1VQ1A

Crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
266
Chain Sequence
b'RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-glutamine methyltransferase, HemK
publication title Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 84
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vq1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vq1A02
2YQZA 8MHTA 3R24A 5FWAA 3P9CA 2VDWA 4QQNA 3DXYA 5LQAA 3LECA 3F92A 3SSOA 1L9KA 5KQRA 4GC5A 4KVZA 1XTPA 3ANXA 2KW5A 3LCVB 3NWEA 3KR2A 3KQQA 3KPJA 2DAKA 3UJ8A 5CVEA 4QVGA 3CKKA 3ELDA 3PX3A 4Y2HA 1O54A 1PJZA 3UJDA 4E33A 3OCJA 1IM2A 3FPEA 3T7RA 2PBFA 4EMSA 4HSGA 1GO5A 3CCFA 3BGDA 3KR0A 2BM9A 4ER0A 1X1CA 2DHYA 3E23A 1ZMVA 1QZZA 4E30A 1P1CA 2CWWA 3KQYA 2H11A 3B3JA 3Q7EA 1F4IA 3HA7A 1JTFA 4KIFA 3HCAA 2DAMA 4YMGA 2IP2A 3FPFA 1JSZA 5ICGA 3G5LA 3FYCA 3OZSA 1VPTA 2H5XA 4BP3A 4HG2A 4RTNA 1QYRA 5EKUA 4E2YA 3T7TA 1M6EX 1RI4A 2YXLA 2O57A 1TPYA 2RRUA 4XUEA 4RTRA 3V97A 2JUJA 3EEYA 4LWPA 5DWQA 5HZMA 2QY6A 3JWHA 5DPMA 1VE3A 5E1MA 3SGLA 2MR9A 2JH8A 1KYIA 4KW7A 3H2BA 2FPOA 4R6WA 3UZUA 3U81A 5EMLA 3VC2A 1ORIA 5DSTA 1P91A 1ZG3A 1V39A 1FJXA 3EPPA 5EZSA 1MHTA 3FUVA 3TPZA 4MWZA 1TW2A 3DLIA 3SR4A 4RVFA 4RTOA 3DTNA 2IH4A 3AXSA 1I9GA 1Y8CA 2OOAA 5GP1A 1Q02A 3M6WA 5DTMA 2ESRA 1RI2A 4DMGA 5E8RA 3GLIE 5CIYA 2PX5A 4LECA 3RIEA 4YMHA 3TKYA 1NW6A 5FQNA 3BKWA 1Q0TA 4C08A 10MHA 1ZKDA 5LSAA 3BBZA 2FYTA 3P2EA 3HP7A 3HCBA 4XUDA 1L3BA 3FTDA 2JY6B 2HMYB 5GOZA 3MMPA 2JHPA 2BR3A 1T43A 4DKJA 4E70A 5HOQA 2GAFA 4OBWA 5E8JA 1AIPC 5K09A 1EQAA 1XJ5A 3FRHA 3FUUA 5C9ZA 4UN2B 2FK8A 1YF3A 1ZGJA 2DPMA 2KNZA 3OE4A 4PYMA 5DXAA 2KHHA 2IH5A 5HILA 3JWJA 2P35A 2L4FA 5EZQA 1QAOA 1NV9A 4FZVA 3FPJA 3PTAA 5FUBA 2ZBQA 3EEOA 5HIMA 2PY6A 3KKZA 3MTIA 2PV0A 4RTSA 3PFGA 4F84A 1NW3A 3G89A 3JWIA 2AOWA 2AN5A 1P3QQ 5E1BA 1YZ3A 2CL5A 2AR0A 2ZZMA 3P2KA 4FSDA 3C3YA 4C05A 2IIPA 2DULA 3LDGA 3MHTA 2F8LA 3R3HA 1EJ6A 3A7DA 3NJRA 4B17A 2L4EA 2AOVA 3X0DA 3SX0A 1SQFA 3C6KA 5K0FA 5BW4A 4HH4A 4FT2A 3LDUA 3DR5A 5KS2A 1DUSA 4KDCA 3NW9A 2CMGA 4YV1A 5E1OA 3A26A 2IPXA 2UYQA 3LDFA 3UA4A 5P8WA 1XCLA 5BXYA 2WK1A 1RJGA 2YXEA 1L3CA 3BWYA 2LTUA 1WJ7A 2IDKA 1C7YA 4OQEA 4O29A 2AOUB 2OZVA 3A4TA 2HR1A 3DULA 2DAGA 1EIZA 3NVMB 3HNRA 3KQPA 2VDUE 4V0RA 5DM0A 3S68A 1MJFA 2PWPA 2GS9A 4AUKA 1DO2A 4H0NA 5LQKA 1T6OA 3PVCA 5E9WA 2P7HA 1WXXA 5HEKA 4XUCA 3E8SA 4C07A 4RVGA 4E2ZA 3GRUA 5ICCA 3BWCA 3CGGA 3BGIA 2O0LA 2JZ0A 2JNHA 2NYUA 2I6GA 4L7VA 2P41A 3B7PA 2R0IA 2PGXA 1NV8A 1R8XA 2XVAA 2I62A 3TRKA 2G1PA 1KP9A 1YB2A 2R6ZA 1N7JA 3GWZA 3VC1A 4IKPA 5DXJA 4YV2A 3EVBA 1XB2B 4G3OA 5E2BA 4HRAA 2PKWA 2DKLA 4RSRA 1BKYA 3M6XA 1KXZA 5FHQA 3IEIA 5C0OE 4YUVA 1E94E 4YUYA 2WA2A 3A25A 1TR8A 5DTQA 5EHIA 3F4KA 1FP1D 1XDUA 2JHAA 1SQGA 2GA9A 2FHPA 5DRTA 2YXDA 1G3IA 1D2CA 1X1AA 3UWPA 3K0BA 3MAGA 3G8BA 5CVDA 1BVSA 4P7GA 1IXKA 5JUWA 3CBGA 2G70A 4QQKA 5CM2Z 1IXSA 3G88A 3P9KA 2HWJA 3K9PA 2FRXA 2PXCA 3C6MA 2QM3A 4DM3A 2EKKA 3IHPA 3V8VA 4R8SA 3HVKA 2ADMA 3FTFA 3C0KA 5K8VA 1G55A 3G5TA 2V74B 4KIGA 1N2XA 4QPNA 4CKCA 4EQZA 3OZRA 1AV6A 1F3LA 5GM1A 2ORED 3FPGA 2VZ9A 1Z3CA 3ER8A 3G2MA 2B9EA 2PX8A 3P8ZA 3GU3A 3EMBA 2OXTA 2O05A 3UBTA 1JR3E 2O25A 4MQ4A 1JG4A 5ICFA 2Y1XA 1RI1A 3ER9A 3M70A 3OPNA 4BP1A 4EKIA 1HMYA 2LVAA 4GOND 4OA5A 3P97A 5EGSA 5DT2A 1IY9A 3LSTA 5E2AA 4PIPA 1ZMUA 5FTWA 4PNEA 3PB3A 5CVUA 3QOXA 3I5UA 3KQMA 3EGEA 2OOBA 4ATNA 2B2CA 1HQYE 4C03A 7MHTA 1JG3A 4DCGA 2AOTA 1NKVA 4BLVA 1HT1E 1JG2A 1JR4A 3AXTA 2PVCA 3EVGA 1R18A 4HC4A 3LCUA 1WXWA 4PYNA 2OYRA 1M6YA 2AZTA 2YTZA 5EIWA 2BR4A 3FRIA 5DX0A 3OFKA 4GUAA 3E05A 3CJRA 4K6MA 2P3OA 4Z2YA 4IV0A 1WS6A 2OY0A 3KQWA 1L1EA 5E1DA 4C06A 3BUSA 3OFJA 1OR8A 5IH3A 2EKFA 4NECA 3LL7A 3B89A 3GXOA 2H1RA 1MN3A 1O9HA 4OX9Y 4QVKA 4ER6A 2PLWA 2AVNA 2LVOC 3DOUA 3QOWA 2P40A 2QNJA 2LBCA 1WGNA 3B3FA 1VEGA 2IFTA 2AOXA 2Z6AA 2BWEA 2G8NA 4OQDA 1I1NA 1JG1A 3KQVA 2B25A 2PWYA 2DAEA 1R8YA 3ID6C 1BHJA 4PWYA 1DO0A 3TR6A 4CKBA 1ZHFA 1AF7A 4PYJA 3IECA 2AOUA 3A7EA 2C7PA 1R6AA 1R4GA 2MROB 1U2ZA 4CTKA 5GWXA 3HEMA 1WIVA 5FADA 4QPPA 4U7PB 1PGYA 2WA1A 3ME5A 5D1HA 4R8RA 3G8AA 3HCCA 3MCTA 4XCXA 4M36A 2XYRA 1SVUA 4AX8A 2FK7A 5K0EA 5DM4A 4PGGA 5DX8A 3DP7A 2NP7A 2C7OA 2JZ1A 3HVHA 5F2NA 2P3QA 1NE2A 3HA3A 4DBGB 2NP6A 3LPMA 1SG9A 4PONA 2B78A 3G2QA 3I9FA 2AVDA 5K05A 1G4AE 3HVJA 1NBIA 2HNKA 2ONYA 3E7PA 2AOTB 2IBTA 1JTEA 4PYKA 2QRVB 3BT7A 4IWNA 2LVNC 2A14A 2XYVA 1HT2E 2JY5A 5EMJA 1VL5A 4QTTB 3BWBA 5DX1A 3DMGA 5U4XA 1A5TA 2IBSA 2JHCA 2GLUA 5K0JA 2CMHA 1X19A 4DA4A 1BC5A 2BZGA 2YVLA 5EC8A 3UJBA 1UWVA 1KYWA 2K4MA 4EKGA 3BZBA 2ZIGA 4PINA 3R0QA 3OU6A 2P7IA 2G71A 5E9QA 3EVFA 1QZEA 1G8SA 4P58A 3ELYA 2K0BX 3DLCA 2BM8A 1INLA 2KNAA 3FUWA 3OU2A 4KDRA 3OZTA 2LVQD 2OO3A 2EJUA 3FUTA 2OB2A 1XDSA 1WR1B 4Y30A 5HIJA 1VDLA 4F1IA 3HTXA 3P2IA 5K0BA 4YV0A 2IH2A 3R9XB 3UA3A 1WZNA 3MB5A 3TOSA 1AQIA 3EVCA 4FP9A 4E2WA 3GCZA 1KPHA 1L3IA 3VYWA 1G41A 3LX6A 5FA8A 3TQSA 5DM1A 4PYQA 4GOLD 2OB1A 4GEWA 5EQJB 5C1IA 2AN4A 4HGYA 4RTJA 1NT2A 5K0NA 4RX1A 2GPYA 2ZZNA 4M7RA 1XDZA 4HTFB 4ISCA 1FP2A 3O7WA 4BLWA 3GLHE 4V0QA 3B3GA 5LQJA 4FGZA 