2EA0A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli in complex with ap-site containing dna substrate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
254
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrate and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 84
structure length 254
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ea0A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2ea0A01
2XZUA 1XNQM 4GKJM 4JI7M 1L1TA 1MU5A 2ZBKB 4DR3M 4LF5M 3SARA 4JI4M 2XZFA 2ZM6M 4JI3M 4DR2M 4MB7A 1PJJA 3W0FA 4X65M 4YHHM 1L1ZA 1HNXM 2UU9M 1FJGM 1HNWM 4B3TM 2HHHM 1L2DA 1TDZA 1N33M 3A42A 3A45A 2UXBM 3SAUA 4NRVA 4LFAM 2F5NA 4JI1M 4JYAM 2F4VM 5ITTA 1N34M 4DV0M 4B3RM 4GKKM 4LF9M 1XMOM 3J81S 1Q3CA 2UXCM 4JV5M 1R2YA 1MX0A 1Z59A 3GPYA 3DOAA 5ITQA 3GPUA 1IBLM 3GQ3A 4NXNM 3GO8A 4X62M 4G4QA 4LFBM 2VQFM 4DV2M 4X64M 1Z5AA 1HNZM 4DR4M 2UUCM 4JI8M 2F5PA 4OX9M 5A2QS 4PD2A 3GPXA 1XC8A 3JAMS 2F5QA 3U6QA 4X66M 4JI5M 3JR4A 5LMNM 3U6CA 5FLXS 4LFCM 4DUZM 3SASA 3GP1A 4G4RA 3VK7A 1IBMM 1N36M 2VQEM 1N32M 3TWMA 5ITXE 3VK8A 4NRWA 1HR0M 3U6LA 1Z5BA 1L2CA 3GQ5A 4LF8M 4LF4M 1L2BA 4CISA 1PM5A 4YY3M 4K0KM 5LMUM 3T1YM 4AQYM 5ITXA 3J80S 1K3XA 3U6SA 1IBKM 4DV5M 3U6EA 3GPPA 3SBJA 1Z5CA 4G4OA 4B3SM 5IT9S 2EA0A 4DR6M 5ITUA 4DV1M 4DV3M 5IWAM 4DR1M 1J5EM 4DR7M 1K3WA 3U6PA 2F5OA 4NXMM 2HKJA 4JI0M 3J7AS 1NNJA 1TDHA 3TWKA 3OTOM 1XMQM 5ITRA 4ITQA 4G4NA 3C58A 3T1HM 1EE8A 2E5LM 1Q3BA 2OPFA 1KFVA 4JI2M 3SAWA 3U6OA 5ITYA 4DV7M 3SAVA 4DR5M 4B3MM 4DUYM 4LF6M 1K82A 3A46A 4PDGA 3TWLA 2UUBM 2OQ4A 2Q2EB 3U6DA 4PDIA 4KHPM 3JR5A 1PJIA 3SATA 4LF7M 5BR8M 2UXDM 1Q39A 4DV6M 3U6MA 4PCZA 1XNRM 4DV4M 2F5SA 4JI6M 3GQ4A 2UUAM 1R2ZA 1I94M
chains in the Genus database with same CATH superfamily
2XZUA 4FWDA 2R6FA 3HX3A 2DAMA 3K9OA 3LMMA 1XNQM 3W67A 2C99A 4GKJM 3IG5A 2Y20A 1GKIA 1ZMUA 4I5SA 1G4AE 4NOOB 4IBEA 4P17A 4M9SA 3SHFA 1TTEA 1ZV1A 3I4VA 3B7QA 1E94E 2FOIC 1YUBA 3KXEC 3M6AA 2XZFA 4JI3M 3BBZA 4R7GA 4MB7A 2C98A 3KOZE 1TF0B 4X65M 1UM8A 1JR3E 1J09A 2GNOA 2UU9M 1FJGM 4OVZB 3HZJA 4IBIA 4IJFA 1T6OA 2HHHM 1HNWM 2WSEF 3UJNA 4TUWA 3AFHA 4NSRA 3E46A 1XWIA 3AOGA 5C18A 3U61B 1HT2E 1IY2A 4GC9A 5ITTA 1NO1A 1GVNA 4DV0M 4GKKM 1IXSA 2VF7A 3FYCA 1PJTA 4LF9M 1IXRC 4OW0A 1Q3CA 2KNZA 5E6JA 2MH8A 2G8LA 1R2YA 1E32A 3IG8A 4XBOA 3CTWB 1Z6TA 2LHGA 3FTCA 3GRUA 1IBLM 3U5ZA 2DI0A 5KO3A 3J7BA 2DZLA 1OJLA 4GIPA 3DZDA 3VLFB 4LFBM 2FS1A 4X64M 4FCWA 4BBAA 1R6BX 1EFUB 3B9PA 3GLGE 3I01M 4PD2A 3HHYA 3JAMS 2F5QA 2P5TA 3FUXA 3U60B 3U6CA 4LFCM 2DZOB 1YLAA 4KT0F 3FUUA 4QOSA 4LJ9A 3TE6A 3ZH9B 1C1KA 4A3VB 3AJIB 3I51A 1AUAA 4NRWA 1QZMA 1Z5BA 5FSWA 4LF8M 4IBDA 1L2BA 3EIEA 2XGNA 4W5WA 2KHHA 4LJ4A 2L7HA 5LMUM 3NWLA 3FRIA 5ITXA 1IXZA 1GL7A 3U5ZB 3J80S 3SMSA 1QZEA 2CHGA 1G41A 3U6EA 1Z5CA 2DNAA 2QHOB 3KVWA 4RKUF 3KFUG 5IT9S 5IREB 2EA0A 4FW9A 1JR3D 4LZZA 1HT1E 3FTEA 2L6OA 4DV3M 5IWAM 4HL4A 2YQZA 1DGFA 2CEAA 4DR7M 5H37D 2QZ4A 4NL4H 3SASA 4NXMM 2HKJA 2YNMD 3A98B 4JI0M 3L29A 2XLJA 3C3EA 3J7AS 4L15A 3OTOM 1LV7A 1VQ1A 1W5TA 1XMQM 3HKPA 1YE9A 2RKOA 3L25A 2XH9A 1DO0A 2JY5A 2KDLA 2CE7A 1C7YA 3SAWA 2R4EA 4JI2M 3KDSE 4DR5M 4B08A 3DA1A 2L09A 2MGWA 2MROB 4CHTB 4FWGA 5EQTA 1IN8A 1FNNA 2EJSA 3HJ8A 2C96A 3FRHA 4I81A 1WXQA 2KEBA 4CIZA 4G3OA 4AKGA 4QHSA 4QHTA 5KQDA 5FTJA 1A5TA 2L4FA 3T6PA 4LF7M 3RFWA 2DVWB 3LVWA 1Q39A 2QP9X 1S3SA 3U6MA 4PCZA 2LBCA 2R0IA 2F5SA 4L16A 3GQ4A 5EXSA 1VEKA 3E9SA 2DENA 1D0KA 3L2AA 4XGIA 3BXWA 3PVSA 3T15A 3MJ5A 3SYKA 4I8OA 2XSZA 2LTUA 2ZBKB 4L4UA 3UZUA 3SARA 1GO5A 1SXJA 1G3IA 1QAOA 5BPVA 2VF8A 3FUTA 2ZM6M 2G5GX 3SYLA 3W0FA 4YHHM 1L1ZA 1HNXM 3KS4A 3IHPA 1GL6A 3A42A 3A45A 3HHZA 3GLIE 3SAUA 4LRTA 3I04M 2NQ8C 5EXPA 3QAUA 4JI1M 3GLGA 4JYAM 1R7RA 4GRIA 2JUJA 2QCUA 1WGLA 2BWEA 4GITA 2KW0A 3E21A 4LJ5A 4IBKA 3WHLA 1XMOM 2C5RA 4GEWA 1WJ7A 4DBGB 5DYIA 1OAOC 3THGA 1IN5A 4FWHA 4ZPXA 2DHYA 5ITQA 4F1IA 4NC6A 1SXJB 4X62M 1KYIA 2JZ1A 5EP1A 1QANA 2WSFF 4GH9A 2JY8A 4REZA 3KSXA 1G59A 