1VQ1A

Crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
266
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N5-glutamine methyltransferase, HemK
publication title Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution
rcsb
source organism Thermotoga maritima
total genus 84
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vq1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vq1A02
3DP7A 5DX1A 2AOUB 2LVNC 2B78A 3BWCA 1SUSA 4E2ZA 3E23A 5KS2A 3S68A 4ER5A 5CIYA 9MHTA 3LSTA 2C7PA 2ZWAA 3BWBA 4E31A 1HT1E 4PWYA 4RYLA 2BR3A 1JR3E 1G60A 5LQRA 3I64A 2ZIGA 2OOBA 1WHCA 5U4XA 1WZNA 2P7HA 3SSNA 2XVMA 1JQEA 3A4TA 5LQNA 1IFYA 2GS9A 2K4MA 1KYIA 5FHQA 3GCZA 2BM9A 5GOZA 3HCDA 3G2MA 2B3TA 1UWVA 5BW4A 4M7RA 1JG2A 3EMBA 2JHPA 4GC9A 3FPJA 1MN3A 2DHYA 1KPHA 2CP8A 2AOVA 1WS6A 2PX8A 5EC8A 5DTQA 4FR0A 2P40A 1G6Q1 4E2XA 3DH0A 3IEIA 3A26A 3G5LA 3LECA 3JWJA 1UFKA 4AZVA 5K8VA 3B3FA 3CKKA 3HCEA 3PFGA 1NW5A 3FTCA 4DBGB 5DSXA 4Q7JA 1RJFA 2Z6AA 3K9PA 2P8JA 3KR2A 2IFTA 3NWBA 1M6YA 4PYKA 1WIVA 1DO0A 3UA3A 3REOA 1KP9A 2ZCJA 4YV0A 2G71A 4P7JA 2DI0A 2AN5A 4YUXA 2B9EA 3IHPA 4OBWA 1F38A 4OA8A 5CVEA 3GIWA 3HM2A 1JSXA 3KU1A 3LDUA 3H4JA 1ZG3A 5F2NA 3FPEA 4RTKA 5ERGB 3F4KA 1EJ0A 2FPOA 1I4WA 5BXYA 1DO2A 2KNZA 2YXEA 4RWZA 4FS8A 3LL7A 5HOQA 3R9XB 2FYTA 3LCVB 3PB3A 5CCXA 1R8YA 1X1BA 3P2IA 4R6XA 3BGIA 1NW3A 4XUEA 3KPUA 2Y1XA 2IGTA 4EQZA 1F4IA 3G88A 2VDUE 2I7CA 4ZTBA 3T7SA 3ORHA 1RJDA 4YMGA 4F84A 4GOND 3UJ9A 4JXJA 3M6WA 4CTKA 4PONA 3G2PA 2GB4A 3MAGA 4MHTA 1XCJA 1ORIA 2C7RA 3E21A 3B7PA 3HEMA 1OKSA 1R4GA 4AX8A 2XYRA 4EKGA 3OFJA 2LVOC 3CJTA 4R71A 4NECA 4PYLA 2ZVJA 3TLJA 5EQJB 4HC4A 2KNAA 3MCZA 1RJGA 4YMHA 1X19A 2NXJA 2AVDA 4GOOD 3C6MA 2K0BX 4FT2A 1M0EA 2VP3A 1I1NA 3HVIA 7MHTA 1D2CA 3LX6A 3MTIA 3KR0A 4P58A 2PT9A 3GLHE 5H02A 5E9JA 3NWEA 3NW9A 2ZZNA 5LQUA 3P9IA 3SX0A 1R74A 1DL5A 5LQCA 3JWHA 4L7VA 1EFUB 3I9FA 2JY8A 5K0CA 3UJ8A 2OB2A 2B25A 2EX4A 2MJ5B 5T64A 3OZTA 5EKXA 3EVBA 3BKXA 2QRVA 2O25A 2PWYA 1BKYA 3V97A 2PWPA 4HTFA 1SUIA 3ELUA 3KPWA 5CCBA 5G02A 1X1AA 4HGYA 3HCAA 4QPPA 1KPGA 2Y1WA 2CMHA 5CUQA 2KNVA 4CKEA 4RTJA 4GC5A 2YXLA 3LGAA 3TMAA 3CJRA 1VP9A 4XUCA 3E7PA 3HA3A 1KYWA 3FPHA 3RIEA 3UFBA 4M38A 5D1NA 4G56A 1UFZA 5E2AA 1JTEA 4U7TB 1MHTA 4GOLD 3FUXA 3LKZA 3OU2A 3TR6A 2OZVA 4E30A 5DXAA 2P41A 2JH9A 4H0NA 3ER9A 4ER3A 4DF3A 5CVDA 3TM4A 3M4XA 1A5TA 3OCJA 4P7GA 2GAFA 1SKMA 1RI5A 3R0QA 1F3LA 3BWMA 3GO4A 4CTJA 4F86A 1AQJA 5GIOE 2C7OA 1IM8A 2G70A 3SM3A 2PX5A 2ZTCA 2UYCA 5EPEA 2KHHA 3L8DA 1ZMUA 1NV8A 3A27A 2FK7A 1G3IA 2UYOA 4YUVA 2JY7A 4AZSA 4LWOA 4PNEA 3R3HA 1IY9A 4M36A 3HVJA 2YX1A 5K0JA 4RX1A 4EKIA 4YUZA 1HNNA 1KYZA 1FP2A 3NJRA 2DULA 4RV9A 3GXOA 2BH2A 4Z2YA 3T7TA 2LBCA 1RI4A 5CVVA 3DXXA 2ZULA 1NW8A 5IKMA 3DLIA 5P8WA 1P91A 2IDKA 1L3CA 4F85A 1XXLA 1WY7A 2PXAA 4PYIA 3EVGA 10MHA 3PS9A 4IV0A 3EPPA 3G8AA 2F8LA 2OYRA 3U81A 5CM2Z 3FZGA 3TOSA 3ELYA 4QVGA 3C3PA 3KPYA 4G3OA 5K05A 2JNHA 1P1CA 4RTQA 2JH8A 1JTFA 3P9KA 2PY6A 5FULA 2ORED 4DKJA 2UYQA 2IH4A 4R05A 3BUSA 8MHTA 2DAMA 4E2YA 2JY6B 3HVKA 4R8SA 1U2ZA 1G4AE 4X63A 4DQ0A 3LBYA 3FYDA 2AS0A 1Y8CA 3KQPA 4C03A 3HCFA 1JSZA 4GQBA 3TFWA 4EVIA 4GEWA 4FP9A 1FBNA 2DPMA 2G8NA 4PIPA 5E9WA 5EZQA 1ZGJA 4M37A 5FADA 2P3LA 3EVFA 2P35A 5DX0A 4X41A 4V0RA 3EEOA 3PTAA 2NNWB 3K9OA 5E1MA 1YZ3A 3UJDA 3GWZA 5K0LA 3UJCA 1JQ3A 2HMYB 3SSOA 4YV1A 3THRA 1T43A 1SVUA 4BP3A 3FUUA 4ISCA 4MQ4A 2N47A 4MTLA 3PLAE 1RI2A 2CWBA 4KIGA 2MR9A 4LECA 2PVCA 1ZMVA 2R0IA 3SR4A 3JWGA 1FPQA 1HT2E 1VPTA 2ZWVA 4E33A 2EJTA 3WSTA 4BLWA 1WJ7A 3OU7A 3GRYA 3G7UA 5FUBA 2FRXA 2IBTA 1KIAA 3ER8A 4PYMA 3M6XA 5KYGA 5DPMA 3FPGA 4OQEA 3DULA 4PGHA 2ZTHA 3KQTA 2L2DA 4ATNA 5GIPE 5BP7A 1JQDA 2LVPC 1AQIA 1QZEA 1YFJA 5HIJA 5GM2A 2OY0A 4ER0A 1JG4A 5JI2E 3GLIE 5F2OA 1P3QQ 4FSDA 2LTUA 3P2KA 1KPIA 4C04A 2A14A 3HNRA 3C3YA 5ICGA 5EHGA 1XCLA 2YTZA 2P3OA 2WA1A 2K9DA 3OE4A 1YB2A 4PIMA 1VLMA 4A6EA 2DNAA 2GH1A 3QV2A 4DZRA 2P1DA 3HA5A 2JG3A 1ZMWA 4E70A 1XDSA 3P97A 1C7YA 4LG1A 2QM3A 2V74B 4RTPA 3ME5A 1ZV1A 2ZBRA 3KQSA 2GLUA 1QAMA 1WG8A 3CC8A 3AWIA 3HCCA 1CUKA 4YV2A 2ZZMA 5E9QA 5C0OE 1XDUA 3M6UA 4QDKA 5CVUA 1ZGAA 1AIPC 5LSAA 4ER6A 4RTOA 5E8RA 2EJUA 1KR5A 5LQKA 2IP2A 2AOUA 3EVDA 4CKCA 5EG5A 4RSRA 1QANA 3UJAA 3DXZA 2MGWA 1SG9A 3T6PA 5KQSA 3AY0A 2NP7A 3M70A 3MCTA 5K0FA 4QVKA 3E8SA 3DLCA 4C05A 3PFHA 3K0BA 1WGLA 2AOTB 5EHIA 5DLYA 4PYNA 2NYUA 3UWPA 3KR1A 3IHTA 1D2HA 3FYCA 2QE6A 3EGEA 5HEKA 2IH5A 4YUYA 2LVAA 2PXXA 4KVZA 2PKWA 3FE3A 3BT7A 3AJDA 1JG1A 1L3BA 1NKVA 3FTFA 2WK1A 4GUAA 4R8RA 5EMLA 4E2WA 3VC2A 2R3SA 5EGSA 3KQWA 4XCXA 2P3QA 3BGDA 5HZMA 1D2GA 2AR0A 5M5BA 2XYVA 3G2QA 3NMUF 3TKYA 4DM3A 4MIKA 2AZTA 1Q0TA 3HVHA 3NVMB 4EK9A 3T7RA 4EMSA 3ELDA 3O7WA 1VIDA 1OTRA 4R6WA 3BWYA 1WR1B 3TQSA 1L1EA 2ONZA 4PYJA 2ZTDA 4FT4A 2AOWA 4KDRA 4OQDA 2AN4A 2IPXA 5FA8A 3SVZA 1YZHA 1HMYA 2O57A 1MJFA 4PYQA 1OR8A 5FQOA 2GPYA 2PX4A 4PINA 1DV0A 4POOA 3FRIA 1VEKA 4WVLA 3NVKI 1HJPA 5JR3A 3Q87B 1RJEA 5GINE 3FUTA 1G8AA 3GGDA 3OFKA 4KW7A 1T6OA 2OXTA 3SMQA 2DAEA 3CCFA 3JWIA 3ANXA 2HAKA 5K09A 1X1CA 3K6RA 2CL5A 1PJZA 3LCCA 5DRYA 3DOUA 