1VQ1A

Crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
266
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords N5-glutamine methyltransferase, HemK
total genus 84
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vq1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vq1A02
2EKFA 5DX1A 1INLA 3KPVA 1XXLA 4HSGA 5CCXA 2VP3A 1JQ3A 2YVLA 2ZIFA 3KPWA 3Q7EA 4RTMA 2Z6QA 3KR9A 3DLCA 1JR3E 3BWCA 1H1DA 2OY0A 2Y1XA 3MERA 3ER9A 3GU3A 5LQUA 1R6AA 3K6RA 2CMHA 4FR0A 3FTEA 4FZVA 3UJ9A 4DMGA 4HTFB 4LG1A 2XYQA 5IH3A 2R6ZA 3AY0A 2ZSUA 3LPMA 1SUIA 2I6GA 1ZMUA 1R8YA 1M6EX 2PWYA 3BWYA 3FUXA 3NW9A 2JHCA 5DM1A 2FYTA 2QSFX 2OZVA 2FCAA 3VYWA 4DCMA 2C7RA 2H11A 4M36A 3GO4A 5KQRA 3HVHA 2JZ0A 1SVUA 2Z6UA 3PX3A 3R24A 3A27A 4PYLA 5K0NA 1BC5A 3A4TA 2P40A 3HA3A 5FWAA 2PVCA 3CKKA 3BGIA 5FA8A 2UYCA 5E9JA 1VEGA 3SMQA 1UFKA 3UFBA 1OQYA 5DXJA 2YTZA 2HWKA 2P8JA 2JG3A 4CXMA 1VG5A 3HTXA 4PCAA 2HV9A 2JJQA 3NJRA 1JG1A 1HT1E 4XCXA 2VZ9A 1MHTA 1VPTA 1NW6A 5F2NA 3SSOA 5BW5A 3FTFA 5ICGA 1RI2A 1AQJA 3T7TA 5ICEA 2XYVA 3BKXA 1N7JA 5GWXA 1G8AA 4RTOA 3KQMA 3NTVA 1VDLA 3FRIA 2B78A 3OFKA 2DAMA 2FRXA 4AZTA 5EVJA 3P2EA 2CP8A 3PB3A 1YUBA 1BOOA 2IFTA 2VDWA 3CVOA 5DTQA 1A5TA 2FHPA 2P3LA 3A25A 1FP2A 1GO5A 1JTEA 1O54A 5T6BA 1JTFA 3VC1A 3HA5A 3P71T 2PV0A 3RODA 4XUDA 3MQ2A 2AZTA 2O0LA 3SSNA 4RTQA 4R6WA 2NP6A 2EJUA 5DSXA 3EVBA 1DO0A 2K9DA 2LVOC 1DO2A 2KNZA 3KQVA 3B5IA 5EEHA 3IHPA 5ICFA 4JXJA 2ZZMA 2ERCA 4GQBA 3LCCA 3PLAE 4M7RA 4KDRA 2ZTHA 1QAOA 3HCFA 5KQSA 3EGVA 2B3TA 3K9PA 2P1DA 3E21A 3PS9A 1MJFA 5K0CA 1WGNA 2OO9A 3HCBA 5DM4A 3LECA 2WZJA 1UFZA 1WHCA 4F2LA 2XVAA 2IH4A 3MHTA 1YZ3A 5BXYA 4PINA 3LCVB 2IP2A 3GLHE 3SXJA 2OYRA 1G3IA 3OZTA 4BP3A 2UYQA 3C0KA 1NT2A 3ORHA 3E23A 1NW8A 2LTUA 2PWPA 4RYLA 3LDGA 1L1EA 3CGGA 1D2GA 5CD1A 2PKWA 3PFGA 4MIKA 1TTEA 2IH2A 2H5XA 1IM8A 3DXZA 3ME5A 1I1NA 1NV9A 5E1DA 5E8JA 4ATNA 4DF3A 5HIKA 2WA2A 3BUSA 3D2LA 3G2PA 3MTEA 4GC9A 3A7DA 1P3QQ 1Q0TA 1D2CA 2QE6A 1RI3A 3KQWA 4CTKA 4UN2B 1EG2A 2DHYA 4RSRA 2QRVA 2OO3A 3REOA 2PJDA 3G89A 1QZZA 5DFLA 3AJDA 3GJYA 4C07A 4MWZA 5EHGA 5JUWA 1F4IA 1L9KA 1JSZA 2B2CA 2OOAA 2QY6A 1O9GA 3M4XA 3THRA 5ICCA 4AUKA 3VC2A 5EMLA 1WXXA 2KNVA 2AOXA 3GDHA 4OA8A 4V0RA 1M6YA 1ZG3A 2IDJA 2PX8A 4R8SA 1SQFA 1G8SA 1XDSA 2FPOA 1IFYA 1P39A 3GIWA 5EIWA 5B1SA 1EAMA 3BT7A 1RI4A 2YXEA 4GBED 1Q02A 2JY5A 5EQJB 3EVZA 2OXTA 2WK1A 1WY7A 3OU2A 2EJSA 3EVFA 3OU6A 2IH5A 5DX8A 1VL5A 3UWPA 2NXNA 2XVMA 3EEYA 1RJDA 3DOUA 2AN3A 3IV6A 1XDUA 3FPEA 4KW7A 5LSAA 3KHKA 1RJFA 4CKEA 3G5LA 7MHTA 1KYWA 4UOEA 2R0IA 5GINE 5HILA 1X1AA 2AN5A 2NYUA 1IM2A 3M6WA 9MHTA 1Y8CA 3HCAA 1L3BA 3LDUA 3FUTA 5KYGA 2FK7A 2B9EA 3FUWA 3M70A 3CJTA 4QDJA 3O7WA 4QPNA 3LL7A 3M6UA 3NWBA 2NNWB 4C06A 3GXOA 5LQKA 1E94E 5KS2A 3O31A 4IV0A 2PT9A 1T43A 2G3QA 2OPBA 2P7HA 2LD4A 2YX1A 3OPNA 3Q87B 5EOVA 2IIPA 5FTWA 3UJDA 4C08A 5DLYA 3FTDA 2BH2A 1T6OA 3G2MA 1G55A 2PX5A 5FWDA 1HNNA 2DAIA 2ZWVA 3ELDA 3GWZA 3LX6A 4KWCA 5DRTA 4P7FA 4DM3A 5HZMA 5BP7A 3ERCA 1KPIA 1WGLA 2OBFA 3C3YA 5E1OA 1EFUB 4R6XA 4YV1A 2DZLA 1Q0SA 4YUYA 2KW5A 3ELUA 4U7TB 3EGIA 4EKGA 4RTKA 1BVSA 3ELYA 5DM2A 3LHDA 3P9IA 4YUZA 4X61A 3K0BA 2NXEA 1G60A 2BWBA 3KQQA 4E2XA 4F85A 4ZTBA 3BGDA 3R9XB 3P97A 4PIMA 3CC8A 1XXHE 3NDIA 3UJ6A 3EGEA 2PLWA 1SG9A 2EX4A 5E9WA 4MTLA 3R3HA 4QTTB 5K0GA 5M5BA 4DA4A 5HEKA 4YMHA 1VIDA 3FTCA 2NXJA 3UA3A 3DULA 4QVGA 5FHRA 2OB2A 4GOMD 4KVZA 4QPPA 5LQRA 3HNRA 2I9KA 2ZIEA 1RJEA 3FPFA 4ER7A 3IEIA 4WXHA 2OKCA 5P8WA 4RTRA 3UJ8A 1OR8A 1YZHA 3G7UA 2QNJA 3R0QA 1ZMWA 3R6TA 3VSEA 4DZRA 1U2ZA 1KR5A 4MQ4A 2MR9A 1BKYA 4CWAA 5HOQA 1AV6A 2AN4A 2G72A 4V0QA 4X60A 5K0BA 3JWGA 2DAEA 1RJGA 3I64A 1P1CA 1XCLA 1ZQ9A 3FUVA 2AOVA 4XUCA 1HQYE 3K9OA 3FE3A 3B7PA 1QZEA 2GA9A 5K05A 1AQIA 1OKSA 4KIGA 3BXOA 2PSSA 2AS0A 2PXCA 4WVLA 3T0IA 5HFJA 5BW4A 3HA7A 4BLWA 4PONA 3GLIE 2LVPC 5CIYA 5EKXA 5GM1A 2DENA 3OCJA 1QANA 5FADA 3EEOA 4PYJA 4X63A 4YUWA 2ZBRA 3LDFA 5K03A 1NKVA 5T64A 3TPZA 1KYIA 3FPHA 4BP1A 5EGSA 4ER0A 3PTAA 5DTRA 3P9CA 3ELWA 2PX2A 4ISCA 1KPHA 3HP7A 2P3QA 4K6MA 2PX4A 4RVGA 2LVQD 5EZQA 2BZGA 5GM2A 2NP7A 3BGVA 4A6EA 1PJZA 4E31A 1P91A 2YUIA 4OBWA 3SGLA 5LQNA 4PCLA 3TKYA 2BR5A 2WA1A 3EMBA 1YFLA 2Z6AA 2P3OA 2MGWA 3EVCA 4LWPA 2GB4A 1UIRA 2N47A 4O29A 1I4WA 2LVNC 2ZULA 3QOXA 1JG4A 1VE3A 4QQKA 5CUQA 3MCZA 1OAIA 4E70A 2IPXA 2ZBPA 3EVGA 2BWEA 2PY6A 3NVMB 4RTPA 1M0EA 4EVIA 4GOOD 1EJ0A 3P2KA 3U81A 3KR0A 3V8VA 4G56A 3RIEA 3O4FA 4YMGA 1R00A 5K0FA 2I62A 3FZGA 3GRZA 1WJ7A 2YXDA 1NBHA 2YQZA 3T7SA 1NW5A 4HC4A 5FHQA 1XVAA 3UBTA 3SVZA 1SKMA 3T6PA 2ZZNA 1ZGAA 2JHPA 3MTIA 4IKPA 2YR0A 4IV8A 3KR2A 3QV2A 4DQ0A 4C03A 5K8VA 2PT6A 4DBGB 3G2QA 1G6Q1 3GNLA 3HVIA 3UZUA 4KDCA 2VDUE 5LQJA 1KP9A 2ADMA 2F8LA 3EPPA 2JY7A 4P7KA 1KYZA 5EMJA 3MB5A 4QQNA 5DWQA 2VDVE 4RVHA 4Y2HA 3I5UA 4GEKA 1VP9A 4C05A 3FUUA 4GF5A 1VLMA 1TPYA 1AIPC 4BY9E 2HAKA 2JP7A 1FBNA 1RI5A 4NECA 2HMYB 1R18A 1G41A 2ESRA 3C3PA 4IWNA 3G88A 4M38A 2ZCJA 5DX0A 5GIPE 4AZWA 3JWHA 2C7OA 5CVJA 4QDKA 5FA5A 3UJBA 3DXXA 4HG2A 3EVDA 3LBFA 4OBXA 1O9HA 4GC5A 1JG3A 5T67A 3IECA 2P7IA 2ONYA 2ZW9A 3KPUA 