4GC9A

Crystal structure of murine tfb1m in complex with sam
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
318
structure length
317
Chain Sequence
b'FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase 1, mitochondrial
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 93
structure length 317
sequence length 318
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc9A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc9A01
3QOXA 3FUXA 1KR5A 2VS1A 4BP3A 4EMSA 5LR6A 3A25A 2I6GA 5EEHA 1QAQA 1JQ3A 1MJFA 3NMUF 5DSXA 4ER6A 2ONYA 5EKXA 5ERGB 1G55A 2FRXA 3UJ9A 1YZ3A 2PLWA 4RTPA 4PIPA 4OA5A 4E2WA 3UJDA 1X1DA 3GCZA 3OPNA 1G60A 5GIPE 1B42A 4FZVA 2YUIA 1TPYA 3HP7A 3V97A 3OCJA 3EEYA 5BW4A 3B89A 2PY6A 5K01A 1R18A 3PLAE 3R9XB 2P1DA 4GOMD 5EG5A 4M38A 2NYUA 2YXEA 3LKZA 4PCLA 2ZW9A 4LECA 2NXNA 4MTLA 3FPGA 2IBSA 4G56A 3DH0A 3HEMA 5LQCA 4QTUB 5GIOE 3DULA 3P2IA 3HVHA 4LG1A 4F85A 2ZZNA 3EVDA 3OE5A 4DM3A 2NXEA 3NTVA 3HVKA 2OXTA 1M0EA 1X1AA 3E8SA 2V74B 4DQ0A 2PGXA 3DMGA 4KRGA 1FP2A 4HGZA 3NWEA 1AF7A 3GRZA 2ZWAA 4IWNA 2YQZA 4POOA 4PYOA 5DM1A 3FRHA 2BR4A 3TLJA 3JWJA 4HSGA 5CCXA 3HA7A 1UFKA 2AOXA 2QRVB 5FWAA 3UA4A 5K0NA 1SUIA 3RW9A 5GM2A 4V0RA 5E9QA 5LQNA 3I53A 4PYQA 3LDGA 1HMYA 5E1MA 3QOWA 3G2PA 4ER3A 1P1CA 1NW3A 3G2MA 3PB3A 2ZIFA 3KPVA 4EQZA 3UJBA 1EIZA 3PTAA 4RTSA 2AZTA 1RI1A 1N7JA 1XCLA 1NV9A 1BKYA 2BR3A 3CKKA 2VZ9A 4PYLA 5E1DA 5BW5A 1R74A 5DPMA 1N2XA 3KPYA 2BM9A 4IV0A 3GRYA 2FHPA 3EGEA 3OZSA 2HNKA 4IV8A 5ICFA 4A6EA 3TFWA 4X61A 4GC9A 3P9IA 3HTXA 3Q87B 4KIFA 4QVGA 3EVGA 4RVFA 3G7UA 1JG1A 4X41A 2DPMA 5K0GA 4K6MA 4QVKA 3D2LA 4OQDA 1D2GA 4GF5A 4Y30A 5BXYA 2AOTB 2OZVA 2C7OA 4BLVA 4RYLA 4WXHA 2IDKA 2UYHA 1Y8CA 1G38A 2QE6A 3KQPA 4KW7A 4RVGA 4HGYA 4X60A 5B1SA 2YXLA 4C04A 2AN3A 4DZRA 2NP6A 2AS0A 3OZTA 5U4XA 4MQ4A 2G1PA 2IBTA 2CKDA 3P9NA 4MIKA 5IKMA 2JHCA 1YFLA 3HCBA 4PYIA 3KQVA 4XUEA 2ESRA 1WXXA 5E8JA 4DCGA 3F4KA 4QTTB 5EMLA 4P7JA 3V8VA 3FTFA 1I1NA 1JR4A 1KP9A 2PX2A 3M6UA 3MAGA 5GM1A 2G8NA 4AZVA 1JG3A 2UYCA 5CVVA 3GRUA 3E23A 4FR0A 1R8YA 2GPYA 3KQWA 2JH8A 3DLIA 3UJ8A 5EC8A 3VC2A 3GJYA 5IH3A 2BZGA 5BP7A 3CGGA 3PX2A 5EZSA 2XYRA 2YR0A 4U7PB 2P7HA 2AVDA 2IPXA 2P7IA 1M6EX 4HG2A 2CMHA 5DLYA 1DCTA 1RI5A 3EVBA 3FUTA 1KYZA 1NW5A 2WA2A 3FYDA 3JWHA 4E33A 5HZMA 3KQOA 2P3OA 3L8DA 1BHJA 1XVAA 3FPFA 3BGDA 4YMGA 5DSTA 3ER9A 3FTEA 3DXXA 2PKWA 3GGDA 2Y1WA 3NVMB 4UOEA 1RI3A 1R00A 1XDSA 5CUQA 3MTEA 4GEKA 2XYQA 5FHQA 1KPIA 5K0EA 1RJFA 3PVCA 2G71A 4RWZA 3GNLA 3E7PA 3BT7A 1MHTA 3NDJA 1X1BA 3GXOA 5DM0A 4PINA 4KDCA 4QPPA 3RIEA 3C6MA 3S68A 3P71T 2O07A 2E5WA 5DX0A 4GBED 3I5UA 4FSXA 4QDJA 2A14A 1O9HA 4RVHA 5HOQA 2EX4A 2IDJA 1L3CA 3OZRA 4CTJA 4KDRA 3I9FA 2P3QA 1KPGA 5KYGA 1H1DA 4A6DA 3HVJA 2GA9A 4HC4A 4KWCA 4P58A 3BKXA 3HM2A 3TPZA 1WY7A 2AOUA 3DTNA 5EIWA 1O54A 5F2NA 2C7QA 2ERCA 1ZG3A 2QM3A 3EGVA 2Z6QA 3MTIA 5GINE 2PBFA 3K6RA 10MHA 4AZWA 2YTZA 2VDVE 3BKWA 4R05A 2WA1A 2LD4A 4YV1A 2UYOA 3R3HA 1L3BA 1RI4A 4GQBA 3SSMA 3TM4A 4YUWA 2OO3A 2PV0A 3MCTA 3ELYA 3A27A 3C0KA 4AUKA 1SKMA 4E30A 2AOVA 1VBFA 3UJ7A 3TMAA 3I64A 4RTRA 1VLMA 3DOUA 5HIMA 5LSAA 3AXSA 3PT9A 2UZ4A 3KU1A 1EQAA 2OKCA 4DMGA 4ER7A 3ER8A 2IFTA 4GC5A 2I62A 2VP3A 3M6VA 1G8AA 1RJEA 1YUBA 2BR5A 5C9ZA 5LQJA 3AJDA 4R6XA 3IV6A 4EVIA 5KQSA 3JWGA 2VDUE 4ER5A 2Y1XA 3UFBA 4KIGA 2YX1A 4CKBA 1AQIA 3KQTA 1X19A 1TW2A 5E1BA 3SX0A 3CJRA 3TM5A 1AQJA 3M33A 2EFJA 4XUDA 5DRYA 1RJDA 1ORHA 3K0BA 3P97A 2JJQA 2PXCA 1DUSA 5FULA 1ZKDA 2JG3A 4MHTA 4EKGA 3O7WA 2PWPA 3C3PA 2ORED 1IXKA 1NW8A 1XDZA 2YXDA 3EGIA 4FT4A 5HILA 2NXCA 3IYLW 2ZFUA 4P7KA 4QDKA 4M7RA 3B7PA 4U7TB 2P8JA 3EMBA 4P7GA 3KQMA 3PS9A 4LWPA 1WG8A 2I7CA 1XXLA 4Z2YA 4E31A 2OB2A 3UJAA 5DXAA 5DX8A 4QPNA 1VE3A 1JTEA 5FTWA 2PVCA 3ORHA 3T7SA 2DULA 4FP9A 2AR0A 4BLWA 3MQ2A 3FYCA 5DM2A 3KPUA 2P40A 5EPEA 4E2XA 1F3LA 4FSDA 3ERCA 3T7RA 1FJXA 2Z6AA 3R0QA 2O05A 4NECA 4RTMA 2B25A 2O06A 4OQEA 3FZGA 5T6BA 3E05A 4HH4A 1XCJA 3B5IA 3CBGA 3EVEA 3CJQA 3P2EA 2AN4A 2FYTA 3VC1A 2FPOA 3EVFA 4RTNA 3UWPA 4AZSA 3NVKI 2Q41A 5C1IA 4E2YA 2PX5A 3LECA 5P8WA 2O57A 5D1NA 3SXJA 3C3YA 3BWCA 4FS8A 5EEGA 1RI2A 2KW5A 3GDHA 4XCXA 3UJ6A 1VP3A 3CCFA 4AZTA 1VP9A 1SUSA 4GUAA 5K0CA 2O0LA 3DXYA 1O9GA 3KR2A 1ZQ9A 2WK1A 3RODA 1IY9A 1UIRA 1Z3CA 3BUSA 3SGLA 2QRVA 3P9CA 5FWDA 5KVAA 2BH2A 2ZLBA 1N7IA 1QZZA 3BWMA 2B9EA 3LX6A 2NXJA 5EKUA 2HTEA 3TR6A 2ZBRA 2IH2A 1PRYA 5DTMA 5G02A 2R3SA 2ONZA 1OR8A 4PYNA 3B3FA 3DR5A 1SQFA 3BZBA 3OU7A 4GOND 5GP1A 5E2BA 3O4FA 3DMFA 3KKZA 5FA8A 1FPQA 1YZHA 3KR1A 4QQKA 3TRKA 3UJCA 3FTCA 1FBNA 2P3LA 3MB5A 2OPBA 1EJ6A 3LDUA 2H1RA 4BLUA 3FPEA 3HCCA 5K8VA 2R6ZA 1NW6A 1SG9A 3A7EA 3DLCA 4C05A 3EPPA 3KPJA 5H02A 3ID6C 5FQNA 1BOOA 4ER0A 4IKPA 3ANXA 5EZQA 4C03A 4RTLA 1KXZA 2ZULA 3VYWA 2B3TA 3R6TA 2BM8A 5FUBA 3GIWA 1NKVA 2ZIGA 2XVAA 3AY0A 2F8LA 3G5LA 5F2KA 3SR4A 1NBIA 3LCVB 3ELUA 5EMJA 3T0IA 2OY0A 4RTOA 2AOTA 5LQRA 5CVDA 3CC8A 5EHIA 7MHTA 5HIIA 1JQEA 1G8SA 2EJUA 5KS2A 4OBXA 3VSEA 4PYKA 3SVZA 4PGHA 5K05A 2GAFA 5K03A 2OB1A 3G8AA 3PFGA 5EIFA 2JHAA 2B78A 3SSOA 5LQKA 5CIYA 2ZZMA 1VL5A 3GU3A 5DTRA 4ZTBA 3MGGA 3P2KA 