1DUSA 3FUVA 1O54A 4FZVA 5HIIA 5LQJA 3IYLW 4X60A 3DXYA 3LHDA 3QOWA 2V7EA 2ADMA 1XTPA 2FHPA 5EZSA 3RW9A 2I6GA 1EQAA 2CWWA 1ZHFA 1BHJA 5E2BA 3V8VA 3NDJA 3EGIA 2PJDA 1B42A 3KQOA 5EKUA 3UJ6A 4GBED 2HV9A 1TPYA 1JG3A 4RTRA 3MERA 1O9HA 2IBSA 4QQKA 4GOMD 1YLAA 2B2CA 3PX3A 2YXDA 3O4FA 5K01A 5T6BA 3BXOA 2G1PA 2NXNA 4RVFA 3B5IA 4HSGA 3BGVA 3C0KA 4GF5A 1OQYA 5D1HA 3TPZA 2ZSUA 2YQZA 2EFJA 3CJQA 1ZQ9A 4RTMA 3KPVA 5FCDA 5KQRA 2HWJA 5BW5A 2XYQA 4PYOA 1VDLA 3GRZA 3KQYA 3CBGA 4C08A 2AOXA 5DT2A 1Y8GA 2EKKA 2ESRA 1TR8A 3M6VA 5EMMA 3GDHA 1RI1A 4C07A 2G3QA 1XXHE 3KQMA 4MWZA 4P7KA 5CVJA 1FJXA 5FQNA 2QY6A 3NTVA 1G38A 5EEGA 3HA7A 5EMKA 4QDJA 1L3IA 1R00A 3ID6C 5GM1A 2JHAA 1H1DA 3OU6A 1VEJA 3KKZA 3LPMA 3T0IA 2DAIA 4KIFA 5DFLA 4RTSA 1E94E 4HG2A 2WZJA 3MMPA 3NDIA 3RODA 5K03A 3DTNA 4LWPA 4QPNA 3SXJA 4WP2A 4UN2B 2YVLA 1N7JA 3BZBA 3SSMA 2ZBPA 1QAOA 2R6ZA 2WA2A 2HTEA 1HQYE 2CMGA 4UOEA 3OZSA 2AVNA 2H5XA 3UJ7A 5F2KA 3MTEA 1NT2A 3DMGA 2E5WA 5C9ZA 5EOVA 2Z6QA 1XB2B 1VE3A 1INLA 2OKCA 1PGYA 2ZIEA 4PCAA 4RVDA 2HWKA 2OOAA 1QZZA 2L4EA 1IM2A 3HCBA 5EMJA 2PT6A 2VS1A 2LVQD 1RI3A 1Q02A 2BWBA 2JUJA 1ZKDA 3DMFA 5FWAA 3DUWA 4FSXA 2QRVB 1YFLA 3G8BA 3X0DA 4HTFB 4CKBA 2NXCA 2EKFA 3I58A 1BOOA 3EMDA 1VG5A 3BKWA 1KHHA 5KVAA 2LD4A 5EEHA 3EEYA 3TKAA 2P7IA 3I53A 3GU3A 2KW5A 2H1RA 4P7FA 3DMHA 2L4FA 1NE2A 3A25A 5JUWA 1G55A 1TW3A 3FUWA 1XDZA 1EJ6A 3CGGA 1QAQA 4OA5A 2DAGA 1SQGA 4QTUB 5K0NA 1AV6A 5DX8A 5FHRA 3OE5A 1Q0SA 2BR4A 1O9GA 3THSA 3A7EA 3E46A 5HIKA 3B89A 2Z6UA 4IKPA 1IXKA 3PX2A 5C1IA 5LQAA 5MHTA 5DRTA 4QQNA 1PRYA 2XVAA 1VQ1A 2DZLA 1I9GA 1SQFA 2ZIFA 1R8XA 3B3JA 1XJ5A 3H2BA 2QYOA 1QYRA 3EVCA 3DR5A 4AUKA 3MHTA 5FA5A 3VC1A 2O06A 3EVEA 1AF7A 4F2LA 2C7QA 3GLFE 2HR1A 3ELWA 2Q41A 3KQQA 1FP1D 5DM4A 3GRVA 3OPNA 2EJSA 2QSFX 2NP6A 3UZUA 3TM5A 1M6EX 2IDJA 3PVCA 3GNLA 2UZ4A 1VL5A 4A6DA 3P9NA 2O05A 1WXWA 3LKDA 5DM0A 2H00A 1DCTA 3LDGA 5E1BA 4Y30A 3LBFA 2ERCA 4KDCA 2O07A 5E1OA 1P1BA 4WXHA 2ONYA 1EAMA 2ZW9A 5HILA 1WXXA 4OBXA 2PXCA 1NBHA 1IXSA 3I5UA 3MQ2A 4IV8A 1VEGA 4AZWA 3HTXA 3FPFA 5FTWA 1EG2A 5DWQA 1YF3A 2I62A 2DKLA 5GWXA 1XVAA 3AXTA 3MB5A 4XUDA 3EGVA 3EVAA 4O29A 4K6MA 5E1DA 2DAKA 3AXSA 3KQVA 4V0QA 4B17A 5EIWA 4BP1A 2OO9A 1G8SA 3P71T 1NW6A 4Y2HA 1NW7A 2GA9A 3FTDA 3C6KA 4BY9E 4KWCA 4RTLA 4DA4A 4PGGA 5DM1A 4BLUA 3OZRA 3IV6A 3R24A 3F92A 2ZBQA 5DTRA 5DTMA 3B3GA 2PLWA 1N2XA 3R6TA 4C4AA 2JZ0A 5LR6A 2NXEA 2JZ1A 2PX2A 5HIMA 5GP1A 5K0GA 2O0LA 2FCAA 4OX9Y 1BVSA 4KRGA 4RTNA 4RVHA 5B1SA 3G2OA 4PCLA 3HP7A 1UIRA 5HFJA 4GEKA 4IWNA 2BWEA 4U7PB 1P39A 1ORHA 3D2LA 3CVOA 3G89A 1G41A 4AZTA 1NBIA 2PGXA 5IH3A 3UBTA 2BR5A 4X1OA 1JR4A 2OPBA 2JP7A 4DCMA 2XBMA 2YUIA 4DCGA 5K0BA 5ICEA 2MROB 3P2EA 4FGZA 2OO3A 2VZ9A 1NV9A 3VYWA 2ZLBA 2IH2A 1Z3CA 2ZFUA 3LDFA 4C06A 4DMGA 3FRHA 5CD1A 2OBFA 2PBFA 2JHCA 5DSTA 3SGLA 4X61A 5EVJA 1GO5A 3KR9A 3ERCA 2DENA 3KHKA 2FK8A 2PSSA 3G5TA 4E32A 3VSEA 1V92A 2HNKA 4HGZA 2UYHA 2BM8A 2CKDA 3QOXA 4YUWA 4ER7A 1R6AA 2JY5A 3Q7EA 1X1DA 3FTEA 1N7IA 1L9KA 2ZZKA 2OB1A 5DM2A 5T67A 2YR0A 1TTEA 4RVGA 3GRUA 2QHOB 5E8JA 1BC5A 3LCUA 2BZGA 4F1IA 3UJBA 1R18A 1VBFA 2QNJA 2RRUA 3P9CA 3E05A 1WGNA 1KXZA 3P8ZA 3GRRA 3O31A 2JJQA 5K0EA 3IECA 3UA4A 1EIZA 1YUBA 3GLGE 2EG5A 2PV0A 1OAIA 2VDWA 4CWAA 5DXJA 5ICFA 1V39A 4BLVA 5FWDA 4HRAA 2AOTA 2IIPA 3PT9A 3MGGA 2VDVE 3BBZA 3EVZA 4CXMA 2AN3A 3A7DA 4QTTB 3KPJA 1TW2A 3GJYA 4HH4A 4HEOA 2G72A 5ICCA 1VP3A 3M33A 2I9KA 2H11A 5EIFA 3TRKA
chains in the Genus database with same CATH superfamily
2CNWD 3DEFA 2AOUB 5HQ3A 4MKXA 1IC6A 1DINA 4BN5A 1A77A 3H5TA 4M0UA 4GLJA 4NOKA 2J9RA 4KR7A 1TCVA 3F6BX 1ZAYA 5AXAA 2HHAA 4NBRA 1BU5A 2FWNA 2F8MA 4BUCA 2X2PA 3QGMA 4EGAA 5I9BA 1QKJA 4X64M 2VBGA 2XT0A 4ZVKA 4OGKA 1RC1A 2N9UA 3GHHA 2PMKA 3EH2A 1NMEA 4LMPA 2BRUA 2P9QA 3FPJA 5AOCA 3EC1A 3EZNA 5F1OA 1G8MA 4P0QB 4XR4A 4RK4A 2GEBA 3K31A 2RHBA 1PKXA 1K3TA 2Z56A 2JEZA 3IT2A 1CC1S 4FVTA 3LRTA 3ZV5A 1OXMA 5BWBA 1GTG1 4GZLA 3SYNA 3CLTD 1Z4LA 1SURA 5I9LA 2Z6AA 3K9PA 4MCJA 2DUMA 4EHBA 4TXNA 2IFTA 1TCCA 1IXRC 2DFLA 1ZMBA 1UANA 4QOIA 3WAGA 1W47A 2B1RA 4NQRA 1WV1A 2YWDA 2R48A 1I2ZA 3OLQA 2FEAA 5H0IA 1N34M 2V3CC 3GZ4A 1UT5A 1UEJA 3H19A 4P82A 2IEGA 4BO6A 3P0EA 5ERGB 1Y1TA 4FFSA 4D7AA 3LMMA 4MA0A 1L7VC 2AEEA 5FBWB 4JI7M 4CG2A 4F3NA 4MI9A 2G4CA 3O8QA 5BYAA 4L15A 3QJYA 5ITWA 3MTGA 2J8ZA 3QFFA 1JAIA 4HN9A 1UT6A 4QPJC 1QZ3A 2GF9A 5BN5B 1QE5A 2NQ8A 4M83A 1S01A 1CUUA 3T41A 3ETEA 2JH3A 2E3JA 3TNDA 4GOND 2XVYA 2Z2IA 5A3JA 2OZKA 1XKQA 1GXSB 3DAFA 1IAVA 3B60A 3OETA 4P83A 1F0YA 2A1TR 4CF3A 2PKRA 4HEA6 3GMSA 1EBUA 3OM0A 4R40A 3U6SA 2PT5A 1CR4A 3T5TA 4M0DA 3C24A 3DHYA 3C4JA 5IUNC 2DBZA 1TJNA 4YREA 2XB4A 2XXAB 1SUEA 1Y4DE 4FGLA 4EB8A 3ZBUA 3F74A 4GOOD 4Q47A 5JS2A 3CF6R 5BMOA 1Y1SA 2JCVA 1FP7A 1GU1A 1P6XA 3IDZA 7ABPA 1NBMA 3DAPA 1CY8A 1R5BA 1BTOA 1PR9A 2HL6A 1R74A 3KJFA 2KDLA 3HJRA 4YB8A 3JWHA 1P9WA 5JNSA 2Q9UA 3UJ8A 3T1NA 1FP4A 2UAGA 5F7OA 1IL0A 1QBGA 1OROA 4JP2A 5GJVC 1QXSA 3RC7A 5A62A 3D4PA 4J2OA 2JFUA 1QZUA 1AKMA 1T0IA 4UW9A 2XYHA 2IXDA 4EBFA 2PWPA 1RBQA 1MNAA 4MS4A 2H9AA 3E35A 3PHLA 2O01F 4UTZA 5MN6A 4UM9D 1CJVC 