1VQ1A

Crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
266
Chain Sequence
b'RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-glutamine methyltransferase, HemK
molecule tags Transferase
source organism Thermotoga maritima
publication title Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution
rcsb
total genus 84
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vq1A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vq1A02
2PWPA 3MTIA 2BM9A 2L4FA 2ZLBA 2ZFUA 5EOVA 3OFKA 4RTQA 1NT2A 3C3YA 3B3FA 2PXCA 3FUVA 4KDRA 2QRVB 5LQKA 1HQYE 2P1DA 4C4AA 3E21A 1WGLA 1DL5A 5JI2E 2O57A 3M6XA 3MTEA 5FHRA 4H0NA 2ZZNA 1JG2A 2ZBRA 4X41A 4HGZA 10MHA 5JR3A 2JHPA 2QNJA 2YXEA 2B25A 4RTLA 4QDJA 3TMAA 1G41A 2KNAA 2R3SA 4E2XA 5EHIA 1UWVA 3H2BA 3Q87B 4IWNA 4DZRA 4HG2A 1NE2A 2QY6A 1BHJA 2CL5A 5K0GA 1Y8GA 3OZSA 4XUCA 4A6DA 1OQYA 4ER3A 2FPOA 3DH0A 1VEKA 5B1SA 3MERA 2KHHA 3KQPA 5EEHA 1WIVA 4R71A 1VP3A 4ATNA 1UFZA 4BP1A 1WS6A 3LX6A 1WHCA 3NVMB 5DT2A 2C7QA 3PLAE 3UJ9A 5HIMA 2JG3A 5CVDA 2R0IA 1Y8CA 5HEKA 3M33A 4YV2A 3SR4A 2EFJA 5C9ZA 5KYGA 1G38A 2HAKA 3FPHA 5LSAA 4AX8A 1L3IA 1L9KA 3KQWA 5IH3A 3LCVB 3HEMA 3T0IA 5GIPE 4FZVA 3TKAA 1FPQA 4DA4A 2NP7A 4BP3A 4F84A 5T64A 2Z6UA 2XVAA 4ISCA 3FPJA 2KNZA 1WJ7A 3G88A 2HWJA 3DMFA 3SSOA 1KP9A 3OE4A 4CKEA 3A27A 3ELUA 3G5LA 3THSA 3BT7A 1DO0A 4YV1A 3IHTA 3HNRA 4PIPA 4G56A 5EMMA 2OB2A 5K0JA 2OZVA 2PWYA 2AS0A 2BR5A 4ER7A 3AXSA 5BW4A 1H1DA 5CD1A 2AVNA 4F2LA 3GCZA 4KIFA 1INLA 5BP7A 3B3JA 3ME5A 1E94E 2EX4A 2PLWA 2ZSUA 3I9FA 3L8DA 3M6WA 3MB5A 1I1NA 5EC8A 4YMGA 3DXXA 2GH1A 5HILA 2AOTA 1OAIA 3ELWA 4E2YA 4NECA 4RTRA 2NXNA 1KHHA 2G1PA 1BOOA 4RX1A 5EGSA 1NW6A 1G4AE 2PXAA 3TLJA 2O25A 2E5WA 4GOND 3EVDA 3IV6A 1QAMA 1IY9A 3IEIA 1VEGA 3LSTA 3UJ7A 4PGHA 1YLAA 4RVFA 3UJCA 4BY9E 2K9DA 2AOUA 2JY5A 2HR1A 3GIWA 3PS9A 1KIAA 2V74B 4KRGA 5DTRA 5E2BA 3E05A 5FA8A 4DF3A 5FADA 3FYCA 4GOMD 1D2HA 3NVKI 1X1DA 1SUIA 1GO5A 3O31A 5KS2A 1QAOA 1TW3A 1VP9A 2B3TA 2DI0A 2EJSA 2IP2A 2Y1WA 3M70A 5F2OA 4YUZA 1F4IA 5EPEA 3TOSA 1QANA 3CGGA 1SQFA 3EEYA 3O7WA 3KPJA 4GC9A 2HNKA 1P39A 4WVLA 3BBZA 3G2MA 1TTEA 3ERCA 3I58A 2IH5A 4C08A 3H4JA 2C7PA 5DTMA 2VDVE 3AJDA 4V0RA 4U7TB 3CCFA 2GA9A 2AOUB 1RI3A 2PXXA 3DLIA 3GJYA 3NDIA 3LHDA 5DLYA 3UA3A 2GPYA 2LVPC 3NJRA 1T6OA 3FUWA 5KQSA 3GRZA 3UJ8A 2LVAA 3PTAA 2DKLA 2O06A 3DLCA 1XXLA 4QVKA 3EGVA 3R0QA 3P8ZA 1VEJA 4C04A 1TR8A 1V92A 3LDGA 2I9KA 3FUXA 4GF5A 2DAMA 4C05A 3TR6A 5P8WA 2AVDA 2PVCA 3GU3A 1KYZA 1R18A 3BGIA 2UYCA 5CM2Z 4R8RA 2JZ1A 3TPZA 1QYRA 3GDHA 4FT2A 4AZTA 1VG5A 4KIGA 1JQEA 1RJEA 1WXWA 3EGEA 5BW5A 3Q7EA 5LQCA 3SMQA 3OE5A 4F85A 4M37A 3ER9A 4QTUB 1NBHA 2AOVA 4MTLA 3C6KA 2FRXA 4RTPA 1L3CA 5GM1A 3CVOA 3V97A 4CWAA 1ZG3A 5H02A 4QQNA 2MR9A 1X1AA 2Z6QA 1IFYA 2ZTCA 3LDUA 3PX3A 3HTXA 5HIJA 3RW9A 1G60A 3B3GA 3LPMA 3TM4A 2VDUE 4G3OA 1RI2A 3R9XB 2ZBQA 3DMHA 2QM3A 1WY7A 5GOZA 1YZ3A 3DOUA 3ELDA 2F8LA 3GLIE 3HVJA 5DM2A 1NW8A 5D1HA 3UJBA 3FRIA 2V7EA 3BKXA 4DCMA 1WXXA 4F1IA 2OPBA 4LWPA 2O05A 3PFHA 4GOLD 3MCZA 1ORHA 4R6XA 4RWZA 3UFBA 2IBTA 5LR6A 2XVMA 2VZ9A 5EMJA 3F4KA 5E8JA 5U4XA 4BLUA 5GM2A 1ZMWA 4GUAA 3FTEA 1B42A 2XYVA 2AOWA 4YV0A 3D2LA 1AIPC 5EHGA 2PKWA 2G71A 3P71T 4HH4A 1KXZA 3G2PA 2GS9A 3EVZA 1NBIA 3P9NA 3GRRA 4LG1A 4PCAA 3EVAA 2ZWVA 1G6Q1 3LDFA 1DV0A 3A7EA 4LECA 4X1OA 1WR1B 1HMYA 5DPMA 2G72A 2P35A 1C7YA 1XTPA 1ZV1A 2IDKA 3GRUA 3HCCA 3ORHA 4OBXA 1BVSA 4OQDA 2HTEA 2EKKA 2LBCA 1VIDA 2DNAA 3FTDA 3HP7A 3KQTA 4HRAA 5C1IA 4CKBA 2C7OA 3UZUA 1X1BA 3UBTA 4XUEA 1F3LA 5G02A 4EKIA 4BLWA 3KPYA 5BXYA 1I4WA 3BZBA 4GBED 4JXJA 1IXKA 3DMGA 1OR8A 3HVKA 4EMSA 4WP2A 1EQAA 5LQJA 5K0LA 2ERCA 4QTTB 4PYNA 3EVCA 1TW2A 5D1NA 1XVAA 3RODA 2O0LA 1XCJA 1YZHA 2OKCA 3OU7A 2L4EA 2H1RA 3G2QA 3P9IA 3VC2A 1AQIA 3LCCA 5EVJA 3TKYA 2R6ZA 5F2NA 4RVHA 2MROB 3BKWA 3THRA 3CKKA 4AZWA 2YR0A 1XXHE 5CCXA 1R8XA 2CMHA 4KW7A 5KVAA 5CVUA 3DTNA 3F92A 1R6AA 1BC5A 3U81A 4RTJA 3P9KA 3CJRA 5HIIA 3P2KA 1JSXA 4OQEA 3M6UA 3SVZA 5IKMA 5DSXA 2QRVA 4OA5A 5FCDA 1VPTA 5FULA 2PGXA 1P1CA 1QAQA 2JHAA 3P9CA 1NKVA 5EMKA 3SXJA 4YUYA 2P40A 1HNNA 3GLHE 3VYWA 4OX9Y 3HVHA 2QSFX 1NW7A 3AWIA 2B78A 4IV8A 2YXLA 1KYWA 3C0KA 5DX1A 5E9QA 4PYJA 3MCTA 2C7RA 1OKSA 1N7IA 1IXSA 2H11A 5EQJB 3CJQA 3LBFA 1ZGAA 1ZGJA 1HT1E 3BUSA 2AR0A 4P58A 4QPNA 4LWOA 2GLUA 4PYIA 4WXHA 4X60A 2BR4A 4IV0A 4Z2YA 5DX0A 3B7PA 3BGVA 3MGGA 2CWBA 5EKUA 1ZHFA 3IECA 1D2GA 1JTEA 1NW5A 2WA2A 2Q41A 3A25A 4PGGA 4PYKA 4F86A 2BWEA 3E8SA 3FYDA 1I9GA 2VDWA 3HA7A 2FK7A 1R74A 5M5BA 2OO3A 1RJGA 1JG4A 3B5IA 3G5TA 2I6GA 4QPPA 1MHTA 3REOA 2XYQA 2CKDA 4AUKA 4EVIA 1NV9A 4HEOA 1R8YA 2DPMA 3KR0A 2YVLA 5E1MA 3I5UA 3A4TA 3E23A 7MHTA 1OTRA 2BR3A 3NDJA 5FUBA 4UN2B 5EZQA 5DRYA 1RI4A 5ICCA 4QQKA 3IHPA 1N7JA 2BM8A 3QOWA 4MIKA 4PCLA 3UA4A 4M38A 5FTWA 1DUSA 1KPHA 3LECA 2YX1A 4ER0A 3EMBA 3HCDA 2JNHA 4XCXA 3KQVA 4QDKA 5CUQA 2Z6AA 4RYLA 1N2XA 3DR5A 4Q7JA 3GGDA 3FPEA 3FPGA 2K4MA 1XJ5A 2IIPA 2ZIFA 3AY0A 3GRYA 3HCFA 4PIMA 4PYLA 5CVVA 3ER8A 1M6EX 1AV6A 1F38A 1NW3A 5K0EA 4RTNA 1EIZA 2OXTA 2JH8A 2OB1A 3BGDA 5HZMA 5MHTA 5DX8A 3PX2A 4QVGA 5K0CA 4FSDA 5E2AA 1Q0TA 