3FTEA

Crystal structure of a. aeolicus ksga in complex with rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
VSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 60
structure length 233
sequence length 233
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fteA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fteA01
4Y30A 3FUVA 2AR0A 1QAQA 2FHPA 2H11A 3KQPA 3PTAA 3NMUF 3SGLA 3EVAA 5HIKA 2PY6A 3EGIA 4GOND 3ERCA 4PYKA 4GOMD 4M36A 1ZHFA 4YUWA 1RJGA 3MTEA 2NP7A 3P9IA 2ZBRA 2XVMA 3CKKA 3KKZA 3P71T 3FPJA 5JR3A 5K09A 4PINA 5DX1A 3G89A 4KVZA 3H2BA 3KPWA 3MTIA 2C7PA 5HIMA 4AZWA 2B25A 2WA1A 4AZTA 4XUDA 2O57A 5EMMA 4RVDA 2IFTA 3MERA 3TOSA 3G2QA 3LHDA 3OU7A 1UWVA 5JUWA 4CXMA 1WZNA 5DXAA 2P41A 5DM4A 5EIWA 4KWCA 5T6BA 4P7JA 3OE4A 5FHQA 4YUYA 2AOTB 2PLWA 3DULA 3HCAA 4G56A 1YFJA 1BHJA 4GUAA 5C0OE 3ELYA 3B7PA 4DF3A 1RI5A 3T7SA 4IWNA 4Y2HA 4E2ZA 3EMBA 2BR5A 3LKZA 3CJTA 1KHHA 1EJ0A 4V0RA 3A7DA 3BWYA 4XCXA 2DULA 4E2WA 1KR5A 2NYUA 2PV0A 3I5UA 3CCFA 2NXCA 3ORHA 3NWEA 4MIKA 3FUTA 2OZVA 2PGXA 2PXAA 1NW3A 3WSTA 4RTJA 2YR0A 3JWIA 3FTEA 1XVAA 2BR4A 2JHCA 4KRGA 4RVGA 5IKMA 3EVGA 2UYCA 2QM3A 3UA3A 1NE2A 2EFJA 1G8AA 1WG8A 3TR6A 3V97A 4E2YA 2YXLA 5DXJA 4L7VA 2P8JA 2PX8A 3NDJA 1QANA 4X60A 2ZIGA 3BGVA 3KR9A 4LWPA 4FS8A 3LL7A 1VBFA 1AF7A 5CVDA 2B2CA 4GOOD 3GRUA 1VL5A 4NECA 4EK9A 4DCGA 4DA4A 1RJDA 4QPPA 5CM2Z 2FCAA 4CKCA 4ER0A 3P9NA 4KDCA 1PRYA 2H00A 3HNRA 4EQZA 1G60A 1QZZA 1JQEA 3BZBA 2OKCA 3LECA 1X1CA 1IXKA 2AN3A 3QOWA 5EZQA 2VP3A 2PXXA 1NW5A 1RI3A 3S68A 3ELWA 2OBFA 2QRVB 5HIIA 5ICCA 1WS6A 2HV9A 3GGDA 3KQMA 4QDJA 3FPFA 1NV9A 4FGZA 3QV2A 3A26A 3TM4A 3LPMA 4RTQA 2GAFA 3PT9A 3TKAA 1KIAA 1BC5A 2ZZMA 3E05A 4FP9A 1NV8A 3M6XA 5LQNA 4GC5A 5ERGB 4MWZA 1RJFA 4FSXA 4AX8A 2OB2A 4C04A 1F38A 1M6YA 4XUEA 3DUWA 2P3OA 3TMAA 3EEOA 4U7PB 4OX9Y 4M7RA 3VYWA 5F2OA 4C06A 3KQSA 5M5BA 5DX8A 1XDZA 4P7FA 3KR2A 2PKWA 4MTLA 4GEKA 1DUSA 5DM1A 5IH3A 1ORHA 2IIPA 2OO3A 4FR0A 5CVJA 3EVDA 1HMYA 5LQKA 3DTNA 2EJTA 4HGYA 1X19A 4PGHA 3SM3A 5ICGA 1OR8A 2ERCA 4KW7A 2FPOA 5KQRA 2PBFA 2E5WA 2IDJA 4MQ4A 4PYLA 1NT2A 4ISCA 1R00A 4IKPA 2ONZA 1VQ1A 5EQJB 3HCFA 3LDFA 3JWGA 5HFJA 1N7IA 1ZKDA 3AY0A 1VP9A 3I53A 3X0DA 5LQAA 2JH9A 3T7RA 2AN5A 4GC9A 3K6RA 3O4FA 3KHKA 1YZHA 3L8DA 2YQZA 3KQVA 4C07A 5FUBA 3PS9A 2PWYA 4F85A 3EPPA 5KQSA 5E8RA 1RI1A 1VP3A 5FWDA 5C9ZA 1JG3A 2I9KA 2PT6A 3SVZA 1VIDA 1KP9A 1EJ6A 2ORED 3DP7A 1WXXA 1TW3A 3DXYA 3PLAE 1JG2A 2Z6UA 1JG1A 3SSNA 1G38A 4XUCA 2C7RA 3GO4A 3KPJA 1Q0SA 5E9JA 3FUWA 3G2OA 4OQDA 3F4KA 5T67A 2OYRA 5DSXA 5K0EA 3SSOA 3DR5A 3OZRA 3IV6A 1XCJA 3CJQA 4CWAA 1YB2A 4GOLD 3ELDA 3P97A 5T64A 1I9GA 5BW5A 3B5IA 5DM2A 4BP1A 2WA2A 1P91A 1XCLA 4FT4A 2AN4A 2CKDA 3PX3A 3EVCA 3U81A 2LD4A 5DSTA 2N47A 3GRZA 4ER6A 1XTPA 4QVGA 1SKMA 4R8RA 5DRYA 2P35A 2AOWA 2G71A 2ZW9A 3CVOA 3FZGA 3M4XA 3O31A 4RV9A 5CVVA 3UWPA 4UOEA 4R8SA 7MHTA 2WK1A 2XYRA 4KIFA 4PYIA 2B78A 3EVEA 3P8ZA 5FQNA 3UA4A 1NKVA 3HVHA 1D2GA 3K0BA 3KPUA 3KQWA 5K0FA 5FA5A 1AV6A 1NW8A 2JH8A 5BP7A 3DXZA 1SG9A 5DTQA 4DMGA 5K01A 4DKJA 5CUQA 5GP1A 3FUXA 4R6WA 1R18A 4QQKA 2NNWB 5ICFA 2CL5A 5H02A 3THRA 4DZRA 3TQSA 3E23A 3OCJA 1R8YA 2HNKA 4HRAA 5K0CA 2G72A 2AVNA 1WY7A 2QYOA 1JQDA 5FULA 1KPIA 3G8AA 5D1NA 1NW7A 4M38A 4RTKA 2FYTA 3A27A 3HM2A 4A6EA 3BWMA 4POOA 4OQEA 3UJ6A 4BP3A 3CC8A 5EGSA 4RTLA 4CTJA 2FK8A 2PX2A 4FSDA 1EIZA 4X1OA 1I1NA 3EEYA 3B3GA 3HCCA 1MJFA 1XDUA 2ZIFA 1VLMA 2AZTA 4K6MA 2ZSUA 2IGTA 5GOZA 3IYLW 5K0NA 3DLCA 2IH4A 1F3LA 2JHPA 3BT7A 2P3LA 2FK7A 1G55A 3B89A 5K0LA 2Z6AA 4V0QA 2ONYA 1IY9A 2NXNA 4C08A 2OXTA 4PCAA 3C0KA 3LX6A 2FRXA 1X1AA 2G70A 5E1MA 5EOVA 5FQOA 2BR3A 3NW9A 1PJZA 4KDRA 3LCCA 3TLJA 4CKBA 2ZWVA 3TRKA 2O06A 4QQNA 4E32A 5GIPE 3HCEA 2VZ9A 5GINE 2EJUA 5FWAA 1EAMA 3DMHA 3EMDA 5EMJA 1RI4A 2AOXA 3BWCA 2UYQA 2CMHA 2G1PA 3TKYA 1BOOA 2O0LA 5CIYA 5P8WA 5HILA 1JTEA 3A25A 3KQOA 4PYJA 2CWWA 1ZGAA 4GBED 2ZIEA 5EPEA 2UZ4A 2YXEA 4DM3A 5EIFA 1SVUA 4OBWA 2KW5A 5U4XA 4WVLA 1D2CA 3OFJA 2YUIA 3B3FA 3EGVA 2PSSA 4E33A 3FRHA 4E31A 3ANXA 4ER3A 5EVJA 3KQTA 2Z6QA 1VPTA 4HTFB 1AQJA 3TM5A 1R6AA 2GPYA 2F8LA 3MQ2A 5K05A 4QVKA 1JSZA 3FTFA 2PT9A 1XDSA 1Q0TA 3A4TA 3JWJA 4KIGA 4O29A 3HP7A 3DLIA 3C6MA 4PWYA 3RODA 3UZUA 2P1DA 5EMLA 2IBTA 2YVLA 3G2MA 1R8XA 3HVJA 2H1RA 3UJCA 2YTZA 1BKYA 1G8SA 3BUSA 2A14A 4RTPA 2HMYB 1M0EA 2XVAA 3CBGA 3EVBA 3G8BA 4X41A 2JG3A 5F2KA 5GM1A 10MHA 2IH2A 3NWBA 3C3PA 1FJXA 5FTWA 3P9KA 3VC1A 4YV1A 3BGDA 1SUSA 4HSGA 4H0NA 4HGZA 5KYGA 5CD1A 3O7WA 5DX0A 1IM8A 1FBNA 3FPEA 3R24A 4QDKA 5G02A 2B9EA 5EHGA 3KU1A 2EG5A 4BLWA 1FPQA 3HEMA 2CMGA 2ZLBA 3R6TA 3HA7A 5E1BA 3LDGA 3KR0A 1YUBA 5EZSA 3OZTA 1XJ5A 5LSAA 3FPGA 1TW2A 2UYHA 5K03A 2R3SA 4OA5A 2I6GA 5GM2A 3VC2A 3MGGA 2PVCA 1D2HA 5HIJA 2ZULA 4PNEA 3FTCA 5CVUA 3ER9A 3EVZA 4F86A 2JHAA 1X1DA 3REOA 5FA8A 3UJ7A 5DPMA 5LQUA 2GH1A 1L3IA 5CVEA 2C7QA 1L3BA 1P1CA 4LECA 1SQGA 2PWPA 4QTTB 4RSRA 5CCBA 4R05A 2YXDA 4PYNA 1DL5A 1RJEA 5CCXA 5EC8A 2ZFUA 3IEIA 3SSMA 5E2BA 5MHTA 3BKWA 3MCTA 3Q87B 2I7CA 2AVDA 5DRTA 4RTRA 4PYOA 2AOTA 3SR4A 3PB3A 4PGGA 4PCLA 2PJDA 4DCMA 3M6WA 1O9HA 4X63A 