2ZBRA 2K9DA 1KYZA 2DAIA 5DRYA 1UFZA 3LBYA 4MIKA 2UYCA 2P1DA 5GINE 2CKDA 5K01A 1QAQA 3SM3A 2CWBA 3HVIA 4P7FA 1P1BA 3UFBA 4A6DA 1VQ1A 4F85A 5KVAA 4FSXA 1VG5A 1YZHA 2I7CA 5E9JA 4BLUA 4C4AA 1ZQ9A 3TKAA 3HA5A 2P8JA 4DQ0A 2NXNA 2EFJA 3TFWA 3THSA 4OA8A 2LVPC 4RVHA 3M6UA 2Z6UA 3KU1A 3FTEA 5EHGA 4GEKA 2EJTA 4R05A 2ZVJA 2PX4A 4X41A 2ZSUA 2JG3A 3ORHA 1YUBA 3GGDA 3CC8A 2HV9A 4GF5A 2ZLBA 1EFUB 3UJ6A 2R3SA 1QANA 1OTRA 2H00A 3BXOA 1CUKA 1B42A 5HFJA 1G60A 4CTJA 3G2PA 3SVZA 2VDVE 3RW9A 4IV8A 5M5BA 2UYOA 4ER7A 3I58A 3T7SA 4P7JA 3UJ9A 3E46A 4PIMA 3WSTA 2ZIEA 2O07A 2QE6A 4U7TB 5K03A 4BY9E 2ZBPA 5LQRA 3ELWA 2YX1A 5F2OA 1TW3A 4PCAA 2PXAA 2Z6QA 3O4FA 3C3PA 3FYDA 3LCCA 1NBHA 1YLAA 4AZWA 4E31A 1RJDA 1YFLA 2XYQA 3IV6A 2UZ4A 3IYLW 5LQCA 2C7QA 4F86A 2BH2A 1SUIA 1RJEA 3A27A 3B5IA 2DI0A 2WZJA 4YUWA 3GLGE 3MGGA 4GC9A 3T6PA 2L2DA 3KHKA 2NNWB 1N7IA 3NTVA 4FS8A 1XXLA 5BP7A 2PJDA 1G38A 3HCEA 3LKZA 4HGZA 4RTPA 3Q87B 2MJ5B 4CWAA 1NW5A 3PX2A 3BGVA 3I64A 2QRVA 3MERA 3TMAA 3JWGA 3KPVA 3AJDA 3REOA 4RTMA 4R71A 3UJ7A 4MHTA 1SKMA 3EGVA 4AZVA 4GOMD 5T64A 3HCDA 3GRRA 2JY8A 1RI5A 3KQSA 1FPQA 5EVJA 1XCJA 2O06A 2PXXA 2ERCA 1UIRA 2ZZKA 1I4WA 4PYOA 2PX2A 3RODA 1JQEA 1X1DA 4DF3A 2V7EA 1VBFA 3GIWA 2DZLA 2DENA 2HAKA 3GRZA 3GO4A 2AN3A 1WGLA 1M0EA 1P39A 2B3TA 3LHDA 1R74A 3HM2A 5ERGB 3DUWA 2JP7A 3PFHA 3FTCA 3DXZA 5EMMA 2C7RA 3UJAA 2EG5A 4CKEA 3MCZA 3OU7A 5G02A 1OQYA 2DNAA 1G6Q1 2EJSA 1UFKA 4A6EA 2CP8A 3G7UA 1AQJA 3PLAE 5K0CA 2PSSA 4RV9A 3KPYA 3MQ2A 4PYIA 3EVEA 4F2LA 3SSMA 1WG8A 5GIPE 2NXJA 5HIIA 3KQTA 4M38A 4FT4A 5FCDA 3PS9A 5CD1A 2GH1A 3IHTA 5T6BA 5K0GA 4Q7JA 2ZWAA 1HJPA 3KPWA 4GQBA 3D2LA 1HNNA 5GIOE 4HTFA 5EKXA 5EG5A 3ERCA 4P7KA 3I53A 3DH0A 1VIDA 5FQOA 4G56A 5D1NA 3GRVA 3M33A 2OBFA 4EK9A 2HWKA 2OPBA 5K0LA 1RJFA 3FPHA 4E2XA 3EVZA 3NMUF 3AWIA 3M6VA 4YUXA 4CXMA 1VP3A 1PRYA 1R00A 1ZMWA 2Q41A 3R6TA 2Y1WA 1TTEA 4UOEA 2OO9A 2NXEA 1ZGAA 2ONZA 4GOOD 2G72A 2P3LA 1SUSA 4JXJA 3THRA 1KPIA 5LR6A 1NW7A 9MHTA 1G8AA 3E21A 5CVJA 3FZGA 3EVDA 4FR0A 5EIFA 4RTQA 2QYOA 2JH9A 3AY0A 1KIAA 4PCLA 1JQDA 1IM8A 1O9GA 5T67A 4DZRA 1V92A 3ELUA 5ICEA 2EX4A 4QDKA 2ZTDA 1Q0SA 2XBMA 4ER3A 1VEJA 3EMDA 5FA5A 4WP2A 3NDJA 5JR3A 3UJCA 3FE3A 3MTEA 3TM4A 3EGIA 1KR5A 1QAMA 1VP9A 3LKDA 2ZCJA 2IDJA 3T0IA 1DV0A 5EOVA 4EVIA 1NW8A 1X1BA 4LG1A 3EVAA 1YFJA 1Y8GA 3KR9A 4C04A 1RI3A 1XXHE 2HTEA 1ORHA 3KR1A 2FCAA 5F2KA 3K6RA 4WXHA 3VSEA 1XVAA 2E5WA 1IFYA 5EMKA 2MGWA 1D2GA 2ZTHA 4PGHA 2ZWVA 4X60A 2GB4A 4M37A 5DFLA 3DXXA 4RWZA 1ZV1A 2ZW9A 3P9NA 1F38A 2G3QA 2BR5A 4RVDA 4RTKA 3SXJA 4WVLA 3KPUA 1DCTA 1OAIA 4PYLA 5EEGA 5KQSA 5H02A 5CCBA 5B1SA 2ZFUA 3SMQA 3HCFA 5DLYA 1VEKA 5DTRA 3M4XA 3DMHA 5LQUA 5FHRA 4QTUB 3QV2A 3BKXA 4X63A 2LD4A 3CJTA 5CUQA 3CJQA 5CVVA 1VLMA 3NVKI 3SSNA 3P71T 5DM2A 2BWBA 2YR0A 4DCMA 5EEHA 5BW5A 1WHCA 3H4JA 4RTLA 5KYGA 4ER5A 3TLJA 4YUZA 5HIKA 4AZSA 2XVMA 5JI2E 2I9KA 5FWDA 3O31A 4X1OA 1DL5A 1JQ3A 1KPGA 3FUXA 3DMFA 4HEOA 1EJ0A 4POOA 2JY7A 1OKSA 1H1DA 3P9IA 2VP3A 5CCXA 4LWOA 2ZULA 4AZTA 2OKCA 2ZTCA 4KWCA 4E32A 3LGAA 3GLFE 4GBED 4KRGA 2ZIFA 3LBFA 5EPEA 3TM5A 2AS0A 4QDJA 2QHOB 2UYHA 3KQOA 4MTLA 1BOOA 3PT9A 2YUIA 3CVOA 1FBNA 4OBXA 1EG2A 5DSXA 5FULA 2NXCA 3BWMA 1JSXA 2N47A 3GRYA 1KHHA 2PT9A 2KNVA 2IGTA 3GDHA 4ZTBA 1WY7A 4X61A 3L8DA 4RYLA 5MHTA 3NDIA 2PT6A 3GNLA 5LQNA 4R6XA 1D2HA 3G2OA 3K9OA 5GM2A 1EAMA 2JJQA 2VS1A 3OE5A 2QSFX 3NWBA 5IKMA 3GJYA
chains in the Genus database with same CATH superfamily
1V6AA 1Z4OA 4XVHA 3DXYA 1T9GR 3C5VA 3RYIB 2W8ZA 4XWAA 1UBNA 2GN9A 4ZQBA 4UOZA 4PPQA 3ZCSA 3I3SR 1GGMA 2WYWA 1GPH1 3IQXA 4GR9A 2ETVA 2WSSA 2OK7A 3OQ1A 2AC2A 4WW0A 1IIBA 1ORYB 3FFTA 1E6KA 3NWEA 4UE2A 3KQQA 1XLVA 1YJQA 4DUZM 2R6CA 4UEOA 3UKDA 4P32A 4EMSA 2IX9A 2R6AA 3CCFA 5KTSA 2IC5A 3LUJA 4FNOA 4TT3A 5ADWA 3ESQA 4PGFA 4J1SA 4G9BA 2I4LA 1XP8A 5AOAA 1HO3A 4AQYB 2HADA 4ZT3A 4D5EA 3WLKX 2WP0A 3B1XA 4UTZA 1XNRB 4RZUA 1ADGA 1NU6A 1TPYA 5HP4A 5CX1A 8ATCA 3KIPA 4JYZA 1J4AA 3MLBA 2G1KA 4CIYA 1E77A 2Y0DA 4Y1EA 2PS3A 3Q11A 2CF6A 3OKFA 3NBZC 1MGPA 3LWNA 4O4HB 2G77B 1RQRA 5LDHA 1E66A 1WUTA 4HQ0A 3SGLA 5J1TB 3ZCRA 5T8KA 4ZMBA 3CQ9A 3SLGA 2NM0A 4EJ2A 4E3ZA 2WHYA 3VC2A 4DEVA 2H1FA 3VNQA 2IHKA 4IIFA 4L9RA 2XTJA 1WY5A 3ZHSA 2ZYSA 2CFSA 1XLTC 1PKEA 5DNVA 1YVPA 1SXGA 1J56A 3DW3X 1T3LA 3QY0A 1HR0M 3C39A 1ICIA 1GN9A 1GTL1 4Q1AA 2XADA 2EGGA 2WSBA 3E4DA 3S5UA 2CNLA 4BGDA 3TJMA 1WCV1 4DV6B 1L7XA 4MR9B 3R7AA 2WBLC 4MUIA 3EAGA 5FQNA 4DQVA 1VPEA 2C99A 1ENZA 4K9LA 1HE1C 2QD1A 1M2NA 5DZSA 1G63A 5EP2A 5KQMA 3HP7A 4AIRA 1P7ZA 2WOOA 1TMKA 5FR2A 3RBAA 1XQWA 1IBMB 2Y3IA 1NF2A 1B43A 3T95A 5K09A 5JBQA 2BP7B 3WLAA 4TVBA 3D8UA 4PYMA 2IQ5A 2BSQA 3PTAA 4O4JB 2HLDD 2IYWA 3IBCA 3OZVA 5H8WA 2R7KA 5KBYA 1GNPA 4Q16A 2YYZA 1RYBA 5LOVF 2O8NA 5DLEA 5KAPA 3I37X 2R18A 1GNTA 4MB2A 4R2IA 3UWOA 5JXHA 1SO8A 3B6IA 1FDTA 5LLDA 3VM6A 4UHEA 1IJBA 4IVNA 4HYYA 2P2ZA 1SQFA 1J0XO 1E8MA 1CJCA 4HH4A 3A6FA 5KTNA 1DEKA 2DJ5A 3MTAA 4HBZA 4ND4A 5LMUM 4J7UA 2OV1A 1N2ZA 1M0TA 5FIUA 3IH5A 3K1YA 1AM4D 3QBDA 1F2DA 5BXYA 3OZIA 1WJ7A 2IDKA 1JXAA 1J1ZA 4PLFA 3F98A 1W19A 3ZE2B 4P92A 1KZGB 