4GC9A

Crystal structure of murine tfb1m in complex with sam
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
318
structure length
317
Chain Sequence
FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dimethyladenosine transferase 1, mitochondrial
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
total genus 93
structure length 317
sequence length 318
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc9A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc9A01
4PGHA 4P7FA 4RTJA 2ZZNA 3FPEA 2P1DA 3OZRA 5FULA 3TM4A 1JG1A 3JWGA 3UJ6A 5DX1A 3KR0A 2ZTHA 5K03A 5HEKA 3T7TA 1QANA 5K09A 3QOXA 3LBFA 1VP3A 3B3FA 1EQAA 3MTIA 2AOWA 4KIGA 3SSNA 3C6MA 2EX4A 5EMKA 1V39A 2XYVA 2XYQA 4GF5A 2AOTB 4MWZA 4R05A 4RTMA 1JQ3A 5CVJA 4AUKA 1NV9A 4DMGA 4RTKA 4RTOA 2E5WA 3FRHA 5GM1A 3C3YA 1AV6A 2PXXA 4ER7A 4X61A 5K0FA 5H02A 1AF7A 2O07A 2Z6AA 2I62A 3O4FA 2WA1A 3S68A 2G8NA 2VZ9A 3BUSA 3R9XB 4LECA 2PBFA 2YXEA 2ZCJA 2B9EA 3ELYA 3NW9A 3P71T 5E2AA 3PFHA 2ZBRA 1RI2A 1D2HA 3M70A 3I9FA 1H1DA 2QM3A 1JG2A 2VS1A 4DF3A 4PYKA 3LDUA 4EQZA 3HVKA 4PYJA 3DOUA 5BW5A 2H11A 1YFJA 4EKGA 5K0NA 3DXZA 3Q87B 3BWYA 3EGVA 3HNRA 2ZSUA 3SSMA 4CWAA 1PJZA 2QY6A 4LWOA 5ERGB 3ER8A 1XJ5A 3SMQA 3EVFA 3AWIA 5BXYA 4KWCA 5DM0A 1N2XA 4IV0A 3EGIA 1G8AA 1QAOA 4L7VA 1M6EX 4PCLA 3I58A 1FBNA 2BR3A 1EJ0A 2AOUB 2AR0A 1BHJA 4FSXA 4F84A 4QDKA 1ZHFA 2ZVJA 1KIAA 4M38A 4PYQA 1P1BA 1SQGA 2ZWVA 2HMYB 1KPIA 3G5TA 4PINA 3M6WA 1Y8CA 2PY6A 4YV2A 4HGYA 3B3GA 5CCBA 3PTAA 1B42A 4V0RA 1MJFA 3HCDA 2JJQA 3DR5A 3A27A 5F2NA 4CXMA 1Q0TA 2XYRA 2QE6A 5HILA 2ONYA 5E8JA 4OBWA 5GWXA 2HR1A 4YUYA 2IP2A 3LDGA 3ELUA 3EMBA 1M6YA 4GC9A 1IM8A 3A26A 3KQPA 3PVCA 3E05A 4GOLD 3LGAA 2ZW9A 4ISCA 4A6EA 3P97A 8MHTA 4YUZA 7MHTA 1NW3A 5LQCA 3E23A 4GOOD 5KQSA 2I6GA 1N7IA 3FTCA 3EVEA 2G71A 3GIWA 3G2OA 1NV8A 3A7EA 3AXTA 4U7TB 4X1OA 3NVMB 3MTEA 2HV9A 1WS6A 5D1NA 4E2ZA 1R18A 2H00A 4DKJA 3BXOA 4F86A 3T7SA 1F38A 1SUSA 3HA7A 1ZGJA 5EHGA 3HTXA 2OYRA 2NXCA 3TPZA 4DCGA 3O31A 3HA3A 3UFBA 1SUIA 4HTFA 5GIPE 4RTLA 2YTZA 3G88A 5MHTA 3FTEA 1YFLA 4E2YA 5IKMA 5CVVA 1N7JA 3K6RA 3EVGA 3NMUF 5FTWA 2HTEA 2NXNA 5DRTA 2ZIFA 1SVUA 2UYQA 1D2CA 5GP1A 5K0GA 3OFJA 1WXWA 5ICEA 3G8BA 4HH4A 3FUVA 5EMJA 4E2XA 1YZ3A 5E9JA 2AOXA 5T6BA 5B1SA 2PSSA 4KVZA 3CJTA 1X1DA 3C0KA 2GLUA 3HEMA 3KQQA 4H0NA 3I5UA 4ER6A 2PWYA 2EG5A 4XUDA 1L3CA 4GUAA 3LCVB 3OU2A 3VYWA 4R6WA 3P9KA 4PONA 4LG1A 4NECA 4RWZA 3FUTA 1AQJA 1RJDA 4XUCA 2OXTA 4QDJA 3JWJA 3FZGA 3LCCA 1NW7A 2P41A 3EVBA 5FUBA 1KP9A 3FPJA 4IWNA 5EMLA 3T0IA 1WY7A 5FA5A 5CVEA 4GOND 4YV0A 4X60A 1ZQ9A 3HVIA 3QV2A 5KQRA 4RVHA 3IHTA 3M6UA 3DMFA 3MCTA 5DM2A 5T67A 1XXLA 5K01A 2AN4A 3EPPA 4M7RA 5FWAA 2BR5A 3WSTA 2Y1WA 1KR5A 2EJTA 2B25A 3F4KA 2YQZA 2DULA 3O7WA 5EPEA 3P9CA 10MHA 3UJDA 2IBSA 4KIFA 5K0BA 5DSTA 2B78A 2WK1A 1OR8A 2F8LA 2G72A 3P8ZA 3UJAA 3KPWA 5EMMA 5LQAA 1F3LA 1JQEA 2IDJA 2AN3A 1KYWA 5G02A 5K0JA 2OBFA 3ER9A 4RX1A 2UYCA 4RV9A 3DXYA 2P3OA 4ATNA 5E1OA 5EEHA 3SSOA 3M4XA 3LSTA 3CBGA 2IH4A 4QVGA 4MTLA 5C0OE 5K0LA 4QTUB 1EIZA 1TW3A 3GNLA 2Q41A 3UBTA 1ZG3A 1PRYA 2Z6UA 4PYOA 5HIMA 3GGDA 4WXHA 3NJRA 4KDCA 1KXZA 2PXCA 4ER0A 1P91A 1G60A 2P3QA 2NP6A 3DXXA 4M37A 3UJ7A 3KKZA 3MQ2A 3UA3A 1BOOA 4IKPA 2VDUE 3MCZA 4OX9Y 3PX2A 3GRVA 4CKEA 3BZBA 1IXKA 3LDFA 4KDRA 2BH2A 2P7HA 5DTRA 2PJDA 3GO4A 1R00A 5KS2A 4RTRA 3V8VA 1JTFA 1ZGAA 5FADA 4DM3A 3CKKA 3FUWA 2PV0A 1U2ZA 2HWKA 4YUWA 3HCBA 5CCXA 3OU6A 2AVNA 5HIKA 5CD1A 3ELDA 4PGGA 1DUSA 2PX4A 3GDHA 4QQKA 5DLYA 5GM2A 1VLMA 4C06A 4DQ0A 1EG2A 2FPOA 5CIYA 3KQSA 3P9IA 1TPYA 4DA4A 5BP7A 2NXJA 2NNWB 2OY0A 4P7KA 5HIIA 2R3SA 2YVLA 5DXAA 1MHTA 1UFKA 5FHQA 5GINE 3E7PA 3AXSA 5FCDA 4R8SA 1QZZA 1R8YA 2PWPA 5JR3A 1JTEA 2CMHA 3PS9A 4YUVA 1BKYA 5CUQA 2B2CA 1KYZA 2FYTA 3R0QA 4PIPA 5EQJB 1RI5A 3RODA 5DXJA 3A4TA 2PVCA 1G8SA 3NDJA 4RVDA 2OO3A 3KR2A 2QYOA 2O57A 4MIKA 2AS0A 3HP7A 2JHAA 4O29A 2IGTA 4R6XA 5DX8A 3KQVA 2IIPA 4G56A 3DLIA 2JHPA 3KR9A 1AQIA 3JWHA 2QRVB 3MB5A 2ZULA 4PYMA 5EG5A 4QPPA 3TFWA 4RTQA 3R3HA 2XBMA 4PNEA 2O0LA 1RJEA 2CL5A 4RTPA 3LCUA 1WZNA 3VC1A 4C04A 2C7QA 5EEGA 3P2EA 3BWMA 4BP3A 4X63A 4X41A 1JSZA 3MHTA 2I7CA 5EGSA 3NDIA 2R6ZA 1Z3CA 4FP9A 5LSAA 2YXDA 5DM4A 1YZHA 2ZIGA 1FP1D 1O54A 1Q0SA 1XDUA 2PGXA 3A7DA 3BGVA 3GRZA 3KPJA 3OE4A 3RIEA 2AVDA 2PX2A 3KQWA 2FCAA 4IV8A 5F2KA 3FPGA 3FYDA 3DP7A 3ORHA 3P9NA 3HCFA 2JH8A 4YMGA 3THRA 5EOVA 3TRKA 2CKDA 1VQ1A 4R8RA 4ZTBA 3GRUA 2OKCA 2PX5A 3L8DA 4V0QA 2OPBA 3UJ8A 3UJCA 2IBTA 3BT7A 2AOTA 4QPNA 3FUXA 4JXJA 4FGZA 1NBHA 3A25A 3M33A 4OQEA 4QVKA 5EIFA 4CTKA 5DTMA 1YB2A 5DTQA 1HMYA 1DL5A 1JG3A 4UOEA 2VDWA 3G8AA 2JH9A 1VBFA 2XVMA 2OB1A 5EZSA 4YUXA 1ORHA 5CM2Z 2NYUA 4HSGA 5E2BA 3EVAA 1R6AA 4PYNA 5JUWA 3LPMA 5LQUA 5FHRA 1UWVA 5F2OA 3CJQA 5DWQA 3M6VA 2IH2A 3E8SA 1XCJA 5KYGA 4RVFA 3SR4A 2GAFA 4C08A 2UYOA 5ICFA 3D2LA 3DUWA 3K0BA 2UYHA 5DM1A 5LQRA 1JSXA 3DMHA 4C03A 2UZ4A 3SVZA 3FTDA 4C4AA 1DCTA 3I64A 2P40A 1IY9A 3KR1A 2O06A 2V74B 3LHDA 4BY9E 2ZWAA 2AOUA 1JG4A 3NWEA 5E9WA 2P3LA 1BC5A 3CGGA 3PLAE 1VP9A 3FPFA 3R24A 1UIRA 2IH5A 3OFKA 3V97A 3M6XA 3DLCA 5U4XA 5T64A 4AZSA 1D2GA 5DSXA 