4GC9A

Crystal structure of murine tfb1m in complex with sam
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
318
structure length
317
Chain Sequence
FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase 1, mitochondrial
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 93
structure length 317
sequence length 318
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc9A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc9A01
2UYOA 1JSXA 1EIZA 5T64A 4R6XA 2A14A 3HP7A 5E9WA 3DMGA 5FCDA 1ZKDA 1IY9A 3FUXA 3GO4A 4MQ4A 2Y1XA 2OBFA 3P2EA 2AVNA 3M6XA 1ORHA 3KPUA 4K6MA 5IKMA 3O4FA 1DUSA 2OO3A 2XVMA 5DLYA 1VPTA 1XTPA 2B25A 2DULA 4KVZA 3UJ8A 2NXEA 3B89A 1KPHA 5DTMA 5K03A 2BM9A 2WK1A 3FRHA 3I53A 3NW9A 5LQCA 3TMAA 3KPYA 3A25A 4P7FA 1FP2A 2PLWA 4AX8A 2ZBPA 3P2IA 4C4AA 3LDGA 4EKGA 1T43A 2PWPA 4GC5A 3SVZA 5F2OA 4BP3A 4E2YA 1D2CA 2ZIEA 2O05A 1EJ0A 3KQSA 2VZ9A 5M5BA 3JWHA 1RI3A 5LQNA 5DXJA 5DX0A 5DM0A 2H1RA 3LBFA 3OU6A 2XYRA 4KWCA 3P8ZA 5FHRA 4MIKA 5E1BA 4ER6A 5EKXA 3UFBA 3IHTA 3KKZA 3KPJA 5GIPE 2HV9A 1UWVA 4OQEA 4RTNA 2IFTA 1JQEA 5T6BA 4A6DA 3FYDA 2PGXA 5FWDA 1VL5A 1NE2A 1O9GA 2YX1A 4RWZA 3TKYA 4PYLA 1DL5A 2ONZA 3AXSA 5LQAA 2P35A 1FBNA 1INLA 3DOUA 1KP9A 5CD1A 2BM8A 3LKDA 3OU2A 1WS6A 2JG3A 5B1SA 4GQBA 1JQ3A 2OB1A 5BW5A 4POOA 2JJQA 2B9EA 3CBGA 3KR0A 2JH9A 4CTJA 3EVZA 1XVAA 2FRXA 1KIAA 1WG8A 4A6EA 5LSAA 4QDJA 2H00A 3G5TA 5KQSA 3JWIA 5GINE 2ZZMA 5EHIA 3VYWA 1SG9A 1L9KA 4P58A 4FT2A 3LCVB 3A4TA 1Y8CA 2ZIGA 3H2BA 3MTEA 5BXYA 3FPEA 5DM2A 1QANA 3BXOA 1TW2A 2VP3A 3KQOA 5E1MA 3MCZA 3GRVA 5EHGA 5DWQA 5EPEA 4KW7A 3PLAE 4HSGA 1EG2A 3BZBA 4YUYA 1XDUA 4PCLA 4GBED 4RTPA 4YV1A 3P71T 2PT6A 5C9ZA 2FK8A 1YB2A 3DUWA 3HCFA 4RTKA 1BKYA 1NW8A 2AN3A 2GLUA 3HEMA 4YUVA 1YUBA 2PX4A 2Z6UA 1RJGA 4MHTA 4M7RA 3ME5A 2XYQA 2CL5A 2QY6A 4C08A 2UYHA 2PXCA 3FRIA 3KPVA 2E5WA 1XJ5A 4QQNA 3TPZA 3LX6A 3KQTA 5EVJA 5E2AA 5FHQA 1I4WA 3HVJA 3T7RA 2V7EA 3LDUA 5EC8A 4FP9A 3DULA 3T7TA 4U7PB 4DMGA 5LQUA 5DM1A 4CKCA 2ZZNA 4YMGA 2BZGA 5EMKA 2BR4A 3G7UA 3HA5A 4F85A 2NXCA 1RJFA 4HG2A 3NDIA 4HH4A 4HGZA 2YVLA 3V8VA 5KQRA 2YTZA 2C7RA 4E2XA 4PINA 3GWZA 3MGGA 5CM2Z 3HVIA 1G8SA 1PRYA 3I9FA 3K0BA 3UJDA 4YUZA 3IV6A 1UIRA 5K09A 5CCBA 3QV2A 5FQOA 1G60A 4FGZA 2AOTA 3UJBA 1KPIA 3EGVA 3HNRA 5HIMA 2UZ4A 1EJ6A 1MHTA 4OA8A 2PXXA 3HVHA 1I9GA 3G5LA 2PX5A 4PYMA 3DTNA 2C7QA 1FP1D 1RI4A 4HTFB 4ER0A 5K0FA 4PYIA 4NECA 3V97A 4FS8A 2FK7A 3IYLW 3B3JA 3G8AA 3VSEA 2FCAA 4C06A 3RODA 1VP3A 1EAMA 3K6RA 4RYLA 1WZNA 3TM5A 1VP9A 2K4MA 4FR0A 1XXLA 3ELUA 4PGGA 4AZTA 4AZVA 1G8AA 2O57A 3MERA 5K0JA 2B2CA 2GH1A 2CWWA 1SVUA 2ADMA 3BGVA 2P3LA 5FUBA 5GWXA 3TLJA 5E9JA 1L1EA 2YUIA 4ZTBA 2O07A 5HZMA 1I1NA 1RJDA 4HRAA 3TFWA 3MAGA 4YMHA 1X1BA 3KPWA 3GCZA 3NTVA 3P9KA 4LECA 1AQJA 2EX4A 1D2GA 5FULA 2ZCJA 4X63A 4IV0A 3B5IA 3FZGA 4RTLA 5DTRA 3NVMB 2EJTA 2G71A 2NNWB 4DM3A 4ER7A 1JG1A 5FA5A 3EVAA 3CJTA 1X1CA 1V39A 3UJ7A 2VDVE 3I5UA 2IH4A 1H1DA 5LQRA 4FZVA 3QOWA 2NXJA 2QM3A 4KDRA 4EVIA 3CC8A 2ESRA 5H02A 3NWEA 1B42A 5HOQA 5K0CA 3FYCA 2F8LA 5CUQA 2P40A 3C0KA 3EMDA 1SUSA 4RX1A 5IH3A 2QE6A 2JHAA 3E7PA 3LKZA 4PCAA 1MJFA 2OPBA 2PXAA 4XUEA 2ZW9A 2YXLA 1N7IA 4AUKA 1VBFA 3TR6A 1QAMA 1P1CA 1JG2A 5DPMA 3F4KA 2EG5A 4OQDA 2ZBRA 4EQZA 2P3OA 3NVKI 3RW9A 3CJRA 3M6WA 5K0GA 3DLIA 5G02A 4U7TB 1R00A 3OCJA 4Z2YA 3G2PA 4OBWA 4RSRA 3UJ6A 1X1AA 4FSXA 3WSTA 1DCTA 2DPMA 4BLVA 5GM2A 1JG3A 3HCDA 4GUAA 5E9QA 3SX0A 2YQZA 3GJYA 2I9KA 2ZIFA 3M6VA 5HIJA 4C07A 3GDHA 2IPXA 1JTFA 4BY9E 2PV0A 3GNLA 5DRTA 1UFKA 2ZWAA 1NW5A 5KS2A 4FT4A 1RJEA 4RTRA 3GRUA 3EGIA 5DX8A 3B7PA 5DTQA 2AR0A 2HTEA 2XYVA 3UBTA 5MHTA 3P97A 2NP7A 2QRVB 3TM4A 4ER5A 4GOMD 4HGYA 3FPJA 5LQJA 4DCMA 1FJXA 3THSA 3BT7A 3E23A 4E33A 1G38A 2FPOA 2HWKA 1NKVA 2B3TA 3HA3A 3ER9A 1ZQ9A 4IKPA 4ISCA 4RVFA 3A26A 2OY0A 2ZFUA 3NMUF 2O0LA 4R6WA 2AOWA 2R3SA 3CJQA 5DM4A 4ER3A 3M4XA 1NW6A 3O31A 3QOXA 4QVKA 1ZGAA 3SSMA 5CVVA 3CKKA 4F86A 1YF3A 1NV9A 3M33A 1XDSA 2B78A 2AOXA 5EEGA 4QQKA 5DRYA 4DZRA 2ORED 2Y1WA 4QDKA 3ERCA 5CVJA 3G8BA 3DMFA 3EVBA 2ZLBA 5K0LA 3R24A 4IWNA 3UJAA 4GEKA 2IBSA 3PVCA 2C7OA 4LG1A 4KDCA 3NDJA 2WA2A 5DT2A 5FA8A 4RTJA 2IIPA 3B3GA 4CKEA 3LSTA 4GOLD 2FYTA 3FTFA 3JWGA 2JHCA 3DXZA 4X41A 4GC9A 4MWZA 3SM3A 5JR3A 4GF5A 2JH8A 2PJDA 2Q41A 2YXDA 3I58A 3REOA 1QAOA 5E2BA 5ERGB 2FHPA 5EG5A 5FQNA 2AOVA 1VE3A 3KQWA 3O7WA 1M0EA 1N2XA 4BLUA 2JHPA 3FPGA 3M6UA 4LWOA 4PYNA 3KU1A 3PFHA 2AZTA 2I62A 3IEIA 3OFJA 4QTTB 5CIYA 3PFGA 4WVLA 3LDFA 4F84A 2N47A 3C3PA 4PGHA 4PYQA 5HIKA 1D2HA 4E2ZA 2OB2A 3HCCA 3EVEA 2VS1A 4X1OA 1OR8A 5K01A 2AOTB 3P9CA 7MHTA 1TW3A 5EGSA 1FPQA 4PWYA 5DSXA 1JQDA 4DA4A 2H11A 3PT9A 5EIWA 3R6TA 4OA5A 1KPGA 2OZVA 3Q87B 1RI1A 3X0DA 3SMQA 3ORHA 3R0QA 2P7HA 4DF3A 2G8NA 3ELWA 4PIPA 5EMJA 5HILA 1KHHA 5ICCA 2C7PA 4PIMA 4PNEA 5K0NA 4Y30A 1G55A 1SQGA 3UJCA 1WXXA 3GU3A 3LBYA 3EVDA 3EEYA 5GM1A 1P91A 1R18A 3BGDA 2OYRA 3T0IA 3CCFA 5ICEA 3GXOA 4UOEA 1ZG3A 3GGDA 3G89A 4GOND 5HEKA 4CKBA 5E8RA 1TPYA 3BUSA 5EMMA 3PTAA 2I6GA 9MHTA 3MCTA 1QAQA 5T67A 5LR6A 3HCAA 2NYUA 1L3BA 1IM8A 1O54A 1X19A 3OU7A 3DP7A 4OX9Y 3DXYA 1ORIA 5KVAA 