2AOTB 3DULA 3I64A 3OFJA 4HGYA 4BLVA 2ZTDA 2IGTA 4A6EA 3BWYA 3BWCA 3FPFA 1KPGA 3HM2A 3ELYA 3R24A 3PFGA 4FGZA 3P2IA 3MQ2A 3LBYA 4GC5A 5DTQA 4EQZA 4RTKA 1DO2A 5FQOA 3V8VA 2ZBPA 4RVDA 1M6YA 3HCAA 4O29A 1KYIA 1RI5A 3CBGA 3IYLW 2ZTHA 3PT9A 2CP8A 3M4XA 5DRTA 2OBFA 4HSGA 1KPIA 4Y2HA 2JY7A 1SQGA 4ZTBA 1AQJA 1PRYA 3EEOA 3G7UA 2P3OA 5K0BA 1FBNA 2AN3A 5K01A 3EVBA 5LQAA 2ESRA 1FP2A 3C6MA 4ER5A 3KPVA 2DULA 1HJPA 1ZKDA 1RI1A 4P7JA 1ZMVA 1P3QQ 3T7SA 1O9HA 2G8NA 3GLGE 3DP7A 4P7FA 2I7CA 2H00A 4R05A 3LKZA 1P91A 2P3QA 4RV9A 1IM8A 4XUDA 5EZSA 3FE3A 5HFJA 1SG9A 3GLFE 2AOXA 4MWZA 4RVGA 2EJUA 3OU2A 5JUWA 3QOXA 1JSZA 4E2WA 4HTFB 2WZJA 3LL7A 4CTJA 3KQQA 4CTKA 5DFLA 4DMGA 3M6VA 2IDJA 1EAMA 4P7GA 2IPXA 3LGAA 3LCUA 3FUUA 2IH4A 1ZQ9A 3HA3A 3KR1A 3AXTA 2DENA 1XCLA 2OOAA 3JWJA 2WA1A 5DXJA 2MGWA 3NTVA 4POOA 4YUWA 5HOQA 3EVGA 4RTMA 2IH2A 4RTOA 2BH2A 2AN5A 1DCTA 4OBWA 1JTFA 2HWKA 2CWWA 2KW5A 2QYOA 1XDSA 1VLMA 3HCBA 2JP7A 2ZIEA 4P7KA 3KQOA 2XBMA 1JG3A 2ADMA 2ZIGA 5K0NA 5EIFA 1O9GA 2PX4A 3A26A 4M7RA 1UFKA 2P7HA 4HC4A 5HIKA 1U2ZA 5CCBA 2MJ5B 2NXEA 4PNEA 3B89A 4ER6A 1EJ0A 4K6MA 3KR9A 3TFWA 5ICFA 1R4GA 3K9OA 4PONA 3SSMA 4EKGA 2ZCJA 2DAGA 4E30A 3X0DA 2AZTA 3I53A 1HT2E 2FYTA 8MHTA 1JQ3A 3GWZA 3E46A 2IFTA 3JWHA 1CUKA 4AZSA 4EK9A 2YTZA 5LQUA 1SKMA 4PYQA 2EKFA 3EMDA 4UOEA 5GINE 2H5XA 1X19A 1IM2A 3MMPA 2O07A 1JR4A 1Q0SA 3K9PA 1YFLA 2ZWAA 3GRVA 1RJDA 3T7TA 2UYOA 3EVFA 2NXCA 2YQZA 2JY8A 3FTCA 3K6RA 4X63A 2DAKA 3CJTA 5FWAA 3FZGA 5K0FA 3SM3A 2ORED 9MHTA 2VP3A 2BWBA 3FUTA 3KHKA 2JY6B 1SUSA 4U7PB 1YUBA 1UIRA 1G8SA 5F2KA 4PYMA 1PGYA 4AZVA 4DQ0A 4GEWA 4KWCA 4CXMA 3VC1A 5K09A 3KQSA 5FA5A 2YXDA 5DM0A 4DBGB 2LVOC 1MN3A 1WZNA 2L2DA 3LKDA 3SSNA 2UYHA 1FJXA 5EEGA 4R8SA 1PJZA 2LD4A 1MJFA 3PB3A 1VL5A 5LQNA 1X1CA 3MAGA 2PJDA 5DWQA 3P2EA 2BZGA 4YMHA 3GO4A 5GWXA 2AN4A 2YUIA 4GQBA 3TQSA 3OPNA 3MHTA 1JQDA 3TM5A 3KR2A 2OO9A 2JJQA 2PV0A 5GIOE 4E33A 1EFUB 3R6TA 2GB4A 4RTSA 4YUVA 2LTUA 3GXOA 3KQMA 5K05A 3RIEA 3WSTA 4X61A 2HV9A 1P1BA 2JHCA 3C3PA 4RSRA 3NWEA 2PSSA 3T7RA 3FRHA 2P7IA 5T6BA 3R3HA 1SVUA 3KQYA 2NYUA 3DXZA 2FHPA 3E7PA 4PYOA 4V0QA 2UYQA 2B9EA 2PX8A 2QHOB 1G8AA 4FSXA 3ANXA 1Q02A 4PINA 4R6WA 5E1BA 2P8JA 2UZ4A 1G3IA 5E1DA 3PVCA 2A14A 3BWBA 3UJ6A 2DAIA 5E9WA 5E1OA 3S68A 3TRKA 2P3LA 3UJAA 2HMYB 5EKXA 3G2OA 1FP1D 3HCEA 4KVZA 2DAEA 1YB2A 3OU6A 4C07A 5C0OE 3EVEA 3NWBA 2LVNC 2PX2A 3ID6C 5DM4A 4DM3A 3HA5A 4E31A 2OOBA 3VSEA 3O4FA 1EG2A 1T43A 5EIWA 1ORIA 4L7VA 4IKPA 3KPUA 2PT6A 2G3QA 4PWYA 4C06A 3KKZA 1D2CA 2ZVJA 5DXAA 2Y1XA 2EJTA 2LVQD 2PY6A 5K03A 4DCGA 3BWMA 5FQNA 3KU1A 1XDZA 4GEKA 2EG5A 3JWIA 3P97A 2ONYA 3BXOA 4CKCA 1VBFA 5ICEA 1QZZA 3EPPA 2OYRA 2FCAA 2P41A 2DHYA 5DSTA 2VS1A 2XYRA 3OZRA 1WG8A 1XDUA 5EMLA 5LQRA 4FR0A 2ONZA 3FTFA 1G55A 2K0BX 4FP9A 2PT9A 3UWPA 2G70A 1A5TA 5E8RA 4M36A 2JZ0A 3CC8A 2NNWB 4OA8A 4E32A 5KQRA 2ZZMA 2PBFA 3DUWA 1YF3A 1Z3CA 5EG5A 1EJ6A 4E2ZA 3NW9A 1VQ1A 4GOOD 2FK8A 4E70A 1KR5A 3QV2A 2B2CA 3SGLA 2NP6A 1XB2B 2RRUA 5CIYA 1JG1A 1TPYA 2NXJA 5CVJA 1BKYA 1NV8A 3NMUF 3HVIA 1M0EA 1L1EA 4FS8A 2ZULA 2ZW9A 4MQ4A 3OCJA 1VDLA 4B17A 2PX5A 3A7DA 2KNVA 3JWGA 3DXYA 3OZTA 2JH9A 5ERGB 2N47A 5CVEA 1VE3A 5FWDA 5GP1A 2JUJA 2OY0A 1YFJA 2GAFA 1WGNA 1L3BA 5DM1A 2DZLA 3SX0A 2IBSA 4HTFA 3G89A 4DKJA 4MHTA 1AF7A 1R00A 3EGIA 2ZZKA 3K0BA 3KPWA 5ICGA 5K8VA 4C03A 3GNLA 5E9JA 3G8AA 1O54A 2WK1A 4KDCA 4YUXA 1QZEA 4FT4A 2I62A 1V39A 2QE6A 1RJFA 4Y30A 5FHQA 1ZMUA 3T6PA 2CMGA 3UJDA 3G8BA 5T67A 1JR3E
chains in the Genus database with same CATH superfamily
1UKVY 2X77A 5K9ZA 2PPLA 2OK7A 5TR9A 4CL2A 2IYNA 2QL7A 3KSJA 1P5HA 2OFPA 1SFRA 4L9SA 1GPKA 3TUJC 3O1LA 4F21A 3RBAA 4DIEA 4Q9IA 2VHYA 3WC4A 4H0NA 3EK2A 4G09A 2AHRA 4ZREA 3WKCA 5AI0A 4B3FX 1C9DB 3NH6A 4ILEA 4URZR 4D57A 3DDHA 3FMVA 1CIPA 4PZ9A 4MVCA 4LMBA 3M0EA 2ODNA 3Q40A 3DAYA 2CVQA 4DJTA 2D0IA 3AP2A 4MVYA 4ROSA 4HN4B 2X15A 1NMZA 1KZ1A 4IJMA 4B7FA 1GYPA 5B1SA 1YVDA 4DV2M 3N2KA 4FEAA 3IOCA 1QIIA 4PAMA 5KWSA 1RQNA 1EVIA 3QTTA 4NFLA 2QJOA 3PLAE 4TYWA 1V37A 4L6IA 3SMPA 3AF5A 2KHZA 4BKUA 3ZDBA 1N0UA 5TJHA 3DF7A 5CW1A 2OQVA 4HRYA 4BFUA 4I1RA 1X2EA 1BXRA 2AF3C 2QV7A 3DLTA 1L3IA 3KLOA 5GIPE 4ZGGA 2PUEA 5AXBA 2BZSA 1G5FA 4FHFA 3ECSA 3GJ5A 3DCYA 4AU1A 1HGXA 4CCSA 1XPRA 3MJCA 5IKEA 1Q7CA 2Z83A 3L79A 1XL1A 3PRHA 4U5QA 1FDIA 5CK5A 3UB4A 1JJ7A 1Z6TA 2R7KA 4BDSA 3QXHA 4E7OA 2RD2A 2KNZA 3ND5A 5BUCA 1Z29A 1NU6A 3F8SA 1UZLA 5AI5A 3QTLA 4U0JA 1CY7A 3E5NA 2GJ8A 3LMMA 2AT1A 1LTQA 5CA0A 4Z9XA 3C3XA 3FH0A 4GR4A 4U2BA 5GAJA 1UC9A 3JCZA 1R0KA 4W7SA 3U48A 2GWHA 2VDWB 2ATIA 3UVEA 1A5ZA 3GCZA 2BGJA 5L3QA 2D1YA 2VTEA 3B3JA 3T9DA 4Z7NB 1NASA 1PE0A 2WB4A 3CNOA 1OU0A 3JV7A 1SURA 2OTCA 2RAUA 3DHEA 4RJ2A 5CX1B 1KDYA 1TUBA 4DY4A 4YMGA 1E2HA 3E2IA 1DIHA 1OAIA 2D2IA 4NECA 1ECFA 2ECOA 2FPRA 3WKEA 2FMFA 5BSGA 1E3WA 3H1TA 4LI0A 2B61A 3PNLA 3D2CA 4H1UA 4GOND 4IFEA 1HKHA 1Y4SA 4D8YA 1J99A 5BSVA 3S7TA 1BXZA 1YIOA 1IEQA 4B4KA 1WHTB 1U3WA 2BE7A 1I24A 1FX1A 3PS9A 1Q0QA 1H5UA 3AJEA 5FWXB 1K75A 2ZJFA 3MFQA 3ZZNA 5K4GA 2GLXA 3T12A 3COSA 5A5FA 1VP9A 2F5SA 4IILA 1ZVMA 3QVGB 2FFJA 3AB3A 4PE5B 1SA0B 