5CVJA 2N47A 3M6XA 2FCAA 2ZIEA 1KPHA 3MERA 2XYVA 3SM3A 3I58A 1M6YA 3JWIA 3KQSA 2H11A 3ELWA 3NJRA 3GRRA 1NT2A 1HNNA 5DXJA 1EJ0A 3OFKA 2XBMA 1NE2A 2EG5A 2HMYB 3KQQA 4C08A 5ICGA 3OU6A 3LBYA 3DXZA 2HWKA 4X1OA 1VQ1A 3C6KA 3EEOA 1NW7A 4BP1A 1Q0SA 5E9JA 2IIPA 3AXTA 4V0QA 3HNRA 3HVIA 3A26A 5D1HA 2ZVJA 2ZBPA 3BWBA 2HR1A 4RSRA 4HTFA 4RX1A 4Y2HA 2Z6UA 2ZCJA 2GS9A 2JHPA 4EK9A 2ZWVA 4M36A 4CKCA 5DTQA 3NW9A 4RTJA 3REOA 4E32A 4PYMA 1JTFA 4E70A 5EQJB 1U2ZA 4WVLA 5FHRA 2CL5A 1D2HA 2PXXA 3O31A 5F2OA 1BC5A 5E1OA 3G5TA 5JUWA 1ZGJA 1INLA 2XVMA 1L3IA 5CCBA 1R8XA 2G72A 5EGSA 5CVUA 3FTDA 2B2CA 2UYQA 1P39A 3G2QA 3HCEA 1JSZA 3KPWA 5EVJA 5M5BA 2G70A 3BWYA 4P7FA 4X63A 5EOVA 2OYRA 3KHKA 1XDUA 4DKJA 4DA4A 3LCUA 4BY9E 1UWVA 5DX1A 3LSTA 1SQGA 4F86A 1JQDA 4E2ZA 5LQAA 2OBFA 5FADA 1QANA 1F38A 3BGVA 3HA3A 1JG4A 1XTPA 3EVZA 3LCCA 3R24A 5E2AA 5E8RA 2IH5A 1YB2A 2C7RA 3MCZA 5ICCA 3THRA 4OX9Y 4YV0A 5FCDA 4JXJA 3KQYA 2NNWB 3IHTA 3NWBA 4GOOD 3P9KA 4O29A 1P91A 5T67A 3ME5A 4PYJA 4FT2A 4KVZA 4M37A 1QAMA 3HCFA 3SSNA 2ZBQA 3LDFA 1NBHA 2P35A 1X1CA 4CKEA 4YUYA 5DT2A 5K0JA 1V39A 2FK7A 2C7PA 2PJDA 1L9KA 4GOLD 1P1BA 2PSSA 1ZGAA 1VIDA 4YMHA 3EVCA 3HCAA 1G6Q1 5C0OE 5GOZA 1PJZA 3ELDA 1JG2A 3EVAA 3G89A 3HA5A 3LKDA 2K4MA 4ISCA 3QV2A 3NDIA 4B17A 4RTKA 3DUWA 2GLUA 3FPJA 3PX3A 4CTKA 3AWIA 3M70A 3UA3A 2HV9A 3SMQA 4C4AA 1Q0TA 1EG2A 5EHGA 4AX8A 2ZSUA 1DL5A 2QYOA 3DP7A 3KR9A 4XUCA 2PT9A 2YVLA 3LPMA 4PONA 4R8SA 4ATNA 9MHTA 4CXMA 1RJGA 5CD1A 1IM8A 2PXAA 2ZZKA 2CMGA 2PX8A 3M6WA 5DM4A 3H2BA 3GRVA 1TW3A 3P8ZA 5FA5A 3CJTA 3G2OA 3THSA 4PNEA 1WXWA 4RV9A 2AOUB 3EMDA 3BGIA 5CVEA 1XJ5A 3TKAA 4F84A 3MHTA 1VPTA 5K0LA 1ORIA 4OA8A 1D2CA 2JH9A 1QYRA 2PT6A 4PWYA 5GWXA 3T7TA 3LGAA 5JR3A 3UBTA 3OU2A 2IH4A 1KIAA 4RVDA 5LQUA 3CVOA 1ZHFA 1NV8A 4CWAA 1WS6A 3DMHA 2GB4A 4R6WA 3KR0A 3X0DA 2CWWA 3B3GA 3IEIA 3LHDA 2ADMA 3FUVA 1WZNA 2NP7A 4YUZA 3FPHA 4HRAA 3HCDA 3BXOA 2I9KA 2GH1A 5KQRA 3LL7A 5MHTA 3FUUA 1KHHA 5ICEA 4HTFB 4L7VA 5K09A 8MHTA 4RTQA 1L1EA 2PWYA 4R8RA 1I4WA 2EJTA 3TKYA 5EMMA 2V7EA 5DWQA 5HIJA 1JSXA 4PIMA 4DCMA 3UZUA 5DRTA 4LWOA 3LBFA 1SVUA 1FP1D 3OFJA 2PX4A 2FK8A 1I9GA 3WSTA 1QAOA 2VDWA 3A4TA 4OBWA 4PGGA 4YV2A 5HEKA 3TOSA 5E9WA 4YUXA 4DF3A 3TQSA 2AN5A 3FRIA 2IGTA 4QQNA 1YF3A 4FGZA 2ZTHA 2QY6A 3PFHA 5HFJA 3GWZA 1R6AA 5T64A 1EAMA 2AOWA 5EMKA 3GO4A 3OE4A 3G88A 4EKIA 2IP2A 3G8BA 3A7DA 1KYWA 3M4XA 5FQOA 4H0NA 1T43A 4PCAA 1AV6A 5CM2Z 2H00A 1YFJA 3U81A 5K0FA 3FUWA 3B3JA 5K0BA 4C07A 2AVNA 2P41A 4MWZA 4C06A 4YUVA 5HIKA 3Q7EA
chains in the Genus database with same CATH superfamily
5CDGA 1SEPA 4O1HA 2PA3A 3HRHA 4UU8A 3EXEB 3NBZC 4KHPM 1UDXA 2PH5A 2HQ1A 1PFVA 2ZATA 1UJCA 4HDCA 3K71B 3V55A 1SXJA 5IEJA 1QH0A 2JHFA 4K86A 1OYVA 1SD2A 4KRGA 4O08A 1FP2A 1AS0A 3EG9A 2AN9A 5JEEA 3MCAA 3AFHA 1D6JA 5D3MB 1JLHA 3MGBA 1X7YB 4L6IA 2ZR8A 4FHDA 1M8JA 3KWLA 2ZTMA 3N5CA 1V8PA 4KXXA 3GA5A 2OWEA 4DQXA 1FSFA 2P5UA 1QDUA 2ORYA 5IT9S 4JQYA 2YJGA 1HMPA 4AFNA 3N8KA 4LAFA 2CNOA 3SVTA 4ITQA 1J8FA 2Q2NA 4MYDA 4YRBA 4WH0A 4HEHA 3UWKA 3PXXA 3W4IA 2QLTA 1NZJA 3DAHA 1C1XB 3E9ZA 3LT5A 3EQ8A 1QVVA 2D2EA 1J0DA 3IUJA 5AWFC 2XA9A 1NT4A 3UPUA 4BNFA 3L2AA 2O07A 3NWOA 4V0SA 2EX4A 2VWQA 3PTZA 3S2YA 1FC0A 4B3SM 1M6VB 4HNQA 1ZAEA 3J81S 4MS1A 3DT9A 1KAEA 1NI3A 3WJAA 4Y2JA 2WC1A 1VBFA 2GGSA 3FOBA 1MHPA 3HC7A 2OO5A 4URWR 4B43A 1VIVA 2PK3A 5HYVA 3M6VA 1VRWA 3IV6A 4QXAA 4EDHA 4IIWA 3FIUA 3PNQA 3N05A 5AFSA 2EBUA 2R6R1 5DXAA 4TS9A 1ZC3A 5LA6A 4D9MA 3NRBA 1KK1A 2HH9A 4E2YA 1HZZA 2SBTA 2I33A 1H6UA 1QHXA 4D9FA 3K9WA 2XA2A 4C0KA 4MGZR 1EFTA 3DOJA 2JAUA 1HA3A 3KALA 4BGIA 1XHLA 1GADO 1U3UA 3AEKB 5ALIA 2Z3ZA 3DCJA 1NGSA 4BKUA 4K81B 5CLQA 1KAMA 1Y34E 2G63A 1J8DA 1XD2A 5ED4A 4YAFA 4V2IA 4HN4B 3WMWA 3L7NA 5C8XA 2R8ZA 5C8YB 1J4AA 1J90A 1UDWA 1VBNA 3SCZA 5BNTA 1V5FA 2W6QA 1EDEA 4YCBA 5ED0A 4J1QA 1EVLA 4MWCA 2O8NA 5KYVA 4FYJA 3HDGA 1KK3A 3QKRB 1SCBA 2EQ5A 2ZUDA 3B8HA 4P22A 2I7NA 1A8QA 4KG7A 2XVMA 2I2DA 3I34X 1GA6A 5HX7A 2V4MA 4I8IA 4Q0MA 3ZU6A 3PNPA 1P77A 3IKJA 3GFOA 4J0QA 5TVGA 4Z1MA 1UMKA 3THRA 5FCDA 2YQ5A 2AE2A 3HN6A 4JBYA 4KSBA 4MKXA 3B60A 3VI3B 9ATCA 2PMWB 2LNHC 2WU8A 4QOHA 1G3UA 4Q9HA 1IIBA 4EA9A 2AC4A 4R8LA 1NNEA 2QYOA 1NSTA 2QL5A 1TLTA 1GPMA 2ZAOA 2IYEA 1FFDA 3N86A 2DHDA 2LHGA 1DOZA 2ZQ5A 1NV8A 4GM1A 5GVRA 1Z2NX 2P3SA 1N0IA 2W6JD 1L1EA 2EJTA 3OJOA 2PLNA 2QTCA 3HO6A 4JNCA 5FUMA 4YQYA 3GUYA 3AF6A 3GGJA 4FHGA 1NAIA 3OQHA 3BC1A 2XUHA 1JH8A 4E09A 1RADA 1VG8A 5CM2Z 2OCDA 2G67A 5K0FA 3P2YA 5HIKA 4K05A 1P2TA 3PFIA 3OEEA 4JGGA 1FVOA 4G0QA 2ZYIA 1Q7CA 3T9AA 5JY6A 3GYBA 3RRBA 4MRMA 4RJKA 3W7BA 4BKPA 2G40A 1ZW6A 5K3EA 1U63A 4KO2S 4U2GA 2FZ4A 5EGNA 5TC4A 4ND5A 5AKXA 4NMWA 3FRHA 1USKA 1NNSA 4PFKA 5DULA 5IN5A 4LX8A 1L7QA 4BO8A 3GFGA 1YB1A 4CEJB 4ALIA 2R60A 3U4AA 1FYWA 1FZQA 3B3AA 5CT4A 3C1OA 4QYXA 3T4EA 3G8CA 2IKQA 3DT8A 2P2YA 4BEWA 1RPNA 1ZQ1A 3VPGA 5A3VA 4DMLA 1IEXA 1G38A 4HQ0A 1DC3A 5AHWA 5P21A 2CRUA 2XJ4A 3W3AH 1Z06A 1GT91 5J4KA 5EMLA 1J5EB 4TV8F 4DEYA 1SPBS 3LY8A 4UFNA 5A0VA 1QRDA 5BN3B 3KKQA 3WI7A 1M0SA 3OZUA 5ADWA 3OP4A 4IJWA 5KHOC 5ITXA 5ALNA 2A1UA 1AO0A 1CY8A 3H5VA 4TGLA 