2JNHA 2F5PA 2LH0A 3M7GA 3LCVB 2KNVA 3U6QA 3FKEA 4Z8XA 1CUKA 2YFQA 3RE8A 4B7GA 4JI5M 2MJ5B 3K2LA 1OAIA 2R62A 2XF3A 2I7PA 4R71A 2RGHA 3VK7A 4D81A 5KPTA 1N36M 1IBMM 2D7HA 1XB2B 3VK8A 4R3DA 2DZNB 3U6LA 4Y28F 4MGIE 2EUCA 3GLFA 4WW0A 3LCUA 4QOZC 2M5ZA 1PM5A 3AOEA 1XXHA 5JI3E 4Q7JA 2L7IA 3K1JA 1VG5A 1ZMVA 3PNVA 2LVNC 3TQSA 1K3XA 1E9SA 4KLNA 1HQYE 3D8BA 2Z3XA 3GPPA 3SBJA 1J7KA 1EIJA 2YR0A 4G6ZA 1NV8A 4LJ7A 3FUWA 3DFZA 3KOXE 3KW6A 4DR6M 1N75A 2G3QA 2MR9A 2O25A 3QWLA 2HCBA 3SC3A 1G71A 3C9PA 3K92A 4CJ6A 4MGZE 2HL7A 2DAEA 2R18A 1NY5A 4RF1A 1NNUC 1IXSB 4M0WA 2VDBB 3HGIA 4LJAA 3GLFB 2OPFA 2DAIA 4DV7M 1DGHA 3BOSA 1QQWA 4FD2A 1QAMA 1JB0F 1K82A 2ZANA 4FVMA 4PDGA 1DGGA 1IN4A 4UN2B 4WP2A 2KXEA 2R45A 2UUBM 3U6DA 4PDIA 2B3TA 2JWSA 3FTFA 1NV9A 1QUSA 3KSJA 1PGYA 3CF6E 3MK6A 3EIHA 1PJIA 1VDDA 4AG5A 2JP7A 1TGUA 2RGOA 3GLHA 3L28A 2UXDM 1NHWC 2K9DA 4BLCA 1ZMWA 3K8ZA 4KO8A 3Q8XA 5IZ7D 1XNRM 2QQ8A 2BWBA 3QYEA 4S12A 2KZSA 3CF2A 4AZFA 1VDLA 4M0DA 1OFIA 3GLIA 1R2ZA 2UUAM 2APLA 5L8RF 5JI2E 1D0MA 2DWZB 2Z4SA 1DGHB 2LNHC 4PT5A 1JQJC 3F92A 1MU5A 3W68A 2QSFX 2JA2A 3E4RA 1MJGM 4DR3M 2CV1A 2L2DA 1V34A 3RGPA 4BB9A 3HU3A 5KQ8A 2WZJA 3ILKA 4DR2M 3UMMA 2QPAA 4IBCA 4MGKE 3HHWA 2AHMA 3FUVA 4B3TM 2XEPA 1ORYB 1L2DA 2JY6B 1L8QA 5EJCA 1QDTA 3GLHB 1OKSA 3PFIA 4LFAM 2F5NA 3WHKA 1QVRA 1JR3A 3R9XB 2R44A 3LQRA 4QNMA 5KPRA 3VKGA 1QDRA 2ZTCA 3J81S 2UXCM 1ZQ9A 4JV5M 3RGSA 1N78A 3AV0A 1NY6A 2JXNA 3DOAA 3GPUA 3VDUA 3J2PB 3VKHA 3IECA 4MGYE 4G4QA 2DXIA 3V76A 1VEJA 2Z4RA 3CF0A 2VIIA 1UFZA 4D80A 4AKHA 2JY7A 2CV0A 1SG9A 4JI8M 3GPXA 4FCVA 4EIWA 3SFZA 1XC8A 1D0LA 3Q8GA 2CFOA 2W82A 5FLXS 3LVVA 5EP4A 4IBBA 1MN3A 3NBXX 2OOAA 4AG6A 7CATA 2VQEM 1N32M 2LHCA 2R46A 3TWMA 5C1BA 5EP3A 5ITXE 1V92A 2BNKA 1HR0M 1L2CA 2K6BA 3GRVA 4M9XA 3GQ5A 1P3QQ 1GLNA 4CISA 1E9RA 4MH0E 2ZAOA 3T1YM 1DGBA 4KODA 1IBKM 4DV5M 2FFJA 4G4OA 2KA6B 4B3SM 2KNAA 3KOWE 3AL0C 1RU3A 3FD9A 4OVZA 5ITUA 3HU1A 4LG2A 3FYDA 1TR8A 2CHQA 2EKKA 3U6PA 4D82A 2F5OA 3U61A 4GHLA 4LZJA 3C3DA 4Z6YA 3GLGB 2OO9A 1NNJA 2DWLA 4QNRA 2CV2A 4P16A 2Y0TA 4G4NA 1VEGA 1TH4A 3HHXA 2JZ0A 1EE8A 2HWJA 3J27B 5FTLA 1H6UA 3W0LB 2E5LM 2DKLA 1PJQA 3D8LA 3SAVA 2D7EA 4JN6A 4B3MM 4LF6M 1XHBA 1OFHA 2K47A 3HJQA 4NSOB 1WHCA 2LXEA 2EKFA 3MMPA 3VFDA 3TWLA 3HWSA 3QYBA 5FTMA 2OQ4A 2Q2EB 1GABA 1D2NA 5FTNA 2N35A 4I4LA 4KHPM 3SMPA 3KP1E 2DWNA 2C9OA 1HJPA 1PJSA 2H5XA 4MGHA 1Y8GA 2K0BX 2R4JA 2ZAMA 1GJSA 1OTRA 3UK6A 1DV0A 3U60A 2O01F 1W5SA 5BR8M 3B7NA 4DV6M 1ZAEA 3B74A 1SXJC 1IQPA 4JI6M 1T43A 2I7NA 3L27A 4LY6A 1I4WA 4XK8F 1SXJE 1NSFA 2GQFA 1T3TA 3KS8A 4L8RC 2ERCA 3ZC7B 4JI7M 1IY1A 2LWXA 1L1TA 4HEOA 1XXHB 4L6V6 1NJGA 3KOYE 4LF5M 4II7A 4JI4M 3GRRA 4ANRA 2BJVA 2QNJA 1BVSA 3FTDA 3M0EA 1PJJA 2DHRA 1IFYA 3HU2A 1N33M 1TDZA 4AI6A 2CWBA 2UXBM 1YSYA 3ZCBB 4NRVA 1NJFA 4RF0A 2QBYA 2F4VM 1IN7A 2LVPC 1HQCA 2V6ZM 1N34M 2O5RA 4RNAA 5GKNA 3H4MA 3T38A 3UGJA 4B3RM 2LVQD 1N77A 3HJSA 2Z8YM 2CP8A 5DYGA 2LVOC 4GMQA 3TL4X 1MX0A 5E26A 5FTKA 1Z59A 3GPYA 5DNYA 1WR1B 3VDPA 8CATA 3GQ3A 4NXNM 2FH0A 3GO8A 2ZTDA 2LVAA 4LGMA 2VQFM 3H4JA 2M60A 4DV2M 1Z5AA 1QUTA 1OQYA 1Q02A 1HNZM 4DR4M 3I4YA 1TH2A 2R65A 2UUCM 4IBFA 2EO2A 1LTMA 4OX9M 5A2QS 1X37A 1R5LA 2Y0QA 3AOEC 2J7NA 3PNYA 2CHVA 4B7FA 4X66M 2FE8A 1WGNA 3JR4A 5LMNM 3GLFE 4IBJA 4CGYB 3B7ZA 4DUZM 4OU7A 2QBYB 4HLQA 4F2LA 3GP1A 4DV4M 4G4RA 1XXHE 3LW5F 2XSZD 2KZUA 5EXTA 2CUZA 3GLIB 4IIWA 1F4IA 4AW4A 3K9PA 1SXJD 2X8AA 2BJWA 4LF4M 2H1RA 4LRSA 4LGYA 2HAKA 4IBGA 4YY3M 4K0KM 3NBIA 4AQYM 3CGWA 1NVMA 4MM3B 3U6SA 4AKIA 1PRBA 3L26A 2CRUA 1KSFX 2DAKA 4DV1M 4WURA 3AKZA 1IM2A 2XFSA 4DR1M 4M9ZA 1J5EM 2DAGA 1G8PA 1NHGC 3KP0E 5KPZA 1K3WA 1IY0A 2WSCF 1QAQA 1DO2A 2QENA 1TDHA 3TWKA 1QYRA 4ITQA 4L78A 3SHGB 4JXJA 5ITRA 4IJEA 3PXGA 4LCBA 3C58A 2D7GA 1R4GA 5EP2A 3T1HM 5F3WA 1Q3BA 1KFVA 3FE3A 4LJ6A 3U6OA 5ITYA 3MHVC 3HY5A 2Z7JA 3ZQJA 1AIPC 1OIPA 4DUYM 2DWMA 3A46A 1V33A 2V1UA 1OIZA 2C9CA 3R8FA 2J5YA 2V1CA 3GLHE 1WIVA 2X49A 2KRKA 2J7OA 4B7HA 4GHAA 2OOBA 1GJTA 3JR5A 2XFTA 2L4EA 2X4AA 3TPZA 3B89A 2KRUA 2FNAA 5EXXA 2Y21A 3SATA 5DFLA 3LQQA 1IN6A 2A5YB 4GC5A 1TH3A 4FCTA 3GRYA 4LJ8A 2RRUA 1I94M