2Z2YA 5AUOB 1IK4A 2WABA 1P9LA 4HGOA 4CQLB 2FX2A 1U94A 1QCYA 2OK8A 5DGDA 5FTNA 1TM2A 2DBRA 2QRNA 3RS2A 1PUXA 2OM2A 2W8BA 1FDOA 2BFFA 2PRIA 1JB1A 2R84A 3H17A 4P36A 1XQYA 2OCLA 3A4YA 3I58A 3LVBA 3H4JA 4ZVRA 2X0EA 5I4BA 1M2OA 1WUIS 3ZY4A 1JYFA 1K9SA 1NHGA 2XLCA 4I6GA 3LHDA 5DI9A 5LKRA 2Z43A 3GG9A 4CT0A 3JR5A 5H83A 3UJ8A 2OWDA 2RHBA 2Q46A 4TV9F 4CM1A 1R37A 3LQ4A 1NXPA 3GRPA 2MYUA 2MSCB 3BQNB 3TAHA 2ZSAA 1D2NA 3AOEC 3L4BA 4GBMA 4UXIA 1EFCA 4O2AB 3JD4A 2XUHA 3ZV4A 1OB2A 4OI2A 1TECE 4ZMRA 4LXTA 5FAXA 3T35A 3TX2A 4EL0A 4N0DA 4L95C 3LYLA 4FHEA 5EYPB 2VEDA 3CW9A 3HZHA 3S8MA 2HJRA 2DHRA 2Z4SA 3BRSA 4YDRA 3WFZA 1RJEA 4H59A 4BGIA 4CM7A 3U16A 1Y8QB 3AEQA 3JAKA 3QQ5A 5CJJA 4YP1A 2G0AA 4QTUB 1NN0A 4P5DA 5G0TA 4JENA 4RTPA 1L4KA 2Q5EA 5HKLA 1NMSA 1TQ2A 3E4RA 3VUFA 4BFXA 1A7UA 3TR5A 2DQKA 4JI3B 1M54A 2CLOB 5TQ0B 1Q0LA 4FLEA 3ZU3A 1P61B 1US8A 1QR2A 1V96A 2VJOA 5L4SA 1CP2A 1EJ2A 2GKGA 3ZWDA 1C4OA 1FW8A 3CRNA 4A10A 4ECAA 4LF9B 1OVMA 2FOIA 2PUJA 3Q2KA 1K7YA 3INRA 4NP6A 4Q4JA 4D79A 4DCPA 2W6NA 2FI1A 1Z6PA 2HRCA 1JECA 4B85A 4CMAA 2XA9A 4UUAA 2I2WA 2Y0EA 3HV0A 3AIOA 5CLQA 4A1OA 3T54A 1DQSA 2XZTA 1UODA 3O0TA 4DG9A 5I9NA 2VZ9A 4HNQA 5L51A 5E8JA 3W8RA 1Y0BA 4J9VA 4D9IA 5EQDA 1E2KA 3DBRB 4W5NA 3ZTWA 4YR9A 4Z4GA 3P9NA 2R25B 4ZN6A 4LSGA 2NVOA 2ZWVA 1OAOC 2Q3HA 1C9EA 3K30A 1WF6A 2NNLD 4WK0B 3U6LA 1ISJA 2QZSA 3W1WA 3VBCA 5TGZA 3KM0A 4IX1A 1U81A 4U1RA 1N78A 3QYFA 3SOZA 2EKBA 2X5XA 4J07A 1F1JA 1FSPA 4I9GA 3WAGA 2H52A 1R10A 4BLTA 4YRBA 3K94A 4EKIA 2X3YA 5E7IA 1LB1B 2WHRA 3ASUA 4YAEA 4M46A 2BSAA 1KSGA 4BMYA 5ENZA 2B8WA 2PL1A 1EQAA 3JYHA 4LZAA 4ENRA 2CSXA 5HKKA 4MJ7A 3WQRA 3E03A 5CLIA 1F2TB 4UEQA 1P0MA 3I0NA 1VHTA 1GZ6A 2PCLA 1M8JA 3FIUA 1XUOA 2P3SA 3NYIA 1VFPA 2OXEA 2Q1YA 1DXOA 1LLUA 4JHLA 4JKYA 4Q9NA 4AUEA 1IZ8A 1I9CA 5ABPA 4LCJA 1DZ3A 2R6ZA 3RM3A 2BMAA 2VSYA 3BKWA 1WVIA 2G77B 4X93A 5AH0A 1PF7E 5I8ZA 2YR0A 1AZLA 4E88A 3FDFA 4ETWA 1UBMS 1BMDA 4Y9SA 5HZHA 3ZXUB 3DTNA 3F92A 4EHHA 1T6NA 4XLLA 2GBCA 4NV1A 5CU7A 3WRYA 3W5CA 3NV7A 2DWUA 3ONDA 4GM1A 2V7BA 4EUHA 2Z4RA 1IATA 3WNBA 3EBOA 2FE8A 2Y4NA 3W6NA 2I71A 4QUIA 1BYUA 4PYJA 4RD4A 3SHTA 4UEJA 3M4JA 2ZUBA 4B1FA 2FEMA 4ISBA 1GTG1 4HADA 2R00A 3C3KA 4OJQA 5EMNA 2BEUB 5JMWA 2VP0A 4P4SB 4Y9RA 1XD2B 2BR4A 3RVMA 2RFLA 3AU8A 4JB3A 5K8LA 1XMOB 3LHSA 4X1IB 2R4JA 3IECA 1EM6A 2A1TR 1B6TA 3EGDB 4NE9A 4IOJA 4UU8A 3RI3A 4F86A 3UMVA 3RSZA 1BS1A 3HA7A 4EPWA 2A9OA 2XD9A 3AG5A 4GPIB 1DO8A 3ENNA 4Q7JB 1AKYA 4QHYA 3SHQA 1JNXX 2FZKA 3V6MA 5U1PA 3ZI4A 2DZDA 3VV2A 3VH2A 5IBCA 5K6RA 4WINA 2QRHA 1TTPB 4P3XA 3WL8A 1ZCZA 4XM0A 4EKEA 2ZDQA 3IP6A 5EWMB 2XGGA 4NPAA 4XQGA 3WIUA 4YDSA 3OWOA 4M89A 1ODFA 2E4WA 1M2KA 1GNVA 1GG8A 4M4SA 3WZ2A 3QVTA 1DC3A 2OXIA 3LSYA 1DAOA 1E3LA 3HEBA 4F4UA 5EL0A 2PQ2A 1QV6A 3O2SB 1XC8A 1QRDA 1BXGB 1YZVA 3WK4A 1EXDA 4DR2M 3QSYA 2JCBA 1A4IA 2J9XB 3NTRA 1N2XA 1PP4A 4Q7JA 1FDTA 2GN0A 3I0MA 2ZREA 3M5CA 2X8WA 1R9NA 3O83A 2IA5A 3T1VA 1SHLA 2GA8A 3HUTA 4M0MA 1OC2A 1U7PA 1MCZA 1JE0A 3OT1B 2JEOA 3ROMA 3UQYS 1JS1X 4ARSA 3VZCA 1LLCA 2DETA 4NG5A 5AJUA 2X5NA 1SXPA 4W9RA 4HQNA 3VO1A 3WL7A 4YGYA 4PPFA 2VHCA 3N2KB 3EXEB 5D01A 4I8OA 4YJ2A 1GFZA 4RKFA 4KTTE 1P5JA 1D1SA 1BS2A 2X8JA 2R8ZA 5G1PA 4IOKA 3DZJA 4HJRA 4LBZA 4J9UE 1Q95A 2CJPA 3VYUB 2DUUA 1C0IA 1ZM2A 2ZBPA 1V8DA 5K1ZA 3VU8A 4BRWA 1XLWA 4NCAA 4OM8A 2B8TA 2JIZD 1E0KA 2QJTA 1Z2NX 3TOVA 5A9RA 3E9EA 2RGCA 1JIVA 5CA1B 1FBNA 2Z1MA 1N2IA 3GAZA 2OGWA 2XGJA 2ZS9A 2O8DB 3KJHA 1X0VA 5KC8A 3KPVA 4GL4A 2FVXA 4I4CA 1FFGA 4PLFA 3STWA 2GPTA 3KKQA 4Q00A 1M1XB 3C74A 3IIEA 1E5LA 4LF4B 2H0RA 4JYBA 4HAOA 2EJUA 1OX5A 3JX9A 4FMCF 4NMWA 1JGTA 1T2VA 3TL4X 1SULA 2IPXA 5LB2A 3FUUA 1ND6A 2VP5A 4K81B 1PGOA 2DJIA 1M6NA 5GOTA 2HFKA 2KX7A 1VA4A 2WA1A 2OYSA 1VCMA 2VSFA 3JYPA 3AKDA 2X40A 3JVEA 5JALA 3NFRA 2BFNA 3TZ6A 4ENUA 1E1DA 2PX6A 4O4IA 5JWOA 2NYVA 5CB4F 2WE7A 2XMGA 3CNNA 2WU0A 3TEFA 2OGSA 5HFAA 3TPFA 2VHEA 1M0WA 1W0JD 3N5CA 3KWLA 2WD9A 2F4VM 1HYBA 2P7HA 4M49A 6REQA 3TG8A 4IIVA 5DBEX 1OWOA 3H3FA 1U11A 4M22A 2X9LA 5HX7A 4RAQA 4Z4IA 3RUDA 2ZJ0A 4LJ4A 4BMPB 3HCRA 1SQ6A 2ZIXA 3E9DA 3MVEA 4WN9B 4DMFA 5AM2A 1VM6A 1U1GA 2OV2A 5IC5A 3ASZA 3NBFA 1A5BB 5LLSA 3ZU2A 2ZRAA 1TMYA 3ZK7A 4PYQA 3UJHA 2G7MC 1EE2A 3EMDA 5DYTA 4UM7A 1IM2A 3U6QA 1U8ZA 3MAAC 4R5HA 2BUCA 3ZK8A 3U39A 1XNRM 4HS4A 1R9MA 2YQZA 4LY0A 2CCJA 2Y99A 2JJ1A 5HS4A 4WTOA 2H17A 3MK6A 2M1XA 4HDKA 4Z4QA 4BRUA 1KAGA 3GA5A 4TSFA 1G8SA 1CY6A 4WKBA 5C8XA 4NCJA 1C7EA 2UZAA 2G4LA 3HJNA 3ZCVA 5K09A 1GPDG 1GAQA 4NCBA 2R79A 3GMSA 1Z6AA 2A57A 4MM3B 2D5AA 4V38A 4YNBA 1CC1S 1NSYA 2NZUG 3O8OA 4MQFA 3CH4B 4M1YA 3H87A 4Q3OA 3GI1A 5HJ2A 3WYCA 1VL5A 1YCDA 2MOKA 4BV3A 1YOVB 4JA0A 1GABA 1T8SA 2HSGA 3DOEA 4L3VA 4RK4A 5ED4A 1KFCB 4GH5A 3E9ZA 2CXRA 2V9ZA 3NS7A 3Q6MA 1ESDA 4IY1A 1H2WA 2JJQA 1C8BA 3D7RA 1SCAA 4WIAA 3IPXA 2I2AA 3QYJA 2Y0QA 2HA4A 2GKOA 1RBZA 4CQJA 3C3PA 2PVPA 4XLTA 1NN1A 2V7UA 3PRYA 1KJWA 1LPPA 1JHRA 2EBUA 1JI0A 4D9NA 4O2RA 1RWWA 5C7YA 1JPVA 2OORC 1KY3A 1TU3A 1Y9JA 3EHEA 3QKRB 2KXEA 2VBIA 4MPDA 3DZ8A 3K6SA 3EIOA 1P72A 2P5UA 2UYQA 4GLJA 2H1SA 3F5DA 3N6XA 1L5HB 3EZYA 2A14A 