1HNNA 2PLWA 3KQYA 3Q7EA 3QOWA 3P2IA 2BR4A 4E32A 4POOA 3GXOA 4Y2HA 2BZGA 3H2BA 4PWYA 4CTJA 1L3IA 2ONZA 3X0DA 2EFJA 5FA8A 3LECA 1X19A 5E8RA 1I1NA 3UJBA 1XVAA 3EVDA 2GB4A 2ZZKA 3IV6A 3OPNA 2Z6QA 3C3PA 1R8XA 3B5IA 2ESRA 4EKIA 2PKWA 3BKXA 3ERCA 4E31A 3LL7A 2JG3A 3B3JA 2FRXA 2I9KA 4AZWA 4XCXA 1RJFA 4E33A 3LX6A 3ME5A 3P2KA 4P58A 4A6DA 2AZTA 3UWPA 2CMGA 4E70A 5EIWA 1FP2A 5EHIA 3AY0A 5FQNA 3BWCA 4DZRA 5LQKA 2ZLBA 1XCLA 2N47A 3BWBA 3EVZA 3GCZA 3KQOA 1YF3A 2P35A 3CCFA 4LWPA 3SX0A 1I9GA 3DMGA 3GU3A 2NP7A 1INLA 3KU1A 4FS8A 4HTFB 2C7RA 1T43A 3ELWA 5HFJA 3MGGA 2H1RA 4EVIA 5KVAA 3TOSA 4EMSA 1M0EA 3THSA 1RI3A 4Z2YA 2WA2A 2ADMA 1P39A 2YXLA 3MAGA 5LR6A 5D1HA 1VIDA 2VP3A 1QYRA 3ANXA 4FT2A 3EEOA 1JQDA 2FK8A 1G6Q1 1X1AA 4GBED 4ER5A 5HIJA 4WVLA 2ZFUA 4BP1A 3KPYA 3OZTA 3NVKI 4YMHA 1NT2A 4OQDA 2VDVE 3G5LA 1NE2A 4E2WA 2ZBQA 5EC8A 3AJDA 3GWZA 1G38A 1EJ6A 2HNKA 3EGEA 2OB2A 1XDSA 2AOVA 4GOMD 5E1DA 5K0CA 1O9GA 2ZIEA 3HCEA 4PYIA 3JWIA 4GEKA 4HRAA 4AZTA 4EK9A 4PIMA 1VE3A 4U7PB 2PXAA 3G2PA 3FUUA 3B89A 4BLVA 1RI1A 2IFTA 5DX0A 4E30A 2GS9A 1R74A 1L9KA 4QQNA 3BGIA 3TKYA 2IPXA 3TQSA 2CWWA 3HVHA 3PX3A 3R6TA 5EKUA 3HVJA 3EEYA 3G2QA 2LD4A 4XUEA 3OZSA 2AN5A 3FPHA 5K8VA 3UJ9A 2FHPA 4OA8A 5IH3A 2V7EA 5EKXA 2ZZMA 1I4WA 4FT4A 3FRIA 5EVJA 3PB3A 3SXJA 3KPVA 3SGLA 4RVGA 3U81A 3UA4A 4MHTA 3HM2A 4K6MA 2A14A 5LQNA 1VL5A 3CC8A 3I53A 1X1CA 2IDKA 1EAMA 2GA9A 3PT9A 3TMAA 5C9ZA 1RJGA 4OA5A 4PYLA 4HG2A 3TM5A 3C6KA 1YUBA 2OZVA 5FQOA 4HC4A 4C07A 4RSRA 5P8WA 1SKMA 2B3TA 2G70A 1NW8A 1P1CA 4KW7A 1QAMA 1SG9A 1SQFA 1QAQA 1RI4A 1VPTA 1XTPA 4YV1A 3B7PA 2YUIA 4OBXA 4CKCA 5C1IA 2ZBPA 1KPHA 2FK7A 4FSDA 4F85A 5K0EA 3T7RA 1KHHA 2O05A 4FR0A 4AX8A 3G7UA 3IYLW 1KPGA 3MERA 4P7JA 1O9HA 5GOZA 4ER3A 1FJXA 3NWBA 4HGZA 5FWDA 2PT9A 5DRYA 4RTSA 5DT2A 9MHTA 3G89A 2Y1XA 3HCAA 3KQTA 3RW9A 2GH1A 1WG8A 5M5BA 3LBYA 4B17A 2DPMA 2P8JA 1L1EA 3BGDA 2XVAA 3HA5A 3IEIA 3NTVA 3FTFA 5ICCA 2PT6A 3GRYA 2NXEA 2EJUA 3HCCA 4BLWA 1NBIA 5HZMA 3DH0A 4GQBA 4AZVA 3REOA 5ICGA 4QTTB 3G2MA 4C05A 3ID6C 4BLUA 1NKVA 3KPUA 3SM3A 5E9QA 1ZKDA 3KHKA 2BM8A 4FZVA 2ORED 4P7GA 3TR6A 2K4MA 2BM9A 2P7IA 1ORIA 3LKDA 3VSEA 1L3BA 3GRRA 5CVUA 3EMDA 3UZUA 4RYLA 5E1MA 4RTNA 1NW5A 1NW6A 3BKWA 3CVOA 1WXXA 4Y30A 3LKZA 2C7OA 4GC5A 4DCMA 4CKBA 1G55A 4M36A 1XDZA 1FPQA 2YR0A 5LQJA 3DULA 2JHCA 5E1BA 3CJRA 3KQMA 2QRVA 3PFGA 3DTNA 3EVCA 3GJYA 4PCAA 3OCJA 3OU7A 5CVDA 5EZQA 4KRGA 5GIOE 2KW5A 2ERCA 2YX1A 3OE5A 4MQ4A 3VC2A 1X1BA 5DPMA 2C7PA 1TW2A 2GPYA 5BW4A 1JR4A 2PX8A 3TKAA 3FYCA 5HOQA 3TLJA 2G1PA 5K05A
chains in the Genus database with same CATH superfamily
1ZHHA 1GT6A 3AUAA 1S2GA 1OFVA 4LY9A 4TRNA 3CFYA 4ZJZA 1ADBA 4RTMA 2JF0A 3U3KA 4O8CA 1Q19A 1K68A 4IRXA 3WWEA 4PYJA 3GDGA 4A8TA 1CG6A 3H9UA 1X39A 2G4CA 4DNQA 2YKGA 3GV0A 4X8OA 2QSZA 1BA2A 3SMQA 2BGWA 1I36A 5I6DA 3VMMA 5DXFA 1WW2A 3B70A 2HYDA 2CXTA 3VO1A 3M6WA 4LMRA 4MAAA 3PTAA 1Q7GA 4CMJA 3DGFC 3KQPA 2ZWPA 3LKVA 5IUNC 4B6GA 4FYHA 3CWQA 1CVIA 2M1XA 3LBIA 1M6WA 1VSTA 1Z4KA 4R2IA 1IUKA 2EARA 1SUFA 3UGQA 4F72A 4DBZA 1DHRA 3K6RA 4D43A 3A1VA 4GYWA 1WXWA 2FEWB 5DP1A 2WPNA 1EVLA 3A6FA 4P33A 2NOAA 3KLOA 4CV2A 4XYEA 3M6MD 2CDRA 1BS9A 4HLUC 4I1SA 1QCDA 4O4LF 2OUKA 4MHSA 1V8BA 3DXYA 1ZYUA 1RHQA 2VHUA 4JB3A 4LVUA 1AGRA 1GRNA 2EYQA 2X9LA 2GRAA 5A62A 2D7DA 4UAUA 1YS2X 2CUTA 2Y0TA 1QLWA 2DQZA 4CV1A 4RJTA 3AUKA 4EEZA 4FGUA 2DFDA 3EOAI 3RKSA 3BHIA 2BY4A 4NSRA 5KTTA 2YVLA 1UFKA 2QS9A 3AVOA 4YUVA 1TI7A 3AFIA 4LK2A 5LFAA 2NZWA 4EJ6A 3H5TA 1PUJA 3ZWYA 2HRRA 2G08A 1E1QA 1O6CA 4Q9IA 5ILGA 3KUDA 1E2LA 3PU6A 3QNMA 4DYHA 1FP1D 3KPJA 1HPLA 5HA5A 3K6JA 1F2UA 4EL0A 3OX2A 3BE8A 4YWJA 4C87A 2V6JA 3E48A 4R5MA 4FGZA 1I6LA 3U4QB 4UTXA 5BPHA 2QRQA 1MPXA 2QMHA 2R1TA 1V34A 4JI8M 4Y6QA 2A0FA 3HEBA 4C03A 3OPYB 4FWIB 1QG6A 1TTHA 1SOUA 1XCOA 3RRFA 3UH1A 4YN3A 2TMKA 4BMOB 1P0FA 1XVTA 4GO1A 2C8JA 3QE2A 3EHEA 5C7YA 1Y1RA 1DGHA 1UDXA 3QPAA 4YA6A 2BLNA 5IJ0B 1MCZA 4MV8A 2V0CA 1NRXA 4RA6A 4LF7B 2QUJA 1ZKMA 2GJ4A 1THGA 1ORRA 1OQAA 1KY2A 1XYVA 1DIAA 4M88A 3K0KA 3OZAA 3A3KA 3VR2D 3ORSA 3PNSA 1QVWA 1YWGO 4A6PA 3ZV5A 4OQMA 1HG0A 2GN8A 2XECA 1SCJA 2B4RO 2ECFA 3GP8A 4M2LA 2DR3A 4XUEA 1V11B 2QUBA 1JPVA 4E1AA 3R7DA 1QRRA 4Q48A 4ITRC 5H3LA 4FEEA 5DIFA 4F2LA 1BQ3A 4LCJA 2EJVA 5ISMA 2QROA 1TK3A 2IYLD 4XM0A 1ECCA 3FCEA 1PFVA 4ACAA 3Q7IA 1F1JA 3IBSA 2JIBA 1U2RA 3IAHA 1CY4A 3UMMA 5CH5A 1Z2EA 3R6GA 3O21A 4LRUA 1J1IA 4K40A 2V6MA 1DAPA 1GY8A 1J23A 3DTVD 4DG9A 2PA0A 1KEWA 3LW5F 4I4TB 5JIBA 3D3NA 3C70A 1JT2A 2JGNA 1I8TA 3O8BA 1QANA 1C3EA 4MI6A 1OGYA 2XTZA 3GELA 1T1EA 5EJFA 4R0MA 3QLUA 4Q1VA 3OQ1A 1C2TA 2RK4A 1EWKA 1BH2A 4MKFA 3F7OA 4RK1A 5C5CA 3LFTA 4R1NA 1IY0A 3P9QA 2UZ3A 4TLEA 1TJPB 3G5MA 5BXYA 1OFHA 2VSQA 3HBAA 1MB4A 3NYRA 1DT3A 4Y6SA 1OQYA 3PXDA 1PQPA 5ALEA 1LNQA 5E26A 2QR2A 3QJ5A 2DCMA 4NPHA 4ZT4A 3ED5A 3P97A 4X64B 4PZLA 2QBYA 1U1IA 3DKIA 1F2VA 1OIWA 4KXWA 4LX8A 4ADSG 2AGVA 3UC5A 1IN1A 3NZEA 1NHGA 2X0DA 1RRVA 1T4CB 3IC5A 1D03A 2P2ZA 3HCWA 1W36B 2G17A 4CMEC 3PC8C 2ZR9A 3R44A 2X1LA 1GZ3A 3FKEA 2UUBM 1FE8A 3NORA 5ESRA 3HVIA 2C9DA 2GXSA 1RW4A 1VLZA 3R3WA 5SY6A 3O74A 2NUTB 