4KIFA 5FWAA 1SKMA 3SR4A 2AOUA 4V0RA 4WXHA 2UYCA 3TRKA 1KYZA 2HR1A 1P1BA 1Z3CA 2IGTA 4IV8A 2ZVJA 3DH0A 5DXAA 2QYOA 4C05A 3AY0A 1KR5A 2Z6QA 1BHJA 2PSSA 3BKWA 4M36A 5ICFA 2ZTHA 3UWPA 1M6EX 3KHKA 3FPHA 3DR5A 1IXKA 5CCXA 2VDWA 2IDJA 4RTOA 4DQ0A 3G2OA 3R3HA 4HTFA 1VIDA 3G88A 1KYWA 3E8SA 5DX1A 4BLWA 5CVDA 4MTLA 4B17A 2GA9A 3KQYA 3AWIA 4XUCA 4V0QA 1EQAA 3A7DA 3GRZA 3THRA 3PS9A 1NBHA 3ID6C 2V74B 4R8SA 4KIGA 1WXWA 3KR1A 4P7GA 3CVOA 4XCXA 3VC1A 2O06A 3EMBA 3EPPA 5EEHA 5GIOE 2GB4A 4QVGA 2LD4A 3OZTA 2BR3A 3A7EA 3PB3A 5GP1A 3DXXA 5BW4A 3Q7EA 3AXTA 4X60A 5BP7A 3ELYA 1XCLA 3P9NA 4RVDA 3FUTA 5EIFA 1HNNA 1BC5A 4RVHA 1R8YA 2NP6A 3OZRA 2I7CA 3TKAA 3GRRA 2PVCA 3HM2A 5FADA 4E31A 2ZWVA 3FTDA 4R05A 4YUWA 3FUVA 2KW5A 2PKWA 5CVUA 5K8VA 4CTKA 2XVAA 2NXNA 1SUIA 3BWMA 3R9XB 1ZGJA 5GOZA 4KRGA 2BR5A 2CKDA 8MHTA 3FPFA 1VQ1A 1NW3A 2P8JA 4M38A 3KR2A 4RVGA 2ONYA 4LWPA 1Q0TA 1YZHA 5K0EA 3BWYA 1KXZA 2YXEA 2BH2A 3NWBA 2OXTA 4RTQA 4E70A 1WY7A 2PX8A 3L8DA 4E2WA 1G6Q1 2WA1A 3OFKA 1XCJA 3OPNA 5KYGA 1F38A 1SQFA 2AN4A 1Q0SA 1XDZA 3LL7A 3OZSA 3LCUA 5HIIA 5P8WA 4EK9A 3LHDA 3SSOA 5DSTA 4G56A 3VC2A 1YFJA 3HVKA 4C03A 3CGGA 2IH2A 1RI5A 5EKUA 1AF7A 1HMYA 3C6KA 3EVCA 5EMLA 3MQ2A 5EQJB 4PONA 2UYQA 5EOVA 5FTWA 3I64A 3EVFA 4C04A 3KR9A 2ZULA 1YZ3A 3C3YA 1ZHFA 4X61A 3BWBA 3FTCA 1R8XA 3NJRA 4YV2A 2CMGA 3S68A 1NT2A 3HCEA 5HFJA 1PJZA 4DCGA 1F3LA 5C0OE 3T7SA 3ELDA 4E30A 3B3FA 4QPPA 3E05A 1VLMA 3GIWA 4FSDA 3P2KA 3UA4A 4AZSA 4BP1A 4E32A 2QRVA 5K0BA 1YFLA 3AJDA 1QYRA 2PBFA 4YV0A 3SXJA 3G2QA 2G70A 3LGAA 4P7JA 3KQPA 2AS0A 4ATNA 2GS9A 1L3IA 3DMHA 3A27A 3BGIA 3ANXA 3SSNA 3HTXA 1BOOA 4XUDA 3UA3A 5K05A 1QZZA 3P9IA 5D1NA 5EZSA 3HCBA 4CWAA 4EMSA 1JG4A 1L3CA 1X1DA 5C1IA 5F2NA 2PT9A 2IH5A 1P39A 2EJUA 1JR4A 3EGEA 2EFJA 5D1HA 2YR0A 3FUWA 4OBXA 5U4XA 5LQKA 3TQSA 1R6AA 4RTMA 10MHA 2Z6AA 4PYJA 3LPMA 3D2LA 3MTIA 2ZSUA 3LECA 4YUXA 2P1DA 2HMYB 2G1PA 2IBTA 4QPNA 4EKIA 2P41A 1AQIA 5E1OA 1NW7A 2P3QA 1NBIA 3EVGA 3G2MA 1O9HA 4L7VA 1R74A 4GOOD 3KQQA 5E8JA 3SGLA 3TOSA 2XBMA 2PY6A 2ZZKA 4QTUB 3U81A 1N7JA 5CVEA 3M70A 3MHTA 3PX2A 1M6YA 4PYKA 3GRYA 2GAFA 3JWJA 4HC4A 3UZUA 1RI2A 3LCCA 4DKJA 3RIEA 2R6ZA 1JTEA 5ICGA 4Y2HA 5JUWA 3OE4A 1JSZA 2AVDA 2PWYA 4R8RA 4PYOA 4P7KA 4CXMA 3FTEA 1U2ZA 2AN5A 2IP2A 4O29A 2AOUB 1NV8A 3FUUA 3UJ9A 3OE5A 4RV9A 3KQVA 3KQMA 3PX3A 5EZQA 2CMHA 2P7IA 3C6MA 3DLCA 2IDKA 2PX2A 5E1DA 5F2KA 3BKXA 3ER8A 3HA7A 4H0NA 4AZWA 2ERCA 4RTSA 4M37A 2VDUE 3BWCA 2HNKA 2GPYA 1AV6A 4JXJA 2G72A 2ZBQA 3EEOA 2OKCA 3MB5A
chains in the Genus database with same CATH superfamily
2WU4A 3U60B 1MA0A 3SZ3A 5JNTA 3WGUA 1PD0A 2OR3A 3EC7A 2BBTA 3WMWA 2GM4A 3GFOA 3L7NA 3IKTA 1Q3CA 3DKVA 4XPIA 3LGXA 2YYZA 3FPKA 1RPNA 4C5CA 3CY6A 2XTNA 2BOVA 3B1WA 4EATA 4PYLA 3W5VA 5CBPA 4RKEA 2K9DA 1J8YF 2NSJA 2R1TB 5LSAA 4KPUA 5AVOA 4MS1B 5TGTA 5KQPA 2JBWA 1TW2A 5DWQA 3W04A 5EQFA 2VCHA 3U3XA 2DZNB 1XQ6A 2UU9M 1B23P 3UUFA 1MX3A 1P3DA 3OQ1A 2P4SA 4I1UA 1FC0A 3R8XA 3AR7A 5TPWA 3VUFA 1T1RA 4MWBA 2E3JA 3KQTA 1KC1A 1XZDA 4K0RA 3QF4B 2WSFF 5CLQA 5CPFA 2WKSA 1EFPB 4PLHA 1ZVQA 1JHUA 3P4UA 4B3DA 1J7KA 1OSNA 2W9XA 3WYEA 4HZUA 4RHYA 5K09A 5A03A 3TQQA 3MTDA 1PR0A 5ES3A 1IFYA 5REQA 3SQWA 1ZESA 4TS9A 2WHQA 3IMEA 1T5SA 3KB1A 2QIOA 3VSEA 3WAKA 4HUTA 3O47A 3P9PA 3H1PA 4RK4A 3ZBUA 3TLJA 1TIKA 1XYGA 4J0KA 3VU9B 4MWEA 2A9QA 2NNWB 1V39A 3RHSA 4D41A 1MOQA 5B1HA 4IM7A 1QQWA 4JFRA 1W4RA 2O7VA 4C7BA 2LVAA 1FUEA 2HSEA 5C8VA 3HZOA 3PPXA 5LQMA 4AUNA 2QN1A 2NACA 3DT6A 2HUPA 2JPDA 1W48A 1E20A 4KQEA 4UVIA 4HWPA 1NPYA 1TD9A 2FR8C 3EISA 5CVVA 3ABZA 2HCBA 2IHYA 4R2LA 4DLWA 3L26A 3K15A 2PPLA 4BNZA 1DAKA 4FNGA 4LFBB 3W7BA 4JVOA 3ADCA 2NO5A 3JQ8A 2JAQA 3A9RA 1MIOB 2JRCA 4BU0A 1MRZA 4KO8A 4D1YA 3H1FA 3HJSA 2HLHA 3AF5A 1NURA 4A7PA 2C2YA 3ELWA 4BV2A 4WT7A 1G55A 5FYDA 4LN1A 4BWFB 5PNTA 4JI6B 2XTMA 1JMYA 1XT6A 2CEKA 2W37A 4DMFA 1P1BA 2DFKB 3QV1A 3BQMB 3OVMA 3GHYA 3WNZA 2FQ1A 4YBZA 4B47A 4LCEA 1Q15A 3E21A 3T3HA 1S2LA 4ZMSA 1WD7A 1AS2A 1QQTA 4OCZA 4HGQA 1FX1A 4HLNA 5H9VA 4PBTA 2CLCX 3PEFA 3M49A 1I30A 2QHOB 1J07A 2JIDA 2P3SA 1E1CB 3A3PA 2VWPA 3MCVA 2Z5GA 1SC6A 4LJ8A 3AP3A 4HB4A 2H5JA 4GU5A 4MARA 2C4VA 3MT0A 4NBTA 4LMAA 5MN6A 3HR8A 5JVDA 1CZKA 2J3IA 2AZDA 4LF4M 3FTCA 1BA3A 1KJZA 3K9HA 4BVHA 1V5GA 1MGPA 1WVGA 3K3PA 1JPJA 5CB6A 1P19A 4BO6A 3NTQA 4LY3A 4KE6A 2HSWA 1WWKA 3PHJA 1OBHA 3TQSA 4A9AA 1Q7EA 3N2YA 4C6TA 5FH9A 3AEKB 5HQ3A 3A1SA 4QEKA 5B7NA 1K97A 4DSUA 7YASA 4OOFA 5EVCA 1W75A 1GZHB 4EG8A 4RENA 2BMFA 1X70A 3EUEA 3LHFA 3PFBA 4OP3A 4KVFA 4M46A 1FS4A 4MRVA 3GN2A 1A9TA 4H7IA 1EBBA 1EDEA 4AQDA 3I12A 1ZRSA 4E5SA 4TTJA 1O87A 3CZCA 2XKAA 3RS9A 5KOHB 3O4FA 3B8EA 2IZZA 2AQIA 2XGNA 2B4QA 1YZUA 4HGOA 1RHQA 3PRKE 3M5PA 4RAOA 3OKAA 2RB4A 4NF2A 2XVYA 3U4AA 2QRKA 3IEPA 2QZJA 1E6KA 5DN9A 2GN8A 3ZZ0A 4U9IS 3OHPA 4LF9B 1KVQA 1Q57A 1XF1A 2P6NA 4TUYB 2Q5LA 2BFBB 3ONEA 5CJJA 1SPXA 2VJCA 3WK8A 1XVIA 1Z6GA 4W5HA 5G0SA 3RD5A 2HZBA 3TD2A 3OU2A 2G5GX 2Y0BA 1JBQA 2JH9A 4AD8A 1YOVB 1N2CE 3EIHA 4JI8M 2HWWA 2QG6A 3ZY4A 4TXLA 2LZ0A 5DM2A 3SASA 2E49A 3DZKA 2HJHA 4WZAA 4F5YA 5AI8A 1NASA 3U44A 2JIZA 4D43A 2AWNA 