3CR7A 3ILXA 4YP5A 1GRNA 2DAIA 5BSUA 3UJAA 3E7FA 5LD2B 4KTVE 3VR5D 3VRHA 2HMYB 2VATA 5BR7A 2OQRA 3C48A 2BT4A 4JI3M 4RL4A 3DGEC 3KLBA 4CM4A 2BFCA 3FOBA 3ZU4A 3TJZA 4MPRA 4GECA 3EDYA 4OL0A 3VSEA 5LNK6 4F4IA 3AO0B 2BDEA 4Q39A 3EXFB 3RR2A 1Y3FE 3AEKA 1B74A 2WYWA 3DO8A 3OLXA 3QXGA 4GT1A 4JQCA 2NTJA 1HOTA 4O2LA 5GONA 3EGXA 2Q3MA 1CY8A 1T4MA 2Y1XA 2PY6A 2WNHA 1D0SA 3C16C 2JDIA 1D4FA 3O2QB 3KCQA 3OPQA 4A91A 3K8ZA 5LCXA 1BWPA 3I12A 2FF7A 1HC7A 1KKLA 4CFZA 5I6DA 2IPLA 4D8UA 1P2GA 5FTKA 2NO9A 5F1PA 3Q3VA 5ICEA 3O8LA 3TDKA 4DMMA 5EMLA 1WG8A 2RGUA 2XMRA 1EP3B 1USKA 3NIFB 4WNCA 3RTDA 4FR0A 4J0GA 5J9FA 3AKEA 3FR7A 3VYSB 1V95A 3CCBA 1M2GA 1TEHA 1WM1A 1V26A 5H5JA 3LXRA 2IUUA 3CVYA 1DADA 4AT1A 3OZGA 4G0MA 4F5ZA 3DDZX 2OZPA 1IHYA 2IBMA 1WB9A 1Z3CA 2JBWA 4RE6A 1G98A 4HMOA 4KB5A 4UEOA 1DWOA 1NXSA 1UBGA 1P5FA 2ZYSA 3C2QA 2UYYA 2Q9BA 2ZULA 3HZOA 2Z3ZA 2R8XA 4R1TA 4GI3A 3D3WA 3U3XA 1BX0A 3CLVA 1C9NA 5KYUA 3OZTA 4QL3A 4C0SA 1GN9A 2NACA 1JF8A 4XZ3A 4DMRA 1YFJA 1KO1A 2Z7JA 3N6RA 1TO1E 2BBWA 3KLMX 4GLBA 2ZJ7A 5BN3A 2QAGA 3KPWA 2DY0A 1N8TA 3EZLA 3TLXA 3U26A 1GRCA 1CLUA 1FU4A 2BGRA 2E1RA 4XFKA 3RVPA 4CLXA 4CKXA 4RULA 5JO0A 3MHPA 4TRJA 2CE2X 4MUKA 4GMHA 6ABPA 4WFJA 4KI7A 3ZGZA 3BWDD 5GGXA 1NT2A 5TF0A 4ZDIA 2C5SA 2X19A 3M4YA 1YBAA 1W5TA 1M5TA 1DL5A 1DTWB 3NBZC 3UT0A 4D8TA 4QRIA 2C04A 3GX1A 2AYZA 1TZMA 3LA6A 5EJCA 1K6IA 1RLUA 4FXOA 4BN5A 2QTWB 5I51A 3O4HA 2CLKB 4PAOA 1W5EA 2G9QA 1G41A 2J3DA 1P1RA 2DM6A 2ATVA 1DEKA 2XGNA 3MMZA 5DVZA 4GRIA 2X0FA 4DUGA 5FWYA 4DR5B 4WQMA 5DYYA 2MCFA 4MP3A 3RFXA 3NWPA 3T7IA 4YHHB 3BQ9A 4XDYA 3BEOA 4LQCA 4J2OA 3HYNA 2C5BA 4YFYA 2XODA 3FDZA 3OQ1A 3OLQA 3SSAA 3WWYA 4AL4A 2WF8A 2H1OA 5GZ1A 4TKZA 1B6SA 2WILA 3JZFA 2A9PA 3RHSA 4DWJA 5E4TA 4NNOA 1DLIA 2H3HA 3U7FB 1XXHB 1TMGE 2X9NA 3E81A 4IIUA 1Z74A 2VF2A 1FYDA 1I4DD 5C37A 3SR4A 2EFJA 5KYGA 4KNYA 1DGHA 3FPHA 1P17A 4PF1A 5DF1A 5KNDD 2C78A 5KNLA 1X1SA 4ZP1A 1RADA 3K35A 3TKAA 1SCUA 2XWPA 3GLIA 3GR6A 5KX5F 4BWVA 2F7SA 1ZJJA 2WWVD 4AD8A 1J8DA 2R7NA 1T5TA 3TZHA 3MS4A 3BWXA 1XDGA 5H37D 5K6AC 1M1YB 1YU6A 3JWEA 4J0IA 4KVAA 2A5GA 1C3OB 1PLKA 2G1UA 3RSSA 1J8YF 3IUMA 1RU3A 3U7JA 5JW6A 1UJ6A 3E15A 2FFRA 4QBIA 5T8KA 1XZHA 1ATZA 2C1ZA 1I2ZA 1NNUC 3QWFA 3N8DA 2W6QA 1Y3DE 1Y6ZA 3I28A 4O1HA 1N77A 4ZU6X 4BVAA 5BMVF 1EWQA 5A0TA 3V1YA 2IOYA 2CLMB 1QH9A 3LOQA 4BNIA 1BMFD 2WV7A 3AETB 4YRLA 3X3HA 3I9FA 4OVKA 1A3CA 3H5VA 2GCGA 1QQ5A 5ANRB 1LNQA 3FZEA 1KF0A 3T3DA 5G3YA 3IILA 1P31A 2G1PA 3ZCBB 1K7XB 1NI4A 3AR8A 3FROA 3GUHA 3TECE 1C41A 4IQ0A 1WHSA 4CR7A 4DPKA 2DXIA 2NO0A 2O0KA 3MLBA 5AFSA 2O7NA 1V8OA 3KVNA 2QD4A 2YUTA 4KQGA 4GE3A 5DISB 1SU6A 4EUEA 5FPTA 1CDDA 2GN4A 4FFVA 1QKJA 4NZMA 4DF3A 4YR7A 3LL4A 1R5BA 3EUWA 4PN3A 3P0JA 4CLDA 5EXSA 3O5AA 4XJSA 1O1YA 3I9NA 3RJMA 1N34M 4E09A 3G0GA 1QKIA 2A6PA 4MGZE 1KJIA 4B3RM 2OO5A 1NJ1A 1E2DA 3KFVA 1KXJA 5KNBA 2CJWB 4X20A 1A8UA 3UT5B 3D8RA 4I1YA 3P9PA 4EHFA 1W0JA 4K9QA 4B3CA 1UF9A 5E26A 3LV8A 2FJUA 4MH0R 2WKRA 2QMOA 1OBFO 4RADA 3JTMA 4L15A 3TRFA 3WOHA 5LIPA 2AI1A 3R7BA 2GCEA 2CEAA 1PJ3A 1U31A 1YBFA 3ZE9A 3C5WP 4V02A 3NHUA 3EA4A 1T5DX 1YXMA 1G71A 1E79D 1XVUA 1V33A 2HM7A 1P7CA 3PTAA 4XX0A 4K9LA 2O06A 2HF7A 4DA9A 2O2DA 3O8DA 1OH8A 1JJIA 2IUFA 2XFSA 2ZAMA 3P8ZA 2F4VB 2DTEA 5FOTA 2EA0A 4DTIA 4HUTA 1ODTC 3ZIDA 4RL6A 3LYUA 3PGLA 4C05A 1NSTA 4CM8A 5KYXA 3WLFA 1G2QA 1AKRA 4NK4A 1TJPB 5KI6A 3KJEA 3BGIA 5CM2Z 2VHUA 4GKJB 1GSAA 3LG2A 4Q03A 5KDOA 4G5FA 3NHRA 6CHYA 3KWFA 2K7ZA 4QYIB 2GOYA 3VZSA 4Q05A 1EXNA 3EPJA 1J0BA 3BMOA 3DHWC 2OGZA 1PR5A 4LDRA 5FLEX 5ALVA 4MTLA 4DXHA 4ZCSA 4AY2A 1TPZA 5FYDA 3EC7A 4PN7A 5A4MS 1GRQA 1XKLA 1WTAA 1Q39A 4HZIA 3V9PA 1GGJA 5FXMA 5ECWA 4CMEA 4X45A 2QPTA 1IMJA 1QXSA 4AC9A 2VDUE 1RI2A 4P0QB 4G89A 2PUHA 5EE3A 1E77A 3GFBA 4MWGA 4CQMB 5KYKA 1V1MA 2D4AA 3LW8A 4FNGA 1Z36A 1ISGA 5FEUA 4OXNA 1K27A 4LCEA 4RZXA 3QUTA 2X9QA 5CGQB 1K8XB 4AZ3A 2XZLA 2V45A 3OFND 2GASA 3SQDA 1J5EB 1QUSA 4NESA 4IZOA 2DFDA 1A2QA 2PSJA 4A4DA 4N5MA 1EZ4A 1X7WB 1MIHA 3ZN2A 1FUYB 1AIPC 2CHGA 2P0YA 5EHGA 4E21A 4B8WA 1BH6A 4R69A 3RC7A 1KI2A 3X44A 4BMNA 2NVBA 4NOKA 3WRVA 3B2NA 3WNQA 4IXNA 5A3QA 1N32M 4IUDS 1G5HA 5ISMA 1UR5A 2TMKA 2PLNA 3R7LA 2NV6A 2PZBA 1TKAA 1X1BA 2QN2A 3DBVO 5AVZA 1LC0A 1D9ZA 1MZVA 2I8CA 1YJQA 3L9XA 3FZQA 3P2JA 4QOGA 4RVOA 3JQ6A 2YHIA 3E7XA 4NHEA 2KW0A 1E2FA 3TLBA 3VYVA 1WEHA 1SC3A 2RGNA 4PYNA 5DCUA 5JBNA 1ULZA 1FOEB 3DCIA 5CAEA 4K9OA 1J5EM 2WFAA 1QHEA 4I4NA 5FKJA 5BQPA 3V48A 3L0YA 5EIOA 1KEKA 1V7PC 3LZ6A 1D3AA 1KI9A 4OM7A 5FUXA 4MGHA 2JRCA 2R66A 1D0VA 3IB6A 5LMZA 1YK0A 3KYCA 3GD7A 3REFA 3IQEA 2J6IA 2GEJA 3E5HA 3IIJA 4JR1A 4MW4A 3ADDA 1T6BY 1HEUA 4FUQA 2XDAA 4IJ5A 4HYTA 5EIXA 4OA5A 1KJQA 2W6PA 5ERYA 5EN4A 1RABA 2AW5A 1EH5A 5HBRA 3SXJA 4AJOA 1LK7A 3VYWA 2WIBA 1DBVO 3QXCA 2P0AA 4KO4S 4LOKA 1UBUS 2HAEA 2O2XA 2NYAA 3VU0A 5D6OA 3I1FA 4W63A 1GCAA 5FIUA 4F92B 5LUAA 4C43A 4F38A 2H1VA 4XPIA 1HT1E 3VC7A 5IZCC 3UB3A 4K3VA 1NVVQ 2HCRA 2FWMX 2ZDHA 1T3ZA 4GICA 3ESDA 3CN7A 4TMTA 1X7YA 5I01A 2ZT5A 1T3GA 1PTJC 5LQDA 2ORVA 3WLMA 1O4VA 3EN0A 1K06A 1W88B 1SBZA 1W30A 2Q5IA 3A36A 3D5TA 1BWQA 