4KIFA 3WB9A 2ZUVA 3S2SA 4AROA 1MRNA 5IKEA 3FR8A 1CUFA 1QKJA 1WCIB 4MQUA 1WPXA 3N39C 3VVLA 4A26A 1GZSA 1DQSA 1MZVA 2FW6A 2QLNA 3GMSA 5BSFA 3IVGA 4DADA 5IJAA 3RASA 3NM4A 4NC9A 4RTRA 3B6MA 5D84A 4KG7A 1X9GA 3JX9A 2YZNA 2YYAA 2QP4A 1QRUA 3GDHA 3MJVA 3RANA 4DLRA 4IIJB 1SRRA 3LUHA 1G6HA 1YZNA 1QZZA 4LMBA 1PTJA 2I2BA 4UBKA 1EBBA 4X8LA 5FWNA 3LPLA 1JYEA 4PX9A 1ILWA 4DLWA 2B34A 1DDGA 3FCYA 3FY4A 1GUDA 3JZIA 1LJLA 3RSQA 5FX2A 3E4DA 3OEED 3DL7A 2QZZA 3QVOA 3PWSA 1E1YA 1DV2A 4PLPA 5ALGA 4CL2A 2PH1A 1C1DA 1KQFA 1X1RA 3ZDZB 4PAWA 1YK1A 4JI4M 4DV7B 3HXMA 3RKRA 1C7JA 1BFDA 4IPTA 3VR6H 2X19A 2XRFA 5K0ZA 3LY9A 1NBMD 2GI4A 2CE2X 2XMCA 1J1UA 1S8OA 5L3RA 2WDPA 1NI5A 1OYVA 3G2IA 3HP4A 3TOVA 4D9BA 1CTQA 1AUAA 3D2BA 2G88A 4B7UA 5G53C 1YONA 2COEA 3PC2A 3R7AA 5C8ZA 2DWZB 1ZK0A 2V7QD 3VDPA 3PSHA 2RE8A 3FMOB 3CURA 3LO8A 1XA0A 3SC6A 1ZZEA 3HLTA 1TH4A 3EGEA 3ZDXB 4KGZA 3FIJA 3LNTA 2DWMA 2JL1A 2WTNA 1RZUA 4Q3OA 2BBSA 3CKLA 1YQGA 2H1LA 4U1RA 4YP9A 1EX1A 4NDAA 1I32A 2VAVA 4P16A 1FDRA 4YXWA 2O9JA 4PC1A 1YZYA 5TPWA 3EVTA 2XGSA 1B2RA 4IJ6A 5C31A 2A1UB 4WLOA 1U7UA 1G7CA 4DDMA 1ZJ6A 4BVBA 3O9VA 2C2BA 5DP2A 4RTSA 4RPGA 2SKDA 1MX9A 1JLMA 3G0GA 3KOYE 2ZJ6A 4IZ6A 1QUFA 1U0JA 1UOEA 1WBJB 1DKQA 1QNFA 2D2FA 3C3BA 1Z5BA 2XB6A 4C89A 1HT2E 5I7WA 1DJLA 1H42A 3ZHCA 5B6PA 1LW6E 3FJ1A 5HJ5A 2PX8A 1BDMA 3PQ6A 1DFHA 1Z33A 3GAFA 2E87A 5IABA 3VKFA 4CT4B 2JLWA 1SHUX 3V1LA 2LV8A 4DPKA 3TLXA 4HHEA 5EPOA 3DFZA 1SKYE 2QVBA 5BMVB 3UOAB 2VO1A 1JKJA 2XDAA 3SBOA 2RG1A 4G81A 3UAXA 3BFJA 2OAQ1 4OJNA 3O4JA 4GKJM 4OGWA 2RONA 4KO2S 4MGZR 5IBRA 1SXJD 1P9LA 1QG0A 2XDQA 3T1NA 4NXNM 1AB6A 2FRDC 2OHJA 4Q9DA 1JIUA 1QJ4A 2HIHA 4PLZA 1I10A 2O5EA 1I3NA 1NKTA 4LNHA 4X7MA 4AFNA 1W0JD 1I1OA 2GETA 3DLBA 5BV2P 3QHAA 4EDHA 4F2HA 4PS1A 1SUIA 5TQ0A 1GR1A 4BE9A 2Q07A 1ZEJA 1YR7A 3IIMA 1T9CA 4DANA 4I4TF 3FUVA 2J6HA 2AZ4A 1LRJA 3C3CA 1SVMA 4MAMA 4OLFA 4GXTA 2J5QA 3S2EA 2PGJA 5FWYB 3VGJA 3GVIA 3AV3A 4KRXA 5BSGA 2VOEA 4W1SA 3AM5A 3IUJA 2HHAA 5JYCA 4ZPXA 3SJCA 4J29A 1NVTA 2WV9A 1YS9A 2PZFA 5FUQA 4FJ0A 5H7XA 4IICA 4DJAA 3VI3B 1TW3A 4BX3A 1DNPA 1XZEA 2FLWA 2PXCA 1TJ4A 3VZPA 4GSKA 2JJ8A 1VECA 4XPZA 2X8WA 2GBPA 3I4VA 3NHUA 2HU7A 3ESDA 3TOCA 2CXNA 3PHGA 4L0QA 4UNPA 2KRKA 1GQ2A 1R4AA 4IS3A 3QLEA 4ZT5A 2RGYA 2J4FA 5DXJA 3A4TA 7ABPA 4IDHA 3EWIA 4G56A 4HZGA 2OQ2A 2IX3A 4RTQA 3BK1A 4RLFA 1RJEA 4M87A 4G5SA 4LF4M 2C4VA 1KQGA 3MHTA 2CXUA 3SNKA 1XR3A 3ZX4A 2YXDA 4LZJA 4DBGB 3HYTA 1FLNA 1H5QA 2X7JA 3ZNNA 2AVDA 3A8TA 2CVFA 1M8JA 1FW6A 3HCFA 2FG6C 1IN4A 3R8FA 4NTZA 3VKWA 1EUYA 3KXLA 3S81A 2BLLA 3UJNA 3BTVA 5JSYA 5CEFA 2BL4A 4NCBA 3HXTA 2XVMA 3VYSB 2OB1A 2GRUA 2JNHA 4PTYA 1Z8FA 4II7A 2QTVA 2EL7A 1P31A 2E82A 4TWBA 4KDFA 1JSXA 3B9RA 4CN9A 4GLOA 4EQ6B 3MUOA 4MPDA 3CF6R 3R24A 1IONA 2FV8A 3ZKWA 3Q3GE 3DAGA 2R9VA 1AZWA 1FCJA 3J81A 1R5OA 3MMPA 1TQDA 1DRUA 4IIJF 2JG3A 1DQNA 3T3PB 1KVSA 3KXPA 3QF4B 1NW4A 3MELA 1ISGA 5A9SB 1V1MA 2DGDA 1BW9B 1MAVA 3L6EA 3VM6A 2WA2A 3HXPA 1FRNA 2NZ2A 2VF4X 4AAYA 4MB6A 3SHWA 4LDQA 4EY7A 5DT9A 3LT1A 1YS4A 4JBNA 4BNXA 3HU1A 3KDPA 2VIIA 3H97A 3JQ8B 4GOMD 3AVWA 3DOHA 3DV2A 1ADCA 4JJZA 5BSTA 1GKKA 2P9TA 2V5VA 4GD3Q 4ZVQA 3A6ZA 4BLVA 5EJ6A 4P81A 1A2QA 1HYEA 2J9RA 1YOVA 3C5EA 3F92A 4DEYA 2V7EA 3MAAC 1CV2A 3JARA 3WLLA 5E6RA 2WLSA 3O4VA 2D1SA 2OWDA 4KW7A 5JLAA 3DXFA 4UDNA 5I9IA 1STOA 3IELA 3ZCPA 1UOQA 3PENA 1C2YA 4D45A 3I5YA 3N28A 3DZHA 1UKVY 3ZQ6A 2YHUA 4K88A 5LOVB 4HL6A 2Y1XA 4EABA 3LHIA 2NV2B 2I5PO 4BL5A 1M2NA 1EDEA 1R2ZA 1QKKA 2FSPA 4GKKB 3ESXA 2CRUA 4G4SO 4LI3X 2Y93A 1I2ZA 2F64A 4D3XA 4MCAA 4PHHA 1Q7TA 1NYLA 3WQSB 4CKBA 5LN1A 4BGIA 2PGDA 1HR0B 1BMQA 1RHKA 4H6WA 2VLIA 3QFTA 2CMKA 1KYYA 2W2PA 4ZEVA 1D07A 4Q03A 4Q3NA 3GLGE 3CHYA 4J90A 2FY8A 1RWKA 1N75A 1NVWQ 4Q4JA 3U9TA 5DNCA 4G1VA 4LECA 3WGKA 2GJ9A 4JENA 1H1DA 2AIRA 2FSVC 2OD9A 3DZIA 4XPIA 4KBYA 2OYSA 5E9AA 4DV0B 1QSGA 1BEUB 1PFGA 1A4RA 1KZHA 1BVHA 1PN3A 2BAGA 4FOTA 4BLQA 2R65A 5T3YA 3LGAA 2GN6A 4KQMA 3IUBA 1MVOA 4P08A 1NV8A 2QG4A 5JPDA 1T9KA 3KUXA 1A7JA 3RYHB 2J3MA 3WLHA 3HYCA 3W5HA 4EEXA 3KRTA 1K6EA 2ANCA 3R7SA 1DJPA 3SOPA 3PNOA 2ZSHA 3KETA 1WU8A 1SY7A 1YS1X 4MVJG 4A8JB 4LG1A 3KUKA 3I23A 2A84A 2YY5A 3GA5A 4OUDA 3IHTA 4KO8A 1FUEA 5BMVF 4KSYA 2I6XA 3EWSA 2VNAA 1I7DA 3LSTA 4BLSA 1OIZA 1NP7A 2EZ9A 3ZHVA 5JMOA 1BDIA 1NNJA 3N07A 3EDMA 5HP4A 4OHFA 3LYLA 2BFBA 4JI3M 1KEZA 2VSYA 1POXA 1XZLA 4J0KA 1QDLB 1W85A 2LXEA 2C77A 3RH0A 1JLLA 1OU0A 2GEBA 1XP5A 3QW2A 1GO5A 4MW5A 4EB0A 5EAIA 4FFSA 2XUZA 1R50A 3TJRA 4OFZA 3ZCSA 3SAUA 1HFKA 1R88A 2WYHA 2GN1A 2IIQA 2I6TA 3L40A 3QWIA 4TV9B 2P4UA 5B6IA 2YRWA 3WR5A 1P7CA 2XV1A 3GCXA 3RWBA 3X3HA 2P69A 5CNJA 5KQDA 5A1JA 2DYKA 4OX9B 2W6NA 4GRIA 3JR4A 5JD5A 4LAFA 4GSLA 3ZVMA 2YHIA 3BGSA 2J3EA 2PBLA 2A0YA 4E15A 2WZCA 4J49A 5FWXA 3WRVA 4HNSA 1DXOA 4ID9A 3UAGA 5EP2A 3DSRA 1IHUA 3TSAA 5U4XA 3L29A 1FYXA 1VB5A 4MJ3A 4MGKE 3H9EO 4LFBM 1M8KA 2LTAA 3UJBA 3K32A 4EKIA 2O48X 1W7AA 2F5QA 5A7GA 5KSYA 1VLLA 3H6GA 4I2NA 1D9ZA 1CETA 4ODIA 4RMJA 1F17A 4HH1A 1U65A 3ENVA 3JWEA 5H8WA 5IZCA 2EF0A 4JHLA 1SELA 2J30A 1DQYA 3VSAA 2PZBA 1QYRA 5BWNA 2O3UA 1PJ8A 4ZVSA 