3LX6A 2E85A 4R5HA 3Q7SA 3K8OE 4U1RA 2H5EA 1DGFA 4OQLA 1BMDA 5K20A 5JJLA 5FPTA 4REOA 5IFLA 2EW8A 4OIMA 1PRYA 5KTOA 1BE1A 1CUYA 1YE5A 2H06A 5BRJA 3QY0A 3I04M 1BJRE 1AUOA 4OD0A 2VDWB 1VJTA 3V97A 3ZHVA 2IYZA 4TQ9A 1KJYA 3A3OA 4G5FA 2Q5FA 3L43A 1KSHA 1A8IA 4JEHA 3AVWA 2C8LA 4OHCA 1N6OA 3H11B 3ZGOA 5EKTA 3EA4A 2PD6A 1N8TA 4FZVA 1HRKA 4DBZA 3C3CA 3ZE9A 4MGIE 4XUEA 1XZCA 1T9CA 5B57C 3USES 1QKJA 1CIJA 1TZKA 2CXPA 2HU5A 1L1QA 5BN3B 5LKAA 2NO7A 1G5HA 4OQMA 5MN4A 3ONFA 3B7PA 3MLAA 3I0ZA 5TT0A 1U0JA 4C1NA 1FFXA 4I14A 3U26A 4KREA 3CFYA 4E4RA 4KN8A 3M3DA 4HH1A 3ZEAA 2XGMA 4B6JA 5EQDA 3ZXIA 2BBSA 1Y42X 2FN7A 4GHWA 4BAUA 2C2GA 2D54A 5F33A 1QIEA 1M34B 2YXDA 2GM9A 3CINA 5HZGA 3GD5A 3I3SR 4GGPA 4DEXA 3SHTA 4L78A 1QGUB 5I45A 4UNIA 1EE8A 4Y0NA 4KLCA 3GFRA 3W7AA 2PEYA 1FPQA 2QMUA 2OKGA 2YV5A 1B14A 3EULA 1KHHA 2ORVA 3U19A 1SQGA 2B8WA 3UWMA 3CNNA 2PA0A 1MTZA 1HEUA 3Q7RA 3SAWA 1EXDA 1A9ZA 4NH0A 5LA6F 1YE3A 5HM8A 3HKDB 3GLSA 2IIQA 3JD2A 4KP7A 1GVNA 3RFFA 4JJZA 1VE6A 2XE6A 3KR1A 4XI9A 4MYRA 4LOKA 4II3A 5D3MB 2B36A 1A9QA 1AMOA 3C6QA 4XRGA 4G8CA 1NPTO 4CHTA 1LPOA 5HFAA 1SRRA 1ZGZA 2FU5C 2UUPA 3MT9A 3LVVA 5KNDD 3SSOA 1TK9A 1BG6A 3U3JA 4YR9A 3AW9A 4NPCA 2ANBA 5J2UB 4B43A 3EVFA 1PR5A 4CISA 4YV2A 1OPRA 2WICA 5BQOA 1UT5A 1K0UA 5CVCA 2WB2A 1F2TB 4M1SA 1X7WA 3D4IA 1CY7A 4F71A 4FYWA 2PMCA 1Z4KA 2AJ8A 1JU4A 1QRSA 2ZM6B 2HMYB 2YYAA 1TH4A 1XU7A 4QPNA 1NF3A 3EK2A 5B2FA 4GZ6A 1W5EA 1GARA 2Q0XA 2JI6A 3UMGA 1T3SA 3JVUA 2GNOA 4WHMA 1AF4A 2DMRA 3RIEA 2CLDX 1T5BA 4XVRA 1WSDA 1B2LA 2FPPB 4EHAA 2PWAA 4BX2A 1ECCA 4GX0A 3DVQX 4D4JA 3MB5A 4BJ3A 1SBIA 5JDCA 1FP4B 1IXRC 5EIEA 3M6XA 4J3JA 5CDFE 1YXMA 3IAM1 2VA9A 1V92A 2W5UA 4NH4A 2FG7C 2WWFA 2QN6A 4G0MA 3W8RA 4C4AA 2QTLA 1UAGA 3L7KA 4RJKA 4X5OA 5J47A 4U3JA 4OLBA 4O2BB 2G1AA 3ZBTA 3AQ4A 1H5UA 4F8JA 1XTIA 1H0KA 1QMGA 3WGOA 1EUDA 4D9CA 1XV5A 4WN9B 1LBIA 3F78A 3F98A 4RJLA 3KHTA 2ZE5A 3V55A 1Y3HA 2Y77A 3TQTA 4C0LA 3NBAA 1YKGA 3Q7TA 1GUYA 5CYOA 1NVUQ 2N9UA 4BVLA 4PS0A 3KJQA 4DS3A 1XDUA 5LIPA 2JD2A 1IUNA 2GLUA 1QFZA 5LPNA 1FOEB 2BGJA 2PZLA 3IHKA 4G5YA 3UYKA 4F97A 1KI7A 3KT6A 2ANCA 1T3TA 4RJIA 5IYZF 3F8TA 3FHOA 4QNRA 1B00A 2QLJA 4I5EA 1F48A 1H6BA 3DHYA 5HIMA 4RFVA 2DFPA 2XX3A 1NYRA 4YAEA 4QT0A 2I4IA 1HQYE 4KZKA 5EJ6A 3EW9A 3OCWA 2C4HA 4KE8A 1ZBDA 2V7QA 3A3NA 3V4RA 1GTMA 3G9QA 4Q1VA 4OX9M 4Y2GA 5CFPA 5IH3A 3S8EA 3NVKI 3GMIA 1U3DA 1PTJC 4LYGA 5E6UA 5LCXA 4AY5A 1TUBB 4LJ5A 4IIFA 4TXJA 4UPDA 4DC0A 2PL3A 2QRVB 3NANA 2UUAM 2EERA 3LMMA 4R1LA 4AN0A 2GRUA 5FOSA 2I4TA 4KOEC 5F64A 4OU4A 1QF7A 3GQ3A 4OXRA 4B7ZA 5LP6B 2V7TA 4P3YA 4TTAA 1N0HA 4M7PA 4M0DA 1LTKA 3TEMA 1NE7A 3T99A 2FLKA 2VDOB 1TM5E 3PDJA 3PFGA 1BDJA 4AJJA 1EXVA 1B4DA 1S2MA 1U02A 1XLUA 1DTWA 3WC4A 3R6TA 2PKYX 1OH7A 4Q4HB 2DBVO 3R0QA 4JT8A 3ZI4A 2C7PA 4DR4M 721PA 3E7DA 1F6DA 1XCMA 3N74A 2M6KA 5LNK1 4I1IA 1U8CB 1CXZA 4OVZB 1R0KA 2QUIA 4ZO9A 1K6EA 4J90A 5EQTA 2QMZA 1JR3D 3R5FA 4UHBA 2QI9C 2BKXA 4U2FA 5EEHA 1FUKA 4YP7A 4Z4CA 2HHLA 3EFOA 4NCNA 4KXVA 2EKKA 3OLCX 1JUDA 3LDHA 1XO1A 2AFHA 2FW9A 1GTSA 3R77A 3FNEA 2ACEA 3BXPA 1QBGA 4HAUA 3IDFA 4GXTA 2CZCA 3CZAA 3D6JA 3O3CA 2IF0A 1KRWA 2YZGA 5FTWA 1I2AA 5A9RA 3SSAA 1ECFA 4IDDA 5EAIA 3W5UA 1I2BA 3DGEC 4FQ7A 2ZDQA 1RPTA 1XCGB 2Y05A 1Y3AA 1M7HA 1ZMRA 2XWJI 3ETEA 1ZM3A 2BGKA 2X4DA 1H9AA 3G8DA 4IBBA 1Z7GA 4MKFA 4BWVA 2V1CA 4LDPA 3TAXA 3UKJA 3SC2B 2QCUA 2NPFA 2BUAA 3GI1A 5KBYA 2Q2WA 4UNQA 5U9CA 2OORA 2XZOA 3UENA 3QWBA 4JJIA 2QVCA 2ISSD 3G13A 4ZZIA 3PYMA 5AW4A 4OQQA 2LHGA 2EHDA 5LA6A 3HU3A 3GPDG 4PFKA 5CFQA 4TM7A 3EPHA 2F5PA 1O08A 1TFUA 1JZSA 1TQDA 1E6WA 1G64A 2Q7XA 1TPZA 3QKWA 1ONOA 4DNXA 3H87A 3IBTA 4W4TA 2HDHA 2LIVA 1FU7A 3DVAB 3KXDA 4J0GA 1TYCA 5AXBA 5LMNB 3DZFA 5D7BA 3VPFA 1XNQM 3C98A 3F7MA 2BM0A 3N75A 2DETA 3Q12A 2ATIA 3KZCA 2XGOA 4CTMA 1RE0A 2VZ0A 1T8TA 2QTRA 3DL0A 2ZI7A 5DHAA 2CB9A 4UATA 3L4BA 4MHTA 3HYRA 5J43A 6REQA 1K63A 2JGMA 1GGEA 4IICA 2Z2YA 4JI1B 4ITVA 3TYXA 3V8VA 4Y2TA 1SBZA 1O9BA 2AG0A 4FUQA 4FILA 1BWPA 2A9KA 4V0NA 3OIDA 5FL7A 1JI0A 1J25A 2I2BA 1CETA 2FPIA 4RYLA 2ZRHA 5DNVA 4D6PA 2F5SA 4AY4A 2CWWA 4TWIA 3BGVA 3VR5H 2F64A 3IE2A 2PH1A 1D2MA 3UMSA 5LZ5A 5AOBA 2Z95A 2Z4SA 3D7NA 4UARA 3GDWA 1V26A 3NWEA 5HOQA 4MVJH 1QC5B 1UKBA 4XVHA 2KRUA 3V32A 3WBFA 4XASA 3SYNA 1OBOA 4D9JA 2E6UX 2PPVA 1CQWA 2YINC 5CW2A 2VHZA 3A31A 1T1JA 2C1XA 3CE9A 5I7FA 1ZH0A 4WESA 2Y1FA 4HB0A 5JNUA 3OY7A 2VJQA 1DVRA 1MAWA 5A6SB 5E4FA 3AMVA 4XRRA 1D09A 4PM4A 5DHSA 1OXVA 3BBLA 4GWGA 1RQPA 4DLPA 3IUNA 3CZMA 4P2GA 2OVBA 2ZJZA 2E6KA 3F5FA 4GPEA 3PIRA 2Z98A 3QPDA 3NETA 2OO5C 1NQWA 5E2BA 1JDJA 4CKCB 3IVCA 2CUNA 2M60A 3WZLA 1CZLA 3ZWBA 4WVFA 1E79D 4A5OA 1R5LA 1TIBA 2Y1CA 4AM8A 5DSXA 3MWFA 2D4HA 4YCAA 1BZYA 2AMFA 2OCLA 1JAYA 5K0NA 4RDHA 3TCKA 1O6FA 3L1VA 5J5VA 3QVKA 3GXOA 3PGKA 1GTVA 3MT8A 1KOJA 2PGOA 3LX8A 2WWRA 1Z4NA 1K7EB 3P9RA 3PYXA 1U9JA 1CVRA 1J6UA 5ITWA 1LSUA 1KYWA 2VKQA 2GLXA 3IHLA 4QT4A 4NMMA 2Z8ZA 3QPWA 4B40A 3PKZA 1S8OA 1T9HA 2QUKA 4AY3A 2W2KA 4PXAA 5B58T 3L6OO 3H5TA 1Y7IA 2CV0A 4DILA 4O2LA 4EK9A 1KRXA 2Q4BA 5DSTA 4IIJF 1PJRA 1N2EA 4I9GA 3EG9A 3QBTA 1BHO1 4DLLA 