3S1LA 4UUBA 3WGLA 2CCGA 4HWSA 4YROA 3W9YA 1U8TA 4DR2M 5ARDA 4OHWA 5L95A 4O0MA 3F5QA 1FSSA 3D8TA 1U8UA 3WHKA 1LVHA 1GZHB 3ZTTA 2PBFA 4X3CA 3LT2A 4ETWA 3QIVA 2ZS7A 3DSRA 5C8ZA 2H16A 4GYYA 4CLEA 3TMAA 1V8BA 1Y33E 4KKXB 4CMJA 3BMOB 3I4YA 5K4AA 4J0IA 1MAVA 3IOEA 1R6VA 2WMYA 3HY4A 3HCOA 2V5UA 4OIMA 5ALSA 2C5AA 5JNRA 5DRYA 2PS9A 4FQ7A 4N8DA 4XZ3A 4BECA 2ZJ5A 1U99A 4ZC8A 5JC1A 4ZJPA 2I7CA 4C43A 1O97C 4DCSA 3MEQA 1NPTO 4G5XA 4H3HB 1PT6A 3GD7A 1L4EA 2NV0A 1YRYE 3E27A 3FZGA 2HHAA 2O9JA 3EPJA 3I4FA 2C8LA 1PBTA 1T3GA 3AYXB 3PEWA 3VR6H 2FEKA 1B41A 2BRUC 4ZHQF 1W35A 1NE7A 2XUAA 4NE9A 3WMGA 3IPYA 4Y9TA 4CR6A 5FI0B 3WGYA 2GJ9A 1SEVA 2NO6A 5FBZA 4JYBA 3QUSA 2JD2A 4ERXA 3FFAA 1R4MB 2OY0A 2AOTA 4G0ZA 2WJIA 1WUKS 1LEHA 3G8AA 4EA8A 3MWKA 2EFDB 2ZSHA 1OWOA 2XNSA 3L7KA 1Z17A 1E63A 4MWTA 1EUZA 4XB6B 4DA7A 2A9OA 5KJCA 4TVKA 4OQLA 3S2ZA 2RAPA 2H4FA 2CNNA 2PJRA 5BQ5A 2ZPTX 1R8XA 4UMVA 4HDRA 5CB8A 4CHGA 3MW8A 2IEBA 2JFGA 3LX5A 1GGJA 4LF5B 4G1CA 4E2ZA 3EW9A 4P53A 3IAS1 4U0KA 5B58T 4GKJM 4ZOAA 2EGUA 3J27B 1EP9A 1Y7PA 2A0WA 1OXVA 4QLBA 2HA7A 1VIDA 4O02B 3EVAA 3F6PA 1NNUC 4UMEA 4XARA 4ZO7A 5TS2A 3ROXA 2HV9A 2Y0CA 4OYYA 3G1WA 5GONB 5FYDA 4MYTA 2PT7A 2OLKA 2X8AA 4LF8M 1QYRA 3D5QA 3COWA 4ENQA 2GZAA 2XXBA 4EUKA 1L4UA 2W48A 1LPAB 3TRIA 2A5YB 1H3NA 2I3AA 4EX7A 1O6GA 4K9RA 4C7KA 3UMSA 3IAXA 1H0SA 4LVCA 2WAAA 2F3QA 3KL4A 4ZI5A 2ZSJA 1UXOA 1A2OA 1M54A 3KJZA 2QS9A 2WR8A 5F12A 5DI9A 3LKVA 1HF3A 4HB4A 1J33A 4YMUA 5LOVF 5CHEA 5DDIP 2BGIA 3TXXA 3LWDA 4H16A 5T8KA 5ERGB 5LIPA 4YT4A 1O95A 1ZOLA 3KYJB 3OPNA 3HFGA 1RYBA 3IBCA 1RQRA 3DAYA 2OORC 3I92A 3PE6A 2CV0A 4GKKM 1T5HX 4PSDA 2VT3A 2QSUA 4EYSA 2PRIA 3WAKA 2MOKA 3IP3A 1QJ4A 3GHHA 4LS3A 4ENUA 1P60A 4REZA 3O83A 3E9SA 4MVJF 2GQ0A 3ZLUA 4M46A 3WIOA 1N1GA 4LX0A 3D3QA 5C1BA 5KDLA 3WBKA 5E26A 3LNTA 4DGSA 3RSFA 4WZBE 5AKYA 1X74A 4E5UA 2KZUA 3GLFA 3OT5A 4AJPA 3KQPA 4BCDA 4BNVA 1E2GA 1R4ZA 3RBZA 2JFXA 1O94A 3O26A 3ANMA 3TLGA 5LZ9A 4UXIA 1GNRA 2XQJA 1Q7TA 5KX5F 3C5WP 3BQ9A 4OHUA 5THXA 4U7PB 4LXHA 1OV4A 3D6NB 4PPFA 1ICIA 5DSTA 2LIPA 2JKYA 3RWMB 2YNMC 4FEGA 1KJWA 4P4SB 2JXNA 5LLSA 2OAQ1 4EF5A 3PC7A 2C9DA 4ZK2A 5KIAA 4E3WA 1VLZA 5DU2A 1OZGA 4LY0A 5D01A 2F3RA 3G13A 2EXXA 3PQ4A 1FQWA 4AN1A 1KTVA 1XP5A 3EPLA 4F92B 2GF9A 3L5KA 1WABA 4II3A 4N5IX 3UWSA 4IVPA 4JCCA 4DY6A 1H8HA 1RP1A 5ALRA 3FCCA 5IH7A 5KJEA 1ZKDA 3KQKA 4CUZA 4TROA 1E2KA 2HRRA 2ZFUA 2ZYHA 2X1HA 4CN8A 5DW3A 4AIRA 1EM6A 4IDGA 1JQ5A 2V6IA 4OQEA 5TF4A 3AT1A 5CGZA 2O0HA 1DQSA 3TOVA 4LRUA 4YJFB 2P0YA 2YDYA 2IZOA 3UYLA 3AUXA 4G0YA 5JVDF 2H2GA 1YBAA 2ZTDA 4OJQA 3FDFA 4N7RA 1VE6A 1YFZA 4UHFA 3SMSA 3FSGA 1C50A 3D7NA 1TCVA 4BVAA 1NY6A 2ZWIA 3OCUA 4QGAA 2XVAA 3CC8A 1DIBA 5HZHA 3OZEA 3HZRA 1IBMM 1L7XA 2Z8XA 1E0JA 3GAFA 4JC4A 4W7HA 3AGPA 4J7XA 1RJWA 1NT2A 4HJXA 2WYHA 4HBZA 1KH1A 2VSFA 4AY6A 2PKYX 1S9HA 3FD9A 2ODPA 4TV9B 4LRQA 2IOHA 3H8VA 4U3JB 4NX2A 2QUZA 3NGXA 1SO8A 2ZJYA 3GQVA 1QGUB 2XVYA 2XZLA 2RGCA 2H5JA 1HRDA 2BBOA 1M7BA 3NOQA 3GGGA 5FADA 4LV8B 1EB8A 2QAGC 3L1IA 4H17A 3S2UA 5KPTA 2ZBGA 1IPFA 1CEEA 2C7PA 3GLKA 5CDUA 3O74A 4RM3A 1N7GA 3DPIA 1EBFA 1QZUA 4QUIA 3MJEA 5B1DA 2D62A 2QRJA 1GAQA 4RORA 4PS1A 4HKTA 4IIUA 3G2OA 1FDUA 3NQ41 5ILQA 2W2KB 2UXCB 2OV2A 2XWBF 4QGFA 2H07A 3EMKA 1F7VA 1F20A 3EHDA 1AKNA 1S2DA 4JLAA 1AKMA 5EMMA 3RS7A 4YY3B 2JGDB 1UBUS 5IKEA 5JXHA 1AGXA 1YRQA 3JASA 3DDSA 2JIMA 4KYIB 3DTVB 3P52A 1DDOA 2QL7A 2QT1A 2YIJA 3AR9A 1GV0A 4M0KA 4LDNA 4BVKA 1SVSA 4IJ5A 5BQ3A 2HPVA 3CRQA 3NJ4A 4TT3A 1GUYA 1QPGA 2ZYGA 3B7QA 2H1CA 5AM2A 1VE7A 4NU0A 2JFZA 2FTKE 1QLJA 5L7YA 1KVTA 1MAWA 2D7EA 2IHYA 3V4FA 3HA7A 1JLLA 5AKJA 3VR1A 4YRFA 4PQFA 3I9NA 4UQOA 3SYTA 4AF8A 4H4DA 2HO4A 4EUFA 2QQ5A 3UT5A 1M8PA 4D4JA 1K8ZB 5B55A 1YTLA 4E6PA 4LYDA 2YHIB 3OQJA 3TIXB 3EUWA 4GIPA 4JLVA 4L0QA 3ZVLA 2WMNB 1F8YA 1KP9A 2OTCA 2SNIE 4LFBM 1GTVA 3UAVA 4OX9M 5K8TA 2CJXA 4GQAA 5G3ZA 2KPOA 3OCCA 5HZMA 2Q3MA 3WK8A 2A9FA 3NHBA 3SS8A 1FRFS 4JN6B 1II8A 4FYIA 2EBFX 1MFZA 2OBXA 3NFYA 3WMFA 5FNZA 4HMPA 1C8BA 4IXTA 1EWQA 2W93A 2XTMA 4YH1A 3PIDA 3AY6A 4IHJA 1U2PA 3BKXA 1SD5A 1YOVA 5K2OA 3BG5A 4B7ZA 4YAUA 4JI8B 3FFWA 3EDYA 3K1ZA 4Q4JB 3H2GA 4J2HA 4Y2QA 3PKZA 1TEHA 3D6MA 2C61A 2UZ4A 2XV1A 3CLTD 4JWKA 4GLJA 1F0NA 2O7SA 1EWKA 1LNQA 2WSYB 1MW8X 5SZIA 4PZPA 4YAWA 3TX2A 2PAAA 2CVFA 2V59A 4P4NA 4Z53A 4BKQA 1CP2A 4OVKA 3WLJA 4EZIA 2J9XB 1DBWA 2JNHA 3CZ4A 4CF3A 5K8IA 1FJXA 5DBOA 4E5KA 1MR3F 4DSAA 1E6CA 3WYFA 2JAXA 4F96A 4FNGA 3GOQA 3DNFA 1ZI6A 3NJ8A 4A0GA 1J24A 5FL3A 3UO8B 2V6BA 5JCJA 1VP3A 2KNZA 5CA0A 4ACAA 4IOJA 3GQ5A 3QE2A 2MR5A 1N7IA 4WURA 1V6CA 3U13A 3HMQA 4UHHA 4TKLA 4QZVA 4MWOA 5KSYA 4A1FA 2QX8A 4QWMA 3GRKA 1TDJA 5ITZB 4HDAA 1DRUA 1RR6A 2ZP1A 1E3IA 1U7OA 1M2OB 3DV2A 5HF6A 4A0SA 1TDHA 1KP3A 3A1NA 4YFVA 4EB6B 3GB9A 1U8XX 5BVHB 1C1YA 1X13A 3K9HA 3IP1A 2VCEA 4R2XA 1SVMA 2DWNA 5HF9A 1XLTA 3DW3X 4WY2A 4NICA 2AC7A 3RTAA 4P3YA 1Y7HA 1BQ4A 4BO4A 5CVUA 4JIMA 1EFPA 1ZNZA 4PLTA 3D59A 1RXEA 3ABOB 3FYSA 1JR3E 2CLIB 2D1TA 2WJYA 1EX1A 2OYCA 5I45A 4GPBA 1ODTC 1E3DA 1H6BA 3ANNA 4GPTA 1VLQA 4PZCA 3R8XA 3UB2A 4B17A 2ZSUA 2PXAA 5JBIA 4DT1B 