4RPJA 1N33B 1XMSA 2YDYA 4NMXB 1UKEA 1TMKA 1A8PA 4ZCRA 2QR5A 4TL6A 3KK0A 4NZPA 5IC5A 1FYDA 3L4KA 1SIOA 2CLFB 3R7FA 1P7ZA 3H9QA 3AI2A 1NBOA 4XSGA 1YQ9A 2AYZA 5I4KA 3ILVA 1J97A 2VNJA 2IEZA 3ZKAA 4BRZA 2QW8A 3Q4GA 3NXKA 2DY0A 5JJCA 5ELMA 1EI9A 2R1VB 8OHMA 5HK9A 2BVNA 2WE7A 1HURA 1QZUA 3I1YA 1QDTA 2PT6A 4UTNA 4OAOA 3QEMB 4ALKA 4JLVA 5DHTA 4XM1A 2YWHA 1QG2A 4AULA 5CVUA 1H3EA 5TVGA 3GYBA 1U28A 2C04A 1IWPB 2NTYC 4BQNA 1Z5GA 4Z3KA 3PIDA 1VXRA 2B1RA 1AKQA 1T10A 2QMOA 4YQEA 2Y0DA 1L2DA 4KIGA 1UT8A 4E14A 4ZV7A 3E3NA 1DAGA 1V39A 2VUUA 1DJQA 4OIMA 1LDBA 3KELA 2QRKA 2PO5A 1QZTA 4KV7A 3DL4A 1TYCA 4MA5A 2NT4A 5FUWA 4ZI5A 1L5RA 2CXXA 3KEGA 1QVVA 4Q6BA 1FUYB 3I58A 2ZI3A 1Z73A 3MW8A 1Y48E 4ZZ1A 3KEMA 2CHGA 2BKEA 3TIFA 5F2NA 3LVRE 4BX9A 1FP4A 4WDQA 3AW8A 4YBRA 5EJGA 4AMZA 2MMGA 1FNBA 2WM9B 1O94A 3MUNA 1GUFA 4EH1A 4L72A 3WOHA 1XQXA 3CSSA 3B6IA 1H23A 3RG8A 4BVAA 3CUUA 3IUSA 1GTRA 2LUOA 3MWEA 4I5DA 4R8LA 2PX0A 5PNTA 5GIPE 3TL4X 3ZV6A 1IB6A 4KXXA 1DKOA 3R4CA 3RARA 1UBEA 1LBIA 3F8TA 5CVEA 2PNJA 5GZ6A 2JLQA 2G6TA 3NIBA 5THQA 5FBRB 5EPEA 2L2DA 3P8ZA 5K0JA 2GBCA 1P0MA 4UM9D 2L0XA 2P3QA 1XDWA 1DKNA 5AOBA 1BOOA 3PP8A 2O5VA 3LI2A 1MFPA 2E89A 1CEYA 1Y8RA 4L5BA 3DJYA 3SF8B 2NUAA 4Y1RA 1IYZA 1EM8A 1EVJA 4LG2A 1EHCA 2DHCA 1XZHA 4HEJA 3WB2A 5JQGB 3QFFA 3D6JA 5FFNA 2K47A 1SZPA 4CM4B 3E2MA 2IYQA 5FT9A 3IE2A 3QTTA 4MQFA 3IG8A 4GKAA 2BFFA 3I0ZA 5DHRA 5CFPA 3MTGA 4FOOA 5AK0A 1IY2A 3KTAA 1UBJS 3D5TA 1A9PA 4TROA 4DV4B 3UUEA 1QTQA 5ITWA 2GN9A 1C50A 3B1ZA 3GLIE 3K20A 1GTG1 4QOGA 1M66A 2H31A 4I9GA 1VPEA 4G97A 3HZJA 3G59A 4JLAA 4IBJA 5GTDA 5A3RA 4MVJE 2JLAA 1AA9A 3FIUA 2G67A 4PQEA 3N59A 3ORFA 2DWLA 2CDBA 3FPSA 3PI6A 1OA1A 1XAIA 1GSIA 5AI0A 2JB9A 4KE8A 3MMSA 4QUHA 4BNZA 3FCAA 4JI1B 4RESA 2OFFA 1KDTA 3KFUG 2V9CA 5EUMA 1SOWA 4FYVA 1KJ8A 2HTFA 4OPMA 1FFAA 1F06A 1FSSA 3GZNB 3TOSA 3QUQA 3DOAA 4TV9F 2DPGA 1ZXBA 3A1CA 4PHCA 4D9EA 4M4SA 3HN7A 5B1DA 1RI1A 1UMKA 3DKVA 3FNRA 3R09A 1M2WA 3SNHA 4WRRA 3AMVA 4L4SA 1W6RA 3IO3A 3CWCA 2GA9A 2VF5X 4IDEA 5C53B 3ONFA 1HTTA 4QOSA 3OD5A 1RS0A 2OHVA 4BUZA 4FGLA 3T4EA 1V7PC 3QHPA 3L7KA 3I83A 2ARKA 3MWFA 4RK0A 4NV3A 3DH0A 5ALSA 1SBCA 1P2VA 4IDBA 3KKNA 5B53A 3EZFA 1MC5A 1FVFA 1W59A 3WKCA 4G0VA 2YHBA 5KKAA 2NNLD 1NBAA 2QN1A 1EUCB 2EZUA 1OIXA 2RAFA 3HJNA 3R0ZA 2HQ1A 1HQDA 5K6AA 2G5TA 4MQ4A 3TD6A 1PWYE 2RIPA 4YROA 5FULA 2IWHA 2O0HA 4QXPA 4X00A 5DTEA 1C1XB 1CUJA 3DVAB 5HFAA 3PXEA 2ZROA 1V8DA 5CVJA 4DVJA 3HQ4O 1FXWF 4UHKA 4LJLA 3PR3A 4RPHA 3GROA 1G5HA 2I62A 3PHIA 2PFGA 2VZ9A 1ZNQO 4WX2B 2VXYA 4ND3A 2O1SA 5DNDA 3TAHA 3V4OA 1Y80A 2C3OA 5MFZA 1RJWA 3T35A 1I4DD 5I47A 4Z1OA 1YSYA 3NQ41 2H4FA 2FGKA 1S3SA 1H2FA 3WSWA 4JI2M 3ZCXA 2JJQA 4JUBA 2PKQP 1XIVA 4KN9S 5DTIA 1PS0A 4UN2B 1NQWA 4PLFA 4DB2A 2LHCA 4ZVOA 1CQWA 1VE5A 1ODLA 4NRVA 3G8DA 4QUJA 3VDMA 4UMFA 2Q4RA 5KEIA 5FOXA 3FCSB 5BOVA 4CHGA 3OWXA 1SUSA 4UDYX 3BMOA 3CBQA 4XD7A 4BS9A 5JTTA 1K98A 3NEPX 2YV3A 4Q4HB 3U61B 4CGZA 1K5PA 1NW7A 1ZCFA 1Y1LA 4C0JA 4X93A 2E48A 2IBSA 3AKEA 3UCEA 2O5CA 4L8RC 3LGSA 3A9RA 4N39A 2MSEB 2Z6UA 4MYTA 2UKDA 4B7CA 4MGYR 1LB1B 5GADl 2CVQA 4EUNA 4ARSA 1RYDA 2RHLA 4QREA 4UFOA 1PR3A 3S2ZA 2VK8A 3ZWKA 3Q6IA 2QMEA 3JAWB 3ZY3A 2OVFA 5F1OA 1W5AA 4DLBA 2CFSA 4EGFA 2WVAA 2PSHA 4B7AA 4FYIA 1T29A 4Z5XA 3UB4A 3O8QA 4XDZA 2KX7A 4CW7A 5LLTA 2DQYA 4YQZA 4LOIA 2PWZA 1YZHA 3SF0A 3A7DA 3X1WA 4G6ZA 1LBQA 4E22A 2R68A 1S96A 4PDIA 5DYNA 2YOFA 2DWPA 3ONEA 5D87A 5ALTA 2AV6A 2KRUA 4YNBA 4DJTA 3GRPA 4WKOA 5LQSA 4CE6A 1OY1A 4W8HA 2WP8J 2GNPA 3JQPA 5A9TA 3G8YA 4WN9A 4OQZA 3IQXA 3VR5D 5E3IA 2GD0A 1YRLA 2P3LA 3PLAE 3DD5A 2WMDA 2REBA 1JB0F 2XKJE 1QE0A 1QUTA 1XLVA 4OQXA 4N8DA 4UUQA 4UW9A 3PUHA 4FHDA 3V7YA 4N3NA 4WJLA 3RRNA 1NOKA 5JQGF 2Z8YA 1JX6A 1KI3A 1RQNA 5F78A 3VAAA 5LJLA 4LSMA 2VWHA 3CNBA 2FX2A 1E3JA 2P2SA 3L2OB 4QT0A 4JJ4A 3V2GA 3S8EA 2YN4A 4O4LB 1FTSA 4KVFA 5LQDA 2SECE 1CFJA 3EA5A 3VDRA 2H5EA 4K9SA 4S1PA 1X94A 1YC2A 1TDJA 2OK7A 4YR7A 3LYHA 1OYOA 3THXB 4B79A 5D86A 3NYIA 2E6KA 4IGFA 1N5IA 3C14C 4K6MA 4E2FA 1ULHA 4J1QA 4HDNA 2ZYAA 2UZ1A 1SKMA 4DIMA 1P1CA 1BYIA 4YREA 1SQFA 3CCCA 2Y4OA 3R20A 2H1HA 4Q05A 2X9VA 3DMTA 1QPBA 3KJZA 2WZQA 3HZOA 4KLRA 1EVQA 5G0WA 3K5HA 4AZ3A 2AMVA 2DAIA 2F67A 4A27A 1D0SA 1U8YA 1NLMA 4DNFA 4EY8A 1OXUA 3MRSA 4YP6A 1XRNA 3RAJA 4G2NA 3LHSA 2G63A 1C1HA 3MBKA 3IUQA 4CF7A 2ZSKA 4ZMRA 1C29B 3FUCA 1PDOA 3GPXA 4PCAA 4EVRA 1ID8A 4ZT6A 4QOEA 5SY9A 3FPEA 4I5IA 4LGYA 3PCXA 3GD5A 1H9CA 1VGQA 3UFXA 3WLAA 2X3FA 4LXGA 3JQ9C 4TLAA 3WVNA 2D54A 4Y2XA 1ZNZA 5IFLA 2NU6A 4V1CB 3DEZA 4LCEA 4Z3OA 4FS3A 2N46A 1WUJS 3QPDA 1YFJA 4BXOB 1V35A 1BN7A 3B1YA 2COKA 4RCVA 2ZQYA 2WHQA 3PRHA 2BEVB 3R4VA 2FWRA 3BIWA 3MWJA 4JI8B 3DR5A 5KSWB 2XVZA 3DMDA 2OC9A 5IDQA 1ZN9A 4GOLD 1J5EM 2HMUA 3VO2A 2I6GA 5K3FA 1HLPA 5BSMA 4L9WA 3IPAA 1EKXA 1EFAA 4BNYA 2QTLA 1GPYA 4HS9A 5T57A 3S2FA 4EW3A 4N3CA 2CLKB 4M49A 2XCQA 3TPCA 2HA6A 1F14A 4HAXA 1VRCA 3U7HB 3B7WA 5CLGA 2DFKB 2GEKA 4QZVA 1SCUA 2XNCA 2AN3A 2OBFA 4CMHA 3SSOA 3V7NA 4KREA 3SHFA 1WMDA 4PZPA 3M6IA 1UKYA 5JJ5A 1EYZA 4WZAE 2JASA 5K0TA 1W29A 2GZ2A 3I2GA 3EZYA 1JALA 1XFAA 1JAIA 2B6NA 1SVSA 