 E;  4B3R M;  4MGI E;  1QAN A;  1GL6 A;  4AW4 A;  4B08 A;  3U6Q A;  2DWL A;  1GVN A;  1WXQ A;  2R45 A;  1LV7 A;  3SAS A;  1NVM A;  3J80 S;  5ITX A;  4JYA M;  3TWM A;  1IY0 A;  4GC9 A;  1NHG C;  4X64 M;  3U6D A;  1N33 M;  3GLH B;  5BR8 M;  3GPY A;  4M9X A;  5FTJ A;  3WHL A;  3U6M A;  1UM8 A;  4JI8 M;  4G4O A;  2ZAN A;  4GC5 A;  3RE8 A;  3E4R A;  3KFU G;  1IM2 A;  1SXJ E;  3AJI B;  3GPX A;  1HNW M;  5FTL A;  4KOD A;  3U6C A;  3KOW E;  1DO2 A;  3SHF A;  1L2C A;  3J2P B;  4CGY B;  1YE9 A;  2L09 A;  5EP3 A;  4G4Q A;  1Q3B A;  2QPA A;  4CHT B;  4IBB A;  2KZS A;  4RF1 A;  4LZZ A;  1Z59 A;  1QZM A;  4LJ8 A;  3L2A A;  2OPF A;  3KP0 E;  1OFH A;  4DR7 M;  1IN4 A;  1W5S A;  2CE7 A;  4M0W A;  3SYL A;  2F4V M;  2X4A A;  2R46 A;  3HGI A;  5EP2 A;  4FCV A;  3TPZ A;  3UK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...