4HTFA 1XCJA 3WSTA 1CUKA 1EJ6A 1B42A 5C1IA 1KXZA 4E2ZA 1HMYA 1KPGA 3M33A 5FULA 3SX0A 4E30A 2L2DA 2DNAA 2AOTB 3HM2A 3I9FA 1X1DA 1N7IA 3OZSA 2ZTDA 3C6KA 4M37A 2LBCA 1AF7A 2KHHA 2BR4A 2CL5A 1ORIA 2JH9A 2O07A 3KQTA 4X1OA 4E32A 4R8RA 3TLJA 3QOWA 2MJ5B 1JG2A 3NMUF 4FP9A 5EG5A 3PT9A 4FT4A 5U4XA 1G4AE 2QHOB 4HEOA 2O05A 4LWOA 1G38A 1EQAA 3E8SA 1DUSA 2ZIGA 3AXSA 4E2YA 2HR1A 5FUBA 4RV9A 3B3FA 3MAGA 3UA4A 5LQCA 3MGGA 4RX1A 2A14A 5HIIA 5F2OA 5DT2A 1Y8GA 3UJ7A 3GLGE 2UZ4A 3G8AA 2HNKA 2ONZA 5GIOE 4E2WA 1WG8A 2AOWA 1ZHFA 3TKAA 2K0BX 5E2AA 1JQEA 5D1HA 4WP2A 3NVKI 4F86A 5FQOA 2Y1WA 5E1MA 5EC8A 4OA5A 2LVAA 5CVVA 3ANXA 4EK9A 2QRVB 1SQGA 3CCFA 3TM4A 3F4KA 5CM2Z 2CKDA 2E5WA 2CMGA 3KQPA 5CVEA 3BKWA 3THSA 2O06A 3EMDA 1KIAA 3CJQA 3HCCA 1VQ1A 2H1RA 1JR4A 2G70A 3P9KA 1WXWA 4PGHA 3B3GA 1FPQA 4B17A 3DTNA 5K09A 5LQAA 2B25A 3P2IA 5D1NA 4PWYA 5ERGB 1ZKDA 2JZ1A 4YV0A 1QYRA 1NW7A 2O57A 2CWWA 3UJCA 4CKBA 2ZZKA 5K0JA 4EQZA 1HT2E 4C4AA 2JNHA 2I7CA 1DCTA 2DI0A 4F1IA 3G5TA 3RW9A 4OQDA 2BM9A 5K0EA 3LSTA 5E8RA 3DP7A 2UYOA 4AZVA 3ER8A 1IY9A 5EIFA 1WS6A 3L8DA 1L3IA 2GAFA 2K4MA 1PRYA 4F84A 5DM0A 1ZV1A 3TFWA 3A7EA 1R4GA 3TOSA 3TR6A 4R05A 5MHTA 2HTEA 3DH0A 5C9ZA 2IGTA 2ORED 2ZLBA 2FK8A 2EG5A 3KR1A 3KU1A 4X41A 2JY8A 4XUEA 2H00A 5EPEA 2BM8A 4EKIA 1UWVA 5EHIA 4AZSA 3PVCA 2GLUA 1NW3A 4PYIA 3E7PA 5DPMA 3F92A 1WR1B 3DLIA 3MCTA 4YUVA 3TRKA 3B89A 3IHTA 1I9GA 1DV0A 1MN3A 3LBYA 5E1BA 1DL5A 1NE2A 1X1CA 5JR3A 5EMMA 4RTJA 1PGYA 1XJ5A 2AVDA 2AOTA 3DR5A 2EJTA 2GS9A 1IXKA 2DAKA 1RI1A 3PFHA 3HEMA 4RTLA 3AWIA 5FCDA 3KPJA 1NV8A 4GEWA 2KNAA 1XDZA 1VBFA 4ER3A 5FQNA 4AX8A 3EVEA 5DXAA 3HCDA 4YUXA 2O25A 3EVAA 3KQOA 4KIFA 4FS8A 2GPYA 3ID6C 4YV2A 2ZVJA 3V97A 5G02A 2C7QA 2L4EA 3LCUA 3FRHA 4PGGA 4FGZA 4GUAA 3DXYA 4H0NA 3SSMA 3CBGA 1ORHA 3GRVA 3TQSA 1VP3A 4G3OA 2OOBA 1TW2A 2G1PA 5K0LA 1QAMA 4Y30A 4RVFA 3OU7A 4FT2A 2DULA 1ZGJA 4Q7JA 3GGDA 3KPYA 3OE4A 3LKDA 1YF3A 2DKLA 3GLFE 1WIVA 3BWMA 1D2HA 3GRUA 2XBMA 4PYKA 2ZWAA 5HIMA 4RVDA 5H02A 4RTNA 3NWEA 4P7JA 2DPMA 3E05A 4PYMA 5JI2E 2XYRA 4GOND 4L7VA 4CTJA 4FSXA 1JQDA 3G8BA 3IYLW 4KRGA 3GCZA 3SM3A 1QAQA 3X0DA 3S68A 5DTMA 3UJAA 3MMPA 2AOUA 4PYNA 4E33A 4LECA 2AR0A 3NDJA 4HRAA 4PNEA 5LR6A 4R71A 3DMFA 4U7PB 4PYQA 4QVKA 3P8ZA 2PXXA 2VS1A 3H4JA 1YLAA 4FSDA 4PYOA 5EZSA 4QTUB 4DCGA 4RTSA 1WZNA 2QM3A 1YFJA 1F38A 3B3JA 1R74A 3OZRA 4Z2YA 2JUJA 2GH1A 2ZBQA 4DKJA 1KHHA 3KQYA 1HJPA 2QYOA 3HVKA 3T7RA 3JWJA 3GRRA 3FPGA 3H2BA 2PGXA 1FP1D 5C0OE 3FYDA 2AOUB 2UYHA 1OTRA 1TR8A 2P41A 3LGAA 3TM5A 3BZBA 1C7YA 3I53A 4P58A 1V92A 4GOLD 4HGYA 1IXSA 4BLUA 2IDKA 2BR3A 5EEGA 3A26A 3KKZA 3M6VA 2G8NA 2P35A 5HIJA 4OX9Y 1JSXA 1VEKA 2Q41A 2C7PA 2JHAA 1L3CA 2RRUA 2DAGA 2JH8A 3OFJA 3E46A 4HGZA 5EMKA 1F3LA 2EFJA 3P9NA 4EMSA 2NXCA 8MHTA 3I58A 3AXTA 4RWZA 3KQSA 1ZMVA 1SUSA 1EIZA 1R8XA 4ER5A 3BBZA 4POOA 5EKUA 10MHA 2V74B 5E2BA 2IBSA 2G71A 3HVJA 4MHTA 2MROB 2IBTA 3PX2A 3DUWA 2JY6B 3G2OA 4HH4A 1Z3CA 3FYCA 1YB2A 2PBFA 3GRYA 3CJRA 5GP1A 5IKMA 5E9QA 1V39A 1XB2B 2CWBA 3SR4A 3JWIA 5K01A 2OB1A 5CVDA 5CVUA 4A6DA 1BHJA 3FPJA 3M6XA 5DRYA 4PIPA 1NBIA 5DSTA 4OQEA 5F2KA 4CKCA 1FJXA 4P7GA 3BWBA 2ZTCA 2R3SA 5CCBA 1X1BA 2ZFUA 2PXAA 3DMGA 2YXLA 4ER6A 1P1BA 4BLVA 3DMHA 5GOZA 4C04A 2V7EA 3TMAA 1TW3A 2HWJA 1XTPA 1VEJA 2AVNA 3HCEA 5KVAA 1N2XA 3C6MA 3OE5A 2EKKA 2L4FA 3LKZA 1X19A
chains in the Genus database with same CATH superfamily
2OD7A 2OUIA 4KJZA 5AW2A 1KYYA 2FPGB 2UUPA 1M5TA 1R6UA 3O1LA 5C35A 2DERA 2QG6A 1KI6A 4HAUA 3GT7A 1UJCA 5WRFA 3SIXA 4ZFNA 3RSCA 5BMOA 1SOUA 5A6VA 4FU0A 2GK3A 4NC6A 3E4CA 4YN3A 4IV5A 3FTEA 4FZVA 5A5VA 4ZTZB 3KZNA 1N0VC 1SUBA 5C4IA 5CLLA 4DEXA 2Z2IA 5ICMA 1UPBA 1XZBA 4MVJP 1EU1A 2Y1KA 5F51A 4D5GA 3TZQA 4MV5A 4NC9A 2Q21A 4LVCA 2QSFX 3E8XA 3HKCA 3JVIA 3GO4A 1T6YA 3FKJA 1IIBA 3GQ4A 1RQ2A 3EXG1 3Q2IA 1RWQA 4IGFA 4MSUA 3EOZA 4QUAA 3AEKB 1OBFO 2WE8A 3DCIA 4FCTA 3VYUB 3WYDA 3SDBA 5J2TB 1GILA 2QYSA 4TTIA 5MGNA 3BGWA 3EY9A 3NTRA 2QBYB 5F64A 5KKAA 1TM4E 1HGXA 3EX7C 1GCUA 3HWX1 2FZKA 2UYCA 2DT8A 1LNZA 1C4KA 1ML3A 3A1TA 2GTIA 3NUGA 3AM1A 3F2IA 1ND6A 2CN1A 3U6CA 1BXRA 3DE5X 3W3AD 4HVLA 1VPVA 2F67A 5LZ4A 2BKLA 4HQLA 4BGDA 2GPNA 1OCEA 1M0SA 1CB0A 4I1OA 2KB0A 2V3CC 3OTIA 4FMPA 1P29A 5GVRA 3SBJA 4XD2A 4C7KA 1QGDA 3IPRA 3SX2A 4JUAA 5JQWA 5AK3A 3DL4A 2W83A 3DDUA 4PNPA 4H1VA 3MYRA 4PZAA 1PGPA 2WLSA 2X8LA 3N07A 3UEOA 4YRQA 5JSZA 3H7AA 1X94A 3T7IA 4ZDWA 1I51A 1NG1A 1X80B 1A5TA 3T52A 3G82C 4EG7A 4UPEA 5E6UA 1XMQM 3IKLA 3I04A 2C5AA 5F77A 4HO1X 2LVOC 1P5FA 5AKLA 3LQYA 5DYWA 4PLTA 3FFTA 3T1HB 2I4NA 4XGIA 3COZA 2OL4A 3GT3A 2NSHA 2VO1A 3L7IA 2WZQA 5FR2A 3UH1A 2R6JA 3IPCA 1QQBA 3K9PA 5LQAA 3I2FA 4X9XA 3CCCA 5CAEB 2W2KA 2QMEA 4D3FA 4B46A 3HCBA 1RQXA 1Z38A 4RVSA 2XNCA 2Q3JA 3P9RA 1N6PA 2XTMA 2J7PA 4JI5M 2YY5A 3U80A 2BELA 1JECA 3MOGA 3HDVA 2Z57A 3C0KA 2WF9A 1AN9A 5FFFA 5HMLA 3E22B 3U5ZA 3W4IA 5FBHA 3LDGA 3CGGA 4W6QA 2NT4A 4P1ZA 2O14A 5G53C 5T3YA 3F97A 3VR5D 3BHIA 2VP2A 5B3AA 3GO8A 1FW8A 1J00A 4FW9A 1N2JA 2Q3HA 1SCKA 2JA1A 2REQA 1S8AA 2GHIA 2KJQA 4UBKA 4RKQA 1Z33A 2V7GA 4GBMA 2MCFA 2MSNA 3BUSA 1K88A 