5KTRA 3ESDA 3QKIA 2VH2A 2XNHA 3FKEA 5A9RA 1MB0A 3CH7A 2GASA 1J5XA 1EVYA 2IXGA 1GILA 1XK6A 4ODIA 4Q37A 3W8EA 1Y9JA 5I6DA 5JASA 1LBSA 2IYYA 3NBXX 1T5IA 5C5CA 1DXQA 4ZVOA 4M4SA 4ZI7F 3QEAZ 3M6IA 1K88A 2I91A 2O59A 3A6DA 4L0DA 2H16A 2AHOA 1HFWA 5LJIA 3ER9A 1VPVA 4BLRA 3TOVA 1D9ZA 3UXEA 3NC0C 3N7TA 1J24A 5IAOA 4FYJA 1IM8A 1U0RA 3M6AA 2ZI6A 1ZFNA 4DNFA 1XYGA 4B45A 2H4XA 1TCBA 2F5SA 4MQBA 3V1NA 4LAFA 4Y2XA 3VM6A 2G7MC 1HLFA 4ZQCB 3TH5A 1FTGA 1YB4A 1GN9A 4I6GA 2FK7A 1H4TA 3QY9A 3W04A 3JVDA 4YUVA 5GZ1A 3BD6A 4LVUA 1MZVA 2HI0A 2W6ZA 2CFRA 2VZ0A 4EDHA 4A91A 5LP6B 3KKKA 7AT1A 1T36A 3UH1A 3FI0A 2P30A 2QJWA 1K5HA 1DKRA 2ZIZA 3ODPA 3OC0A 3I04A 1HE1C 4PAGA 4HNTA 3FYUA 2VHWA 1TI7A 3QMMA 2EGGA 3NTOA 4HQ6A 5FRDA 4OK5A 3WK7A 2O2DA 5IKMA 1MQ8B 4WLNA 3IO5A 3V55A 3AIMA 3Q2KA 5HBRA 1EP9A 1Q7GA 3ETNA 3GD7A 3RUEA 5TEWA 5ED4A 4B7FA 1WY7A 3X1DA 4JQOA 5DI3A 3AH8A 2WM9B 3EPPA 2J32A 2LRHA 3ZI7A 1AS0A 6CHYA 2RGNC 3QSGA 2O3TA 4CGYB 3GCWA 3HSSA 5CM2Z 1FK8A 5G2OA 3ICCA 2W2KA 1YQEA 1YR7A 3IPXA 5I8WA 1I0LA 4NHOA 4G5OA 1L4NA 2JNHA 4ZIRB 5I9IA 4Y9DA 2DQSA 1II8B 4DL9A 1Q3BA 5GVRA 4UMEA 3G6WA 1VYVA 2MMCA 3EYAA 1J5EM 4HFJA 2AXEA 1U7HA 3HK2A 1F2TA 2UZIR 4Z3DA 3FYDA 3QEBZ 1KYXA 1MVLA 2HCTA 1YONA 2QCUA 3H5IA 3OZBA 3N8NA 1I0ZA 1TVCA 2DPMA 4RQBA 2VTDA 2REQA 1MFZA 3LK7A 2F9MA 1ZD3A 2HGSA 2I7XA 2ICAA 4Y6LA 1IWBB 1BFUA 2X2EA 3EPKA 2FQYA 3GWZA 5EJ8A 3KLBA 3U7IA 4BNIA 4I4IA 3Q2OA 5H3CA 3PWTA 1NURA 2XGOA 3P9YA 1HUQA 2NG1A 1AMUA 4XASA 5I7OA 1O8CA 4R1TA 1NWCA 4LSGA 2DB3A 2ETVA 1YK1A 3P4XA 1NULA 2I1QA 1XZKA 1FPQA 3ND7A 4QHSA 2A9FA 3WSTA 1GYQA 2DLNA 2AEFA 3CSSA 4EZIA 1U94A 5IWCA 2XRZA 5KYGA 3TB6A 1QO7A 1J0BA 5H68A 1TDJA 1VCNA 4TWBA 1WW8A 2D8AA 4YPFA 3THWA 1YDMA 1JA0A 4ABTA 4OYLA 1K7XB 3PC8A 2ONCA 4PPNA 4QODA 1JJFA 3OZUA 3P2KA 4GKJB 1HDGO 2VPQA 2A14A 1QDRA 3C3YA 1PR3A 1ZXXA 1YQDA 2GJAA 1UZAA 4D56A 4XSHA 3TRDA 2EEPA 4KE7A 1MJGM 1OWMA 4H27A 3ZIDA 2W2VA 3VZRA 3K0CC 4B5KA 3BCHA 4MV5A 3RV4A 4WW0A 3ZWQA 1UWCA 1SVKA 2D5IA 1K4MA 1VSBA 2V74B 3CNEA 4G1EB 3BIOA 5CB0A 3DMNA 2XZPA 1LBEA 5CEJA 4HPXB 1BE0A 3HPRA 4GKKM 2Y4NA 4BMSA 4P36A 1JKJB 1Y3AA 1C3VA 4ID3A 4MGHA 3S5UA 1LWOA 2OM6A 5D85A 2XA9A 1WPQA 2KM1A 3AEYA 3TVDA 1AC5A 3D5TA 1DGHB 3NBZC 2F4VB 2P6UA 1E2PA 3VSBA 2UUBB 2R1TA 1ES9A 5LXTF 3R7NA 3L7JA 1Y8RA 4PYNA 5L3QB 1G5RA 3U9SA 5JH7A 1GL3A 1JE0A 1G42A 3FDZB 2RCYA 3VZDA 3FYCA 1V11A 3O8DA 5DASA 4B85A 5CB6A 2OG1A 2C2YA 2ZM5A 5EINA 2PKWA 4KG7A 3FRJA 5B7QA 2RAUA 3UT0A 1VJ5A 2OYSA 2FRDA 1NKVA 4N8DA 2XNJA 1W94A 3LKVA 4GM1A 3ROZA 2Q2NA 4GDFA 4X1IA 5B4TA 1SXJD 1FS6A 4I0WB 3ILSA 1Z0UA 1Z88A 2D2XA 3PL1A 2R7KA 3U7HB 5DNEA 1YE9A 2H0QA 1BE1A 2ANCA 4IBIA 2VPWA 3LU1A 4IL5A 1SOAA 2P1ZA 1P73A 4N9QA 1ZK4A 4MKZA 2C5AA 2Q5HA 4I5GA 3VR4A 2VRNA 3WMFA 5JCXA 3ZDCA 1AN9A 4K6GA 3X1KA 4H1UA 1ZCZA 2QORA 2AIRA 1TU4A 3A9TA 3I1YA 3KQLA 2RIRA 1F06A 3WV4A 2XOXA 4Y2UA 4GMKA 2H4HA 1Z0AA 2YWJA 2UZ0A 4S24A 1A1SA 3RS0A 2CDRA 5JZBA 5KNDH 4FCTA 3SMQA 3OECA 1XN4A 4YJ2B 5HMMA 4QOZC 1SHJA 2P2LA 2CHUA 2HDOA 2O5EA 1LJ8A 3JQEA 1Q0ZA 2AJTA 3DTVD 2C5LA 1NLMA 3I0MA 4LNUA 4RXTA 2R7MA 3IUMA 4MW1A 3OEHA 1W0KD 1ZHFA 3GFOA 4ZI2A 2YW9A 2AYYA 1EX6A 5K5EA 1U6KA 5CTAA 1RM4A 2X8WA 3T5GA 3PG5A 4KAJA 4JDPA 4YCBA 1H8EA 4MW0A 4RC9A 1O9HA 1K63A 4QYXA 2ETXA 3OX1A 1XEAA 4KQWA 1M54A 4HXGA 3UEOA 1QONA 2ZDGA 2FQXA 2Y9MB 1CFJA 3T34A 2V3VA 2GEDA 4ZCMA 4QRDA 5I9MA 3A2KA 1HRKA 1XZQA 2H0AA 4CM8B 4EPVA 3AZPA 5BR8M 2A0UA 5FBHA 2C2XA 4LFBM 2WM2A 5CX1B 2WJPA 3PFNA 4QJ3A 1E6EA 3ILHA 1SVWA 4X84A 2OHFA 3M6VA 3WK4A 2C78A 3U6BA 3GDHA 4A8JB 4DPMA 1RI1A 4DCNA 3O90A 4C07A 2O14A 5IXSA 1AVTA 1FOEB 5JYEA 2RGCA 4B3RB 4B7CA 2XWBF 2D1TA 3ID6C 5GM1A 4GPEA 1V3VA 4W99A 1L5HA 3T9AA 5HVNA 2P5SA 1KVUA 4RTSA 3QMVA 5CA1A 4JI4M 3RIHA 1N5IA 4G3XA 4ZT4A 1TMYA 2BHLA 1RQLA 4R0VA 3PR2B 4TLLB 1XZCA 2VR1A 2C5FA 3FD9A 1HF3A 4WHMA 3OZSA 1XU4A 5FLYA 1V6AA 4YQEA 4HDRB 3PXGA 1VJRA 2XWQA 4IIEA 2IDZA 3JR5A 3S7TA 2OVFA 4RIHA 4LUCA 3IXLA 2OKCA 3WGZA 3O95A 5JSFA 2AHMA 3KZ1E 3ZIAA 4RK1A 1I7SB 2J5KA 3ZDQA 1RI3A 3CZ4A 3SQDA 2J5RA 1UXKA 2A57A 4CCYB 2N35A 3COWA 1LLFA 1JEYA 4EL0A 3ETCA 1BROA 1R8JA 2W70A 3HB0A 4RF3A 5M2QA 1QCYA 1Y81A 2QRVB 1VSTA 3IP6A 2F90A 7REQB 3DB2A 2P9EA 1C2YA 4BDSA 3IMKA 2EKFA 1JU9A 1BQ4A 5HTKA 3PNQA 4Y6RA 2YS7A 4P4SB 1XDDA 2QTWB 1RW4A 1C0EA 4O1MA 3USZA 1PYDA 3PDCA 4LYGA 4F0JA 1AURA 5E6SB 3P9XA 5DOZA 2HV8A 1X7ZA 2P4QA 2HA2A 3W4IA 4B82A 1A9XA 4O3MA 1H2FA 2G5CA 3U09A 3LM8A 1KL7A 4EHAA 3IEPA 4H6VA 2V6MA 4O4JA 3O4GA 3L8CA 4NSRA 3WADA 1NDHA 2DAGA 3RIXA 1A04A 1V95A 3EIWA 4V0NA 4PQEA 3E27A 2ZBKB 1ZJ6A 4F91B 2XCLA 4GI1A 1YH3A 4P0TA 1IBLM 4AD8A 2HTFA 1ECFA 1ZIOA 3EXG1 3H0KA 3ZI0A 2QLTA 1VQ1A 1RYZA 1PJIA 2JJ1D 3IOEA 4Z3KA 2I33A 2HQOA 3TLZA 5HS4A 3OBBA 4AMYA 2V97A 1W4ZA 3S28A 1Z37A 2B8EA 3E5NA 4DBLE 3VR3D 5BWOA 3HP1A 4LDPA 1GOTA 4ZMSA 2AL7A 3OY7A 2PL9A 4NAVA 2JI4A 4OFBA 4HVAA 4C14A 2AFRA 2TECE 1QHFA 3T5PA 3L4KA 4M1QA 1CJSA 4KNYA 5FOXA 1HQCA 2OBMA 1JAXA 4RCYA 2UZ4A 2ZTVA 1ECPA 1UKCA 3EPRA 2NUPB 3M81A 4CZ2A 3TIXB 4QXRA 3WO1A 3L0DA 1ZM4A 4C1NA 2V6GA 4PRKA 3T1YB 1N6HA 4NMMA 4QFCA 1MQAA 3RSFA 