1PEAA 2Y68A 3KQPA 3VHRA 3ANNA 4PLPA 1CE8B 1RWBA 2FSUA 4LDRA 1KJIA 2JGFA 2FTKE 3CPSA 4K87A 2AFIE 4E5VA 1S89A 2WHQA 4DREA 1SBQA 4XD7A 2QBYA 1N2JA 2XOKD 2P91A 4N5LA 3FDJA 4DWJA 3LFUA 1NNJA 1H2EA 1Z9BA 2QQ8A 2QT9A 1I2BA 1PK7A 3DCYA 4IEFB 1Y9EA 2VYVA 2CNNA 1ISPA 2QAGC 3USZA 2CF5A 2JNHA 1VI2A 1O57A 3KZMA 4H18A 5LC1A 2ECOA 4R8LA 5BNFA 4U9IS 2VAXA 4G5SA 2E4WA 3LK7A 5JOQA 4TLAA 1E4EB 3BIOA 4FGUA 3C87A 4UCXA 4Q15A 3GQVA 1V5WA 3GPLA 3PDJA 1SHJA 1A1SA 2PKWA 1Z63A 3CNQS 3U5ZA 2UVQA 2AHOA 4MKXA 1J49A 1OC2A 3RBZA 5I9LA 5K8LA 4WESA 3C4VA 2H8GA 1QTQA 2BY4A 4BC0A 4G3XA 1BW9B 1TEVA 5REQB 4OB6A 5A04A 4Z49A 4RJTA 3BM5A 3PPWA 4E6PA 5I3CA 4CM4B 4IUDS 2JI9A 1BVSA 2HA6A 4K86A 4FOLA 4B6RA 2QMOA 2QN2A 3WB0A 4L02A 1DAHA 1BG6A 1GPLA 1QZ3A 4S2EA 3EWSA 3C7DB 1AN9A 3W8NA 4DLRA 2BW0A 2ZU0C 3EH1A 3V8VA 3OZGA 4YAWA 4I1OA 4Q24A 3VSCA 1PDWA 5BUCA 1WKCA 2P0YA 4KIGA 4I3HA 3HS3A 4WBNA 1ZHHA 1S8NA 3G7NA 4M0MA 4OHUA 4M1SA 2ORED 2CJWB 4AYTA 4O8ZA 1IHXA 2O05A 3KOYE 2ZYHA 5KKNB 4IJVA 2Z9BA 2ACEA 4MQ4A 4FMDB 2XYHA 4GZMA 5ICFA 3E3MA 2V1XA 1TQ4A 4RACA 1C2TA 2UKDA 2LVAA 1GFWA 3P97A 1Q0LA 1W35A 5FTWA 4WNAB 1Z73A 2OILA 2R8OA 3L8CA 4BNDB 1HE8B 2QMZA 4D43A 2L17A 1NVXQ 3QOXA 4ZQCB 4COOA 2VYND 3RFCA 4O2BA 2CE2X 3IPXA 4EPXA 2YIVX 3ZS8A 2WRZA 1QBGA 4R51A 2B8WA 2C59A 3IUQA 5AW7A 5KTMA 3H4IA 1G21A 3MCUA 1WXWA 2F6RA 2B0JA 1KSHA 3W9SA 5TRTA 3C3EA 4QBGB 1V8OA 1RWMA 3OIDA 4QHYA 1U1DA 3T9FA 3DWGA 2ZRJA 2BBSA 1A96A 1YACA 3N1UA 4ZJUA 2EKFA 3ZLJA 5F78A 3SEFA 3AYZB 2VJPA 3DLTA 3SHVA 3IP6A 1ACMA 1LW7A 4JJAA 2NSYA 3WY9A 4QUHA 1XK7A 3GV0A 4LK3A 3GHYA 5EKDA 2D0PB 2V8BA 3QOWA 2P40A 3HV2A 1W44A 2XCRB 3PNOA 1N5MA 2QMEA 2W0MA 4QXAA 5C51B 4CMEC 3TQQA 1WUYA 3KQVA 2E5FA 1G5HA 2P6NA 2R97A 1EUDA 2N9UA 1AHHA 1B6GA 2DXIA 2V0NA 4K0KM 1HE3A 5E4FA 5LMZA 2OCAA 1QV9A 4N47A 3IECA 1LDEA 4Q82A 2X6TA 1MB0A 3IALA 5A0FA 3UYKA 5EHZA 1GG9A 2FFAA 3MC1A 2G4VA 3O8RA 2QQ0A 1GL9B 4TM7A 3MSXA 4EO7A 1OGJA 4CIAA 2AD5A 1KEKA 5KYUB 521PA 5AI0A 4CHTB 4FN5A 3HEBA 4H6WA 4Q0MA 2NP7A 4Z3DA 1U2TA 3KVVA 1QPZA 1QG4A 2P3QA 4ZT5A 3VNUA 1I2AA 4JI5B 1Y7TA 2FEKA 4GVXA 2PWAA 3L0IB 4IOJA 4DRZA 4X7BA 3BVPA 3L7LA 3I9FA 1EP3B 3WGNA 3RSQA 1T0PA 4JJKA 2FQXA 4JGIA 4B43A 3IDQA 1ZNZA 2ZRLA 1VG1A 2D5IA 4TS3A 4KQWA 4BNLA 1VMEA 3GXBA 1T5BA 3ZEIA 4D0GA 2ZT8A 3G0DA 2WWRA 2O8FB 4D57A 4NYJQ 5EQFA 4YI5A 3RUDA 2ISSD 2WIBA 3T1OA 4R2HA 5LVAA 1BDMA 1P2GA 4OQPA 4P3YA 4PYRA 4PZEA 4KK4A 4RZXA 3ZE8A 2D7HA 5BN4B 5JMTA 2P69A 5L3SA 3KHTA 4J3NA 1QF6A 2R48A 4X45A 4OQLA 3HUEA 4HAWA 4PF1A 4OD0A 1GL7A 1A97A 1OLSB 4JBLA 4OO3A 1IY0A 2V7UA 4ZCPA 5IH7A 2KNAA 1SCAA 4QUJA 2OV2A 1SIUA 1TYCA 2J0UB 5ELMA 4FFOA 3JR7A 4I9NA 2RAFA 3PJRA 4Y30A 1XXHB 3FHJA 3RTEA 1S9HA 1XC7A 3GVCA 4FILA 4TTVA 4LHEA 1WZNA 5THXA 4HR7A 5SY4A 5F76A 2I1QA 5BSKA 3HHYA 3Q7RA 4RO0A 1GQYA 4B33A 1F2VA 3IIMA 4JL5A 4NHOA 3LKBA 4GOLD 1DJPA 1MT3A 3JD0A 4Q7JB 5AM3A 4BN0A 2X9LA 1DG3A 1POWA 3GLGA 4ZV7A 2YMLA 4GYWA 1BA3A 4G5GA 1RM5A 2RGDA 1RRKA 3ITDA 3DFUA 2A5FA 5L4LA 3LBYA 5GZ6A 4X44A 2VSOA 1Q6ZA 3OESA 4TX1A 1IM5A 3UC9A 1W5TA 1XRNA 3HMQA 1NJSA 1FVHA 3GJRA 5ALJA 4HYEA 4Q47A 1QCYA 1ZYUA 1XF9A 5KWEA 2GEJA 2RH9B 4ZHQB 2D5LA 4PG7A 6NULA 1L5RA 1JNYA 2DFPA 3ECCA 2YY6A 4AY5A 2G25A 4EJFA 2EJTA 3M34A 1OFTA 4ZJYA 2HDHA 1X7GA 5F33A 2BKXA 1OXKB 3NI2A 5LZ9A 3HR7A 1XLUA 1YUBA 2WKQA 2YBEA 3I83A 4MOWA 4YLYA 4HDSA 1N36M 2P5TB 4ASUA 1O4VA 1MJHA 3WYCA 5JYEA 1D4AA 2G6TA 3TW0A 4EOGA 3NBAA 4IH9A 1KZYC 3ZWPA 5EIOA 4I5EA 5FI0B 4W5NA 1QPGA 2VDVE 4LMBA 3EXAA 2JAUA 2F9LA 4LJ5A 5M5BA 4UMEA 1HLPA 1DWOA 1DX6A 4XSVA 4PLVA 1E1CA 1JDVA 3WRYC 1UJ4A 2QE6A 1O0BA 5K03A 4BY9E 1PSZA 2QPAA 3WKBA 1EP1B 2B37A 3N87A 2P4HX 3WB9A 5H37D 5IF3A 3P0RA 5ALGA 3SBOA 5EAIA 4C7KA 2CCJA 2ZB7A 3SJAA 4CCSA 3O8BA 2ZI5A 3WMWA 4I1YA 2YZKA 4YXFA 2P2GA 3KX2A 4C2TA 1K9VF 4W1RA 2GERA 2C07A 3FLEA 2GDJA 4CQMA 1F06A 2I2BA 3VZDA 5AJWA 3D0RA 1N7IA 4J4TA 1RSZA 1D4OA 3WBKA 1NF3A 4OGWA 4BKMA 2MMCA 4QRHA 4HGZA 4Q3NA 4CWAA 5DHFA 4XB1A 4J3FA 3WMXA 1XEWY 4PZPA 3HJRA 2C8JA 5KSOA 1KR2A 2K7FA 3F47A 1RXIA 4CM9D 1DDOA 4LW8A 4X85A 1XCJA 4DAOA 1VLVA 2YQ4A 3S6JA 2PX2A 3B7WA 3H6KA 1C7IA 2AW5A 4DF3A 5CA1B 2UU9M 1UAGA 1G9SA 1A95A 5CP8A 2WU4A 3O6VA 5KJEA 3MVEA 3ONDA 2AN3A 1NSFA 1MDFA 2JAWA 3ZWCA 4WKCA 3HM2A 3LSYA 4XDZA 4BMOB 4TLBA 2C54A 2IZZA 5F51A 3QELB 5IKPA 1NJ2A 4I7EA 2OESA 3OJWA 1SZJG 2LCFA 4BNVA 2DWOA 5CJJA 4YJ2F 5C18A 4KB5A 1ILEA 4MPDA 3DA1A 2PSSA 1TCVA 3RGPA 4TMKA 1I6WA 2PL1A 2IHUA 4PYIA 4IXNA 1NBMA 2XUJA 3KOMA 4MXDA 2NXJA 3NTRA 5SY6A 4DTIA 2WLSA 4HH1A 2BCGY 3SBDA 1CG6A 2BGNA 2BFDA 3P1JA 4NJMA 3W4IA 4M54A 2BI4A 2M6KA 3BIJA 2VTVA 2ZWAA 2PD4A 1SZPA 1ZKMA 1IUPA 1ZGGA 3LOQA 4ZI7B 4QD3A 4DLUA 1KI6A 5FQOA 5G1NA 3HKEB 4OJQA 1E60A 1R0SA 4QU8A 1ZD9A 5C5EA 1Z7YA 4CETA 3CXRA 4NJOA 4XRGA 5K0LA 3FPHA 3W9UA 3MS2A 1RQGA 3JQFC 1KVTA 1R00A 4CL0A 3TIGA 1EFHA 3PBKA 1XEAA 3N8NA 1Z45A 2NXEA 1Y4SA 1HA3A 1CJTC 5J4KA 4M22A 3NG1A 1BGVA 2H52A 1O5OA 3JAKA 3LVWA 3SQMA 2JIOA 4TV9F 3TVYA 4N7RA 1KQNA 1O6ZA 4JQZA 4ZVNA 3PSHA 1IM8A 4J94A 2IELA 4YYEA 4Q1VA 4B8ZA 3N6RA 821PA 3H04A 3AESA 1L8LA 2RG1A 3EGIA 2Y9PB 4F93B 