3L7LA 3V1NA 2GM9A 3QBTA 4B2YA 2R8EA 2YHIB 2H51A 4EY8A 1ENPA 3DGFC 3PFIA 3GCDA 3QU9A 1ZIXA 3TLGB 3A4TA 2XQVA 2VUHB 2FPLA 3AI3A 5BV8A 3A28A 3U6BA 2JGNA 1EQUA 1EUZA 1AKVA 3PHGA 5CEJA 2Q1XA 2EKQA 1KYXA 3TUZC 4W5QA 1C3EA 2J3QA 1Z62A 3ZD9A 3H42B 3DBIA 4AROA 1HR0B 1F1BA 5CUQA 3RUPA 2B21A 2JFFA 3IVMA 3QMPA 1JHMA 5SZKB 3FPGA 2JARA 2PGAA 4MR9B 3QV1A 5DGXA 5K3FB 3QLVC 3CG0A 4HAUA 4UM5A 1VJ1A 3PWZA 3G0BA 3FWNA 4O59O 4X20B 4F56A 2CVFA 1A2BA 1G16A 4QX6A 4S1VA 3VZRA 4LS3A 1TVEA 4FDLA 3PX2A 2JLYA 4ZAGA 2ZRKA 1N25A 1H0SA 2X86A 3M9WA 4PO1A 4Q7LA 3W9BA 5DSZA 2RI1A 3I64A 4F0JA 3HFRA 1XQXA 1YJAA 4KQ6A 1DC5A 1O96A 3IRUA 4YJGB 2Z95A 5CA1F 2LBPA 4CQMA 1Q7BA 1ZA2A 2GZHA 2W2OA 3OX2A 1MV8A 1QV9A 1DFIA 3GPIA 4P17A 4P35A 3IYLW 5DFAA 4ZAFA 1WA5A 4BRZA 3WLQA 5BV7A 5AW4A 1C1DB 1KPIA 1YKFA 1L4BA 2GVNA 5EXEA 4L8GA 4JC4A 2CN1A 5EIAA 3RFFA 5FOQA 3K70C 3VHQA 1UDRA 1V1RB 4XDZA 2DULA 1ZKDA 1I3CA 3B38A 3IXQA 3OSUA 2A9KA 2ZCVA 4C4ZA 3L5KA 4LF8B 5DHPA 1BQEA 1UMDA 3QM1A 3DD5A 2AOXA 2OAGA 2E2WA 3DNMA 1LNZA 1XCGB 2BGNA 3KSBC 4GUDA 4D74A 4JLJA 2ETXA 3KKKA 3K0AB 5C18A 1ULBA 1E92A 1XO1A 1N5RA 3AHCA 2PYDA 3BD8A 1VPLA 3PGMA 1GNPA 4GBJA 1HKUA 4QE3A 4JCCA 2WSIA 1QVRA 4BZZA 3NCHA 2MGWA 2FUNB 3Q2OA 4G0OA 4LBYA 1IONA 2C3PA 2QLJA 4MV8A 4H2DA 1B1AA 1XWWA 4BQQA 3ZDXB 3H99A 3N0VA 4MCIA 4R4JA 3IUSA 4WBNA 3OECA 3HCBA 1OB5A 3EG9B 1VZ2A 1CJMA 3ZW8A 3CUVA 3F8TA 1XRSB 4OSPA 1YDEA 2CXHA 2XSZD 3EZ2A 2JD2A 5DHQA 1N6LA 2WJVA 3KAQA 4WGGA 2D00A 4KWHA 1CUAA 4K0RA 4PNEA 1NQAO 4M1ZA 3IDAA 2Z8YA 4EY6A 2E18A 3II6X 3FBWA 5ICFA 3AESA 2LKDA 4OB6A 2OGUA 3CIFA 3JAKB 5TT1A 5HSGA 2X4AA 1ZM9A 1JIKA 3DW1X 3VR1A 3AR7A 4WNAB 5CDSA 2RH9B 3F74A 5TLSA 1X7GA 1XK6A 1Y3AA 2QMEA 1AN9A 3QU7A 1E58A 4OQLA 1LJUA 3ZJVA 2EJVA 4GYKA 4NC6A 4ARAA 1ZK0A 4AZSA 4EG8A 2D8MA 5KYYB 3N87A 3MYRA 3Q8WA 5L7TA 2XUFA 1F2DA 1SQ0A 1ZOOA 3MMPA 1FTSA 1M6WA 1QIDA 1U3GA 2C2HA 2QJWA 3PXEA 4GO1A 4WHMA 4YP7A 4EA6A 1YFLA 1A50B 5G4LA 3OIWA 2SKEA 3VMMA 1XZBA 2HK6A 3C97A 3FTCA 3QPDA 3PBKA 4UATA 3P9RA 2APLA 3Q11A 3FUTA 5E2IA 4F8YA 4V1CB 3DL2A 3B9BA 4L3WA 1RQXA 2CNBA 3MWFA 4GX0A 2FETA 1FDUA 4ZDWA 1OXMA 3K1YA 3H04A 4XWAA 4YAWA 1NQTA 1M34E 3GMDA 4RETA 2ZJ4A 4XJTA 2A7QA 1JR3D 1FW6A 2C03A 2IYFA 3LKDA 1XRRA 1T2FA 4O1MA 3U7IA 4URXR 3DBRA 2CUKA 4JBGA 4RVUA 1PRBA 1ADJA 5FWNA 1C1HA 5DHSA 4L6V6 3CRQA 3OEYA 1NONA 5GKNA 4MYUA 4A0GA 4GQBA 1PX0A 1E60A 2DECA 5B7GA 2GJAA 3CSDA 1PAUA 3P9XA 1N7GA 1QQ6A 3I04M 1PL0A 2YQ4A 3SBJA 3CV3A 4A6XA 1CQIA 1EVEA 2Y21A 4ETMA 4KG7A 1Z2PX 5JD3A 1NYTA 1VMKA 2QVBA 2PSSA 5GJBA 1E2UA 2QVXX 4PDIA 3L28A 5I3CA 2FGJA 4IHAA 1YR1A 2ZT7A 4XH9B 4Q16A 4KN8A 5E7JA 2XUAA 4R6WA 5K7SA 1TEZA 3A2KA 1T2UA 2UZ4A 4BYGA 1OQAA 1SRQA 1M9NA 1G3IA 5L7WA 4LJKA 2NZYA 4DJFC 4G01B 4IQ4A 3OZ7A 3UJ6A 3UV7A 5JYDA 1N33B 4YJFA 1SO8A 4F8EA 3OPYB 4IINA 4BMOB 5HJ7A 3I32A 3ZLBA 2UUOA 1YZLA 2QTNA 3L2AA 3U6OA 2PX2A 3ID6C 2XF8A 3IKVA 2WWGA 1XTIA 3LIIA 2QLNA 2DPXA 3NAMA 3WQHA 3NBXX 4IIYA 4OHWA 4BB6A 4QUJA 1PEYA 2GXQA 1ORIA 5HK8A 4OXIA 3V8BA 4IGIA 4EG6A 4B0PA 4PRYA 1CF9A 1IEVA 3O47A 5COAA 5DXAA 2ZVJA 1OAOA 4NI5A 1SD5A 3Q9UA 4RGYA 4HNHA 5AI4A 4YAIA 4H0CA 1TF7A 4BIMA 2DFPA 2OZKA 5J2UA 1NXTA 1X9IA 2QE7D 2XGOA 4A0QA 1RLIA 1TRKA 4HPWA 3CX3A 3ED5A 2XTZA 2DHYA 2Y0TA 3BDVA 3HB9A 3OPXA 5HA5A 4YMVA 2VS1A 2XYRA 3GROA 2BFEB 1VCNA 4GDMA 2C5HA 3PLNA 1IQRA 3DVRX 4UU7A 5ITZB 3PYMA 1U5AA 1DPGA 3MUOA 4DEVA 5KNBH 1U8TA 1POXA 3H97A 3S2UA 1V48A 1VG9B 3CWQA 2G8LA 1EP9A 3MW8A 5EE9A 4HEA6 2NU7B 2CDRA 3ADPA 1RYMA 1ZLXA 3SVTA 4IDAA 2ZZMA 1DHRA 4JXZA 4X8LA 3WHKA 2XB4A 3ZD6A 3SS7X 4ZARA 1N0VC 4MGIE 3VHXB 4RA9B 3UMSA 2GARA 3F6YA 1GYQA 3V46A 1BKYA 1NV8A 5JHGB 1L1EA 2CCKA 3C9PA 3EXAA 4INPA 4B17A 2PX5A 1NPDA 3OZAA 1K68A 4YAUA 1XGKA 4Q4DA 3ZPXA 4EPXA 3M89A 2WTEA 3SC2A 3U61B 1E4VA 1ZO8A 2IPNA 2W0SA 3CVJA 5KAMA 2X0NA 3N5KA 2UVPB 5KHLB 3RUAA 1I3KA 1OBHA 3E8MA 2BTOA 4UCQA 5EZYA 4DSUA 3KELA 1AJEA 1MQAA 2XWJI 2W2XA 3IMEA 3IX7A 3NR2A 3ZC3A 1AF7A 3V1MA 5BQFA 2QVCA 2ZZKA 1O77A 2GUWA 4KT0F 1UKCA 5TS3A 3NP7A 3VBEA 1I0IA 2R1VB 3BB3A 2B94A 3GP1A 4GMKA 1NVVR 1GZ7A 1I0ZA 1RLMA 1UBNA 3HB1A 3EFHA 3KKLA 3PEEA 1QOPB 3UANA 3R5HA 1QUFA 3W06A 4RTQA 1ILWA 3EEQA 4ZZ3A 4QTZA 3TLCA 4FLFA 1HTWA 3HG7A 3PCXA 4QSHA 1MKYA 2I87A 1P2TA 3HJUA 1HV8A 1PR0A 3NVDA 1MH1A 4KXMA 4PC3A 1I5EA 1M2EA 4X41A 3ZEAA 3ZYZA 1I7PA 1K3WA 1K08A 1KMCA 3H5IA 5HTKA 3L9WA 3DE4X 4I81A 3SMSA 3BTSA 1V45E 1SXJD 2ONJA 1GLGA 5ESRA 1UWVA 2IWRA 5MN6A 2FFQA 4GW3A 1BOFA 4A6DA 3RU9A 5SY4A 2HWWA 5C8VA 1CXZA 3ESQA 4GMDA 5CFNA 1Q0RA 5JXGA 2WSEF 4TWRA 4ZICA 1XEWX 2QSYA 2ATEA 4DR4M 1IOZA 3P9SA 4ZVLA 3ULKA 5CVDA 1LV7A 1NGSA 1I0LA 2VDLB 4RJTA 3LPCA 2V8BA 4MICA 4V0OA 1DBPA 5JNUA 1WABA 5JAUA 4AX8A 3EA0A 4R9VA 4IWYA 4WKPA 3W2EA 4JXKA 5G0WA 1DT5A 2DT5A 1Y1SA 4KSYA 4F84A 2JXNA 3KEFA 3WE7A 3QFFA 5I9MA 3A6PC 2XVAA 4ZV9A 4FEGA 2OV3A 4R1SA 1KTIA 3H1BA 3JWPA 2UUCM 3RUHA 3P4UA 3SVLA 2W98A 3ELUA 2B3DA 3PUIA 3ENWA 3RVJA 1XLTC 3H1PA 3AYZB 3BD9A 3DXFA 5H68A 3IBFA 4LMPA 2FLWA 2OZVA 2PWYA 2GCNA 5CFLA 4KHPM 2CVZA 2VG8A 1MEJA 2AVNA 2HFJA 1E9CA 1RKUA 4U4AA 4V3CA 1VTKA 5DEOA 2FPMA 4B7UA 1E8NA 