4DRYA 3MELA 1V35A 4EGCB 5HTOA 1M5RA 2GETA 3MJDA 4CCSA 2VNJA 3AWDA 4RESA 5F2NA 3GX1A 1W93A 4XGRA 2XB4A 1J8VA 4KU4A 2R9VA 4PFSA 4YPOA 2V5VA 5DH9A 4TWJA 5AD1A 4J0HA 2C8VA 1H8HD 1C1DA 5H37D 3FWKA 4DR3B 2GVDC 3KWLA 2VNAA 2I29A 4E51A 1UXKA 5F2KA 4Q3KA 1SCNE 3EYWA 1MH1A 3ASYA 4OATA 5TPZA 4IGEA 3X43A 1VPDA 4O2AB 4IRXA 3ZD9A 3RDPA 1P4SA 4H9GA 4X65M 1M1YB 2DPHA 2O01F 3MM4A 2FJ0A 1XTVA 1L2BA 5FD8A 1XZIA 5BUSA 3B7GA 2WKRA 3G0HA 2C9MA 1GGNA 1DTEA 4C88A 2V8BA 1KGSA 4C7JA 2PMBA 1PS9A 3COPA 5LMCA 1SEPA 1GG2A 1M5UA 1H1LB 1WLYA 4QE3A 3QMPA 3C8HA 4CL8A 1L7MA 4X0EA 1BWSA 4OXQA 3AR8A 3AKEA 4V0OA 1V8DA 4IJ6A 3D8UA 1CTQA 3RRYA 3YASA 4Q7JA 3P1JA 1V4VA 3JD3A 5LDHA 4LYHA 4DMRA 3LOUA 4PINA 3EEQA 1ZH4A 4C4YA 5CRIA 2Z4RA 2VAVA 1EM6A 1V11A 3FWYA 3IP8A 3INGA 2OV6A 1VP9A 3EDOA 2ZB8A 4Z4EA 1UBNA 2APLA 4RD2A 4OYRA 5C18A 2FWIA 4WLVA 1AKVA 4FNMA 3A6KA 1UXHA 3BB4A 3DLTA 2JXNA 1DC3A 3TMKA 1PW5A 1DIOB 3S0JA 4ZT6A 5DW3A 2I66A 2WPDA 1HEYA 3SX0A 3M6VA 4IGKA 3PGXA 4KR2A 3ETDA 3JZIA 5A2QS 1FFGA 5LD2C 2XEDA 3S7ZA 2WYOA 1JJAA 1R37A 3IQXA 2VQDA 4RANA 1Z0DA 2YBDA 3E23A 1DIBA 4BFUA 4IKPA 4AO6A 5JJ5A 3ZBPA 5TMEA 3A6JA 1U0BB 1US8A 4JP2A 3RWBA 4CMHA 1P1KA 4ZTZB 3U61B 3FOAA 5FA8A 3JWGA 4KN6A 4MB2A 4EPYA 2FW8A 5HKKD 4Q6WA 1VEGA 1XLTC 1Q0HA 3O2QB 3CCCA 1UANA 1J70A 4X94A 1W9MA 3K71B 1JR3A 1NXVA 2BSQA 4TSKA 4WECA 5AKJA 3T9EA 1HH4A 4YT5A 3HB1A 3G89A 3K6SA 5T67A 1DV2A 2YHUA 3WGVA 1VHJA 2IZ1A 3N39C 4B6PA 4UCQA 5CA1B 4HDMA 3EVNA 1QZMA 4YY3B 3EHDA 5HS6A 3M9XA 2ZAMA 4C6RA 1XMVA 2Y20A 4PY2A 2DBRA 5ALFA 4J8PA 3G2OA 1PR2A 4ID3A 4GL2A 3RVBA 3JSAA 4MK4A 1Z3IX 2F48A 2VQSA 3L84A 4HDSB 5KQMA 4XWGA 4K88A 5ADUS 3D0RA 1XD2A 2YXEA 1Z83A 2PUBA 4EUFA 2VBFA 3ZV6A 3PEWA 5JFGA 1M2KA 3FJOA 2QIPA 4KSYA 2XVXA 1DGHA 1T8RA 4YJHA 1F8UA 1O0BA 3Q2IA 3HDQA 2QW0X 3QWLA 2ZULA 4LYDA 4TN5A 1N34M 3MRXA 4WNAB 4AW9A 1MQSA 1J9ZA 4Y0VA 1G20B 1XSEA 4TN1A 1HT0A 2DWQA 2IZ0A 3B1JA 3ND6A 3UKOA 4N3BA 2EUCA 4YCBA 4DLVA 4X84A 3MD0A 3V6LA 2HCRA 3THXA 2B7LA 1XMOM 2ZPTX 4CLEA 2Z9CA 4EBFA 1LDYA 1Z7WA 5EA2A 1RLMA 2QZZA 3RYFB 5AM1A 4HS9A 1K4MA 2ECFA 4KK4A 3PF9A 2BEWB 2CXSA 5KJCA 1UBRS 2LRHA 2OFXA 2KJQA 4CUJA 1GDDA 3GLGB 2BBWA 4OUDA 1V34A 6NULA 3RHFA 2NYAA 3O8QB 1EJ2A 1VIMA 4ALJA 4JV5M 2SBTA 4NSRA 4CL0A 3VSBA 4D3FA 1UDAA 4NLLA 2A1TS 3PZBA 1E4OA 1JJVA 2QTGA 3W79A 1Q1AA 2ZVPX 2JASA 3L04A 2BDEA 1TZMA 5BN1A 2BGTA 2Z8YA 3VDNB 4E15A 3KFLA 4X6LA 3N8HA 4LF6B 2F17A 4YMSA 3WV4A 3UMFA 4BMNA 1LRJA 3EGDA 4DQUA 2GHRA 4ZMRA 3SS8A 5BT9A 4CIBA 2Y4NA 3H8WA 3AC0A 3T4PA 1Z6AA 3TEFA 4IIJA 3IESA 3W2TA 1VFPA 2HPZA 5JEDA 1DBSA 3CZ4A 4EI9A 3O4IA 3KD2A 3KTFA 2CD7A 5JYCA 1TEXA 1M0WA 5FHQA 3P9XA 2XZLA 2JLCA 4L8LA 1ZX1A 2F3SA 3CVXA 4INPA 3QJGA 5LBTA 4OHXA 3U5ZB 4YC7A 1JKXA 4D45A 1K8YB 3EGVA 4FE7A 4DC1A 3EEFA 1MDFA 1U8YA 3PA6A 4O4LB 2ZRJA 2VJNA 1BWQA 3EXHC 3S55A 3E48A 5EJ9A 2QR2A 1MMFB 3FNFA 3TW4A 2AD1A 4LKOA 5BSVA 4H77A 3CC8A 3WWPA 3FYCA 4QDOA 5AQ1A 1Q7BA 3PUIA 1NUQA 1NXXA 3F0TA 2C9CA 3K2BA 4U7TB 2JANA 3UEOA 3ORFA 1TVKA 1A9SA 1ZIYA 4KDFA 3UV7A 1CQIA 3VZPA 4RHXA 5FV4A 3OOYA 1RM3A 4TMFA 4PBSA 4DR6B 1E79A 2C8KA 3SIPA 1K7YA 5KO2A 3OCXA 1I13A 4B3BA 3NEAA 1I3CA 5D3QA 2P9ZA 4MCJA 1IEXA 4HWRA 3WQBA 4B5LA 2AOVA 3VA7A 5C2JB 3R0IA 3W6PA 4XQGA 2CFOA 5KX5B 3HV2A 1WO8A 3KU1A 5ES4B 3RUCA 1T34A 4COKA 3EQ2A 2OB2A 1KZHA 4RHEA 3C14C 2F43B 2I7PA 2HSGA 1IY0A 3ABIA 4PNEA 4PG8A 1LK5A 4UCXA 4LYEA 2VG8A 1YBFA 2AHOA 1HT2E 2PLNA 1FXWF 1K6JA 4DANA 2AOUA 1GNSA 1WZEA 5C8DA 5IM4F 1MT3A 2HMTA 1G66A 5DX1A 4L85A 4UMVA 3CH7A 4ND1A 4CMEC 1DQYA 1FP7A 3AUTA 1SG6A 2IOFK 2W22A 1CUHA 4JI4B 4JK3A 4Q9IA 2R6DA 1M2JA 1N9ZA 1R4GA 3AY6A 1ZVJA 4JQYA 5A5FA 3ANNA 3V1UA 5AR1A 1BFDA 1R4MB 2QE7A 4KRXA 5KDDA 3ZZMA 3N53A 3LLMA 3OOEA 2W4IA 5ILGA 4LRXA 4X20B 5IH7A 3I9MA 4LJ9A 3MN1A 4E32A 5EPUA 1T4DA 4ALKA 1BMFD 1H8HA 2Z8XA 1XD8A 5K05A 3HCBA 1X1DA 5L40A 2VDLB 1QF6A 3TOVA 5BSFA 4AURA 1XEWY 3T5MA 3AOEC 4QEZA 3LVFO 2EA0A 2VR1A 2XNDD 4YP1A 4DNOA 5BR4A 4NE9A 2NWQA 2CBXA 1RW4A 5IXYA 3TD6A 1NXQA 1QU3A 1R8SA 3O82A 1QP7A 4PYOA 1BRTA 3WB1A 5AW0A 2NX2A 5JZBA 3MOGA 2JWSA 3FOCA 5A3JA 4CIXA 1IZ7A 3N28A 5FIUA 3DMGA 5HBRA 5EFZA 1U6JA 3P5SA 4G85A 4JLSA 1L5HA 1FFAA 5E95A 4J4TA 3SNHA 1W88A 4BBZA 1M1XB 5ARCA 3CEAA 4HGPA 1FRNA 3JWHA 1DKMA 1ES9A 3HCRA 1EB8A 3SR3A 2XB6A 4LK2A 3S2FA 4HT3B 3VV3A 1EDZA 2FPXA 1LNZA 4L50A 1RTKA 4DKXA 1FUYB 1DINA 2XMGA 4CKEB 2PZKA 4MJ3A 1N8KA 1I80A 1O4WA 1TU3A 5J5AA 1KZYC 5BR8B 3N9IA 1S2IA 1QANA 4DDVA 4KGXA 1D7AA 2WJZB 4NDNE 4QUBA 2BY4A 5K99A 3UF0A 3P26A 2NVOA 1XQWA 4QOSA 4YUVA 4G5QA 2X5NA 1XK6A 2ZTVA 3IRVA 4CIZA 5DXFA 2NU6B 5TQJA 3TR5A 2JGNA 2IV3A 3GPUA 2PD3A 3F5SA 5DBEX 2WAXA 2FW0A 4ZFNA 1X38A 1TYBE 1ZIXA 2LCFA 4CFZA 1F17A 1TVEA 1YAJA 1YI8A 1P72A 3F4LA 1RZUA 3D3JA 1BCRB 1TECE 3CG4A 3I9V6 4NENA 5JALA 4Y2XA 4IJUA 1U5BB 4YTEA 1T5DX 4E4TA 3DWIA 1X8LA 5JC8A 5H4HA 3S8MA 1TF5A 1YL5A 4FFLA 5G4KB 1L4HA 3PI6A 4YAWA 1CY6A 4HEQA 1JH8A 1P77A 2RIRA 4MAMA 4F6RA 2UXDB 3Q3IA 1NN3A 1WJGA 1IQPA 1LQUA 4YYZA 1IJEA 2AGVA 5HKKA 4DAEA 2WU0A 2EP5A 2JLQA 3W1EA 3T5GA 3WYBA 3ZD6A 2Y8EA 3C5HA 2JGRA 1NBME 4EG4A 3D7SA 5JCXA 2C2WA 1WPXA 