3HYNA 1I4LD 1KOJA 3CV3A 4PO1A 5BN5A 1IWOA 2HSZA 2ZJ3A 2VQ6A 1BIFA 3U80A 3SZUA 1S6YA 1LPMA 4MLDA 3IUPA 1I6LA 4W5QA 2IYTA 4ENPA 4XTCS 1I10A 2XGMA 2CFOA 5JPDA 4XEHA 2VHEA 5CG2A 2GJ9A 4Y2QA 5KAMA 2JK0A 3FSGD 4EAQA 1RC8A 3P0EA 2JBAB 1UMCA 1U9YA 3KD3A 4EFLA 4JLSA 3HKBA 4PR3A 1MF7A 2YW9A 3LP5A 3AF6A 4KDEA 1GJRA 4FB5A 3GEGA 1KY2A 3SE7A 3F9RA 1U2EA 1CHDA 1XEXA 1L5HA 4M1QA 2V65A 3ZJUA 3E48A 5B1YA 3KPUA 4JV5B 3PKZA 2WYVA 2V97A 4HDKA 1X14A 5DBHX 1V11A 2NSHA 1Z59A 4RVSA 1NJ5A 3GYBA 1BS9A 5GGYA 3AL0C 4RABA 3WK6A 1RKQA 4ZYZA 3WAGA 4UUQA 5JSQA 1J25A 4CEHA 1MX9A 4W6QA 4DR3B 3SSNA 3FLMA 3OKCA 1D9ZA 4C14A 4RS4A 3LZDA 4KR9A 3JRWA 4EHBA 3W5CA 1C9MA 3BFXA 4KODA 2PZBA 2GF0A 2QN8A 3G59A 4J1TC 4WN9B 2WAMA 2B5WA 2FP4B 3HO8A 4UBKA 4F5EA 2XKKA 4CF5A 1GP2A 1EJ0A 4MW9A 4GZ5A 3AM3A 1R4MA 4YXWD 4DJFC 4INOA 5TMDA 2FPIB 1UXJA 3BXPA 3RANA 1F0NA 3A1UA 2KE5A 4I3FA 1VG0B 2Q9AA 3PNYA 2H92A 1U0HC 4JWTA 2DP4E 3DWFA 3PVSA 2ZRDA 4OBXA 1WHSA 3HHPA 1HTTA 4YAIA 1K5PA 3V1MA 5J23A 1MUUA 2VJYA 4KE9A 4WK0B 4PBSA 5L3RA 3OCCA 2WZCA 1Q7TA 3HDTA 4IVRA 2Y4NA 2CZGA 1VA4A 2XNSA 4R6XA 3L2OB 4EF4A 3HJTA 1EAMA 4MEAA 5J4LA 3GYGA 1XRPA 1Y98A 2C4WA 3M6AA 1QOPB 3EEIA 2D1RA 2TYSB 3NNSA 1Z6YA 1IZ0A 3CPEA 1S2LA 2QL6A 5JHHB 3LA6A 1QCZA 3U6CA 1IRIA 3CX6A 3SSOA 2OMEA 1EBUA 2CZCA 3AKYA 4ZXPA 5AD1A 5T7BA 2C4HA 1VG9B 3N2KA 2H1WA 2C4UA 1KKLA 1P1KA 1L5SA 1NDHA 3K92A 2IXEA 4XQGA 4Y2HA 2L69A 2YH2A 3OCVA 5ALEA 3SEQA 4TRMA 3DHYA 3MJHA 2YQ5A 4HSGA 3JAWA 4WEQA 1UAAA 2XUQA 4X64M 1PBNA 2UUAM 3E23A 3BBPA 2A94A 2I2DA 4DEXA 4XVUA 1GO2A 3QEAZ 1PJIA 2RCNA 4UOQA 2R1TA 4MWSA 1EZZA 1ZPDA 5JJKA 2HEIA 4LSWA 1C30B 3ZC3A 4R84A 1YUNA 4GR5A 1N34B 2XA1A 3KZNA 3CVUA 4WOKA 1Z2AA 3P2YA 1FNBA 1ULSA 5CDUA 5LMNM 4EZBA 3L6CA 5KREA 2QTCA 5B1EA 1K4YA 2PBZA 1TU3A 2Q6LA 1IZYA 3GL9A 1U1FA 1VDMA 2CNKA 4AT1A 1Z82A 4JU8A 3N0WA 3SARA 4F12A 1QYXA 2FPOA 4OHFA 4LVOA 4DMRA 3SC3A 1VOTA 1Z6ZA 4Q1CA 2DTXA 2WICA 1IHPA 2DHDA 4U4AA 1FJXA 1EUCB 2O8BB 1KH3A 1ATIA 3HXTA 3P45A 5J43A 1E64A 5DGIA 2VQ3A 5U9CA 2IEYA 1DBQA 3RS3A 1XTUA 4REZA 4L95C 1T25A 2ZK7A 2EG9A 1Y8CA 2FLWA 2C5BA 3N8GA 4BVGA 1EA5A 4IBJA 4DMGA 1E2KA 4TV8A 4LC0A 1DXOA 1USIA 1URPA 1GYQA 3C98A 3UK0A 3PWSA 3H9GA 4JJFA 3GT4A 4ZK6A 4B7HA 5MFZA 5LSAA 4DCOA 2KPOA 4UM9D 3CO5A 3PEVA 1KO1A 4DQKA 3PR3A 3VI3B 2O3JA 4NATA 3T3EA 5HR5A 1NUPA 3U3MA 3L5KA 5DNCA 2CUZA 4F6RB 3COZA 2GWHA 5E8JA 1AIPC 1DAPA 2DZDA 3I01A 4DNXA 3L6UA 4BLCA 2YYSA 4I2VA 1RACA 4JJIA 3RS2A 4KI0A 5F98A 2BBOA 4RNDB 1T8WA 3EFHA 3I0MA 4XM1A 4RK0A 3TZBA 3CSUA 2FFBA 1JDUA 2Z8ZA 1FP4A 5CJ2A 4Q00A 1OUMA 2VJCA 1K7XB 2ZRCA 4QAJA 5C7IO 4A15A 1A9QA 4MDHA 4LTMA 3A1NA 4M49A 3PC4A 3NHYA 2D74A 1PIWA 1G59A 2ZRFA 3QUQA 3SDBA 2R4QA 1QZUA 1H6UA 2ZUTA 3PA6A 5AKXA 2EV9A 4LOIA 2BMJA 2CNDA 1ISJA 4FFWA 4XASA 2FMKA 4JP8A 5IFLA 4QJIA 5EJIA 2VLBA 3WMGA 1LPPA 3C6KA 4OLHA 2R8EA 2R5NA 4JIGA 1ODTC 4J0FA 1E3WA 3VPDA 2Z43A 5KU1A 3S2IA 4Q9HA 2ZUSA 1G0OA 1P2BA 3NYQA 3FVTA 2WSEF 4HWKA 3LDFA 1P1RA 5CFOA 2WK1A 3LY5A 2XR1A 1NVBA 4EI9A 2HBQA 4R9NA 4Z4EA 2RSLA 4NLLA 3D02A 4K6KA 1JALA 2YYAA 3LZ6A 3NVMB 1S8OA 3BJMA 3SXPA 5HF9A 5IJAA 4UHCA 3BJZA 4A73A 4EJMA 4PX9A 3KP1E 4Q1FA 2J0VA 1AURA 2B4KA 3STYA 1C7QA 2GZRA 1T26A 1F17A 4JJ7A 4Z3OA 2UXDM 3HHEA 5KIAA 3AVUA 2AZ4A 1AU9A 1SHTX 3ZCXA 1VHQA 3VMFA 1SOMA 2HLHA 3L0YA 3M1LA 1M2VA 4K05A 1XCGB 2IIBA 4MQUA 1C0LA 4WACA 3DO8A 1V3QE 1NI4B 3U4DA 1CRQA 1G5IA 3UAOA 4H1VA 3LDAA 3JASB 4IFEA 5DNEA 4YV2A 5BNZA 4MW4A 1HG0A 4GBMA 3NORA 3PC8C 3VDPA 2J4DA 4MCHA 2PFSA 3Q8WA 3QUAA 2L82A 2HT6A 2LW7A 1N4AA 4EELA 2Z4SA 4H4EA 4KFSA 1DRKA 4FYHA 3MPUA 2A3NA 2BKVA 3PUKA 3ZV6A 2M1XA 2IEDA 4JYAM 2RJOA 1ZXBA 2D5CA 1FP1D 5IYZA 2ZETA 3CLHA 3A3PA 4NMLA 4BHTA 2C92A 3G9TA 4MRNA 4DSAA 4DADA 1CY0A 1CEYA 3TXAA 1ZWKA 2WHEA 2PD3A 3EIWA 3UT0A 3AVOA 2OWDA 3DR3A 1AXEA 2GBIA 1REQA 3HU1A 3S2UA 1A77A 3LVQE 4MYHA 2A58A 1NVWQ 1Y81A 2QTGA 2V74B 3ZG6A 4IF4A 3U44B 4P6VF 3LT1A 5DBIA 2JKVA 3D5QA 3RTAA 3MFYA 4CT0A 1MABA 5ITRA 1LK5A 1YNSA 1JYSA 1GGVA 5F35A 1K9SA 2YKGA 4TL9A 3OF2A 1C3VA 4NENB 3ENZA 1SXJA 2V0CA 2C77A 2YHAA 5ABPA 4GG1A 3CTMA 2NYRA 4KLCA 2G9ZA 2IK8A 2E48A 1O95C 4ZIRB 3RVPA 5KTOA 2HNBA 3URMA 1NUUA 3RUFA 4DUGD 4I50B 4LZOA 2EP8A 1QC5B 1B00A 4F92B 2WM9B 1A72A 4JXZA 1BXZA 1NKVA 4KVFA 1JPVA 4O1IA 3L0OA 2V7QA 3O4JA 2X40A 1XVVA 4ISBA 1P60A 2M6LA 4P93A 2JFQA 2IV2X 2ZDHA 2VT7A 2P3OA 5JS8A 3KYDA 3P94A 1UZUA 3EWAA 3QW4B 2X3FA 2WPNA 5EJ2A 1R9GA 3VO9A 3AR2A 1LVUA 4F6CA 1PJ8A 4MRMA 4UNSA 4PCZA 1SIBE 2X76A 3I5MA 3WB2A 3RK4A 4GHAA 3KZ1E 4B4KA 1CY1A 4LI0A 3R09A 4KV7A 3GJ7A 4B75A 1ND6A 4OX9Y 2WFZA 2WDZA 4B4OA 4R1TA 2CL0X 3U1TA 1D2NA 3NJ8A 3V00A 5G0TA 5B3JC 3QEMA 3FMIA 4DLPA 1A9RA 5L6LB 1B7GO 3IT1A 4WH0A 2WKSA 1NOKA 3AR5A 2FJ0A 1XZCA 4AJPA 1L8QA 5LB4A 2BE7A 5EPOA 3FNRA 1HI9A 4S1OA 2VK2A 5HKBA 1DS6A 1N3BA 3R9XA 2A0WA 2C7PA 4ES6A 4D6PA 1SA0A 2XT0A 2D62A 2XOEA 4L16A 6ABPA 2EBFX 3CVWA 4H08A 1HNXB 1E5VA 3MFQA 4BX0A 4RLFA 2LGJA 1O1YA 1W73A 3G1WA 5LYJA 3WISA 3CU5A 3UV3A 1RLOA 4P5EA 3K9FC 4XARA 1NVAA 4BAZA 1Q21A 4PGGA 5L3QB 4G0PA 3EBOA 4PFJA 2JZ1A 2JZCA 1B2RA 2OP1A 2Q5EA 1ABFA 