1SQFA 3DXXA 4WXHA 2QY6A 3P2KA 5K0GA 3LGAA 4E2XA 3I58A 4DQ0A 1YF3A 3BKXA 5EMKA 4P7GA 3KQQA 1KXZA 4RX1A 2IH5A 2HTEA 5B1SA 2IDKA 1P39A 4RVHA 2AOUB 4F84A 2P40A 2I62A 4YUZA 3G88A 2XBMA 2QE6A 3LDUA 4C03A 3HVKA 3EVFA 3OU2A 3E7PA 5FHRA 5LQJA 4LWOA 3P9CA 3AXSA 2AOVA 5FADA 5C1IA 4EVIA 2BH2A 3LKDA 2BM8A 5E9QA 2PXCA 4RTMA 2PX4A 4EKIA 3TFWA 2GA9A 3AWIA 3AXTA 3FYCA 4AZSA 5FCDA 3T0IA 1B42A 2V7EA 1L1EA 2ZBQA 4FZVA 3GRYA 3GJYA 3GDHA 1UFKA 3LCVB 2XYQA 2IBSA 4IV0A 3HCDA 4P58A 5DLYA 4OBXA 2Y1WA 3FUUA 5E1OA 2K4MA 4OA8A 3PFHA 4P7KA 3GNLA 2ZZNA 3DOUA 5GIOE 3MHTA 3GIWA 3P2EA 2BZGA 1G6Q1 3UJBA 4YMHA 2ESRA 1KYWA 4EMSA 4E30A 2ADMA 3QOXA 5EKUA 1RI2A 2DPMA 3UJAA 1QAMA 4ZTBA 5GWXA 2QRVA 3HTXA 2Y1XA 1M6EX 1L9KA 3PFGA 3R3HA 4GQBA 3UJDA 3UBTA 3C3YA 3GWZA 1KYZA 3NDIA 3KPYA 4AUKA 4CKEA 4YUVA 1H1DA 3JWHA 3M33A 2O07A 4EKGA 3UJ9A 1N2XA 2NXJA 4HH4A 4PYQA 1KPGA 1HNNA 2GS9A 3KR1A 3OE5A 1MHTA 4HTFA 5EEHA 2ZVJA 2EX4A 3SXJA 4PONA 2ZCJA 5E1DA 3I64A 3ME5A 4QPNA 4YMGA 3G5TA 3MAGA 5BW4A 2P3QA 3NJRA 3GRVA 5K8VA 1TPYA 3NVMB 3DMFA 3G7UA 1EQAA 2G8NA 1JTFA 4BLVA 1YFLA 4MHTA 1XXLA 1INLA 3GU3A 4PIMA 3I9FA 3NVKI 4RVFA 4C4AA 5DTRA 1NBIA 4PYMA 2Q41A 3B3JA 3AJDA 3FPHA 2V74B 1R74A 8MHTA 4CTKA 4FT2A 1JSXA 3ID6C 2ZWAA 3R9XB 1NBHA 2OB1A 5BXYA 1ZGJA 3BGIA 3BXOA 3C6KA 3LCUA 2P7IA 3E8SA 1SUIA 4HC4A 3M6UA 4E70A 3OU6A 5ICEA 5DM0A 5LR6A 4YV0A 3PX2A 4GF5A 3FTDA 3KPVA 4RTOA 3D2LA 1O9GA 3CGGA 1QYRA 4A6DA 1Y8CA 2P7HA 4QTUB 1ORIA 1V39A 3A7EA 3HA5A 4M37A 1JG4A 5E8JA 4BY9E 3Q7EA 3HVIA 3MCZA 2VS1A 1P1BA 1JQ3A 4R6XA 5EKXA 4RTNA 2ZTHA 4Z2YA 4ER7A 5KS2A 2HWKA 3LBFA 4LG1A 3THSA 4BLUA 5DTMA 5DWQA 1VE3A 3RW9A 2IPXA 2PX5A 3GCZA 4AZVA 5K0JA 2ZBPA 3FRIA 5LQRA 3KQYA 3OFKA 1I4WA 2JJQA 1WXWA 2O05A 3DH0A 5LQCA 2UYOA 3CJRA 3HA3A 3T7TA 4ER5A 4YUXA 1QAOA 5HOQA 3EGEA 3SX0A 3UFBA 3DMGA 2AS0A 4RYLA 3HCBA 1YZ3A 2C7OA 3LBYA 5DT2A 2GLUA 4ATNA 1FP1D 3GXOA 4YV2A 1FP2A 1O54A 2XYVA 4RWZA 3TPZA 5EG5A 3UJ8A 4B17A 5F2NA 3G5LA 1X1BA 5KVAA 5E9WA 4JXJA 2OPBA 4X61A 4C05A 3VSEA 2HR1A 2YX1A 2VDVE 3LSTA 1EG2A 5HEKA 1ZG3A 4HG2A 1AQIA 1N7JA 1ZQ9A 5E2AA 2VDWA 3P2IA 9MHTA 2BM9A 1T43A 1L3CA 1Z3CA 3BWBA 3M70A 4IV8A 5EHIA 2AOUA 3SMQA 3M6VA 3ER8A 3NTVA 3OPNA 2R6ZA 3PVCA 5HZMA 5D1HA 1NW6A 3IHTA 2B3TA 3MB5A 3FYDA 3RIEA 2OY0A 3R0QA 2VDUE 4U7TB 1UIRA 1DCTA 5EEGA 3V8VA 4PIPA 3GRRA 2GB4A 3ELUA 2ZZKA 2NXEA 1U2ZA 2IP2A 3OZSA 1KPHA 4RTSA 5K0BA 2NP6A 3G2PA 1JR4A
chains in the Genus database with same CATH superfamily
3THXB 4UKDA 3K9GA 5EJ4A 1IBRA 3TAXA 5DF1A 3EQ9A 4GEGA 1M1XB 3VR4H 2Q5LA 4HT3B 2IEBA 1AQNA 1QB7A 3GCXA 1H5NA 1GA1A 2OFFA 3VX3A 4NNOA 2AR7A 1RI5A 2F1IA 2QTWB 1D1PA 2WHXA 3HWSA 4ZAYA 4YRKA 1OXKB 1LA2A 3ZPXA 2QRLA 2RJOA 3FTEA 4BQPA 4AJNA 3QLJA 3ASUA 4YRFA 3V3KA 3FKJA 4P0PB 1G60A 3D1LA 1CZNA 3KQNA 1T0BA 3ZV6A 3IUMA 2HZBA 4WRRA 3CLTC 4C04A 5JCOC 2YW2A 5LBUA 5ANRB 1O94C 3R3ZA 4BMSA 4F5DA 3GUUA 1ZJ4A 3HYCA 2ZIXA 4FBLA 4YRTA 4NFHA 3WXBA 5A1JA 2XE6A 2ACWA 3L6EA 1D2AA 3KSDO 3EPPA 3V4RA 3JZAA 3F3YA 3UNXA 2QYTA 3V8MA 3URKA 3IALA 1U81A 3S7TA 4MPDA 3IQXA 4PBTA 4MQFA 3OF5A 3IV6A 5CIQA 2AZDA 1NP6A 4RGBA 2PMFA 3E4CA 4MW2A 3NTRA 5DE3A 3KB2A 1LEHA 5KJFA 3UA4A 1UJCA 1CF2O 4H1UA 4HVLA 2FYTA 2PSEA 4MA0A 3HCPA 4LV5B 1A77A 4O1HA 4YRPA 1PZNA 3VO8A 3R7BA 4EG5A 1T2VA 2BR3A 2VCYA 1CF4A 3A36A 1JEDA 4PW0A 1RQPA 4DADA 4EKYA 1OXVA 1ZESA 1YB7A 3VZCA 4L9SA 2RH9B 4P08A 5FL7A 2ABWA 3G9UA 4TSFD 1E2UA 2O5VA 1NJFA 3F97A 2D0OB 4GW3A 4DRXA 1GDDA 3RT1A 4YV1A 3VHXB 2DNAA 5IK2A 4PC1A 4G4NA 3NETA 2J07A 2XYHA 2Y3IA 2QG4A 5IBRA 3VC7A 1XEXA 3DB2A 5ES3A 1VL6A 1R2ZA 2QJOA 3CZ4A 1XQXA 4Z3DA 2F7SA 4DWVA 4GXQA 4RDXA 4CG2A 4LOKA 2GYUA 1OZ0A 4FXOA 3IFSA 2SCUB 4JYMA 3C7AA 1EFVA 2P77A 1SQFA 4KHPB 2QLBA 2F1KA 3PP8A 4RVHA 2AWNA 2C3UA 2HRBA 2PKCA 1LV8A 3PCTA 2X58A 1GNLA 3QOYA 3DBRB 3U7HB 3NIDB 1DE0A 3FZYA 4TYQA 4PSCA 4CEJA 3MAAC 3C5HA 1XJWA 4Q6WA 2BFFB 3NNSA 4P32A 3NBIA 3EXAA 3IVCA 3ZCSA 1Y5IA 1HXHA 4AWAA 2BFCA 1T36B 4DT1A 5E9AA 4MLZA 1OBCA 2YRWA 3RC7A 1S2IA 2B94A 4BY9E 4PS1A 2IYPA 4UVGA 3ZKWB 4LFAB 2HK8A 4LOHA 4CQNA 3IP8A 2A7QA 3UHOA 3MCVA 4XEHA 1DJQA 1R1DA 1BVRA 3IILA 5KJ6A 4WUTA 5LP6C 4PZYA 1GFSA 2HR1A 1SA0B 3FIJA 3OJXA 1RQ7A 1C1DA 5IVIA 1TUEA 3A9WA 3JQAB 1EWQA 1SBHA 1R0YA 3G8YA 4YQYA 2P90A 3DZBA 4KLNA 2BI7A 1LB1B 5ULLA 4PPFA 4TYPA 2M60A 3A3NA 2WUWE 5JAUA 4RL4A 1A9XB 5ENZA 1RJGA 4ZVPA 1XN1A 4DV7B 2WPDA 2PEZA 1KSGA 3SJ7A 3KDPA 2Z5GA 4TKLA 4BNHA 1E79D 4ZOBA 3K1TA 4IWNA 5IPFA 1RYFA 1B6GA 3DA1A 2UUAM 2WFMA 4LZJA 4IEFB 4CISA 4G4SO 4LJSA 2UUBB 1PW7A 4LSGA 4D4JA 4XYLA 2XFTA 1KI8A 1XR3A 2XE4A 3DDHA 3LLMA 1GQFA 1KIAA 1HFKA 3OEHD 1QYWA 3I83A 4AQYM 1G8MA 2EATA 3LUCA 4C0BA 1F4VA 3LO5A 4ZP1A 1AD2A 2DY1A 2HU8A 2FSVA 4K6KA 3D8HA 3EVDA 1T9BA 5EP4A 5JMPA 5CLLA 5TQJA 2HSGA 4MGZR 1NVBA 2R2GA 1KVSA 2OCIA 3A8TA 1FDUA 2CJYA 3FSEA 3HUTA 1JEYB 5HX7A 3LVVA 3DR5A 1JDPA 2Y76A 3BH6A 1KZ9A 1JP7A 4EGCB 2PDAA 5AW1A 3WYCA 2AE2A 1E5XA 1SK8A 2HI0A 5CJPA 1IULA 4EJ6A 1XEFA 1T2EA 1TEHA 3AFHA 2ZK7A 1CUAA 2WK1A 4R2JA 4ND4A 5FUYA 3EGDB 3J7BA 4LQLA 3GDOA 5KYKA 3SBEA 5JATA 3GDWA 3QKRA 3INRA 5ITUA 2DPHA 1BD3A 3P5SA 