3ZDRA 1P3QQ 2GSWA 3FCYA 4ZODA 4RKUF 1G5PA 1UXGA 3KM0A 5F1PA 1TDZA 2BMFA 4NS4A 3STUA 1D3AA 3GDFA 1PN3A 4LSMA 4INPA 4CMEA 3WLHA 4I9FA 3NWJA 3V32A 5EHGA 3VZPA 2QY6A 1E8NA 3L82B 3WMFA 4X1IB 3THRA 1TK3A 5P21A 4AUKA 2HDHA 4Q1AA 2AOXA 2V55B 2WI8A 4QOFA 5LXTF 3RAFC 3CF2A 1ZG3A 2R7AA 5SZHB 3H5AA 2FFQA 5BMVB 4IIEA 5KWSA 1SRQA 2F5PA 3FYHA 5EQJB 4AKTA 1A9YA 1D6MA 4OHOA 3IV6A 3K1AA 1P5JA 4LN1A 5GV8A 3K16A 2VCYA 4PR3A 4ZWNA 3V9AA 1X1AA 3MJCA 3PSHA 4AJ1A 3KKEA 4K28A 4R68A 3T54A 2W4MA 4HUJA 2XD4A 4MIOA 3P52A 1I7SB 1RW4A 2W4QA 2Y4NA 3DT6A 1KI9A 3BCRA 1QC5A 3VNSA 2FWNA 1II8A 3V42A 4KO3S 4Z4QA 4Q7JB 5JFOA 3QNUA 3L40A 3GLGA 2W6NA 2YX1A 1ISRA 4I8OA 2D1SA 5HF8A 3UJDA 5C1OA 4P98A 4GKJM 1AUXA 2BHLA 3BK2A 4MCAA 4NV3A 1EFDN 4YALA 3F8TA 3GC6A 5LKRA 2G17A 3KRTA 4GS5A 1I10A 2HA5A 3BVPA 4IQ4A 1QP4A 1ONPA 1TMOA 1TTPB 1N5IA 1N92A 2HO5A 2YYZA 3D6AA 3H0CA 4OK5A 5M3BA 2DZLA 2QTVB 3RSQA 1H6DA 4IIWA 2UUBM 3FSRA 4U63A 2A9FA 2I4IA 3VKUA 4KQMA 3LPDA 1Z2NX 3PPVA 5CCDA 3TRHA 5M2QA 4BL5A 1G60A 3CUUA 3KQQA 4C4OA 2X5XA 3BGDA 3LW5F 3H9CA 3VYTB 2QV7A 1GQQA 2EX4A 4RHFA 4QTTB 4ZALA 3ZY5A 5B6PA 1E7WA 2R4QA 1AGNA 3HS3A 1ZMOA 1YQ9A 2IYYA 4XWKA 1Z07A 3IV7A 3OHSX 1M75A 3CE6A 1Y7IA 5JCJA 2WHEA 2NX2A 4MKXA 3AHIA 3P5SA 1EZZA 3M9LA 1J23A 5D3QA 2IV7A 2OCKA 1S2IA 3G59A 2OCYC 3ZHBA 5CP8A 4D4LA 3CO5A 4BNNA 1AV6A 4GYYA 4UVIA 3VJKA 1CJUC 4DE5A 4IYRA 1Q74A 2ZITA 2AHMA 6ABPA 2FMXA 4MQ5A 3OJXA 3GV0A 1Q57A 2C5SA 3LYUA 1R9JA 2PXCA 2Q1SA 3KSUA 3LYHA 1TADA 3TEFA 3QNWA 1G20B 5BW4A 3BXFA 2RHMA 3ONDA 3L7BA 2V7UA 4O1MA 4OI2A 3UB2A 2JJ1A 2HF2A 1NIPA 3AYZB 4BN4A 4NV1A 4ESEA 4PYJA 1GTZA 3C5WP 3LDFA 1E8DA 4X65B 4Q37A 5DP2A 4XSGA 2R48A 3EZFA 2YWJA 2V98A 4RHUA 4HAZA 5CM8B 4AX8A 2GNPA 4TPKA 3HKBA 3U1VA 3FZYA 2ODWA 3QLVA 5KSWB 3VPGA 1W36B 4KL8S 2QUAA 1H6AA 4QRDA 5BOSA 4OHWA 1CY4A 1E3WA 1QHHB 3VU8A 3PE4A 1PEAA 2GB4A 1UDBA 2HXYA 2P6OA 7CATA 2WTXA 4GITA 3MJRA 5ALTA 4EEXA 1FOEB 4YJHA 3U60A 1UK6A 3AGQA 3R7WB 4LQLA 3O75A 1E2IA 4KSBA 1RXWA 4BIIA 4HB4A 2VPIA 3AL3A 3I34X 4JJ6A 1LWOA 1BN6A 4HN9A 2SNIE 3EC2A 3AF2A 4B3MM 4TMTA 4J6EA 1GCAA 2DCUA 4Q7QA 1Q7BA 2JLSA 2C5RA 3I83A 3WO1A 1UINA 4YNBA 3KKPA 5FHQA 4F3YA 6REQB 1XVAA 2C2OA 5LBUA 1X7GA 5TMBA 3W5JA 4LRSA 5G41A 3V4FA 3QV2A 1EVLA 3AJRA 4RK1A 4DA6A 3H6HA 1N75A 5LL6P 1HZZA 4RUKA 3GMSA 4FK8A 3CVJA 1BVUA 1TJ5A 4A36A 1F0YA 1RIFA 1VMDA 3WL7A 2N0SA 1FU7A 1VLMA 3NS7A 1Z7WA 1AIPC 3O4JA 3R7SA 4FD3A 4TUWA 1LQUA 4U7GA 3SXPA 1BZYA 1G0OA 2WT8A 1NI4B 4AN4A 1FFHA 3BICA 3DQQA 4HWTA 4PRKA 1JFSA 1VG1A 2GETA 4UNRA 5JAUA 3WBFA 5GIPE 1R10A 1ZR4A 3T95A 4U2FA 5CB8A 2OFOA 4O2AB 3FTQA 5I8ZA 1JG3A 2W2LA 2WV7A 3LT1A 1DWUA 4K6CA 3DAFA 3VU9A 5KTKA 1NUTA 4OI4A 1E2KA 3T1HM 2P68A 1KEKA 2QX6A 1KPGA 1UJMA 3FGNA 3EBPA 5KNCA 2O1XA 2CXOA 4LMAA 4UM7A 3FMGA 4WW0A 2W2KB 1QG4A 2W6PA 3C6KA 3ZE9A 1VMEA 2J7PD 2GBLC 1NXQA 2HHAA 3W5CA 4KUHA 4LXYA 1ZM9A 2P4UA 2JGEA 3CWCA 4B3SM 1MC1A 1Q1BA 3NWOA 1FVXA 4D97A 2MJ5B 3N8GA 1Z4MA 2WSIA 5EG5A 1Q7EA 4URVR 1U6IA 2B4YA 1W29A 2XOXA 3BD7A 3OZDA 3W1WA 4O4IA 3E1GA 2EHDA 4E2YA 2KEBA 4ZO9A 4ZVVA 3TQFA 2PT5A 3OFVA 3HJHA 4M7OA 2I7DA 5AW0A 4OHRA 1UMBA 3K0KA 4BFTA 1O95C 2D2FA 3WLMA 4DQLA 1IN7A 3H2GA 3G3EA 3G8AA 4F2DA 1YNSA 2X1HA 1TU3A 1B0ZA 4B48A 1GGVA 3PZBA 5B1HA 2XE7A 2HOQA 2W8BB 3NVKI 1QOZA 1YO6A 3F6YA 1KERA 1H0HA 4LYFA 1FRZA 1HLFA 5FBVB 2TRSB 2EATA 2D1FA 5ES3A 3L05A 3QLVC 2BIFA 2YWEA 4LVUA 4U00A 3IAAA 5KWEA 3ABZA 2PMDA 2X0DA 1EX9A 1F4VA 3UPDA 2IXFA 1A1VA 4QQFA 1XNQM 3QHAA 1E59A 1Y9JA 4Q9AA 3AR4A 4XRGA 2C31A 2YWBA 4OFXA 4G4IA 1IBLB 4CQLB 4GM4A 1ZRMA 4TWZA 2OGSA 3PA8A 3PDIB 1U3GA 4CMBA 3KKKA 4B4OA 1EXMA 3K8QA 2O57A 3QF4A 2I3GA 1W44A 3BDVA 1WAMA 4LK3A 3G2LA 3S2GA 4EPWA 5J2UB 2OR3A 2XNSA 1HR0M 3C41J 1DCTA 2HA6A 5CXUA 1XT6A 2BM9A 3W1EA 4MUHA 3DCYA 4YGYA 1GAQA 1SCJA 1U65A 2W11A 4ZT7A 3LK6A 1S7GA 2JPDA 3NI2A 3TXYA 1Y6RA 1CUHA 2ODPA 1GAXA 2XX3A 2GRJA 4BLOA 4RL4A 2R46A 4RF3A 4CG1A 4B7FA 4LRQA 2H1HA 4DV0B 5LUBA 1NBWB 2JD2A 1AQ6A 1O89A 4P38A 3PFBA 2QE7A 3KOYA 1PK8A 2XI4A 4CMEC 2IYTA 3GCGA 3LZCA 4EKIA 3IDQA 2ODQA 1NLUA 1I0ZA 1P0MA 1XTRA 2GEVA 3I2KA 1WSAA 3L07A 2ZKLA 4FFDA 4IS3A 4EI9A 4DR7M 2BEVB 3E7PA 3H8WA 1O58A 1E3QA 3EXEB 1ZA1A 1SXJE 2EV9A 1HNZM 2H4YA 3K5PA 3M82A 4GGMX 5LZ9A 1N34B 4OLHA 2OXCA 1CUVA 4MV8A 1LFDB 1S2MA 1WA5A 2FZWA 1H5NA 3DTTA 3NBYC 4PX3A 2W6ID 3L92A 3CZ9A 4JBIA 3WLNA 3ZDXB 1CR0A 2RH9B 3MRVA 1KHTA 4A8JC 3UK0A 5D5PA 4PTLA 5TMEA 2KNAA 3BBLA 1V7QA 3KTDA 1T2DA 1ECJA 3FTNA 3WGLA 4HLNA 4LY3A 1EVIA 1N2OA 4BLCA 1WLYA 2DFLA 5HJ2A 2NTEA 5GOTA 3S70A 4H6VA 2G9UA 3NHAA 3IJEB 4P34A 1XEXB 4LV6A 5DHPA 5J5AA 1NQVA 1V9SA 2I2CA 2GNOA 3KSAC 2M1XA 2BH9A 4UNSA 3ETJA 2VTDA 4RIIA 4B09A 3IHLA 3IP6A 4MPJA 4TZKA 4C78A 4YP0A 2MSCB 2QX9A 2IE8A 4RVFA 4LFCB 2L82A 4DAEA 2YC4C 1PSDA 3GGDA 2WYVA 1Z5AA 5JMPA 1XMOB 4L2IA 2E48A 1LDNA 1QQTA 1KNQA 2ZI4A 3HNOA 4PAOA 4PYKA 4BC0A 4RVDA 1GCGA 3CRRA 3HWSA 4WZZA 2X9VA 4RO0A 1P5ZB 1R9NA 5E6RB 3WI7A 3ST7A 3IURA 5BSRA 3G8BA 1B73A 3IPAA 3NQ41 4IIBA 5D85A 2OMKA 5C7LO 4M0MA 4UJ5A 4ZO7A 5EWJB 3WLTA 2IVFA 1YBHA 1J07A 3ZCBB 2AR0A 1NUPA 3MJHA 4ZJYA 