4LVUA 2BGTA 3E9MA 1UJBA 4N5HX 3DOJA 5HZGA 2ADOA 1J8VA 2FUG1 1NBIA 1JTEA 3I5AA 4HS9A 1C0EA 3LT4A 3RASA 1G21E 2KS6A 3TZKA 3DEFA 2DHQA 221PA 3R6WA 4JNCA 5NLLA 1HT2E 3NEAA 1TA9A 3RUEA 3IE2A 1Z0AA 4QIHA 5KJ6A 2AE2A 3ICOA 2V03A 1JB1A 4WUVA 1U3DA 4LX0A 1SK8A 2WWVD 2VDQB 2CMHA 4JDPA 2ARKA 1SH7A 1SB9A 3FYUB 4DR5B 2QSUA 5BOSA 1Y89A 2C42A 1U8YA 1A5AB 1UWVA 1N0WA 5GKNA 2A9FA 5JBNA 1TUBA 4LGYA 3IDAA 4E5YA 3MWDB 2COUA 3MINA 1F1BA 3UK6A 1HEYA 1G8SA 1WDLA 1YA4A 3F97A 4BP8A 1YRLA 4F8JA 4PRKA 2OOKA 1INLA 1MD9A 3FUWA 1PX2A 1DDGA 2G76A 1H5UA 2ZBUA 1WBBA 2EJUA 3BMOB 1AK2A 1FFDA 1VDLA 3D8HA 3M6IA 1X3SA 2A88A 4M9XA 1U8FO 3KWLA 3PCXA 1H2BA 2I7XA 3ILSA 1XZKA 2VDPB 4GZ6A 4FP9A 4QBFA 3ZK9A 3JQRA 2HF8A 1WU7A 3L4EA 4BX9A 3EGWA 3ORYA 4AJ1A 3T38A 4G25A 5C1IA 2OCPA 1SJ9A 4CF3A 2Y1KA 2JCBA 5AIBA 1IB0A 4D9CA 3IVCA 5DRYA 3WB1A 3N5CA 4WGFA 1SRQA 3ZJTA 2J9RA 1IUOA 2P1DA 3KS9A 4X62B 3IC5A 2W6PA 1OA0A 3Q41A 2FG7C 5LJLA 1K6EA 3MBIA 1JVSA 2CLEB 1W88A 4UCQA 1XRRA 3DZBA 4MICA 2E89A 2ZIXB 1ZVQA 4K9OA 4WZBB 3OTWA 1DE0A 1PEYA 3TE7A 1JX6A 3F49S 1RBMA 2MDTA 1R4NB 4WEOA 4J7CA 1PFKA 2V9ZA 3BWVA 3MRVA 4WV3A 4DCPA 1TA4A 1DWUA 2GNOA 3AVYA 2NZVG 5C5DA 2WZDA 1SUDA 3GT3A 5HFJA 3BWDD 4XJSA 4C4TA 4B8YA 1PG0A 1TT5B 3P9RA 4F97A 1N25A 2EYUA 3LQFA 5LP6B 3UHAA 4EG8A 3KQHA 1N78A 1N33M 3HSYA 3LIIA 4PIMA 3C1TA 3KKLA 2PPVA 2QMUA 2OUKA 2I54A 5TJHA 3V2GA 3EF1A 2BTQA 1XQ6A 2GM3A 4WCFC 1YS1X 2JLSA 1MA3A 3Q15C 2VQEB 2NVUB 2BHLA 1PGNA 1EDZA 3DFZA 4AJ4A 3WJ1A 2DWQA 3KBOA 3CMCO 4LYEA 1AXGA 3GLGE 4KQKA 3UGJA 4LYYA 2G67A 3KJGA 4HK4A 3SMSA 4HMQA 4HVCA 4R8KA 4CM7A 2J9YB 2HFKA 1Z3IX 5EE1A 5L8RF 2HGSA 2PVSA 1PJSA 4QNRA 3MS4A 3GRFA 3BERA 1XRQA 4XM2A 3JWGA 2QIOA 1RIFA 3UJ7A 4YCAA 4ZC8A 4M9RA 4CKYA 4XM0A 1JMYA 2CYBA 3M9LA 3OE7D 3K72B 1Z5GA 1XZGA 1I4WA 2OCXA 1VJTA 1HUQA 3T4XA 2V7EA 1GG8A 3OO0A 3I42A 3ZZTA 3R6DA 3M3HA 4DN6A 4B31A 3CINA 2H7XA 2ADFA 3K0CA 4G1VA 1QJ4A 3RPEA 3TRJA 1PZMA 4YAOA 4OOEA 3EG9B 4N0PA 1RJ9A 4UFOA 4BVJA 5A62A 1KYXA 1AUVA 5K7SA 3WDLA 1VA5A 4L8WB 4EIWA 4FFMA 5G40A 1B8OA 3Q3CA 4M8SA 5J58A 1T2VA 3TNJA 2NMVA 1OFGA 4NV1A 2XNDA 4L2IB 3M82A 1KJ8A 4GE0A 3FPKA 4KEAA 1JHAA 4OBEA 3BD7A 2AF3C 1WMAA 3D8BA 1J06A 4F2LA 1P5FA 3NTLA 3IAAA 1PQPA 4GMQA 4F4CA 4ZAFA 3O8NA 1NTOA 2XUOA 2ZUVA 4AF6A 4FEEA 4LWZA 3HXKA 2XYPA 1QFMA 3I1YA 1M34A 3IHTA 1V4BA 4B45A 5K3AA 1YV9A 4JSTA 1HJPA 2BOVA 1GKYA 3KP1A 3CSDA 4WLFA 4INZA 5CNKA 3I53A 4R31A 4HXGA 3CF4A 3ND5A 3OMWA 4RKEA 1FQOA 1JAYA 1UBGA 3GRVA 1XFDA 4KLAA 4E2XA 5IBCA 4BAGA 2Q5JA 1Z26A 4GI1A 1TC1A 2UXCM 4FIZA 1U6KA 1W47A 1VP3A 3UGTA 1Q0QA 3VU9B 2I2FA 3L7CA 4NNOA 3DDOA 3Q1KA 1D1QA 5HQJA 3LJKA 3SHOA 2HQOA 3ZTTA 4N8DA 2PE5A 1WU8A 3M3DA 3SQDA 3M7IA 4OKIA 2KA6B 3CRRA 2AJBA 3AHEA 4D9EA 5CVJA 1TXGA 1WZCA 5C8YB 2AX3A 1XZMA 3FOEC 1K6JA 2JJ2D 4YC7A 5IDQA 4IBGA 1U0JA 2ZAMA 2D1TA 1ZC4A 2ZIUB 4PCLA 2IXAA 1E5QA 3GLQA 4Z6KA 2ZTDA 3OFNA 2VAVA 3QPCA 1MA0A 1NR1A 2QA5A 3MTEA 2ZM5A 2X3YA 1QNLA 4GHLA 4NOOB 1XJ0A 2L7HA 4MKZA 1ESNA 2NU6A 5IBPA 4XQ0A 1OXUA 5FWNA 5CEJA 2I22A 2W83A 1M6VB 2HTEA 1U2RA 3SOPA 2GHIA 3A05A 3ZBPA 2I4MA 1NBME 2XOXA 3DL7A 2UXBM 3VBEA 1HE2A 4X60A 4NOLA 4UNNA 3DEAA 1U0NA 5I5GA 1D0VA 2OORA 1UBFA 3COWA 1LSOA 2BR5A 1MEJA 1GM5A 3WK9A 1FFCA 2BFBA 4G1BA 1EVQA 4AD8A 2F62A 5A06A 5BQ3A 1WE2A 2WG1A 1KWKA 1T4BA 1QQBA 4A0RA 1N6HA 3ZLTA 1Z18A 4EYSA 5EWMA 4EFNA 2O5CA 3SJZA 4DARA 3PXUA 2RD2A 3VYVA 3IQDB 2J7KA 1LRLA 2Z09A 2X0NA 5CVVA 3IOBA 5KNCA 3ASZA 2GESA 3VV3A 3MWEB 3KZXA 3I4YA 3F7NA 2QSZA 1OLXA 4W7IA 1QR6A 4AZSA 2H18A 4OJTA 2K6GA 1FFWA 1I0LA 4LNUA 4TZTA 4MP8A 3IKMB 3BQMB 3GRKA 4IM7A 1PR5A 4CVNA 2R4UA 3BK7A 3ACBA 3T3NA 1I3KA 3AU8A 3JYPA 1V47A 2OHXA 4KWCA 5TPWA 3K5IA 5MN4A 3ZDFA 4HO1X 3DMYA 1WPRA 1T4CA 3HP4A 1EX6A 5JISA 1R88A 5EL0A 1DIBA 3LQ4A 5AJZA 3M7GA 4UQOA 1C50A 3OURA 2JZOA 2VDKB 1SC4A 4ZHSA 3GRPA 5AW4A 2EHDA 4YHHM 4BMVA 5H16A 5A4AA 4K6FA 2LCQA 5FOQA 3FETA 1TGVA 2BUCA 1Q7GA 4BGIA 5AXBA 5D5QA 2ORVA 4JELA 3WG9A 5ALNA 3T0FA 4PG8A 3VDUA 1XZQA 4M87A 3GG2A 1Z0IA 4DLXA 4EHJA 3A45A 3QX9A 3NWBA 1ORVA 5BORA 3ANMA 4H16A 6REQA 1PM5A 4R9UC 4KR6A 3N2NA 1RMTA 4DQXA 4WNIA 3LECA 2VP5A 5FAXA 4UREA 1TVCA 3V1NA 2C5FA 5BV1A 3ROTA 2Q3LA 3K32A 4FHCA 3KEMA 2GPJA 4M9CA 2NPOA 1RW4A 3PSAA 3D4LA 1GPDG 4M8IA 4C1BA 4MW0A 4M0CA 3FROA 4D44A 3SHFA 1V1MB 1OZHA 2HRBA 2A9KA 1QQAA 5A6VA 3K35A 2HU5A 5IT9S 4B7FA 1Z8FA 3IVXA 1CR0A 4OL9A 3MN1A 5CFZA 2AKAB 3KFXA 1V5EA 2W00A 3TLGB 3PNBA 1QX3A 3E3NA 3HRHA 4ENQA 2PRIA 4KIFA 1FU4A 5EIXA 2Q2VA 5CTAA 1DMSA 1UPCA 2GFQA 3X1DA 1K63A 3FUCA 2VRCD 2R62A 4YR7A 1VPTA 3QWIA 1NKTA 1GPUA 3QXSA 1XRMA 2XZFA 4KKXB 3UOAB 1RQ2A 1ONPA 2CGEA 1DARA 3WOHA 3QMWA 2ZE6A 4COKA 4MIYA 1YDFA 4FYPA 3GN1A 5DPMA 4XPIA 3WQRA 1ZM2A 4H7HA 2WT9A 4FOOA 3GPDG 2NO1A 3GAZA 4YFVA 5ALKA 1PWHA 3PXBA 4JLPA 2FXIA 2HY7A 2V55B 2RGNA 2IPLA 5IKOA 2F5OA 3FUVA 1FYVA 1MIOA 1TZ2A 1DOHA 1TW2A 4KWIA 4OAPA 4L8YA 4RVFA 2QXYA 2IH4A 3W2TA 3QPVA 1LJUA 1YC5A 4HN9A 4AKTA 4LPKA 4WUTA 1C1DA 3BCUA 1JKIA 1XE3A 4ROTA 4Z4GA 1F4PA 4DILA 2I3ZA 3OFVA 3PYXA 4N6GA 3TKYA 1PFYA 5B2ZA 1NBOA 3TOCA 3S1AA 3DO5A 3B6ZA 2JY6B 5GONB 