3KAKA 1IOLA 3ANMA 1EHIA 4IVNA 4K0RA 4DV6M 3KVNA 1L4UA 4ZJZA 4KR6A 3B53X 1J33A 2IHUA 1CT9A 1NF9A 5D7NA 2OGSA 1YR3A 1SOMA 5ITVA 4X65M 1GRNA 5LKRA 4R84A 3DHEA 3C3JA 1XRNA 1NW7A 2D3TA 2FVYA 5B12A 2FOIA 2IEAA 2HCRA 3IQEA 1UP7A 1E4OA 5ESXA 2AQIA 3D8SA 4F72A 2X42A 4CCAA 2YWBA 1XU7A 2IY8A 3SASA 3H42B 3UATA 3LZCA 5A06A 4DCPA 4E0BA 2HK7A 3DE1X 1XDWA 3ZEIA 2ZDQA 2O0LA 3JWEA 3JQBC 3E61A 2FPIB 3K5IA 3PA8A 5C8YB 2XADA 5KAMA 4PRLA 1SUWA 2VP2A 2AEMA 4NFSA 1JIXA 2QZ9A 1ORHA 3TDKA 3T3PB 2C4VA 4KMMA 4HZUB 4HLDA 2DR2A 2P5YA 2JVKA 2XBMA 1R0ZA 5K0BA 2EP7A 4RADA 3KYCB 5CX4A 4JXZA 5ALKA 1HNWM 4JL8A 1FMLA 4L76A 1DAIA 2X8BA 4UZEA 3WRWA 1II0A 1Q0LA 3NI2A 1TLLA 4OUDB 4C06A 1EFPB 3CSDA 3N8GA 2Y8EA 4X61A 1M9NA 1SN7A 1KOLA 1ML4A 1I30A 3K30A 4ZALA 3GDOA 3Q3HA 1MC5A 3QOXA 4JX8A 4V39A 2J0EA 1V7CA 2FHSA 1R6AA 4IIUA 5E3HA 4Z8XA 4I1OA 3PXAA 1B73A 3P2MA 5KQGA 5JS6A 4FNMA 2V6IA 1H6BA 1GGMA 4RVGA 5JAPA 1M2KA 3IBYA 4LF7M 1AOXA 2WM8A 5AW6A 4LWQA 1URPA 1MDFA 4LYEA 5KCZA 2FMHA 3BE6A 3T1OA 2NGRA 2VJBA 1H4VB 1SC9A 3LH5A 5LOVA 4GGOA 3TAXA 3VO1A 4KK3A 4JUDX 2IE8A 4Q9JA 4O2AA 1DKLA 2DPYA 1T8UA 2OHGA 3NVDA 1EFHA 4MXDA 2XE7A 1VXOA 3D43A 2IIPA 5LYJF 5JO0A 4BVBA 4AY3A 3RVDA 4X8MA 3BMNB 5IDQA 3A7DA 1EWYA 1NDUA 3AGPA 1ULTA 1GTL1 1I7PA 1WB4A 2PJUA 4ZT6A 5KNBH 4YGXB 2AE2A 4X6YA 2JLZA 1YR2A 2Q7XA 2UDPA 3E23A 3OLYA 5KS2A 4S1WA 4ON9A 1VIAA 2J45A 2XTMA 4C4TA 1HSOA 1CR0A 2UYYA 1NA5A 2V9CA 5BN1A 5CG2A 4JN6B 2Y92A 2HWUA 3THGA 1GZ3A 2V7BA 1WZNA 1FLNA 1IEXA 2QBYA 2VKQA 4BV8A 4Q93A 4FSHA 2PCLA 1L1TA 3O3NB 2VAWA 1UJ4A 3X2FA 3MD9A 1QRDA 1HDZA 2G17A 4AQYM 3E15A 4U2KA 4UTVA 4QPCA 4ETNA 2B3TA 2ZRBA 1LV7A 2MCFA 4UVHA 4LC1A 4RPIA 2NO1A 1MN3A 2GZ2A 1IEQA 1CB0A 5TQJA 4CLDA 3R3UA 3NH6A 2P6NA 3SNHA 1XF1A 3DPUA 4M2LA 4NONA 2RHMA 1CUIA 1JXMA 3KUXA 4XGIA 2V59A 1U7DA 4XFKA 2Y05A 1GYRA 3QG5A 5CJ2A 4GLOA 4H7JA 4AMVA 1HTWA 1C1XA 1E4EA 2J41A 4QXOA 1MEJA 4GOKA 3KSRA 1DTWA 2QU8A 5F78A 5TGZA 2OGZA 5IAAA 3IKJA 2OWEA 4PYKA 4IDHA 1JHXA 4JC5A 2GPNA 2W8ZA 1MV5A 2GLTA 3MA0A 2XQVA 3RM3A 2AK2A 4RKUF 1GZHB 4JBGA 4M9RA 3DCNA 1M5TA 2CB0A 2OV8A 3V42A 3RYFB 4DM4A 2HRCA 1DE0A 3MUFA 4M1MA 1C0IA 5JNTA 3TR0A 1PSWA 4DCOA 3N53A 2BGGA 4CUJA 4JJFA 3AVPA 3S8EA 1MOZA 1C7IA 3BGWA 3PB3A 2F1RA 1R8YA 4F1JA 4MULA 1FTWA 5JSZA 3KPUA 3TSWA 4S1PA 1PV4A 3OIFA 1I5EA 4PT5A 1PN3A 4MQEB 1Z5NA 5TSDA 1ZJ4A 4PONA 3KFUG 4BYMA 4ZHQA 4B6QA 1TUBB 1U65A 3OD5A 2OZEA 4CMIB 3B7QA 1R8SA 1T6BY 1DXYA 1Z4MA 4NK4A 2F2TA 3R5KA 2FZKA 2D7HA 1U0BB 4KPEC 3LVQE 1WMFA 3TGPA 1SZDA 4KNWA 3MWLA 3LMKA 2PEYA 1C3XA 2LVOC 4RK7A 3PWZA 4FFNA 2HRZA 3G8DA 1RJWA 5JPIA 3T52A 3OT4A 3TCKA 1EM6A 1UBTS 2O5CA 3IMFA 5J4KA 3MMSA 3V8MA 3OQJA 1U4SA 5C80A 3ZJYA 1P19A 2AR7A 1F20A 2FSHA 3EY9A 6REQA 3P9ZA 3H2YA 3DZHA 4XGKA 2QV7A 2WTEA 4KH0A 2LIPA 3LRPA 1YBFA 3JYOA 4TLAA 721PA 3JYLA 5FI1B 1EE8A 1CUYA 2JHGA 4DY6A 2K7FA 1MB2A 5AHRA 4XWWA 2CJWA 4YCLA 1JPVA 5TPZA 4FI3F 1F0KA 5FV7A 5ITXE 4KKVA 1AS2A 3HVUA 2JGNA 4PVCA 4G4OA 5JQGA 4FCCA 1CUGA 3EHEA 1DT5A 1YTUA 5LMNM 1G21A 1MIOA 5KNCA 4H4DA 5BQPA 5K4AA 2BFEB 1FFXB 4CFSA 5CCBA 4E15A 2VTEA 1YS9A 3TLKA 1KPGA 2V9ZA 1CZHA 3K0FA 3O83A 3VR5A 4FZRA 4C3ZA 3TMAA 1U0JA 3E7PA 3HA3A 1L1RA 4ROSA 2R68A 4IO0A 1NZFA 2BSAA 1UFZA 2VNHA 4A5OA 5J58A 1W87A 4F2HA 1D6JA 1JWBB 2BWJA 1VRVA 4RA6A 2RAVA 1IEVA 2G36A 2GQ0A 1HBJA 3O8CA 5BVHA 4JV5M 1WU7A 4DF3A 3IPAA 5EJEA 2ATXA 1W1UA 4CTJA 4H15A 4DDMA 1BU8A 2EDCA 2NT3A 2JA2A 1Q20A 4G1CA 5B57C 4URZR 4A23A 2FWMX 4MVJD 4G97A 2WKQA 3VTZA 2BMFA 1LQUA 2FPKA 2Y67A 4JJ4A 3FCCA 1RR6A 2D13A 1UDBA 4X66B 3GA7A 1XWIA 4YUZA 2J30A 1JH8A 3BHNA 4OHMA 1FP2A 1U3UA 2VUSA 4FWGA 3OZGA 4CM5A 3NJRA 4EAAA 4RKQA 4MLZA 1Z4NA 3R4VA 4LRWA 5EJ5A 3ZTWA 4P32A 4R83A 1IN7A 4GOJA 4IJEA 5KOHA 1V5WA 3ZDBA 1UPXA 3R09A 2Q5EA 1OLXA 2ZIUB 2A84A 3V4VB 3MBIA 1UADA 5NULA 4WFIA 4BV9A 1OWLA 2XNDA 2E85A 2WVHA 1TK3A 3AJ8A 4YA6A 1R0LA 1B0PA 5THKA 1GPWB 1E63A 1HNXM 2VHYA 1EGQA 4RD1A 1NQ5A 4OD0A 1IZZA 1C7ZA 2OYRA 3SP1A 4JT2A 4MJ3A 2N42A 1UKZA 4FDMA 4R9NA 4FPXA 2D00A 3EG5A 3HCPA 3Q40A 4IFEA 3TSCA 2PA3A 3GVCA 5D84A 3RBVA 3D5EA 4AY2A 4QBKA 1NXSA 1JTFA 3LXUX 1YTLA 1D2MA 1EFUA 4R05A 2DHCA 3BUSA 3H99A 2C59A 4DVGA 1G20E 3QKTA 4XH9B 3KO8A 4ENPA 1ZD9A 4HAUA 1CUXA 3TTWA 2CVHA 4Q16A 1RKVA 2V7QA 1BZYA 4YV7A 2OHIA 2Z57A 2WWGA 4LC0A 1UPBA 1OHHD 1CE8B 2H2WA 4PC3A 5E1MA 3L0CA 3AHGA 2D7EA 4BASA 3TLGA 4C3VA 1EGVB 4DBZA 4QELA 1NVTA 2Q8NA 2VHXA 3BREA 5B3JA 3WLNA 4RLSA 1Z6AA 1OLUA 2BFBA 3DZBA 1IN8A 4IYRA 1SQ6A 2IOHA 3I6QA 1YMQA 3K5WA 4L02A 3LZDA 2XSZD 1B0AA 3MJRA 1ID8A 3C16C 4HLQA 2FRXA 1D7AA 2FN9A 2IBTA 3OAAD 5FX2A 2SCUB 3ANLA 3FVWA 3HFJA 1GZ7A 3VNVA 1CJTC 4IILA 1PLKA 1JJAA 1AQIA 2GXUA 3RSZA 1C4WA 2QP3A 3EBLA 1C9MA 2SHKA 3OP1A 3B1WA 1CPYA 2YCBA 3EXEB 3O8RA 4EUFA 1X87A 1KI6A 1CQPA 5EHGA 3TTSA 4YLGA 1Q14A 4LJLA 4RDIA 2VAPA 3WIEA 4KGXA 2GH1A 1PWXA 3SDSA 3AEXA 3RRNA 2FZGA 5IWAM 3RUHA 5MN4A 3HU3A 1YE3A 3QYJA 3CA8A 1CCWA 5L95A 4Q4LA 4HRYA 2YNMD 3H11B 3PPIA 4U5QA 4X1YB 4AKTA 1V8BA 4YK7A 1CUKA 5ECWA 1D4ZA 4AY6A 2WMOB 4QO8A 1UMCA 3W5CA 3SQLA 4NEHB 2ZZMA 2ZJ7A 4PG6A 2IWRA 3PRJA 4ND6A 4L5BA 2ERYA 