1Z2AA 3KUKA 3VR4A 1P45A 1LPSA 3ZLJA 2VJKA 2X4DA 4UD2A 1V35A 4M0LA 4L50A 3RUCA 4B2IA 5COAA 2VSNA 4Y6OA 1W88B 4TL9A 2QWXA 1B26A 3KQKA 1FF9A 1ADCA 1JG6A 4HNUA 3GDGA 2PBRA 1H5UA 4Z0HO 4MW7A 3F0TA 2QUHA 4FC7A 1ESEA 4BATA 1XZHA 4D9JA 4I5FA 1CIJA 5EN4A 2DT5A 4DIDA 1U1FA 3N2LA 2YXNA 4LOLA 1VJ0A 1JHQA 2D7HA 1LZLA 1DAOA 1V95A 2CHVA 4CL8A 1FP4A 4PVCA 3LWBA 3LX5A 3O9ZA 2PJDA 2QN7A 1O9HA 4HEQA 3HJAA 3WMWA 3L02A 1G59A 1P29A 4XSVA 4FFMA 3LJKA 4EVIA 4M53A 3C8ZA 3C7DB 4OKNA 1JNYA 2JARA 2I4TA 4LXTA 2QQ5A 1GUZA 1NQUA 2ZB7A 4OBXA 3E7FA 2HJ9A 2VP4A 1LTHR 1KYTA 3K73O 2OL4A 2A30A 3CN9A 2NQ2C 1ZMUA 4HTFA 4M9CA 5TC4A 4YT8A 1ZGBA 3L05A 1FS5A 1AXGA 1T0HB 4MI6A 1RXSA 3WYAA 1UCFA 1I10A 2AK2A 3RPEA 2EA0A 1N2OA 3HVRA 3EIOA 1J0EA 3DLAA 1NX6A 4QGFA 4Q4JB 3M89A 3RCBA 1EUCA 3EGEA 4LXIA 4UARA 1O54A 3BMXA 1F2VA 3MVEA 2Q6OA 5FJJA 2NYVA 3PC2A 2CFOA 2XEXA 2X13A 5J63A 4CGZA 5EJGA 1I5RA 4ARZB 1EVZA 2HB6A 1U2ZA 3TXYA 3R20A 3UANA 4M46A 3W5BA 3NI2A 3LQYA 3C3BA 5EFOA 4E12A 5HBGA 1UPAA 4XUDA 3MLBA 2PFGA 2LKCA 3MERA 5BQOA 1KY4A 4GYWA 1QP7A 2AT1A 1ILEA 1IPHA 1E4OA 3TS1A 4KBYA 4CZ2A 5GAJA 2ERYA 4AMYA 5KO2A 4JFRA 3AUAA 3D7NA 4AL4A 1NW3A 3WGLA 3IVAA 3BVPA 2I78A 4QDXA 1Q7GA 4HO1X 1YB5A 4YP7A 5H3HA 1AVTA 1G2OA 1G21A 4KREA 1H0HA 1X1CA 4KQJA 4WZAA 1AK9A 1JIIA 2DFVA 2G3QA 3LXRA 2XV1A 3HZJA 3I04M 1M6YA 1T2NA 1SY7A 4EEXA 1O5IA 4AN0A 1TIBA 3LHKA 1P7CA 1HMYA 1U8ZA 3R7SA 4AJ2A 1CY1A 1T5BA 2Y8EA 4LIPD 2XA9A 1P4JA 4S1VA 2R6JA 4A92A 3L29A 1A2OA 1KERA 5FD8A 3MWDB 2FFHA 2R4TA 1MOSA 4MVCA 3TRJA 2IU3A 3GZTB 3FD9A 4DMMA 1TVCA 4WGGA 2YHIB 3TSOA 3KVYA 2IEDA 2UUCM 1IN1A 2WAOA 1XLTA 4L8FA 5T64A 4DLXA 4DVGA 4I1PA 1R6BX 1WUKS 1K3UB 5T7BA 2DWZB 4E1AA 3KB8A 3X1WA 1ZY2A 3A9VA 1DX4A 5BYJA 2WR8A 2HNKA 2QYOA 1EXMA 4PFJA 2TMGA 5AKEA 3UJ6A 5EGSA 2YC4C 2UZ3A 4M88A 1N7GA 3IUBA 2AZTA 2DTDA 1JEJA 1O96A 2VH2A 1WBJB 2YV5A 3D7RA 3UGQA 3LBHA 1F8XA 2GF9A 2F8SA 1UZNA 4S1PA 1JBQA 1EHIA 1F8FA 2DHRA 4YPVA 1ZM7A 4RF4A 1AMNA 1QDEA 2BGWA 1J0CA 3VDUA 1VPTA 2V1XA 2O0KA 4R51A 1KOFA 3GMTA 1EDOA 5DYYA 2XWJI 4EI9A 2JGDB 4TXJA 1UKAA 3VISA 5B2FA 1U5CA 4QTZA 4B0PA 3VC1A 2GD0A 3TMYA 2Y27A 3E53A 3X43A 3U5TA 4M1KA 2WHPB 1S4MA 4OFBA 5ALFA 1RHMA 1NMQA 4BX8A 1TW2A 3DAHA 3II6X 2OCKA 3IMGA 3BFPA 4GMXA 5DXFA 3C5VA 3A4YA 4X1KA 4BBAA 1Z36A 3KUDA 2WV9A 3OPYB 1LS1A 1MOZA 1IY0A 1Z5GA 2JY6B 1Z75A 5IH7A 4HQ0A 3KFXA 2AFHA 2OBMA 4DQ0A 3FSGA 2ZUSA 5DIZA 3D6HA 1U0TA 3RBVA 3OUUA 1OMOA 1KKUA 2GN4A 3EJ6A 2O8VA 4KLRA 4JJKA 2PIDA 2WP0A 3GFQA 1GYPA 2Q1XA 3NWLA 4GKVA 1VPDA 3NHZA 1ZXBA 1Y82A 5GWXA 2VNHA 2FW6A 3NDIA 1K27A 2KMLA 2IV3A 4G0ZA 3T5CA 2G5TA 2J6IA 1DKQA 2HHHB 2P6RA 2FUNB 5A7HA 1V9LA 2E4AA 2NO0A 5B64A 3AJDA 4J94A 2OBXA 4DMUB 1T4DA 3ID6C 1T9ZA 1S3SA 3W2GA 2EBFX 2QSFX 1WXHA 2VK8A 2CXTA 1NZDA 1GTG1 2Y1EA 3KUCA 4J03A 3NGMA 4GXRA 4F2LA 1FP1D 1MFZA 1FX0A 3NEJA 1J24A 4HWTA 4HY3A 1L7AA 2WTXA 3NUGA 3GIDA 5FWXA 2O8DB 1PG5A 2Q6TA 1YR9A 3NTVA 2HQOA 1ABFA 5A4AA 1SUCA 1YZQA 3ZBPA 3RVKA 2VHJA 4EVRA 2O8FB 4FNGA 2FMKA 5JSZB 3BSWA 5H1YA 5L7YA 2QM8A 2FUG6 3ZUPA 4EY8A 1YA6A 1E77A 1K88A 2PLWA 3GMIA 3D3QA 2ONCA 4DF3A 3I0ZA 4OYYA 4Y1RB 3HN7A 3EA5A 4Y2SA 2W8ZA 2QRPA 2I7PA 4LXGA 4KO8A 4DB4A 4B3TM 4D0RA 2IYWA 3OX1A 4RC9A 1YBFA 4LF5M 4QUDA 2ASVA 4C5AA 1HSZA 3JAMS 3ZC3A 1XTQA 5SYMA 3AR7A 4HEA1 4FGZA 5KNCD 3TQCA 4HYYA 4TTVA 3QLUA 3KAQA 3E1GA 3AIKA 3SQDA 1NNI1 2XKAA 4M0FA 4L22A 4GEKA 5KSYA 3V42A 2EJTA 2WV7A 3Q88A 5AHOA 5IAAA 3QELA 3HYRA 3BPSA 2JA2A 4L8GA 2P9YA 3VDQA 3IMFA 4U7HA 4EDFA 3NRCA 1NOJA 1DBPA 4O4LA 3E7XA 3WMRA 3HUEA 3I4CA 3DZCA 3WLNA 1LRLA 1RQNA 3ZE7A 2WKRA 3CM0A 2HIGA 5FQNA 5FA5A 1CY4A 1P0MA 3LWZA 1ZDMA 5EZ5A 3EX7C 3STYA 3JVUA 5CBKA 4XCVA 4CMIA 1JKJA 2VPQA 2NZJA 5ECWA 2ROQA 5D86A 1TVEA 2QZ9A 1TYBE 2GFQA 3BDVA 1ARZA 1VIMA 4ZDWA 3VNSA 3C2QA 4DLZA 1BH6A 4H18A 4Q3CA 3EMDA 4KMSA 2QUJA 1K6XA 3G0CA 5JO9A 2LWIA 4NBSA 3EGVA 4HFNA 3HU3A 2WE7A 2PS0A 2RD2A 4M0KA 1KU6A 1MB9A 3VAYA 2A7XA 2ZJ4A 2HMYB 3LHIA 1ZA2A 1QOQB 4RK4A 2O8EB 2K6BA 3TQOA 4PQFA 1RXEA 1EVQA 2ZE7A 3K32A 1GTZA 2DBQA 2CZGA 1CUEA 5IABA 1URPA 1EK6A 3LVQE 2IHJA 4AJPA 3MYRA 3GRCA 4D9HA 4LJ5A 1BG6A 3DAFA 3F7MA 3SIWA 2NSHA 4XYMA 4QPCA 4LZNA 3WGYA 1W8DA 2I54A 4LVOA 5D51S 1IN5A 4CMCA 4TTQA 4RJLA 3ZHYA 4H4EA 1P39A 5AK6A 1I7QB 2PUDA 4HUTA 3BE5A 4OL9A 5C1IA 3WB9A 4FWIB 5A0TA 1ZJJA 3D2AA 3B9PA 1V4BA 4ZK2A 1P0IA 2JASA 1X9HA 4P4UA 3UW3A 1RXVA 2AW5A 2P62A 3UBTA 3IBSA 2CFIA 1ZN7A 2CZQA 1E2GA 3E27A 3I64A 3WGJA 1NU6A 3ZBTA 1O8CA 3K5PA 4TSKA 3QM1A 4XFKA 3M82A 4NBTA 3PBKA 2OB1A 1P4HA 3I01M 3IDAA 1L4FA 2FFBA 3ORSA 4XQEA 2IZ6A 3AV3A 3QX9A 3ONEA 2C31A 3QMMA 5BNWA 3WV5A 1FFWA 1Q77A 2O1XA 3QIVA 1CS0A 1F9EA 4CRWB 2CNNA 1EM8B 2J41A 5K20A 5C5CA 1EI9A 4PBSA 1KO5A 4EHKA 2G9ZA 4QATA 5E2AA 1MJGA 4HD8A 3SF0A 5JWHA 1JS1X 1QSGA 3QTTA 3RHFA 1KDZA 5JY6A 1H8HD 2VYQA 4XUGB 1U80A 2AR0A 3KVRA 2I1LA 1ZRMA 1PWYE 4BFVA 3QEOA 2YY5A 5F7JA 3VDRA 2FOIA 1E1RA 3EY4A 1B41A 4Y98A 4JELA 2DWUA 4JI1M 1SXJD 3R6GA 1WXDA 3NPAA 4Q9NA 4PLCA 2I3ZA 2YQ5A 1U3WA 5CLGA 3QX3A 3SM9A 3RU2A 1OPRA 2QN1A 1XNRM 3RH0A 1Z62A 4EUSA 1C81A 3UKOA 4DIKA 1SB8A 3DZKA 1QKJA 