3P8ZA 4ZMSA 4O4HF 3EMDA 2B7CA 4MLDA 3GNTA 1N33M 4LYJA 2VP9A 4QJBA 4A5OA 3IEIA 1G8MA 3E70C 4CMCA 4Y6RA 5LC1A 3U4CA 1YV9A 4JI0M 4JLDA 4YRIA 3CR8A 2GN4A 3REFA 3G7NA 3WLEA 3EUEA 2ZDHA 2B4QA 1E2LA 4NFYA 3HWSA 4D6PA 4Q3DA 2VJAA 1HETA 2VS1A 3HNPA 4LJ8A 3HDYA 3BTVA 3CO0S 2QIOA 2IL1A 3QYPA 4L8RC 2R2AA 4LDRA 4URVR 2B61A 1B42A 4JI6M 1SCUB 4EMUA 5FV4A 3GLHE 2XDQA 3D3EA 4W99A 2PLAA 3Q85A 3EH2A 3K6SB 3UENA 1R0SA 2EA0A 1J0EA 2G9RA 5KVQA 1Z2AA 4ZVPA 3HY5A 4IO1A 3QTLA 3DBHB 1R3DA 2VPWA 4CM4A 3KOMA 2ZB3A 3CF6E 4D56A 3MTGA 3PB3A 2ZIFA 3GP3A 3A11A 5KOHA 4BPBA 1GFIA 1EUDA 2XD4A 3AVQA 1WIWA 2J3MA 5K1ZA 5MGBA 1FXSA 3VZPA 3IUPA 3IP6A 1BJRE 3K05A 3AR8A 5DYWA 1Z35A 3VO2A 4P36A 4WXHA 1PV2A 3L9WA 3V8EA 3B74A 1XTJA 4F4CA 3AKYA 4B32A 2AD5A 4OU4A 2EHJA 5TT0A 4AZ3B 2JAHA 3AESB 4PDGA 3H4IA 5T57A 2XDYA 3BJZA 3MRXA 3OESA 1DPFA 4POAA 5JH7F 1AU9A 2AR7A 1SG0A 2NUTB 3FFTA 4LNHA 3W3ZB 2V9ZA 2AQIA 2H1HA 3IEPA 4HXGA 4G2NA 4QDJA 1D0KA 1NA5A 3CIFA 2EFCB 3U6KA 4ENWA 2CWBA 1JA9A 4PWZA 5DASA 4MP8A 1N25A 1PVVA 2WAYA 3E8XA 3FLBA 5E7QA 2XB4A 2C8VA 4ZDKA 3GLVA 3OOSA 3K6KA 2E48A 5LMNB 2QVCA 4Q3AA 4AC9A 5KQSA 1ZOIA 2CJWB 1R8QA 2VJMB 4KI0A 2RH4A 2G04A 3BD7A 3QLUC 2LRHA 2QOEA 2CHUA 5DIZA 1KSHA 4G01B 3U19A 1WNFA 2FPGA 1JEAA 3VPFA 2ATEA 5L3ZA 3HXLA 3FHTA 5GMOA 4DUZM 3W5CA 5KYYA 4K0RA 1KEUA 2GO7A 5LLTA 4MROA 1AZTA 5CGQB 2Q1SA 1P17A 5AM1A 4JAVC 1GEGA 2OQRA 1N34M 2DF8A 3O1IC 4WK2B 4RF3A 3HI6A 4MXDA 5JD4A 5IHPA 2K6BA 2LZ0A 2BF4A 2IZ0A 3BQNB 1CUEA 4I1RA 3AOEC 1QUTA 3TR6A 4ICIA 1QS0B 5CLGA 3I62A 3BULA 3OLQA 4KRYA 5FBRB 3ZXUB 5HDQA 3LDUA 2DENA 3WHIA 1H1LA 3VR3D 3KPJA 1NJ6A 3V7UA 4M8IA 3H18A 1SXGA 2ZJ3A 4KUHA 5HK9A 5HK8A 4BJ5A 1SAYA 2Y0EA 3NHMA 2G6BA 3M6XA 1Z8DA 3I8XA 1QP8A 1M33A 4FWIB 2VUSA 4TKUA 1NRWA 3THYB 4K6OA 2ZBPA 3G0BA 2M1XA 1OWLA 2QR3A 3L8YA 4GWLA 5DTQA 4GYJA 3CSUA 3RTGA 5MN6A 5K7SA 1LNSA 3A1VA 4ZC1A 1G9XA 2R44A 2O2SA 3BGVA 4DJFC 2CLCX 3DEHA 4WJLA 2F3UA 5EMNA 2J5KA 1WBDA 2B4TO 3BX1A 3FHCB 5AJHA 4I3HA 4R71A 4DBLC 1VPLA 4YMHA 4TTRA 2WHYA 2GR9A 1U0RA 1L4LA 1L4FA 1RRFA 1AKUA 1A9ZA 3O0TA 5JPDA 4DS3A 3GP8A 3N39C 2WU4A 3DP7A 2WKSA 4QU0A 4NV3A 4TLBA 4RJIA 3E5HA 5IU6A 4G4SO 4HEJA 3MHTA 2OXRA 4F84A 5LQSA 1QYCA 3PDHA 2CDRA 1ZYUA 4OUDB 4RV5A 4LCEA 3VDPA 2B21A 4JXKA 4MWBA 3VYSB 1KHHA 1JHYA 3Q0IA 1PZFA 3H9UA 4KR3A 1P6XA 4J1TA 1K2VN 3TNLA 1BMTA 4ZZ2A 4JHLA 2N0SA 3TQSA 3FRIA 1F12A 4KSYA 3PNKA 3AZQA 3O0DA 5F35A 3UGKA 1PQ4A 5AVRA 1GL9B 1IVNA 4ZEXA 4B3BA 3BWXA 1P0CA 2C9OA 1YQ9A 5KHAA 5EKXA 4UEJA 4BWYA 4JUIA 1LC0A 4FEEA 4RZXA 4XB1A 1ZGGA 2XUJA 4UD6A 1TF7A 4P4GA 2IYPA 4C0QC 4MO9A 4W5QA 1OREA 2B36A 3D0QA 4NYJR 4BV9A 4E08A 3LHIA 4ZOLA 1T4CA 3QI2A 1KK0A 4YHHM 3SFVA 1GQRA 3ZHTA 1SH7A 4US0R 1CY6A 3I9LA 4PO9A 1EGAA 1L2DA 2R4UA 1Q7BA 1NNJA 3WQRA 2YV3A 3AINA 2BELA 4KQMA 2QHOB 1MIOB 1ZH8A 4CN9A 3UTDA 4O4LA 4R0MA 3L4EA 3VBEA 3HTXA 2H7YA 1UXKA 1LDBA 2WLTA 2WE7A 4FCWA 1OTYA 1BHO1 1YRLA 3C4VA 5HS6A 5KCZA 1PP4A 3BWVA 2JFOA 3IQHX 1P1FA 3G0CA 3HABA 2ISSD 3WRYC 2HHJA 3H5IA 2NU7B 4UEOA 2IA5A 1WMBA 4JI1M 4DSUA 1E9VA 1TGUA 1B73A 1KJJA 1QU3A 4F93B 1EE9A 1T5TA 4OCZA 1G20E 3L41A 1XTSA 3Q7QA 4MAAA 3PHGA 1SQSA 3OQ6A 4LQCA 1CYDA 4LYEA 1YQUA 1F2VA 1OI2A 2VK2A 2ERCA 4COOA 1BDMA 4B48A 4FGJA 2AOVA 4ZIRB 1RXYA 3ASVA 1PT7A 3DOUA 2H3EA 4KPGA 2ZJ8A 2AHOA 3MD9A 3U80A 3NAGA 3U56A 4DWOA 1PWEA 4FMCB 3EIFA 4DABA 3ZDDA 1UP6A 3DYVA 4CEHB 2Q3HA 3KQMA 2PE5A 4CTMA 1G7TA 4XGIA 4NRVA 4Y2TA 3K2IA 3I2HA 3I9KA 4WFIA 1XF9A 4PNHA 1G21B 5H4GA 3E3AA 1Y6GA 1B8UA 5AXCA 1M2FA 2WWVD 5FLYA 2JLRA 3NONA 1KI7A 4ZXPA 3SXJA 3C3YA 3KDPA 2D06A 4F9EA 1GR1A 4XIIA 3IQZA 1CJSA 3N8HA 4P84A 2Q3FA 3VNBA 4MJ3A 1F6WA 3RSQA 1N6NA 4KYTA 1DXHA 5JQGA 3KP1E 1RDFA 2PZJA 1D0LA 3H1GA 2HCRA 2QG4A 4DMHA 2Z2JA 1NXVA 3K2LA 3IXQA 2VVTA 1WUIS 2C95A 4LV6A 4HZUA 4F6RB 4IBBA 1LQTA 4HX9A 1M8FA 1XXHA 4G84A 1A3CA 2HJ9A 2A1TR 4RULA 4MQBA 1FFYA 5D1HA 1BMQA 3REGA 3E7XA 1RKQA 5JMTA 4JLUA 1ZGJA 4Q9IA 2GD6A 3AL0C 4YHBA 3HB4X 4LHXA 4YAOA 1VL1A 4UNNA 5KOJA 5IWCA 2W6ID 4JI7B 2VH1A 4XYMA 4Q4AA 2VAMA 4OQFA 4BASA 1MORA 1S8AA 3GLRA 3LX4A 1LD3A 4R1MA 3COZA 3EVCA 1A4RA 2IVZA 3FMFA 2AB0A 4TWAA 2VPYA 3KR9A 1GGNA 3FE2A 3LPMA 4IM7A 1DC4A 4UAJA 3KD3A 1G6HA 1XQWA 3TKAA 2B69A 3AKDA 1IM2A 1UMCB 2Q7OE 2XUOA 2OUIA 2QJRA 4MVJE 2P2ZA 1J5PA 3D64A 1ISRA 1UM9B 4U4AA 3OCXA 4R8RA 1PD1A 3JQAB 3GPXA 3U16A 5DM60 1TM5E 3ZHUA 1I5EA 3ACDA 2LVPC 1QLHA 1P33A 1K82A 5C46F 3OIUA 3RSGA 3F5FA 2VAXA 2PR2A 3SC3A 3ZBQA 1NWCA 3I5XA 1XJWA 3K31A 3V2IA 4CIDA 1R18A 4GOMD 4PCLA 3KKMA 4U6SA 2DAIA 5DJ5A 3T5CA 5AM3A 1YJ8A 4E15A 4DL9A 3HWX1 1E2HA 1C1HA 2QAJA 3QYJA 2HNAA 2D1SA 5CFQA 3RW9A 4LF7M 3A4VA 5GJBA 3PXDA 2CT8A 2NPIA 1OASA 1N5KA 2HF2A 2O7RA 1XQYA 4BCCA 1YZGA 5FUXA 4IV0A 4G81A 3OZSA 4QGGA 3TGWA 1Q83A 1G19A 3OF3A 1TA0A 2R11A 2B4AA 1TJ3A 1V47A 2YMPA 3KJNA 3R0JA 5FO0A 2NP6A 4X60A 1DZ3A 3EXFB 4XAQA 1Z15A 4KUGA 5BSFA 2SKCA 2RGYA 4CDMA 5LNK6 1JR4A 5KREA 1ZCFA 4F4UA 2E4ZA 3HJFA 3QPCA 2PBZA 3U7QB 2VUTA 4BX8A 5FORA 3ROZA 1XC8A 5CG1A 2OHGA 4N8EA 1T2NA 3W5HA 4RWZA 3QPVA 1Y1PA 2XZDA 5CPBA 5J2UB 1V5EA 1AN9A 4HN9A 5ANRB 3A1FA 3KFUG 1P62B 1QHSA 3ZVMA 