4Z6KA 4MQ5A 3L0OA 1YZKA 2LNHC 4YAGA 3KKOA 3I39X 2KSQA 1KR5A 1KBOA 1M1YA 4HNHA 5TPWA 1Y4ZA 4BC1A 1TGYA 1XHLA 2VG8A 4UATA 1VKRA 1CR2A 1IHOA 3EGOA 4LHXA 1SC4A 1M7GA 4H17A 5K0FA 3E8SA 4GMHA 4UHEA 1GPAA 4MK4A 5IJ9B 1T13A 4TRNA 5HEKA 2Q7DA 2A78A 3ZNNA 2X23A 4IBKA 2DGDA 1REQA 1KIMA 3AM3A 2GYYA 2LBPA 2NMVA 4HL4A 1XMVA 1KE2A 1XHEA 2WHXA 3JX9A 3QLEA 2CXNA 4HLNA 3A37A 4XRGA 4J4BA 3NMUF 3X1JA 3H84A 5JLAA 4ZK2A 1XLUA 1N2BA 2W2LD 4KR0A 2AZTA 1BCSB 5KVCA 1ZI8A 5LPNA 4DJTA 4CBVA 2MINA 3MWEA 5K6AA 4X7PA 1P9NA 1NM5A 1IK4A 1NHWA 1DMRA 4ZEVA 2GDZA 3G7NA 2I29A 4FC6A 1Z7GA 4AX4A 1OBFO 4P4LA 2Q0HA 4KDRA 2D4AA 3GPBA 2AN4A 3LF2A 2QT9A 3V2UA 1U2PA 1XYVA 2O9JA 1JAYA 1OOEA 2VA8A 3NLLA 1HDCA 2JFWA 1QCCA 4KW7A 4IBJA 2F3UA 3O1LA 5ALNA 3H1FA 3L1KA 5C37A 2ZYIA 1TH2A 1YR9A 4WN9A 5TLSA 4WY2A 1Z28A 4L8LA 5LQJA 3UWDA 1LRKA 3P7MA 1I14A 1O5IA 1SU8A 3I4YA 3K4HA 5EERA 2ES4A 4AZ0A 4RS4A 2IKSA 1TT5A 3ZNPA 3Q8XA 1E79D 3U17A 1H2ZA 1PUIA 5E2BA 4LVCA 1C9KA 2FG7C 4Q3DA 3O8OA 3OIVA 2FQQA 2QD4A 2KX7A 1NJ6A 1KETA 3PX3A 4V0MA 2Y21A 4ND7A 5K01A 1UBMS 4F5ZA 4EG1A 2H1IA 3BGVA 2M6KA 1AGRA 1ZM9A 2Q3CA 1KVRA 2Q1UA 2HWJA 2OCGA 4JJEA 3E48A 2A5DA 3K0AB 3GRZA 2QD3A 1ZSYA 1XAJA 1OU0A 3KHTA 2X3UA 5IZ4A 4C6TA 1ODJA 4F9FA 1E1QD 4HS4A 3CX6A 4G2TA 3KJXA 4DDKA 1LU9A 1GPMA 1G38A 5IKXA 2CLFB 1HG0A 3HA7A 4FNOA 2HLNA 1VEJA 2H2HA 3C39A 1I3CA 4P3YA 2QTHA 1RYFA 3SEFA 3QK7A 3LD9A 4EZBA 4LWPA 3BMQA 4UN2B 5AQ1A 5JISA 3WMEA 3P0HA 4OU7A 2ZU6A 5AW0A 1QAOA 2V7TA 3UN1A 4XGNA 1HQYE 4I6JA 4D0GA 5CB4B 3DA8A 3HH8A 1XTVA 2C2MA 5B2EA 3LHKA 4OHFA 3FMGA 1PGYA 2ZIEA 1LY1A 4ND2A 3HCBA 5EMJA 1HDYA 3I2GA 4EUEA 3ONDA 2VOJA 2O2CA 2P0AA 2X76A 3OOWA 4AWXA 3K9CA 1M2OB 1S8OA 4G9GA 5I8PA 5KSWB 2EIHA 1HYQA 1M6VA 4WE3A 1XDGA 1AA9A 2QVCA 4HMPA 2IXBA 2VPXA 3PD1A 3UV3A 5DNWA 4KBGA 4K40A 5HF8A 2FWBA 1XPJA 3PTZA 3BF7A 4EFMA 1M7HA 4YONB 3UM9A 3MYYA 4NCBA 3BE5A 4BNVA 2P5TB 2YZGA 3H9EO 4JZKA 2XVXA 2I2CA 1P9RA 2SBTA 3BD8A 2ADOA 4ITQA 4CV0A 5GJCA 3BOSA 1P1IA 1W36C 2JGKA 1RTTA 2WAAA 1YVEI 2Y0CA 3SBOA 5JQWA 2XUHA 3NRBA 1U7XA 4MV4A 2QENA 2CDAA 5K0NA 3H9GA 4REMA 1P18A 4LOJA 3E9ZA 4ZU3A 1SCUB 1EH5A 2WJ6A 3WB9A 4NE2A 5C1IA 2VK8A 1R4MA 1DPGA 1E1DA 4YHHM 5KYXB 1DRKA 3GQVA 3RPEA 3I9V1 3BSFA 4J9UE 1JJVA 2X4DA 2PS3A 5HZHA 4LJYA 4JKYA 4AFNA 4CJXA 2YC4C 1Y7LA 3ECCA 3WKCA 4AJIA 2EWVA 1LRLA 3L0ZA 3GLFE 1Z7EA 4I50A 2C1EA 3D3QA 3L0BA 4H1TA 4JA2A 1PGJA 2X0DA 1FP1D 2IYPA 4XCVA 2QSFX 1DIRA 1SQ0A 5FAXA 4G5YA 3ZWOA 2N75A 3PVCA 1PFYA 4KYIB 2J0SA 3DBVO 4TS3A 3S5JA 2Y68A 3VU0A 3DV0B 2XOKA 4GBMA 3AKEA 2JC3A 4ZU6X 4FINA 4KDCA 5LQDA 4J75A 1QDUA 3WA6A 3VHLB 4NNPA 3H4MA 3P0IA 3GY0A 1I10A 5HILA 4LCEA 4NYMR 4I55B 2NNLD 3WOVA 3S6JA 4N5DA 1C3OA 5HZGA 5IYZA 3EB9A 3GA5A 2P3SA 1H6AA 1Z83A 3FPFA 5FL7A 3C3CA 4QU9A 2DE0X 2L18A 3CMCO 1KSFX 4YWJA 3L28A 4LJ5A 3EGVA 4W1SA 3X2SA 2J7KA 2H1LA 5JADA 4FLMA 1OSNA 5AJZA 3TLBA 2ACEA 4ZRMA 5JAHA 5CYOA 1PJ4A 2D7JA 1YULA 4BP1A 4BOYA 2OO9A 1MKYA 3BTVA 3ROKA 3ZOZA 2X1MA 4RY8A 3UJNA 3WLIA 2R25B 2OCXA 1Z59A 2X0JA 2LXEA 3OZRA 2ZKLA 3O92A 2WD8A 4BO7A 1X7YA 3QTBA 4S3MA 4XQ9A 3HUFA 4TV9B 1QLWA 3IT0A 3R6TA 4EY8A 4JJKA 2JJ2A 2OK7A 2JZ1A 3QKWA 5JAQA 2PX2A 5BWLA 4Y2JA 3I1FA 2ZSBA 2QMZA 3PRYA 3PQ7A 5AESA 4B2PA 1HT3A 4KRGA 5CPBA 2FUNB 3UAYA 4RVHA 5B1SA 3TQCA 3G2OA 4B2LA 4PCLA 3HP7A 2I3DA 5A3VA 4CKWA 3AF2A 2XA2A 2JAQA 4ZANA 2QT1A 1L7QA 2GOYA 4GLBA 4PU0A 4BE7B 1XLWA 3MJEA 2OM2A 1O94C 5BQXA 2JAWA 2NOAA 4X1OA 4OW0A 2WICA 2FY8A 5D5PA 4FUQA 4L5JA 1CY2A 1UAGA 1O77A 1N33M 1RFLA 4RU1A 2AJCA 4UHBA 3UYKA 2A4MA 4NRVA 1QWSA 3NGLA 5AFSA 3K7EA 4LQDA 3T12A 3N2NA 3F8SA 2JFYA 4PLHA 2CCGA 3THYB 4L78A 2ZJYA 3KT3A 1SVMA 3FGZA 2VDJA 3UMYA 2NYAA 4OAQA 1UM8A 1I2CA 5DTJA 4REQA 4MEAA 4YUWA 4CIXA 1XNHA 2NT4A 4ER7A 4S2UA 3Q7EA 4REOA 2CVPA 5IBCA 4RJLA 1M75A 4FHZA 2ZZKA 1KGDA 4L9SA 3EYWA 2BZGA 4C7XA 3UJBA 1R18A 1LBIA 3FM9A 1VBKA 2I3AA 4J91A 2JIRA 2XGSA 2IPNA 3PEYA 2ZRDA 4ZK6A 3ZTYA 1DX4A 3CLRD 1RAIA 5KEIA 3A2LA 1Z75A 5HFNA 3DBHA 1AN0A 3VSAA 3K32A 2A59A 2VDWA 2WT9A 4NBSA 1TM4E 1ISMA 3KELA 3KYIB 2CV0A 4OHVA 2AOTA 3EX7C 4C3UA 5I7EA 4GL2A 3EVZA 4D8VA 1ORDA 3DE3X 1CUAA 4MR8B 5JYBA 3DEHA 4BB0A 2CNKA 4DBVO 3VPDA 3O21A 1P1KA 4G0MA 2G9QA 1R6UA 4D9CA 1RT9A 5BO5A 3DP7A 4XVQA 4H3HB 2EUCA 1Q0HA 4DIMA 5IK2A 2XNCA 2H1SA 2XUPA 3KNZA 4E2ZA 3U6CA 5KQMA 2B5WA 1FSPA 5BSEA 4KIJA 2IEDA 1VDMA 3DP9A 3VPAA 4OVZB 4Y67A 1LLQA 5CLFA 4CM6A 4K7JA 3A4NA 5JYCA 1SC6A 3D02A 3EIUA 1M34E 3BX1A 3LX8A 4YMTA 3A1FA 3R8XA 2EJWA 1N0HA 1QG4A 4F5DA 3NPAA 2LWIA 5ES3A 4G0ZA 2C42A 4RK6A 4OL9A 2XF8A 3TEFA 5HKKD 3TD2A 3H2IA 1W88A 2DHEA 3IJEB 5E4JA 1YDHA 4Z0NA 5CM9C 4PD2A 3TTYA 3L25A 3QEJA 2BMVA 1O3YA 2QMHA 3Q2IA 3SAJA 4YDQA 2C7BA 2Q0QA 3GA0A 3CKKA 2INGX 4L6IA 1V35A 1ST2A 4MLCA 1B15A 2ZP1A 1W5EA 4LFAM 4BJ6A 2VO1A 1OI4A 2FN8A 4DLNA 2C1ZA 3NWBA 4OGFA 5L8VA 3OHMA 2GETA 4P7JA 1G3UA 2J3LA 1G3QA 4OJTA 1XEWX 3N1UA 3CRVA 1P5RA 4P84A 4AF7A 2V3WA 3DYVA 1CSEE 1PF7E 3IUPA 1P3JA 1KU6A 4KAFA 1NVVR 4YEDA 2YWCA 3OKPA 2VEOA 3HSKA 2D2IA 2Q4DA 2WWYA 5CCXA 1GDHA 4NCNA 4RD4A 4MW9A 3Q98A 3INTA 1H1TA 4MJLA 4RMIA 2I7CA 2VRWA 4ZCSA 1J22A 4G0UA 