3EXHA 1M8PA 3N0VA 1NBMD 4B6EA 4TM8A 3WNDA 1FLAA 4R9SA 4DDTA 1GU0A 5F4ZA 4BAUA 1QZXA 4CKXA 3A0UA 4ZVTA 5H9VA 2IXTA 4Z4GA 3LW7A 2WYOA 5ALVA 2ZRLA 5CLFA 1B0UA 4D81A 3TMAA 2YWGA 4JJEA 4QJBA 3OQPA 2AX4A 3OOSA 3HO8A 3KR2A 2VNKA 1SKAA 1LVHA 5CNIA 1Z33A 1U98A 1XU9A 3OOEA 5ALXA 3RS2A 4JITA 4J91A 1CETA 1T6XA 1PJCA 5EQJB 2D4AA 3BEDA 1JALA 4IW3B 2ZIUB 1O58A 2HX1A 4LXQA 5BV0A 1SU8A 3ZCRA 4Q18A 3TRHA 3W8FA 5K6AC 1M2NA 1FNDA 2PUTA 5DM2A 1RMTA 4LJ6A 4LGMA 4FMDF 4BNDA 4UFOA 2CVZA 4J0DA 3IDSA 3L8YA 4IP0A 7MHTA 4PLVA 4B73A 2DUMA 4Q82A 4QXMA 3ECAA 4HDRB 1KDTA 2IXDA 3VR0A 2XTZA 3DLPX 3A27A 5DB4A 1XFDA 1E18A 4YI3A 3GLKA 2D8AA 3EK2A 2PZ8A 1T0PA 3PXAA 1E5QA 1CQWA 3N70A 2WTNA 5GINE 3ESQA 3HO1A 4X65M 1UXKA 2E4ZA 3IE0A 5HILA 1GLNA 2D06A 3FPLA 2OV3A 2OGUA 3KQTA 1K3XA 4MYSA 3OY2A 1TK3A 4JXKA 4CCSA 3NWBA 4YI5A 3IJPA 2PUCA 1P8JA 4IS2A 1OROA 5IX8A 4IYRA 4I1OA 4HWRA 5DNVA 2J7KA 4X6LA 3ZD7A 2NO1A 3Q9UA 4BV8A 1YB6A 1PJ4A 1I13A 4LHYA 4MGYR 1DU4A 5LZ2A 2PLFA 5A3JA 3L8GA 4F3NA 3M1YA 4Y2GA 3OU2A 2L7IA 2UV8A 5FADA 2ICAA 5JSUA 4BMPB 4PIVA 1BRMA 3FDIA 4QUGA 2G17A 4UD6A 3ZXUB 4XD7D 2BRUA 1FFEA 4JXZA 4DMKA 3FGZA 4DBLC 3G6KA 1B1CA 2IZZA 3NHSA 4WNCA 4AJ1A 3GV0A 4DB2A 2XTJA 4MDFA 1NBIA 3L40A 1TTQB 3ZI7A 2X1HA 3WRXC 3A7EA 4MVJI 1SURA 3DE2X 4FMDB 4MLPA 3GH3A 4M99A 3IAEA 2FEWB 5F33A 3PE6A 4CMKA 5EPOA 2QD2A 3JSAA 2B36A 4QELA 2ZANA 3AFGA 4OXIA 5L3QA 3BD6A 1Q1AA 5DMHA 5JLJA 5B57C 3O21A 3GJZA 4RK1A 1C2TA 1DEHA 3IO5A 4P5EA 1F4PA 3QX8A 3FYDA 5FI0B 1KK2A 4EFDA 4U7TB 5KOHB 5NLLA 1V96A 2KJQA 621PA 4CKYA 3ZVLA 5KTKA 1J0BA 2WIAA 4MS4B 3DZHA 2X3FA 3WWDA 2CUNA 1L2DA 3E35A 2YBEA 3QVGA 5BRJA 4AUMA 2XADA 1VL1A 1R88A 4I8XA 4CF7A 1WMSA 1GL6A 2X7HA 4DDKA 2QT9A 1MNAA 4GNRA 4LF9B 1Q92A 1J70A 1XRSB 5G4KB 2B6NA 3PGLA 3L41A 2ZYDA 3AJAA 4JKIA 2CFSA 1TOAA 5AOAA 1QRDA 1CQIB 2YYZA 3TLGA 1UQRA 1YZYA 1EESA 1H6UA 4MB7A 2FFAA 4EITA 4RTQA 1GQ2A 3D31A 1ZINA 4Q00A 3KE9A 3LC2O 5IFLA 3KD3A 5EMHA 3F6SA 2FX5A 3CZ9A 1NNLA 3K16A 1CUXA 5L7WA 2QRJA 5JI2E 3ZXXA 4OBEA 3RE8A 2A5JA 4OYRA 1WB4A 1DCKA 2VIIA 4P17A 1T15A 3E1KA 2ORED 3OE1A 1DAFA 1G38A 5KWSA 1UAGA 5JXWA 1HQDA 2HK6A 1CD5A 1K6EA 1NY6A 3SC2B 1KOLA 1Q1NA 4RA9A 2J6BA 4M0DA 4O59O 4RY8A 2OR3A 1WQ3A 3CEAA 1XZPA 1U3VA 2CNWA 1G5HA 2C2HA 1E4EB 4PN3A 3O94A 4EY7A 3AJEA 3O0TA 1P5HA 4H2DA 1EK2A 3HKDB 1VTKA 4LDZA 3C3AA 2J5RA 2D62A 2CV0A 3F5SA 4QTXA 2ONYA 4X24A 5F21A 4Y6LA 5REQA 1FUUA 4TMFA 5AW8A 2ORYA 2I7NA 4GBED 1SVUA 2IUFA 4IY1A 4ZD6A 4MK4A 2XCUA 1DIHA 1AQJA 3TMKA 3S3TA 1NY5A 4JBNA 2D5LA 3ABSB 4PAGA 1YQDA 3T7JA 2BELA 3Q8GA 4A16A 2P69A 1XZDA 4Q1BA 1UBSB 3TZCA 3JRWA 3Q8XB 3I8OA 2O0MA 1FJGM 5DCWA 5KYXB 4FYJA 2PBLA 1U94A 1S9DA 2VF4X 1J21A 1W7AA 2QE7A 5CA1A 2I8AA 4X94A 4PYNA 4P5PA 2TRSB 1TO1E 2FQYA 2O3RA 1X77A 1BWQA 1KSHA 4D41A 3CRNA 3DKPA 3T9EA 1KQPA 3QNMA 3Q10A 2GM3A 1AH2A 3OPVA 3LQ1A 2NSYA 3D4BA 3K20A 4EELA 1QQ7A 4Q02A 3LX4A 4L74A 4IMPA 3OQ1A 3WHKA 4LXXA 4YJDA 5JPCA 1T91A 5J2TA 2QLMA 4D9EA 2DQSA 4E30A 1RC0A 1TMYA 4ROTA 1ISSA 2ZXUA 3K2IA 1JBKA 5CU7A 3G1UA 4H35A 4V0MA 3DEJA 3MAGA 2I2AA 5CGZA 3NVKI 1PQWA 2Z3XA 2WYVA 1D2MA 2ASEA 2V7VA 4CMGA 2FPUA 3KLOA 1AG9A 2C0CA 3H5TA 3E3MA 4I1RA 1N6OA 5CHYA 3D2LA 4UDOA 4IDPA 4A2WA 3CPEA 4NULA 2G67A 3QWHA 4RY2A 1U8UA 4YJ3A 3WIDA 4RPJA 3AERB 1FVHA 4JYAM 2VVTA 3TW8B 3NWOA 4DA9A 4BYGA 1KZGB 4GSLA 1V8BA 3RYFB 2IYUA 2MIIA 1N78A 3DTVD 3CEHA 2EW1A 4KMRA 3PVCA 5IBCA 3IDFA 3OKPA 1Z6TA 4UCWA 1AMOA 1JAZA 2ZZKA 3I4FA 4X95A 5CA0F 1OIVA 2B5VA 4EARA 2NU9B 3RG8A 2CLOB 1GADO 2ONKA 3B6ZA 1XD2B 4XAQA 2YZ7A 5HIMA 3WK7A 2QD5A 3H42B 4JMLA 3IB6A 2I8CA 4DMHA 3CZCA 5DLPA 2DC1A 5KWIA 1RBYA 2LP4Y 1NC1A 1V6AA 3AI7A 5J4VA 2EQBA 3VVMA 4Y18A 3LFHA 5HMMA 1QRAA 2IOFK 4RZXA 3ES9A 2DKLA 3BIXA 3TR6A 4HDAA 1VCMA 3VK8A 1CUGA 3LGXA 2JFVA 5C1OA 2J7NA 4GOOD 5BSKA 5C32A 4UE2A 4PZZA 1Y8QA 1CUCA 2VP3A 4PPQA 5EJEA 2R87A 5AK0A 1LPPA 3WLPA 2PM8A 4RUKA 1U2PA 2ODPA 4DSUA 2AQ8A 2IPAB 4R1MA 4YXWA 4URWR 3TQQA 3K9QO 1GZ3A 1Z4IA 4PGAA 1PF7E 1MKYA 5BW8A 4WLEA 4KFRA 2XWPA 4DCNA 5DWVA 5LMUM 2NN3C 5B2EA 4RVNA 1AHHA 1JYSA 4FX5A 1IN7A 1VIDA 4ZGWA 2NX2A 4A3SA 4NCBA 1MZPA 4ZJZA 3F7NA 3S5JA 5DW0A 1NNUA 4PAMA 4OB7A 1HT0A 1Q17A 1MMFB 2WIBA 1QRRA 1G63A 3QUBA 4L2IA 1U8YA 1OUMA 1OLXB 5KSZA 1REQB 4AMZA 1EWKA 4NOKA 1YMQA 3OAAA 1FQKA 1BGXT 1EP3B 4O4JF 4A8JC 2YWXA 1MN3A 3TECE 3TIIA 4YQFA 3EUEA 4QUJA 2YIJA 1QQBA 1L2CA 4ZIRA 3CUTA 1KQ3A 4G3XA 1A9QA 5HS4A 1MQ9A 5C3UA 5KWVA 2A9RA 4ZC8A 4QNNA 3ETLA 1A7JA 1TQHA 5T6MA 3ETJA 1FSGA 2KW5A 3QVTA 1WNFA 2DBRA 3EOBI 2AUNA 1L5MA 3OCUA 1LSSA 3QVUA 1YDWA 4L9AA 4Y1GA 4IDFA 2QJTA 4OXNA 3W9UA 3QTBA 1C9DB 1ABEA 3VU9B 2JFFA 2Y6UA 4C30A 4FJ1A 4EWLA 3OEYA 2UYHA 3QVMA 5GM2A 2I6GA 3AC0A 1AQYA 4JUBA 4J4BA 3SDBA 3IT1A 3AIOA 1N5DA 2WLSA 4ED9A 2JDIA 1HMPA 2QSYA 1C3XA 1WHSA 2JANA 1FMTA 5K0ZA 2VRWA 1QQ5A 1KAGA 3IKVA 1DDGA 3T06B 4M8IA 2TMYA 3QPWA 4JA0A 5K0GA 2IC5A 4AKSA 2FE8A 1Q74A 2PZEA 3P2YA 4HQFA 2XBMA 2QE6A 1VOTA 1YBMA 3GLVA 2LVNC 1R5NA 2GZDA 3MJEA 2R00C 3EC2A 4DDUA 3PLRA 4HQRA 3R6LA 3X1MA 4NG5A 3OT5A 5DLYA 2JBHA 1ZI6A 1GGHA 1L5QA 1AM4D 2X5KO 5CDUA 2Q7XA 3JQBA 4RETA 