1KO8A 4NK5A 2IV7A 1FYWA 4NBRA 3E7WA 3OUTA 1R9JA 3QHPA 3ELWA 3TR0A 4D26A 3DLAA 4KXLA 1NBOA 1ONOA 3WSWA 4Z4EA 2FMUA 2Y2VA 1G59A 2COKA 4OH1A 5IARA 4TQGA 1Y7LA 3GVXA 1DEXA 4M98A 4QQFA 3JQEA 3ORRA 4I6JA 4TV9A 2OLEA 3T5MA 2ZSFA 3FFAA 5JY1A 5E2BA 2D7HA 2XADA 4NVRA 4EDHA 1UUFA 2M1ZA 4MB2A 5AJTA 3NTUA 4UXJA 4CODB 3L8YA 4TTIA 3UXMA 1I2DA 2IP2A 2G67A 2O52A 3DTVB 4G9EA 3LT5A 1F4IA 4G5XA 5G53C 3W7AA 1SIBE 1U8YA 1NI5A 2LNDA 2QV0A 3HXMA 2KBEA 4QEZA 4HVAA 4EJ2A 1JLHA 3W1VA 1R8SA 3A6ZA 4DLBA 1P39A 1A88A 2J5YA 1NBAA 1TTEA 3QELA 4YRQA 3OJLA 4W5RA 3MOIA 4C08A 2J9RA 2YVQA 3KD3A 4KQ1A 1A9TA 5KREA 2E0IA 4B5KA 1IQUA 2PXXA 2FSSA 1J4AA 1TIBA 2B4AA 4EO7A 5I7OA 3KL2A 1ACLA 1K89A 4R9SA 2CD7A 4BVFA 3THGA 4I19A 3K20A 2OV8A 1KSFX 5KTNA 1QTIA 2PQ6A 4KNVA 5T57A 5BN3B 5J5AA 5CD9A 1AK9A 1ENZA 3CLTC 4ML3A 4URUR 1AZTA 4WBSA 3W67A 4GPZA 3D8SA 1IIBA 3LYHA 2IIVA 4MQ5A 3K1JA 1R18A 3PQ2A 3I51A 4TS4A 4YRSA 3TPZA 3IIKA 3QEMA 3IRVA 1N2ZA 3HLYA 1UAYA 1CJCA 5EJEA 2Y3IA 2FPIB 1RXVA 2JD0A 4G85A 1YB1A 4E11A 2NZVG 4XM1A 3GUZA 3DYVA 5JH7B 3D8LA 4H6PA 5GM1A 2WC1A 1QF7A 3S3TA 4JVMA 2BHRA 1X1AA 4BKPA 1KAOA 4ND2A 3H65A 1HLFA 4PNHA 5HIJA 1JW9B 4CLEA 4B3HA 3R7WB 3ACDA 3SEQA 2VZ8A 1G20B 2PL5A 4GKKM 4DW8A 2FHSA 4H4DA 4UMEA 1RKBA 3FJOA 3K5WA 5BYJA 4HX2A 2RGOA 1E6UA 3A6GA 1AUPA 3U7QB 1JZTA 4HYQA 1N2GA 2EL7A 2MMGA 3R0VA 4NJMA 5GONF 2WR8A 1VE9A 3QVSA 1FS6A 1GPJA 4TWBA 1QIFA 3MTAA 3B7QA 5GM2A 1Z35A 3LBNA 3HVRA 2RC5A 2EZTA 1Y42X 2G71A 2Q5CA 3BCUA 1EGMB 3FHOA 4YJ2F 1Y1PA 4PHCA 1DAGA 3R6DA 1KK3A 1PDVA 1UQUA 1W5BA 4HNGA 4IIFA 1E1QD 2D74A 3W77A 5CGZA 1WR1B 3QXSA 4M2LA 1XG5A 4WRRA 4RABA 4GH9A 2AKYA 2PH1A 2HTEA 2LBCA 2OZLB 4MJLA 1M1UA 2Q9CA 4TVBA 3EH1A 3GF4A 1C1KA 4Y28F 1O8CA 1Q0PA 5G02A 2JS7A 4OHZA 3T52A 3JD3A 5JAMA 1IXKA 2H4HA 4YHBA 2GRUA 1LWNA 4EHBA 2VT2A 4FS3A 1TVKA 2ID7A 4LRYA 1G2PA 2GEUA 4LQDA 1LBHA 3EMKA 3OU7A 1ZR4A 4JD5A 2JLAA 1VXOA 1L5LA 1W5FA 1FRQA 1SQ5A 4NYIR 4QUDA 5JFGA 2C0PA 3HXQA 3LGXA 1E5QA 2YFHA 4MKRA 4EJSB 3VXKA 3U7RA 1EXWA 2HF2A 2YJ4A 5CPBA 4CT4B 4K9KA 4LQLA 4YCBA 5C4IA 3ITNA 1AA6A 5K5EA 3CSUA 3LRXA 2QUKA 2IYPA 3I8SA 1LPNA 1P1FA 2AMLA 4JDUA 1NVAA 5H9VA 3TZKA 3QGMA 5I3ZA 5KB3A 4UBKA 1N2SA 1JSXA 1Z4QA 4YJKA 1DG3A 3H5TA 1XDDA 1PCXA 2WT9A 2YXPX 2PGXA 4MLCA 5FPHA 2JHAA 3GT7A 2DBQA 4IMPA 3RTEA 1XJQA 3KP1A 3GJRA 1L8OA 2Q5JA 4WXYB 3DDWA 4PEVA 4TV9B 4DHEA 1T8UA 3QA3E 3DFFA 2FPPB 4YRIA 1IDN1 2XBLA 1W85A 2R6DA 3PD0A 4NZYA 4ZVNA 4CM5A 1A82A 1OT5A 2CJWA 1HK7A 4J90A 1U3FA 3A4NA 3F47A 4ZVTA 1E6CA 4BQSA 5EQFA 3U61A 2WA2A 4RY2A 3CKLA 1UWLA 5DYGA 2JGRA 2O0MA 3PJEA 3QF4A 4LQ4A 4OU5A 5TJ9A 4L2IA 1I3OA 1AXRA 1DIRA 1NW9B 3TVYA 3QBVA 1KMHA 2ZRBA 2AE2A 1F0NA 3MOGA 2NQTA 5SZIA 3WADA 1UJMA 5E3HA 3H0EA 4Z51A 1X1QA 4KGDA 4IL5A 2C9BA 5E1MA 2BR3A 3NDJA 2JFHA 2LIPA 4HXGA 4TLDA 1RI4A 1XIVA 1OBOA 3M9XA 5AK4A 5GADl 1C9KA 1W36B 3WLIA 4AIIA 2F67A 2LKCA 4Y98A 1FQOA 3T0FA 4MYSA 1SHZA 3EG5A 3ZWXA 4AZ3B 2R87A 3RD5A 1WBJB 1VCHA 3EIWA 2EEPA 3CUTA 4I1VA 4OSOA 1FYXA 4JJ6A 2WF9A 1GILA 1VJGA 4RPLA 2H1HA 5DJ5A 4RM3A 2AC4A 5C5EA 5G0UA 4TVSA 4NMMA 5I48A 3NONA 4OGWA 4RMGA 5ER6A 2ZOSA 3R5FA 1GQQA 4U3JB 4DDVA 1H1LB 1U1IA 3SC6A 1E59A 1TUBB 4FSDA 5A6SA 3VOSA 5LWQA 5JRJA 1KQGA 3AHEA 4HGYA 2EBFX 1Z8DA 2LVBA 3KXPA 5IRCD 4LJAA 2C2ZA 2EU8A 4S1PA 4RKRA 4GC5A 1LTKA 5D3MA 2AI2A 4KAJA 1RWXA 4Z2AA 3DE6X 2VJQA 5JWRA 1X87A 5FQOA 3ZWYA 1DBSA 5DN6D 1M6YA 1L5YA 2EZ8A 1EFUA 2VJYA 5IN4A 3CBGA 2NM0A 2ZTHA 3FCCA 3PT9A 3KHTA 2OBFA 3ZE1B 3VNAA 2DHEA 4DDWA 5B7NA 3CRZA 3KZMA 1ZBDA 3D4BA 3T9EA 1B93A 2NUPA 1KMIY 3PD7A 1FU8A 3R3UA 3C6MA 3IP8A 4GYWA 5B3AA 1PHRA 1DTEA 5LUBA 5I4IA 1WP9A 3JQ7A 1DEHA 3AKZA 2MYPA 5KDLA 5EYPA 4P7FA 1PTJA 3WGTA 4JOSA 1ZH0A 2WWHA 1E7MA 2R1VA 3AFNA 2QYSA 3QBDA 3HJ8A 2PUTA 3D5QA 1HF3A 1ZI9A 4FGWA 2FP3A 1AGNA 4K1LA 4AMVA 1LJLA 5CXXA 1S2NA 2WJJA 4H08A 2BFWA 3ADOA 1W2WB 5DFLA 3S55A 4DLPA 3WAJA 4ZAYA 4P7GA 4HQ0A 3CB4A 1N1DA 1U2DC 2FY8A 3IP7A 3RFTA 3DONA 3OX3A 3AXTA 4PLCA 5LYYA 5DW3A 3UWKA 1Q7TA 2G82A 4ZAXA 1W5SA 3T9AA 4POOA 5JYEA 2IH2A 2HMSA 1K3TA 5AUNB 1C8VB 1MORA 2BV3A 3GK3A 1XKTA 2OD2A 2CWWA 2QVZX 3VK7A 4MV1A 2JLQA 1O96B 1S9HA 2YHBA 3K7EA 3LBAA 1I80A 3T3EA 4B3TB 5JJKA 3KOWE 5CRIA 2J9ZB 3EMVA 3HADA 3JD1A 3OM8A 4U63A 2GYWA 3J7AS 1X1TA 2JBHA 1IZYA 3K0CA 5IEBA 4BX2A 4D3ZA 2ZYHA 3FX2A 3GGOA 3EIUA 5IDYA 1JLLB 3AHHA 4FYHA 4NBSA 1XMPA 2UU9M 1H9CA 1H2HA 1RYYA 1RXWA 5ALRA 5ITUA 1ZD8A 2UXDB 2ZETA 3FCXA 2Y20A 1Q74A 4YFVA 5CNIA 1W52X 3SX4A 2PGJA 1HNXM 1UXHA 2A3NA 3M2PA 4Y8VA 2IY9A 1ISRA 3PUZA 3WXBA 2C59A 3ZV6A 2A5DA 2HSWA 4C7BA 4UBJA 4LYHA 4IGAA 1Y63A 4GX2A 3RADC 3F6PA 4P33A 1KFVA 1HE2A 4MYTA 3GGJA 1GA6A 3T7TA 4AN4A 5B6PA 2WU8A 2NXCA 4X63A 2VPTA 2DRIA 3D8BA 5BSKA 5H59A 2B7CA 4FKZA 5C34B 5F2KA 5LQNA 2X1MA 3PWKA 3ETLA 3OTGA 4OI4A 4OHMA 4YI5A 4BFSA 1EFRD 5J1SB 4CXMA 5IFLA 3MXOA 4RCVA 5FA5A 4TTTS 3HI6A 2F3UA 4PLYA 4QDUA 4YECA 2QRLA 3OD5A 3ZU6A 4KYTA 4AZ0B 3EPKA 3D2BA 1MJFA 1GDHA 3QUCA 4M6WB 5ITSA 4RHUA 2AN1A 1OE0A 3CNBA 3IUNA 4HVTA 1QHNA 4PQEA 3ABQB 3T4UA 1SJ9A 5J5CA 5TQJA 1DKNA 5D85A 1L1FA 4GBGA 2D1QA 3DQZA 5DBIA 4XVUA 1LZKA 3E4CA 4I5GA 