chains in the Genus database with same CATH topology
2XZUA 4FWDA 3LMMA 1XNQM 2C99A 4GKJM 3IG5A 2Y20A 1GKIA 4I5SA 4NOOB 1G4AE 4IBEA 3SHFA 4M9SA 3I4VA 1E94E 2FOIC 1YUBA 3KXEC 3M6AA 2XZFA 4JI3M 4R7GA 4MB7A 2C98A 3KOZE 4X65M 2UU9M 1UM8A 1J09A 1FJGM 1HNWM 4OVZB 4IBIA 4IJFA 2HHHM 3UJNA 4TUWA 3AFHA 4NSRA 1XWIA 3AOGA 5C18A 3U61B 1HT2E 1IY2A 4GC9A 5ITTA 1GVNA 4DV0M 4GKKM 3FYCA 4LF9M 1IXRC 4OW0A 1Q3CA 5E6JA 2G8LA 1R2YA 1E32A 3IG8A 4XBOA 3CTWB 1Z6TA 3GRUA 3FTCA 1IBLM 3U5ZA 5KO3A 3J7BA 1OJLA 4GIPA 3DZDA 3VLFB 4LFBM 4X64M 4FCWA 4BBAA 1R6BX 3B9PA 4PD2A 3HHYA 3JAMS 2F5QA 2P5TA 3FUXA 3U60B 3U6CA 4LFCM 2DZOB 4QOSA 3ZH9B 3FUUA 3TE6A 4LJ9A 4A3VB 1C1KA 3AJIB 3I51A 4NRWA 1QZMA 1Z5BA 5FSWA 4LF8M 4IBDA 1L2BA 3EIEA 2XGNA 4W5WA 4LJ4A 2L7HA 5LMUM 3NWLA 5ITXA 3U5ZB 1IXZA 1GL7A 3J80S 3SMSA 2CHGA 1G41A 3U6EA 1Z5CA 3KFUG 3KVWA 5IT9S 5IREB 2EA0A 4FW9A 1JR3D 4LZZA 1HT1E 3FTEA 2L6OA 4DV3M 5IWAM 4HL4A 2YQZA 1DGFA 2CEAA 4DR7M 5H37D 2QZ4A 4NL4H 4NXMM 2HKJA 2YNMD 3A98B 4JI0M 3L29A 2XLJA 3J7AS 4L15A 3OTOM 1LV7A 1W5TA 1XMQM 3HKPA 1YE9A 2RKOA 3L25A 2XH9A 1DO0A 2CE7A 4JI2M 3SAWA 2R4EA 3KDSE 4DR5M 4B08A 3DA1A 2L09A 4CHTB 4FWGA 5EQTA 1IN8A 1FNNA 3HJ8A 2C96A 4I81A 1WXQA 2KEBA 4AKGA 4QHSA 4QHTA 5KQDA 5FTJA 4LF7M 3RFWA 2DVWB 3LVWA 1Q39A 2QP9X 1S3SA 3U6MA 4PCZA 2F5SA 4L16A 3GQ4A 5EXSA 3E9SA 3L2AA 4XGIA 3PVSA 3T15A 3MJ5A 3SYKA 4I8OA 2XSZA 2ZBKB 4L4UA 3UZUA 3SARA 1SXJA 1G3IA 1QAOA 5BPVA 2ZM6M 3FUTA 2G5GX 3SYLA 3W0FA 4YHHM 1L1ZA 1HNXM 3KS4A 1GL6A 3A42A 3A45A 3HHZA 3SAUA 4LRTA 2NQ8C 5EXPA 3QAUA 4JI1M 3GLGA 4JYAM 1R7RA 4GRIA 2QCUA 4GITA 2KW0A 4LJ5A 4IBKA 3WHLA 1XMOM 2C5RA 5DYIA 3THGA 1IN5A 4FWHA 4ZPXA 5ITQA 1SXJB 4X62M 1KYIA 5EP1A 1QANA 4GH9A 4REZA 3KSXA 1G59A 2F5PA 2LH0A 3M7GA 3U6QA 3FKEA 4Z8XA 2YFQA 3RE8A 4B7GA 4JI5M 3K2LA 2R62A 2XF3A 2I7PA 2RGHA 3VK7A 4D81A 5KPTA 1N36M 1IBMM 2D7HA 3VK8A 4R3DA 2DZNB 3U6LA 4MGIE 2EUCA 3GLFA 4WW0A 4QOZC 2M5ZA 1PM5A 3AOEA 1XXHA 5JI3E 2L7IA 3K1JA 1K3XA 3PNVA 3TQSA 1E9SA 4KLNA 1HQYE 3D8BA 2Z3XA 3GPPA 3SBJA 1J7KA 2YR0A 4G6ZA 4LJ7A 3FUWA 3DFZA 3KOXE 3KW6A 4DR6M 1N75A 3QWLA 2HCBA 3SC3A 3K92A 4MGZE 2HL7A 2R18A 1NY5A 4RF1A 1NNUC 1IXSB 4M0WA 3HGIA 4LJAA 3GLFB 2OPFA 4DV7M 1DGHA 3BOSA 1QQWA 4FD2A 1QAMA 1K82A 2ZANA 4FVMA 4PDGA 1DGGA 1IN4A 2KXEA 2R45A 2UUBM 3U6DA 4PDIA 3FTFA 3KSJA 3CF6E 3MK6A 3EIHA 1PJIA 1VDDA 4AG5A 1TGUA 3GLHA 2RGOA 3L28A 2UXDM 1NHWC 4BLCA 3K8ZA 4KO8A 3Q8XA 5IZ7D 1XNRM 4S12A 4DV4M 2KZSA 3CF2A 4AZFA 3GLIA 4M0DA 1OFIA 1R2ZA 2UUAM 5JI2E 2DWZB 2Z4SA 1DGHB 2LNHC 4PT5A 1JQJC 1MU5A 2JA2A 3E4RA 4DR3M 2CV1A 3RGPA 4BB9A 3HU3A 5KQ8A 3ILKA 4DR2M 3UMMA 2QPAA 4IBCA 4MGKE 3HHWA 2AHMA 3FUVA 4B3TM 2XEPA 1ORYB 1L2DA 1L8QA 5EJCA 3GLHB 3PFIA 4LFAM 2F5NA 3WHKA 1QVRA 1JR3A 3R9XB 5KPRA 3LQRA 4QNMA 3VKGA 3J81S 2UXCM 1ZQ9A 4JV5M 3RGSA 1N78A 3AV0A 1NY6A 3DOAA 3GPUA 3VDUA 3J2PB 3VKHA 4MGYE 4G4QA 2DXIA 2Z4RA 3CF0A 2VIIA 4D80A 4AKHA 2CV0A 4JI8M 3GPXA 4FCVA 4EIWA 3SFZA 1XC8A 2CFOA 2W82A 5FLXS 3LVVA 5EP4A 4IBBA 4AG6A 7CATA 2VQEM 1N32M 2R46A 3TWMA 5C1BA 5EP3A 5ITXE 2BNKA 1HR0M 1L2CA 3GQ5A 3GRVA 4M9XA 1GLNA 4CISA 1E9RA 4MH0E 2ZAOA 3T1YM 1DGBA 4KODA 1IBKM 4DV5M 2FFJA 4G4OA 2KA6B 4B3SM 3KOWE 3AL0C 3FD9A 4OVZA 5ITUA 3HU1A 4LG2A 3FYDA 2CHQA 4GHLA 3U6PA 4D82A 2F5OA 3U61A 4LZJA 4Z6YA 3GLGB 1NNJA 2DWLA 2CV2A 4QNRA 4P16A 2Y0TA 4G4NA 1TH4A 3HHXA 3J27B 1EE8A 5FTLA 2E5LM 1H6UA 3W0LB 3D8LA 3SAVA 2D7EA 4JN6A 4B3MM 4LF6M 1XHBA 1OFHA 2K47A 3HJQA 4NSOB 2LXEA 3VFDA 3TWLA 3HWSA 5FTMA 2OQ4A 2Q2EB 1D2NA 5FTNA 4I4LA 4KHPM 3SMPA 3KP1E 2DWNA 2C9OA 4MGHA 2R4JA 2ZAMA 3UK6A 3U60A 5BR8M 1W5SA 4DV6M 1ZAEA 1SXJC 1IQPA 4JI6M 2I7NA 3L27A 4LY6A 1I4WA 1SXJE 1NSFA 1T3TA 3KS8A 4L8RC 2ERCA 3ZC7B 4JI7M 1IY1A 2LWXA 1L1TA 1XXHB 1NJGA 3KOYE 4LF5M 4II7A 4JI4M 3GRRA 2BJVA 3FTDA 3M0EA 1PJJA 2DHRA 3HU2A 1N33M 1TDZA 4AI6A 2UXBM 