1CKEA 3UJAA 4WK6A 1H85A 3R3HA 2V0NA 2HJHA 1PM5A 3RVBA 2BWJA 3AV0A 1P1KA 3NOQA 1RZRD 3RSOA 3W5AA 3MNFA 3CF0A 1OTYA 1JTFA 3O6VA 1YQUA 5CG2A 2HAKA 2BEUA 4GLBA 5AVOA 1SUWA 3FHOA 1R0CA 1IHUA 4QFCA 4HH1A 1W73A 3FOCA 3AL2A 3CGGA 5EIOA 4DJTA 3A6KA 4M37A 3C43A 1THMA 3K5WA 4KDEA 2Z8YM 4J0QA 3KZKA 1I4WA 2JHFA 5I8ZA 4AJEA 3CVUA 2X8WA 2QL7A 3MWKA 4R0MA 1FP2A 4FFWA 4O4JB 1KYQA 2ORIA 1VRCA 4RO0A 3NJ4A 3QEMA 3ABQB 3W6OA 4CT0A 3W3ZB 3FGPA 3DA8A 3D59A 4LDQA 4CHTA 4UHKA 3TIXB 2A0FA 4YFYA 1CNFA 3A32A 3C3CA 1EFRD 5BXQC 2AL7A 4GI1A 4FE7A 4WBSA 3BRQA 1RFLA 2VHXA 4OX9Y 3ZOZA 2GK7A 3FHCB 3VSDA 1SH7A 3FHTA 1GG8A 4LVUA 5DX1A 4RK0A 4AULA 5LJIA 1E5LA 2D8MA 1J5PA 2GXAA 3PD7A 4WDRA 1X7YA 2AFIE 3BIOA 3CJTA 2HRQA 1KFKB 1JL3A 2IY7A 4KWHA 5IXYA 5DHRA 3A05A 4KXFB 2Q8NA 4EJ0A 2R68A 1D6SA 4LHEA 1NUTA 2VZ8A 3L7JA 3JSXA 4Z4HA 5CLHA 3UMYA 2QQ8A 3S2ZA 1LLDA 2F1JA 4US1R 1ZVVA 4MYDA 3TM4A 3WMFA 2QTHA 4WKOA 1M34A 4UNNA 2P3OA 2RGWA 3W1EA 4IJKA 1I1QB 5K51A 1OQAA 5FB3A 2EFDB 4C1BA 1SCKA 4D9FA 3DTNA 3AQ4A 4LZZA 5H5JA 3BRWD 5EP3A 4EAQA 4O4HF 4UW9A 4JFAA 1UPFA 3Q1LA 4ZQHA 4IDNA 4ZFNA 4UZSA 3J81A 1YL7A 2WD7B 5CXSA 5K4AA 2MGWA 1WTCA 2ZXFA 3I3SR 4TTRA 5TPZA 3H65A 3HJGA 5JARA 4DEXA 1E0JA 3WNZA 1TH3A 2R65A 2ZW9A 1H3EA 2JW5A 3R44A 2HMTA 3IIMA 1U2TA 4FEGA 2PQMA 1I6KA 3K5HA 1UPBA 1L1RA 1UANA 1NYLA 2ARKA 4G25A 1T0IA 4JEMA 1OW3B 3A3KA 4OO3A 4JI4M 2EDAA 5K0LA 1S3GA 2W7TA 2VDNB 3QPBA 2DTEA 2WZJA 1BXZA 2CL0X 3V8BA 2VQSA 2V3CC 1WSDA 3K70D 1TA9A 2HIAA 1WCXA 5FWAA 5IEJA 5J4KA 1J1ZA 5KWEA 5CIYA 4MP8A 1YULA 3TZ6A 1KGSA 1D9ZA 5HYVA 1ZMOA 3FYTA 2VKTA 2PUFA 1SRQA 3W6UA 2QB5A 3FOWA 2VNIA 4R8LA 1HDYA 2DWQA 3U44B 1VE6A 4RJIA 4P31A 4QQRA 3ZHZA 3VR6D 1BKYA 3W1VA 2Z7JA 2PGIA 3DKIA 5TV2A 4JMPA 4MHSA 1X80A 3M2PA 4N5DA 3QU7A 1N34M 4K6HA 1KP3A 4WADA 5TRTA 4MYUA 1ZMBA 4MA4A 2X8BA 4DGSA 3WNBA 3OQIA 3F71A 3Q3VA 3PQDA 3NAQA 3GVCA 3IIIA 4HX5A 2FI1A 2VYFA 1V48A 4AMUA 4YXFA 4DGQA 1KIMA 1A50B 3KYDB 3CVWA 1XXHB 1XZGA 3GLTA 2HRDA 3B9QA 3T38A 4D25A 2C20A 4JCCA 4BJHB 1DCMA 3KOWE 4JJ6A 2W8BB 1D2NA 4JYZA 3B2QA 3HZOA 2VDQB 2W4IA 1CEXA 3VJMA 4B48A 4N8EA 5IZ4A 3DZFA 5LC1A 5D7BA 4YY3B 1BHO1 2ZYSA 5EYPB 2HXSA 3PF9A 2H08A 1L9KA 5J23A 5JD4A 1ZL2A 1E0AA 1E9EA 4G65A 2F5PA 5I7EA 4MDEA 1P19A 1SOWA 3H83A 4UUPA 1ZHOA 3AZPA 3SHGB 2DPLA 1IXZA 4O4HB 4L72A 4S1NA 5KPDA 2RHJA 5DV9A 2YJNA 3I2YX 3BXOA 2VNAA 1EUDA 3FKSA 1KK3A 5IASA 1DEOA 3N0RA 1E69A 3KJNA 1ULSA 2P6MA 4L4XA 2DHDA 4GBJA 4QHTA 1E62A 4U2FA 3KS8A 3OLVA 1NM5A 1CUIA 1TUGA 4ZVMA 1E99A 1XTKA 2HM7A 5HZKA 3DOJA 1HDIA 1AQUA 2BM1A 2HJRA 2IEYA 4MS3B 2ZROA 3RT7A 1ZC3A 4ZYXA 3HJHA 3R7NA 4XPIA 2JFWA 4G24A 5HIKA 1K0FA 4DS3A 5AO9A 2QRKA 4TXHA 4G2NA 4M2LA 2ZETA 3LX8A 1IY8A 3VI4B 3BBLA 4UU7A 1ENPA 1DQRA 4LTNA 3STUA 1A1VA 3L27A 4C22A 1ZSVA 3I9OA 5JAMA 4A2PA 4E7PA 4WA7A 5JTTA 5E6UA 1IHOA 1C41A 3V7FA 4OB6A 1GKYA 3LQ4A 2PGOA 1LK7A 1W59A 4TZTA 3H0EA 1GGVA 5DNAA 3RVSA 4DOMA 3I37X 2VR1A 4QNRA 3E5HA 3CFYA 4D98A 3ZDCA 2C57A 2OCXA 1G6HA 3DV9A 3MWJA 2L42A 3G9TA 2CDRA 1YR7A 5IYZA 4KWIA 4D3DA 3ZHVA 2WDPA 3KXKA 5TS3A 5BPFA 2Q5EA 421PA 1HRDA 3OH8A 2OGWA 1E1YA 1YCDA 4D82A 4Y2XA 4RFSA 4CT5A 1WHTB 1A95A 5CFNA 2DP4E 2QMEA 2NTNA 3ROQA 2GDJA 1YDGA 4EB6B 3CH6A 5EPUA 3UT6A 4RKUF 4L57A 1CR2A 1P6QA 4KYUA 1YQ9A 2H16A 4JLNA 5AW7A 4AMGA 1QC5B 2L6OA 2VP2A 1UBLS 3GFSA 2H07A 4KSCA 4ITQA 1XTIA 3UK1A 4ACAA 4FKMA 1JFTA 4FI3C 1W0KA 1ZK3A 3SU8A 1Q57A 3NRBA 1IUPA 1GZ5A 3IQEA 1N25A 4BMVA 5COBA 2B8TA 5DBFA 1AU9A 2FX3A 4Y6QA 2VO1A 4C2UA 1EVIA 2B78A 1ZIPA 5IDVA 2GJ8A 2WY2D 1GIAA 1S8OA 9ATCA 2P4HX 4B80A 1P9LA 4YHHB 4EKEA 1Y9EA 1ZOPA 1OPXA 3U40A 4ZCIA 3JYPA 1VMAA 3JD3A 4EGQA 1HFJA 5C18A 3H6HA 1PAUA 1TAUA 1XP8A 1JI0A 3IPCA 5DNYB 1BRTA 3M3PA 3KHTA 1BX1A 2HREA 4MTCA 1L2BA 4KFTA 4CT4B 3CU5A 1JLSA 4RW0A 1OAOA 3KKLA 1ZUWA 4J0HA 4BCBA 2WEKA 3AU9A 2PCLA 1UBNA 1YOBA 2CC2A 2JIQA 4FGJA 4C0HA 1R12A 1Q2UA 1ENOA 4GKJM 2D1RA 1B3BA 2PSDA 2Y4NA 2WG0A 3OSZA 4EG4A 2WAMA 2Y1CA 4WN3A 1BVUA 2AK3A 3BIJA 1PJIA 1TT5B 3DCJA 4DCOA 4AWBA 3VLFB 2J5KA 1Q02A 1Z6AA 3QWAA 3WQSB 3TLXA 3K6SB 4MKIA 3HNPA 3EGXB 1JIUA 2FN3A 1Z5CA 2GEUA 3UUEA 1RWNA 4LRTB 821PA 2YS7A 4JLSA 1YZGA 4WZBB 1YBAA 4XR4A 2UZ1A 2Y77A 2QPLA 5I9SA 3BXXA 3JALA 4QUBA 3LRTA 4MV7A 4Z9YA 1AGPA 1OX4B 2ZSJA 3L1JA 1GPH1 1N1MA 4MJXA 2RGNC 4GQBA 1V8FA 1GAQA 2I1QA 1AB5A 3WYEA 4LJAA 3R9IA 4U8GA 4WNAB 1Y0BA 2BJHA 2I0FA 1E2PA 1CUBA 4WKPA 4I1VA 4HS9A 4IDEA 4GMKA 3UT5B 3V34A 5KB3A 2FDXA 2VUHB 3PL5A 1QYRA 5AVRA 1NURA 3TI9A 1V25A 4R6XA 1ZU5A 4TT3D 4AZVA 1BU8A 1SOUA 5IZCC 1UFZA 4KQEA 3LSYA 4PRYA 2F8MA 5KOJB 3FOFC 4ITVA 1K75A 4D2IA 3BGWA 1DTWA 5JFTA 2ZJFA 1M2VB 3EEFA 2VDWA 3Q2IA 2V45A 3CRZA 3F74A 3ABRB 4PE5B 1NNJA 4B85A 4OCZA 1SBQA 1NW6A 1AKYA 1A8PA 3ZZNA 1Y9AA 2PKRA 1XE3A 2C00A 4W82A 2XMSA 3QFRA 3CZQA 1Z2NX 1U6KA 4U2KA 1ODSA 4NPHA 1AGXA 5KQ8A 3H9GA 1I4DD 1UDXA 2XX3A 1X8XA 4CHGA 3FMFA 4BNMA 1XL1A 4H4DA 2NT3A 1QUEA 2VC2B 5HJ5A 2JLCA 4DLUA 2D7JA 2HSWA 2DWOA 5C8YF 5G1OA 3ZJVA 1KMIY 1SIWA 3T9DA 3BJIC 4XCXA 1YXMA 1HOTA 2YJGA 2Q1WA 3L7AA 1Q1QA 1PTJA 2X7XA 2G9RA 5J5VA 3TRDA 2H1CA 1RTKA 1QLHA 3LL7A 2P30A 