3STWA 3SKVA 4RIFA 4BC0A 3VFDA 4TRMA 5JS6A 2XCSB 4H1TA 3J7AS 4I7EA 3OUUA 3GCGA 4C87A 3R9IA 4TWRA 2OXRA 4PIPA 2X6TA 3OZWA 3KZKA 2GJSA 4R84A 3T3IA 3MJEA 4BE4A 1VHQA 4TV8F 1JYFA 5BV7A 1E64A 4JNCA 2AMJA 4LFAM 5TEVA 2XYHA 3NUQA 2DFVA 3N2GB 1E7SA 4EAQA 3IULA 1B16A 3JCZA 3D6FA 1IB0A 3LVQE 4K03A 3E9DA 5FTJA 5KHOC 5GIOE 2VK4A 2DI0A 3C6YA 1DBWA 3RYCA 2DY1A 4UBIA 1PNTA 4LJAA 4LSMA 3FH0A 4UM7A 4R7TA 3T8YA 4GO1A 2VZ8A 1I1HA 1RZRD 4P17A 1BFUA 4CG3A 2H7VA 1NRJB 2DVMA 5AIBA 1AN0A 1UL1X 1MX0A 1KAEA 4MUAA 4FGJA 5HRCA 1NLUA 1PL6A 2RH4A 4YV0A 1RPZA 3AU8A 4ZQEA 2AFIB 3LYUA 1RWMA 3HABA 1U8FO 1MO4A 3I42A 4ANRA 3B1ZA 2I65A 4IEFB 1S1MA 3U3ZA 1I5OA 5F9FA 4RLHA 1QCCA 3KJIA 1EFAA 4FR5A 2O50A 1YRAA 3EZ6A 3EAQA 1YQEA 1AM4D 2WP0A 1KR2A 1J23A 3NHRA 1U5AA 1U7WA 4DSTA 3EGXA 3ISJA 2HF7A 3DPUA 1RC1A 1M5TA 3RFTA 1D03A 3SF8B 5HA5A 2O2EA 3KW6A 3WLJA 5KOIA 4FXOA 1XPJA 1Y1SA 5FCDA 1IEVA 1CE8B 4H08A 2BMAA 4IX9A 4R0VA 2ZATA 3TJZA 2GYVA 1EDOA 1FXWA 3VNBA 4G26A 4DEVA 1CSEE 3GEHA 2OLKA 3IXLA 4JBYA 2IYXA 1D2CA 3R9KA 2JVIA 5PGMA 4YJFB 1MO2A 3LPLA 5H70A 3WIVA 2FVXA 1TDHA 1EE9A 2NT4A 4XDHA 1VXOA 5GIPE 4L08A 5KI6A 3FZQA 3S2UA 1NE2A 2B30A 5EIBD 2GN9A 4DXDA 4A6XA 4JL8A 4YJ2B 4UNPA 3B3QA 3LUHA 1V7ZA 2W2NA 4HWOA 5BV2P 1YUMA 4E03A 1IOZA 5C5DA 1VRWA 4B3MM 3L7MA 5ADVA 3FKJA 2R7LA 4IYRA 3IBSA 2FRVA 2OHXA 5I8WA 3RT9A 1LDEA 4JCCA 1A9OA 3WGYA 1ZU4A 3BSFA 4RULA 4LGCA 4QYWA 4HXEB 3U13A 3R5XA 4X1YA 4TQGA 3ROPA 3EXIB 2AK3A 1FYEA 4L27A 2DKLA 4W9NC 2VF4X 3TX6A 3B82A 3NTRA 5AJUA 1YDFA 6CHYA 2ZTUA 3ASUA 2YVLA 2C4MA 1P0QA 3QV2A 1OWOA 4LVCA 4DV3B 2C0PA 1VZ3A 1CZUA 3IOEA 1NN0A 1WHTB 5DYWA 2YNMA 3N05A 5K0FA 4M54A 1IE3A 2R7KA 2I4LA 3QITA 3X1ZA 5GWXA 2HDNB 1XOIA 1UIMA 4PQFA 1GHTA 3T0GA 3R0VA 3VPHA 4MW1A 3VKGA 3GAZA 1JYEA 7ABPA 4IJWA 1GCIA 3QHAA 1XRPA 4JWTA 2B1QA 2HREA 3PGA1 4OH1A 1JNYA 2WE8A 3WBJA 2QT0A 3OO1A 3F9IA 2Z5LA 2XBLA 1YO6A 3JRXA 1OIWA 1Q0RA 4AJ1A 3HHPA 3THYA 4F1WA 2VTBB 4DB4A 4NMXB 2B35A 2GWHA 5DHFA 1YR3A 4EHNA 1H0HA 4ZGGA 3FPSA 4X24A 1YT5A 2PZFA 3PE4A 2WY2D 2QVGA 5CVJA 4MZXA 4IJEA 3K16A 2XWBF 4C0AC 1TTPB 1YB5A 2VBCA 2GAAA 4TVKA 1VLZA 2YJTD 3IPAA 5DASA 3AM4A 3OHSX 4BO3A 2I62A 4URYR 1LRKA 5F35A 5IW8A 5BVHA 2UZIR 3ASVA 2VSQA 3EJ6A 3TBFA 1JLRA 4MWCA 4BVBA 1LFDB 4IIYA 3QI7A 3H19A 2C95A 1YS1X 3KVNA 3L77A 2W6ID 1KYYA 4TZKA 2WINI 1IM8A 2J3DA 2GKSA 5GZ3A 4IS3A 5FFMA 3UT5B 1QHEA 1RYEA 1THMA 4J2TA 5NULA 3EGCA 2A9PA 4W6ZA 4WXPA 2I1QA 1G2IA 3KLOA 1U6IA 4AF6A 3LZCA 2PUCA 1QTNA 1E5VA 5FR1A 3L8EA 5FWYA 3H4MA 1JIKA 3CT4A 4Q7QA 5BW4A 3EA5A 5A4DA 2HWYA 3OZRA 3WKCA 3DBOB 5FA6A 3GPCA 1BXKA 1RACA 1NW3A 4OKNA 3S3TA 1HNZB 1T9DA 1Y1PA 1JSCA 4A3SA 3OFKA 4F9EA 1Y3FE 2FR1A 1W94A 4YI5A 1C0PA 4YMIA 3VMMA 1HMYA 4BB5A 1ONPA 4M0EA 2WJWA 4CKWA 3BDAA 1G7RA 1PJZA 5K6AC 2QTAA 3P2KA 2XNDA 3MUNA 1E99A 1GPNA 1MQAA 4V02A 1VBNA 2NW6A 4BGEA 5AW3A 3D0KA 2WYUA 3G1TA 4HZIA 5BWLA 1QVVA 1PFWA 2AI2A 4WNYA 1IBMB 1TO1E 4DV6B 3PT5A 2GHIA 2B2XA 1USGA 4OXYA 5LZ4A 1BRMA 1YKFA 1K3WA 4CG2A 2D7DA 4TSFD 3BKXA 5JLAA 3ON5A 3JZFA 1ULBA 4B8YA 5I7UA 3MA0A 4AO7A 3TLYA 3VNUA 4QG7A 5BXQC 4EW1A 5D3KA 1QLJA 5AYVA 4TV8A 3UJ8A 1PSZA 3R0XA 1TRKA 4UCWA 3R74A 4C21A 3DCYA 4UU0A 2QW1A 5DU2A 2ZIEA 3NHWA 4E5VA 4HX9A 5E0OA 5BYAA 3D5QA 4HNTA 3K96A 5IAKA 1MKYA 2QM0A 1DHRA 1GY8A 5FWDA 3REQB 3RV3A 1MT0A 1XZGA 2BRUC 3LP8A 4KLZA 1CS0B 3CQ9A 1OAKA 5L3VA 2P11A 5DHUA 2ZSFA 5BMOA 2ZT8A 1B8UA 3DTVA 4NIMA 3TMYA 4WZBB 2GCOB 3G1WA 4PZCA 2VSXA 2Z0MA 4QU5A 5A3SA 4C0XA 3BXGA 5KTKA 2GN2A 3GLTA 5FLXA 2PU5A 5A0TA 3GLFE 1K4YA 2GRJA 4KAJA 5BPVA 2H1CA 2P1RA 1K7SN 2IITA 1S4QA 2VSFA 1E1KA 5M29A 1I24A 5B1EA 1YR2A 4FYMA 3KKLA 3QZUA 1AMUA 4MQ6A 1QHXA 1L0BA 5EUCA 2W48A 3BREA 2G4VA 1FFCA 2P3LA 1GFIA 2K2WA 5AUNB 1LW7A 3ABRB 3T54A 4P81A 1KFCB 1VJCA 3MUFA 4ER7A 4D56A 2PJUA 4B08A 4CTNA 1PLLA 3KZVA 4ALLA 1KEUA 1YZQA 4OHUA 3B6JA 1DFHA 4Z2YA 1Q7RA 3H2SA 4AWAA 4JP5A 1OAIA 4QUAA 5BPFA 3QENA 3GPIA 1RKXA 2PH7A 4NG4A 4TZ6A 4Q1CA 1V48A 4MV3A 2KW0A 3COVA 3WK4A 4ZEVA 3PBKA 1RPJA 4GSYA 4MR9A 5ALRA 1RJWA 1UJBA 5BWCA 1CNEA 1J8MF 3TLKA 5BY2A 1GPWB 1W47A 3DO8A 2DKFA 1HZJA 1U7ZA 3FNBA 3TW8A 3KHSA 4XLTA 1U0FA 3HY5A 3CUKA 3ZG6A 3L7YA 3J27B 3ETHA 3JAWB 4G8BA 4O1HA 1NVMB 2FFBA 2N75A 4L3WA 1JMVA 2VQ3A 3OZEA 4HRXA 4A8JB 4GS5A 2B6HA 2CVFA 4P9NA 3LXUX 1JEYB 3SDSA 1G17A 3A1CA 3ENKA 3N70A 1D2NA 3PNQA 2NSYA 4Q66C 4S1VA 4XWAA 1K06A 5JI2E 4LRQA 1G7TA 3VR5D 4RORA 4NOKA 4WBNB 1USVA 4H0CA 5F4ZA 1TF0B 1RAIA 4Q4AB 4OG2A 5JARA 4LRTB 2EKPA 2A2ZA 3Q6NA 4IZOA 2O7QA 3IUSA 5TS3A 1A4XA 3GRKA 3ZWOA 2ZJ4A 3HO1A 2ZXUA 3MCAA 1E4EA 5ITVA 2OBBA 4R2MA 1Y9JA 3OZGA 1EXNA 1S3FA 3AESB 4FOPA 4NULA 1M6VA 2DQSA 4G4GA 1YDMA 2HMAA 3QVLA 3ZVMA 2CL0X 4ARSA 1GGHA 4UHEA 1OFHA 3QRWA 1XLVA 4FMCB 4Z6YA 4I9FA 3NTOA 2YOHA 3CEJA 2FPKA 1ZVKA 1LXCA 3TX2A 5AHOA 3F6EX 5I4KA 2QRMA 3FMVA 3CXRA 3ZVNA 2LE0A 2NUAB 1R9NA 1JLHA 3NGMA 2PUDA 2QUBA 1YCDA 2R1UA 1LBSA 2J6BA 2X0IA 2A14A 2JIBA 3BN3A 3OC6A 1NDQA 1Y81A 1MABA 4F12A 2O2HA 1WMBA 2L19A 3D5TA 2FEPA 2IEGA 3BZWA 4LZLA 4WXRA 3URKA 3GIDA 3G6WA 3DOFA 4M89A 2NU9B 1YGYA 1LTHR 2LVQD 3VSAA 5GONF 1DEHA 3IAS6 3LY5A 2F9LA 