1YSYA 3ZCBB 4NRVA 1NJFA 4RF0A 2QBYA 2F4VM 1IN7A 1HQCA 2V6ZM 1N34M 2O5RA 4RNAA 5GKNA 3H4MA 3T38A 3UGJA 4B3RM 1N77A 3HJSA 5DYGA 4GMQA 3TL4X 1MX0A 5E26A 5FTKA 1Z59A 3GPYA 5DNYA 3VDPA 8CATA 3GQ3A 4NXNM 3GO8A 4LGMA 2VQFM 2M60A 4DV2M 1Z5AA 1HNZM 4DR4M 3I4YA 1TH2A 2R65A 2UUCM 4IBFA 2EO2A 4OX9M 5A2QS 1X37A 2Y0QA 3AOEC 3PNYA 2J7NA 2CHVA 4B7FA 4X66M 2FE8A 3JR4A 5LMNM 2QBYB 4IBJA 4CGYB 4DUZM 4OU7A 4HLQA 3GP1A 3SASA 4G4RA 5EXTA 2XSZD 2KZUA 2CUZA 3GLIB 4IIWA 4AW4A 1SXJD 2X8AA 2BJWA 4LF4M 2H1RA 4LRSA 4LGYA 4IBGA 4YY3M 4K0KM 3NBIA 4AQYM 1NVMA 4MM3B 3U6SA 4AKIA 3L26A 1KSFX 4DV1M 4WURA 3AKZA 1IM2A 2XFSA 4DR1M 4M9ZA 1J5EM 3KP0E 1G8PA 1NHGC 5KPZA 1K3WA 1IY0A 1QAQA 1DO2A 2QENA 1TDHA 3TWKA 1QYRA 4ITQA 4L78A 3SHGB 4JXJA 5ITRA 4IJEA 3PXGA 4LCBA 3C58A 2D7GA 5EP2A 3T1HM 5F3WA 1Q3BA 1KFVA 4LJ6A 3U6OA 5ITYA 3MHVC 2Z7JA 4DUYM 2DWMA 3A46A 2V1UA 2C9CA 3R8FA 2V1CA 2X49A 2KRKA 2J7OA 4B7HA 4GHAA 3JR5A 2XFTA 2X4AA 3TPZA 2KRUA 2FNAA 5EXXA 2Y21A 3SATA 3LQQA 1IN6A 2A5YB 4GC5A 1TH3A 4FCTA 3GRYA 4LJ8A 1I94M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZU A;  1XNQ M;  4GKJ M;  4JI7 M;  1L1T A;  1MU5 A;  2ZBK B;  4DR3 M;  4LF5 M;  3SAR A;  4JI4 M;  2XZF A;  2ZM6 M;  4JI3 M;  4DR2 M;  4MB7 A;  1PJJ A;  3W0F A;  4X65 M;  4YHH M;  1L1Z A;  1HNX M;  2UU9 M;  1FJG M;  1HNW M;  4B3T M;  2HHH M;  1L2D A;  1TDZ A;  1N33 M;  3A42 A;  3A45 A;  2UXB M;  3SAU A;  4NRV A;  4LFA M;  2F5N A;  4JI1 M;  4JYA M;  2F4V M;  5ITT A;  1N34 M;  4DV0 M;  4B3R M;  4GKK M;  4LF9 M;  1XMO M;  3J81 S;  1Q3C A;  2UXC M;  4JV5 M;  1R2Y A;  1MX0 A;  1Z59 A;  3GPY A;  3DOA A;  5ITQ A;  3GPU A;  1IBL M;  3GQ3 A;  4NXN M;  3GO8 A;  4X62 M;  4G4Q A;  4LFB M;  2VQF M;  4DV2 M;  4X64 M;  1Z5A A;  1HNZ M;  4DR4 M;  2UUC M;  4JI8 M;  2F5P A;  4OX9 M;  5A2Q S;  4PD2 A;  3GPX A;  1XC8 A;  3JAM S;  2F5Q A;  3U6Q A;  4X66 M;  4JI5 M;  3JR4 A;  5LMN M;  3U6C A;  5FLX S;  4LFC M;  4DUZ M;  3SAS A;  3GP1 A;  4G4R A;  3VK7 A;  1IBM M;  1N36 M;  2VQE M;  1N32 M;  3TWM A;  5ITX E;  3VK8 A;  4NRW A;  1HR0 M;  3U6L A;  1Z5B A;  1L2C A;  3GQ5 A;  4LF8 M;  4LF4 M;  1L2B A;  4CIS A;  1PM5 A;  4YY3 M;  4K0K M;  5LMU M;  3T1Y M;  4AQY M;  5ITX A;  3J80 S;  1K3X A;  3U6S A;  1IBK M;  4DV5 M;  3U6E A;  3GPP A;  3SBJ A;  1Z5C A;  4G4O A;  4B3S M;  5IT9 S;  2EA0 A;  4DR6 M;  5ITU A;  4DV1 M;  4DV3 M;  5IWA M;  4DR1 M;  1J5E M;  4DR7 M;  1K3W A;  3U6P A;  2F5O A;  4NXM M;  2HKJ A;  4JI0 M;  3J7A S;  1NNJ A;  1TDH A;  3TWK A;  3OTO M;  1XMQ M;  5ITR A;  4ITQ A;  4G4N A;  3C58 A;  3T1H M;  1EE8 A;  2E5L M;  1Q3B A;  2OPF A;  1KFV A;  4JI2 M;  3SAW A;  3U6O A;  5ITY A;  4DV7 M;  3SAV A;  4DR5 M;  4B3M M;  4DUY M;  4LF6 M;  1K82 A;  3A46 A;  4PDG A;  3TWL A;  2UUB M;  2OQ4 A;  2Q2E B;  3U6D A;  4PDI A;  4KHP M;  3JR5 A;  1PJI A;  3SAT A;  4LF7 M;  5BR8 M;  2UXD M;  1Q39 A;  4DV6 M;  3U6M A;  4PCZ A;  1XNR M;  4DV4 M;  2F5S A;  4JI6 M;  3GQ4 A;  2UUA M;  1R2Z A;  1I94 M; 
#chains in the Genus database with same CATH topology
 2XZU A;  4FWD A;  2R6F A;  3HX3 A;  2DAM A;  3K9O A;  3LMM A;  1XNQ M;  3W67 A;  2C99 A;  4GKJ M;  3IG5 A;  2Y20 A;  1GKI A;  1ZMU A;  4I5S A;  1G4A E;  4NOO B;  4IBE A;  4P17 A;  4M9S A;  3SHF A;  1TTE A;  1ZV1 A;  3I4V A;  3B7Q A;  1E94 E;  2FOI C;  1YUB A;  3KXE C;  3M6A A;  2XZF A;  4JI3 M;  3BBZ A;  4R7G A;  4MB7 A;  2C98 A;  3KOZ E;  1TF0 B;  4X65 M;  1UM8 A;  1JR3 E;  1J09 A;  2GNO A;  2UU9 M;  1FJG M;  4OVZ B;  3HZJ A;  4IBI A;  4IJF A;  1T6O A;  2HHH M;  1HNW M;  2WSE F;  3UJN A;  4TUW A;  3AFH A;  4NSR A;  3E46 A;  1XWI A;  3AOG A;  5C18 A;  3U61 B;  1HT2 E;  1IY2 A;  4GC9 A;  5ITT A;  1NO1 A;  1GVN A;  4DV0 M;  4GKK M;  1IXS A;  2VF7 A;  3FYC A;  1PJT A;  4LF9 M;  1IXR C;  4OW0 A;  1Q3C A;  2KNZ A;  5E6J A;  2MH8 A;  2G8L A;  1R2Y A;  1E32 A;  3IG8 A;  4XBO A;  3CTW B;  1Z6T A;  2LHG A;  3FTC A;  3GRU A;  1IBL M;  3U5Z A;  2DI0 A;  5KO3 A;  