1S2MA 3RD5A 1U9IC 3QFRA 1U04A 1RWNA 1R3UA 4H4CA 1IK6A 3AUYA 5AVOA 1XROA 5DNDA 3WLMA 3VNUA 1NXOA 1U0GA 3CB2A 2VNHA 2QN7A 4PX2A 1VGRA 1EWVA 1RZVA 4GPZA 3L7OA 1E1LA 1NQTA 4IIXA 3MJCA 3U61A 2YIDA 1WOYA 3PJGA 2VUHB 1FUUA 1PFGA 3HSSA 2OSBA 3SR3A 3O7MA 4I6EA 1XO1A 4GECA 1QK5A 5CYGA 3BS4A 3P2EA 3L46A 1ECBA 2ECOA 3I1IA 4JEMA 3QX3A 2WNHA 2RAVA 1Z5OA 1WV0A 1XEWX 1RI2A 4P16A 4WKPA 1O9GA 3JYNA 1Z3CA 2ZLBA 1GCGA 3GVPA 1XDDA 1NG1A 3FWHA 4P3KA 4F11A 3M9LA 2KRUA 3EGWA 1V11A 4RH0A 4J0DA 1FPQA 3OLCX 3WGVA 3MB5A 1DUVG 2GCNA 5A4JA 4B2LA 1Z33A 3FB1A 1E3WB 2O8BB 2XHZA 4X44A 3KKOA 2ZKLA 2QUIA 1U8FO 2JGLA 3SSAA 1HTBA 3K9BA 4A15A 4J2OA 4LXXA 4HNVA 1C7RA 1TYCA 4BAGA 2HIMA 3AZOA 3WR5A 6REQA 3VSBA 1I24A 3EH1A 1E1QA 5IW8A 4DIMA 1PNVA 3PKIA 5E3HA 3F71A 2WSMA 5ALUA 4G89A 5JALA 4KRFA 4YXWA 5M5BA 2G5PA 4IQ0A 3PFNA 4DWJA 4XDGA 3W2GA 1ATIA 4JT8A 1ZM7A 4G0NA 4J0GA 2I6UA 3KYIB 4U5QA 3J7AC 3CXUA 3SDSA 1QAMA 4G09A 1GPWB 4OVZB 1MVNA 1EFRA 1VRCA 1DGFA 4CR8A 4OK5A 3DUWA 5LQMA 5LP6B 1VMKA 4S1WA 3CLHA 2I2FA 1T6OA 2E4VA 5DIFA 2GZDA 1MABA 3U9TA 1T6BY 4OA8A 3C6QA 3ZH2A 4D0SA 4QQRA 3WIBA 5BXQC 4L57A 2CFRA 3QP9A 4B4KA 3IBGA 4XW2A 1PT9A 4DNXA 3UCXA 3FUUA 1QIMA 4MRAA 4TWZA 5LMZA 4P34A 5JXIA 3UZUA 2IUYA 2H9AA 1ZJ6A 2AN5A 1OAOA 3B12A 1K5PA 4F38A 3L82B 4JR0A 1UANA 3LC7O 1XK6A 1Q02A 4LXGA 1FYDA 5KQ8A 2YYZA 1DDGA 2AX4A 3O84A 3LG2A 3ESDA 1TPYA 4FMDF 4M38A 3K4HA 3GT7A 3GR6A 4PDIA 1I94B 3NU1A 3HYRA 2H2AA 1GRNA 4PYOA 5E7IA 3L43A 3AHIA 3VKWA 1LI5A 2BGRA 5SY4A 5B2FA 4DCUA 2WM2A 2VP5A 2JLSA 2WI8A 2BR3A 3TMKA 3RYFA 4TT8A 4EYKA 3LYAA 4OXRA 4IDQA 2KEBA 5FDFA 3Q72A 1HYQA 2QR2A 2F64A 1UPAA 2R25B 1MKYA 4QXRA 4WY8A 1SKYB 4O2RA 1ZWKA 4MIKA 1AV7A 2D7HA 1ECJA 3PXAA 4M1TA 4AJ1A 2WM9B 5D85A 2YHUA 3KVVA 5CVVA 2CF5A 3JQGA 1I32A 5U4QA 3ZIUA 4YJDA 1SVLA 2XCSB 4K87A 3SP1A 3AERA 3VZSA 1K89A 2KYRA 4NSRA 13PKA 2Q5JA 1T2DA 3UV7A 4A8JC 2Z4SA 4DMFA 3A06A 3AVTA 4FW9A 2GJAA 3WHLA 4ZVMA 1GQOA 2H9IA 4X1YA 3I9FA 5TIIA 2O3RA 2HAKA 1IATA 2HRZA 4TTSA 4LE1A 5LKAA 2HWXA 2HF8A 3QYFA 1GTG1 1Z68A 4CODB 3CTMA 5TF0A 3AXSA 1H4QA 2WUFA 1RAHA 4BE9A 3NWJA 3SK0A 1LC3A 1NFFA 1C3OA 3GI1A 2BEJA 4EKGA 2ZUSA 1IXKA 4ZVKA 4JMLA 3WJ7A 2PDAA 5FJIA 4M7RA 3ZY5A 1SVOA 1YTUA 5EINA 2PL3A 1XXLA 4NYMQ 3PT5A 4EM6A 2VPZA 2B1GA 1AS2A 1JKMA 1BWPA 3CVXA 4WXRA 3AL3A 2CBZA 3RVOA 1T1RA 1NHWA 2YY6A 3B5IA 5BV2P 1SNYA 3H2ZA 1ZCBA 2BFCA 1U1DA 4R2WA 2FOIC 4XK8F 3D4BA 1K6EA 1JDSA 4XX0B 4D3SA 3HXMA 4QU5A 1A9XB 5JJLA 1CIJA 3FZEA 2N42A 5KVAA 1IK4A 2J3IA 2PWZA 3STHA 5DWDA 3QWIA 3DOAA 1DAOA 2DH6A 3UNXA 4BNYA 2ZYWX 3JVEA 3WL6A 4FMPA 2AKEA 5U9CA 1Z3IX 3K0SA 1EGHA 2OFPA 3HJBA 3MWJA 1G8SA 1OCEA 2OB1A 4PGMA 4DTCA 1X94A 4UDOA 3TQHA 1WMEA 4RKEA 5BYKA 3ADCA 2EYQA 3PV0A 3LIIA 1NW7A 1BSVA 2PZBA 4RETA 4NPAA 3JD4A 2L17A 4QEZA 5CX1A 3NHFA 1XB2B 2YIVX 3NXSA 4NE2A 2TRSB 3TGPA 3FTDA 1COWA 4MDHA 3CQ9A 5K4GA 3H4VA 2RRUA 1DWUA 3FJOA 3ZWMA 4RF0A 5B3JA 4B09A 4N6OA 2Q1TA 1HE4A 1P91A 2DUMA 2ZJ7A 2RC6A 1Y6QA 3ZK9A 4RIEA 4HS9A 4S35A 4IQGA 4ALMA 2O8DA 3AIKA 3FI9A 3PWSA 5F5LA 2HLPA 1I4EB 4NENB 2H57A 3GN1A 2P68A 5TT1A 1OSNA 2BFAA 3P27A 3O8OB 5C3UA 1Z6TA 5DGHA 4L1KA 4YCLA 1K75A 2QBYB 4AN4A 5IUKC 3S1AB 4AS3A 2HPHA 4R6WA 1HLFA 3GJ6A 3TYXA 3ZW8A 2RONA 4O2AF 2ID7A 3C24A 1YDMA 1ZD2P 3V3TA 4M7WA 3GEDA 5K20A 1ULAA 5MF6A 1AUAA 2E1RA 2Z9DA 4MQ5A 4MJ7A 3N0RA 1OXTA 3L7DA 2HFKA 4HLQB 4ML3A 2JIDA 1PSWA 2COEA 3MWGA 1ONSA 2WIAA 1DHRA 1EFLA 4ODIA 3UK0A 3USZA 1YASA 4CMAA 4RD2A 1CE8B 2DE0X 1CJKC 4S1PA 4IYJA 4M9CA 1LWNA 3VNQA 3TK1A 1ZGCA 2OV3A 3A10A 2VT6A 3FTQA 3R9KA 3LPNA 2X9LA 2G9ZA 2SCUB 1PK8A 3JQ8B 2A58A 4C7VA 3C8HA 3RRFA 4G5SA 1AKRA 3GZNA 3H2YA 1FS4A 2FZCA 4Q02A 3DVQX 3BGWA 4DA6A 2DWPA 4RQBA 2INGX 3ZGXA 4AWBA 4QVKA 3AR6A 4GF5A 1LRLA 3N0XA 2C7OA 3NOXA 3TFOA 3ETJA 4IVNA 1WL8A 2FZ5A 2AWOA 4UUAA 3F5DA 3DW1X 1NULA 4MS4B 5GM1A 3BBPA 2BJHA 4I1OA 5AIAA 3GP5A 4F3NA 4JC8A 2HHHB 4MKZA 3RFFA 1YKFA 3PHLA 1Y5RA 2QL6A 4RPLA 1XR3A 1KYZA 1T1IA 3WLFA 1QQAA 5CUQA 3GLHB 3ZKWA 4E5PA 2F1OA 3IB3A 3NHZA 4NG4A 3ROKA 4B6JA 1JNYA 1ZCJA 1R0XA 2J9ZB 2DLNA 4PEVA 4IIGA 1M83A 1T6XA 1TAUA 4UEWA 5JV5A 4E30A 2PZLA 4CZ2A 4K9SA 1TL7C 4V0ME 1G3RA 4OM7A 4HAOA 4OLBA 1K4KA 3KBBA 1TD9A 1ZMOA 1RJDA 4Z1OA 2I4RA 1J2EA 2J5BA 4WMLA 1OVGA 2I7DA 3RK4A 2BMJA 4OQQA 4HQNA 3NBMA 2G4VA 3RJ5A 1A4IA 3AP3A 1MUUA 4GZMA 1AK1A 2RHTA 3HO8A 1G8HA 3P9YA 4KWTA 2L6OA 3FTPA 3H8JA 2OZEA 4EFNA 1QTQA 2A7QA 1QH8B 4S05A 4PD2A 4Q7LA 5D1NA 5FO1A 4RHFA 3Q6NA 4DJTA 2OKGA 2V7GA 8LDHA 5KQMA 3HBFA 4TYWA 2J9GA 3EAQA 1ZBQA 1N0UA 4IGEA 2LR0A 1XGKA 2JBAB 2OBYA 1RQPA 3CGWA 4JDPA 4TQUS 5IREB 3R3WA 3VYWA 2WHPB 2Q5QA 3UFXB 2UVQA 5I7OA 1HDEA 4EFLA 1EI9A 3PQ3A 2ZCVA 3V1MA 1E1KA 1FSGA 3CLRD 3VZRA 4AKSA 1WUJS 1JJBA 3A3PA 5J2TF 5JLAA 2IS6A 1PHPA 5LZ4A 3PNLA 3MCUA 3PEEA 4QUDA 5BN5B 5EWLB 3CPSA 1AX9A 3I9MA 5EZYA 5JW6A 1RHUA 3JCZA 1VEKA 5AI6A 3INNA 3BMXA 3ZHZA 4B81A 3K9QO 1TZKA 4E4YA 3RLFA 4EG7A 2OUKA 1A5SB 4YV0A 4JXJA 1CUHA 4FOTA 5D7BA 3V9AA 4QARA 3EBLA 4DIEA 1OOEA 4O4IB 2D0DA 4YMVA 3QV2A 5FOTA 4OD0A 1KVRA 3AWIA 4B9AA 3DVAA 1QIFA 3ONDA 3U6OA 4AX8A 1PK7A 4H7IA 5A9RA 4RBNA 2I6SA 2VJCA 