2X4LA 3IVAA 2NYRA 5K2OA 2OQIA 2P78A 3G7NA 1GNPA 3TDMA 3VH1A 4R69A 4XJTA 3ESZA 4MPRA 2EV9A 5EQJB 5TT1A 1Q3TA 4R6XA 1KJWA 1V8PA 4RFSA 1CQJA 4WJZA 5J1SB 3SICE 4MB2A 4B4UA 3V8MA 2NV6A 2VAPA 4FKMA 4F71A 3ZE7A 4CLRA 3H05A 4CR8A 1KMCA 3V1TC 3EZ6A 5L9AA 2QMUA 1U7WA 5DWQA 2BE9A 2WWRA 3QQ5A 4GITA 2BP7B 4LGVA 5AD1A 1IY9A 1WGLA 3QH4A 1EFDN 1UIRA 1O0CA 1HTBA 4IILA 3GJXC 4JBWA 1M0SA 5BVHA 3S5JA 3AF4A 4RKQA 3ERCA 1MB9A 3SC3A 2IJGX 4UAVA 5BPFA 2GA8A 4DDUA 3CVYA 4NMLA 4C76A 3CCFA 3WLJA 2J85A 2C7RA 1Z0DA 4OHYA 3C8ZA 1MAAA 3KKPA 1Y63A 2ONCA 3OZUA 1P8JA 2ACKA 1RYHA 4NLLA 4ALNA 3MUEA 1UT6A 2YVAA 3QKSA 1SCAA 1WL8A 1ZJJA 4PX5A 3HWSA 3FLAA 4OXNA 2GN2A 3E58A 3L07A 2JFOA 4X1YB 5FAXA 2Q5IA 1MEOA 1K4KA 4WBXC 1NMYA 4MRPA 2R2AA 4NS4A 3C8UA 1GYQA 2OEPA 3D6NB 3W7BA 2IP1A 3BGWA 1KC1A 3DQQA 4PC3A 2ZBEA 4TYYA 2X2PA 3ADOA 3JSAA 3G89A 4MGZE 5BSRA 4ZYZA 3OQOA 5D6OA 1S7CA 2Q5HA 4MVJI 4TS3A 2GF2A 4MGIR 3T0GA 2J0UB 4OB8A 4IVQA 3F6PA 1QH1B 1FW8A 1EM6A 1XYGA 3CCBA 1ZKDA 4JZYA 2Q1WA 2JKVA 2RIRA 3VR4A 2INGX 4F9GA 5ITZA 3GZ4A 5J43A 3PFGA 3D0OA 5EZQA 1MQSA 1DX4A 1TQ8A 1TAQA 3NBAA 2ZSEA 4WOJA 1LZLA 4RHEA 3DL0A 4X24A 1YTUA 1N8KA 3HUDA 2AC2A 1G1MA 4C4XA 3VSDA 4XR9A 2XYVA 4RQBA 1BGWA 1GO2A 2VXOA 1NLZA 1X7DA 4B6FA 4B71A 2OFXA 3QE9Y 2RGBA 3H4TA 4FR2A 3JZDA 1I4LD 2CWDA 1P5FA 4LSGA 1Z9BA 1NP3A 3W9SA 4ARZA 3L4EA 1OLSA 3TAUA 1Q0LA 1Y8CA 4Q9NA 3D2CA 3PX7A 4NPAA 3SBEA 4JI4B 5HILA 1UMCB 2I99A 4UHDA 4JB0A 4A6EA 1MTZA 4TWJA 5A9RA 5HF9A 2Y2UA 4U2EA 1QYWA 3FZQA 2ID4A 4Y1FA 4QBHA 3ZEIA 4N8SA 1U9CA 2WHPB 3KKOA 3TUZC 2E0IA 2QTRA 3QYFA 3P5BA 2CEAA 4KVAA 1A9QA 5KTYA 4NMWA 3G1UA 4KVZA 3C0KA 3TQHA 2PJRA 3VU9B 2ZI4A 3ACBA 2IZ0A 3IIJA 1CDZA 3NTUA 5T67A 2Z3WA 3LOUA 3ZDDA 3X2EA 1LDEA 4BNDB 4L4ZA 3NHMA 4XJXA 2C5EA 1RLJA 2CXPA 4MXDA 5G40A 1XNQM 1FXSA 2I4RA 3F1LA 3OBBA 1JJBA 1GGMA 1PTKA 2XJ4A 3RFUA 4P4TA 4EKNB 1JIVA 4C4RA 3M1IA 3PHBE 1GKUB 1K8QA 3CF6E 1WMEA 5I4BA 2OY0A 4HDKB 1TEVA 1WUHS 5EXXA 2PFKA 1A98A 2F3RA 1C9NA 3O8OA 3RODA 1M6VB 4KAXA 2OFPA 2O57A 2PZJA 2NU7B 2FZKA 1FDWA 5KYUB 3GRFA 5CA0A 3FHOA 3L0SA 1NVXQ 3B7GA 3C48A 2V3CC 3NDIA 1NLUA 3ZG6A 2LE0A 1W2HA 2PANA 2QTGA 2NUPB 1KVUA 1PGNA 4DSNA 2VKTA 4AKHA 2AF4C 5JH7A 1E2UA 5E3HA 3HB5X 3WO0A 5KUTA 4MJLA 5LU8A 3L8DA 3CUEF 1A5BB 5CAEA 1K3WA 5AK4A 1N6LA 1H2XA 5B36A 1P29A 4RD1A 1S9DA 2Z5GA 4Z4IA 4PYNA 4X6XA 1OYYA 2WLTA 2B36A 3TXAA 3F5FA 3GNTA 3NIFB 2IYUA 4NYJQ 2A0WA 3V97A 2J1LA 1Z63A 1GPBA 3BD9A 2OMEA 3ZZMA 4YECA 2ZRNA 1Q12A 2SICE 4U3JB 1PJ4A 1U2TA 1EX9A 4FX5A 2QR3A 4BNLA 1Y8ZA 1OYWA 2ADMA 3TGLA 1EZ1A 3E3OA 1L8OA 2JDIA 1BMFD 3TTUA 1BSVA 1ZRHA 4LDAA 3WJ7A 2OB2A 5E1DA 1CQIB 3B51X 1T6XA 1W75A 1S8FA 2W43A 4BKUA 4WURA 4Y2RA 2KNAA 3IAEA 1P1IA 1RKXA 2RKWA 2IUTA 4Z8YA 3AZQA 4F2DA 1O97D 4UCQA 3K8YA 3K0FA 4IGIA 2JLZA 5DVZA 4DHEA 1RCUA 1ZH0A 1L8QA 2AA3A 4C07A 4D9NA 1G5TA 3DL2A 3WXBA 1JKJB 1JXOA 3IAAA 4CUZA 4EX7A 3BMCA 3PL5A 4QGGA 3OZDA 2C29D 4UJ5A 5BSHA 4QVIA 3BGDA 2JRLA 2HMVA 5KYYA 2BCGY 3UGTA 4S05A 2LVPC 3OOSA 2AFHA 3MXOA 1H1LA 5FOWA 4UHFA 1ZWLA 2XDQB 5DZSA 1I5EA 1MO6A 2A88A 4MQLA 4R1QA 4FW8A 4LJ6A 1G55A 4D9FA 1AU9A 2WSEF 1OKKA 2J9YB 3DULA 4BNUA 3K5IA 2BDUA 4EUEA 4LI0A 2ZOSA 3I6YA 3QM1A 2ZZNA 1RWXA 4PAQA 5FI0B 3KR0A 3IDOA 1VP3A 1MIOA 1WP9A 2IV3A 5DULA 4LF4B 5A06A 2HQBA 4Q4AB 5FBLB 4IVRA 5THXA 2BFDA 2C96A 1XA4A 4BNVA 4X94A 2VJOA 5JLJA 3DBVO 3EW9A 1JDTA 3JZMA 3QYAA 2H11A 4PY2A 1RWOA 1E2HA 4G9BA 1ZMXA 4AY4A 2BI7A 3DW3X 3FWNA 1E20A 4BASA 3BD8A 4N48A 3A4LA 1CRZA 1RKBA 4C6RA 1LV7A 1NASA 3RFXA 3LP8A 3K09A 3W4IA 4CXMA 5JYEA 4AS3A 3CZ4A 4LRQA 1JEJA 2HCTA 5JAUA 4JHXA 3FTCA 2VJPA 3NTQA 1GUAA 1LUAA 2VPXA 2PGOA 3EPLA 1V43A 1WZCA 1Z0IA 1GQYA 2ISQA 1GCGA 1UFRA 3ONNA 5CVVA 4PRYA 3MRVA 3O4HA 1IC6A 2RAPA 4GMDA 1Q0ZA 3QX7A 4JYCA 1Z07A 2IEYA 1U9JA 3K7EA 4BVKA 2XZTA 5KQRA 2GM9A 3TQRA 4QU5A 4URVR 4M7RA 2BC9A 5ALNA 1F4IA 2IF2A 3L7OA 1D5WA 2B78A 5HVNA 3M3HA 2PLFA 1XMVA 3HRHA 1A7AA 4FMCB 3TRHA 2E5FA 1A1SA 2XZDA 2D5CA 4B7GA 5JYBA 2GPSA 3IMFA 3F7MA 1HT1E 2Z3XA 4DM7A 4BO3A 4XYBA 5DSZA 2D4HA 3BMQB 1Y9ZA 1KYZA 3JS5A 2LNDA 3OTIA 1TYZA 5C3MA 4MUAA 2G80A 2Y20A 5IF3A 4RIEA 4NE7A 4C01A 3I73A 1KYVA 4I50B 3A45A 2XBMA 3F6BX 4G1BA 1UDWA 1VPLA 2ACEA 5LBUA 2UUOA 2J67A 5BURA 1KYTA 2QLLA 5GOTA 5JNWA 1EWTA 4YQFA 1EK6A 2J7OA 4XJSA 1ZC3A 3ECSA 5FSWA 3BA6A 5IMBA 5LZ7A 2X5KO 5ALXA 3W2IA 4ZVUA 2JH9A 1JHDA 5BN1A 3S7TA 2NYUA 1J0XO 2Q6VA 2YCBA 1M10A 3CW8X 2PSDA 4LPSA 5JROA 1TGVA 3HUEA 2F8TA 4D3FA 1K89A 4N9WA 2GKOA 3R6LA 4HZUB 2X13A 1NNUC 1PYOA 3OA2A 1Z0JA 4EG1A 2O1XA 2FPIB 4C0HA 3OY2A 1G8FA 1QQAA 4TTSA 2MR6A 4YJ2A 2QVGA 5AI4A 2XSZA 2Q1TA 3ANXA 2B0CA 2D6FA 1L5KA 1PEKE 1L1RA 3TLAA 2ZIEA 1N6OA 3QUAA 4B6SA 4X84A 3OE7D 4CG1A 4L28A 2I4IA 5DGIA 1HX7A 2P4SA 1GZ4A 1U4NA 1W4CA 2PIAA 2PR2A 1H0KA 1ISSA 1ZVQA 3KAPA 4ZVNA 3TH5A 4ZOQI 2WY2D 4EHKA 3UAOA 1YZLA 4CCYA 5AXCA 1CR4A 1GU0A 4UHEA 3NTVA 1AB5A 3UQZA 1NBIA 4JI3B 4AZVA 4QTTB 1HFEL 4DIFA 1TIPA 3SM3A 4D9CA 2QEQA 2J3LA 4EZIA 1O0SA 4YH1A 5IVHA 3AIMA 5KO2A 5HKLA 1QOPB 1PSDA 5K4HA 3IP5A 5FBHA 5H16A 4GP9A 2HMTA 1UM9B 1MT0A 2P9JA 5B7NA 3MJDA 2C8KA 4IDNA 1MX3A 2P1DA 3V4VB 1YBVA 