3J7B A;  2DZL A;  1OJL A;  4GIP A;  3DZD A;  3VLF B;  4LFB M;  2FS1 A;  4X64 M;  4FCW A;  4BBA A;  1R6B X;  1EFU B;  3B9P A;  3GLG E;  3I01 M;  4PD2 A;  3HHY A;  3JAM S;  2F5Q A;  2P5T A;  3FUX A;  3U60 B;  3U6C A;  4LFC M;  2DZO B;  1YLA A;  4KT0 F;  3FUU A;  4QOS A;  4LJ9 A;  3TE6 A;  3ZH9 B;  1C1K A;  4A3V B;  3AJI B;  3I51 A;  1AUA A;  4NRW A;  1QZM A;  1Z5B A;  5FSW A;  4LF8 M;  4IBD A;  1L2B A;  3EIE A;  2XGN A;  4W5W A;  2KHH A;  4LJ4 A;  2L7H A;  5LMU M;  3NWL A;  3FRI A;  5ITX A;  1IXZ A;  1GL7 A;  3U5Z B;  3J80 S;  3SMS A;  1QZE A;  2CHG A;  1G41 A;  3U6E A;  1Z5C A;  2DNA A;  2QHO B;  3KVW A;  4RKU F;  3KFU G;  5IT9 S;  5IRE B;  2EA0 A;  4FW9 A;  1JR3 D;  4LZZ A;  1HT1 E;  3FTE A;  2L6O A;  4DV3 M;  5IWA M;  4HL4 A;  2YQZ A;  1DGF A;  2CEA A;  4DR7 M;  5H37 D;  2QZ4 A;  4NL4 H;  3SAS A;  4NXM M;  2HKJ A;  2YNM D;  3A98 B;  4JI0 M;  3L29 A;  2XLJ A;  3C3E A;  3J7A S;  4L15 A;  3OTO M;  1LV7 A;  1VQ1 A;  1W5T A;  1XMQ M;  3HKP A;  1YE9 A;  2RKO A;  3L25 A;  2XH9 A;  1DO0 A;  2JY5 A;  2KDL A;  2CE7 A;  1C7Y A;  3SAW A;  2R4E A;  4JI2 M;  3KDS E;  4DR5 M;  4B08 A;  3DA1 A;  2L09 A;  2MGW A;  2MRO B;  4CHT B;  4FWG A;  5EQT A;  1IN8 A;  1FNN A;  2EJS A;  3HJ8 A;  2C96 A;  3FRH A;  4I81 A;  1WXQ A;  2KEB A;  4CIZ A;  4G3O A;  4AKG A;  4QHS A;  4QHT A;  5KQD A;  5FTJ A;  1A5T A;  2L4F A;  3T6P A;  4LF7 M;  3RFW A;  2DVW B;  3LVW A;  1Q39 A;  2QP9 X;  1S3S A;  3U6M A;  4PCZ A;  2LBC A;  2R0I A;  2F5S A;  4L16 A;  3GQ4 A;  5EXS A;  1VEK A;  3E9S A;  2DEN A;  1D0K A;  3L2A A;  4XGI A;  3BXW A;  3PVS A;  3T15 A;  3MJ5 A;  3SYK A;  4I8O A;  2XSZ A;  2LTU A;  2ZBK B;  4L4U A;  3UZU A;  3SAR A;  1GO5 A;  1SXJ A;  1G3I A;  1QAO A;  5BPV A;  2VF8 A;  3FUT A;  2ZM6 M;  2G5G X;  3SYL A;  3W0F A;  4YHH M;  1L1Z A;  1HNX M;  3KS4 A;  3IHP A;  1GL6 A;  3A42 A;  3A45 A;  3HHZ A;  3GLI E;  3SAU A;  4LRT A;  3I04 M;  2NQ8 C;  5EXP A;  3QAU A;  4JI1 M;  3GLG A;  4JYA M;  1R7R A;  4GRI A;  2JUJ A;  2QCU A;  1WGL A;  2BWE A;  4GIT A;  2KW0 A;  3E21 A;  4LJ5 A;  4IBK A;  3WHL A;  1XMO M;  2C5R A;  4GEW A;  1WJ7 A;  4DBG B;  5DYI A;  1OAO C;  3THG A;  1IN5 A;  4FWH A;  4ZPX A;  2DHY A;  5ITQ A;  4F1I A;  4NC6 A;  1SXJ B;  4X62 M;  1KYI A;  2JZ1 A;  5EP1 A;  1QAN A;  2WSF F;  4GH9 A;  2JY8 A;  4REZ A;  3KSX A;  1G59 A;  2JNH A;  2F5P A;  2LH0 A;  3M7G A;  3LCV B;  2KNV A;  3U6Q A;  3FKE A;  4Z8X A;  1CUK A;  2YFQ A;  3RE8 A;  4B7G A;  4JI5 M;  2MJ5 B;  3K2L A;  1OAI A;  2R62 A;  2XF3 A;  2I7P A;  4R71 A;  2RGH A;  3VK7 A;  4D81 A;  5KPT A;  1N36 M;  1IBM M;  2D7H A;  1XB2 B;  3VK8 A;  4R3D A;  2DZN B;  3U6L A;  4Y28 F;  4MGI E;  2EUC A;  3GLF A;  4WW0 A;  3LCU A;  4QOZ C;  2M5Z A;  1PM5 A;  3AOE A;  1XXH A;  5JI3 E;  4Q7J A;  2L7I A;  3K1J A;  1VG5 A;  1ZMV A;  3PNV A;  2LVN C;  3TQS A;  1K3X A;  1E9S A;  4KLN A;  1HQY E;  3D8B A;  2Z3X A;  3GPP A;  3SBJ A;  1J7K A;  1EIJ A;  2YR0 A;  4G6Z A;  1NV8 A;  4LJ7 A;  3FUW A;  3DFZ A;  3KOX E;  3KW6 A;  4DR6 M;  1N75 A;  2G3Q A;  2MR9 A;  2O25 A;  3QWL A;  2HCB A;  3SC3 A;  1G71 A;  3C9P A;  3K92 A;  4CJ6 A;  4MGZ E;  2HL7 A;  2DAE A;  2R18 A;  1NY5 A;  4RF1 A;  1NNU C;  1IXS B;  4M0W A;  2VDB B;  3HGI A;  4LJA A;  3GLF B;  2OPF A;  2DAI A;  4DV7 M;  1DGH A;  3BOS A;  1QQW A;  4FD2 A;  1QAM A;  1JB0 F;  1K82 A;  2ZAN A;  4FVM A;  4PDG A;  1DGG A;  1IN4 A;  4UN2 B;  4WP2 A;  2KXE A;  2R45 A;  2UUB M;  3U6D A;  4PDI A;  2B3T A;  2JWS A;  3FTF A;  1NV9 A;  1QUS A;  3KSJ A;  1PGY A;  3CF6 E;  3MK6 A;  3EIH A;  1PJI A;  1VDD A;  4AG5 A;  2JP7 A;  1TGU A;  2RGO A;  3GLH A;  3L28 A;  2UXD M;  1NHW C;  2K9D A;  4BLC A;  1ZMW A;  3K8Z A;  4KO8 A;  3Q8X A;  5IZ7 D;  1XNR M;  2QQ8 A;  2BWB A;  3QYE A;  4S12 A;  2KZS A;  3CF2 A;  4AZF A;  1VDL A;  4M0D A;  1OFI A;  3GLI A;  1R2Z A;  2UUA M;  2APL A;  5L8R F;  5JI2 E;  1D0M A;  2DWZ B;  2Z4S A;  1DGH B;  2LNH C;  4PT5 