3JVDA 2A4MA 1RJDA 3HP4A 2V9PA 2OHOA 1OFUA 4XFDA 4YJ2A 4KXWA 1JLMA 2XVYA 4BRSA 2J3LA 3DAOA 2RGRA 1XHBA 4OBBA 1NTOA 2JAUA 1ACJA 5JXJA 1H3FA 3P1JA 2XECA 3DV0A 3MMXA 4DM7A 2Z2ZA 2A58A 2ZBGA 3GAZA 1M6VA 3CMCO 4CCYB 3CB4A 5AKKA 3CR3C 2F5QA 2ZUEA 2IS1A 2R0IA 2X1VA 3BCSA 2FW7A 3SQWA 1WIWA 4WGFA 2UXDM 2QNIA 5SYAA 3V1TC 3D8NA 3GRKA 1JG1A 4LNUA 3FVVA 3ZCXA 1DJLA 1SGWA 4OXYA 3T35A 5CXUA 3P97A 1J2UA 3AM4A 1QX4A 1NVDA 4MDHA 4AYWA 1A2QA 1P2GA 1YE5A 2VH5R 2BEWB 1SKMA 2Q3HA 2QVLA 3OO0A 1T13A 4E5PA 4BLOA 4MVJH 1ABBA 4G81A 3AJRA 1HYEA 3AEKB 1PG2A 3FCAA 2RGDA 2YMMA 1KPIA 1QIJA 3BWMA 5CHEA 2H3EA 1Z15A 1Z6QA 2JLZA 3L9WA 3Q5DA 4UXIA 4DYVA 5CYFA 4ZXFA 4BC0A 2P3LA 1BDHA 2BSAA 1Z2EA 1Y5LA 1TZCA 4DR5B 3WQRA 1I2MA 1E1CB 2D74A 3A6FA 5LWQA 2VJAA 5DTJA 3D8LA 1LJUA 2GJ9A 2L4FA 3LVBA 4KO3S 2EIXA 2PZFA 1RZUA 3QPCA 4W1SA 1QNLA 1PVDA 4JT4A 1ZWKA 1KC3A 4EPXA 1MORA 1QLWA 2E49A 3ZIUA 1JQ5A 3OIUA 4XQ0A 5KYGA 4IBIA 3UAZA 3UYKA 2Q46A 2ZWPA 5LQMA 5KPTA 3HEMA 4P38A 4H3KB 3VDPA 3DVSX 5C8YB 1BXRA 4M8LA 3A1DA 5C53B 2AXNA 2Y67A 4JQCA 3RYIA 4KIJA 5BQPA 4B4WA 1C4OA 3BXFA 4YP6A 3OSUA 2AC4A 4L75A 1VIAA 2DECA 3AL0C 3PLNA 4E21A 1JI3A 3QHQA 3KCQA 3L82B 5BURA 2QP3A 2UXBB 1H2BA 1DO0A 3TAUA 4RX1A 3SXUA 2HTEA 1S2LA 1E2BA 2BOVA 4IO0A 3FNIA 1X7ZA 2ECFA 5FCDA 2JAQA 2KNVA 3AVUA 3TINA 5F4BA 1SCJA 4OA8A 3B85A 1MC5A 3R5XA 3BMQA 1EVKA 2BFNA 4CGYB 3SXJA 3TTVA 4IFTA 1R6VA 2DAIA 1TGVA 4RVUA 3AVOA 4GEWA 2C8VA 2C3PA 3KKOA 4DSTA 3KVOA 1SKBA 2C2KA 4ABYA 1WZUA 1SUIA 1AUXA 5ICEA 1E89A 1N77A 5KKNB 3AHGA 4HDQB 1VDZA 1P4SA 3A45A 1CUFA 4CR8A 2GHIA 2ID7A 3ROKA 3GPUA 3GUYA 4XSGA 3ZHBA 5GGYA 1Z2OX 1L4EA 1WAMA 2EGGA 2GBIA 2CLIB 2J3HA 5K2MA 1N6IA 4OHZA 2PNFA 5EERA 4E6PA 1QIHA 1TVKB 3BXGA 2POQX 1A1SA 2IF0A 2IXBA 4ZMSA 3D02A 5HUHA 4M54A 1U9IA 5JOQA 2FE4A 3B82A 1H1LB 4P3YA 5KSPA 2RAVA 5B7GA 3RNLA 16PKA 4QULA 1Z4KA 4IILA 3VSBA 2HHLA 4R1UA 4ZJPA 2ID9A 4RK6A 1U90A 1E2KA 4P7JA 2ZE8A 1I2BA 3HJCA 1KQFA 5AI4A 1GJRA 4V0RA 3JARA 4E2WA 3H1AA 4I66A 1KJ9A 3MGAA 3OTOM 4MGZE 4W6ZA 2Q0XA 4P81A 5TARA 5A04A 4URYR 4B8WA 1EFPA 5DXJA 1WXFA 2WF6A 4OG2A 1MDBA 1ZL0A 2I2DA 2VZ0A 1B1AA 4UMFA 4EK9A 3SC6A 2V96A 3GMSA 2H54A 5LCXA 1Z74A 4EQZA 2I67A 1IEXA 5L3SA 3QOWA 1K5GA 1Z6GA 3Q4GA 1YVUA 1P1RA 1VPWA 2CDNA 2QW0X 2OT3B 5CFOA 3C48A 1EU1A 3PF8A 5CR9A 1NVMA 1MT3A 2WWFA 4MW9A 5AKIA 3MT8A 4PAOA 1N9KA 3N58A 3F6YA 1NVGA 3U37A 1VECA 4D4LA 5GKNA 5L8RF 3FY4A 3HCFA 1COZA 3ROGA 3MJRA 3MGBA 3QK7A 3BH0A 3CZAA 2XHEA 4YCMA 3AGPA 4HBZA 4HNAB 1KAMA 1MC1A 2OZLB 5AOVA 2XDWA 1XLVA 2RHLA 3OMLA 3ZHXA 4WZZA 3V1YA 2C9BA 3C58A 2UZAA 4AFNA 2ANCA 1H9AA 5BVHB 4KQ6A 3C7KA 2WAXA 1OZGA 1U6IA 2G88A 3RG2A 2ONJA 3SFTA 1RHUA 3DFUA 2WF8A 2J87A 2WU1A 1OBOA 1BQ4A 2WHYA 3X44A 2Q99A 3RVMA 4OQPA 1MRSA 3J7AS 2OXFA 1YQXA 2JZOA 3TTUA 4BQSA 5FXMA 1TLTA 3PG5A 1AKMA 3E0XA 2NNLD 1FIUA 4HAOA 4JBYA 2BSQA 2D1SA 3AY3A 2XZPA 2CXRA 1O6ZA 5KX5F 2ZVPX 4G4QA 1NUHA 2BGLA 3OHSX 1WV1A 3I6YA 1QTIA 4BVFA 1XALA 1ULAA 4JL6A 2DRIA 2H51A 1FCJA 3RBXA 4N9QA 1P5RA 4UEOA 3GLHB 5CMLA 2V55B 2WTMA 3MINB 4I46A 3FPGA 2IKSA 1HM5A 2PJRA 1P9WA 3N7AA 4H0FA 1PFQA 5BRAA 3AVVA 2AUMA 3DUFB 2EX1A 4X93A 2V9ZA 2NUPB 3PZRA 2W2PA 4CIBA 3H4JA 2WKQA 4ZOEA 3BEOA 1MJHA 4AX4A 4NESA 1Q39A 3E4DA 3PUHA 3REFA 4RKWA 4DQLA 4BRUA 2I3BA 1U9CA 1T6YA 3OM1A 2EHDA 1VKOA 3RUHA 4WXEA 1P3Y1 3ONDA 6ABPA 4Y7CA 3PFGA 4MVJA 2AHMA 3BM5A 3IQHX 4HH4A 4TS1A 3LUKA 4K7JA 1AS3A 1YJAA 2VXCA 1PEAA 2VEOA 4MHTA 1K7FB 1XQ9A 4YT4A 2A88A 3M7GA 3E61A 4LW8A 1MDFA 2IE0A 3ADBA 3HSKA 1Y8CA 1JF8A 2HLDA 1PGNA 4BMOB 4N5NA 4I0WB 3AVTA 1S2DA 5F9HA 3EQ8A 1RADA 4UNPA 3T4UA 4KSBA 4GNKA 3DL4A 2OQIA 2QT1A 4YP1A 2ZOSA 2B2XA 2SICE 1J0XO 3HXTA 1DELA 2P27A 3E7DA 3GJ6A 1ZN8A 1JIXA 3I01A 1AUQA 2ZU6A 4TUYA 3MB5A 4NICA 2R60A 2PWAA 3AINA 3GPPA 1QHHA 3TBHA 4B2PA 5KX5B 5GZ3A 2H5EA 3FMIA 1LXCA 1ORDA 1MIOB 5BWNA 5K09A 4QG7A 2GPBA 5BOSA 4AZTA 2W2XA 2HFJA 4RLHA 3TOSA 4REOA 4ZO7A 1OB2A 2X8AA 1ZS9A 2JH3A 1EHCA 4IX1A 1FNCA 2WSLA 4FWHA 4BMNA 3G2JA 4OH1A 5BYKA 5SZKB 1EJ0A 1JH8A 3IP5A 1Z0DA 5D6OA 4FEAA 1HO3A 1W5TA 3TR5A 1DI0A 3U3KA 4FQ7A 2DQZA 2PX8A 3L6OO 5JMTA 4ENUA 2GR9A 2GJSA 2VDPB 2WKPA 4FWDA 1CR4A 4BBJA 3VR2D 4GYYA 1DUIA 2B82A 4MHOA 4D4GA 5LLSA 1PR2A 3D7KA 1P74A 5EI5A 2PZLA 4AZ0A 3NV7A 3D9QX 1WMBA 3UWDA 4DV4M 3ZIAA 4GRIA 3CPJB 4WLNA 5AVQA 3CF6E 4ENSA 1PZGA 4GFDA 1SUEA 3RHZA 3WBKA 4MWDA 2NQ8C 3L0DA 2FWBA 3H13A 3F67A 1PKEA 2DCUA 1GZVA 4ZT5A 4IKPA 3UMBA 5EJ9A 4X66M 1Z4QA 2KEBA 5KCZA 1ORTA 3I2HA 2WAYA 1ZBDA 5BNZA 3SICE 1EJ6A 3CEMA 3TL4X 4ZQIA 3KS9A 1TJ4A 4HR7A 3GO4A 4OGLA 1CY6A 4U63A 3TQHA 5CVCA 1Z25A 2RGAA 3OZRA 3BD8A 3WKBA 4EKDA 4UATA 1DGFA 1JHMA 3F5DA 1H94A 1PFUA 3EOZA 1KJ8A 4B47A 5FRDA 5H4GA 1IVSA 4M7WA 3VKHA 3R77A 1NR1A 5JXHA 4YTEA 4IR7A 4FLMA 1HTWA 3P9ZA 1UKCA 4PPGA 2PA3A 4K6MA 1NYRA 3DKRA 2RGOA 4RLSA 2LDBA 3PHIA 5DMXA 3UJ7A 1X1AA 4OSOA 3DMHA 1N92A 2JIBA 1DT5A 3AK4A 5G1NA 5P8WA 3FFAA 2CYBA 3RS9A 2D1QA 3WYGA 4TMKA 3GGPA 4H6VA 3WNCA 3GJQA 1FRVA 2YZGA 3OPMA 4WLVA 3DEYX 3KV3O 5EIHA 2BGGA 1COWA 3T34A 1CIPA 1OJLA 1GL3A 4GG1A 3TVYA 4OP2A 4UHHA 2IQ5A 5DFLA 4IHJF 3TD2A 2I6QA 