4R2XA 5EI5A 2H07A 3DC7A 1KEUA 5EXDA 2I7VA 4R0VA 1NV9A 5IZ7D 1ECBA 3Q8WA 3TW0A 1QZMA 3ESBA 1PHPA 3NRBA 1V16A 3JR5A 4CNBA 4WZBA 4ESVA 4R3DA 2FFBA 2C42A 5DNAA 3KOZE 2ZUTA 2HWUA 1NC3A 2JFWA 2JIPA 1SQGA 1REQB 3RC1A 1CNFA 3VNBA 2F9LA 3KV3O 2M9MA 5IXJA 4ZI7A 1VEGA 3RYFA 2HXYA 4JLWA 4GLJA 4N3GA 1XDDA 4ZN6A 3DNMA 2BFBB 2Z2KA 4G3OA 3KZXA 1H0SA 3VR1A 1V3UA 2Z4RA 3I8XA 2HD4A 1FIUA 5B4VA 4MUIA 2IOFA 5K3SA 1C3OA 2FSFA 1L7PA 3MF4A 2X5OA 5ESWA 4K8OA 1XXLA 2ZANA 4WKNA 1F3LA 4L4YA 5ANRB 3RSFA 2AR7A 2C4TA 4R51A 1RJ9A 3K15A 3PWKA 3UUGA 1TU3A 1LQUA 4J1SA 1TD1A 1JJFA 3LDFA 2BH2A 5BXQC 1E9RA 3QVXA 2Y21A 4HDRB 1KZ4A 5JD3A 5HNKA 3LCJA 3OIFA 3OHMA 1YTLA 2DZOB 1HJPA 4DV2M 1J4AA 1PS8A 3BL5A 4L57A 2O2CA 3AP3A 3O90A 1PVDA 4R9NA 3ZJUA 5HE9A 3ADCA 4TMZA 1SUAA 1VYUA 1ZK1A 3OQHA 4RPCA 4TQUS 4V24A 4O29A 2FX3A 1NSTA 1LFAA 1C4OA 1NJ6A 3GGGA 4MHOA 2CL5A 2OBNA 1O5IA 4BGVA 3ZCRA 3TGWA 5KVVA 2XUDA 4K6GA 4ETIA 1ZNXA 1MXHA 1T9HA 4ZO7A 2QN3A 2H1WA 1HG1A 5ELLA 3MTAA 4RIHA 2XGMA 5M04A 3ULKA 3INYA 3IBFA 1JHRA 4YQYA 5B55A 4MKRA 1PQWA 2ODEA 4HSGA 3CXUA 4FMCF 1UEJA 2XLJA 4KUGA 3LQRA 3F6CA 2C7VA 4P80A 1RRMA 1WABA 1E77A 2MSDB 1ZGCA 2ZWAA 1ZHOA 4KWHA 1BC5A 4JOBA 1BXRB 3Q2KA 3ENKA 4X45A 1L3IA 2C0QA 1V7ZA 4ZYUA 2FFAA 4IINA 2CFIA 4HFRA 1JAZA 4MA0A 2H6EA 2WJWA 3M6LA 3DAYA 4K05A 2JBHA 4HNGA 4IP0A 3SJ7A 4I50F 5KVAA 1QOZA 4FIZA 1JF8A 5TVKA 2OZLA 2QJFA 2QMZA 4GPBA 4BB5A 3OFND 3PDJA 2CDCA 2FTKE 3KPYA 5EJ7A 3FNIA 2O14A 2FMTA 4NNJA 3EQ6A 1U3TA 3G2PA 2VTKA 3G9UA 1ZM2A 2BKUA 2H4XA 4DDKA 4B09A 5E6SA 3TSOA 3Q2OA 6REQB 2P68A 3HB1A 1USIA 4XIJA 1U8FO 1MJHA 3O9MA 4UOZA 1LSUA 2CUZA 1WKBA 1YCDA 4DLSA 1ZVJA 1PZEA 3OEHA 1RSZA 5C1BA 3HU3A 3HYRA 1WWKA 4A6XA 1LNZA 5HS6A 3FLBA 3AR7A 2WVJA 2QPAA 5FO0A 3WGYA 1ZH8A 2ZI7A 1TJNA 3KHTA 1WNFA 4A8PA 2DZDA 1HE5A 2VZ0A 4N5MA 5HMLA 3ABOB 1JFVA 1QGOA 4CQJA 1Y89A 3WNCA 3GBSA 1CY6A 5CW1A 3T1TA 3CPSA 1EDDA 2YX1A 3BHMA 1VMIA 2QPLA 1PJIA 1Y4AE 4RVHA 2SKEA 1OXKB 5AUQA 4A5OA 2X0EA 3ZYCA 2SBTA 2W11A 2HU8A 3GUVA 4OY3A 4HGOA 2QNIA 4LHWA 3CQ9A 4RZQA 3H11B 3V4PB 2K0BX 1N0VC 1Y9JA 1YDWA 3I5AA 3KOYA 5JCZA 1B43A 3HNRA 3TZEA 3GIDA 2VDMB 2K6GA 3O91A 4GVPA 4CIXA 1XMXA 2PY6A 3U5ZB 4I99A 3BXFA 5AKIA 3LDAA 3WLFA 5DHPA 1U2PA 2ZJ8A 4OUKX 2I03A 4KQXA 3AR8A 2FP4B 2YH2A 1A27A 2CD9A 5L4SA 1EMDA 3A7EA 1KH3A 1C8VB 3I12A 1P5HA 5CX1B 1XMQM 2Q1YA 5IKXA 2CJPA 5K8TA 1VCOA 4FJ1A 2WTAA 2WU0A 1SZJG 4IIGA 4KK3A 2ZIFA 4Q9LA 1IK6A 2VOJA 1LD3A 4J0IA 4MQ5A 2C4UA 4RANA 1E1RA 2R5NA 1ZMRA 1Y4UA 1CUZA 1U5AA 3G13A 1XLTA 4J0CA 4OYHA 2DBRA 2VTEA 4QPCA 3KZ1E 3PUYA 3AKDA 4FDAA 2VEOA 1RNLA 2QWXA 1UJ2A 1VJDA 2QJTA 4MR7A 4BLCA 3O0DA 1R6TA 3RV4A 3JQQA 3C4QA 1GSOA 1NI4A 5FPKA 1Q1AA 3ZXXA 1GPUA 2G09A 3CX8A 3A05A 2L4EA 4NBKA 3MQ4A 3V1KA 1KYXA 1VOTA 1D6NA 3NI2A 1XUOA 2PX4A 2Q29A 4QT4A 1TPYA 2G9VA 2LCQA 3DFKA 2J7PD 3KVVA 4MDEA 3NONA 1E9DA 3F90A 2CMHA 3R0QA 2IZ1A 4EKEA 3LKBA 1HE1C 3FETA 2VJDA 4KFSA 2PKYX 2ENUA 2I1LA 3FWKA 1A72A 1W4ZA 4W99A 2IYFA 1G8KA 2IHVA 3GRZA 4M7PA 1QK5A 3DAFA 2D0IA 5JVDA 1NYQA 5LDHA 2FPUA 2DVWB 2O7SA 3A25A 5ARBA 4IMPA 4REZA 1I7NA 4CVNA 4HBGA 2Q2WA 3LOQA 2VDWA 4U7JA 1V5FA 3FOCA 4M1MA 1G9TA 2QN2A 521PA 4YYEA 2QGNA 1JEQB 2CT8A 1DRVA 3QVKA 3L49A 5HCIA 3ACCA 3GGCA 3SZ3A 3QI7A 4MWBA 4Q3EA 4F2WA 3JAKB 2JIQA 2QZ9A 3WHPA 4EHAA 1CUWA 2YMQA 2Q0QA 3SQXA 2KHZA 4P35A 1SD5A 4O6VA 3O8NA 4RZ2A 3OT1A 3BWCA 4DZRA 3TVYA 5AK5A 4IDPA 3THSA 3ESCA 1RLUA 4RHXA 3C41J 1E6LA 3U2QA 5KO3A 1ZIOA 2JFBA 4GM1A 1W96A 3WLTA 1Y5IA 3N8GA 1I5RA 3ZGVA 2YWFA 2FWNA 3KE9A 3ZHOA 2D0PB 3D7KA 2QKYA 2ZIUB 1USVA 2UVPB 4O02B 4GLLA 1YDGA 3R0VA 2FFHA 3OLCX 4I3FA 2IPXA 2OVBA 1L2CA 3U1TA 4L75A 3SP1A 4PANA 4OA8A 4DJEC 5E4YA 2XNDD 1XZIA 3VTZA 2Q2EB 2FWPA 2PJZA 3KNZA 1JBQA 1E6WA 4MS4A 4LV8B 4NULA 2ZTMA 4HAYA 3ETHA 4PLVA 3DKPA 2QXYA 3TW6A 2GPBA 4G8JA 3PNQA 2O8DA 1BCSA 4EMTA 4YRMA 4DA0A 2LH0A 4F6RB 4FD3A 1N2CB 3FOZA 5HCNA 3ER6A 5E6UB 1IXYA 1SXJC 1ORIA 2VWPA 4HB3A 3VLFB 2N3ZA 3FDXA 1B8UA 3M34A 4DLPA 3BC1A 4D46A 3E82A 3P32A 2HA0A 3UKDA 2QT9A 4TWAA 1W76A 1JPNA 2FG5A 1WR8A 4MWOA 2ZK7A 4BFTA 4BJ5A 4M8KA 4EMUA 5KNLA 2YNMA 2DHYA 3U4CA 1SUWA 3ZDAA 3BSYA 5GKNA 1VKNA 3FDJA 4XVHA 4KYVA 4KX3A 3S8YA 1YA8A 1BS1A 3JVVA 3ZGNA 2NO5A 3DV0B 1JDNA 2FMXA 4Q1DA 4K28A 1XBTA 3USZA 2B9EA 2A4KA 2B9VA 4ALMA 1C30B 4L5IA 1XZNA 4MS3A 3BWXA 1QDEA 1FVHA 3ZE1B 4QU0A 1ZMTA 1GKLA 2FQXA 5AHWA 1NXQA 4HNAA 5HDQA 4LYAA 4EJSA 4YT5A 1ZXXA 5EJ9A 4BQQA 5CT9A 4YP1A 3IJEB 2H08A 2RHCA 3GLGA 1GVHA 4JP2A 3B6ZA 3WGMA 3AOGA 4FBMA 4CZ2A 3WMRA 3M4JA 1WCXA 4FDLA 3RK0A 2NXCA 2WJ6A 3WK5A 3OPXA 3C58A 2V3WA 4E03A 5DLQC 1YBFA 2GFIA 4JBYA 4LDZA 1SXJE 4AKIA 5AVSA 4G8CA 4YRDA 4BO6A 4NBWA 3QV2A 5DM2A 1WOMA 3C5HA 3V7FA 3T54A 4M7OA 4BDTA 4R4JA 4MDFA 3M7IA 3E5HA 2G72A 5IJ9B 3EFOB 3ER9A 2WSCF 3U80A 1KFCB 3VJRA 2C4KA 1PR1A 3H5VA 4F9TA 2C78A 4J9VA 1JKXA 3DB1A 4HDMB 2C20A 5FL7D 4F1JA 3RROA 1OSNA 5CLHA 2O54A 4IIUA 1G8JA 4KVGA 5AI8A 3GO4A 1CY1A 3HEAA 5CT8A 4PQGA 4HFMA 4P7KA 3WLOA 4CDGA 5IVPA 2QG6A 5FHQA 1QPGA 5T7BA 1T5IA 1V33A 2WICA 4MQMA 1T8YA 1F8YA 2IGTA 2CE7A 1AUXA 5D2CA 5J4VA 1NKSA 1DC8A 5AO9A 3WBBA 3Q2IA 3QLVA 4PFJA 