A;  1JQJ C;  3F92 A;  1MU5 A;  3W68 A;  2QSF X;  2JA2 A;  3E4R A;  1MJG M;  4DR3 M;  2CV1 A;  2L2D A;  1V34 A;  3RGP A;  4BB9 A;  3HU3 A;  5KQ8 A;  2WZJ A;  3ILK A;  4DR2 M;  3UMM A;  2QPA A;  4IBC A;  4MGK E;  3HHW A;  2AHM A;  3FUV A;  4B3T M;  2XEP A;  1ORY B;  1L2D A;  2JY6 B;  1L8Q A;  5EJC A;  1QDT A;  3GLH B;  1OKS A;  3PFI A;  4LFA M;  2F5N A;  3WHK A;  1QVR A;  1JR3 A;  3R9X B;  2R44 A;  3LQR A;  4QNM A;  5KPR A;  3VKG A;  1QDR A;  2ZTC A;  3J81 S;  2UXC M;  1ZQ9 A;  4JV5 M;  3RGS A;  1N78 A;  3AV0 A;  1NY6 A;  2JXN A;  3DOA A;  3GPU A;  3VDU A;  3J2P B;  3VKH A;  3IEC A;  4MGY E;  4G4Q A;  2DXI A;  3V76 A;  1VEJ A;  2Z4R A;  3CF0 A;  2VII A;  1UFZ A;  4D80 A;  4AKH A;  2JY7 A;  2CV0 A;  1SG9 A;  4JI8 M;  3GPX A;  4FCV A;  4EIW A;  3SFZ A;  1XC8 A;  1D0L A;  3Q8G A;  2CFO A;  2W82 A;  5FLX S;  3LVV A;  5EP4 A;  4IBB A;  1MN3 A;  3NBX X;  2OOA A;  4AG6 A;  7CAT A;  2VQE M;  1N32 M;  2LHC A;  2R46 A;  3TWM A;  5C1B A;  5EP3 A;  5ITX E;  1V92 A;  2BNK A;  1HR0 M;  1L2C A;  2K6B A;  3GRV A;  4M9X A;  3GQ5 A;  1P3Q Q;  1GLN A;  4CIS A;  1E9R A;  4MH0 E;  2ZAO A;  3T1Y M;  1DGB A;  4KOD A;  1IBK M;  4DV5 M;  2FFJ A;  4G4O A;  2KA6 B;  4B3S M;  2KNA A;  3KOW E;  3AL0 C;  1RU3 A;  3FD9 A;  4OVZ A;  5ITU A;  3HU1 A;  4LG2 A;  3FYD A;  1TR8 A;  2CHQ A;  2EKK A;  3U6P A;  4D82 A;  2F5O A;  3U61 A;  4GHL A;  4LZJ A;  3C3D A;  4Z6Y A;  3GLG B;  2OO9 A;  1NNJ A;  2DWL A;  4QNR A;  2CV2 A;  4P16 A;  2Y0T A;  4G4N A;  1VEG A;  1TH4 A;  3HHX A;  2JZ0 A;  1EE8 A;  2HWJ A;  3J27 B;  5FTL A;  1H6U A;  3W0L B;  2E5L M;  2DKL A;  1PJQ A;  3D8L A;  3SAV A;  2D7E A;  4JN6 A;  4B3M M;  4LF6 M;  1XHB A;  1OFH A;  2K47 A;  3HJQ A;  4NSO B;  1WHC A;  2LXE A;  2EKF A;  3MMP A;  3VFD A;  3TWL A;  3HWS A;  3QYB A;  5FTM A;  2OQ4 A;  2Q2E B;  1GAB A;  1D2N A;  5FTN A;  2N35 A;  4I4L A;  4KHP M;  3SMP A;  3KP1 E;  2DWN A;  2C9O A;  1HJP A;  1PJS A;  2H5X A;  4MGH A;  1Y8G A;  2K0B X;  2R4J A;  2ZAM A;  1GJS A;  1OTR A;  3UK6 A;  1DV0 A;  3U60 A;  2O01 F;  1W5S A;  5BR8 M;  3B7N A;  4DV6 M;  1ZAE A;  3B74 A;  1SXJ C;  1IQP A;  4JI6 M;  1T43 A;  2I7N A;  3L27 A;  4LY6 A;  1I4W A;  4XK8 F;  1SXJ E;  1NSF A;  2GQF A;  1T3T A;  3KS8 A;  4L8R C;  2ERC A;  3ZC7 B;  4JI7 M;  1IY1 A;  2LWX A;  1L1T A;  4HEO A;  1XXH B;  4L6V 6;  1NJG A;  3KOY E;  4LF5 M;  4II7 A;  4JI4 M;  3GRR A;  4ANR A;  2BJV A;  2QNJ A;  1BVS A;  3FTD A;  3M0E A;  1PJJ A;  2DHR A;  1IFY A;  3HU2 A;  1N33 M;  1TDZ A;  4AI6 A;  2CWB A;  2UXB M;  1YSY A;  3ZCB B;  4NRV A;  1NJF A;  4RF0 A;  2QBY A;  2F4V M;  1IN7 A;  2LVP C;  1HQC A;  2V6Z M;  1N34 M;  2O5R A;  4RNA A;  5GKN A;  3H4M A;  3T38 A;  3UGJ A;  4B3R M;  2LVQ D;  1N77 A;  3HJS A;  2Z8Y M;  2CP8 A;  5DYG A;  2LVO C;  4GMQ A;  3TL4 X;  1MX0 A;  5E26 A;  5FTK A;  1Z59 A;  3GPY A;  5DNY A;  1WR1 B;  3VDP A;  8CAT A;  3GQ3 A;  4NXN M;  2FH0 A;  3GO8 A;  2ZTD A;  2LVA A;  4LGM A;  2VQF M;  3H4J A;  2M60 A;  4DV2 M;  1Z5A A;  1QUT A;  1OQY A;  1Q02 A;  1HNZ M;  4DR4 M;  3I4Y A;  1TH2 A;  2R65 A;  2UUC M;  4IBF A;  2EO2 A;  1LTM A;  4OX9 M;  5A2Q S;  1X37 A;  1R5L A;  2Y0Q A;  3AOE C;  2J7N A;  3PNY A;  2CHV A;  4B7F A;  4X66 M;  2FE8 A;  1WGN A;  3JR4 A;  5LMN M;  3GLF E;  4IBJ A;  4CGY B;  3B7Z A;  4DUZ M;  4OU7 A;  2QBY B;  4HLQ A;  4F2L A;  3GP1 A;  4DV4 M;  4G4R A;  1XXH E;  3LW5 F;  2XSZ D;  2KZU A;  5EXT A;  2CUZ A;  3GLI B;  4IIW A;  1F4I A;  4AW4 A;  3K9P A;  1SXJ D;  2X8A A;  2BJW A;  4LF4 M;  2H1R A;  4LRS A;  4LGY A;  2HAK A;  4IBG A;  4YY3 M;  4K0K M;  3NBI A;  4AQY M;  3CGW A;  1NVM A;  4MM3 B;  3U6S A;  4AKI A;  1PRB A;  3L26 A;  2CRU A;  1KSF X;  2DAK A;  4DV1 M;  4WUR A;  3AKZ A;  1IM2 A;  2XFS A;  4DR1 M;  4M9Z A;  1J5E M;  2DAG A;  1G8P A;  1NHG C;  3KP0 E;  5KPZ A;  1K3W A;  1IY0 A;  2WSC F;  1QAQ A;  1DO2 A;  2QEN A;  1TDH A;  3TWK A;  1QYR A;  4ITQ A;  4L78 A;  3SHG