5CA0F 2OQ4A 1RFLA 3E0QA 5AKKA 5CVCA 1MB4A 5G2OA 3VPCA 4ANFA 3IVGA 3TNJA 1PNRA 1BQ3A 2H1IA 3GDFA 2Z30A 2JHCA 2XT6A 5D2CA 5BN4A 2BFCB 4AQYB 5SV2A 2YZ2A 4Q1CA 4RFVA 3HUFA 2Q45A 4LKRA 2NYUA 2QDXA 3DXZA 2JAWA 2VSNA 1EXMA 3ESBA 4GR5A 4C04A 4NRVA 7ABPA 1Q2XA 3EZ7A 1MDBA 2GAJA 1G291 1KJNA 1MO3A 1ECCA 3MZ0A 4ZCLA 2V4UA 1H4QA 1VJ0A 1M75A 5E9WA 3S68A 2CZCA 2IPAB 4PXSA 1SOWA 1E1RA 1P0FA 1Y89A 3SBXA 2ZANA 2DLNA 3KZNA 2ZJOA 2VUTA 3IVRA 4C07A 3H2ZA 3I9MA 2HIHA 1WCYA 4TUWA 1DU4A 1EWVA 1I2CA 1SOAA 4HQ6A 4XM2A 5I9TA 1U9IC 1CRPA 1IN4A 2RIPA 2DYKA 1QYIA 4IKPA 4XBOA 5AR1A 4HN9A 1I30A 2P78A 4O25A 1ZONA 3L49A 4FYXA 1R0SA 1V6AA 1VJ5A 3W2IA 4YLYA 4G4JA 3RHTA 1DX9A 2BEVA 3QE4A 2P2LA 2J7KA 3IUYA 4IHKA 2QE7A 3OOYA 4N4AA 1O87A 3FLAA 1ISHA 1T9CA 4F3KA 4LG2A 4WI1A 3KEGA 2I7NA 3N7UA 1F5NA 1JUDA 4PRZA 3CHYA 3HHEA 1D04A 1QVVA 3HI4A 4I9UA 4TMZA 4YRAA 1LRLA 1OPRA 4H0FA 5EJ7A 2PT9A 2JIOA 4ZD6A 2G70A 5HGJA 2ZTSA 2I80A 3I04A 3OF3A 1GAEO 1M10A 1MO5A 3HEAA 3L4JA 2UUBM 5JH7A 1KY4A 3TGPA 1T8WA 3F2IA 1GA4A 4UTXA 1WDTA 4M0KA 1NI3A 3ZGLA 1CR4A 3IHKA 4Q3AA 5EG5A 1YFKA 3SASA 2P9ZA 1T9ZA 2VVTA 3FA2A 3LWZA 3OCZA 3L1KA 3L18A 3PGKA 3PP8A 5HQJA 3WIOA 1FDVA 3ZHOA 1DQPA 1WWKA 4BV9A 3BPSA 4J4HA 4UPDA 2GD0A 4I99A 3NMUF 1COZA 1HE5A 1Z13A 2MWMA 4EHAA 3U6KA 2XB6A 3L6DA 4MQ4A 4C5BA 5AKZA 4NCXA 1PN3A 3PUJA 4LK2A 3KLPX 3NHLA 4WUTA 5KJ1A 2HK9A 1O5OA 5JQGB 1Z2OX 3IQHX 5L95A 3BMQB 2XCTB 3C6XA 4DIDA 2EFCB 1E2JA 5AMXA 2KLBA 1RT9A 2RGGA 1FTYA 4HTFA 4DKJA 5JS1A 4PLHA 3BB1A 1MB2A 1E79A 1R00A 3K96A 3P52A 3SQOA 3TIFA 2ZPAA 4C03A 2W71A 3ZS8A 3PHIA 3F6SA 1KDOA 4TN1A 1JVNA 1J2JA 5JS8A 2P9GA 4BLVA 1YJCA 5G0VA 2NU9A 3SKVA 1MX9A 5BVHB 2X6QA 4HXEB 3V2GA 8ADHA 5L4NA 3B3FA 2FUG1 4TKMA 3ZTTA 4OO3A 1UT6A 4C4AA 4KLRA 1L5HA 4YMIA 3UK1A 2OOKA 3LVVA 3MTEA 2D2XA 3RF6A 4NXNB 1TCAA 2Y1FA 2CMDA 2C7QA 2QRJA 2JIRA 3ZXSA 3F5MA 4DBVO 1DDIA 3HUUA 2J6HA 3TMAA 4ZFNA 3PWTA 1Q3HA 3LHFA 2WJHA 4C0HA 3V1KA 3ZWNA 4DA0A 1ES9A 1QRAA 2CV0A 3IJEB 1U0FA 4OIMA 1BHJA 1MAVA 1MF7A 3W8EA 1PJ4A 3OQVA 4MCHA 5B3JA 4NBNA 2QTAA 4QG3A 1MVNA 2KHHA 1R0RE 1X86B 3IALA 2P5YA 3MWYW 4R2HA 1FMJA 1WS6A 3F6EX 1YDGA 1PFGA 1C3OA 3H9JA 4GEGA 1PJRA 4EPVA 4C0JA 4CM6A 4PCZA 2K5UA 4JLBA 4YJHB 2ZM5A 5THKA 3D4PA 1OLSA 2JHFA 4QBTA 3ZWCA 5DN9A 3R7NA 3OZDA 2JAXA 5C8YB 5C9ZA 1CZUA 1U9ZA 2Q2NA 1DAHA 1E63A 1BVYF 4K86A 4WUVA 5JVDF 5L3QB 4HOYA 2WJ6A 3ZZ0A 4DTCA 2VNJA 3A9RA 4HXFB 1C1XA 2EDAA 2H7XA 1ID1A 3MBIA 4PSUA 1YS1X 2GO1A 2R1UA 1FIUA 2CHFA 4DQVA 3NFYA 4Y2VA 3IBYA 4C2AA 4B3IA 1EHCA 1K8QA 1WUKS 1Y7TA 3HR8A 3HXTA 2V97A 3MTQA 4UQOA 4Y0AA 1JIIA 1GQFA 4N41A 1G7SA 2O9JA 3FIJA 2NU6A 1Y6RA 3BT7A 2NMVA 1ZMRA 1Q50A 2EJCA 4FGKA 5G0SA 5M34A 1SNYA 2CLLB 4YV1A 3HNRA 4J6EA 5D5PA 3A11A 3PI7A 4G56A 3ZVMA 3H11A 3WTCA 5M04A 4DV7M 3HPRA 2WM2A 3M1LA 4X7PA 1CR6A 2XCIA 1Q6ZA 2IZ6A 2HWXA 3GFTA 1PQUA 1E2GA 1CQJA 1SC6A 5TMBA 2YN2A 3L0CA 3NHFA 2JGFA 4M9UA 2GZSA 2IODA 3EB9A 1E5TA 3RAEC 1NNI1 1KS2A 1Z73A 1QGUA 1V5EA 2FAXA 3FDIA 2JA1A 1NYLA 4C4RA 3G13A 3ES9A 1T35A 2A0YA 1SKUA 1J23A 3ZX5A 2DWCA 5JOQA 3RYHA 1XX6A 3OP1A 4CIBA 2XIQA 3TLJA 4BVGA 1O97C 4UFPA 2FUG6 3I3OA 4FJ0A 5HF8A 4AMGA 3RGSA 3W6OA 1E64A 4NBWA 1P6XA 1BMQA 2C1EA 4FJ1A 2BGUA 2C31A 1JDZA 2XYHA 3B1XA 5FA8A 3H11B 1FNNA 4LC9A 4PW0A 3K1AA 3ZDYB 2HYIC 2GNPA 2VFAA 4W9NA 1G21A 1RXCA 3A0UA 3FBTA 2DI0A 2YFQA 3KE9A 1T5HX 1R16A 2JLWA 1OLOA 1AXEA 4F4FA 5EPEA 3NAQA 2K2WA 2R1ZA 4LWZA 3EUAA 4EW1A 1B76A 1R5NA 4NWIA 3G8DA 2HNKA 2JCYA 4QAQA 3RVLA 2CFOA 5KJCA 1ZGGA 2GZMA 1J0EA 1TQ6A 2JAPA 2ZPUA 5HXAA 1XTJA 3GFSA 1M5RA 1QIMA 3N3AC 5BQOA 1V7QA 3FETA 3PKIA 1E62A 5G4KA 4LE1A 4CVNA 5DLYA 3SDZA 2IHBA 4IBBA 2IW3A 4YQFA 1X7XA 1VLZA 2BRUA 2OCXA 2QLTA 4RZQA 1DS6A 5KQSA 2F4NA 4CMJA 4MO9A 2B30A 5IU6A 4HNAB 4G5RA 1GCUA 3EGVA 2MDTA 4J1TC 2HMWA 2YQ5A 3LDGA 4G0XA 3S99A 2HLDA 3WLHA 2CBZA 5REQB 3LVWA 4CG1A 2W0MA 1Q83A 1FY2A 4GF5A 1R0LA 3G6WA 4UD2A 3KKNA 3TBHA 2HLHA 3DVAA 4EEKA 3I09A 3D6VA 4AG5A 4P08A 1CULC 4C4XA 1G7RA 1R0YA 4GL2A 5J3JA 1N5DA 5JYCA 2O2ZA 1RPAA 3SMQA 3R4VA 4JJIA 2WWXA 2HHJA 4IJUA 4UVHA 1EFRA 4MUBA 2J7PD 1O94C 2DSNA 1H0KA 3FNRA 3DOFA 2OXCA 3HSKA 4QQNA 4UASA 421PA 4ALKA 5ADWA 4DFDA 2WJWA 4UNNA 5FL7A 1OD6A 4R2MA 3LIPA 3E8XA 1JSCA 2QLLA 3AUYA 1AZSC 1H69A 5MGBA 4NXMB 2E87A 2JAUA 2IDZA 3D2AA 4GITA 1WY7A 4NU5A 2O5VA 4IIJB 3R3ZA 1ZWLA 1HE8B 2CDCA 1M74A 4P53A 3JAWB 4DCMA 1Z0KA 4F1IA 1H23A 4TS1A 5K3OA 3O9ZA 4GOLD 1SIUA 2GJ9A 1A2OA 1BTOA 2LTAA 3ANSA 3SXUB 3ZHXA 2JAHA 2Y1GA 4LWQA 4WGFA 1GSIA 3CEHA 4GKBA 4KWTA 4WDQA 1R0WA 2MSEB 2QVLA 3AOEA 3VTKA 1HH4A 2FSVC 5IZ7D 3EDCA 4DR3M 5JO9A 3ZCXA 2RK6A 4LDPA 4LG1A 1RVV1 4Y6PA 3IPLA 5KPRA 2Y71A 1KDTA 4ZODA 2GBFA 2QXUA 2Z3VA 3JY6A 5EHQA 4DLRA 1M3SA 2FPKA 4A8TA 4P83A 3LFTA 1UM9B 4NFHA 1XTSA 3ROPA 2IDKA 2JRLA 4P4GA 3SWWA 3ZC7B 1JFFA 3ZGOA 3ADCA 3GA7A 2EKKA 3F98A 4IYRA 3ROQA 1YVUA 2J31A 3FPBA 4KQWA 4N01A 3CIOA 2IU4A 4NMHA 4J1SA 1FLVA 4XUEA 4X64M 3ROFA 1CIVA 1CY4A 1OI4A 3KPYA 5I9SA 1UMKA 3AVTA 1CDEA 4KLNA 3PPWA 3K5HA 4FCVA 1QVWA 5K0LA 1USVA 2QD3A 2QQ5A 4YCJA 2SCUA 1LDBA 4DNOA 2F1RA 3R4CA 4ZEXA 2OKCA 2G06A 1HQCA 2L4EA 3AR9A 5F35A 