1UCFA 2PUGA 3TG8A 2YX1A 4U02A 2ON6A 3MOSA 5YASA 2CKMA 2A8YA 3D4NA 3A1DA 3CBGA 2HT1A 1MD9A 4ZICA 1NHGC 1L9KA 1BH2A 2V55B 1E2HA 4S3MA 4CG0A 4U00A 1XWIA 3BFXA 3SIRA 3ANYB 3KYCA 2XITA 1KOFA 4QQRA 4EY8A 1JV2B 2UYHA 4PG6A 2ZRFA 2IPLA 1XZKA 1GZSA 2EFYA 1OBFO 5JYBA 2Y2VA 3N5KA 3U6OA 3MRVA 1GLNA 3HLKA 3TL6A 1HL3A 4Q12A 1N5MA 4MDEA 2NUBA 1R0SA 4C0HA 2KBEA 1R2YA 4N5MA 2UZ4A 3M6IA 1OTXA 6Q21A 4QOJA 5JASA 2DJIA 5IZ4A 1Q74A 1L2DA 4WD3A 1YGPA 4YRLA 1ZN2A 1Y98A 4Z51A 4K6CA 4NBLA 2V7UA 5IXSA 3EBPA 1O2DA 1R6VA 4JXZA 4ZALA 3M6MD 1VYHA 2X8BA 4OIFA 2P62A 3I6BA 4MA0A 3RPEA 4B6RA 2JBHA 1GAXA 4YRDA 4EZEA 4RELA 5FPPA 2WZJA 1E94E 3CJRA 3KP1A 4QBGB 3KV3O 4BO9A 2YQZA 3FLBA 2Q62A 2ZQ5A 1N36M 1YC2A 4P36A 3WZMA 3DTYA 1EP9A 1P4HA 1T26A 3JQCA 1RXEA 2A1IA 2PS1A 4BNMA 1CFJA 1Z06A 1JG6A 3ESBA 2PA3A 1TTTA 2R3SA 3VK8A 3C7CB 4ZJUA 4RA9B 1M2OA 1HQKA 1NATA 5KUTA 2FMTA 3CS3A 1R88A 1TQ8A 3PWTA 2WA2A 3C97A 1JHRA 2W6IA 2CXTA 1L7VC 2DWPA 4BLUA 3AVPA 3FPGA 2E4VA 1XXHB 1V7PC 5JD4A 1JKIA 4KQ6A 1OC4A 3FY4A 5BSRA 4LFCB 3UWOA 2LP4Y 4WX2B 3UG6A 3KTDA 1DC8A 4B7CA 1CB0A 1B8VA 1ZM4A 3CR3C 5JSUA 5DYNA 1J99A 1HFJA 4Q00A 3E03A 4O25A 4RMHA 3PTAA 4N3AA 1GUFA 3AYXB 4RDIA 1OXSC 2X9NA 1Q7GA 3UWPA 3EF3A 3HU1A 3N7UA 2RGDA 1EUQA 4BMVA 3R3HA 4HTFA 3AWIA 1ZW1A 2JGEA 2Q2EB 5G2OA 1C3XA 3ID6C 3OH8A 3KSAC 3ZLVA 2GB4A 1V16A 4QM6A 5IVHA 4PLTA 3LUGA 3PTZA 3TLGB 4ZT7A 4IUCS 3USCS 2O0HA 2FSIA 3EB9A 1XC8A 1OYVA 4PG7A 4XUGB 3EXFA 2QJOA 1WVIA 3EGWA 1Y34E 5IJ9B 4ZC1A 4UFPA 4QD3A 4I9NA 2X41A 1EH5A 5H3HA 2VFAA 4HWSA 3STTA 2Y6UA 1NAIA 3RJ5A 1RCUA 2GR9A 1BU5A 2OV1A 2RGEA 4X71A 1ESMA 4ZCIA 4BMOB 4MCHA 4A26A 1O6BA 4IDQA 1HKUA 5DULA 4OOEA 3ZY5A 3WK6A 2JH3A 1WA5A 4TSFA 2V8OA 1ND5A 2FZVA 4XOIA 4CLRB 4L7QA 3W0FA 2L2QA 4JI7M 4HKTA 3QX7A 3TRHA 3QEJA 4BGDA 3RK4A 3PLNA 3G0DA 2BLLA 2O54A 4P4SB 4Q7EA 5CLJA 4YCNA 3Q9NA 3EWAA 3E5HA 4R01A 5EINA 3D4BA 4AS2A 2JFWA 4GI7A 2CFRA 3ML1A 5CK5A 4AIIA 3D8TA 3ICWA 4RJJA 3RIYA 2EZ4A 1YJAA 2X2EA 1BS1A 5ECWA 1XF9A 1YULA 3T7AA 2OO7A 2O19A 3U48A 3W6UA 1U3CA 2XYGA 3TSWA 1XEFA 4RF4A 3OESA 3AEQA 2Q3MA 1ZH8A 4G25A 4I5FA 2WF5A 3CNOA 4ZYLA 2OB1A 2ZJ2A 4LTMA 4HVAA 5HJ7A 1JDVA 3S40A 1GG9A 1N33B 1CLUA 5KOJA 4JBHA 4YV1A 5D87A 1L5LA 1KBZA 1FQOA 621PA 4HLCA 4TPKA 5B7QA 3GGPA 1ZA2A 3T7RA 4BCCA 5T41A 3UH1A 1E1QD 2GZDA 1Z34A 4NMLA 5JD3A 2A5LA 4ZU1X 3DWEX 1PDVA 2FN3A 3H2JA 4AQYM 2MWMA 5LWQA 3LVBA 1TVMA 1PK7A 3A9CA 1RBYA 2VSNA 2WYHA 2CHQA 3HJGA 5DBHX 3O9ZA 5IYZA 3HYLA 4J4HA 1MX5A 1QTIA 4O4IF 1XJCA 1DKLA 2QYSA 5FULA 1HNXM 2Y0QA 3BBPA 1VL8A 4IR7A 2EFHB 5ALDA 2C84A 2FSFA 3KEOA 1UMCA 2WKPA 4NU6A 4V0SA 5KNDA 1QHHB 3MWEA 1CEXA 3O03A 4NU5A 3I09A 4M99A 2IGBA 3SI7A 4F2GA 1S6YA 1EZ1A 1I1QB 3UTCA 4KAFA 3UBTA 3VNRA 4BZXA 2P5YA 1T1EA 3OJEA 1G38A 3L82B 1N5OX 4GMFA 4BNKA 3D3WB 4HUQB 4FS3A 1YIAA 5DM4A 1QDUA 3JALB 1BH6A 2E37A 1A2BA 3OFSA 2XZFA 1QZUA 1OZFA 4M0CA 2W6QA 5AVWA 4FR2A 3Q72A 2HFKA 2BEVA 4KBFA 1CUCA 3SX4A 1KKLA 1FJHA 4DUZB 4YRFA 4PYNA 1DKQA 4TMVA 3QXSA 3I0MA 5AKYA 4F5EA 3T7KA 7MHTA 2YZNA 3DDHA 2Z09A 3R76A 1Z18A 2KMLA 1ZNZA 3NEJA 3RVPA 3GGDA 2BFFA 1AK1A 2BHTA 2H4FA 4EG5A 3AERA 3DXYA 4D9FA 5KTYA 4F72A 2FPWA 5JAMA 1T15A 2HJRA 5JNRA 2JAUA 1NI4A 1FYVA 3WQRA 2O8BB 3VDXA 1SWWA 1SZJG 5DLPA 5KJEA 2BD0A 3PPIA 3R41A 3Q8LA 4HEA6 4N0PA 4J0FA 2QLTA 2R8ZA 3NXSA 3OJWA 2IXBA 2KLBA 2ZQYA 1Q6YA 3PFWO 3QYAA 3NBYC 2VK8A 3K9WA 3NT5A 1Y0BA 1N25A 2BGMA 4KFSA 4G56A 3N2ZB 2YWDA 1B1CA 3PITA 1KIMA 2JAHA 2XTJA 1JSRA 3HCEA 1SY7A 3H4VA 4CLOA 2HWUA 2VIIA 3LGAA 4PGMA 3U31A 1YHYA 1P44A 2XMRA 3AKDA 3A04A 4JEIA 5JXHA 3TCNA 3QW4B 1G41A 5EKSA 4G4RA 2VXOA 4K6GA 4K2AA 1UC9A 2H3EA 3K0AA 3A98B 3DAFA 3OFVA 3W2FA 5AJWA 1M6YA 3L7LA 2C5LA 4BGIA 5CVTA 3FTEA 3PQFA 2WU1A 4L6CA 2NSHA 2FP4A 2WTMA 2V1UA 2HH9A 3RLFA 2LHCA 4YONB 3L7IA 4Q93A 3UB4A 1X37A 2TMYA 4V2UA 1I14A 2OBFA 2J3EA 3O3MB 1QDTA 2WUEA 3F3KA 1B93A 3CA8A 3RJZA 1YASA 2E4WA 1Y6QA 5HS4A 4II2A 2DAKA 1PLKA 2MCFA 4O5AA 3LFTA 2FB9A 2ZYVX 1Z56C 5I47A 4N5DA 4NYIR 4BFTA 1DWUA 4LF5M 4H6WA 3G2NA 2BKVA 4BKQA 2LVNC 2P9TA 3GW8A 5JNVA 4UTZA 5T4EA 2O48X 1ZCZA 4UXIA 2DUNA 4J7XA 2PCJA 3TZKA 4TLLB 3GNSA 2QWXA 4OI0A 2P0EA 5ALSA 3P71T 2ZPUA 1KK3A 1R9GA 2XUQA 3DMPA 4DHEA 2RCYA 5KU1A 4JT2A 3KUUA 2JJMA 2XQVA 3HDYA 1S2NA 2WFMA 5CM2Z 4YMWA 3U6BA 2C77A 2EGUA 3UXHA 2XQGA 4CMIB 4EITA 5JMWA 4NY1A 3U4DA 3OIWA 2WTAA 3WMGA 2OHHA 2OAGA 2ZIXA 2VZEA 2NUPB 4NECA 3OIFA 1YRLA 1EE2A 4W5RA 2K4MA 2VP9A 1WZIA 4Z1OA 1CY8A 1SVUA 3CLUD 1MV5A 3CZ5A 5KYVA 1W1WA 1PK8A 4ZCTA 1I32A 4N03A 1HEIA 1U3FA 3WA7A 2XMZA 2DHRA 3HSSA 2JAOA 2YWCA 1JRLA 1W2WB 1QQBA 1P1CA 4MQEB 2AR9A 2P3OA 2YIJA 4A3VB 2ENUA 3IXMA 4I3FA 5GM2A 3X1WA 4RIHA 2PQ0A 5CLLA 1SWVA 2ZWMA 4JUIA 5LZ9A 2FPGA 3VHRA 2ZYAA 1BXRA 4MV0A 5D6OA 3ZX4A 3TF5A 1MU0A 3U1TA 3NV7A 1X8XA 1N2ZA 3RBXA 3VYUB 2O8FB 1T36A 3NGXA 1ISPA 3HGTA 3R24A 4FJ1A 4M1MA 4CQLB 3GPLA 1OI2A 3FZEA 3KUCA 2VDBB 3QYFA 4QFMA 2W7TA 4PG4A 3QOYA 4DMHA 3Q8GA 4EEXA 2YMQA 5AI9A 4IQ4A 1ISJA 4YACA 4XW2A 2PVPA 5HKLA 2W2XA 2P4HX 3TI7A 3Q7PA 1A4IA 2O0KA 3RE8A 4C7MA 3SQNA 1XMPA 3RUHA 3DUFA 1SCIA 4Y2SA 4INOA 4HNAB 4I2VA 4UHFA 1QYVA 3TRDA 3ENWA 