3PJEA 1U1IA 2WWGA 1ISHA 1ECGA 3VKHA 3SQXA 2BHLA 2CXUA 2VDOB 2GESA 1D2CA 2OENG 4CUJA 1QPBA 2H08A 3QM1A 1KZHA 2Y9MB 3JXEA 4K9MA 3FMVA 3BXOA 4P35A 1MX9A 3ESCA 3E81A 3RO7A 3ENVA 4L4UA 3WA7A 4U9IS 4CIZA 1W0JD 1SVUA 4PQGA 4IBJA 3UY4A 3L7YA 1J2RA 1OX5A 3VH1A 4TMTA 1XCOA 2YMMA 5EMKA 4ZI3A 5LD2C 4NL4H 5SZHB 4HPJB 5B36A 2Z2IA 3PNSA 1L7OA 1UBGA 4D9BA 4C3UA 2YCLA 3UAGA 1ZV1A 3MOGA 2XI4A 4KK4A 4CF4A 2GVZC 1J09A 1JB0F 3GA0A 2OGUA 4CTOA 5YASA 4HLUA 1KC1A 1HUQA 3UF0A 5A03A 1VE9A 1JIIA 3PZBA 3FW1A 1Q44A 3NP7A 1GN8A 2HL7A 4EFDA 5FBKA 4TL6A 3AC0A 2EARA 3GLIE 4IIVA 4P32A 1S3GA 2BCEA 1Y3AA 4DV6B 4L50A 3LUBA 2HQBA 5K3DA 4IEIA 2XDAA 1L0BA 3IUBA 1UCFA 3V1LA 4D0RA 1S3FA 3NHRA 2B2NA 5CAEB 4PXYA 3LC1O 2DAPA 4Q24A 3CV3A 4WACA 1U31A 2JW5A 1ODLA 4EARA 1TAGA 5BRJA 2FZWA 2FUEA 4TV8B 4YRZA 2NU9B 5ALYA 4L73A 3F9RA 4IS2A 2PMEA 1P3Y1 1FSZA 1S9DA 3CH7A 2C8KA 2E37A 1K3FA 4WXPA 1NYRA 3PPIA 3HHXA 3F90A 5THQA 5TQJA 2B30A 2I2WA 2L69A 1S2LA 2JA1A 4C88A 1QCYA 3LOPA 1Q0UA 3HY3A 3V42A 3RU2A 4I55B 1SRRA 2QKYA 3JATB 4QUKA 4ASUA 1Z0KA 5TQ0A 3NWLA 1L3BA 2G3YA 1V9CA 1DG1G 2WTNA 5EXXA 1DIHA 3QEKA 3C1TA 1QIGA 1XMOM 4PF1A 1YZNA 1BRMA 2JLQA 1EMDA 4LYGA 1P74A 1AQIA 1QVWA 2W2PA 4QKQA 5TEWA 2ZPUA 1KMQA 1KFBB 3G0DA 1QQTA 3JQQA 2RHHA 1PG2A 1T5IA 3GPPA 5BUZA 1ZWLA 4X3PA 5FTMA 4CL3A 2Q3EA 3MNFA 1MZVA 1JJIA 4D8UA 4AZSA 2L18A 4EW2A 2FPPB 1K06A 4LDJA 5IAJA 2RGGA 1QBGA 4UE3S 4EVSA 1G20B 3SYKA 4LK2A 4ILEA 2BL4A 1IG0A 3QVSA 3DOOA 2REXB 3E9MA 5L3QB 2XUIA 1Y8GA 4GP6A 1TVMA 3VH3A 4RMGA 2WZQA 1GG8A 2Y6UA 2WFLA 2O5RA 3KT3A 3K0CC 4XSHA 2I4TA 4J0KA 1H5UA 1KC3A 4RC9A 3I9JA 4B9EA 1F51E 3KVWA 3O9ZA 3LC0A 2WWXA 2J48A 2AI2A 3KSJA 1OFVA 2JFPA 5SZKB 1XWFA 2XBLA 2WJAA 2WHEA 2ZJAA 1E92A 1L5MA 2FOLA 4RTJA 1YB6A 2IYUA 4S1OA 4JENA 3VR5D 2XE8A 4RA6B 1HYEA 1QQBA 4LXUA 2VHTA 4DC0A 3FYUC 4ZRNA 1DIRA 3BHIA 4QXPA 1QXSA 4ZGWA 3ZQ6A 1Z7EA 4KWIA 2WQ6A 2GSWA 4FWBA 1X70A 2R1TB 4P2GA 5DTJA 4UTNA 2P30A 2NZJA 4R7GA 4Q21A 2F62A 1DKLA 5IDVA 2G08A 5FF9A 1CC1S 1I9CA 3LGSA 3STUA 1RZRD 4W1SA 3SFTA 3EX7C 2AUTA 1E2DA 4MV8A 1IM8A 3GRVA 4Z4GA 1TXGA 4FWGA 2W00A 2PTGA 2ZJOA 2VJDA 2HXYA 1ZVJA 1W4ZA 2PSDA 4EG0A 5H81A 3F92A 3B9BA 3IE2A 4KFRA 2HX1A 2JFWA 4IIJA 1DAFA 3TINA 3WWCA 5HEKA 4RHEA 3HXQA 2E55A 2XMSA 3BHJA 4R3DA 3GAZA 5KTOA 3V46A 3QWHA 1KDOA 1B6RA 3EZ9A 2IYNA 1WQ4A 3I0MA 3FHLA 3OLWA 3KB1A 4RTPA 1E69A 4NMLA 5LOVB 2YUIA 3NIFB 5ICSA 3PF9A 1XZNA 1C2TA 5AJZA 2BN4A 3J2PB 1CUJA 4CCYA 2J67A 4L6AA 1H5NA 3E03A 3K9FC 3JSXA 4JASB 1GGEA 4EAQA 2OXCA 4MDFA 1N1EA 1ILWA 4CLOB 2OK8A 2OQ4A 4N76A 2W8BA 2I4OA 3ZEIA 3WFZA 4Z7NB 1DRJA 2J85A 3SC6A 5HE8A 2A5GA 2FUG6 3LK6A 4B08A 3K53A 1XTRA 3EVGA 1CUAA 1P73A 3G7UA 5EXEA 3PRKE 5FPSA 1UDBA 3M3HA 1UBTS 3RF6A 1Y42X 1OY1A 2C31A 3PI6A 1GGFA 4IGFA 4YPOA 3AR4A 3INRA 2XGJA 3IR6A 3QLEA 2WB4A 2JJ2A 5HTOA 3F6CA 3PCXA 5KX5B 3ZYCA 3AV3A 3K1JA 4XPIB 1ZNXA 1NO1A 1NXWA 3P5BA 2GEVA 4G9EA 4BP8A 1PL0A 1RKBA 2BFNA 1NLMA 3CVWA 4XOUA 4UM5A 1MVOA 2XB2A 3WIVA 2NUAA 3TPZA 4F5YA 3HJGA 4CDGA 1GU1A 3BKWA 3QFFA 2VF7A 1QR6A 2MSDB 1MF7A 1TPZA 2KM1A 3RYIA 4HT3B 4TTJA 4YVFA 1TR8A 3A4MA 4LI0A 2X19A 1UK6A 1GDDA 5DZSA 1KZ6A 1JGTA 3CW8X 2XNJA 5FPQA 4LZAA 2IUUA 1JUDA 4QDXA 4QU9A 2WHQA 2IHVA 2QJTA 1QTRA 3V7FA 1NVGA 1TU3A 2P40A 3LVBA 3LTEA 3D0KA 4GXRA 3EVEA 4U02A 4OQPA 1PJ8A 3MS7A 4LJKA 2CWDA 4XFDA 1H4SA 3GBVA 4Q9LA 5I9LA 3R7NA 1D4AA 3NTRA 5JWHA 5TQVA 1ZVQA 4TS3A 3BHMA 4B71A 3EG5A 3WYNA 2NIPA 1KFEB 5JVDB 1PFUA 3KR1A 2Z6VA 3GQBB 3CTPA 4M0LA 5FUBA 3WAJA 2X4DA 4GGMX 5LQRA 1V43A 2I80A 5HIIA 1XMQM 1UKVY 4OBXA 1OI3A 4W5NA 1P7YA 4H3KB 3IDSA 4O2BF 3AY3A 5IZ4A 3KYDB 4UHBA 1U2RA 3AJIB 2CGEA 4TRJA 1UOPA 1JBEA 4LVUA 2VTEA 2QI9F 3VNAA 4PN7A 1KMHA 2PMBA 2IEZA 3UAZA 2D5BA 5EQJB 2XFSA 3HBLA 2J6IA 1F5SA 1TAQA 4KXMA 4LXTA 5EZ5A 4E5DA 4J3JA 1VKHA 2FSUA 1D2AA 3S27A 1JDZA 2VUIB 2QW0X 1UUFA 4GLBA 1DDIA 5DNAA 5BUQA 1VG0B 4M1KA 3DUFB 1OB5A 1Z73A 2QZSA 3EXEA 1V25A 5GJVC 3OZIA 3SJBA 2XUKA 4AY5A 1T9AA 4EGCB 5JG7A 5E2IA 3WZLA 1JBKA 2AMLA 2Q28A 2PGLA 3PR2B 3CWQA 3M2PA 2NAFA 4E7PA 4OI0A 4B79A 5EUMA 3KOZA 2FMFA 3PR3A 1KSFX 1XJ5A 1U0HC 1FW8A 5D3MA 1H2ZA 1XTZA 2OLEA 5F4BA 3TTSA 3DLAA 5I8WA 4CWAA 1X7YA 2A2ZA 2QMZA 2GH1A 5EHNA 4X65B 1DGHA 3N07A 4H15A 3S8YA 3SQOA 2E5LM 5EWMB 4V39A 3EEQA 3C43A 4YGYA 4TLCA 5CDFE 1YZKA 1C4KA 3V8RA 4BNDB 4RFSB 1PT8A 4YUVA 3AZPA 3TXAA 3BRWA 3CRNA 4ZYTA 3TEFA 1X80A 3JQ7A 1Y6FA 1FDWA 1TOAA 3C39A 5KSWB 1T2EA 4UAVA 1AQLA 2G5CA 3L0CA 4J76A 4JJFA 1TUIA 4ARBA 2I1QA 1L5YA 1BJKA 5E6UB 2Q5CA 3ICQB 4C4ZA 1ZMXA 1KFKB 1NX6A 3NT4A 3UUGA 2O1EA 3ZBTA 3NT2A 3NVAA 1P2VA 2QLLA 5EE0A 3BXFA 3MJSA 2YYSA 4UTVA 2J0QA 2GZHA 4TMVA 1UR5A 5AW8A 3IERA 3TE7A 4IIYA 4PYLA 5EP2A 1BKYA 3SYMA 3W5IA 3HJHA 2JVKA 4IJEA 8OHMA 5I8ZA 5EP4A 1VDMA 3D6VA 5FNVF 1ST3A 1UBLS 3GEMA 1XDBA 4LOJA 3M1IA 4KN6A 3CURA 2CNLA 2GBPA 5ITRA 2XFTA 1FVXA 1NC1A 4YJ2F 4YS6A 2PZAA 3LLSA 1MA0A 4F9GA 2Z2KA 4NJOA 4UOQA 4QFBA 4V1CB 5BP7A 4QUEA 1XV5A 1V3VA 1QP0A 4C3OB 1W36C 1I7PA 2IPNA 4NDZA 1P44A 2AI1A 3HH8A 2GYYA 2F17A 1RJ9A 3MTEA 3ND8A 1V6AA 3SHVA 2Z9CA 3GLTA 3M6IA 3WHPA 4WZZA 1VI6A 1O9HA 1NJFA 1VMEA 1KU6A 3SM9A 