5A9SA 4PIVA 3N05A 5E6UB 1JB0F 3E84A 2JLRA 3I9LA 3UBMA 3DFKA 4ZGBA 1NE7A 1HZZC 3BF8A 1Q22A 3IRUA 3VJLA 3EXFA 1N2EA 5ICSA 2VAVA 1J0CA 5DMXA 2XX3A 1S2GA 5FI3A 3GJ6A 2B7BA 3OTQA 2BLNA 2YMLA 2HDHA 4ZMBA 3RT9A 3MPOA 2IEYA 4KQIA 1KH2A 2WJJA 4FJ1A 4DXDA 4U9HS 4LXIA 5CDHA 1Z2DA 4Q7EA 4RCVA 2VF2A 3HZJA 1MO5A 2UUAM 4ZO7A 4JBLA 5C7LO 3TB4A 1RJGA 1X19A 5I3ZA 4ZKEA 1ENOA 4RM3A 1YR8A 4MH0R 1QU2A 2V5UA 3OQNA 4P58A 5L53A 2PT9A 2R6R1 4JI2B 1OZFA 4PLCA 5H02A 5J5CA 1D04A 1LDBA 3HXTA 4TSFA 1I94M 4OHXA 1PL7A 3T54A 1OGYA 4XTRA 2NO7A 3JRWA 3E3AA 1WMBA 2F3QA 4MARA 1PQPA 2JIZD 5FUWA 3GK3A 4FX2A 4R81A 1CNEA 2FSVC 3TW6A 1LK7A 4LE1A 2EX4A 3TK1A 2JIBA 3ZJ5A 1FPMA 3K0HA 4KAAA 4MCIA 3CR3C 3OPXA 4R3DA 2ZQZA 3BKXA 4YRMA 2O25A 1U7OA 3V97A 4PNPA 1DTEA 2WJHA 2BD0A 3PNLA 5KKNB 1DAKA 1UDCA 5ECDA 3BD7A 2QTBA 1D03A 4PXAA 2HLDD 4MEBA 4DR7B 5JT1A 3SIPA 4ZDKA 4AJOA 5HIAA 1WZIA 2PKXA 1R0SA 3QWHA 4Z9FA 5DV9A 3RYCA 1IOZA 5CW2A 3T3MB 4GC5A 4ZOLB 4UE6A 2J0VA 3OZXA 4E46A 2YRFA 4H6XA 5EJ9A 5EP2A 1XMIA 4AZFA 1ELOA 4LQLA 3TR6A 4NCXA 1UBUS 2WFAA 1OU4A 5CVDA 4I81A 5HKAA 5IHXA 3BWMA 3ONVA 2W2MA 2GJ4A 2Q9CA 5DSZA 3C98A 4MM3B 2EJBA 1SZCA 2YHSA 1VKZA 3KYJB 4LYFA 4IKOA 4YAJA 3LUHA 3WGHA 3K5HA 2PS9A 5EJ2A 1JLSA 2YWXA 2FMIA 1SG0A 3CSUA 3R0JA 4BWVA 3H17A 3G9ZA 4MVXA 3DOEA 3W2FA 2AXQA 3GJ0A 1H9AA 2NPOA 3R74A 1DTSA 4GKBA 3IAS1 2GVDC 4OB6A 2FZ4A 1E32A 3KWJA 5LP6F 2Q5LA 1QMGA 1FYVA 3HKEA 4Z2YA 1U2RA 4P6VF 2R8EA 4XPIB 3ET5A 2G80A 3MWDA 1OAAA 4QDUA 1WVMA 2Q1SA 3GUYA 1PDOA 3JATA 4LDNA 3EFHA 4BVJA 3I45A 2MSWA 2Z3WA 2R8XA 2WIBA 3FWPA 4W8GA 1MJ5A 1VBNA 3G0OA 3LW8A 1Y37A 3RYHA 3PS9A 3HHXA 3AV0B 1COWA 1NVWQ 4WAUA 4OATA 3E70C 1KK1A 3KZNA 1FNSA 3EIHA 3SC2A 2GBGA 4ENQA 3HJNA 1W30A 1Y9EA 4QVGA 3KLPX 3C3PA 3I62A 1PZFA 2QOEA 4A36A 3VU3A 4N5IX 3CKYA 2W71A 4E1BA 2IL1A 3GYGA 1UK6A 4XD7A 4KXQA 2A35A 2QTTA 4D9MA 1HH4A 3PBKA 5CEEA 5GAJA 4LTMA 3FCUB 4WGGA 1V11B 1JVSA 4LTNA 3VDQA 4W63A 4WPGA 5KTNA 3KQPA 5JSYA 3FW1A 4TL7A 3W2EA 1NAHA 3UF0A 3T9BA 1X7XA 1Z0IA 3WKAA 4GQBA 1NBME 2VCEA 2Y6VA 1TTTA 2OBXA 4M37A 2RGGA 4MP6A 4TMWA 5KWJA 4B3DA 1H5NA 1YZ3A 3CLTC 4XK8F 3P96A 4I4NA 3D3WB 2Q4BA 4KEAA 2G9ZA 1JDBB 3KD3A 1IVSA 5JDIA 1X1TA 1EFAA 4ENRA 4Q9DA 2ODQA 3LYAA 4HWPA 2ZTMA 2RH5A 1IN4A 4LDAA 3M6FA 3GQBA 1YGYA 2OCKA 3SR4A 3AM5A 2H4JA 1FUUA 3LO5A 1VYTA 2C1XA 2GPAA 2B37A 1DHRA 1WJ7A 3F1LA 4XSGA 3OWHA 2QN8A 2X9VA 5SZKB 2QQ0A 4PGHA 2X58A 4CDRA 2D1SA 2P0YA 2L2DA 5F9MA 2NZUG 4HDNB 1A76A 5TMBA 4E03A 3VU1A 4YMLA 1JG4A 2NSHA 4RBNA 2D0PB 4HVLA 1DG1G 3EULA 3NBAA 2DF8A 4PAOA 4BNWA 3IKVA 3S1AA 1YB2A 5AICA 3AUYA 4YT8A 2Z2YA 3BXZA 2ZBGA 3UMRA 5LDGA 5GZ3A 4OHOA 4JR2A 4TYYA 2OV6A 3HA5A 1M2FA 3WC4A 4D98A 3HB1A 1V1JA 2QJOA 3SMVA 2KHZA 1OH7A 4O4HA 4RTPA 4MQUA 5CA0F 3ZDZB 1OGIA 3QNUA 1KSGA 4EJSC 1QNFA 1WB6A 2JIQA 3W8FA 5AOAA 2HRQA 4D82A 4QBHA 3UPDA 2WUWE 3UPTA 1WL8A 2FETA 5CVUA 3VDNB 1R0XA 4EX7A 3NASA 3GJ4A 3KEFA 4MGZE 1A96A 2C5EA 4CKCA 2NVUA 5KYWA 1QANA 1MCZA 2FJUA 5AJHA 3M70A 3TG2A 2Q5JA 1VPLA 3MMXA 2C00A 1E2QA 1KZ6A 3PGJA 4U7JA 5AM0A 1GUFA 4DC1A 5DNCA 3QPUA 1LI5A 1YQTA 4O4LB 2HHJA 4KHPB 4DV2B 2VZ8A 1G8YA 3FTFA 4ZJPA 4WCDA 2X1HA 3O3MB 3GT3A 5DCLA 3HKPA 4TT3A 2X1VA 5ALRA 4E5SA 2E21A 3Q9SA 1YVDA 2BF7A 3A9VA 5T8KA 1DIHA 2X0EA 4WDRA 4FCWA 4XB1A 2R1ZA 2CBZA 1G66A 4R8VA 2GSWA 1SKQA 1HURA 3MILA 1A5BB 5IC5A 3QEMB 4BWGA 2IYEA 4BO3A 4D4GA 2ONZA 4YGYA 2KZUA 5TRTA 1CR6A 4FOOA 2P2YA 2QVGA 5DCUA 1IAQA 2AOWA 4ARZA 1JAZA 2IPXA 2RAPA 1YZHA 3RTEA 1CW2B 1MJGA 5BWNA 3PGXA 4J7CA 4B73A 2GPYA 3WLMA 3ORYA 1VEKA 4LG2A 2HDNB 1JIIA 2GYVA 4RL4A 4ZVTA 5I7UA 4DCJA 3FTPA 2BSXA 4TV8B 3NM6B 1JHZA 1R27A 4ESOA 3NHFA 1ENPA 3PXEA 1NYLA 2BVNA 4FUTA 1DUSA 1BVHA 4XB2A 3LHDA 3OFSA 4YJ2F 1N2GA 3JR4A 4KO1S 4CEJB 1J39A 3D7RA 3L4JA 2X8JB 3C6ZA 2Q27A 2PMDA 4OVKA 1LW7A 1Y6JA 2IVZA 5ITQA 1HRDA 4UHJA 3OVMA 3LTEA 3DL7A 1R3UA 3IT1A 2IBSA 2OILA 4B3HA 4UTRA 3MJTA 4ZTZB 3EWNA 2F17A 4RVFA 4LV5B 2QUIA 4G01B 3PLNA 1KP3A 4K1XA 3EZ7A 4E5NA 4RIFA 4KPUB 4W5QA 2WC1A 4HDMA 3TQFA 1JU3A 5KYTA 4C08A 3LGSA 4EBBA 3DF9A 3LVRE 3E03A 4GR5A 2YMPA 1L5YA 4HZGA 1V8ZA 3B36A 1DOZA 1JFRA 2VUIB 1ZMRA 4MDFA 1JKFA 3ON5A 1ULHA 4HNAB 3W8RA 4P7KA 1Z5ZA 4MJXA 3RS2A 2YN2A 1KJYA 4QDJA 4CF4A 3UMBA 1SO8A 3BFKA 3BFJA 4DIOA 3WL4A 4R1NA 5A4JA 2VOEA 5FUVA 5BN4B 2OBLA 3CUUA 2XCTB 4PS1A 4O3FA 3D4NA 1JDJA 2R7NA 4EW1A 3M7IA 3R77A 5FJJA 1OPRA 3IE0A 4MS3B 2WWIA 4O08A 2YVLA 5AWFC 2HOQA 2VYNA 1G20B 2BHRA 1DAMA 4NNJA 4AS1A 4JJZA 1IMJA 2OQVA 5BT8A 1UAAA 3K6SA 2PKQO 5BSFA 3TO5A 3GEHA 4BMCA 1YCHA 3MFQA 4HWSA 5HQJA 1XRQA 3OE1A 3V1YA 4MA5A 2F1OA 2MR6A 2C98A 4EQ6B 5AI4A 3TWKA 2IDMA 3EOZA 3OY2A 4MWSA 1I3OA 3PPWA 2C2BA 3KVVA 1C1DA 1GUYA 1NWHA 1C29B 3DMFA 5BWMA 4TUYA 3UJPA 3HRKA 5I9SA 3G8BA 2UUCM 4GRAA 1YCDA 4D6YA 3EXHA 3SHTA 4L4RA 4I6EA 1F4VA 1ZOIA 2C4MA 4ML3A 4AY5A 5REQA 1T8PA 3BKWA 3F7NA 3IDFA 5B1YA 4ZICA 4UPDA 2C7VA 4IZHA 4OQXA 3KZXA 1BVYF 2PPLA 4C1BA 4MWEA 4M98A 1EJ6A 1O4WA 2B99A 1XLTA 1SQGA 2P67A 1US8A 3VKUA 4N54A 3Q9UA 2OG2A 2GCEA 4IG4A 1AV6A 4BXOA 4HJXA 3E4DA 4BCCA 4BO8A 5FUXA 4HDAA 5EHXA 4HX2A 4PM4A 4FLFA 3IQDB 4KBFA 4BGVA 