1WMEA 4WKGA 5BORA 4Q9KA 2PWBA 3IG8A 5FSWA 4HN2A 3JQFA 1HG0A 3AR2A 3THYA 3U7IA 5EUCA 3VAAA 3KB1A 1YCGA 3WSVA 2BP7A 4R05A 1DIGA 5G40A 1L4LA 2RK3A 2FEKA 4AO6A 3UHPA 2A86A 3KYJB 2V4ZA 3ZKAA 1ORWA 3LOQA 1ISGA 4OHPA 2CDBA 3FLBA 3IB3A 4O4IA 2OYCA 3ZDXB 3WBBA 4KITB 2AOUB 3R8FA 4UBJA 4D96A 4WW0A 2PQ0A 1RAHA 4J7XA 4RTMA 3KRTA 3HJNA 2C2GA 3BWXA 1RWVA 3UEOA 4D4MA 1UP6A 2G7ZA 2P65A 4OJNA 3VTZA 4YMHA 3U4HA 4YRIA 3QOXA 4WPGA 4J0GA 4PG8A 5F77A 1FFXA 2Q4DA 2DAMA 5TXGA 3HB7A 4ZVKA 4BFTA 4C4OA 1EGAA 2QX9A 2LWXA 1TDZA 2E4XA 3C85A 1RHQA 2B7LA 4MVJG 1FSSA 3EJWA 1TZBA 3WWCA 3E2PA 2I1VB 4NMLA 1T6ZA 3QVKA 2VS1A 1VL0A 4MUYA 3VYUB 4NKRA 3RJTA 5JD5A 2C5FA 3NIWA 1P1FA 4AKTA 2B7CA 4B17A 2F5SA 4L8YA 5ER6A 3ZV5A 1QCZA 1UPUA 4LUCA 2JY5A 1XZLA 1X15A 2ODWA 3W78A 1HSOA 1MEOA 2POCA 3P27A 1BJRE 3N2GA 1AKUA 1M83A 3RJMA 4JYPA 5E7MA 3NMUF 1RLIA 1CLEA 3PHBE 3V4VB 2BZSA 3P9IA 3LNCA 4RA6A 1GGJA 2RAFA 1WZNA 1OWPA 5GONF 5BQXA 1IUOA 1YB4A 3IV9A 3GPXA 3QF4B 2I66A 4C4RA 3MOSA 4BKOA 1BFKA 4KNVA 4FMCF 3C41J 3BS4A 3MJCA 4PD2A 4AZFA 2F3RA 4QJ4A 1EHYA 3THWA 1YUNA 2IHVA 1KYVA 4Y2TA 1U1IA 1FSZA 5KYUA 2B2CA 1M2EA 3K0CA 4WV3A 2V7WA 1F06A 2WFAA 5DLQC 3QKUA 4EB0A 3UQZA 5JZVA 4F2PA 2JGEA 5L3ZA 1GNVA 3M34A 2H9YA 3OF3A 1XLUA 3FR8A 3ET5A 4U7PB 2CFRA 4PX5A 1FDVA 1XDZA 2BWEA 4FYXA 5ELMA 3V9PA 4AB1A 4PLYA 5FF9A 1VZ3A 2XMGA 4TKVB 4PQRA 3S27A 4DA8A 3A6LA 4JXXA 4UFPA 3L0CA 5B58C 1C3OA 4YRLA 3U4QA 2XW6A 3KQVA 1VJ1A 1XN4A 2A57A 4LSZA 3JQ7B 3HV0A 3CZMA 3IT3A 5K0EA 3BTVA 4CWAA 3FLAA 2HWXA 1TFRA 4BX2A 3GVHA 1VHQA 3PEEA 1W93A 4QVGA 1O97D 5I6DA 1W1WA 3G1WA 2AZ4A 2F9LA 4BLRA 5B4UA 4HZUA 1BOFA 1CUYA 3UKDA 3P8ZA 4X1IA 2VTEA 3ETGA 5K0FA 1T9GS 5GVSA 1UZMA 3RS0A 1R8YA 4JP2A 4V02A 3ONFA 2I7DA 1PJ8A 4DA6A 2O9JA 1EGQA 1Z7WA 4EY3A 2P2ZA 5K0NA 2CYAA 1HE3A 2IWHA 2FK7A 2QLNA 3E4RA 5DJ5A 4FGKA 4Q37A 3FZEA 1NQXA 3UC5A 4AURA 3TOXA 1JGTA 4OH7A 2OOKA 5C46F 2XNDD 3MS7A 2UVPB 1Z08A 1Z7YA 2PO5A 4MO2A 3CW9A 2BFMA 5LP6F 5CX1A 1TIPA 1BW9B 2R97A 3FKEA 4JVNA 3TSYA 1J5EB 1EE8A 4Z2AA 4NZOA 3IERA 4TQAA 3SYNA 4GWLA 2D00A 3I9V1 3OEEA 3I8SA 2ZAMA 4ZOQI 2QEQA 3CBGA 4CFZA 1CNMA 3OJWA 4ESEA 5I7SA 4BMCA 4IRXA 5ECGC 2V6IA 3DMTA 4QDKA 1W4AA 1X86B 3L04A 4KK3A 5GONB 5BSVA 1XNQB 1Y7IA 1YUBA 3NEPX 4BFLA 1H2YA 3HKEB 4KXVA 4GGPA 3UQYS 1PEKE 3ENZA 3U6CA 4UQPA 1KTIA 1DBRA 4FMCB 3AF4A 5BW6B 1A9YA 4MB0A 1GP2A 4HEJA 3A1NA 3N2YA 4GKKB 1H0KA 2FSFA 2XB4A 4LE0A 2EJBA 4IIHA 4OHWA 4N47A 1DJOA 1PUJA 4TLMB 4MR9A 3AEYA 2MSEB 3LHFA 3KSZO 1FYWA 3AHCA 2R2AA 1XYVA 5TY0A 3AJ9A 1UPXA 5GIOE 3S4YA 2JLUA 3KT6A 3Q40A 1QR2A 2O8BA 1HNNA 1PK8A 1EMDA 5IJ0B 1FNMA 2FZ5A 1S8AA 3MT7A 2C77A 3UV3A 1JKXA 4H27A 1M76A 3JQCA 5K6TA 3VGJA 1NBHA 2OK7A 3M6UA 1AN0A 3D5EA 1P2TA 1FPMA 3ABOB 3KLPX 1ATZA 3ZLTA 2HWKA 4H6WA 4KHZA 3R2JA 4BAGA 2JIRA 3D8UA 3INGA 2HY7A 1EBFA 4ZVQA 1Y1RA 3OQ6A 1UC9A 4JGIA 1FFGA 3IUSA 4K86A 2Y1LA 1C7JA 5HSGA 1CF9A 2GEFA 2C59A 1D6MA 5AHRA 2JFNA 1G5QA 1XP5A 4AY6A 3JAWB 3QNWA 4F2DA 4EDHA 2IRWA 4MEBA 4YCLA 3MJVA 5L6LB 2R1UA 1CFZA 4F0JA 1Z0SA 2QP9X 4U6QA 1Q12A 3ELUA 3IHKA 4YV7A 2CJXA 1U0GA 3ZWCA 4EMTA 5K8CA 2J33A 5LP6B 3HU1A 5FTNA 2HWWA 3ZK9A 4XB2A 1LJLA 1TUBB 4O1IA 4QOHA 3VVBA 5AJUA 5BN5A 5FUXA 4LK3A 5UKDA 2DERA 2NSJA 1IMOA 4HLCA 2D7DA 3F3KA 1YCFA 4ND8A 3H2JA 3ODPA 5HM6A 1XFAA 1VYUA 3BWYA 1JR2A 1H65A 3NWEA 5C51B 5D5HA 4FD3A 1IY2A 1M8JA 1ZITA 3UA3A 1QTRA 3DV2A 2PX6A 2AJCA 1Y34E 4OX9B 4DV0M 1N6LA 1F6BA 3TLMA 3ZQJA 1WPQA 2DHYA 2WVGA 2PKXA 1SUDA 2QRHA 3H2IA 4KN9S 4ANRA 4PO3X 1JQEA 1Z7BA 1V3QE 1XHLA 2V7GA 3GBVA 3QV1A 2D1FA 4C6TB 3FG9A 1DIRA 5K9ZA 2GAFA 5CA0B 4FI3F 3EEOA 5BR4A 3LVRE 4P7FA 1EE9A 1Z37A 4JH0A 2HPHA 4KW7A 1VLLA 2IDJA 4EOGA 1QFYA 3DCYA 1SR8A 2XF3A 2F64A 3B1WA 1JDNA 3KOYA 3LK6A 1UQTA 4GC9A 4ZI7A 3MJ5A 3GZNA 3W5JA 2YWHA 1P9NA 3CQ9A 4BIMA 2WICA 4CKZA 4H1VA 2EJCA 2WJHA 1SC6A 3FUWA 5AW0A 2C9OA 1NG9A 1JNXX 2MINB 5ED0A 4CJ6A 5C4GB 5HQ3B 1N36B 4X3PA 1P91A 2G9UA 2X8JA 2NO5A 3PNQA 2P35A 4IQ8A 4JVOA 2WJ3A 4AJKA 4JI6M 3RSCA 1JFLA 3CYFA 2ZSBA 1QBKC 1YUMA 2PUWA 2WMDA 4A6EA 2J0UB 2J9FB 1SOAA 4TRJA 1E4VA 3B3GA 3AF2A 3S1AA 3QP9A 3A1SA 3R23A 1P2SA 3RAPR 1V6SA 1CZRA 4ZHQF 3HBMA 3UG7A 5SV2A 4E32A 2HA4A 4DIEA 2YRFA 3S6JA 1SC9A 4II7A 4FUQA 1CRWG 3CEPB 1NBAA 4EJMA 2WU8A 1D0LA 2VF8A 1HDZA 2WUDA 1F0YA 3H05A 2Z6VA 4Q47A 4TMWA 3JAKA 5EJCA 2QU7A 1KBZA 4MWEA 3OC0A 4HNRA 4D9CA 3R24A 2BTOA 1NI4A 1NN1A 1BS1A 3OUZA 3QPUA 2VHTA 4Q7EA 3E9MA 2QTTA 3ZZUA 2WUFA 1M73E 3CRW1 3HU5A 3B1XA 4D0SA 1PVOA 3RROA 1PZMA 4EGFA 3A1CA 2O2EA 2C3YA 1P1IA 1KHTA 1FRZA 3LPAA 1UAAA 3P2KA 2JLQA 3QBTA 5DM70 2IH5A 1SBTA 1T9DA 4RCZA 2PRJA 4LYFA 4IX9A 3ETCA 1HE2A 2VH1A 4K6OA 3CURA 4HF7A 1YDHA 2Q2OA 1DDIA 3SQNA 5KYTA 3O93A 1KZ6A 4FFBB 4EMSA 2SHKA 1IE3A 2PTHA 4TS4A 4Q6BA 2V7UA 2IHZA 2OP1A 3M4JA 2H3HA 5E6SB 4C6HA 1XKTA 1IWBB 3QZUA 1T1RA 4PYMA 2WNHA 1J9ZA 8MHTA 3KWLA 2EXXA 1TMOA 1SOVA 2GEBA 4DV5B 3O90A 4ZZIA 1NW4A 4DIMA 3FRIA 1MW8X 1D0KA 1P1HA 1DNPA 3JQEA 4GVXA 5FOQA 2JATA 2BGNA 2UUPA 2QN9A 1OOEA 2B7BA 2EVWX 3GW8A 3NASA 2OPBA 2J3KA 1AQIA 1T5OA 1JWBB 4NTZA 2HPAA 1IQ0A 1PBTA 3V4SA 3QBEA 1JSLA 1KOGA 4ZHQB 4ES6A 