4QHSA 5LR6A 3WS7A 3D31A 4LZJA 4NQRA 3HB4X 4MMZB 2WSBA 4MRMA 1JB9A 1RHKA 3EZLA 4IKEA 2A59A 3RS0A 4DTCA 4OHBA 4P4UA 1HE3A 2G9NA 4YRMA 4RKYA 2I4RA 1NVFA 2M32A 5KNCD 4PO1A 1OI4A 4BYGA 4O4IA 3NTLA 3FDIA 1VCNA 1Z4OA 2LIPA 1MFZA 2Q2NA 1T6OA 2YQ5A 1X9HA 5EE5B 3I51A 1P2FA 4H18A 2AE2A 1VJDA 2IA5A 5F3RA 4QAJA 1H2AS 3C74A 3PKIA 4AKHA 5K0EA 2J59A 4DXAA 4FCVA 4EPWA 3I5YA 5H9WA 3LL7A 5P8WA 5HQJA 2B21A 4D0SA 3A0UA 5FR2A 5EOVA 4RETA 3FLMA 1OX5A 3VGJA 1XMIA 4QPPA 3GIWA 8AT1A 1F51E 1LBHA 1OOEA 3RHZA 3G0IA 1E3LA 2GS9A 4N6GA 5AK3A 1P39A 5AESA 1SXJE 1W44A 1YRYE 4G23A 4EHBA 1N8NA 4Q03A 3D2LA 3K8ZA 1PR6A 5FLKA 4C3ZA 1MRNA 4FEEA 1QLWA 3N8IA 3AF6A 5GGXA 2OPFA 3HRIA 1REQA 4LBZA 7REQB 1H2RS 3DZCA 5C1BA 4LJSA 4XJSA 1E92A 1U99A 1LDBA 1DQPA 3ER8A 1N8SA 3CUVA 3VVBA 3CH4B 3I2IA 1DELA 4FDAA 5GJWC 3QOFA 3W34A 5L3SA 1TMOA 1KMCA 4DCSA 2AUTA 4HDKB 2PKXA 3VTKA 5CA0B 4NSOB 3GA5A 4G5SA 1CEEA 4I55B 3P2OA 4Q3EA 3ZVLA 4O8CA 1MAUA 1DKPA 3ZTWA 4OFXA 4P7FA 1JU3A 2B9VA 4C29A 4CEHA 1KF0A 4YMLA 1VHTA 4JLMA 3T3EA 4Y2JA 1U8EA 4PZZA 2L69A 1ML3A 4BRWA 1YR8A 5EKXA 2HBQA 4GMQA 1UWVA 4RTNA 2VZLA 2QR3A 5CURA 5H3CA 4AJPA 1N5DA 4NNOA 1I3OA 4X00A 1HNWM 3QEKA 5IKXA 2R48A 4TXHA 5BWBA 2I1WA 3NHLA 4GIPA 1OFGA 4D7AA 5ESXA 3WYAA 1GZ3A 1QZEA 1M8JA 4BZPA 4FJ2A 4F1JA 2MOKA 1LRLA 2FZLA 5F7JA 2DUWA 1B26A 4KIUA 4NU8X 4WBSA 5JJCA 3INTA 1JF8A 3SWWA 2NU7B 1KQGA 3NXKA 3VKFA 1COZA 1DJLA 3SG0A 4FWBA 4P80A 2E1RA 2BCEA 1IG3A 3K70C 3I76A 1CQPA 1C80A 2CNWD 1DQRA 3COSA 5FOVA 2ADOA 4QXPA 1HDRA 3UK0A 3G02A 3BX1A 4BNVA 2ATCA 4AZTA 2O6LA 2FQWA 3FKQA 3ICQB 1UT8A 5BN5B 1HBJA 3E22A 1VIAA 5FNZA 1JN0A 4G3XA 4DR1M 4F1KA 2F8TA 4FYVA 2DFLA 3DD1A 5AK6A 2JHAA 1KS2A 4QASA 5ELMA 2ZBRA 3QX9A 4OBWA 4US2R 4FSXA 3KJZA 3BIXA 2EEZA 1AUAA 3GQ4A 4ER5A 4FUTA 4HGYA 4IF4A 2WIJA 4HNHA 3TIXB 5BURA 1GN8A 4KWEA 4ABTA 2HRCA 2XAAA 2QRNA 2W6ZA 3ZKWA 3DDZX 1YU9A 1X42A 4JYCA 3H84A 3C3DA 3NYRA 1NF2A 2QORA 3TTXA 3UHAA 2IODA 1E9EA 1VLLA 4K9OA 3NPAA 5IUKC 4WOBA 2HYDA 1SCJA 1TQHA 1CR6A 3W8DA 2VF2A 1TW3A 4KO2S 2QTBA 4OA5A 4DCCA 5AI4A 4XSVA 1H2ZA 4X7BA 4RPGA 3IH5A 3EZFA 3LRTA 4N6NA 3MMNA 3PQDA 5JYDA 4OMCA 3MHPA 1I0LA 4KIFA 1PZNA 1AGRA 4DV0B 4ITQA 3TTWA 3G79A 1G5FA 5H81A 4L5JA 2GFQA 3K9CA 1YQ9A 4J0EA 1Q2XA 5LWHA 4D97A 3NTUA 3A7EA 1MXFA 4IX1A 5F1OA 2ZSJA 1J8QA 3GOQA 4KBYA 2BFMA 3DLHA 4R05A 2R5NA 5J2TF 1WSAA 1WW8A 3COJA 2PANA 2ZBFA 4U2DA 4JA0A 1WY7A 5HMLA 1T0BA 2XDQB 4EFNA 2HQOA 3OJFA 4QYXA 4GFDA 1E3QA 2Z3XA 2RH9B 4ZRNA 2YV2A 1Z6ZA 3RYHA 3I2GA 4UULA 3QIAA 3ELDA 2OOSA 3RI3A 2BP7A 4I1VA 4UQOA 4BB0A 3QFSA 3DFUA 2A3RA 4IUDS 1J56A 3DBRB 5CG2A 1ZW6A 2A9RA 4J07A 5A2GA 2EWMA 4IQGA 4JZYA 4OQZA 2I6TA 1WXQA 5TMPA 3ETGA 1F2DA 2XHZA 4XWWA 5TSDA 1Y80A 4Q34A 4JB0A 2C92A 3LFHA 4XYEA 3OE5A 5FOTA 2VSOA 1OAOC 4YP0A 4REZA 3PE3A 4B8WA 1X7DA 3UQYS 2L42A 2PGJA 4MKIA 5E6RA 2RGXA 2ZJ0A 1FFDA 3SEAA 3H17A 3HXQA 4YVFA 3SHOA 3AHEA 1YQQA 4UEJA 1Q20A 5F2OA 3L8MA 1ZWKA 3GEEA 3GEBA 3L2AA 3P9ZA 1VFNA 1YJ8A 2J9ZB 4XJVA 1C0EA 3P19A 1NJ2A 5FLYA 4JDUA 4HAVA 1CVLA 1RD4A 3IR6A 1EUZA 4B3TB 1RRKA 1NVTA 3FWNA 3I4YA 2OP1A 2FVYA 3MTEA 2QTCA 5I5GA 4C3OB 1KE1A 4YWJA 1WIVA 1WEHA 5CITA 1QVZA 2ZKIA 1BKYA 4PAWA 8LDHA 1G21E 2GBIA 4C7OA 5A9SB 3A1NA 1FJGB 2VF8A 3V1MA 2G80A 1KI1A 3PP8A 4G3OA 4JY7A 1PQUA 2IT1A 4HLQA 1SHZA 1QHFA 3SYTA 2Q1UA 1EWYA 1XROA 1GPMA 4FNAA 3HKEB 1SCKA 3RYTC 3JU3A 3OX4A 1I10A 3MRTA 3TOZA 1IRIA 4ILKA 1DRUA 3WAJA 2WIAA 2JEOA 4AZVA 1H05A 4LJLA 1UDBA 3VAYA 2RIPA 2DBZA 2EKZA 2P9FA 3AKCA 2V0NA 1THGA 5JHHB 3KFVA 4N18A 5JZ9A 4L0CA 1EVQA 1ZJJA 2X4LA 1NKTA 3OBIA 1Y8RB 1QS0B 4JOSA 1YDHA 2QM7A 1GNPA 1VLHA 4P83A 3FF1A 5LQSA 3T3NA 2GBPA 3NS7A 3L4EA 3DKIA 3AZOA 5DDIP 1KYVA 2DFNA 1ESCA 4O5OA 3HA3A 2R8YA 2REQB 3H18A 3FFBA 1CRLA 4C5BA 2D1FA 3QVGB 3ZR4B 3PDIB 2A0UA 5DLQC 4B4DA 3O8RA 1VGVA 3UW3A 1HDIA 3CLTC 3GEPA 2CE7A 1R0RE 2RARA 4MPRA 1E0KA 1Q84A 3W9YA 3RVDA 5C4MA 5DCLA 4MJLA 1JEJA 4KJZA 3AETA 1ODKA 4GR4A 1N5RA 2EDAA 4X1OA 1Q12A 2Q9CA 4TTRA 3KZXA 3PUYA 2D3WA 1QJ4A 3PGLA 4LWZA 3RU9A 1I94B 3KB8A 4ZK6A 2WE7A 2RGOA 2TECE 1WXXA 4YR7A 3B5EA 3EVDA 4JLWA 5KNCA 1OXBB 3SKYA 1EWQA 3KVVA 3N0TA 1W4AA 4RZXA 4ZCRA 3JQAB 2CJXA 3VDQA 2PZGA 4TVSA 3UCEA 3DHNA 1UM9B 3E8SA 1L7NA 4IKOA 5HJ2A 1RYHA 1ZJ4A 4KNYA 3PRJA 4KSCA 3NIDB 3K9NA 2XDWA 3PXCX 5IM4A 1E1MA 3RWOA 1ZNXA 3H9UA 2WTBA 2O2YA 5AJYA 3K0CC 1EVKA 3LBAA 1EEHA 3RSFA 4CI9A 3CUSA 1L5MA 1WUKS 3QHQA 2WJ4A 4F4FA 1VBMA 3OPYA 4KQHA 1M3SA 4UBLA 2H4HA 1SXJC 3VLFB 2QN9A 2QSJA 4Z99A 3DOEA 1V25A 3K2EA 1RFGE 2G0TA 1E2KA 3ZXYA 5EZSA 1X6VA 4Y9TA 5KQDA 5JCOA 3ZE7A 1P5HA 10MHA 2EYQA 3TLBA 2ZRAA 3MJCA 2AZXA 4J7AA 2MMGA 1WV1A 3FDZB 5ESWA 1Z47A 1W52X 5MGNA 1SH7A 3DA8A 5HK9A 1J00A 1EX7A 2WOJA 1NV8A 4DEYA 4U0KA 3AHHA 4WCFC 4OUKX 3SJZA 2MT9A 4GX5A 5LIRA 3GFBA 3RG8A 2OKCA 4MB7A 4MPPA 5KYUA 3U9TA 5AIAA 1M6NA 2BI8A 3EOAI 3Q88A 3RGPA 4G4SP 2O7NA 5DTMA 1SOUA 4Q9JA 3CSSA 3H3XA 3FIUA 4H7PA 3RC2A 1G2PA 1EJ0A 1YS6A 4G65A 4Z7NB 3WHLA 2FETA 4AULA 4R8KA 2GZAA 3PENA 3GJ5A 1ZC4A 4ZYYA 3MCWA 2FOIC 2REBA 2CJWB 5FP0A 3M6LA 3KAQA 3TBKA 4CF7A 2EFGA 1Z6XA 4KFCA 1A5TA 3E4RA 1EWVA 4AAYA 2OHIA 3A6PC 