1P31A 1DXHA 5DNAA 1Y3FE 4TN1A 2K2WA 2I6SA 3FGOA 1SCUB 2OFXA 1XJ5A 3JD1A 2FK8A 4RJIA 4FU0A 1I1QB 3ICVA 1PGOA 4I4NA 2Q3MA 5JVDA 3V4PB 1PQWA 2CCKA 3FPJA 4Q34A 1OD6A 4WY8A 1VBKA 5DIZA 1HORA 4F84A 5LB2A 1D09A 2HYIC 4BQSA 5CX1B 3OZBA 1G5TA 2GF9A 1E6EA 4WGGA 1PTKA 3GP1A 2AFVA 3EE6A 1JU9A 3NJRA 1R6TA 3IVMA 2L4EA 3AB7A 3GY0A 4YRAA 1JSRA 1UR5A 2DLNA 5E1OA 3LT0A 5CG1A 1EFAA 4MR8A 4QNNA 2XZUA 5KQPA 4WLUA 4FFRA 1XQXA 1T9AA 4R81A 2QS9A 4JB2A 1Z5CA 3BL8A 3HFJA 5A4FS 5ALOA 3W8RA 3UWSA 2PKEA 1FDOA 2CVQA 5IKXA 2OECA 4L0CA 5AW8A 2DWPA 4V24A 4JEMA 2Q7DA 2YWEA 5DHPA 3BK2A 1VXRA 3UC5A 4ZYVA 2ZS8A 1Q44A 2WI8A 3PVCA 5HQ3A 3VR5H 5L95A 1E5DA 1KDTA 3L8HA 4TS1A 5D51S 1GDHA 4E4YA 4X6YA 1FB5A 4HAUA 3WSWA 2VOJA 4WSOA 2FQYA 1YB7A 2NYUA 1RE0A 2ZI6A 3OJCA 1YR2A 3CH4B 3Q2IA 1KRWA 1HWYA 1EHCA 1W4ZA 3AV3A 1N6OA 2FPGA 2R6ZA 3IPAA 1NRJB 2ZB4A 5G53C 3RSLA 4DIOA 2FRDA 2LNHC 4QECA 2BONA 1JHQA 3J7AS 3W5VA 4A2PA 4M9UA 2AJCA 2DKLA 3C6YA 3X1JA 5EJ7A 4OHXA 1NFRA 1LPSA 3IMEA 4JLUA 4E11A 2VF8A 3N2GA 2P9JA 3DMTA 3FTNA 5DTQA 2DEUA 2C9CA 1VCIA 4B0OA 1UQUA 4K6HA 2EFEB 1GAWA 4F2WA 3AK4A 5LU9A 4F4HA 4UU0A 1N8NA 5BYBA 5JAHA 4IYRA 5B7PA 5J2UF 3ESRA 4L4SA 3UWPA 3D6VA 4MUGA 4RF4A 2G09A 2WILA 3FWKA 2YHIA 3PJEA 3OOJA 4HCJA 2PMEA 2QLJA 5GJVC 2FRXA 3BN3A 3F67A 5EJMA 2X5NA 4CODB 3SG0A 4DM3A 4MYUA 1H3NA 3DDNA 4PSUA 3C0KA 5EHQA 4B3RB 3V8RA 1KJWA 4G63A 1QZXA 1UBOS 1SHLA 3QWHA 2CJYA 2W4QA 1VSBA 5HBGA 2IITA 3EXG2 4ANRA 5TQVA 5C1DA 4URUR 3UN1A 4UULA 1P6XA 1G3RA 2QBYB 3F2VA 5E2AA 4F6LA 3O90A 4MB7A 4AKHA 4PFQA 1G19A 2H1OA 4PTYA 3ADBA 3I8XA 3INGA 3FDZB 4M21A 3ZBUA 2KXEA 2BJWA 2Y71A 2QX6A 1XZAA 4FTWA 4BN4A 3EZFA 3F6SA 2R2GA 4F1WA 5FB3A 1UFRA 5HRAA 2Q6IA 4WMLA 2HIAA 1BGXT 1Z0SA 5CLLA 4QOSA 1H9AA 1FC0A 3D0QA 4IJMA 3OFKA 2P9EA 4HXEB 4ZOQI 4URFA 3M6MD 4MJ3A 3GX1A 1N5OX 5I7HA 4ZICA 3SM9A 3H3XA 3I9OA 3CTWB 4RU1A 4IHJA 3UXYA 4IUYA 4FNAA 3TQRA 1DQYA 3A32A 1NBWB 4WESB 1U7PA 3GXOA 4LXXA 2JAOA 2X23A 2XIQA 1W87A 2UUOA 4RSHA 2ID9A 1ZH8A 3U6KA 4HNUA 2OV6A 4RLHA 3U7QA 4MQLA 4EZEA 3QGMA 4UHKA 4EHDA 2ZI3A 1V5IA 2CC2A 4XLTA 1XNHA 1JIIA 4LF7B 4LF8B 5I01A 3DZHA 2HD4A 3OZDA 1P17A 4PLTA 2R79A 4TYWA 2LTAA 1WUKS 2M60A 1ZK2A 3M5CA 4JWKA 1I2MA 1YIOA 5LP1A 3JAMS 2D54A 3WWYA 3HFGA 1TDHA 1P18A 2GOYA 1ZXXA 2IYSA 3B9BA 2XNHA 1AMOA 4OU4A 3MCVA 4WBNB 1RPNA 4RESA 1HL3A 4EYQA 4BFUA 4U7PB 1NI3A 5MFPA 4ZODA 3BSSA 2ACKA 2FSVC 1P7CA 3F71A 4JI6M 3AUYA 3I2FA 1SXJE 5A2QS 2XV1A 3QTTA 2WHXA 1O58A 3DP7A 2NO9A 1V3UA 4OHZA 4FOSA 1SKAA 2VP6A 3AONB 5EMNA 1SG9A 3RS0A 4O2BB 2GM4A 1NLYA 4ITVA 2PXHA 4QASA 2ICAA 3H8WA 2QRVB 4B4VA 3QYEA 1BYIA 3AG5A 1G21B 4MCJA 1FBTA 3NWPA 4AJJA 3UMGA 4TS9A 3MYRA 3DMGA 1GFZA 4LQLA 4U7FA 3EPHA 5EJCA 4H60A 4M1ZA 5KOJA 1HEIA 3VPFA 2XB6A 4NOKA 4I5DA 5J4YA 1P45A 3OQIA 2MYNA 5BWOA 3H6HA 4Z4FA 3V8QA 3N2YA 4RK4A 3DLCA 3LS2A 4I08A 2EO2A 4GPZA 1X80A 3PD7A 5SYMA 1EUDB 4J6EA 4LXUA 2J7NA 2W2KB 2CL6X 4F1IA 2OWEA 2JIRA 1GSHA 1JHPA 5KSPA 5K0BA 3E70C 1AHIA 3B2NA 1N3YA 3U1VA 2IV3A 4YP9A 4UCWA 2AJTA 1L3IA 4UMVA 3DMNA 3QSGA 1CYEA 3C1UA 1RADA 2PEZA 3WGKA 1WTCA 4CYMA 4QYIA 2AN4A 5C3MA 2GASA 3SN6A 5D5PA 3D2BA 2Q1UA 1C0KA 3DF7A 1UWKA 4B1FA 5JAUA 4TLEA 1XVTA 3LL4A 2HK8A 3O91A 4JLKA 3TGPA 2IRWA 2A9OA 3L8YA 2UYCA 4INAA 2P6RA 2FS1A 4LCEA 4WNCA 1QO7A 3UM9A 2JJ1D 2OO5C 3F5DA 1G6OA 4RQBA 1PO7A 1U2DA 4BV9A 4LE2A 4YP1A 1ZQ9A 2PIDA 2OENG 1DOZA 3USES 5JAIA 1XD9A 1K7EB 1R5BA 2ZIZA 4JJ6A 1D0IA 1DELA 1CLEA 4JLAA 1AXRA 2ZVJA 5CGQB 1AK9A 2W82A 1P73A 2PA3A 2FX3A 1I1HA 2HHCA 5COQA 5KOIA 4PEVA 5L3SB 3RG2A 4RDHA 1CUGA 4TWBA 1UOQA 3ZY3A 2OCBA 1TFUA 1J8FA 3EOZA 4NS4A 2DOKA 4UNRA 1N3LA 1CQIB 4GRIA 1CPYA 4Q7MB 3L0DA 1KY5A 3GBVA 4RKQA 2QR2A 3LC7O 1BH2A 3AJAA 2VO1A 3CRQA 1BRTA 3I58A 3MGBA 1U02A 2QVGA 1SD5A 2PQ0A 3VJMA 1PDVA 1NQVA 2YDYA 1WZUA 2Q9CA 3RHSA 5GY7A 1QO0A 1NSYA 4PCAA 3ONWA 3QQ5A 1P5RA 4DDKA 4A8JC 2XX3A 1KQ3A 4TYPA 3RC7A 5AQ1A 2DX7A 4JI0B 1QQ7A 3ADKA 3D5TA 3HO6A 1G4HA 1M67A 3DMRA 1BQ3A 4EJSA 3ADDA 3AT1A 5LQCA 2C7QA 2O3UA 1G18A 3GFRA 1SUIA 5I7WA 2WPDD 1LTQA 4S0XA 3T52A 4MVJF 3WGOA 2WJ4A 2POCA 4PHFA 3KO8A 3GLGB 3KT0A 2WSYB 3FVRA 1KU0A 1OFHA 4JI8B 4TTAA 3T5MA 1AZSC 4URHA 4D9HA 4RTPA 2MJ5B 4NXNB 3IEPA 3OICA 4I1VA 4BN5A 3HHXA 5EWLA 2JFZA 3MERA 2O0JA 3TMAA 3KPVA 3W3AA 1OYVA 3T7EA 1SUBA 3EDOA 4DLVA 4F06A 5IWAB 2ZZKA 4RMGA 4EUNA 3UMMA 3C6XA 4WDRA 2Y4OA 2IXGA 4LXIA 2IVZA 3RB8A 3L79A 1PT9A 1VBFA 2CW5A 2ZRKA 2GBGA 1XVLA 1R0XA 2ZBGA 1DJQA 2MT9A 1QM5A 1T5IA 3F6EX 1IVNA 1PV4A 2HWUA 3WRXA 1S3SA 4NG5A 3IUSA 4HDSB 4AU1A 4B3FX 3PDUA 1DRWA 5IJXA 3DXZA 1GDDA 1N32B 2AUTA 4CKEA 2A92A 2B7LA 1WMSA 1Z83A 4L78A 3OUTA 3SS7X 2AYYA 5HE8A 3KZCA 4BQEA 4F21A 2DT5A 3LV8A 3ROGA 3U5TA 1MAHA 1UJNA 1C3OA 3M3PA 4JVNA 2PZLA 3D7KA 4FFPA 5I8ZA 2K7ZA 2CDCA 5SZKB 1UJMA 5AOCA 4CQJA 1YVUA 3IAEA 5E6RA 2E3JA 3I9V1 1FMLA 4KQIA 2B5VA 2OZLA 4MA4A 2H4YA 4CLHA 3VSDA 3VHXA 3KPWA 1L1TA 3FD8A 3T9BA 2EW8A 4MGZR 3TQFA 3D8LA 4HTFA 1Q92A 5JLJA 4CQMB 3G2JA 2WM3A 1U8CB 3DH0A 3UXHA 2AHMA 4XIIA 1VL1A 4H7DA 4BRZA 3FYSA 2W2XA 5AVWA 4B3SM 5BUQA 3M6VA 3VYTB 4D3SA 4B3TB 2QT0A 4Q48A 3D7LA 5JW6A 4BVHA 2XJ9A 