2ONJA 3VU1A 3RS0A 1XDUA 2ODTX 2PZAA 3ORHA 4JLKA 3SAVA 3HSKA 4HB0A 7ADHA 2UUCM 5K3DA 2QL5A 3P0FA 2YFYA 3O75A 5TC4A 1H5UA 4D81A 4JUIA 3ZI7A 1PT9A 2A5YB 4OL9A 2UYHA 3C7CB 1JHVA 2PLRA 1U0RA 2J48A 3W6PA 3RKUA 2RAUA 2CHUA 2QQ5A 2H4HA 5TS3A 5BN4A 4RMNA 2LP4Y 3SLRA 5BVGA 4AJOA 3ORYA 4LYEA 3TE6A 3DPUA 1F9AA 4YCLA 2IELA 4F1WA 4RNDB 1WZ2A 5AW6A 1TF0B 1BROA 3RRXA 3STWA 4N18A 3OESA 2J9ZB 1DZIA 2D74A 2H9AA 2D4AA 4WD3A 2D1RA 3CLHA 5D5HA 1XXHA 3GU3A 2FH0A 1ADFA 2VCYA 1J5EB 2B69A 5LLDA 1UADA 4DCCA 3AFOA 2C54A 1K6XA 2PTHA 4J6EA 4Q9HA 3LC7O 2HO5A 3IJPA 1I2CA 1I9CA 2D59A 3F4BA 2A78A 4C3VA 1TFUA 3TRDA 4C0SA 3S1AB 3O03A 2QZSA 4MR9A 4ARIA 5A6SA 4YY3B 1GQFA 1P1KA 4KPYA 1XO1A 1NVVQ 2O8CA 3TQSA 3J7TA 5AW4A 1ECGA 4BMDA 2IU0A 4I1YA 2PT5A 4RLSA 1YXMA 1VJ5A 2XY4A 3SMSA 1AGPA 3SS9X 3MYRA 3PG5A 1QAQA 1NE7A 3L6OO 4AJ4A 3QP9A 4OHOA 1NYRA 3ADPA 4L8VA 2P4HX 2HPHA 2I2DA 2D5BA 5J58A 2IZOA 3RU2A 2H7XA 1TUEA 3KHKA 1N0UA 1TLLA 1RADA 4C2TA 1QHGA 4EPXA 3MGAA 1Q50A 2AG0A 4JQOA 4CIVA 3LVFO 3SHGB 4LMPA 5HEKA 1W5FA 1CF2O 4C3OB 1E3WA 5TQ2A 1SUBA 3O26A 3WYBA 1A69A 1J20A 1XNGA 5K0FA 3PXCX 3L1VA 1NF3A 2DP4E 3CGWA 3LW8A 2R84A 1K7FB 4F11A 4AXBA 3SSMA 4C0XA 4OHBA 2I8LA 1RZVA 3A42A 3L1IA 4KQWA 2VK1A 3DBLA 3UG7A 2MINB 4DPMA 2HO4A 3SR0A 1ESDA 1HRKA 1T2VA 3E8MA 4AN4A 2R85A 2JCBA 3TLMA 5FTKA 4DTCA 3CLTD 2QUHA 1PT7A 1UBMS 1W46A 1DDIA 2YICA 1SCDA 3G2OA 2HF7A 4UD2A 4J0EA 5BOSB 1TIKA 3BXOA 2KZUA 1KA9H 4YRJA 3O31A 2TECE 3ROXA 3G88A 2Q5JA 2OO5A 2PZKA 3EMKA 2IXBA 2QDXA 4HVTA 4LJKA 4TT3D 4ZIRA 1F0KA 1PR2A 3IBYA 2XXAB 3LCVB 4KQKA 3E2PA 1PS9A 4RE6A 4JEUA 2C82A 4CM7A 4IWNA 1M33A 5CLJA 3MEQA 2Z2JA 3DDCA 1Z5AA 4PNHA 2PUBA 4RV9A 1BJRE 4AIIA 3K9QO 4YFYA 4WXHA 4TXNA 1D2NA 3V1MA 3F96A 2HSDA 4FKBA 1GPLA 2ATIA 2YFHA 2ACWA 1P81A 1KQNA 2FPOA 4Q3LA 2I22A 3I0NA 2R3SA 3ODPA 5ICMA 3IV9A 1VMAA 2H8GA 2AZMA 2O1WA 4I66A 4IJUA 2QT1A 4AVYA 3HBLA 4C6SA 5JPIA 4B76A 1QWSA 1DI0A 1J0EA 1Z7YA 1ZI8A 3AVUA 2NV0A 1D0IA 4KQ1A 4BNTA 3EA4A 5FLXS 3L0DA 5DYIA 4CLHA 4GMFA 4P31A 4ML3A 2WZBA 1GR0A 1VBFA 4ONEA 1IY8A 2WSLA 3X1XA 3AU8A 2C5HA 2VP4A 4KBFA 2R6AA 2L7HA 4NCXA 1ZDMA 2Z8YM 1N0HA 3NBUA 3P9YA 3O1JC 1LDYA 4HATA 4FOSA 4QGAA 3SKXA 2GASA 1IXSA 2WKWA 4PWYA 4I1OA 3T1OA 3FR7A 4RF5A 3A6PC 4P2GA 2VDJA 4M0CA 1M76A 2BZ0A 4PPGA 4F9EA 1Z6GA 1YHZA 1FP2A 3TLBA 4R8VA 4ENQA 2E1RA 2O20A 5I51A 5TLSA 1YBAA 1UBKS 2G9QA 4B8YA 2XR1A 4XSVA 1Q0HA 4GMXA 1LLFA 3W6ZA 4UUBA 5I9BA 1M34E 1NAIA 1N6NA 2RGNA 2H16A 3GBVA 2ZZMA 3L5OA 4O2LA 2YY6A 4ZCSA 4UU1A 1ZUNA 1V9LA 4JBHA 4DUPA 3IUYA 3LWNA 3KWFA 4D6XA 5J40A 1HK7A 4E5YA 1OB2A 4W9RA 4FR0A 2QG9A 4ZKDA 3NPMA 1E4OA 1Z5WA 2GH1A 2AEEA 5CG1A 3NBFA 1PJBA 1DGQA 1C14A 1LK7A 3THOA 1XNQB 1Z4QA 1FDSA 4I4CA 3ID6C 3CR7A 2HH9A 1P6UA 3PEVA 3DE2X 4X95A 1NW5A 2B1QA 2Z2YA 4BLRA 1LI4A 2QGFA 1VB3A 2JHCA 3EXIA 2WMOB 1CR6A 1ZCJA 2KZSA 1ZINA 4E3ZA 4J7AA 3F8WA 1F2UB 2JFFA 3AOEC 1LVHA 3JQBA 4EG0A 4B3SM 3TG2A 1Z5VA 3RV3A 4MPPA 3QU4A 1LSJA 2R1TB 3U6EA 2PH3A 3HVKA 3DOUA 3ROZA 1QQ6A 2QAJA 2XFSA 5GGYA 1U4OA 3RHZA 3TOXA 3K4HA 3B8HA 2P62A 4YJGA 4DDVA 4I1VA 4Z99A 2CVOA 5K5EA 2YVQA 5TMPA 1VE1A 3AHDA 1DGHB 3IBGA 2JJ1A 3EXHC 5HTKA 4ZVTA 3ROQA 3EQ9A 3MWYW 2DJ5A 1YDFA 5EIAA 3D3QA 4RA6B 5I7VA 5FR2A 2ZCUA 3OA0A 2BZ1A 4L6V6 2PX6A 2BFEA 3C3AA 2OE2A 4QUDA 3EAGA 4RMHA 5ICEA 2NSJA 3TJZA 1KH2A 1NXXA 1AQUA 4R6WA 1V0JA 1JKMA 2VTBA 3DFMA 4HXYA 1UBRS 1X1EA 2PZGA 5LLSA 2FN4A 2ZAGA 3QJGA 2CXHA 3QLTA 2PU5A 5I7SA 3AQIA 3MD9A 2ZIXA 2QMYA 3UJAA 5I3ZA 4QULA 4NBVA 3AJEA 4KKXB 1QUSA 4ATNA 4YMTA 4YJ3A 1T0IA 4I1IA 2X14A 4DRZA 5KYNA 5HQTA 3Q5GA 3BE6A 1JI3A 3HXQA 3E3AA 3OCCA 1YGPA 3C6XA 1SBNE 1H8EA 4DUZM 2CYCA 1U2ZA 2AG8A 2RC5A 5CM8B 3OX3A 2NXJA 3NP7A 3FB1A 3AONB 1E9EA 3BXPA 2KNVA 2RD2A 5HBRA 4QUIA 2JAOA 4B0OA 4UARA 3MK31 5EIEA 3TFWA 4F4IA 2D3TA 4BAZA 4PLCA 5ALLA 1T4GA 4GBMA 3RIEA 5KMGA 5EFOA 2UUBB 4Y98A 3D7MA 1OI7A 3NUQA 4A15A 1VIYA 4HDOB 2PX5A 4PRKA 5JRDS 1L4BA 3U19A 1ZJ5A 2OESA 1PE0A 1FDOA 1NO1A 4H31A 2GYYA 4MLDA 3MJSA 1SA0A 3I05A 1NF9A 3BFPA 3ZOZA 1RM0A 3N86A 4PFQA 3FPFA 5AM1A 4B3IA 4M9UA 2BSQA 2J9FA 2PUVA 2WWIA 4Q3CA 3HJTA 2GESA 3LT0A 2BR4A 5KTOA 4GRDA 3N3AC 3T3EA 2Q5EA 5JYDA 4AMGA 4G36A 4RW0A 1LU9A 3JTEA 2QBYB 1WUIS 3N6VA 2FRXA 2JGRA 2GEUA 3HJHA 2AJBA 2JA2A 1T9ZA 2O0KA 4ZGGA 3JD1A 3DVQX 3BIFA 3TWLA 1IEWA 3FYUC 5LR6A 2Z8XA 1HE4A 2AFHB 2PMCA 2A9FA 5F2EA 1V2GA 5E7IA 4BPBA 3AO0B 2WJIA 3H4MA 2YW2A 1KOFA 3B13B 1OIVA 4H18A 2ZB4A 3U4MA 4WERA 3GAMA 3U1BA 1WMFA 2E85A 2A5JA 5C51B 3CX3A 2Y05A 4QQNA 1OAAA 3Q7TA 2CWWA 1SU7A 4DIDA 3H8WA 3CV3A 4EYSA 1H2EA 3MMNA 2GILA 3ZY6A 3IERA 3CZAA 3IODA 2EWWA 5C9ZA 4GQAA 4DQKA 2OZVA 1ZD4A 2OORA 3DD1A 5EIXA 4Q34A 3DE6X 2ZBPA 1E32A 3CNHA 1FNNA 3WTBA 2IVZA 3CRQA 1B14A 1A1VA 4RXUA 2F55A 2QJRA 4N0MA 3AEYA 4ZPJA 4RJKA 3FOWA 2UUAM 1U9IA 1WBBA 2LW7A 4JR0A 3TD2A 5JDIA 3A3YA 1JPUA 4XGRA 2BFOA 4ZU6X 4IX1A 3F47A 1G9XA 1W52X 1RXWA 3H1BA 3OIGA 3OLWA 3CUKA 3LPCA 2QTMA 3T7TA 1DBSA 4LC0A 1PIWA 1PSZA 3JRNA 3URKA 3VNVA 3RIHA 3UK2A 5F7OA 2ZUBA 1R0LA 4KMOA 1OWOA 1YL7A 1UFVA 3HPRA 4XYLA 1C1DB 4X44A 2MWMA 4JZKA 5BW5A 3OJOA 3TO5A 3IKJA 4GRAA 1XQ6A 4QKQA 4EG3A 5KNBA 