1R8SA 2BGIA 1PNQA 1W4RA 4EP1A 2O2IA 1KL7A 1IPEA 2VG8A 4PPNA 3CCCA 4GS5A 2WSFF 1JH9A 2PY6A 3FTPA 2WUVA 2OQVA 4L3OA 2X49A 3O9VA 3S70A 4AZWA 1E7WA 2ZBDA 2GEVA 2B4RO 1B2LA 1Z34A 3HJRA 1WDTA 4YV0A 3VRHA 1VPVA 3CGWA 1FU8A 4REQA 3D8BA 5KNDA 3L8EA 3EXFA 1C9KA 3IL2A 3NS7A 3WGHA 3W3AA 3PD1A 2PFSA 2D2XA 5K3FB 3EZ9A 4G0MA 3UAXA 2W6CX 4ZTUB 1TI7A 1BDBA 1QYDA 1DZIA 2FX2A 3CMMA 4YRRA 2HV9A 4M9XA 2P67A 4QYIA 1H23A 1KEZA 5ALTA 3NR2A 2ZKIA 1VSTA 2ZS9A 1HZZA 3BTOA 4MIYA 4B34A 4ME6A 4E2FA 3V8NA 1NNSA 4C7OA 5B36A 4M1YA 3QJYA 2ZWOA 3SYRA 2I1WA 4ZAVA 4X7PA 2D5AA 1CWUA 4ARVA 2JCXA 2V0GA 1KEEB 2EQAA 2BISA 3LK7A 3HY3A 2XT6A 4JK3A 4X20B 3ZHRA 1TEZA 5JD3A 3R7FA 5T4EA 1B76A 5A2QS 2YHBA 1U2EA 3EVCA 1RXYA 5BN1A 3U1VA 2AOWA 5JS6A 4N9WA 2XI4A 2L2QA 4HLUA 4GPBA 1SG9A 1NGSA 3E23A 2R8YA 4JI0B 4AJ9A 5IF3A 4IBGA 4CEHB 5A3QA 5IUNC 2WKWA 4MW1A 1WCYA 4P82A 5LYJF 4BGEA 5IJ9B 4FILA 5E1MA 2C1EA 1MVOA 1V16B 4OAQA 2RE8A 4HUQB 2B9VA 4EYQA 4WCFA 4DUYM 4JEUA 3L92A 5CCEA 2FPIB 3QEBZ 3MTJA 3L0OA 3DNFA 5FH9A 3MXOA 1XNJA 3JYNA 2F3QA 2MHCA 1GSAA 2PUEA 3G5MA 4HSGA 5TEVA 1FC0A 4D99A 3UJ3X 3M0EA 1G21E 2Q6LA 3LDGA 1FFDA 2BUBA 4WZAE 5EZSA 1H1TA 2OGTA 4Z7JA 4K9DA 1A8UA 1ZCAA 5CVUA 3RTCA 3AFMA 3FFTA 4JLUA 1Y81A 1XD9A 4UEQA 3VV3A 2ZFUA 3KT3A 1I2ZA 5GJCA 4G0PA 4Q12A 3TNLA 1UMKA 4Y2QA 2V7TA 3BKXA 3KQQA 1NDUA 1L7DA 1DOZA 2ATVA 4LCEA 1M2HA 1R10A 2PX4A 1L7OA 3L8ZA 4HJRA 1NJ1A 4O2BA 1QGYA 1XTSA 4D6XA 1LBTA 5ENVA 3N8DA 1D7OA 3USZA 2QRVA 5G41A 2B30A 3QI2A 3FCCA 1YNSA 1IOLA 1J2TA 4C7VA 4L15A 3VNUA 2EX4A 4KQWA 4MV8A 1DBVO 1S8FA 3M81A 2H4ZA 3ZN2A 3RWOA 3B3JA 4JVLA 2FDCA 1CEYA 3WRYC 5EXDA 3WLQA 2O2YA 1UBGA 5G3YA 1HNZB 4HNQA 4CMHA 4K0KM 4GSYA 5CBPB 2XMQA 3TDMA 2F6RA 7ADHA 4ID9A 4QFMA 1WUYA 3OE7D 4RYLA 5IM4F 1NF9A 2WJPA 3U7RA 3JQPA 4C9BA 3PT5A 4M55A 5LYJB 3MUEA 3GCGA 2A5DA 3DT6A 4UM9B 1KOJA 3WWOA 1G5PA 3LOUA 5AHXA 5JZ9A 4DJFC 1IUKA 4CNQA 4R16A 5HF9A 5CLJA 1C8VB 2DG2A 4ZCLA 2CLSA 2H1FA 4KE8A 3G2IA 2VPYA 3FPJA 4PINA 5IP5A 2ZJZA 3GYGA 2DEUA 3FF4A 2NUAA 2UU9M 1DC7A 1BMDA 4ENWA 1SHJA 1JECA 2BKAA 3ZWNA 2IS2A 4KXNA 2AFHE 3ZE0B 4CDMA 3N8KA 2EZ8A 1OD6A 1XDWA 2WSBA 4G1MB 2ZJ8A 4W1RA 1N7HA 3QXHA 2YXLA 4R83A 4PNPA 3DW1X 3WV4A 1UZUA 1BVSA 2WMOB 5BWBA 2KRKA 3CTPA 2H00A 3ESCA 2H29A 1XRLA 2X0IA 2JFXA 4KR7A 1JE0A 4ZEVA 2O2XA 4KL8S 1ZOIA 3WKEA 2K5UA 4IBDA 4ZT2A 4J07A 1B4DA 3VH4A 1RCFA 4FS3A 4TVSA 3WJ1A 5EIEA 5KTOA 1SHKA 2ZITA 1NLUA 5HWSA 4IDDA 2AR9A 1LNQA 3JQ9C 1M1YA 1JTVA 4R0VA 3HGIA 2R1TA 4CQLB 2PUHA 1SIBE 3QENA 5LD2C 4B3MM 3ZTWA 4Z1MD 2OPFA 2H8GA 5BMVF 1BCSB 3EXEA 3LZCA 3T61A 4QXOA 4PDIA 3ND9A 1UXOA 4NSNA 1MRNA 3A14A 4UUMA 4KK4A 1BIFA 4EUHA 4IBCA 1U7WA 3FZNA 4M1QA 2ZDQA 2OBLA 2Z08A 5EJAA 4PN7A 3P94A 1YJCA 3U39A 3TRIA 2JH8A 3KJHA 4B09A 5FLXA 3HNOA 4MCJA 1HKUA 3GEPA 3BYZA 1I6WA 3KFLA 5AESA 5BV8A 4N6GA 1LNZA 5LA6F 1GKKA 1F1JA 3FE2A 1BA2A 1BXGB 5ILGA 5EINA 4WXRA 2OXTA 1X7XB 2MYPA 3ZCTA 2ZYVX 3KJZA 1XZIA 1H2HA 4JCOA 2G77B 5I8WA 3PRKE 4NE2A 1NOIA 1MP0A 3I3OA 1RKXA 2GHRA 3LT1A 1GUAA 3JY6A 3SHVA 1JLKA 4B3RB 1DMRA 4MRSA 4O29A 3HPQA 2COEA 2FA9A 3FVWA 1MQAA 5BYAA 2DAGA 3ZHTA 1XHEA 1TCBA 3ENVA 3W5DA 4C0QC 2OENG 4HV4A 5IU6A 4FPXA 2FEPA 2P2GA 1Q2XA 1CX9B 5I4CA 3H3XA 4O5AA 2OEPA 4DV6M 3N0WA 3VM6A 3UC9A 4J1SA 1J5XA 3Q8WA 1FMJA 3EIEA 4ZCRA 4LRUA 2XXAB 1UMCA 3FI9A 3AR9A 1WVIA 5H16A 1NVUQ 4I1IA 4C03A 1OF1A 721PA 1H2EA 4D4KA 1CUHA 3LY9A 2YV2A 4ARUA 2R6DA 1Z13A 4G89A 2G9NA 2ADMA 5T8KC 1KDVA 2XR1A 3ZE6A 9ABPA 1VKHA 2AYZA 1ZUNA 5AJHA 1KPGA 1VEJA 5DGHA 2GAIA 1Z2PX 5DGIA 2QS9A 5DNCA 4X8MA 1AUAA 4HMQA 3WLRA 1VJCA 4BNXA 4AZ3B 4I4TF 3TSCA 1HR0M 1DBWA 1VGVA 5BMVB 2WSMA 4Q4DA 3QGMA 2QMZA 4CKEB 4ER7A 5DTMA 3ND8A 3DMPA 4B6SA 4MI9A 4EYEA 4ER5A 2M1XA 3DD1A 1NF2A 3DDOA 3HCBA 4DE5A 5E4JA 4IVNA 1OTHA 3JQAD 1VDMA 5LA6B 2ZI9A 4D9MA 1UT6A 1P0PA 4P36A 2A9QA 1Q3KA 4XWKA 5JNRA 1R9NA 4B83A 3IHTA 1G98A 3U4MA 2QG6A 4M89A 4OQMA 3OIFA 1FTGA 4NJEA 5JDCC 3JQGA 2BFDB 3Q3HA 3I04A 2XIQA 2VAXA 4KPUB 4RMIA 3RIYA 3LUPA 3UHFA 1P0QA 2WA1A 3WS7A 4XWWA 1Q16A 3C45A 4PWZA 3EYAA 3VGPA 3C74A 3QFHA 3LKZA 2FEOA 3UUGA 4QYTA 4GHLA 4J3JA 4IJFA 2ZTVA 3QPDA 1ZW1A 2OP0A 4DANA 1I3OA 4PG7A 1PV2A 4N6OA 2FUKA 2OLKA 1SN7A 1C2YA 2QUKA 3I0MA 3MJDA 2A9KA 4EGSA 4LRQA 1EGVB 3O2JA 2GZ1A 3BMNA 1H6CA 3EUAA 5A6SA 5I7RA 2NUTA 1CRLA 1M1NB 2JKVA 4KH1A 1QM5A 3L0YA 5ERGB 3HB1A 1QO0D 4LJKA 2ZUVA 4L4YA 3TZHA 3TWKA 3U3DA 4BV2A 5ITQA 1B8NA 5CNMA 1W49A 1QPGA 3RYHB 4OHMA 3RGPA 2ZBFA 1FMLA 1EK1A 3NPMA 4JLPA 4ZAWA 2Y71A 1TEXA 1VP3A 4KQHA 1TW3A 1RYHA 4ZU3A 1BJTA 2CUTA 3KPJA 2OGSA 3KALA 3OJEA 3VJKA 2ZTCA 3T95A 4GOLD 2R5FA 2GBLA 1PJTA 2F5NA 1PG0A 2GWRA 4QSHA 2QM7A 1W85A 4I4TB 3ML1A 3IQWA 4M87A 5DOZA 3WRVA 2P9CA 2LVAA 2V1UA 5I4KA 1KP2A 4KAJA 3AYZB 3GD5A 5DI3A 3RS5A 1QVAA 2W48A 4RABA 4JJ4A 5H02A 2V0CA 1T5IA 5F2EA 4LOJA 1ZNQO 1MQSA 4MYTA 3R9XA 1LTKA 4DLAA 3DLCA 1F3LA 1Z4OA 4C4TA 2Q9BA 3W4KA 1KZHA 1QHSA 3GGJA 3EZGA 4F2WA 4K9OA 2ZSHA 2YFHA 2ZSAA 1OC2A 2O2ZA 3ZG6A 1E2DA 3FDJA 4Q1CA 4GGMX 3W6ZA 1NP7A 4XJSA 3MQ2A 1ZNZA 3RGSA 3RRFA 2GRUA 4PX9A 1L5VA 3K1AA 1U2SA 3R0ZA 4ALMA 1OHHD 2NTEA 3ASZA 4YRBA