3HDHA 1R0KA 3HYTA 1O03A 1DQNA 4A9AA 5IANA 3ZDQA 4EQ6A 4KGDA 3TM4A 3VR2D 2C3MA 4JBIA 1RXUA 5EI5A 2ODEA 3CH6A 1IN6A 5C8YA 1BIFA 4I81A 3F9IA 3M33A 2V6MA 2FRVA 1NY5A 4F8YA 2XYHA 1U8YA 1DE0A 4X94A 1JI3A 1ZIDA 1QQ7A 2FN4A 1WPXA 3QKRA 4IDPA 4CT4B 3NOVA 3R9XA 2YBEA 4UW9A 4EJSA 5GZ6A 1GT6A 1XQ1A 3K4PA 1E7WA 1M8KA 5EEGA 1XZLA 1ZCZA 2C42A 4FD2A 1ZH2A 2XX3A 2G88A 1B74A 5A71A 3GQ4A 1E6UA 4M4SA 4RK7A 3I6QA 4TUYB 2BW0A 5FA8A 1Z83A 4FHEA 4C4PA 4GKBA 4UTOA 1SG9A 1A98A 4FGUA 4MW6A 5LZ2A 4EECA 1BRTA 3PJRA 5BNFA 3RUFA 3OQIB 2FZLA 3JR7A 2DAEA 2ZYTX 4K9OA 4ZZ1A 3K70C 1VPVA 4ZEVA 2BSXA 2WIFA 1W73A 1IEWA 1JDJA 3VR4A 2CFOA 3TI9A 2C3OA 1T3LA 2GRAA 1G5IA 1NNI1 2A0UA 3LUPA 4UVIA 4Y0NA 1HT2E 4R9VA 1VQ1A 4OJTA 5CYOA 3IOYA 3ZWYA 1TYBE 5BR8B 2J0UA 2W2XA 5EUQB 5DLDA 5DO9A 3F6BX 1R4NA 2X4AA 3OEHD 4K9LA 1VCHA 2HYDA 3WK7A 1J6UA 1L4NA 2IUSA 3MK31 4DBLE 5EPUA 1Z7WA 4FD3A 3WV5A 3RUDA 4YC7A 1XTPA 5JPIA 3FPCA 1KJ9A 2EQAA 4HFNA 3S1SA 2O8FA 3UPTA 3A2KA 4YCNA 4A8JB 1J5XA 1U4NA 5AIBA 1K7XB 4CFYA 4Q4LA 2XE7A 3G89A 3GN2A 3RIYA 4AM8A 1JHXA 2ZR0A 3UWDA 1SOWA 1TVKB 3LUDA 5K3FB 1JI0A 3EUFA 4C4TA 3I39X 3GA7A 4RV9A 4Z0TA 2GXSA 3QE4A 1SZDA 3BH6A 4IJMA 4AG6A 3JR5A 2JA2A 1WO8A 3SLKA 1I7DA 3ZGLA 1QAOA 5KUTA 2VHCA 4Q03A 2HEGA 1HSZA 3WQBA 2W2NA 5T64A 5CDTA 2VTKA 1TEZA 5FKJA 5TXGA 4J1NA 5JZ9A 3ZWXA 2ZUCA 4CIVA 3QMVA 3M4YA 1PQWA 2VDMB 2ENWA 3F49S 3HK2A 3GBPA 5A7HA 4RNCA 2Q9UA 1L6IA 3DT6A 3ZHQA 4EI7A 4AMVA 3MQ4A 1QIKA 3WBFA 1W52X 2VPXA 1E0KA 3NWEA 3SHGB 2HU5A 4EO9A 1FFSA 3AJ9A 3P9SA 4AJJA 3MGAA 3CVVA 1R9MA 2QMHA 4IR7A 5DCUA 2PNFA 4G8DA 1YZVA 4EF4A 4WXEA 1AZSC 1VSVA 4KQEA 3FDZA 3LSYA 1Q12A 4Y6GB 5ISMA 3IVXA 4YGXB 1TO1E 2IPLA 2XADA 5A0TA 1DBPA 3QMMA 3ZDZB 1Y1RA 1R37A 2E87A 2JVJA 2GJSA 3IA2A 3KZVA 5DLYA 5EYPB 1K1EA 4BYGA 4HYEA 2Z2YA 2VDBB 1RLTA 1RJFA 3GNLA 5JH7B 1SZPA 4OTZA 4UU0A 4CMBA 2C4NA 2A14A 1H4TA 4IDOA 1R12A 1VHLA 3BE8A 1G8KA 2E0IA 1UEXC 5KYGA 3HVJA 2IYYA 1YNOA 4WT7A 4LNUB 1T9GR 3EGVA 3L8ZA 3GXBA 3NGMA 1ONOA 4XM2A 1NNLA 1Y7LA 1ZK0A 2HJSA 4DYDA 4QATA 1T4GA 1II9A 1RPZA 1MB0A 5C9ZA 3SIRA 4R6XA 4YQEA 1QF7A 1BDJA 4HDNB 1S4MA 2PSJA 1ZITA 3VK7A 4PG4A 1XZDA 3GPBA 4HLCA 4DE5A 1K9VF 2HSJA 3TLKA 1SQ6A 4RNDB 1RRMA 2I22A 2LVNC 3DTYA 4TYYA 2FVYA 2VLIA 2CLKB 1Z08A 2I99A 2JAOA 2QQEA 2JFYA 3ICEA 1V1MA 2G1AA 4BVLA 3B8EA 2VPQA 1N6IA 1GDHA 2JZNA 1NBMD 2F3TA 2ZBVA 3AEQA 1P6UA 2Z9BA 1FX0B 2ZS9A 3AF0A 3P45A 2IHKA 1Z8HA 5E7JA 3OTWA 3B3FA 3QVJA 2DXIA 3I9OA 1Y9ZA 1X7XB 2R6ZA 4NKRA 1HI9A 4K8OA 5FQNA 1HLDA 2D7DA 3C7AA 2F8LA 4Y9RA 1IXSB 1AZWA 1YD7A 5AI4A 5GONA 1KFCB 2RHCA 3OECA 1IZ7A 5JDCA 1TUGA 1H93A 3LMKA 3UMYA 5E4JA 3THXA 2DLDA 1VJGA 4GI2A 2E49A 2XWSA 3C6KA 3LVQE 3HNRA 1G98A 1CDZA 4FFNA 2Z6UA 3ABIA 5I7EA 1IHDA 3QWBA 2BI8A 1KI9A 1J1UA 1NU6A 5JCOA 2Q2WA 2JGFA 1YLAA 3PG5A 4ZQFA 2LE0A 1W4AA 2O2IA 3DZGA 4BVJA 3SHQA 5JMPA 1ZR4A 1SHUX 1JQAA 5IRCD 2RH8A 3RADC 4MDEA 2C03A 4QO8A 1EFDN 2PSSA 5BNZA 1M9NA 2X9GA 2PD3A 3BA1A 1KOFA 2O5VA 4LY3A 5HQ3B 4B6PA 4BCBA 4HH0A 2NZ2A 1ZO8A 1JEOA 4N82A 2PT6A 2L42A 5BVGA 2IH4A 3NBKA 5ECDA 2PUDA 2Y68A 4Q1FA 2D5LA 3JAKB 2R6AA 3UV6A 4N0DA 3UQZA 4MYCA 1BE1A 1MBZA 1AV6A 2XB6A 3ZWPA 2P62A 3DP9A 4Y18A 1N6HA 2WIKA 3OTIA 2C2GA 4PIPA 4OA5A 2IHUA 4YX9A 4AJ4A 4N01A 1YJAA 3CEMA 2O23A 1BXZA 4G5FA 4ZT7A 1E7RA 4EYOA 3I37X 4GI3A 5SY9A 3ZS9A 4P4SA 3GNSA 2CN1A 1NVAA 4Q15A 2DBRA 2GKGA 2L19A 1U7ZA 4WZBB 1E8MA 5E1MA 3IKMB 1NW3A 2W2MA 4B7FA 3DO5A 4UNQA 4EY6A 5E1DA 5DNCA 3FGOA 5AI8A 3SR0A 1CNMA 5ER6A 4ZICA 3K1AB 1QHEA 1ESMA 4IDEA 3VOAA 3JW8A 1NZFA 4KFSA 5K2MA 2VHJA 3LBAA 4RHXA 2BTEA 1PGNA 3FA2A 3G9UA 1MGOA 4GBGA 5IJXA 3GCGA 3N2YA 1DXQA 3E2IA 3Q10A 1J39A 4REMA 1T24A 4FR0A 2QN8A 5T4FA 4GITA 2K2QB 1NMSA 3V4RA 4DNOA 4IUBS 3A3YA 4HB3A 3ZK7A 1HWYA 4P92A 4KU4A 1FQJA 1XZKA 2OC9A 4AUNA 1DJOA 1FTQA 5SYAA 4RPIA 3WP1B 3ZCRA 3HUUA 4PGAA 3FZQA 3GH3A 1C9KA 4YJFA 1E1QD 3KU4A 4YQZA 4RGYA 1KDVA 2PEYA 3GD5A 1I51A 1O96B 2IP1A 3MAAC 3Q6MA 3OJXA 2AGVA 3T7JA 1SBIA 1SXJD 1PVOA 3R3HA 5JAHA 1RLJA 2HCJB 5LSAA 2VJKA 4M55A 3ZDXB 1VMAA 4HSEA 1MRZA 5LQJA 3AUSA 1SKUA 2DMRA 2XD9A 3O4HA 5IHXA 4XXHA 3IKLA 2VSXA 1NBAA 1EFRD 1QGOA 1B3RA 5KMGB 3EMBA 4UHEA 2Y93A 4LRTB 3W8FA 1RXIA 3FCSB 2FH0A 2YVAA 4R9RA 5KQDA 3H13A 3H1AA 4X9XA 2O05A 3S8MA 1D04A 4HGRA 1W7AA 2EP7A 2O0JA 3E2MA 4LDZA 2X5JO 1QGUA 5P8WA 3Q3VA 3DL7A 4F45A 1F06A 2ZB8A 1ECPA 1G8GA 1ZRNA 1CUYA 2A59A 1E5DA 2HA2A 1O6ZA 2JARA 3CUEF 3WZ2A 1N5OX 4CLRA 5JNWA 3H2HA 1U1EA 4OHCA 4E1BA 2PUWA 4PR0A 5FPPA 4F21A 5G0UA 3L0BA 2DWLA 3PP8A 4Q1EA 3TWMA 3PCTA 3TH5A 4BZWA 4Z7OB 2FX5A 3MGGA 4N6NA 3Q4GA 3EJ6A 4CKWB 2GAJA 4KGVA 4G41A 4BQSA 4H6PA 2YV1A 4Y67A 3SEAA 3LO5A 1ZN2A 1MRNA 4AJIA 4KQGA 1UMDB 3U40A 4CKCA 2AMFA 2PS0A 4L75A 4RZHA 4DA4A 5A6VA 4WASA 2C2YA 2JKZA 3GJXC 4NK5A 4MR8B 2HSZA 2CLFB 1P29A 4WESB 3GLQA 3OF2A 4DNQA 4G0XA 4LJ5A 3IO5A 4C21A 1ESZA 1YULA 3GUHA 3KTAB 3IS3A 5G4KB 1SC9A 3EQZA 2PJZA 2PX8A 1PYDA 5JE8A 3CJTA 2C9ZA 4XCQA 5GZ3A 4BGDA 4ZCIA 3PDUA 1D0IA 4ZV9A 3B3GA 3BDVA 3ZZNA 1CQXA 1NWHA 1D6NA 3V8PA 3TW4A 3BSYA 1NPDA 1K8QA 2WHXA 3VPCA 2BFFB 3A4TA 4HN2A 2YJTD 5TJ9A 2QAGB 1O7JA 5HFJA 4MMXB 3LUJA 