1EDDA 3NUZA 4JX8A 1G1MA 3CNOA 2V6ZM 3SKYA 1RNLA 4MVJD 3U4AA 5HSGA 4XGQA 2ZDQA 4D96A 5L7WA 1LCIA 5FYQA 1V6CA 2C4HA 4OFBA 5BSGA 1XQVA 4YRBA 1II9A 1DV2A 1P9NA 1S96A 3B9QA 2ZYAA 3FPGA 5DHAA 4IQ8A 1XTSA 4CCYA 1Z3IX 4PZ9A 5AHXA 2YJ6A 3O8QB 1KJNA 2IYUA 4RSMA 3TBKA 1TUIA 1QKKA 2GCOA 2OO7A 1CE8B 3JPYA 1IXSA 1H8EA 1LJLA 3DEKA 9LDTA 1P7CA 1CDZA 3DLPX 1J8MF 1YR3A 3HDQA 2CNLA 2HPVA 2H2FA 2P35A 4OMCA 2C83A 4WNYA 2EUCA 3UMCA 1TQ4A 4XWAA 2FP4A 3GH3A 2JJ2D 4IUBS 2EFJA 5KKCA 5DK6A 3N1UA 8MHTA 3K2IA 3BE8A 1Z5BA 1PT8A 3NRJA 1K6JA 4GM0A 5AESA 3GPBA 5ARCA 10MHA 3ZWBA 4FN4A 5B3JA 1Y4AE 2FWRA 1FDUA 4NBUA 4TKZA 5F5LA 3T12A 2RCNA 5IMBA 3ZWQA 3TW0A 1GSIA 1OILA 3A42A 1IUOA 2MSWA 3KVYA 2O6HA 5EPUA 1RLMA 3OMLA 4W1RA 1XAGA 1Z62A 1I3MA 2X4AA 1DLJA 2BUBA 2RG7A 3NT2A 5DTJA 3V7UA 5IAGA 2CNNA 4BNMA 2VJYA 1NF2A 1QK3A 2XVZA 4P3KA 4A6DA 4DXHA 3KETA 1TM5E 4PC7A 3NWLA 2WRZA 4X6YA 4A7PA 3BMXA 1N25A 3COJA 4M1ZA 3GX1A 4E1AA 1WY5A 1OAAA 4RLHA 3SYNA 4EPXA 1KMQA 1PKEA 2HEIA 4FLFA 2FH5B 4IOKA 1FDTA 3VR3A 2J0EA 5E2IA 1MEEA 1WDMA 4UD6A 3O38A 3B7GA 3DNFA 1L4LA 4UBOA 4NMLA 2WIAA 5DYTA 4E7PA 1F0PA 2X40A 1H6UA 2C3YA 1XXLA 2HC9A 2VK2A 1AB5A 1IDN1 2ZROA 2AJBA 3CSSA 1U9CA 3D7KA 3KPWA 5DO9A 5UKDA 4EHLA 3F3KA 2PVPA 2BLLA 4PLPA 1ZKMA 2RH4A 4KT0F 3KJFA 4FEEA 3OAAD 2CMHA 4HN4B 3ZDEA 4TWAA 5JCOA 1IBMM 3RFUA 4OAOA 4W9RA 2XCSB 1XD2B 4DMGA 3Q8LA 1E7QA 2YWRA 1AGRA 3LUCA 2J6IA 3GAMA 1E2MA 2Q2VA 3AY0A 3OCWA 2Q46A 1SUIA 3OTHA 4NJEB 5DCWA 3U39A 1NRJB 3T61A 1JJVA 3PZRA 5FBKA 5BNIA 6ADHA 2X7HA 5JJIA 2YJGA 3VYWA 1QS0B 1IUKA 1TKRA 3U7JA 2B8EA 3GAAA 5IABA 3KZCA 1TH3A 5FA6A 1QKIA 5EE3A 3R24A 4EEZA 2XV1A 3GLUA 2ZIUB 5TXGA 2B4RO 2JZCA 2NT3A 4N6NA 1DKNA 2AX3A 5LA6F 1U7UA 1Z2PX 2BFCA 2MYNA 4QOSA 4ZQGA 1WBBA 2IOQA 1UFKA 2TMDA 3UAZA 4KHPB 3K73O 1RWXA 3FOWA 3TNDA 2HWKA 4Q93A 3FGZA 3HTXA 1HLPA 3G6WA 1ES9A 2R97A 4MAAA 3FZNA 4R7GA 4Q0MA 4M8IA 5LBTA 1VPTA 3AERB 3IHKA 1S1CA 1MR3F 5AM0A 2J0UB 4HJXA 3FTFA 1EP2B 1I6WA 3PP8A 4C3OB 4D4GA 2XYVA 2WWGA 2FSVC 4ZDJA 3GRAA 4BB6A 2QJRA 5KJ6A 1JRLA 2J3IA 2OCGA 2I34A 3QMWA 1S0UA 4Z8YA 1GZ7A 3QIVA 2QZPA 4GBGA 2PU7A 5DTQA 3SJBA 1MXFA 2NSYA 4MS3B 3CF4G 1JTFA 3RK0A 4BFWA 1Y6GA 2BSQA 2YW2A 3T1OA 3FMOB 4RD1A 1VJ1A 2HQOA 3FHLA 3D3WA 4JP8A 1Z0DA 2O2ZA 4BPBA 1DO2A 1FP4A 3LP5A 1M1NB 4UM5A 2KNZA 2QI9F 4MEBA 1CY8A 3IHPA 5LC1A 1BDBA 3OZUA 1O97D 4I3HA 2JGIA 3RHSA 3OMWA 1L8OA 1UC8A 1ZH8A 4R2HA 4EYQA 4DMFA 4AD8A 1GLGA 4F3CA 5A3VA 1WIWA 4EGFA 1K3FA 2WZJA 4QT0A 2F9FA 1YZ3A 3EH1A 1DEKA 1U2TA 2HO4A 2IP2A 3MTAA 3T9DA 4A10A 3TG2A 2OYRA 1DTSA 1F9EA 4UNNA 1C2TA 4CHTB 5AWFC 3TYXA 2EW8A 3TDNA 4JYMA 3ZNNA 1MV8A 3ONVA 4GMXA 4N8EA 5JXJA 5M34A 3H1AA 1GQ2A 3KLNA 1JEEA 4Y1GA 3KQKA 4KFCA 5L8RF 4F8JA 3IEVA 4Z4CA 3ICEA 5KWJA 1H0KA 1TMYA 3ZWMA 2CXQA 1EE2A 4U6NA 4KRFA 2FVXA 1X9HA 2A0XA 4FYVA 5F7XA 3CX4A 1YVDA 4AMZA 1ZHOA 3CCBA 2NOAA 1OFHA 2RAUA 4PZ0A 3FCOA 1QKJA 3FLMA 1FRVA 3IT0A 3LAWA 2DLDA 3V1YA 4XOUA 5J59A 3O3CA 3LU1A 1Q0UA 4I6EA 2VF4X 2JGNA 3THSA 2P6UA 2VUTA 3AGPA 4YONB 4ZVPA 3U3JA 4DCNA 5EJ7A 1QTIA 1PSZA 1WXXA 3HUFA 3M34A 2I7XA 4JMPA 1BFUA 1M6YA 1R50A 1XNJA 2IDJA 3N2YA 4JJEA 3IXQA 2ZTVA 4R8SA 1L2CA 4K9KA 1HOTA 1K3UB 1BXRB 3E3OA 4EBBA 1BMDA 1Z0AA 1MU0A 1L4UA 3IUYA 3WK5A 2PUDA 2NVBA 4P84A 2DFDA 2UYYA 3SWWA 5IVPA 3SEAA 4NOMA 4JELA 3NBXX 1A1SA 1T3LA 3RROA 1ADCA 1D1PA 4N18A 1LC0A 4A9AA 1T1RA 2AN5A 1B23P 1CQIB 3OT1B 3GUHA 3UAXA 4YRKA 1ZEJA 3IOCA 4JYZA 4PZYA 4MMXB 4YRMA 1PX2A 2KBEA 5IXYA 2DY0A 1X7DA 4HDMB 2J9GA 3WGMA 2C2HA 1RE1A 4B08A 1AB6A 1Z4KA 5A5FA 1DCKA 3O31A 3ZQ4A 4LOLA 4C03A 5ITTA 1JL3A 4FI3F 3K5IA 2QNRA 1VHLA 1LQ2A 2L18A 5FTWA 3KYCB 3X1DA 4LZAA 2XMDA 1YA8A 4DJAA 4EG3A 3G2MA 1SG0A 3PNSA 3H1FA 4ILKA 1IN8A 3CF6E 3AW8A 4KWCA 4RPJA 1NM5C 5DMXA 3KWLA 2GM3A 3LY5A 5ALLA 5JROA 2W6JA 4J7XA 1JB1A 4NHEA 5HBGA 3JV7A 1Q3CA 2D7HA 3WJ7A 3ZTTA 4WY5A 4MQLA 1NSFA 3GIDA 4N3GA 5COBA 4RTKA 3X1MA 3NAMA 3O82A 4B6OA 3AVOA 5IHXA 4YUZA 4X61A 3K9HA 1VTKA 2WM8A 3ABSB 1M2EA 3K0BA 4CG0A 5AW6A 5CHEA 4EABA 4CF5A 3VR0A 4O59O 2WKWA 3GUCA 1JA0A 1JEOA 3B85A 3L77A 1E2HA 2CJXA 3OJWA 1N4AA 2AI1A 3TTUA 1SCIA 5JAHA 4O3MA 2P9BA 2JFVA 2Q5JA 1GG5A 3AB8A 4MV3A 2GT1A 3KL4A 4MI9A 1V8BA 2V54A 1IN4A 2NZXA 5FHRA 4GOMD 2WU1A 2I6QA 2Y20A 2JFZA 2UAGA 2QSZA 3E2MA 1PEKE 4WL0A 3HKEA 3H5OA 3MLBA 3TNYA 1OGIA 2YJ4A 3CLTD 3QKSB 3DG9A 1MFZA 1XE3A 1ZMWA 2XY4A 1H93A 5FOVA 1P2GA 1CZKA 2GXQA 2XTNA 4MQ4A 4DV3B 1ZVMA 5TPWB 1PEDA 3L8FA 1DRKA 3GQVA 4AP6A 2IHZA 2G0AA 3B7PA 1W1IA 3D8SA 1EG7A 4GFDA 4Q3AA 4TV8F 4ES6A 2EIXA 3H8SA 3RH0A 1DSSG 4GZ6A 1QVAA 4UNPA 4E46A 2QVYX 3EQ6A 3GVHA 4A2WA 4B6PA 4BQRA 3L2OB 3H84A 1NW4A 2YFYA 3DHEA 3OCJA 4GRAA 1MTOA 2JVJA 5IASA 1IEQA 4EJ2A 3GLHB 2BFNA 2FW1A 4GXNA 2V0GA 4C06A 2V6FA 3C6XA 3DBHB 1I4OA 4JI6M 5ADUS 2EZUA 1OZFA 3EEQA 1K3XA 3A1DA 2CNDA 2GZ1A 1UK7A 3CRMA 4JLKA 3L1JA 2DWLA 1U1DA 3V8BA 3ETDA 1ABFA 3OA0A 3ZYZA 5G2OA 3U3MA 4MINA 3BEDA 3N2ZB 1KP2A 4EA9A 1ENYA 1YB6A 5DMHA 4E3WA 5FIUA 4R41A 3CW9A 3L43A 1MJ5A 3B70A 3OZIA 4I8DA 1IWBB 4E5KA 4EMUA 1ILEA 3K70C 3VZQA 4J94A 1U2DA 3RIEA 4GKKM 1AGPA 2BGLA 1FUUA 4FIDA 3NKLA 