4RF3A 1PQUA 4OXXA 3HJUA 1NE7A 2JL1A 3B1FA 2WSFF 1JYEA 3F8SA 1RTKA 1CY7A 4U00A 5G1PA 4C29A 3MJDA 1PN3A 5EIFA 2JFVA 3PE4A 1M1UA 1DX9A 1Z5BA 4BMZA 2WUVA 4JI1M 4OJMX 1CR1A 4QDKA 3JVVA 2JAPA 2YXNA 1TAQA 1E2IA 5HKAA 1WABA 2X5OA 3PF8A 1LNZA 2PUDA 1M1ZA 1NC1A 1DTSA 1ZD4A 3OP4A 2ON6A 1EFCA 1E79A 4RL4A 3J81A 4CQNA 4BVBA 2G0TA 3U3ZA 2ENUA 1DV0A 3WWEA 5K45A 4X65M 1XRJA 2CMKA 3PC7A 3V2IA 1RI3A 3EZ6A 3DSRA 3QFFA 3H8SA 3FY4A 2VWPA 5B6PA 4QEZA 3HYSA 4WXHA 2PKCA 3LCRA 1O94A 1U7XA 1EDDA 1YASA 2EFHB 3FFXA 4BMNA 1ZBDA 2GB4A 3CWCA 5CYOA 2FEWB 1MXHA 2W2MA 1M34E 4UM8B 5KX5A 2F4VM 2OD2A 2A6PA 2BFDB 4NJMB 4RVDA 2F2TA 2MU1A 3PWTA 3VR6D 2C5LA 1CUZA 4MLPA 2ZIWB 5EEGA 1O0SA 3RSZA 2YVKA 2V58A 4EVRA 3OOSA 2AFIB 3EGOA 1KI6B 3V7UA 3ND9A 4U7GA 1KDZA 4V02A 2WQZA 2A5JA 4BNNA 1RLTA 1DTWB 4HXYA 3JR4A 2X7XA 2Q6VA 4LOLA 2Q2EB 5DM2A 1MOPA 3RHZA 2K5UA 1T91A 1QRTA 2NO6A 3EVNA 3PNLA 3LVVA 5FTNA 3CW8X 5IDVA 4CG3A 5B4UA 2B2NA 5EKSA 3W1EA 1C4XA 3JAKB 3CCCA 3BJRA 3DV0A 1J97A 2FG5A 4MUJA 1C3XA 3SAJA 2EGUA 3OG9A 2X15A 1IB6A 2G63A 5LQDA 4R2LA 4BKUA 1UT8A 2ZWMA 4BKOA 4PG4A 4MW6A 1DKPA 4RJLA 4NHEA 3OJ0A 3AHDA 3FOZA 1TH4A 1KAEA 3HN6A 4RL6A 1PKXA 6PFKA 1GUAA 4I9UA 3PT9A 1JEYB 4Q3AA 4YO7A 1ZY2A 2KEBA 3I05A 4V39A 2E18A 1VE6A 1V96A 1TKAA 2AMVA 6YASA 1FFAA 1KHHA 2ZTVA 4U0JA 1CWUA 4CMGA 3K2LA 5DT9A 1JLSA 2PT6A 2VJLA 4X90A 3S2GA 3ELBA 1KYQA 3T9EA 4KXQA 4NK4A 3K16A 1HNZM 2WFLA 5AKLA 4D3YA 3NP9A 4IHQA 3LW8A 3PUZA 1LI7A 5ECGC 3IJPA 1XEXB 1L5HB 4ZGGA 1FSZA 1DT3A 4EW6A 3HDJA 3U19A 3F6RA 4D0SA 4HDKB 4GC5A 1CVLA 3BWXA 1KOLA 4I3GA 3IMKA 1IY2A 1SHKA 4NF2A 1V11B 2NUPA 3OCZA 2RC6A 4IGAA 4TMTA 3JYLA 1X70A 1L7EA 2A1UA 4P5DA 5JSZA 2WVJA 3RFTA 5CVEA 2IUFA 2VTDA 3M5PA 4ITRC 4CEHB 4L08A 4D5GA 3LCMA 1Y1QA 1GO5A 1MENA 2ODNA 2H2FA 5FR1A 3NVDA 2IE0A 4BNKA 2H2GA 4RV4A 4A2CA 3VVBA 1RLMA 2VHCA 1M8PA 3B3JA 4NPHA 2WF9A 4P33A 3C4QA 4X92A 2OT3B 3EPKA 3W7AA 2H5XA 1FFYA 5JWOA 5HMMA 2NSJA 1OPXA 3B6KA 1Z5AA 3PFKA 4BV3A 1R4MB 4W9NC 1OIPA 4BDTA 5TF4A 1Z5UA 4HGOA 5JSYA 1OFUX 4QO8A 2FUG6 4MW5A 4F72A 3NP7A 1GSIA 3P9QA 1Z15A 3QVKA 4UEWA 2VNSA 3E3LA 1BXGA 1S4QA 3D7RA 1L6IA 1VE3A 4EY7A 2FPKA 1G6KA 1QIMA 1RLIA 2JH8A 1I94M 4Q3LA 4G0UA 3BS4A 1YRAA 3SJUA 1QG6A 2LDXA 2FWAA 1V71A 5BWCA 4F04A 5CTJA 3ZDYB 4A0HA 1SPBS 4PN3A 1ISFA 3IKJA 4G0QA 3Q3HA 5ISMA 4FOTA 1ISGA 3RYTC 5K0SA 4OXKA 3S7ZA 4CISA 2VXCA 1T4GA 1T0IA 3PGVA 3A1WA 3RFUA 4ARIA 1RI2A 3RJ9A 5LU8A 3H2HA 3OTOB 1SVLA 4Z51A 1VBMA 4NZMA 4CL2A 2XMRA 3O84A 1M1NA 3N8KA 3V3KA 1XQ9A 3ZHQA 1AJEA 4FKBA 1PQ4A 3W3ZB 2AI1A 1Q6YA 4GYKA 1T4MA 4NU6A 3QM1A 4B80A 2C04A 1NR7A 1QDEA 1W34A 3E7WA 3N2KB 2Q1YA 1HRKA 3NPAA 2G88A 4RHUA 1AD2A 3WGMA 5EUCA 4QJ4A 3A4YA 4EFMA 2RHWA 2CLMB 2YDXA 3MSCA 3C24A 2NUAA 2O5RA 2HREA 3JAWB 1NUAA 4ONEA 1IUKA 4JP5A 4O59O 3AVTA 2J4CA 3KB1A 4PANA 1HDRA 1N6KA 4EG4A 4M55A 3O3NB 2COEA 1YZYA 3Q9SA 4GQAA 4O4LA 3DL4A 3GMIA 3WYDA 3EN0A 2E49A 3NKFA 1OZAA 1NJ1A 3V3TA 2XUZA 2A0KA 3Q40A 3MD0A 5E4TA 2Q8NA 5JSFA 3FNBA 3FRJA 1IJEA 2VJBA 4HAIA 3K5PA 1R10A 4WKNA 4FHGA 4C2UA 4WDQA 1PFWA 1E9FA 2AK3A 3QLVC 1CJVC 4LSGA 4QHTA 2DLCX 1G64A 1NM5C 1P4HA 3IX7A 4ESHA 1X74A 4MRSA 1EIJA 1A82A 3RVKA 4Y6OA 3PIDA 2A0UA 3TS1A 4EAAA 2AMLA 2IPXA 4M2LA 3I4FA 4WCDA 2NZJA 4KI7A 4KXMA 2E82A 3BFKA 1SVIA 2ODEA 1D8AA 3Q8KA 5DN6A 5JH7A 4YRLA 3SHQA 2BFWA 2R7NA 1QPBA 3OIFA 2CFIA 5DI3A 2Q62A 1GGFA 1IY8A 3TE6A 3ROXA 3OM8A 2FDXA 4TV8B 5JECA 3P5BA 3E3OA 3L84A 3R5FA 1QQTA 5ITUA 2C78A 4BNIA 3O2NA 2YV2A 3E5RA 1WXXA 4XUCA 3G7SA 2ZTSA 2FN7A 3ONEA 4YPVA 5ICCA 1ECGA 3CVVA 1L5NA 3ZGYA 2JZ0A 1A8SA 3H9EO 2RGGA 4DR4M 3ZHZA 1F3OA 1U5CA 4DA0A 3HR8A 2FZWA 4TTSA 2P68A 3J80A 2AX4A 2AGVA 2C84A 4LJKA 1QYWA 5DXFA 1DQNA 5TS3A 4GOXA 1CZKA 4R0VA 3AKZA 1WW3A 5ED0A 5E2BA 3W6ZA 5C1OA 4ZYYA 4ZO6A 3R5HA 4P3NA 1JB9A 3EDRA 4O4HF 1FP4B 5D6OA 3BB4A 1ZNQO 2G9UA 3WK8A 3SHGB 1F20A 4CMIA 3QP9A 1CRLA 1OC4A 3IAS1 2L09A 3C6BA 3RSSA 2F1RA 5LJIA 3UGQA 1KIMA 3WQSB 1WETA 3IDZA 5D5HA 5JO9A 1C5KA 1MO4A 2ZRPA 4DLWA 1R8QA 3MAGA 4U6NA 2R45A 1DBIA 4AO7A 3KFLA 1E3WB 1PZGA 2HWJA 2CXRA 3RM3A 5BSVA 3NS7A 5A9TA 1I3OA 4C4XA 2I1LA 2WJWA 3PQ5A 1BDHA 3KALA 2EKKA 1L5MA 1RNLA 4AKIA 3A6HA 5A3JA 2C5RA 4PTZA 1B3BA 2GPNA 4RVOA 2M2IA 4JBYA 3JQ9A 4G4GA 3NNDA 4Z1OA 3VLFB 4PW0A 3OZRA 4Y0NA 1DEOA 2VZ9A 4JOBA 4ID3A 1BWQA 4DCJA 2Y99A 2ETXA 2NTJA 3PA8A 5HFAA 3OSZA 4DVJA 2Q6KA 3LY9A 4EYEA 1WNTA 3SBXA 3VOAA 1BOFA 4OQYA 4JHLA 4DBLC 4PIPA 5IUJC 4NULA 1P5JA 3D43A 3T1HM 2VHJA 4WNYA 4HJRA 2VWHA 3TKLA 2OGWA 1M2VB 1ZUWA 1Y4UA 4ID9A 1JG3A 3ZXUB 3CPHA 2XFTA 4ENUA 3C1AA 4BLVA 1Z16A 1L1ZA 4JI2M 4II7A 1DUIA 1Q16A 3BTUA 5EA2A 3OA0A 5JBIA 1KO4A 4C4OA 4M7PA 3E05A 1GRCA 4PAWA 3N7TA 4RHXA 2GXSA 5F64A 5E1DA 2VSNA 5HKOA 3QE4A 3KLOA 1VL0A 2ZBKB 4J0EA 2ZTMA 3PQ8A 1CZLA 4LS3A 4ZT4A 3IE1A 4RS3A 4GZ3A 4K3UA 4HNAA 3DE0X 5IYZB 1EX9A 1X9IA 1Z28A 5GQSA 4IX1A 1IZ9A 2ODWA 3LRPA 2PTHA 4GNRA 5EP1A 1IBLB 3T1VA 4EBBA 3SJBA 2HCFA 5DMXA 4LHSA 1ML4A 3SXUA 4B74A 3U4CA 2APJA 3SKYA 1REQB 1HLFA 4Y9RA 3AI3A 5T6MA 4EW1A 4WA7A 1VCNA 1FMFA 2OCLA 2Z5GA 4QJ5A 1B0UA 1NJGA 2JLBA 1W2WB 1P0MA 3THWA 1KY3A 4QYWA 3UPTA 