B;  4JXJ A;  5ITR A;  4IJE A;  3PXG A;  4LCB A;  3C58 A;  2D7G A;  1R4G A;  5EP2 A;  3T1H M;  5F3W A;  1Q3B A;  1KFV A;  3FE3 A;  4LJ6 A;  3U6O A;  5ITY A;  3MHV C;  3HY5 A;  2Z7J A;  3ZQJ A;  1AIP C;  1OIP A;  4DUY M;  2DWM A;  3A46 A;  1V33 A;  2V1U A;  1OIZ A;  2C9C A;  3R8F A;  2J5Y A;  2V1C A;  3GLH E;  1WIV A;  2X49 A;  2KRK A;  2J7O A;  4B7H A;  4GHA A;  2OOB A;  1GJT A;  3JR5 A;  2XFT A;  2L4E A;  2X4A A;  3TPZ A;  3B89 A;  2KRU A;  2FNA A;  5EXX A;  2Y21 A;  3SAT A;  5DFL A;  3LQQ A;  1IN6 A;  2A5Y B;  4GC5 A;  1TH3 A;  4FCT A;  3GRY A;  4LJ8 A;  2RRU A;  1I94 M; 
#chains in the Genus database with same CATH homology
 2XZU A;  4FWD A;  3LMM A;  1XNQ M;  2C99 A;  4GKJ M;  3IG5 A;  2Y20 A;  1GKI A;  4I5S A;  4NOO B;  1G4A E;  4IBE A;  3SHF A;  4M9S A;  3I4V A;  1E94 E;  2FOI C;  1YUB A;  3KXE C;  3M6A A;  2XZF A;  4JI3 M;  4R7G A;  4MB7 A;  2C98 A;  3KOZ E;  4X65 M;  2UU9 M;  1UM8 A;  1J09 A;  1FJG M;  1HNW M;  4OVZ B;  4IBI A;  4IJF A;  2HHH M;  3UJN A;  4TUW A;  3AFH A;  4NSR A;  1XWI A;  3AOG A;  5C18 A;  3U61 B;  1HT2 E;  1IY2 A;  4GC9 A;  5ITT A;  1GVN A;  4DV0 M;  4GKK M;  3FYC A;  4LF9 M;  1IXR C;  4OW0 A;  1Q3C A;  5E6J A;  2G8L A;  1R2Y A;  1E32 A;  3IG8 A;  4XBO A;  3CTW B;  1Z6T A;  3GRU A;  3FTC A;  1IBL M;  3U5Z A;  5KO3 A;  3J7B A;  1OJL A;  4GIP A;  3DZD A;  3VLF B;  4LFB M;  4X64 M;  4FCW A;  4BBA A;  1R6B X;  3B9P A;  4PD2 A;  3HHY A;  3JAM S;  2F5Q A;  2P5T A;  3FUX A;  3U60 B;  3U6C A;  4LFC M;  2DZO B;  4QOS A;  3ZH9 B;  3FUU A;  3TE6 A;  4LJ9 A;  4A3V B;  1C1K A;  3AJI B;  3I51 A;  4NRW A;  1QZM A;  1Z5B A;  5FSW A;  4LF8 M;  4IBD A;  1L2B A;  3EIE A;  2XGN A;  4W5W A;  4LJ4 A;  2L7H A;  5LMU M;  3NWL A;  5ITX A;  3U5Z B;  1IXZ A;  1GL7 A;  3J80 S;  3SMS A;  2CHG A;  1G41 A;  3U6E A;  1Z5C A;  3KFU G;  3KVW A;  5IT9 S;  5IRE B;  2EA0 A;  4FW9 A;  1JR3 D;  4LZZ A;  1HT1 E;  3FTE A;  2L6O A;  4DV3 M;  5IWA M;  4HL4 A;  2YQZ A;  1DGF A;  2CEA A;  4DR7 M;  5H37 D;  2QZ4 A;  4NL4 H;  4NXM M;  2HKJ A;  2YNM D;  3A98 B;  4JI0 M;  3L29 A;  2XLJ A;  3J7A S;  4L15 A;  3OTO M;  1LV7 A;  1W5T A;  1XMQ M;  3HKP A;  1YE9 A;  2RKO A;  3L25 A;  2XH9 A;  1DO0 A;  2CE7 A;  4JI2 M;  3SAW A;  2R4E A;  3KDS E;  4DR5 M;  4B08 A;  3DA1 A;  2L09 A;  4CHT B;  4FWG A;  5EQT A;  1IN8 A;  1FNN A;  3HJ8 A;  2C96 A;  4I81 A;  1WXQ A;  2KEB A;  4AKG A;  4QHS A;  4QHT A;  5KQD A;  5FTJ A;  4LF7 M;  3RFW A;  2DVW B;  3LVW A;  1Q39 A;  2QP9 X;  1S3S A;  3U6M A;  4PCZ A;  2F5S A;  4L16 A;  3GQ4 A;  5EXS A;  3E9S A;  3L2A A;  4XGI A;  3PVS A;  3T15 A;  3MJ5 A;  3SYK A;  4I8O A;  2XSZ A;  2ZBK B;  4L4U A;  3UZU A;  3SAR A;  1SXJ A;  1G3I A;  1QAO A;  5BPV A;  2ZM6 M;  3FUT A;  2G5G X;  3SYL A;  3W0F A;  4YHH M;  1L1Z A;  1HNX M;  3KS4 A;  1GL6 A;  3A42 A;  3A45 A;  3HHZ A;  3SAU A;  4LRT A;  2NQ8 C;  5EXP A;  3QAU A;  4JI1 M;  3GLG A;  4JYA M;  1R7R A;  4GRI A;  2QCU A;  4GIT A;  2KW0 A;  4LJ5 A;  4IBK A;  3WHL A;  1XMO M;  2C5R A;  5DYI A;  3THG A;  1IN5 A;  4FWH A;  4ZPX A;  5ITQ A;  1SXJ B;  4X62 M;  1KYI A;  5EP1 A;  1QAN A;  4GH9 A;  4REZ A;  3KSX A;  1G59 A;  2F5P A;  2LH0 A;  3M7G A;  3U6Q A;  3FKE A;  4Z8X A;  2YFQ A;  3RE8 A;  4B7G A;  4JI5 M;  3K2L A;  2R62 A;  2XF3 A;  2I7P A;  2RGH A;  3VK7 A;  4D81 A;  5KPT A;  1N36 M;  1IBM M;  2D7H A;  3VK8 A;  4R3D A;  2DZN B;  3U6L A;  4MGI E;  2EUC A;  3GLF A;  4WW0 A;  4QOZ C;  2M5Z A;  1PM5 A;  3AOE A;  1XXH A;  5JI3 E;  2L7I A;  3K1J A;  1K3X A;  3PNV A;  3TQS A;  1E9S A;  4KLN A;  1HQY E;  3D8B A;  2Z3X A;  3GPP A;  3SBJ A;  1J7K A;  2YR0 A;  4G6Z A;  4LJ7 A;  3FUW A;  3DFZ A;  3KOX E;  3KW6 A;  4DR6 M;  1N75 A;  3QWL A;  2HCB A;  3SC3 A;  3K92 A;  4MGZ E;  2HL7 A;  2R18 A;  1NY5 A;  4RF1 A;  1NNU C;  1IXS B;  4M0W A;  3HGI A;  4LJA A;  3GLF B;  2OPF A;  4DV7 M;  1DGH A;  3BOS A;  1QQW A;  4FD2 A;  1QAM A;  1K82 A;  2ZAN A;  4FVM