3AR9A 3U4GA 1CDZA 1XMOB 1R8XA 2QVBA 3BM5A 2QYOA 4XWOA 2G6BA 3M3PA 1Y82A 5FA5A 2O06A 4BLQA 3ZR4B 2PGNA 1Z7YA 1GCAA 1SELA 2RG7A 3B7NA 3V8PA 3QKSA 5F5NA 2E9SA 2C54A 3DJYA 5DGCA 3V7YA 5CP8A 3DM9B 3GRVA 4AK9A 4MHOA 1DKUA 2QN6A 2HMSA 2O8CA 1CEXA 4WT7A 3O4JA 3CZPA 2V7UA 1R0YA 4E5MA 4NCAA 1EVZA 2O05A 3BIJA 5FTJA 2J3MA 3BPSA 2H2IA 5ALYA 2SKCA 1MAHA 3TZKA 3KU4A 2ONYA 3VVCA 3AI1A 3K9NA 1T0UA 4MUJA 3QFHA 4YXFA 5DI9A 5EZYB 1X7WB 4O4IB 2PR7A 5AKJA 5JEEA 1R64A 4CTMA 2O48X 3WMGA 1JE1A 1RCTE 2I8CA 1L2DA 5EUCA 3V2HA 2WWHA 1PNTA 1WX1A 2FWJA 4B43A 4ZYXA 1SXJC 5IXJA 5LB4A 2VXCA 4CDMA 4LZAA 1KBQA 2ID4A 1Q1ZA 1TADA 2VI5A 2OXRA 4I3GA 5U4QA 4G36A 1GGJA 1KR2A 2GT1A 2O1WA 2ZR0A 2FG6C 3V4OA 3DDOA 2NAPA 1LSJA 1J8MF 2GD1O 2FQWA 1E5DA 2PLNA 3B3GA 2VZLA 2MSLA 4HADA 1R5JA 2GWHA 1X38A 2DKNA 2WT8A 2DUNA 3Q5EA 1JDTA 1TAHA 4W9NA 1TDZA 5IF3A 4UVIA 2MOKA 1FX0A 4BX9A 1U0FA 2GK6A 4RMGA 2QZZA 3TDNA 1CRQA 1XQ1A 1QOPB 1UIRA 2W4QA 3WWEA 2DJ5A 5C8YF 4M1OA 1H2EA 4YP0A 5HBGA 3D2LA 3GO8A 4JP1A 2PGXA 1NVMA 2ZKIA 3BXHA 4ZEWA 3IJ5A 2G67A 4P3PA 5HCUA 3S2IA 3VR6A 1C0KA 1TA0A 4EYEA 2G6TA 5FI5A 3WLLA 3IQWA 2MSNA 3IAEA 1F8FA 2IOQA 1PVDA 5JO9A 2VP0A 2JHCA 3LNTA 5DSTA 1UXOA 3D7LA 3QQPA 3SAWA 1J9GA 3HYTA 2PSSA 4E32A 4N0QA 1V92A 1IY2A 3GFVA 4YDSA 2RHGB 1BN7A 4RY0A 2FSUA 4URFA 4B3GA 5INTA 3NBFA 2BTQA 2BJWA 1NPDA 2E49A 3ZY4A 4DUYM 4MKHA 3FF4A 4KVFA 3TGWA 3EAGA 3BXEA 4RFVA 1PR2A 2QHOB 4EHJA 2R4TA 3ZXSA 2AUMA 4F1IA 3DD1A 1UINA 4OIMA 1EI9A 5AP9A 1GIAA 2LCQA 4K9NA 1Y7TA 4Z4IA 3TW4A 3A6KA 3DMTC 4LYDA 2NWQA 4UAVA 5J63A 5JS8A 3VJMA 3O7MA 2R2AA 1XIVA 3ZK8A 3JTEA 4LJ8A 1WZEA 5FEMA 1IULA 1G2PA 3WGQA 5CMLA 2AN3A 1GTMA 4MMXB 1PT6A 3VNBA 4LV8B 3GHYA 3I4FA 5EHNA 2GR9A 4D1YA 3CIOA 1T0PA 3SQXA 2NZXA 1CUVA 4TLCA 2J7OA 1J97A 3U3ZA 5IW8A 5DX1A 2GSDA 1MDBA 4BU1A 2B78A 4ZCPA 3DBRB 2G5PA 2ZQYA 3CINA 3K2EA 1QQAA 1ISPA 2O6HA 2VHUA 1W1WA 4CCWA 3LVBA 3ZQ4A 5GQSA 1I24A 5FO0A 4DHEA 5U4XA 2FP4B 2OXIA 1EDOA 1TRKA 3GARA 1H3NA 4LTDA 3GFQA 4DR3M 2WINI 1TEXA 1QORA 3VC3A 2N46A 1NXOA 3DMRA 2IZ6A 5FHQA 2Y0EA 5JG7A 4B3TM 2Y1EA 5TGTA 5J2TB 5BW4A 1ZEMA 3VAZA 4ARIA 2OGTA 4ID9A 1MT3A 1EP1B 1Q7CA 1I80A 1AQLA 1C7QA 4UBMA 3Q3GE 4ESHA 1MF7A 3G5MA 1A4IA 5JQGB 1UM9A 3TF5A 1BXGA 5ALZA 2COEA 4RH3A 4IGAA 4LQCA 4KTVE 2D74A 1DDIA 4DUZB 4JXKA 4TMZA 2XHEA 2BM1A 4ZZIA 1HQDA 4D42A 1ONSA 2W6NA 3ZE1B 4U2BA 3WBFA 3GR6A 3D7MA 1XTTA 4K9MA 4JKIA 3LHFA 1P4HA 4X20B 1PQ4A 2AN5A 3I92A 4YO8A 3Q7PA 2VZEA 3LBNA 4L5YA 2B9EA 2NACA 4OBWA 5AK5A 3IPCA 1O95A 3GJXC 1Y3CE 5HUHA 4J3JA 5AKYA 4YI3A 2DKFA 2FMFA 2F3PA 2KNZA 4IXTA 2YXEA 3IT3A 5EJCA 3G02A 4MW7A 1OILA 3R9XB 4FWDA 3KSDO 1X1BA 2P68A 3F67A 4I8OA 4XUEA 2ZUUA 3CNQS 4P16A 1SUBA 3A6JA 1MB9A 3BULA 3UK1A 4AY4A 1ORWA 3ORHA 2V0NA 4L6CA 3G3EA 2G06A 3HRHA 2NU7B 3VR4H 3O82A 3GLFB 2EFDB 3ZGNA 1ZC4A 2WTXA 3AF3A 4MPRA 4D8TA 1IG0A 5DHRA 1W76A 4CT4B 4RH0A 3I9MA 3PXUA 1UBHS 4G0PA 2PBZA 3QLTA 2O2ZA 3B7PA 4JUCA 1M6NA 2BC9A 2QTLA 5FPKA 4EKGA 1NOKA 4Q7MB 1RXWA 1MBZA 4IGFA 2O8DB 1EVLA 2IUSA 2FR1A 2LKDA 3GOQA 1KDRA 4W5JA 3M4JA 1TB4A 5KPZA 3BRQA 1P62B 4FI3C 4JHXA 4F2PA 1UP4A 1GY8A 3RJ5A 2CDCA 1TZJA 2YL2A 3SVTA 4GE0A 4B0OA 4OXRA 4BVFA 3NW9A 4ZPJA 2GI4A 4X7RA 1N2OA 5BMVF 3PNMA 4TMFA 2ZK7A 2CVQA 5EQTA 2BEVA 2WF7A 2C2ZA 4H4EA 1R5LA 3ENWA 3NU1A 5ANRB 1VTKA 4EDFA 1EFUB 2ECFA 4UNQA 5G4KB 1RYHA 4HJRA 2ZWOA 1WCIB 4H35A 1OFUA 3I05A 4FVMA 1LFAA 4KRXA 3KJGA 5PNTA 2OPFA 3QYEA 3QVLA 1KSHA 2J9XB 1H0HA 1LS1A 3BE4A 4HTFA 3L77A 2E5LM 2B8NA 3UMVA 1PE0A 3TIIA 2ZIAA 4BV3A 4ZAWA 4OHRA 2X9GA 3DHWC 2LHCA 4JI8M 1P31A 4GUDA 1NUHA 3Q0IA 2QA5A 1IWPB 2YZMA 4X24A 4LF9B 1YZVA 1JZTA 1T2AA 4ZOCA 1QHEA 1Z0KA 1WU8A 1W9HA 2ARKA 3IHKA 3HKDB 3W9UA 3DO6A 2UXCB 2QMOA 1U5CA 5E2AA 1VJDA 1YZQA 1N36M 4NJMA 4G4NA 3G79A 3U2QA 3R7LA 2WVAA 3CKMA 3FFAA 3E6AA 1PRBA 1E5XA 3ZG6A 4INPA 2QGZA 3TLCA 3QVMA 3MOGA 5AKLA 1W6UA 4KQJA 2H3HA 4WD3A 1CZUA 2OCAA 4NF2A 2I80A 2VQEB 4GT1A 3VNRA 3JVIA 5H81A 5EJMA 5EUMA 3WWZA 3H5NA 4HGNA 3A06A 1MD9A 3GZJA 2RBGA 5J2UF 2H92A 1M1UA 2OAGA 2ORVA 4XKJA 4IXWA 4M36A 1QIIA 3UHAA 2YX1A 4UTNA 1KI6B 3HXQA 1Z6YA 2MMGA 2I66A 2ZI3A 3V00A 2BY4A 1OWPA 2QRZA 3LLSA 1XNRB 3OQIB 2X4IA 5BSTA 1N3YA 4ALJA 1N3LA 1Q0RA 2MWMA 3GXOA 3TZEA 1ADGA 3T7TA 3JVVA 3NNSA 4IXDA 1KZGB 3R7WA 3OZCA 3LCJA 2CDBA 1ZMXA 3FR8A 3VAYA 2X49A 1Q6ZA 4B48A 1OH5A 1DJNA 1N0IA 1L5GB 4YY3B 4RFLA 1CQWA 2O3JA 2EKZA 1FW8A 1UFQA 1JSLA 4PEVA 1E2LA 4PYIA 3HV2A 1P9OA 3AGQA 2YDXA 3M5PA 3W5SA 2OPHA 1TA4A 4OK3A 1QYIA 3A10A 3GFFA 1S2OA 2NSDA 5JMTA 1Z45A 4M0PA 2Z08A 5K05A 1U9CA 5KO3A 1JI0A 2ORED 3A1CA 3OSUA 4TTSA 1N3BA 1TAGA 5D51S 3QWFA 4ZYWA 1EWRA 1V37A 3W6NA 3DKPA 2W6MA 1P2UA 3MG9A 1M34B 3BIWA 5IAEA 2GLXA 2ROQA 4UVEA 2P62A 3MQFA 4GEWA 2JGLA 3T3GA 2G8NA 2R62A 4IP0A 4GW3A 4L73A 2ZS8A 3PE3A 3AF5A 2PEZA 3UMCA 4X41A 3TI9A 2VJMA 4ERNA 1SCJA 4OHZA 4WLVA 4NYIQ 4WNAB 1VIYA 1JQ3A 2BFCA 4ZAYA 3QLJA 1HX7A 4EHLA 4ACAA 3HGMA 1GGFA 3ABZA 1SVUA 2H1VA 3FUUA 3F4LA 2ZUDA 4E13A 4ZFNA 1NXQA 5K2MA 3PLAE 4YFYA 2I1VB 4MI3A 1TYAE 3MTBA 2IOYA 3BWVA 1LTKA 2FJ0A 3FBWA 3AVYA 5A2QS 2NO4A 5HKBA 3G7UA 3NCTA 1C8LA 2BEJA 3CRMA 