1VMAA 4JI7M 5DBOA 1TO1E 1EM8B 3Q0EA 3UIEA 4OHYA 2JKZA 4UQLA 3JR4A 4O4HB 2F4VM 2OA0A 1CBUA 4TXNA 4UQPA 5ES4B 3NO4A 4BRSA 4IH9A 4AT1A 2BPOA 1NFQA 3ZUPA 1HXHA 4V0KA 4P82A 4L4RA 1L1QA 4KDCA 4WIAA 5LQJA 2JLXA 3S4YA 4MB6A 3QU4A 4P7KA 3MB5A 4Q02A 3DDWA 1PU2A 4GEKA 1SOMA 5LMUB 1BSVA 2Q4TA 3MPUA 3SMSA 2XMGA 1MD9A 4XQ9A 4ETNA 4G4QA 4F2HA 1CS0B 2EWVA 2PG3A 3Q7PA 3MMXA 1C3VA 2L2QA 3BXGA 3D3EA 5HE8A 2OBMA 3FYUB 4IDAA 1IUPA 3HGTA 5K6AC 3BSYA 3QNMA 5IJ9A 3LZDA 4XX0B 1QHIA 4QFDA 3K71B 4WY2A 4MMZB 4OBXA 1PJBA 4KE7A 3PHJA 3A2KA 4LKOA 4MXDA 4XFKA 1HKHA 4NYIQ 5FJJA 3C7AA 3N2IA 4DEVA 2VDLB 5ITWA 2IIBA 4X94A 2X9GA 2FEPA 4E30A 1BXGA 1RCUA 1SQ0A 3L9WA 4KIWA 4WHMA 2BY4A 3HXLA 3KTAB 1EX1A 1QQ6A 2A5LA 2Z2KA 4II2A 2BFEA 2LR0A 2VDBB 5FLEX 5IS2A 3TLJA 1KAOA 2JGLA 3CINA 3HE3A 5L7TA 3ZV4A 4DANA 5FNVF 4MJXA 4ZYWA 3QVSA 1TCCA 1TO6A 5U4XA 4FYJA 4TZTA 3S28A 4EPYA 1N3IA 4EMTA 4LJAA 1DUSA 1I7NA 2Q8PA 2Z2JA 3KX2A 4WD3A 3BULA 1XJWA 2MHCA 2F5NA 3KYDB 3ZV3A 4IIYA 1L2BA 1O6GA 1C7FA 3GLGE 4IVQA 5FI1B 4C0KA 4YXFA 2ZCVA 2BGMA 2HI0A 4I5FA 4EYEA 1M1YE 4RAQA 4UDYX 1J8QA 1OIVA 3N3BC 3T7CA 1VG8A 5E2AA 4L4UA 4WP2A 3JSXA 4PGAA 5D1HA 1P0CA 4MICA 1SEPA 3SE7A 1XL1A 4OA5A 4ARIA 2ZSEA 2IA5A 5EIEA 3UMYA 4DGSA 2WJ6A 2CUNA 3W8DA 4BATA 2DHDA 5DZSA 1U02A 2BFCB 1E2BA 5AHWA 3HM9A 3LWNA 2I2WA 3EH2A 3BJIC 2Y4OA 2H1RA 2ZS9A 4Y9UA 1Y7TA 4X7BA 3P9KA 1JFRA 4MGZR 4CT5A 4XPZA 3FJ1A 2EFEB 3BIWA 5BWCA 5KC9A 1C3JA 3JATA 1LBQA 3ZHVA 4RF5A 1SURA 5H68A 1H6CA 3UJCA 5CB4F 1CJSA 3R76A 2FH0A 1VKNA 4KQXA 3A28A 2IPOA 2XKAA 4F4CA 1A98A 1G8YA 2IU6A 1LV8A 2ZSFA 3MJSA 4M55A 3GRPA 3TGLA 3ADBA 2QTLA 1J0BA 1EEXB 5IT9S 2IYPA 2C9MA 2J59A 2PX6A 1JH8A 2R5FA 2VC2B 4I7EA 4IFTA 4KFTA 1MBZA 2XD9A 4G41A 3VR6H 4C0AC 5GZ3A 3NBFA 3M8KA 4GI3A 4K81B 1NX9A 1ZV1A 1VLJA 4D57A 3BE6A 5BV8A 1RWOA 2GEJA 2IODA 3FSGD 2JCBA 2RC5A 2IGTA 4CIXA 3DT8A 1AE1A 1UH5A 1KAGA 2ZSAA 1ZYUA 3I73A 5ALUA 3PHHA 5EJFA 1TEZA 2HV8A 2XE8A 5JWHA 1ZMBA 1ZW1A 2R1VA 4PCUA 4GX1A 2VQ3A 1GU1A 3HACA 3PVCA 2EAUA 5JAIA 2P9ZA 3FPKA 2G0TA 4WESB 4Z0NA 2Q5CA 2L6OA 4UTVA 2O2DA 1SM4A 1H2YA 2H1CA 3FDFA 4KV7A 2F17A 3C14C 1Q3TA 5BOVA 4BKPA 4NZ9A 2XZOA 4QU5A 4OATA 1I9CA 5SYAA 4FDUA 4IM7A 3NHBA 5BWMA 1JLKA 2FMHA 5DCUA 3GUYA 1SXGA 5DN6D 3FKEA 1AO3A 3BJZA 2R4UA 1WB4A 4L5YA 2V59A 3H2SA 1BA3A 4P3NA 4QUKA 1EUQA 1RRVA 2FLVA 3AH8A 1XB2A 4MCIA 1PL6A 4PDIA 4MKGA 4TV9B 5J4VA 1E6WA 2WE7A 2DUWA 2ZRBA 3LDHA 3PRYA 4HNTA 3ANTA 5E9AA 2YW9A 4JIGA 2ZVJA 3ZI0A 3H4VA 3FRHA 1YH3A 4O8ZA 3WV4A 3O4HA 3T34A 5A62A 4DRYA 1HNXB 2C78A 1ZI9A 4KXYA 4QUBA 1K7FB 3OX2A 3GRVA 2FI1A 2HMVA 2P9EA 4U9HS 3VHXA 1Z7GA 4ANFA 2W9XA 3H11B 5K0LA 3O4VA 5JYCA 2X9LA 5K8LA 1AZWA 2DKLA 4G6ZA 2HL6A 2EJBA 3ZBTA 2YBDA 2C4UA 3ICPA 5AI8A 4DJFC 3A6EA 1OLSB 4FWDA 5K3BA 1JQDA 4GR5A 3SXUB 3UICA 1QLWA 2UZIR 3GDWA 3N05A 2Q50A 4AM8A 1QAQA 2H7XA 2WQ6A 2H8KA 5AJUA 5J47A 4RDCA 3U7RA 4KQJA 1RYZA 3NDJA 4DG5A 3BD6A 4FFRA 2CLMB 1TVEA 1I94B 2JCSA 4IL5A 3FWPA 1WTCA 5HXAA 1F1JA 2XF2A 1V16A 4INJA 2C0CA 2X8JA 1U2GA 3NALA 4FHCA 3TFQA 4O2RA 1PZNA 4MQBA 2ATEA 2Q3BA 5I9MA 1CVIA 1DG9A 2Q6LA 3V3KA 2C2BA 4E22A 4QO8A 5I9IA 3ODGA 1OTRA 2JLCA 5CYPA 1SHTX 4CMJA 3A98B 3AFIA 4AJEA 4CEJA 1V92A 2FMKA 1JHDA 1T36B 3G9TA 3PKZA 1S4MA 2ZATA 4IHJB 4XSHA 1DAKA 5IF9A 5EWLB 4H7HA 1U11A 1N6IA 2Q0HA 4E3ZA 3RJZA 3GN1A 1N5LA 1JVNA 3JQQA 4CQMB 2ZBVA 4TUYB 1C3OA 4BOYA 1VE5A 2QHXA 1JJAA 2ZTLA 5TEVA 5J1SB 3DTVD 1N0HA 2CDRA 4EKDA 3I58A 5IM5A 1I36A 1RRFA 4RF4A 3T9EA 1SC6A 2O0JA 4JL5A 4J3FA 4MHTA 4YMVA 3OCVA 1TM3E 1JXQA 1C8LA 4K1LA 5B3LA 5KWIA 1VYTA 5IKXA 2OOKA 3SZOA 4P35A 1TLFA 5JG7A 3SNKA 1NDHA 4U3JB 2WUFA 3CSDA 3SS9X 2YIMA 5CJ2A 3LKBA 1U1GA 2ZUBA 3QX8A 3KZKA 1UM9A 3V5NA 4ND5A 1NBMD 1SZCA 2XNJA 1T2EA 1H65A 1YL6A 1FU8A 4HLCA 2FWMX 5BSUA 4UC0A 4BN5A 1L4GA 1UXJA 1P7PA 3K53A 2QRPA 4LE2A 4RC9A 3DLTA 2J3JA 2UZ3A 1A4RA 3PR1A 5IAJA 2E87A 4A2PA 5CW1A 3OQBA 5LMCA 1DIAA 2OGZA 2X58A 5DM1A 1EFTA 1KIMA 5FL7A 1W1WA 3UC9A 3PNBA 4AY6A 1ULAA 2QQEA 1PI3A 1J06A 2JAWA 3N39C 1L8AA 1NVAA 2NTJA 3L1IA 3G1WA 3Q7EA 3W67A 1F51E 4PNZA 5KVCA 2AHOA 1RAIA 4GH5A 4Y2TA 4B9EA 1TC2A 4BUCA 2FN3A 2OC9A 5FLXS 1R6AA 3IPXA 4RKEA 3UT0A 2XTZA 3CMCO 1P17A 2CUKA 1Y1TA 1QF7A 2A2ZA 3U0VA 3DD5A 1IULA 2ZUDA 2GN6A 2W2TA 1KAEA 3L7NA 5GIOE 3BTSA 1W4ZA 1UC4B 2Q3MA 3GFGA 4HLQA 3SVTA 4RZXA 3IS3A 2I4TA 4JGGA 1KQGA 1T5HX 2FCAA 4WURA 1UOQA 3IB6A 3OPXA 3SF8B 1CUDA 5C7YA 2UZAA 4WKCA 4EI8A 2ZYVX 1VHWA 3EAGA 3JQPA 3WYFA 3B20A 3ONNA 4UZEA 4HMQA 1FJ2A 5FWAA 1E4OA 2HSJA 2VEDA 3BWEA 3LW8A 3KOXE 1GHTA 2N75A 1EXDA 1VBNA 2D6FA 1SEVA 3BGIA 4BQIA 1M6HA 4NOKA 4V3BA 3ZD7A 1LXCA 3U7QB 5TB5A 1E9DA 2Y1OA 3CUEF 3ETLA 4GLLA 1Z26A 1LJ8A 3OM8A 1T9KA 4Z9XA 3AB7A 4W82A 1B41A 4L4SA 2CHEA 1RTKA 1K92A 2GZHA 4MIEA 1B3BA 3ET4A 4NESA 2VHVA 4R40A 5SICE 4ZO6A 4GMQA 4W8OA 2F8TA 3V1KA 2Q3EA 2Q2EB 1RI2A 4XSVA 4ENSA 4MGKE 2ADFA 4DLRA 3FNIA 1RKXA 2EBHX 1F8FA 1MJHA 3H5LA 1OF1A 1Z0FA 3UQYS 4HGQA 4DG8A 3KXEC 2L19A 3PB3A 2VDWA 3WC4A 1K5DA 3PQ2A 4ZOLF 3DLAA 4ZVMA 2H9AA 2BC9A 3I09A 3CN7A 4LYDA 4NBLA 1H2BA 5LP6C 3F7NA 2NU8A 1V47A 2AZTA 2SCUA 4B7ZA 3I9KA 