A;  4PDG A;  1DGG A;  1IN4 A;  2KXE A;  2R45 A;  2UUB M;  3U6D A;  4PDI A;  3FTF A;  3KSJ A;  3CF6 E;  3MK6 A;  3EIH A;  1PJI A;  1VDD A;  4AG5 A;  1TGU A;  3GLH A;  2RGO A;  3L28 A;  2UXD M;  1NHW C;  4BLC A;  3K8Z A;  4KO8 A;  3Q8X A;  5IZ7 D;  1XNR M;  4S12 A;  4DV4 M;  2KZS A;  3CF2 A;  4AZF A;  3GLI A;  4M0D A;  1OFI A;  1R2Z A;  2UUA M;  5JI2 E;  2DWZ B;  2Z4S A;  1DGH B;  2LNH C;  4PT5 A;  1JQJ C;  1MU5 A;  2JA2 A;  3E4R A;  4DR3 M;  2CV1 A;  3RGP A;  4BB9 A;  3HU3 A;  5KQ8 A;  3ILK A;  4DR2 M;  3UMM A;  2QPA A;  4IBC A;  4MGK E;  3HHW A;  2AHM A;  3FUV A;  4B3T M;  2XEP A;  1ORY B;  1L2D A;  1L8Q A;  5EJC A;  3GLH B;  3PFI A;  4LFA M;  2F5N A;  3WHK A;  1QVR A;  1JR3 A;  3R9X B;  5KPR A;  3LQR A;  4QNM A;  3VKG A;  3J81 S;  2UXC M;  1ZQ9 A;  4JV5 M;  3RGS A;  1N78 A;  3AV0 A;  1NY6 A;  3DOA A;  3GPU A;  3VDU A;  3J2P B;  3VKH A;  4MGY E;  4G4Q A;  2DXI A;  2Z4R A;  3CF0 A;  2VII A;  4D80 A;  4AKH A;  2CV0 A;  4JI8 M;  3GPX A;  4FCV A;  4EIW A;  3SFZ A;  1XC8 A;  2CFO A;  2W82 A;  5FLX S;  3LVV A;  5EP4 A;  4IBB A;  4AG6 A;  7CAT A;  2VQE M;  1N32 M;  2R46 A;  3TWM A;  5C1B A;  5EP3 A;  5ITX E;  2BNK A;  1HR0 M;  1L2C A;  3GQ5 A;  3GRV A;  4M9X A;  1GLN A;  4CIS A;  1E9R A;  4MH0 E;  2ZAO A;  3T1Y M;  1DGB A;  4KOD A;  1IBK M;  4DV5 M;  2FFJ A;  4G4O A;  2KA6 B;  4B3S M;  3KOW E;  3AL0 C;  3FD9 A;  4OVZ A;  5ITU A;  3HU1 A;  4LG2 A;  3FYD A;  2CHQ A;  4GHL A;  3U6P A;  4D82 A;  2F5O A;  3U61 A;  4LZJ A;  4Z6Y A;  3GLG B;  1NNJ A;  2DWL A;  2CV2 A;  4QNR A;  4P16 A;  2Y0T A;  4G4N A;  1TH4 A;  3HHX A;  3J27 B;  1EE8 A;  5FTL A;  2E5L M;  1H6U A;  3W0L B;  3D8L A;  3SAV A;  2D7E A;  4JN6 A;  4B3M M;  4LF6 M;  1XHB A;  1OFH A;  2K47 A;  3HJQ A;  4NSO B;  2LXE A;  3VFD A;  3TWL A;  3HWS A;  5FTM A;  2OQ4 A;  2Q2E B;  1D2N A;  5FTN A;  4I4L A;  4KHP M;  3SMP A;  3KP1 E;  2DWN A;  2C9O A;  4MGH A;  2R4J A;  2ZAM A;  3UK6 A;  3U60 A;  5BR8 M;  1W5S A;  4DV6 M;  1ZAE A;  1SXJ C;  1IQP A;  4JI6 M;  2I7N A;  3L27 A;  4LY6 A;  1I4W A;  1SXJ E;  1NSF A;  1T3T A;  3KS8 A;  4L8R C;  2ERC A;  3ZC7 B;  4JI7 M;  1IY1 A;  2LWX A;  1L1T A;  1XXH B;  1NJG A;  3KOY E;  4LF5 M;  4II7 A;  4JI4 M;  3GRR A;  2BJV A;  3FTD A;  3M0E A;  1PJJ A;  2DHR A;  3HU2 A;  1N33 M;  1TDZ A;  4AI6 A;  2UXB M;  1YSY A;  3ZCB B;  4NRV A;  1NJF A;  4RF0 A;  2QBY A;  2F4V M;  1IN7 A;  1HQC A;  2V6Z M;  1N34 M;  2O5R A;  4RNA A;  5GKN A;  3H4M A;  3T38 A;  3UGJ A;  4B3R M;  1N77 A;  3HJS A;  5DYG A;  4GMQ A;  3TL4 X;  1MX0 A;  5E26 A;  5FTK A;  1Z59 A;  3GPY A;  5DNY A;  3VDP A;  8CAT A;  3GQ3 A;  4NXN M;  3GO8 A;  4LGM A;  2VQF M;  2M60 A;  4DV2 M;  1Z5A A;  1HNZ M;  4DR4 M;  3I4Y A;  1TH2 A;  2R65 A;  2UUC M;  4IBF A;  2EO2 A;  4OX9 M;  5A2Q S;  1X37 A;  2Y0Q A;  3AOE C;  3PNY A;  2J7N A;  2CHV A;  4B7F A;  4X66 M;  2FE8 A;  3JR4 A;  5LMN M;  2QBY B;  4IBJ A;  4CGY B;  4DUZ M;  4OU7 A;  4HLQ A;  3GP1 A;  3SAS A;  4G4R A;  5EXT A;  2XSZ D;  2KZU A;  2CUZ A;  3GLI B;  4IIW A;  4AW4 A;  1SXJ D;  2X8A A;  2BJW A;  4LF4 M;  2H1R A;  4LRS A;  4LGY A;  4IBG A;  4YY3 M;  4K0K M;  3NBI A;  4AQY M;  1NVM A;  4MM3 B;  3U6S A;  4AKI A;  3L26 A;  1KSF X;  4DV1 M;  4WUR A;  3AKZ A;  1IM2 A;  2XFS A;  4DR1 M;  4M9Z A;  1J5E M;  3KP0 E;  1G8P A;  1NHG C;  5KPZ A;  1K3W A;  1IY0 A;  1QAQ A;  1DO2 A;  2QEN A;  1TDH A;  3TWK A;  1QYR A;  4ITQ A;  4L78 A;  3SHG B;  4JXJ A;  5ITR A;  4IJE A;  3PXG A;  4LCB A;  3C58 A;  2D7G A;  5EP2 A;  3T1H M;  5F3W A;  1Q3B A;  1KFV A;  4LJ6 A;  3U6O A;  5ITY A;  3MHV C;  2Z7J A;  4DUY M;  2DWM A;  3A46 A;  2V1U A;  2C9C A;  3R8F A;  2V1C A;  2X49 A;  2KRK A;  2J7O A;  4B7H A;  4GHA A;  3JR5 A;  2XFT A;  2X4A A;  3TPZ A;  2KRU A;  2FNA A;  5EXX A;  2Y21 A;  3SAT A;  3LQQ A;  1IN6 A;  2A5Y B;  4GC5 A;  1TH3 A;  4FCT A;  3GRY A;  4LJ8 A;  1I94 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...