1OTYA 1MABB 4RD4A 4I4TB 1YDMA 3HBMA 3TSOA 4U9UA 3G8AA 3MCTA 4M36A 1ZOLA 1SVUA 2PSEA 5EZ5A 3KJZA 4OLBA 3AFMA 3TQIA 2XXAB 2EWVA 5FPYA 4CNBA 3U7RA 3CZPA 1Z8NA 4XGRA 1PI3A 5H83A 1YHYA 4M1TA 4CMJA 5DYWA 2HMTA 1VYVA 3ZZMA 5IASA 3LBHA 4Q3CA 3K7EA 2GAAA 2YOHA 3HRIA 2ZWIA 4O2AB 2PO7A 2QUJA 2B78A 2QZ9A 4C4ZA 5K05A 3EYWA 5KTYA 4FHZA 4EH1A 3ODGA 1ZXLA 1WSAA 1LC0A 3BQNB 4ZCQA 4WOCA 3RBVA 4ML3A 2FW7A 3KYDB 1SM4A 1A9OA 2XODA 1EE2A 5U4XA 1Y5RA 4NBSA 3K53A 2OHJA 2C0QA 2JDIA 1MRZA 4OF4A 1GKLA 4BFZA 1UPXA 2QMYA 5FOTA 1E3EA 4RD3A 3LLVA 4H35A 1H3FA 1MJNA 3BZBA 3RE8A 4N4AA 4ECEA 3KJHA 5FFNA 5K8CA 2F3PA 1BCSB 3HDVA 1Q1QA 2XRZA 3QEMB 2UZ1B 3CNOA 3GFVA 2YINC 3QFCA 5T3UA 1UXKA 1JYFA 3I2IA 1NFFA 3KTFA 3U4QB 4FC7A 4FMDF 1I0IA 3MCAA 1NL3A 1GKIA 4BGVA 2Y1CA 5EERA 5JFTA 1AVTA 1W75A 5EPUA 4YV0A 3R9XB 2GBLC 2DKOA 1SA0B 1ISHA 5TX7A 3FVWA 3LNTA 1SBIA 3GCZA 1ZGHA 3VOSA 3SEZA 3ZWKA 2CKMA 1NHGC 2H0QA 2XE8A 1WCXA 3OM1A 2X5JO 1XNQM 4H4DA 2JLZA 1ZUHA 4JI4M 2WSIA 5GZ1A 1LU9A 3MOGA 4B7ZA 4Y1GA 4W63A 1MTOA 1TJNA 2QPLA 4V0QA 2P6MA 3DBOB 4ZT2A 3WKAA 3M5DA 3VC3A 1QVRA 3HUUA 3WC4A 2BEVA 3NIBA 5E7IA 3W5DA 1XROA 4AZFA 3D6TB 4NCBA 4BPBA 1GAQA 1VQ1A 2D3TA 2X4AA 2C4TA 3CN9A 5FAKA 2DFVA 5DLQC 3GPCA 1NJ8A 1P2DA 3H17A 4WQMA 1FUKA 3GHHA 1V8ZA 3U6LA 4CTMA 1UOOA 4PG5A 1RWOA 4QARA 3SAVA 1LW6E 2QNBA 3O03A 1HDZA 1E9EA 3H1AA 3EXEA 3A9WA 4BNMA 3UYLA 4DM7A 3BXXA 5BOSB 5EFOA 3RVMA 2O3RA 3O1JC 2VHUA 1TUBB 3K4QA 3LXRA 4C21A 2I66A 3MINB 1PSWA 4H3KB 7AT1A 1FMTA 1B42A 1ISIA 1BZYA 2QUZA 1XOIA 3Q8LA 1GXSA 4U3JB 5IX8A 1NQXA 1XTQA 4HFRA 1AZWA 2DR2A 2XWPA 2WM2A 4Q6BA 4RYDA 1ETHA 3H1BA 2VYNA 4P7JA 4TL7A 1E3JA 2AR7A 1XI2A 4OB7A 4AJ2A 1OJ7A 3DCNA 1C8VB 4GSLA 2VPYA 1EA7A 3ZZ0A 1GZ3A 1K08A 4ZREA 3EGDA 4LHXA 4O1MA 1M75A 4IMPA 4AZWA 1R5JA 5LUBA 6CHYA 2XB4A 1MLDA 2X14A 4N8SA 1SU7A 4FYXA 3TXXA 1WMDA 3INRA 3SIPA 4ICIA 4PHTA 3N0VA 4GC9A 1V7PC 4RMNA 3C3DA 2G07A 1C2YA 5BQ5A 1DINA 1NVGA 1R0WA 1OLOA 4JLBA 2IP1A 2AWNA 5LMCA 1L7NA 2PGDA 2FQWA 1V43A 4KSCA 1DADA 1DC4A 2J1LA 4CUKA 5DGDA 1XAGA 3HDGA 1DQSA 1BDBA 4JUDX 5DHUA 2H51A 2OO7A 1D3AA 2O8CB 3AJDA 3REOA 4MHTA 3SZMA 2P8SA 4P82A 3OIVA 5HX7A 5T64A 4RF2A 1VL8A 1RBYA 1H0HA 5EVJA 4U6QA 1W88B 5T3YA 3A46A 4UZFA 2VCEA 4WE3A 1CUWA 5KJCA 2I7TA 3AOEC 4CIVA 1D7AA 4TQGA 5CA0B 4K9SA 3LXMA 4X3OA 1KWGA 3ASYA 2REOA 1WGLA 4B6JA 1Y5IA 1SB8A 3MRXA 1EMDA 4MJLA 1DAFA 2BL4A 3FCUB 4EA7A 1XMQB 3MEQA 4BGEA 4LGMA 4RKRA 1L4LA 1KI1A 4I8OA 1G6HA 3S2SA 2HI0A 4B3IA 3V1KA 4X7MA 3MTDA 1OQYA 2YJ6A 2D7CA 2X8JA 4AI6A 3TI7A 1JE0A 3QPBA 3N6VA 5DWVA 4RV9A 3KPYA 2SKEA 2E7ZA 3DHWC 3N6XA 4BATA 4EGFA 3EVEA 2BISA 2JFWA 2G28A 1W1IA 1UKCA 4M38A 4FT4A 5ITWA 5FCDA 2YJZA 3KOZE 4TXNA 4OXQA 2QL5A 2G9NA 3UOGA 2KRKA 1DEXA 1ZJ4A 4DBZA 3FMVA 3FNFA 4DB4A 3PXXA 2ZYGA 2J59A 4YY3B 3E5MA 1NP3A 3OT5A 2OBFA 1Y5MA 2QVXX 4ZHQF 1RJFA 3EIXA 1P44A 3RVRA 1SWVA 1X7HA 2OGTA 3MD9A 2OO9A 4QU5A 4IQ8A 2OBYA 3PUHA 4HV4A 4AFNA 4I14A 2JVKA 1MORA 3RUHA 1E4VA 1CS4C 3O2JA 2F4NA 3E21A 3VTZA 5EP3A 1Q2XA 1JWAB 2RCYA 1EE9A 4NICA 1OA1A 1R3DA 3WLHA 3F5QA 1UBTS 5DTIA 4EA6A 2GHRA 1UJ2A 2I71A 4PFKA 4OLFA 5HA5A 3GNQA 3RDPA 4ZT6A 4N3NA 1VEJA 4WP2A 1Z7WA 5I7UA 3TM4A 3VVCA 1Z4KA 1QAMA 4M1WA 2NUBA 5HCNA 4E7OA 2M6RA 4TN5A 3LKDA 1GZ7A 1RJ9B 3MWJA 4I36A 4E08A 2EATA 2OL4A 3J7AC 1V33A 2X1VA 2X0JA 4LG1A 3N74A 3ZIAD 1JS1X 5CNIA 1SIWA 2QTVA 1B15A 5EKTA 2IXBA 4UPEA 2GJ4A 2F8TA 5G3YA 2HPAA 4FONA 4KITB 5KNDA 1B0PA 1FRNA 4G2TA 5K9ZA 5AJVB 1YQ9A 4MGKE 1HE5A 1IG0A 2E4XA 3A2KA 3T1QA 2ZFUA 2ZGVA 2QYSA 5K3OA 1H1TA 3SZOA 4XVQA 2XCQA 2QMHA 1PWZA 4X63A 3IUBA 3VR4H 5CUQA 1LVGA 2B0CA 2ATIA 2NG1A 2GF2A 1R0KA 5CA1F 4J43A 5DBEX 4HDMA 4ZO9A 2VZ0A 3EASA 2Z04A 4AYWA 5CT6A 3B6MA 3RQIA 4ER5A 4UFPA 3EF3A 5HIKA 3DONA 3T61A 5JI2E 1KS2A 1GY8A 5M3BA 1K27A 2C0PA 4RVCA 1W29A 1IXZA 1JDTA 3TLKA 3OT4A 2JCYA 5DO9A 2OKCA 3TAHA 4ZAZA 4YJKA 2QORA 5KTKA 1LNQA 1XVIA 4IWXA 4QQ8A 4U8GA 2ZIFA 3LBFA 1B16A 3LGXA 4QWMA 4JB0A 2WVHA 5FULA 2NU6B 3TD6A 1OAKA 1M8KA 1GGNA 3EQ8A 3PXCX 1JSXA 3NM6B 3IQFA 3A2LA 1TF7A 2RHRA 1QHFA 2PT9A 2XUDA 2Z2YA 2OHHA 2X7JA 2XECA 5E2IA 3FVVA 3RFFA 4ZI7F 3WZLA 4OU5A 2JJQA 4NEHB 2I3BA 1UKEA 1CRPA 5I45A 3ZCUA 2EKBA 5IPFA 4AAYA 1Q1ZA 2ZOSA 2O7QA 3HY6A 2BFBB 3ND7A 1A7KA 3CIOA 4H59A 1L9KA 3KSDO 1NKSA 1GR1A 3Q8XA 1S3GA 4WBXC 2O0MA 1QFYA 3C74A 4Q21A 4JEUA 1TNDA 1GA1A 3ONFA 4FE3A 1SZCA 1MGOA 3DPIA 4PWZA 4ZGBA 5P21A 1DNPA 4P9NA 4HOYA 5IC4A 1BX0A 4D0NA 5CEFA 2WSMA 4B6SA 1QGYA 16PKA 1OH7A 4J0HA 3FPEA 1PZXA 1Z2NX 4FYYA 3G9UA 3S40A 5K51A 3D2AA 3BGDA 1OLXB 3TN7A 1WIWA 4GWKA 1P1CA 2CWWA 3Q7EA 3RC1A 3HA7A 1RXEA 2CL7X 1Y48E 3FKJA 2EZUA 4ZMRA 1C7ZA 2X4LA 5AK5A 4LDQA 5AK6A 2C1XA 3TLYA 4UHDA 1M6EX 3L05A 4DA6A 3FZYA 3AY7A 3U5ZB 1OXSC 5FSWA 2Z08A 4Q4AA 4G37A 4LWPA 5TPWB 4UTRA 2B7BA 1FQJA 4KXWA 1WVGA 3C3BA 5IJ0A 1T4CB 3QVJA 1UQTA 3GEMA 1P81A 4HP8A 2MR9A 3IUJA 3MWFA 4BNWA 4BECA 1P75A 5L7TA 3GEHA 1NQUA 3PFFA 4KE8A 1XTIA 3TRDA 4EHLA 2F3RA 3CF0A 2F5QA 1XPJA 4KR3A 3G0GA 3A4VA 5B7QA 5DGTA 1JKMA 3BMCA 1V37A 5J5AA 4YJGA 3KNZA 2D7DA 5CAEA 5JI3E 2YJNA 5LNK1 5LKAA 2ZYDA 3DFMA 1QIKA 2O2HA 4L3OA 3L27A