1JR3D 3ZWWA 1P72A 3QU9A 1T4GA 4IMPA 3H86A 4UM9D 2ZZMA 1XX6A 3U4HA 3I2HA 5KOHA 4EG8A 4O02B 5LYJA 4BWYA 5HDBB 4IUDS 1RJWA 1N1MA 4XYGA 1C4WA 3V00A 3TFOA 3DO8A 5F2EA 1ZK0A 1U04A 1XA0A 3TSWA 5JDCA 2Z6VA 5KKNB 4BRUA 1NVKA 3ESQA 3OTQA 4X20A 3KKQA 3T3NA 5AJXA 1MX3A 1M2NA 2QJFA 2XDYA 2XGGA 4HWPA 4BIMA 3RYCB 3W5BA 1AKMA 2WF5A 4N5HX 8ATCA 5C53B 2XHZA 5THKA 4D80A 3U1TA 1QO7A 4LYYA 5GJWC 4LY9A 1JT2A 1ZMTA 2HCRA 3LWZA 1W581 4AQDA 1GRVA 1RHQA 3AV3A 5E1DA 3AR8A 5I7AA 4KAAA 4EG0A 3IXMA 4AKHA 2DQYA 3MTEA 1KFCB 4RZ2A 3JARA 4UHDA 1PDVA 3BMCA 1YOBA 5DWDA 3AVQA 3EDMA 3K1ZA 2RGOA 3LY9A 1OZHA 1UAAA 1FNMA 4JC0A 3ZV6A 3G13A 3I92A 3ZNPA 2VYNA 2QTHA 1NJFA 3IC5A 4DMKA 3M4XA 3AU8A 1D7AA 5JLJA 4I19A 1HFEL 4V0RA 1YACA 1QFJA 3IUBA 5SYMA 5FWXB 2AC2A 4PGFA 4MV7A 4X84A 1WEHA 1G21B 2AZ4A 2BEWB 2ZM6B 2WK1A 5KEIA 1DADA 3HJCA 3RSHA 3UM9A 4U3JA 4YXWD 2IHBA 2ON6A 1QVRA 3D6JA 3QTBA 3GFSA 4JBWA 2J1LA 3C3WA 2GZ2A 4GPTA 4UVHA 3TZKA 2M6SA 2NZJA 1TAQA 4JEMA 1QZTA 2WSBA 1DE0A 3DEHA 5FPPA 2W2VA 4JB2A 1TMKA 3HMQA 1LPNA 2LPMA 4NF2A 1J90A 2POCA 1OB2A 4KH0A 2ZBKB 2I3BA 2C00A 5IVIA 1S2DA 1YR1A 4QNNA 1MRSA 3L4KA 3JQ6A 1MQ8B 2P7HA 2FY8A 1SA0A 2ZAYA 4M4SA 3TW4A 3TW6A 5AHKA 4EVSA 3AF0A 3K30A 2L09A 2MYTA 3ZTWA 4Y2RA 5AW9A 1BWQA 3J81A 1P81A 3GWZA 1EHIA 3LX6A 2EARA 2IIQA 3L1HA 3RS8A 4EAQA 4CCWA 1CNMA 4RJLA 1YT5A 4DIKA 1V33A 2PUTA 2Q5IA 5ALOA 5JS1A 3IALA 4UHHA 4H3HB 4LJSA 4QSHA 1ZCZA 3X2EA 2JAHA 3P9IA 4RPLA 2Q5HA 1YMVA 1TH4A 2R00C 2X8JB 4N1AA 4PC1A 4R1UA 2IW3A 2VSFA 4WZAB 3BC1A 4Z7QB 4D26A 1TKBA 1QVVA 3OM0A 3P97A 1T10A 1VLZA 4Z7JA 4PLYA 2JS7A 4Q34A 1R27A 5GGXA 1GV0A 3GQBA 3LC0A 3K1JA 1OH6A 4D1YA 4NXNM 1T4CB 2GN2A 4ITVA 3FTCA 3CUWA 4O8CA 2NXJA 4ZO4A 5CU7A 4WN9B 1XTTA 4BP8A 1Y7HA 4R0VA 4QOEA 4DNQA 2VTVA 4LS3A 1AKVA 3QYFA 1RPTA 2JFGA 3ENKA 3MD0A 3VSEA 1BXGB 3A6PC 3VVLA 1QIFA 2AZDA 3TWKA 4UDNA 3JTEA 1B00A 4INAA 1U7PA 2R7LA 1HQYE 5IEBA 3ZQKA 3AP2A 3FE3A 4DV3M 1KO7A 3AR3A 1S3GA 1E5DA 1TUBB 3KE8A 5DP1A 1AQIA 3PC8A 4RQAA 4EO9A 5K05A 1EH5A 1HDXA 1DAMA 3ENQA 4UTXA 2NWQA 2PD4A 1T3TA 2HSZA 3NFRA 4PONA 2G5GX 4CMIB 4EHNA 4WFIA 5B6JA 1KC3A 3C6ZA 4BEJA 1K0UA 4C0XA 1DRUA 2CFCA 2PSHA 4DPMA 3PTAA 1HFJA 5EP4A 2H1WA 1LPBB 4ISCA 4ZT5A 4U0KA 2P67A 3RRJA 1D4FA 2B7LA 3BGVA 3BILA 3CMMA 4DDUA 1KO8A 4PPYA 1ZEMA 2ZM6M 4RLQA 1K0FA 3HU1A 3TKYA 2BR5A 1ZSVA 3QM1A 4XWGA 3Q72A 2PAAA 4G1BA 2P2DA 4O29A 1HOXA 4ITRC 2ZULA 3A14A 1RXCA 3BTUA 2O0HA 3GP5A 3IIKA 3LFUA 3AJ9A 3QP9A 3H2ZA 4L8GA 2HWXA 4PANA 3U3XA 5IUJC 1PJQA 4LPSA 3FRJA 4HYQA 3UV7A 1ZIXA 4I50A 3KTFA 4M6WA 3TI9A 3LUHA 4OYHA 4P31A 1TC1A 4NIMA 5DBEX 5COAA 1D0LA 1SUPA 2H1LA 5E3IA 3ZJ5A 3UH0A 2HEGA 1WW2A 1Q12A 3FY4A 3MCAA 4HC4A 4CIWA 1X1EA 3M3HA 3T6PA 1XRPA 2CL0X 3WK8A 2AK3A 4IHJF 4WN3A 2JIBA 4KMMA 4BMXA 6PFKA 4HDMA 4JH0A 2R11A 4H7PA 3F3MA 4J7AA 2K47A 4XUGB 3I05A 1KYZA 5FXMA 4R1OA 2DPHA 1M2HA 1JA1A 4CEJB 4PX5A 2E82A 2P3SA 1TAHA 1II0A 1QZUA 4PSAA 2XNKA 3STTA 1EK0A 2O8FB 3DZ8A 4ZAGA 4BFYA 2O1WA 3DEJA 5AVWA 4H35A 4DN6A 4XK8F 2FUEA 4ZCQA 1TFRA 1ZK4A 4H2DA 3MBKA 4IJVA 5LP6A 2EEPA 1DAEA 1H3NA 2WJJA 3RC1A 1YE5A 4JK3A 4NH4A 3I9V1 4LMBA 1V1RB 4RH3A 1SOAA 3HY4A 3QVJA 2RHOA 1NP6A 1FMJA 2ONYA 2VTBB 4N3AA 1XMJA 4KQWA 4YAFA 4ZP1A 2GPAA 1FRQA 1TNDA 4PQFA 3SE0A 1KJ9A 2IWRA 4UFPA 3W5VA 4WCFC 4QDZA 4A6PA 1IL0A 3M3DA 1ZH0A 1KRWA 3UJHA 3RUEA 3PXBA 5LIRA 1NVXQ 2VAMA 2IHYA 3PCTA 4NU5A 3ROFA 5IBRA 3TTSA 4HL6A 2PMBA 1VKJA 3I72A 4GKAA 1D1SA 3AHDA 3SJZA 1GNPA 4DHEA 1J2EA 4LWOA 1Q22A 1YQGA 4WOBA 1YK0A 1IBKM 4PIVA 2ZYRA 1IXSB 5MFPA 4TLCA 1KQFA 1RC8A 1L4NA 5BSKA 4F5DA 1JFFA 4NSRA 4IZ6A 5A9SB 3ZC7B 1CY1A 3CLUC 4HGOA 5JADA 1IJBA 3W04A 4CE6A 1HNWM 5L8VA 5T8KA 3MTJA 3TKAA 1QIMA 3ILKA 1YR7A 5CNKA 1XEFA 1PGJA 3C45A 3WGKA 1Z2OX 2Y1WA 3H6GA 2OORA 2HY7A 4TVOA 4OXXA 4P5EA 4Z0HO 1YS1X 1ONSA 2TMKA 2A5JA 1IRXA 3W8FA 2NPIA 3ZNQA 5JS8A 2YHUA 3UY4A 3DE0X 4JWKA 2CFTA 3BKWA 3IUMA 2YWDA 4FNAA 4DR7B 3HXMA 1XK6A 3FNEA 3GPCA 2O2SA 5LU8A 1OIWA 3A9CA 1FVHA 1ZY2A 2NU7A 1NLMA 1J8FA 2PSFA 3BEOA 1JEDA 2CHUA 1QYRA 5EXEA 3ZHCA 5LOVF 4B71A 2VUSA 2BFDB 1ZESA 2XMQA 1GGKA 3IVRA 5TV2A 3B9RA 3OY7A 1EGVB 3MBIA 4IXWA 1J97A 4UUOA 3FGOA 3HLKA 8CATA 1PJRA 4M0WA 1ZSNA 2Q3CA 3LSTA 4GZ3A 4QFCA 1FTGA 4MS1A 3WB0A 1ZD1A 4F4IA 4YLYA 1H3EA 4JI3B 2K4MA 1KR2A 1NUSA 1PRYA 4G4SO 4Q39A 5LA6B 1IPFA 1KDYA 1Z9BA 5A4JA 4IHKA 1U3CA 1U0OC 4UTPA 1MB0A 2P5UA 2IV3A 1KVTA 3EGDA 3KR1A 3HKPA 4KLAA 1U0GA 2ZAGA 4UEKA 4DCVA 4CV0A 2EZ4A 1UWVA 5F76A 5D87A 5BWNA 3AOEA 4HRVA 2WU4A 4ZARA 1C9MA 1OHHA 1VXRA 4LQ4A 4PRLA 3T3OA 4BWGA 4JBLA 3VBEA 3NM4A 3KXDA 3IELA 2WKPA 1HE4A 2Z8YA 3OOJA 5EY5B 3MT8A 1SVSA 2QU7A 1CZUA 3N0XA 3ANSA 2CUTA 2NU6A 1TTQB 2PV7A 2X1LA 1C0LA 3BZWA 3HUEA 4J1TA 3UAYA 4BHTA 4GQAA 3H3FA 3EXFA 2TYSB 2YV1A 1QYIA 3AWIA 5FCDA 2PUVA 4UQOA 3NEAA 2C4WA 3ZUGA 3GRFA 4ZKEA 2ZYTX 5EERA 3HZHA 4D2IA 3DOEA 3TL6A 3F6RA 5F35A 1LVUA 1FFSA 1L7XA 1OU4A 1P1KA 1ZMXA 3BS4A 4MYCA 4FGZA 4DRXA 4GGOA 1HEIA 2C0PA 2RI0A 3FYTA 4H0NA 4MW5A 1P7VA 2C96A 3CH5A 1TRKA 2IS1A 2HSWA 2E4VA 4Y30A 1G8HA 3OCUA 1YSYA 3D7NA 4FT2A 2B35A 4N5IX 5TT0A 1E1CB 5A4KA 3MTBA 5THXA 