2UYYA 4P38A 3WGKA 3FW1A 1MCZA 1NA5A 1OFVA 2Z1DA 4Y6PA 4DZTA 4ZAYA 4RXTA 2CNWA 5KAMA 3A2MA 3I62A 4H3VA 1BDHA 2LVPC 4B4KA 5TEWA 1XZHA 4JI2M 1X1TA 3LY7A 3WIUA 4RD0A 4F85A 4WJLA 4A1FA 3HK2A 5DM70 2BEUB 1XHEA 3CH6A 4GOJA 3RS4A 1FP1D 3NRBA 2UZ3A 1JXAA 3DV0A 5AW2A 4WOCA 3SNKA 2OXFA 1VG8A 1XZLA 3BGSA 3GH1A 1LI7A 1G4UR 3LUPA 1L4NA 4UFOA 1R5BA 3F90A 3VK7A 3D6NB 4KC0A 2GK4A 1NBWB 4BEBA 2EX4A 2OFWA 1CWUA 1U6KA 2RI1A 4QBFA 2GXQA 4V1CA 2VDVE 1SCBA 1X15A 1T6ZA 3DEHA 4OU5A 5K7SA 1TJYA 1M1ZA 1VI6A 2HW8A 3MNFA 4L16A 3CSDA 2XYVA 1SC4A 3RIGA 1BMFA 5ESRA 1HQCA 2WMDA 4GI2A 3DE3X 1RCFA 2HTFA 2YOGA 2JKVA 4JR2A 3LWBA 4QDKA 3E7WA 3W3AH 4I4CA 1SKQA 1ODIA 3MJTA 4QICA 1V33A 4G36A 3LSTA 1JIUA 3HB9A 2IE8A 3T7JA 2P78A 3WK7A 4Q3NA 3IEIA 1SAYA 3PNYA 4ANFA 1LVGA 1WCIA 4QOFA 1C3OB 5CH5A 1CRQA 2HWXA 4HATA 4R8MA 1QMPA 2ZXEA 4N0MA 1P91A 1T35A 3L1HA 5NLLA 4R54A 1WNTA 2QAIA 2IYLD 3L40A 3AJRA 1DEXA 2P2LA 2ZJ5A 4GKJM 1RM5A 1JWBB 1N1MA 3T34A 3IPLA 3BH0A 2Q5HA 1AKQA 3FE3A 4XPIB 2ZRGA 1TC2A 1UFZA 2UZ0A 1G7CA 1P5FA 1VG5A 1W36B 1XVTA 3WDMA 4DADA 4Q3DA 1S2GA 3ZHUA 5CBPB 4AMBA 3IJ5A 2RGNC 2I2AA 2PVSA 3PQ6A 3A28A 2B4KA 4KPUB 4NOOB 1QNLA 4U2GA 1Z5UA 4EFMA 1TCBA 2JLWA 1NVVQ 1EGQA 4OMFG 1V8ZA 3UAGA 1CKEA 3C6KA 2JK0A 3KS8A 3MUOA 2CMGA 5H8WA 5L7TA 5TF4A 4XE5A 4AZSA 2AD5A 2PUWA 5KSZA 1J2TA 1LDNA 4QYMA 3HTXA 3R5KA 5TQ2A 1XMSA 2IX9A 4GLFA 4E7OA 3OBBA 4L8YA 5TGDA 3KKQA 4HZUB 1JEAA 3KJNA 3LQKA 2XQIA 5REQB 3TE6A 2J5XA 1X1EA 2QRHA 2PSFA 521PA 3GRYA 4CMCA 4HNUA 3SIWA 3F3YA 1JSZA 1TVCA 2EKQA 4Z4FA 1O4VA 1K8QA 4EARA 2O6HA 4TLEA 1RABA 4XLLA 4W5TA 4I3HA 4R31A 2XUPA 1AQNA 1HI9A 3HP7A 2QM8A 5HHTA 4PX5A 1U11A 2O2ZA 4ED9A 2B5OA 2FFQA 1GXSA 3PG5A 2RAUA 4ZOCA 2LV8A 5DNUA 4JLUA 1NXOA 3AB7A 4RF2A 4ZVOA 3Q4GA 5HKBA 4I6JA 3GGGA 3QYEA 4ODIA 3GNTA 4MV7A 2QAGA 2HV9A 1U0EA 4JOCA 1DX9A 3RVRA 5M04A 3JY6A 1OTHA 2PMWB 5JG7A 5FXMA 2QX4A 3DBIA 2C3PA 4GPIB 4K8RB 4WPGA 1N3LA 2V98A 3AVYA 2H1OA 4R68A 3MQFA 1Y3DE 3ND5A 2AJBA 4G5RA 3NFRA 3JQ8B 5FTMA 2QP9X 2ZJ7A 3H9GA 4XD7D 3KKEA 4N5HX 1I4WA 1DFIA 1PP4A 1C5KA 1QGZA 4J2OA 2VEDA 1NNUA 4XIYA 2IY8A 2G40A 3FBTA 2C7RA 3OEWA 4D74A 1WZ2A 2R44A 2PDAA 2C9ZA 4CM4A 4LSZA 3T6KA 4ARUA 4MS4B 2ZYWX 4LDAA 2JI9A 4X90A 1E2FA 2D1SA 2EZUA 2OLJA 2YJGA 2ZSIA 2I8CA 1JS1X 4I4TF 1ULTA 1K7XB 3A6ZA 4F3TA 3DAHA 4YMHA 3WFJA 3GCZA 3H83A 5FUQA 1BEEA 5FPSA 1BD3A 1KMIY 3ADDA 4NARA 3U4QA 1T6BY 2NMVA 2HADA 2VF5X 1RZRA 3T5AA 4IDPA 4S24A 3C5WP 2QOEA 1S2DA 1ZVVA 3HO8A 5J5CA 5JVDB 2SKDA 3GJYA 4D3SA 5HIJA 4FFWA 2O3SA 3GY0A 1L6IA 2OEPA 3MD9A 3HM9A 1DZ3A 1TE2A 2F5NA 5JADA 3TM4A 3VSCA 3PXAA 4U7WA 2IV2X 1R6BX 4IIWA 3RRFA 3A0RB 4B3RB 2Z5FA 3VU0A 1KZ6A 4MVJD 2BFWA 3QI2A 2FEXA 4C6TB 4QPDA 5AKIA 2QQ5A 3PGVA 1ITZA 5HQ3B 2RJNA 3DMRA 2I4MA 3AFOA 3FI9A 4W1QA 3FUCA 2HBZA 2EL9A 2MSKA 2B6NA 3LQ2A 1MEEA 4F84A 1VSQA 4GR9A 2VS1A 3HBAA 1C4XA 3C3MA 1P1JA 2V6JA 2PO7A 3IO5A 3E46A 4BP8A 5A4JA 2FWNA 5AW7A 1X86B 4V0ME 4FYPA 2DPLA 1L3BA 1O0CA 2D5IA 3SR4A 3ABOB 4F2WA 2YVQA 1ECLA 2CLIB 4TTVA 4OAPA 4PT5A 4CKXA 1J2JA 3IC5A 4P3OA 5J23A 1E2PA 1GAJA 3IECA 4FONA 5TDHA 4K9MA 3V4VB 3KX2A 3EMBA 3BG5A 3NBKA 2QMOA 4I4NA 1R8YA 4CL2A 1JJFA 2VT6A 4BQNA 4YUWA 3KVRA 3O0TA 4RZHA 1DEOA 4NCAA 1BVYF 3ZWCA 4A5SA 3S7TA 4Q3AA 4DIEA 2H48A 3BZUA 3KJXA 4WZAB 4PLGA 5KQ8A 3U44B 3I4FA 1QVAA 1F3LA 3HBMA 4IQFA 1FFWA 1U3GA 4WY2A 2YZMA 2B8JA 3Q15C 2BF4A 5AK5A 1JZQA 4MW9A 1Q0ZA 4KMRA 2GPAA 5IUJC 2Z6AA 3FTNA 2WIDA 3SDBA 2AQKA 3KOOA 1BO6A 2B8NA 4WNIA 3M9LA 5DMHA 1P9LA 3COZA 2GN1A 2C3UA 4P7KA 3CRQA 3GCWA 5TMDA 1YQWA 4O29A 2YWBA 2N1BA 5LBUA 2FUNB 1NX6A 2NV6A 3H2ZA 3CHYA 1H65A 2V9PA 5EJ7A 5AO9A 3SOPA 2H2AA 4I6GA 5C5CA 1E6MA 1KOLA 4MR8A 3PGJA 3M7GA 4MVJF 1WAMA 4P3XA 4BZWA 4GECA 3HFJA 2YBEA 1MBZA 4HJRA 2G4CA 1X2EA 4IO0A 3C7AA 1T10A 1P3QQ 3VTAA 3EJWA 4TV9B 4MI6A 1TT5A 2H18A 1C7JA 4R2JA 1FFXB 2HLPA 4E5UA 1EFKA 1OILA 4JBNA 1E3SA 2OHJA 3WMXA 5INTA 1QPBA 1U0OC 3GBSA 1EFHA 2IBMA 4Z4HA 1JZTA 3KNZA 4K9KA 5BQ3A 1KKUA 4C0SA 2DU8A 5IC4A 2ZRBA 3EAFA 3BJIC 1CUSA 2V6GA 3IEUA 1R4ZA 5TNXA 1ZXXA 4OLFA 3QXGA 4DR5B 2DC1A 4BS9A 2BGLA 4OHYA 1L5VA 4DN6A 4DMGA 2E5LB 3EIEA 2I34A 4NESA 1G1MA 2X9QA 1V6AA 3U17A 4ER0A 3IYLW 2Z4TA 1QZ3A 1QQAA 5JXJA 1O5IA 1TCVA 4YCDA 1SR8A 2HUNA 4LECA 3ZWKA 4NXNB 1CUFA 1ML4A 4KODA 4HNRA 3K1ZA 3D6HA 4CHTB 4C0QC 1MVLA 2CFTA 4CQNA 1T5HX 5ALGA 3EA0A 4BLPA 1J2UA 3VM6A 3E4DA 4AKGA 5I8ZA 4F92B 3R2JA 1I4EB 1X7WB 4CM6A 3T5TA 2WWVD 3ER9A 2ZFUA 3ZWAA 2AOWA 2D2IA 3RU3A 3C85A 4FDMA 5C8XA 2UUCM 2G28A 2W58A 2ZB7A 3A4MA 1X1QA 2DM6A 3PC6A 4GLLA 4OKIA 1VHLA 4MYTA 1YJBA 3U1BA 2ABWA 3HACA 5BW8A 1V47A 4MKGA 2JFNA 1KMMA 3ROXA 2IXFA 3DDCA 4JX9A 1G7SA 1P7WA 2UXCB 1GJTA 3HKCA 3I8OA 4NYJQ 3U7HB 2P7HA 3MMPA 4DCJA 4JOQA 3HXLA 1S2OA 3DZIA 2PTHA 3PNPA 3SAJA 1CCWA 3DP7A 2RHBA 2RBEA 4I3GA 2Z30A 2W2MA 3KSUA 1N6NA 2QSFX 4WKPA 3RFVA 3HMKA 1VIDA 2P5UA 4D44A 3BTOA 4ZOLF 4NR0A 3TZBA 3TLEA 3PIIA 3UK7A 1VKJA 2Y9PB 3L0YA 1JFSA 2IU4A 1ZD3A 3J81k 3V7WA 1PL7A 2XVAA 4DCNA 1I4DD 1T4MA 3MWDA 5I7VA 5AVRA 1JFFA 3U4CA 4F4DA 3CGGA 1AF7A 2R6HA 3AKZA 5EXDA 1CW2B 4IWXA 4L6AA 1J5PA 1G3MA 5HFJA 1HKHA 1LLQA 4FDLA 1U2DC