1OFVA 3FPLA 3G0DA 3OJCA 3DULA 2VSOA 1ZUIA 3KLOA 2H3EA 1ZSVA 1V8PA 4JLNA 5EAIA 1BKSB 5JY6A 1AO0A 1EGMB 4AVYA 3NOVA 3E3OA 4IUDS 3H9JA 2DT8A 4I1IA 4KIUA 4MICA 5L40A 1DHTA 3MS4A 1J25A 3EXIA 2R9VA 1E2MA 2XWPA 2WR8A 3ULKA 1W25A 2WZBA 5CXXA 1VLMA 2RK3A 4LX0A 3ZXXA 4BNNA 2IF0A 1J5PA 1UJNA 1PR4A 3ZWYA 4RAOA 4Q9AA 3TJMA 3JYPA 4K8OA 3W5UA 5HKLA 5KYUA 4NZ9A 3FCSB 5JS7A 1XZHA 3S7ZA 5F51A 4G4JA 4FIDA 3ME5A 2CHEA 1N32B 2H2FA 4Q19A 3KEGA 3K9HA 1KY3A 1NUAA 2EG9A 3TRHA 1GTVA 3T7IA 1CJKC 2I4IA 2A5YB 1NYRA 5ALJA 3VYUB 2IPLA 4KXMA 2IPAB 4OBBA 1QYVA 1EAYA 5EY5B 5ARDA 3EASA 4F7DA 1V96A 1GGHA 2H1FA 4RFSB 3D64A 2FDCA 1FFYA 4OKSA 3PVSA 1GAXA 3PFHA 4OMFG 3QVUA 5HX7A 3IOCA 2VQSA 3OJXA 1A9TA 4EITA 4I4TB 3RSSA 5BQ3A 3FOZA 1DQYA 3ZW7A 1ZH2A 3CLUD 3H5AA 1IHYA 2PXXA 3OT1B 3T4EA 4UNSA 4M60A 3FE3A 1OQAA 1V16A 3L02A 1JFTA 3KDSE 3CG0A 3ZWKA 2VSNA 3RS3A 5HQ3B 2WK1A 1PL6A 3HR4A 3NZEA 1W75A 2JDIA 4M86A 4INZA 4QEDA 1ABFA 2RJNA 3CG4A 1JQLB 3TDMA 1WY5A 1J1IA 1YRAA 3WLPA 1EKXA 2QQ8A 2V8OA 3AI7A 2HA3A 1JXQA 5D2CA 3KWFA 3INNA 3KLNA 4DM3A 4ZCTA 5KPRA 1XF9A 1AK2A 4MYRA 3FLEA 1CVRA 3ELDA 1WMDA 3S99A 2AMJA 3PNOA 2B7CA 4R3UC 5ULLA 1LS6A 2W6PA 1IN5A 3CEJA 1Z3IX 2ZTDA 1GNRA 3DT6A 1E7RA 5CG1A 4RDHA 4U2CA 1SZPA 3TZBA 3RS5A 4HQLA 1RM5A 4NZNA 3FJ1A 2H4YA 2A86A 1DBWA 2W0MA 2ZYHA 2D5CA 3D31A 2W6JA 4AAYA 1T6OA 4OFZA 3UAZA 2OXTA 3EUWA 3K8OE 2I2AA 4V24A 1WUYA 4B3MB 2VDPB 1SWVA 1DP4A 4O2BA 1V6CA 3SLKA 3WWDA 4IBDA 4U00A 2H7YA 5FTNA 1F6WA 3VDRA 2WFMA 3I4LA 2QUZA 3VKHA 4W7IA 2D2FA 2DM6A 1DLJA 3B20A 5IUJC 1BFKA 1O1YA 1EWTA 3MVEA 5JCOA 4O33A 4GDMA 4NMHA 1M5UA 5CAEA 4R2XA 4BBPA 1KMCA 2GAJA 3AC0A 2FPSA 4CT0A 3BD9A 3SM9A 5LU9A 1N77A 4FD3A 3LF1A 3NIFB 5BSRA 4BZXA 1VMEA 3O8QB 5KNBD 1C5KA 1Z6PA 1ZKMA 3F8TA 5F4BA 1SH7A 1ZR2A 2GPSA 3K8QA 2VJQA 1M7BA 3LA6A 4IO1A 3IIIA 4BLCA 4RTMA 5FR1A 5BW5A 4ANFA 4QLAA 5B5SA 2FS1A 4C0SA 3C6YA 1K7EB 3KSXA 1UWKA 2A5JA 1GO2A 1ND5A 4DLTA 3VHQA 3PKIA 4DDTA 4LRXA 1ECLA 3Q7IA 3MJHA 4KPYA 3CVXA 4R8KA 3MLAA 4X9XA 3WYEA 4BNXA 1ESMA 3G23A 2JD0A 3VR2A 5U9CA 2X13A 4J1SA 1JZQA 3K9WA 3WGLA 1QH9A 1KH1A 3BRCA 3D9QX 1PK7A 2JHAA 3FB4A 2I4LA 4R98A 4G09A 4Z99A 4ERXA 3OMWA 4KPFC 3VDXA 2VPIA 1M1YE 4OQYA 2Y2VA 1ZA1A 2BGKA 3RRMA 5FBVB 3NDIA 5DGDA 5DLEA 4QPNA 4GMQA 2B20A 3KJZA 4JY7A 3SSMA 2ZE8A 4DC9A 2Q5QA 1X9GA 4UOEA 1OB5A 1D1QA 1I01A 3CRQA 4YP7A 421PA 3L7DA 1QP7A 2OOSA 3IAM1 5LCXA 3V76A 2O0KA 1T15A 4H7PA 1K8QA 3L6BA 2ZREA 1U2SA 1X6VA 1IM2A 4KJZA 4JGBA 3OQVA 2M6LA 3WLTA 1FP4B 2Q0SA 1D6MA 1Q17A 3DLHA 3WGTA 3HNOA 4GPTA 4TWRA 2XF2A 1CP3A 5G1OA 1SRQA 2DWNA 2JFFA 1UJ2A 4S0ZA 3K1ZA 4JP5A 5EIAA 1SZJG 4MS4B 3HWRA 2HCJB 2J5QA 3EMDA 3I37X 5ALSA 4A10A 5KVAA 3LDAA 3DZFA 1T2FA 4Q3EA 1KEUA 4BKPA 4EKEA 1DFGA 3KWLA 1RAEA 1IHDA 1ZZGA 4HAYA 1ZD1A 4HL6A 3PFKA 1WM1A 1FY2A 1I3NA 2GZMA 4LVOA 4K1LA 2C83A 3ADDA 4R16A 4MW6A 2W2TA 1YB7A 1VJ1A 5AIBA 4IKPA 2IOFA 3IAFA 3RT1A 4BEJA 5E6RA 3V9PA 5B58C 5KNCH 2BFOA 2YNMC 4EG5A 2AYXA 4M0MA 2DZLA 2JFNA 4MV9A 3T3NA 4BNFA 3LZ6A 3LQ4A 1P1HA 3O3OB 1W0JD 2GJ9A 3A1SA 4AUKA 2QAGA 2XIQA 2WUDA 2IXFA 4IJFA 3GLTA 1P6QA 1D5CA 2V03A 1CUEA 3VR5H 3VK8A 3QPVA 3EGXA 5DNYA 3N9IA 3H9CA 4IHQA 4J0KA 4V0ME 3RQSA 3DZKA 1T36B 4N12A 1JX6A 2WW8A 1Z0FA 4R8LA 3J7AC 1ZU4A 2QE7A 5IN4A 3W5AA 2VTBA 1TMGE 1PR1A 4OMDA 5A04A 6ADHA 3FYUB 2DWQA 2VJCA 3ZEAA 1WQ4A 4PZZA 5E1BA 3FXAA 2ERCA 1XPOA 4MINA 1P1BA 1YV9A 5AKXA 2E6KA 4W7SA 3JR7A 3BRWD 3KJHA 3SMSA 1S8AA 1AZLA 4UHHA 2PXCA 3WLJA 4TX1A 3E9SA 2QGFA 4GOXA 3R9IA 3S44A 2H29A 1JR3A 3GP5A 1V8FA 2R5NA 4I55F 1IJEA 1S3IA 4QYIA 3TKLA 3WHPA 1IXZA 5DI3B 3FCEA 3BMCA 4DR2M 5B2FA 3DYIA 4YBRA 3QKUA 5B36A 3AXTA 3L06A 2CGEA 3G8YA 4B6OA 1UK8A 4HAIA 2W2KB 2X7HA 4Q9HA 3W6PA 1GTJ1 1DQZA 1NW6A 5BOSA 4Y2HA 2ZIVB 3RR2A 3K1JA 2PJRA 1B93A 4EB0A 3RUIA 2RGAA 1F2TB 1HGXA 1L5NA 3NHKA 3C48A 4MTCA 4P5PA 2X3FA 1ISJA 5JFGA 4LI0A 3G9UA 3MJVA 1FVOA 3NYIA 3BSYA 3UICA 2NUTA 5FDFA 4CM9D 2Z95A 4C0BA 3AL2A 2J7PD 2GQFA 4TV9F 5F1YA 2HXYA 1JFVA 2REQB 1JPJA 4OX9Y 2QG4A 4EPXA 3LPLA 3IR5A 3V46A 3KZOA 1X7DA 1TDHA 3M4NA 2XODA 4D3FA 4WK6A 3Q8GA 1M8FA 4K6KA 4U7PB 3RG2A 1DIOB 1HE4A 2EWWA 3V8QA 2KB0A 1BCRA 4WA8A 1Y7HA 4MV0A 4KWIA 3TW0A 1Q3HA 3EN0A 2I2BA 1UUFA 4DLVA 5AUQA 3RFFA 4UU0A 5HUJA 2OORA 1NVKA 4H7IA 4Q3AA 3LDFA 4RZXA 4HD8A 3WHLA 3AFMA 2XY4A 2VT6A 5CYFA 2OD2A 3GUCA 3MTAA 3ERCA 2IYNA 2DENA 4LJSA 4KXFB 3PV0A 4A82A 4WXPA 1MB4A 1QK5A 1YIAA 1G8PA 5AW4A 3THWB 1S2DA 3IO3A 3OKCA 4GPD1 4QQRA 3C8UA 3J7TA 4NMWA 3CUVA 1DAPA 1L9KA 1P7PA 4EG0A 4GRDA 3VMMA 4NICA 2IPMA 1NMSA 2W7TA 1RXVA 1RXEA 5ALHA 4QM7A 2B6HA 1TUEA 3RSHA 3E05A 3WSVA 1YZTA 4RMNA 2MIIA 1M1NA 1GP2A 4MGKE 4UUPA 3MK31 3PE6A 4CEHA 3L8MA 4P0PB 5KJEA 1T1EA 1PEDA 3RC1A 2LUOA 2ZUCA 4G37A 3UUGA 4E4TA 4DV5M 3N0WA 4N3AA 1RYMA 1LC0A 3VU9A 4CXMA 4DCUA 3I9V6 3JVEA 3S70A 4MKFA 4D3SA 5GMOA 2OL4A 4K8RB 4UNRA 1KJNA 2I9KA 4QICA 3F46A 3C74A 4OQFA 4AP5A 1QQ5A 4IICA 5C7OO 2FW9A 2LVNC 3BWCA 1Z4QA 1VCIA 4BZQA 5CIYA 1WHTA 3OCVA 1E0JA 4CMHA 2R1TB 4F4DA 3BTSA 3AY3A 4KQXA 3E9CA 4RSMA 1Y8RB 4KK4A 5JH7B 2OOBA 4I1YA 3U3JA 2A1IA 1KAMA 1GPLA 2HA4A 3WQBA 4CM1A 3PUJA 3OEED 1IFYA