2IP2A 3VOSA 5DLEA 3CF6R 4JJ6A 5EHZA 3LO8A 2D4HA 3IMFA 3TZKA 4H27A 1WBJB 1Y3FE 4ZHSA 3L7CA 5GGXA 3VU0A 2BKUA 1E2BA 5T3UA 3V97A 3EEYA 2XNDA 2XPCA 3M4NA 4QBKA 2MMCA 3I6BA 4D46A 3PHCA 4JEHA 3STWA 2ZVPX 3CZRA 3AF4A 1N6RA 4FJ1A 2ZIVB 2BUAA 4Q4CA 4Z1MD 1DKRA 2FQQA 4YMIA 4V0RA 4CLDA 1BVYF 3DXFA 3H04A 4K7JA 5I7VA 1WCIB 1T1EA 4U7DA 3UJBA 1XAJA 1X7WB 5HGJA 4BN5A 3ZV7A 4R5MA 4MW5A 5B5SA 1DFHA 5KAMA 4EJ0A 2R4EA 4B6RA 1SWWA 2QE6A 5HFNA 2JHCA 3MPUA 3I05A 3KCNA 4XA8A 1ZONA 1G7CA 3UT6A 1J5EM 2QI9C 2GPYA 2BIFA 3RU7A 2PXHA 5A1TA 4BPRA 1NL3A 4P5EA 4DV4B 2XT0A 1D0SA 3W1WA 5K6TA 1D2EA 2G07A 5ENZA 1CVIA 1QHHB 2GBFA 1MRSA 3O2SB 3OEED 2GWHA 4FDMA 1UBHS 1F3OA 1BDHA 2M6SA 4OQMA 4RYDA 3MTIA 4TLAA 1HL3A 1X8LA 2I0FA 2Y27A 2X7XA 1E9SA 4B44A 2PA0A 4A2WA 3WP0A 2P0EA 1OWMA 3D0OA 5AVXA 3I9V6 2VHXA 3GFSA 4HY3A 1ZR2A 1FCJA 2IFTA 2WVHA 3UAWA 2Y0DA 3RUAA 2A3RA 1IU9A 1VLLA 1TF2A 1TQ4A 1RFGE 1P72A 4ND7A 5H5JA 4EB6A 1PS9A 2NVUA 2PLRA 3H9CA 5L4SA 5BVHA 2XF3A 1GNQA 2CJYA 2A9PA 1CZLA 3A9WA 1N36B 1Z36A 2G7MC 4EHIA 1PD0A 3IOBA 2NO9A 2ZWOA 5ADUS 1FFCA 3A42A 2CCJA 2QL9A 3JPWA 4Q1VA 4PHFA 5IDYA 2EKDA 3IP8A 2Z4TA 5KPZA 3AIIA 1RZ3A 1W76A 4ZVRA 3KZNA 2C29D 2WPDA 3VGPA 3ZW9A 1E6EA 3GZJA 4NP6A 5K8VA 3D6AA 4LOAA 4NATA 4MVXA 3S7TA 1B23P 3O3OB 1N4DA 1VKRA 1AK2A 1YR8A 2AKAB 3JQFC 5KVCA 4KMMA 3CXRA 3RYHB 1BD3A 2FCAA 4AQDA 1TRKA 2HIHA 5ICGA 3RQIA 3AXTA 1D4OA 1IBKB 2QEQA 1Z22A 1PG5A 3IT2A 4C0AC 1Z16A 3P26A 5EGSA 5DVZA 4X54A 1WEHA 4LF5M 4V0OA 1N32B 2WBLC 2DEUA 1JT9A 4TXHA 1VBKA 1N2OA 4FT2A 2GFQA 4XOIA 1MNAA 1SCUA 5KNCA 4C2BA 2O6HA 1ADJA 4BO2A 2E4YA 3S2FA 1TVEA 1YU9A 4AWXA 1CXZA 2ST1A 4MVWA 1NM5A 3V8QA 1HORA 2FW9A 1NUPA 3A6JA 2RKWA 3U1TA 1TF0B 2KJQA 1GXSB 5EIAA 5G40A 2R6JA 3LGAA 5J4LA 5EIBC 1MU5A 3GL9A 3PQ5A 2CWWA 1XSEA 1WZNA 3MN1A 3WK9A 2FEMA 2R8YA 2AIRA 4Y1RA 4YJHB 1KAQA 2I76A 3DO8A 1HFWA 4S1TA 1YDHA 1PS8A 4NK4A 4FQ8A 5GVSA 1Q0QA 3HV0A 3STTA 3C6ZA 3EFEA 4KYUA 4AZ3A 2ZDGA 1V1RB 3RDPA 3K8OE 5BR4A 1TYAE 1VFPA 1KE2A 2NU6B 4B8ZA 5LXTF 1BJTA 3R7WB 1RCTE 1JSCA 2NUTA 3LXXA 4OJKA 3QKUA 3CG0A 3INGA 1AF7A 1ZSVA 1PL6A 4EA6A 2B1RA 2HEIA 5EHXA 5HVNA 1VMIA 4CMKA 4ANRA 4OHMA 3WYGA 3LE8A 3U60B 1TC1A 3QOWA 2AN1A 1QNFA 1WXEA 2PRZA 1Z28A 2IV3A 4CM3A 2QUKA 2OGZA 4RVFA 4CQMB 3C3XA 4H7HA 1VHJA 5HUHA 3BE5A 2W83A 4A23A 2QB5A 2AFHE 1NQUA 1PG0A 3ZDEA 4XH9B 3OLVA 1QORA 1FB5A 5IXSA 3EDCA 4K0KM 2CW5A 2FQYA 2AZDA 4MR7B 2PSFA 1P0MA 3U37A 3PX2A 3AFGA 4DDUA 3DJFA 4LTMA 2XHEA 4WKGA 5FWYA 4TKVA 1QCCA 2GAAA 2CVHA 1KZ1A 3AVVA 1JKIA 3EC1A 4MUAA 2IDJA 1T8YA 1O95D 4LJ4A 3Q3IA 4DG9A 1AB5A 4NOMA 4FU0A 2Z58A 5F2NA 4FK8A 1KIFA 1QS0A 1RHKA 5ELMA 4HUQA 3IURA 3O9MA 1HQYE 1ZH6A 4WLEA 4RDHA 3ZWKA 3BEDA 2N75A 1M0TA 3ELYA 3D7KA 4HX5A 2H4XA 5ICMA 3WJ2A 4G9BA 3JWGA 4J6EA 2R0QC 1NJGA 3K3PA 4G4QA 3IE0A 3T06B 2VSNA 4BAZA 1SVIA 1Y1TA 3U1BA 2B92A 4K6CA 2PSEA 3MCVA 1Z62A 4FFPA 1P7ZA 1OZ0A 1XCJA 2J0SA 2EFHB 1O94D 3DBIA 3PDCA 1OU0A 3LCJA 1K4MA 2UUOA 3HDVA 3NG1A 3KM0A 3KR2A 4J7UA 4TMFA 1VFNA 2VHYA 2VI5A 3A28A 4FKZA 3QRWA 1O6FA 1UM8A 1RLIA 2A4MA 3KUXA 4I1VA 2KW0A 2PS1A 4PY2A 1OILA 2AH5A 3TE6A 1X9IA 1BH6A 2OM6A 1Z4KA 5FBWB 3CPEA 3FKQA 2R86A 1WQ3A 1PNTA 4XYEA 4WNIA 2Q49A 1N5JA 3TBHA 3I58A 3NJRA 4FVTA 4ZO9A 4OUDA 4AI6A 4DMRA 3UMJA 1I3KA 3EEOA 4PTLA 2PZKA 2QVZX 1H1TA 4HZGA 3EXIB 4EK9A 3EZLA 1H8HD 1Z2DA 2FE1A 4TXMA 1JKJB 4HRVA 4LTNA 3K32A 1UJNA 4QDOA 1QKJA 3T5BA 2X1MA 3L3BA 5BT9A 4OHVA 1HLGA 3V80A 3FNGA 1DBRA 1U8EA 1PJIA 2XOKA 3FNIA 3BVPA 4RACA 2NXWA 2PUAA 3C3DA 2WYOA 2BGTA 3IAFA 2F43A 4NCNA 3KJQA 1MO5A 3H9BA 1WUHS 4QDTA 2DAMA 4XIYA 4F91B 4I0WB 1XDGA 1U0OC 3FSGD 1SK8A 4EYEA 1Q0LA 2VYFA 7ADHA 3VDQA 2UXCM 1WR1B 1L5SA 1K5DA 3LL7A 5D7NA 2XMCA 3Q8LA 4Y8VA 4YY3M 1U5BA 4PHGA 3SN6A 5TR9A 4RGBA 2I55A 2IWHA 4ZCMA 4KI7A 3CR3C 3QOXA 5L3SB 2H7VA 2NTEA 2G8LA 4TLDA 3ZN2A 2WKWA 1N1MA 2NU7A 3B70A 2IYVA 1Z5WA 2XKJE 4AL4A 3LUKA 1GTJ1 3W9UA 4R2JA 4QTUB 1RYDA 1YDFA 4O25A 3SI7A 1FDTA 3CLVA 3S8EA 4E03A 4S04A 1CEXA 1T9ZA 1E32A 5AQ1A 3RVJA 4U2KA 3TBKA 1AN0A 4I9UA 4A2PA 3HU2A 3F96A 3SQMA 1V35A 5ER9A 3FGZA 1M2VB 4N7JA 4KSCA 2XH9A 1U1CA 5CCDA 2OBBA 4JP5A 2AG1A 1P4RA 4GX1A 4D0LB 1U28A 3AFOA 2V7UA 1KO1A 3CKMA 4WNAB 3V1UA 2EL9A 3OC0A 3JQRA 2VRBA 1XEWY 1N0WA 1E1MA 4RELA 2O2EA 1R8YA 3TUJC 3DLIA 3CRW1 5G4LA 4ZHQB 1AUPA 4DLSA 1G21A 1UKZA 2ODAA 5WRFA 4OJMX 1L5WA 5BUCA 1RQXA 3ECSA 2NQ2C 3L6CA 5DHUA 2JCSA 4BZQA 1U02A 2IKSA 1G18A 3LZDA 1TMYA 3QELA 2ACWA 4TT3D 1R6TA 2BFBA 5KYNA 1FFBA 4O1MA 4J0HA 2IT1A 3SDZA 3QF4B 1FUKA 2C7QA 5BQPA 1N0VC 1V26A 2QJOA 1OH5A 3X2FA 4JI8M 3N74A 4MP3A 4UPDA 2IXAA 3F3MA 2UZAA 1YQQA 3PT9A 3ZCVA 2YJ4A 3KLNA 5H8WA 4F4FA 3AJDA 1C30B 2H2HA 3QA9A 3IUYA 4W5JA 2LW7A 3IESA 4Z9XA 2GNAA 4FCTA 4F6RA 2XOEA 3FZYA 3NBFA 4P7GA 4TVSA 4RD0A 2QZZA 4UARA 2DGDA 2J45A 5EIHA 1GY8A 1XK7A 4C6TB 2RGBA 3UKJA 1WMSA 4QECA 5EJ2A 3OCZA 4IIEA 5B4UA 1UPUA 4WW0A 1OJLA 1GUAA 3CUSA 4MARA 5F23A 1HE3A 3CX3A 4WLUA 4HH1A 4AECA 5BWLA 1U3FA 3I2IA 1IY9A 2QX4A 4FGWA 2ODWA 5BSMA 1X1RA 3IAM6 3MUEA 2KLBA 4E5VA 1C8LA 3R7AA 5E95A 2WZBA 3MT0A 4D0NA 1FBNA 3A9RA 4YP7A 3W90A 4QD3A 1JFFB 3UJNA 2W42A 4OGWA <