1RRCA 1EFVB 2D4HA 2J6HA 1B74A 2LXNA 3COPA 5LP6B 1QP0A 2H54A 4RABA 1NY6A 3QU2A 4RTNA 5AKJA 4P7JA 3DZGA 3E05A 3FA2A 2JAOA 4JJ4A 4QOZC 3LGXA 5CLHA 4A3SA 4PT5A 1UJ2A 1X8XA 1DFGA 2VATA 2O8VA 4AKEA 4IBCA 1BEEA 1DKUA 3RREA 1TZKA 4G5QA 1SWVA 3B1KA 2W2PA 2J5XA 4QYMA 1L5OA 5AJVB 2YYYA 3E6AA 3UJAA 5BVHA 2YVQA 4URHA 2Q62A 2NO0A 2XJ9A 3ESCA 4MV9A 2VHQA 4IIHA 2AFHB 2BHTA 1LTKA 2QT9A 3OX1A 3ZI4A 3H19A 3IDZA 1Q83A 4FSDA 3QEJA 3EEBA 3T3EA 3VH1A 3P0IA 3H6KA 3U31A 4US2R 1TM2A 4FN5A 2IHUA 2O5CA 2VPWA 4Y0VA 3DVAB 1FSFA 3RV4A 1P6UA 1T29A 2ZBEA 1MTZA 3HUDA 4JEHA 5GQSA 2PGXA 1PUIA 2EQBA 3CR7A 1KAHA 3R0XA 3RK1A 1LX6A 2HMWA 1XNHA 4P58A 1M6WA 3RUDA 3V8RA 2AXQA 5TIIA 3IAXA 4H18A 3TLXA 3OWHA 2F5OA 1KQ3A 1I32A 3GJ0A 3F2VA 4RK5A 1YXMA 3N7TA 1JNYA 2AFRA 2XUZA 4FYIA 4EMSA 3ZIAA 4ZI2A 4OQQA 1RQGA 2AUTA 2C3UA 3NBKA 3WKBA 1Z22A 1LVGA 3VVMA 1UADA 4CIVA 4EELA 3AKYA 4NDZA 1EVJA 4OYLA 1EIZA 1LDYA 1E7SA 1L5FA 4QXOA 4EZIA 5IZCA 1M8PA 1SC9A 2OFXA 4X91A 4ZK2A 1NQAO 1WCIB 1YB1A 1U98A 3CUVA 4XOIA 1M34E 2P0AA 1PQYA 2JDIA 3CRW1 3DUWA 4G1MB 1IVNA 2CLFB 4WAUA 2AWNA 1HRKA 2SBTA 4HYYA 4YDRA 1HH4A 1NMEA 1TUBA 1WMBA 2D5IA 2HAEA 2YQ4A 4MVJM 2AJCA 4BP9A 2INGX 3VR1A 4ONEA 2OB1A 4XW2A 5ISMA 4RMHA 2R7NA 1GL7A 4K46A 1ORTA 2FGJA 4HWKA 4UUBA 4CKCA 1OLXB 5MF6A 1SG6A 4TLLB 1T2NA 2WIKA 4MUYA 2QMUA 1EDZA 2V6IA 2YXLA 2WJHA 3U09A 2FEKA 2D74A 4Y7CA 2XLBA 3RJ9A 1SC3A 3THWB 1DKPA 1BWPA 1GM5A 1YDFA 4YCDA 4Q3CA 5G0WA 3K0AA 1XTBA 3LXXA 3OE5A 3KV3O 5BN4B 4DQDA 2L4FA 4NCIA 3SMQA 3E4RA 3QF7A 2ZJ0A 4BBZA 3WMWA 5KHLB 5E0OA 1HPLA 3CPHA 3PHLA 3LOQA 1AKWA 1OY1A 2I2XB 3F7TA 3NIGB 2VA9A 4Q7LA 4QUJA 7GPBA 4JZYA 4C0LA 1E1LA 1JJBA 4REMA 5LZ7A 4MGYR 2BFFB 5EJCA 3B6IA 4M1KA 3DLCA 4RIEA 3SHTA 1L7QA 4ESOA 4ESVA 1GRRA 2ID9A 4YYZA 3CH7A 4JI8B 3HUUA 4QBHA 3LT0A 3VPAA 3DWGA 3CWQA 3FWZA 3U3DA 3VZDA 2AFHA 4R2JA 2J9XB 3GLGB 1ZC3A 1KOJA 2H52A 1ZJZA 2B99A 3SZGA 4AL4A 1AKYA 4UHKA 3FOEC 1AKRA 3DKIA 4KYUA 2FW6A 3NBMA 3WZ2A 3GFFA 4F2PA 3A4NA 3IAFA 4J76A 3PNPA 4Y8VA 5JQGF 5JI3E 3GW8A 5KTRA 4CM9A 1Y42X 5JH7B 1ZNYA 4G36A 1EB8A 1Z5NA 1CKEA 2R751 3IKVA 2QAGC 1W48A 2FR8A 1ZD4A 2PGLA 2YS7A 3P2OA 3QBTA 2NV0A 3C3DA 3WLJA 3CKKA 4ZAWA 5KTOA 3O8NA 2EQAA 5DFAA 1HT0A 4IF4A 1VL0A 3A4LA 2B4QA 4U39A 4Y2PA 5EZ5A 3BHJA 3PRKE 2EJCA 3BAFA 5JD3A 2F7SA 3I2IA 3C7CB 3P0JA 4R8KA 5ALWA 4KFRA 2WAAA 2WC1A 3WMXA 1Y33E 2FPRA 3AY3A 3QIAA 5JRZA 2O8BA 3QU5A 1MHTA 3ESZA 1ZA2A 3INTA 3D2CA 4ZGWA 4IDCA 4D46A 2O52A 3U3OA 4FM9A 1MC5A 2OK8A 1XQWA 2CHQA 3REGA 3WMGA 3IP7A 3C2QA 2B78A 4HCJA 4XJSA 5NULA 3W2EA 2E5FA 2IPLA 3P2MA 3CVOA 2I71A 2VAXA 4G0MA 3TJZA 3C24A 1SVLA 4D02A 2BGGA 4RESA 2Q9AA 1XVUA 5T6BA 4ZMRA 3R77A 3GRCA 2Q7DA 5ED4A 5I9BA 2NP6A 1EE9A 1MVOA 1E0SA 3QWBA 4R6WA 1WOYA 2F3PA 2Q6TA 3C5VA 1VKOA 4CR8A 4B6JA 3B5IA 1NZFA 1XK7A 4RGBA 2F5SA 1E2GA 5H3CA 2C58A 4DGQA 4E03A 4IJ5A 3EGVA 4GR4A 1JW9B 3MRTA 4HWRA 4BC1A 4PCVA 1U3UA 4OHXA 4J0KA 2F62A 3AM5A 4Y2QA 4BNJA 3Q7QA 2Q45A 1XCOA 4H0CA 1Y37A 3PEFA 5AM3A 2P6RA 4PLWA 3SDZA 2B5OA 3H2IA 3EOAI 4KSCA 2IXDA 2BSXA 2ZTMA 3KKOA 1G7SA 1Z2AA 2JAUA 3OEED 5CD1A 1PRBA 5DCYA 3V48A 3UXEA 4UOQA 1ISJA 4O2BA 2IH2A 5FUQA 3N59A 4AWBA 5ESWA 4M9QA 1IBSA 1P77A 2ECQA 2O3QA 2PJZA 1IHXA 1TAGA 3BL5A 3R8FA 3C3KA 5HTKA 1NYTA 1KKUA 2J33A 4CTKA 3M0EA 4DV0M 3AQIA 1I4EB 2CVZA 3L7DA 4RMJA 2KZSA 4AECA 1OGJA 4G0UA 2C7BA 1Q0QA 4GKKB 4CGZA 4A5OA 4EB6B 3AJDA 3Q7RA 3PG5A 1H1LB 1WXHA 2FSIA 1EBUA 2QGNA 3B53X 4G37A 3V7YA 3KS9A 2HRCA 2L7IA 5A7HA 4E5NA 4TTRA 2P9QA 4JXKA 3KKNA 5EXDA 2O8DB 1P33A 3L4BC 5EIWA 3A1EA 2LDBA 2WTNA 3FF1A 5KQSA 1H1TA 2XKJE 4HWOA 1BMFA 1U8FO 1NVEA 1RMQA 4EPVA 1W2HA 2Z0MA 3OQNA 2FB9A 2H4FA 1ND5A 1VL5A 2AD1A 5EQDA 3WK6A 5AVTA 5JJKA 1RAFA 3FHCB 4HRYA 5TX7A 1P9LA 1M1YB 5GINE 1QIDA 1RYNA 1LZLA 2C97A 2W48A 2ZIWB 2CFSA 4A0QA 4QOGA 1EP3B 1WCV1 2GLTA 1WHSA 3PC2A 1W8DA 2QE7D 1QM5A 5AW1A 2R44A 1G20E 4P9NA 1G20A 1O6FA 2JFUA 3DVRX 5TEWA 4XLLA 2E1RA 1TLLA 2GNAA 3BZUA 1Y98A 4D6PA 5DH9A 1JIQA 3ZWXA 1SAYA 2R47A 4IV0A 2G3QA 3KJXA 2VF2A 2LD4A 4FEYA 2C1XA 2I65A 1T0BA 3F7OA 3GDGA 4AK9A 4C6RA 3FYUC 3KB6A 3B2NA 4O3FA 3FLAA 4BCCA 1ZNXA 3MSCA 4CIBA 4OW0A 2ZR0A 5FWDA 1RM0A 4TKUA 2A9KA 4KRXA 3BSFA 3ERCA 2O8EB 1CK4A 2VYFA 2QN6A 3W0LB 1LSJA 3TSOA 4LFBB 2P6PA 3UKDA 2LXEA 5HZHA 1HV8A 3ISJA 3EFBA 4UM8B 1CYEA 1MC8A 1WQ4A 3L6RA 4WKNA 5KNBH 3SATA 2JIPA 1Y48E 2KRUA 1T24A 3CEMA 1L5NA 1CUIA 2CLKB 3A3KA 1IOVA 4HH1A 3B1ZA 4D98A 2WB2A 2D7GA 1DEAA 5U4QA 1DZ3A 1NPDA 4XIJA 2WUVA 1YRYE 4I1VA 5C8VA 2XWJI 2YMMA 5B64A 4AJ4A 3RVNA 4R9UC 2DZDA 1RXYA 4GXTA 3UA3A 4EZBA 1ZBDA 3L0ZA 2O5RA 5AIAA 3K5HA 5AOBA 1FJHA 2MSDB 2J0UA 3STHA 1X74A 3UFXB 1HE5A 1BS1A 4K2AA 3HG7A 3R0QA 2TECE 4G1VA 4QPJC 1T9GR 4BVJA 1KR5A 5T4FA 4ZMSA 1N2CE 2MINA 3DD1A 3RIMA 4LZNA 2WTEA 1JEAA 1KJWA 5KHAA 3HYTA 4DYVA 1MIOA 1L4KA 2ODAA 3QQ5A 1WBJB 2R25B 5JNLA 3JQFC 1EX6A 3HHYA 4JC5A 1BROA 1G17A 1YK1A 1KC1A 4O2AA 4KR7A 1KO1A 3GLIE 4JC8A 3T3IA 2O23A 4GNRA 4X7RA 5AHRA 1KU0A 1PR6A 3PVSA 4Q1VA 2ZDGA 3R0ZA 5EYPB 3Q88A 4NMHA 5T64A 2PRSA 1KY2A 1ZUNB 5EJ4A 3EZXA 4S1WA 2PX2A 3T7RA 1UJ5A 2IW1A 2R5WA 4L3VA 4L4ZA 