5KNCA 3CKMA 3WGMA 5MN5A 1Q1EA 4DA8A 4DLNA 2EJWA 1GOTA 3LBIA 3DOCA 4AZWA 2B8EA 4NLLA 1R8XA 5I8PA 1NQ5A 1QIGA 4DB2A 3P9KA 3LUAA 2Q4BA 3L40A 1IXSB 2DFKB 3RSCA 3HDQA 4KR3A 1LPAB 4HLQA 1Q3BA 1BKDR 4INZA 3WYAA 4AF7A 4E12A 1C29B 5CNMA 5HZGA 4LFCB 4RMHA 4U8HA 3WRXC 1HG0A 4ACAA 4R51A 2PV7A 1IUNA 1QHHB 2I7TA 2W2KA 3B51X 3SQMA 5HGXA 1FTNA 5KSZA 5HS6A 2J9YB 4UZEA 4N0EA 5BW6B 3AUJB 3FSEA 2PIDA 3VDMA 2ZBEA 2ZUUA 1JDBB 1MG5A 2JC3A 3R3XA 1J0DA 1X3SA 4FD2A 2VJMB 2H07A 3HR7A 2BWEA 1F4PA 2ECKA 2PO5A 1KEPA 4B6RA 3U3MA 4TMFA 4G0ZA 3ZW7A 2C5GA 2P2GA 3B8HA 1JG4A 3KO8A 5T3UA 1DCMA 5EUCA 2JBAB 3R76A 4AO6A 3AHDA 2C8VA 4OJMX 4YT2A 3ILSA 4MPJA 4KX5A 2VPQA 1ST2A 5H16A 1Y33E 1CP3A 4LBWA 4REMA 4UN2B 1O95C 1SK8A 3I6BA 1BJRE 2M5ZA 1CFZA 1M1YA 3M8KA 2X2PA 4OP2A 4ZA2A 4AX4A 4A92A 4QGSA 2WNIA 4QREA 5CG2A 4ZGBA 3JQAB 2ZXUA 2NSYA 2GFQA 1PWHA 3HCDA 4FFNA 2QD2A 1KDVA 3LT1A 1ID8A 3MBOA 1WCWA 2X0JA 4MS3B 4YCCA 2IU3A 2DFVA 4QYXA 3U5TA 4DQLA 5JAPA 3HKCA 2ZSJA 2AG5A 4IG4A 4MUXA 3ZJTA 5HZMA 5MHTA 1KFEB 1S3GA 2BTQA 1H2XA 3ANLA 4NMLA 2AOTB 3D6FA 4BTEA 2OD7A 4GLOA 1OW3B 5AKHA 2PU5A 2FZLA 4R1QA 1JWAB 3GARA 3H1AA 3NAZA 3H2GA 4YRNA 3HJCA 3HM2A 1J2YA 2I1WA 5T8KC 1SAYA 1WW3A 1UP7A 3RV3A 3UYKA 5B3JC 1D0MA 1FS5A 3UB2A 2QROA 3I39X 1H2FA 1MT0A 1UAGA 2ZBFA 4PFSA 4X0EA 5IUNC 4Z8XA 3NO4A 1ST3A 4ZEOA 3W2HA 1NP3A 3MT0A 4HSGA 3B7NA 4ZEWA 3LDAA 4OXKA 3G7UA 4KQMA 5BYBA 5ED0A 5YASA 2JJ1D 1VGRA 3NXKA 1LW6E 2ESRA 2GK4A 1KDRA 3C70A 1RPNA 1L2CA 2JEYA 3F4LA 3OKAA 4P7JA 1BWRA 4HNSA 4TMWA 3MUFA 1L5MA 2HJGA 2MIIA 1I36A 1YB7A 4I3GA 1I4OA 5HFJA 3B12A 3FJ1A 1T36B 5CLGA 2I67A 2QX8A 2XE8A 5CW2A 4X62M 3GZNA 4CLRA 2XAUA 3DKIA 4LRWA 1QSGA 1RWQA 3W34A 3KQQA 4U6SA 4FFMA 4GAEA 2QW0X 3NC1C 3NRJA 5AKIA 4ZQIA 2FWRA 4DS3A 2AE1A 2AWOA 3W79A 1VJCA 3JVUA 3MJTA 4IDOA 3O91A 3PNMA 2DAPA 4LXYA 3MXTA 1W85B 3IT2A 1KYTA 2GF2A 3EZ9A 4U6NA 4N12A 1JTFA 4JJ4A 2JANA 1AQLA 2QMQA 4RPCA 4C21A 2AMJA 2QYOA 3QVWA 4GSKA 2PTGA 3I4VA 4B2IA 3I76A 5TRTA 3TVDA 3CZ9A 3M7IA 2J9GA 3OOSA 4YJ2B 4CGZA 4MVJM 1K66A 1RJ9B 2ENUA 5HCNA 2ASVA 2ADMA 5K0NA 5U4QA 3SQXA 4U00A 1NRJB 1SOVA 5T4BA 1SXGA 3PDCA 3HBLA 3L3BA 1RAAA 1G21B 1MV5A 3TJMA 3IKMB 2XFTA 1UJCA 3L0SA 1LI5A 3FWHA 4UAVA 4EKGA 4N76A 3EQ9A 2JVJA 3OFVA 3FCAA 3E46A 4NL4H 2NIPA 4HO1X 4PRLA 1IZZA 1ZCBA 2JIPA 1L4LA 3HLKA 3UGQA 3E4DA 2NO1A 4HI0E 2X42A 5BV2P 2EQ5A 2JGDB 3NEYA 4BCCA 3IE1A 3J7TA 5CR9A 5DNVA 4D4LA 2ZIUB 5K6TA 4LSZA 4NAHA 1N7HA 2WTBA 4C76A 5IP5A 4L74A 1GZDA 3GBSA 2O3JA 2RBGA 1ZK4A 2CNLA 4Q9DA 1EJBA 1ZLYA 3A1FA 4QXOA 5G3ZA 2Z09A 1AH2A 3WDKA 4E46A 3U6CA 2P6NA 4IX9A 5F3WA 3TLAA 2L19A 4QOJA 2O3QA 1O97D 3AHFA 4X66M 1S8OA 1EDEA 1GJRA 2F1OA 4DBGB 5A3JA 2OLJA 3MS7A 1TK3A 1IZ9A 1OZ0A 2VAVA 3DBHA 3NHZA 4LZWA 1U02A 4XSHA 1PJZA 3JALB 4GZ6A 3RABA 4F2GA 4ZRDA 5JSZA 1UAAA 2GPSA 1VBNA 3GEPA 4YP0A 1HDCA 1XRNA 4F4DA 4F2HA 1PFQA 4EGQA 3BOSA 1R4AA 2AN4A 5GWXA 3RAGA 4BNHA 1EFVB 1U8UA 1SPBS 3GP3A 3RE1A 4ZPJA 3R6TA 4I50A 2PUGA 3UHPA 1HL3A 4DSAA 2BFDA 2VPIA 4MYCA 2EC5A 1QOQB 1T3HA 3KB2A 1QTNA 4WNYA 3W9YA 1XCBA 3FRHA 1L4UA 4QICA 4DCSA 1VLHA 4LF6B 5DM70 2A3RA 3CZ4A 3QWAA 4IM7A 3EIEA 2WWYA 2NPOA 4RQTA 4XTCS 4X66B 4MR7A 3TW8A 5JNSA 1VFNA 2P3LA 2R8YA 5DLPA 5CLHA 1RXYA 1V2HE 1Z17A 3L4BC 4KDFA 1IEXA 2C5EA 2VBGA 2A59A 2FN3A 5FPQA 1KEWA 1LSUA 1Y8RA 2PMCA 1E9SA 1C9JA 3PPXA 4RLQA 4TT3A 4X24A 3I6IA 3QEAZ 3ZIUA 1XD9A 2WMNB 4AQDA 1Z2AA 4J4TA 4YT4A 1OYYA 4PICA 5KO2A 3KPUA 1ZGZA 1R4MB 3I4CA 1BGWA 4P3NA 4YJ3B 3IBTA 5HMMA 4G4OA 1Z5PA 2I76A 2J0VA 1GSHA 4Q3CA 4DCGA 3RJ9A 2ORIA 3UAWA 4AY6A 2ZCUA 3KSZO 2EG5A 4LXXA 2DHQA 5B5SA 4TVKA 3B52X 3SF8A 1SOUA 3EPPA 3BVPA 5DTEA 4KPYA 1DOAA 3SQLA 2PJZA 1IU9A 4YIKA 2B0CA 5ICMA 4EI9A 2X0KA 2QVGA 3CS3A 4WDRA 4AKTA 2O3UA 5AOVA 1PJJA 2ILTA 4OQMA 2DT8A 5IT9A 3C7TA 1QJCA 1HE3A 2RB5A 4KQIA 3RK4A 2J3EA 5FA6A 1I6LA 4ZO9A 1JQJC 2I9PA 1L5FA 1KZHA 2OCPA 1JVBA 2HCTA 4CG3A 4LN1A 1AUXA 2QG6A 3FGPA 4E2ZA 4TRMA 4E70A 1KR5A 2FN7A 1YWGO 1ZGBA 3QV2A 3OJFA 1CERA 5AP9A 4OFXA 4ZXFA 3DAPA 5F98A 1TM4E 3S0JA 3FI0A 1YS7A 1NVDA 2IOFK 2JFWA 3ZKWB 1VI5A 4IDNA 3J7BA 1OU4A 3OCJA 4LVUA 4OQPA 2WOOA 5FO0A 2O2CA 3QWIA 4LC0A 5CDYA 5M7EA 1SXIA 1ZNXA 1ELOA 3HRKA 2VWQA 4H6WA 4LMAA 4X65M 2VNKA 2M9MA 4TTVA 3KP1E 2O01F 1VE3A 3T38A 4RLFA 2OY0A 2Z1NA 2B69A 5CVEA 1A7AA 1HNZM 4AJ4A 2PR2A 2XTAA 4I4TB 1GFSA 1BG6A 4AF8A 1JAIA 4DEYA 4F1WA 4IQFA 2B6HA 1NU8A 3CZCA 3HDYA 3Q0EA 1Q1AA 4EGCB 2GPJA 1IVNA 3BXFA 4W1QA 4N7JA 4D0LB 1JKJB 1N0HA 1DBWA 2N75A 5CXQA 4MIYA 1N4DA 3IR7A 2VP6A 1TT5B 1ZMUA 4JROA 1AF4A 3LE8A 4ROTA 1PYDA 2ZLBA 3DWGA 2EFHB 4EW2A 3SC3A 5C80A 4CUKA 2QRVB 3L05A 5L3VA 2NZWA 1VPDA 5J4HA 4G0UA 1A72A 1GLVA 3LLVA 4LDNA 4YMLA 4MS4B 3MSXA 4CCWA 2VNIA 3C3BA 2DJ5A 3QU2A 1MA0A 4OH7A 3THXA 3T7DA 2AQIA 5HZKA 4IRXA 3ZV3A 2KE5A 5A3SA 3KIPA 3L6BA 4D1YA 3RTCA 2FDCA 2R3SA 2N35A 5EUMA 4IWNA 4D4KA 4MI9A 2CL5A 3TSWA 4K3UA 4AJLA 1ULTA 4QGBA 3CPSA 4E0BA 2G25A 1NURA 2C00A 2QNBA 4RIFA 4KRFA 4A7PA 4KI0A 5FPPA 2Q6LA 1RYEA 4CW7A 4PO8A 1I2BA 1DQNA 1NIJA 4J0EA 3TIIA 1CHDA 1PZGA 2I7PA 2QUJA 3T61A 3BK7A 1HDIA 3PEYA 3A9SA 3BFKA 4WV3A 3FY4A 2R0IA 5LP6C 4ASUD