2HHLA 3GFQA 2JH3A 2Q1XA 1I01A 2LVAA 5DHUA 3QBTA 5K4AA 1B6SA 4GGPA 4P93A 3SC2A 4X6YA 2PYZA 4R1LA 2GRJA 5KQMA 2XZFA 1EXVA 3GFGA 2IYAA 1S8AA 1TADA 3N7TA 1DBPA 1WS6A 2OOSA 5CK5A 1Q74A 4NYMQ 2CDAA 3TG8A 3MINA 3ND9A 4P98A 3T1VA 2IYWA 3QE3A 2GTHA 1O9BA 3FKSA 5LP6C 3Q5DA 4S1VA 5CB6A 1AQJA 4RDHA 2O2SA 3WLSA 3IUNA 3DE5X 4DIBA 2CV0A 5HHTA 4DMFA 3SFTA 2HJVA 4GKJB 3SYLA 1GPH1 4JJIA 3E6AA 5TPWB 5ENDA 3AR5A 2ZSIA 2AL7A 1TVKA 4DQXA 1P19A 2HUNA 2PEZA 3L01A 1TA0A 2J5BA 4MUBA 4IIDA 4NXNB 1UWKA 2PJDA 1R00A 2ZAMA 5AH0A 2PV0A 5CCXA 1EG2A 3CUWA 1H0RA 3HCOA 3JYHA 3GFBA 4AJLA 5ELXA 1L4KA 2GJSA 2HB6A 4F21A 3N70A 2C3YA 4M7WA 2C5BA 2IIBA 4WXPA 2AS0A 1YBMA 4GYJA 3FNEA 4AMVA 5TPZD 2X40A 4KXQA 4LFAM 3TR0A 4E07A 1JSZA 5EGSA 4G26A 1R0CA 3OE4A 4CT5A 4J1TA 1XTKA 4AT1A 1UFZA 2JH8A 1CHDA 3TRKA 2P3SA 3RT7A 2MSLA 3U7FB 5CA0F 5F4ZA 4LDNA 3QPBA 1DVRA 2OV1A 2LCFA 3ND8A 1W25A 1EFRA 3QEAZ 5K3BA 3NNDA 2PS0A 2OAGA 3PTLA 2A1TR 5DYTA 2VP5A 1F1BA 1O95D 4LVNA 2WFLA 2V5AA 4BVGA 3MHPA 2CYAA 1T9BA 2WW8A 2OHHA 3GF4A 3FPCA 2HBQA 2ZUDA 4N65A 1TYDE 2C2ZA 4KOAA 5JEEA 2Q45A 2CMGA 3GEIA 4MI1A 3WP0A 4F6LA 5IM5A 1U0EA 3DO5A 3R6DA 5TQ0B 2L09A 3SHOA 3JW8A 2H5XA 2VDQB 2X22A 1DARA 4NENA 1SUPA 2UZIR 4I81A 4AJKA 1IVSA 3E1GA 3EA0A 3HHEA 3G2NA 4ZZ2A 1X37A 3C3WA 1SG0A 2PL5A 5EKUA 2PYIA 4DT1A 2BIFA 2X1MA 1GM5A 1L7AA 1C0LA 2G1AA 2Q21A 4Z4QA 1WW8A 3ITEA 1C9DB 4B2PA 5EMNA 4Z0HO 3KS9A 1TM4E 4OBXA 4OIFA 3A6DA 3ZY2A 4Y2SA 1KZYC 3AY7A 1L0BA 1ZCZA 2CVZA 4HLDA 4BLUA 4HQNA 5AW8A 3TR6A 3WL3A 1AD2A 3BRWA 4CKWA 3HRIA 2NZXA 1YMVA 4DV2B 2YR0A 3VSBA 2BMEA 3WL4A 3D4NA 2FPPA 1TW2A 4HPWA 2G1PA 4G0WA 3IXLA 4KR9A 1QVRA 1JQ3A 4AUKA 2HIGA 4ER7A 1XDBA 2DBQA 1GITA 3WNDA 3BZUA 1A4IA 2YC2C 2ZBRA 2POQX 5IVKA 3LDUA 2F1IA 3CMMA 5JJLA 2QTVB 1WMBA 5FEMA 2P9EA 1QIFA 1NN0A 3IRUA 2HMSA 2XF8A 1EJ0A 3IKLA 1KIAA 5LD2C 1MO5A 2N42A 1S3FA 1E58A 3ZKWB 5JS2A 5E8JA 1QTRA 5F1PA 1JLHA 3CRW1 1LJ8A 2CB0A 1BXKA 1RLIA 3FPAA 1V3VA 2FUEA 4HBZA 1OPRA 2G1KA 1N36M 4JR1A 4LSZA 4ASUA 2XZPA 3DDOA 3E9QA 5EHGA 1V1MB 1H6BA 1ADJA 3CH4B 1SHZA 4NL4H 3I4YA 3PXAA 2ZR8A 1R6BX 5I7RA 3WK7A 2W2NA 3F2VA 2Q28A 4GUAA 2WHXA 3UY4A 1OPXA 3FUTA 3FZGA 2C3MA 1ONPA 1RRCA 1YOVB 4TYNA 4YJHA 4RXTA 3ZNQA 4CKYA 2Q7OE 4WN3A 5A4AA 2QVCA 3JARB 3SASA 4B40A 5G02A 5E6RB 5ALPA 4O3MA 3A6JA 5H9VA 2P3OA 4QVGA 1GNTA 1MP0A 5GVSA 1VFPA 5FDFA 2QUZA 5H3HA 4GXRA 1ZESA 2J7NA 2E6UX 3S2YA 1XZGA 4DNXA 3USES 2XA1A 3D0RA 4OOFA 4WV3A 3RI3A 3I1IA 4KP7A 4LHYA 4OFXA 4UUNA 1DBQA 3HCBA 4BNFA 4D8TA 1N5JA 3WLRA 1N8SA 2KPOA 1CW2B 4MVYA 1XVIA 1WXFA 4LHEA 3CR8A 4EPRA 1G41A 4NDZA 2QYOA 1RTTA 4FYWA 4CIZA 4IO0A 3V46A 4CKBB 4HLUA 4AMBA 1TYEB 3PDUA 2AHRA 4YAEA 2WAAA 3KW6A 2QL6A 1SAYA 3OEYA 3R5JA 2ZDQA 2WSYB 4QXAA 2C5FA 1X7YA 3IT3A 4LJ5A 2PMEA 4N47A 2JI9A 4R1TA 5DBOA 3JV7A 1SGWA 5H82A 2CVPA 3ILKA 4C43A 3PGKA 4FK8A 4Q4JB 1RYEA 3IQHX 5AVQA 2ZU6A 3IMGA 1VZ2A 2CF5A 3Q8GA 3A9SA 1NXOA 4XPIB 2EA0A 5JCJA 4FCWA 4RH3A 2HCRA 3KOMA 4AECA 2XMSA 2Q7XA 1EVEA 1UXIA 5JOQA 4GL2A 1ESNA 2ZYSA 2W9XA 5L6MB 2JW5A 1T2DA 4S1OA 2R47A 3JSXA 4GICA 4F45A 3N5KA 2APJA 2OGUA 1D6MA 2FKAA 1TH2A 3TZKA 4NFLA 3LXUX 3ILHA 5AVRA 1XSEA 2C57A 1Z83A 4GW3A 1H3NA 1X87A 5A5GA 1XMQB 4HSEA 4LZPA 1YUMA 1QXSA 1XG5A 5IX8A 4OUDB 4R40A 3OIDA 3W77A 3HB9A 1E59A 3X1KA 3HA2A 1HZZC 1OTRA 1E7RA 3SIWA 4BB0A 4XOUA 3HU2A 1OWLA 2RGEA 3Q85A 4JJGA 3SXUA 2C5SA 5A02A 2O3SA 3H2HA 1SG9A 1M1YE 3P20A 3GT3A 5K2MA 3FSEA 4F85A 2VTVA 5DRYA 4LFBB 1W85B 2HLPA 4UM8B 4ZD6A 4U2CA 5C8VA 1JLLB 3O1HB 1Z6PA 1K5HA 3HJSA 2HK6A 1VHDA 1CS0A 5BN3A 3EWNA 4IIBA 5GY7A 3ZDFA 3F67A 2R00C 2BSAA 3ANLA 2UYYA 1PZGA 2HWJA 4HJXA 3ZHRA 5EHNA 4TTJA 4MKIA 4AJPA 3HHZA 1SFRA 4P7FA 3HUTA 3R5SA 4IHAA 5K9ZA 2H9YA 3DVRX 3U3RA 4LOKA 2WTBA 3A1TA 4XDGA 2OP0A 3PDWA 4CEHA 2YHIB 2Q1UA 4NH4A 4US0R 4UBLA 2WABA 2XQGA 4LYYA 3C6QA 1D2HA 4KTVE 3OJWA 4C6TA 3H18A 3V48A 5FWXB 4J7UA 1TKRA 1EB9A 4Z0NA 3ZJ4A 1T0BA 3MGBA 2OCKA 2HF9A 3TINA 4M9XA 4QDKA 4PT5A 1LV8A 3GL9A 4G1EB 1NTOA 3CTMA 1FL9A 3LPNA 1ZO8A 3RVKA 5ES3A 4K86A 2FW1A 1MMFB 3S29A 4TSFA 4D9GA 1X2EA 1HQYE 3U9SA 2CFTA 5DGXA 1BQEA 3EIXA 3T7SA 1J2TA 2DBVO 1MABA 5FBQB 4CYMA 3ELBA 2ABWA 3EY9A 4US1R 1EUQA 4D44A 3CF4G 3P4XA 3F73A 2F3QA 2QK4A 2F90A 2K2QB 3CPEA 1DJNA 4IH9A 3IR6A 2V4ZA 2FVXA 2C9CA 3T0IA 4QIHA 1Q77A 2BH9A 4PZ9A 1A97A 5DNWA 4Q7JA 2XMGA 3B7NA 2C1ZA 3DOFA 3FYHA 1G21E 1DC5A 3QVVA 3JD0A 2MU1A 4QJBA 1V45E 2R86A 5BWBA 1Z7WA 1J5PA 5FUMA 2IZZA 1XYYA 4RL6A 3FVWA 3KZOA 1RC0A 4OV6B 3IP1A 2VDWB 1PZMA 4Q24A 4W8OA 1MGOA 4YRGA 2D5AA 4MLCA 3CZQA 2WIGA 5CCDA 4FFVA 3ZIUA 4JXKA 3PQEA 4G4RA 5BP7A 3AFMA 4CMEA 2F3UA 2HLNA 3PNBA 3CNQS 5L51A 4TSKA 4D8XA 4PZUA 5CXUA 1PSWA 4W82A 1E9BA 1DTSA 1KYIA 3RAPR 1H2WA 4JLUA 3OZIA 4CTMA 4DCPA 3RUPA 1MVLA 2LVQD 5ED0A 2IPMA 3K9HA 3CEJA 5FORA 3KEOA 4Q19A 3C5WP 5D6NA 4BRSA 4BZXA 1FEZA 3M33A 3KZNA 4J75A 2WJJA 2A9JA 1SQ6A 3ZPXA 1ABFA 1JR2A 1V9SA 3GGOA 2R1ZA 3QHQA 3ZLUA 3AEZA 3PITA 3LWDA 3M6VA 3EIQA 3KS4A 3Q0TA 1B8PA 2GAFA 1D3AA 2DKFA 2JJ2D 5J3JA 1ZGZA 1Y7PA 3KJEA 1F9EA 4PN3A 1I6WA 1O97C 4IDAA 1GZ7A 4XQCA 4KHPM 1FP4B 2E4YA 2DM6A 3VJLA 2W6JD 1DCMA 4EYKA 3U44A 4RF2A