5LQNA 1M8FA 3EZ7A 2QXTA 1YQDA 2Z09A 3ZQJA 2IOYA 1B0PA 1XF1A 3VKGA 3INYA 4NBTA 2YRWA 3KG2A 4QQKA 5CUQA 5AVRA 1WKVA 3TEMA 1AG9A 2WVHA 2IPXA 3CLUD 4H59A 3NV9A 1XVLA 1IC6A 1WPGA 3I1YA 5EMHA 3UUGA 3V8VA 2F48A 4YP7A 3NC1C 1VIAA 4DA8A 3QOYA 5KX5F 3RADC 3T7SA 4NX2A 3RASA 3G8CA 2XVXA 1WZEA 1MH1A 2BFBB 2Y1LA 3EXHC 3KXLA 4RM2A 4FZJA 2YR0A 1EVYA 3KR2A 4MJ7A 4UTZA 2OE2A 3U3KA 2VDUE 3EPPA 4JB3A 1NVBA 2A1IA 4WZAA 4RVHA 4U8GA 1P6XA 2J46A 1NY5A 2D13A 3HL0A 3I2GA 4XASA 4PD2A 2JP7A 4K6KA 1SU7A 4LOAA 5CBPB 3GA7A 2I4OA 2E3JA 3G79A 2AMVA 4HVCA 1DARA 3FNBA 1A2OA 1S2NA 3VO1A 3PHCA 4JYBA 4UASA 2BF4A 3EVDA 5EUCA 5DF1A 3V2UA 3DFIA 1XZEA 1L5WA 1NGSA 3RUPA 1CUKA 1P2SA 4G84A 3IDAA 5IRCD 3UTCA 3UGTA 3WKDA 3EMKA 4DV6B 2AOTB 2Z5VA 3PC3A 4L08A 3KYDA 4Q15A 1X1DA 2ZRGA 1CUXA 4ZHQF 1KZ4A 2CL5A 1SZDA 4X1OA 1Q0ZA 4E21A 4EJSA 5IT4A 4MEJA 2V97A 4ZCMA 3C6BA 2J3MA 1Y4UA 1DQNA 4P83A 1DGGA 2ODBA 4XR9A 4OD0A 2WJYA 1KQOA 1GTVA 3HGMA 1NI5A 2WKSA 4EG5A 4D4JA 1N8NA 1CUSA 1EFRD 1RYMA 1U80A 5IF3A 3E0QA 4YECA 5FUBA 1KEZA 1TKAA 1NBAA 1ZRNA 2WIFA 5HIIA 5C4GB 4JVNA 1RAGA 4RYDA 4AW4A 4QTYA 2BKXA 3RTBA 1J25A 1KOGA 3IMCA 1V3UA 5TLSA 4F21A 3ZS8A 1KVSA 2X0JA 3ZHSA 2CV0A 1V1JA 5G4KA 2LVAA 4NBRA 1CQXA 3NXKA 5JFTA 2DT5A 1TZCA 4O4LF 1O5IA 2ZSIA 4TRMA 2CKDA 5IT0A 2QLBA 5B30A 1SN7A 3AYXB 2E18A 4M9CA 3IAS1 4NAVA 3K2LA 3EOBI 2FEOA 4XEUA 3G2HA 2Q6IA 5KAPA 2XMCA 5DNWA 5K09A 2OWDA 1ZKDA 3EK2A 4DS3A 4BNDB 4OI0A 5K20A 2FSHA 2ZBFA 1SK9A 1UDRA 4RF0A 2FN4A 2OECA 3GJ7A 1W85B 4QM6A 3C7KA 2HIMA 2ZT7A 3V46A 2GF2A 5JPDA 4DV2M 1VB3A 4AUNA 5L3SA 1PW7A 4TT8A 4G67A 4IJQA 5BT9A 4F7WA 1TF2A 3GT0A 1DOHA 2GQ0A 4GRDA 4Y6RA 2XOKD 1L5KA 3ER8A 4ND8B 5JS6A 4ESHA 1CV2A 1GRNA 4UARA 2ATCA 1NRWA 3TR6A 3E1KA 4JJIA 5I48A 4G63A 1JHQA 2HZ7A 3W06A 1YFZA 4ZEVA 1SHJA 5GMOA 1ICIA 2IY9A 4XUEA 2H00A 5HCUA 5HRAA 2VQDA 4D8TA 1DGHA 3CB4A 3UKJA 1JWLA 4QECA 2YZGA 1FX1A 3IBGA 3E81A 1H2HA 2AJ8A 4CIDA 1JG7A 5FTJA 1HT3A 1DKRA 1U99A 4C87A 5JSQA 2XWBF 2YZNA 3V7WA 4M86A 2IT1A 5HUJA 1DV0A 4JLUA 2GM5A 3Q3JB 4LGCA 2DSNA 5C1BA 4JFAA 3FG9A 1EK2A 1J4AA 4HNSA 2QQGA 4PG4A 4UAVA 4C0QC 3T5PA 3WL4A 3TE6A 4RA6A 3RBAA 3DS8A 4RTJA 1PKXA 4MHSA 1P0QA 2QRLA 4XFJA 3IG8A 3PFHA 3QE4A 4PM4A 3BH0A 5BQXA 2ZI6A 3IVCA 4FUTA 5KYUB 1E0AA 5B36A 2VXCA 5KTMA 2V6GA 3KQOA 4BUZA 1X0XA 1J70A 2Q9BA 4YREA 1XFDA 4B4UA 2FWBA 5KCZA 1RZUA 5I5GA 3UHOA 3OLYA 4EYSA 2OHJA 5C51B 3DMTC 5BQPA 2O7SA 1A95A 3CISA 4H0FA 4HQKA 3TQOA 3ROEA 1WVMA 2OD2A 3SQNA 3ZDYB 1IRIA 4YRIA 1PK9A 3DMRA 1MQSA 3GLFE 1DXOA 3GJ8A 4BAGA 1MO6A 5C52B 3AVWA 4QEDA 1PZMA 5H02A 5ILOA 1X7XA 1QHXA 3QJYA 3DOIA 3SD7A 2XZTA 3VUFA 2GAOA 5LZ2A 1Q3HA 2N1MA 3K35A 1E0DA 4UE3S 2O8NA 1NHGA 4AJ9A 4RM3A 4E33A 4YT8A 1I7PA 3OX4A 2C8JA 5FBRB 4F91B 5REQA 4B44A 1FS4A 3U4CA 5I3CA 5LR6A 2WJZB 2DUMA 1YKSA 5TQ0A 5IWCA 2PXXA 1BKSB 3H4JA 1THGA 2N46A 4PYOA 3MAAC 3BORA 5JD6A 1WSWA 1ZO8A 4R2MA 1E1RA 2GH1A 4DKJA 3VPFA 1A9TA 3A3NA 1SCQA 3FIJA 3Q0IA 4HXGA 4EB0A 4N6GA 5FX2A 2QR3A 3UKOA 4EVQA 3H2BA 4X3PA 4AMYA 2D8AA 4R8MA 1TK9A 3C5HA 1C14A 3ZWCA 2XR1A 1WCWA 3HV2A 2QRGA 3WYBA 3ZXYA 2IEBA 1PLLA 2VN8A 4BLUA 4WBNA 3W2TA 2IDKA 3T1YM 2DH6A 3KV1A 2J0SA 2ADOA 4L78A 2F5QA 1N2ZA 1VKHA 4KN8A 1AF4A 2GCGA 2QSJA 4QARA 4B32A 4C22A 4CT4B 3HZZA 2Q41A 3LBAA 5LLDA 1AJEA 2A0WA 2DAGA 4TQ9A 3IQDB 3UV3A 4ZEXA 1X14A 1I1HA 1NBOA 1P7WA 3DF9A 3T4UA 3N58A 4YP5A 3KS4A 4ND6A 2CL7X 3JZDA 3K92A 1PNTA 1UM9B 3BF8A 3L1UA 4LYHA 4OU5A 3UT6A 3ZZMA 4RKYA 3UXHA 2PUEA 1X8JA 4NS1A 1GGMA 1XIVA 5EKUA 1RP1A 2ZYSA 5JECA 2IBSA 3NC0C 5IJZA 1R4MA 3KJHA 3OPVA 3TTYA 1HFWA 4BKMA 1NP3A 2GZAA 1F9AA 1N9GB 3EF3A 1LTMA 2ZEJA 4HH4A 1L1ZA 5IKMA 4HAYA 2HLNA 1XEAA 4BB0A 2CWBA 5J23A 3MIIA 5BWBA 3OIYA 4LEIA 1IBRA 4XJTA 3HU5A 1TIPA 2G82A 4AJJA 1Z6YA 4YI3A 1MAAA 1BWSA 1XAHA 4PLCA 4UZFA 3FNGA 4NE7A 3MMNA 4W5JA 4BKOA 4YAKA 5CDTA 4LF8B 4QAJA 5JNRA 4MP8A 3UBMA 2RJ3A 2CYBA 3DMHA 7REQA 3DGEC 1MORA 3TAHA 3ZDCA 1Q92A 3IP8A 2HWJA 1KARA 4G8BA 4JI2M 1J6UA 2DGDA 2WWIA 3CHYA 1B26A 2PT7A 3P9XA 4X24A 5E38A 4G2TA 1JZQA 3B48A 1CF2O 4DJEC 1YB7A 3BQNB 4NCNA 1LLUA 5KO2A 1SVWA 2P5TA 4ZVRA 1P8JA 1SVOA 4LVOA 1NHWC 4UPDA 1WVIA 2I78A 3GFQA 4IMRA 3H9BA 2GAAA 3SQOA 4CHTA 1MP0A 1L8XA 4Z86A 1KSFX 1E69A 2VRNA 1F6BA 3NTXA 1P2BA 4B3XA 5FPKA 3CVWA 5IUKC 2G77B 1G8PA 1MX0A 3KWMA 4OK3A 1QH0A 4MRNA 4R0NA 1ZJ4A 2E85A 4TMZA 4F46A 3T9CA 3WGIA 4H7DA 3EHDA 5EXTA 4J6FA 4CTMA 3IPYA 1A8HA 2PWYA 4KPUA 4X64B 4B6RA 3ZWYA 1CRLA 1A72A 1ZP6A 3OLQA 3ZVNA 2NVWA 2GHQA 2NU8B 1CWUA 1NUAA 2IGBA 3EBLA 3PNMA 4QLAA 2HQ1A 4BFUA 4IGIA 4FYMA 2O3RA 5CMLA 3QUAA 4YDQA 3ROKA 3BIJA 4A5SA 3WQBA 2WEKA 3BM5A 3SHWA 3AM4A 2IOFA 4IR7A 3FOCA 2F3UA 5ITSA 1VPWA 5EWLA 4HB3A 3M5DA 1SBIA 2VHWA 1TUEA 1UC5B 3GEDA 5JTTA 3DBVO 1OH8A 1NAIA 1Y6FA 4JC4A 3HK2A 1DPFA 3PQ7A 1C7QA 3GZNB 4BZWA 5YASA 1T91A 1Y8AA 2HRZA 1C8VB 4MQEA 3NYWA 5FUYA 4ALMA 1MRNA 5CT5A 2C4MA 2A33A 2OZLA 1ADGA 4JFRA 2OMEA 2CEKA 3OT5A 1URPA 4WE3A 1OFUA 1G8AA 5JNVA 2WNIA 4ZQEA 5LDHA 2PGOA 4RTOA 4C2BA 3NGMA 2DAMA 1HEUA 4RY8A 1T4MA 1PIWA 5B37A 3JD2A 1YUBA 3PPXA 5AJYA 3WVNA 5KYGA 5TQ2B 2CY0A 4EHIA 5H8WA 3A25A