3FTEA

Crystal structure of a. aeolicus ksga in complex with rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
b'VSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
molecule tags Transferase/rna
source organism Aquifex aeolicus
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
total genus 60
structure length 233
sequence length 233
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fteA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fteA01
1NW3A 2ZZMA 1QZZA 3LCCA 3R6TA 4E31A 5K0CA 3BUSA 2PY6A 3MQ2A 4E30A 1WZNA 2EJUA 4ER3A 2ZIFA 3DH0A 1ZGJA 3PS9A 3UA4A 3MERA 4RTMA 3DP7A 5GIPE 4GC9A 3DMFA 4MIKA 4R6XA 2CMGA 2PWPA 2R6ZA 2B25A 4EKGA 4KW7A 3FPHA 3OU2A 4LWOA 2ZZNA 4DF3A 3C0KA 4X61A 1AQIA 3TOSA 5ICCA 3ELDA 3GCZA 1BOOA 4RTNA 2HV9A 4HTFB 2GS9A 1FPQA 4OQEA 3GRYA 1B42A 3AJDA 2VZ9A 3HVHA 3L8DA 4HH4A 4L7VA 1ZGAA 2JH9A 3CGGA 3DULA 5DX1A 1DCTA 5BW4A 1RJDA 3HCAA 1D2CA 3BT7A 5DM0A 4IV0A 5CVDA 4ATNA 4RTKA 2UYHA 1L1EA 4QTUB 1EAMA 2AZTA 2PT6A 4M7RA 1TW3A 3EPPA 3PFHA 3KQMA 3ME5A 4WXHA 4RVFA 3CJRA 3G8AA 1BC5A 4LECA 2B78A 2E5WA 1G55A 9MHTA 2UZ4A 3M70A 4YUZA 3C6KA 3ELUA 4FP9A 4HSGA 3OZRA 4U7PB 5DT2A 5E8JA 1X1BA 2H00A 2FK8A 2P3QA 3FRHA 3ID6C 2B9EA 4V0QA 3I5UA 3SXJA 1WS6A 3KQPA 2BR3A 4E2WA 4E2YA 3RIEA 4F85A 5EZSA 2V7EA 3LBFA 4AUKA 4NECA 5CCBA 3AWIA 2IDKA 1OR8A 2KW5A 3MB5A 3ER9A 3E7PA 1L3BA 1X1DA 3MGGA 5DX0A 5GM1A 2DULA 3FYDA 3LDFA 2WA1A 2FPOA 3KQTA 3KQYA 2OPBA 2AOVA 2Z6UA 2G71A 3EGVA 3JWJA 3B89A 1VQ1A 2P3LA 4ER7A 5D1NA 1L3CA 3TR6A 1PRYA 3LDUA 3EMBA 3NDJA 5CIYA 1ZHFA 4PYNA 2GA9A 2NP6A 3HEMA 1F38A 2AOXA 2NYUA 5EIWA 3SR4A 5K0JA 3EVEA 1MHTA 2XBMA 4K6MA 2AVDA 3WSTA 2HR1A 4CTJA 3C3PA 1KYZA 3HVKA 1L9KA 5DXAA 5GWXA 5C9ZA 5DRYA 2IH5A 1VPTA 3R9XB 5JR3A 3UJ8A 4PINA 2QE6A 2PXAA 4BP3A 2ZIEA 5DXJA 1WXXA 3BWBA 3SMQA 4E2ZA 4C07A 2P40A 3THRA 4HRAA 1QAMA 4C08A 3S68A 2AOWA 3HTXA 1AV6A 1IXKA 1KR5A 3CKKA 4RTLA 2O57A 5GP1A 1JG2A 2IBTA 3OE5A 4XUCA 4PYOA 4C06A 3T7SA 2OB1A 1T43A 4R05A 3VSEA 5C1IA 5LQAA 3B7PA 3G5LA 1QAOA 4LG1A 3VC2A 2NXJA 5K05A 2BH2A 3LHDA 2ZBQA 4GOLD 4OA8A 5KVAA 2P7IA 4BLWA 5H02A 3BWYA 5E1DA 1YFLA 2BR5A 1R8XA 4PCAA 5GINE 4RTJA 4QQKA 3KPUA 1SQFA 4DZRA 1Q0TA 1BKYA 5FWDA 2CWWA 5E2BA 1M6EX 2C7RA 4PGHA 5HIMA 2IDJA 1V39A 2EG5A 3KU1A 3KQOA 4FS8A 5FHRA 4GQBA 4ER6A 4U7TB 1EIZA 1NW7A 1R74A 2GB4A 2P1DA 3HVJA 5DWQA 4KIFA 5EVJA 4RV9A 2PXCA 1ORHA 2O05A 3FRIA 4FSXA 5T67A 1NW5A 4QDJA 4M37A 3P2IA 3P9NA 5HIKA 2I6GA 3BZBA 3I53A 5EQJB 5GIOE 3NJRA 3HCCA 3NW9A 4FGZA 2XYRA 2EFJA 4AZTA 1JG4A 2DPMA 4MWZA 4A6EA 2AN4A 5JUWA 5DM2A 3SSNA 5T6BA 1EJ0A 4PONA 3NMUF 2PWYA 1WY7A 1AF7A 1NW8A 5FTWA 2H1RA 1XXLA 4BP1A 2HNKA 1XCJA 5EMJA 3KHKA 4QTTB 2XYVA 1INLA 1R00A 2YXLA 4IKPA 5E1MA 1X1CA 4CKCA 1RI4A 4GF5A 1G8AA 3TKAA 3LCVB 3EVZA 3MTIA 2Q41A 1M0EA 5MHTA 2YUIA 3ELYA 4BY9E 3QOWA 5F2KA 4DCGA 2PKWA 3QV2A 1SG9A 2EX4A 3GIWA 3P8ZA 3UJ7A 4AZVA 5LQNA 1M6YA 1RJEA 1JTEA 1XDZA 5D1HA 4RTPA 3FUVA 2ONZA 4RYLA 1IM8A 2CL5A 4QVGA 4FR0A 3NDIA 1N7IA 5GM2A 4GOOD 2G70A 2ZULA 5FHQA 1FBNA 1NE2A 1ZKDA 3EVAA 1NKVA 3BKWA 3A7DA 2G8NA 3B5IA 3C3YA 2FYTA 2P3OA 2P7HA 3LPMA 3NWBA 4KDRA 2QY6A 3BWCA 4MTLA 4RWZA 2OBFA 3A25A 5EEGA 3FUUA 1NT2A 2VDUE 5FUBA 3HA7A 3HM2A 2C7PA 2Y1WA 3Q7EA 4ER5A 2GH1A 4M38A 5E9WA 5EIFA 4PCLA 4YMHA 4YV1A 3D2LA 3GRRA 3KQVA 5DSTA 2CMHA 2PT9A 5E8RA 5LQUA 5CVJA 2K4MA 1JQEA 5FA8A 3TM4A 4BLUA 3IV6A 2ONYA 2XVMA 5DTMA 1EQAA 3LX6A 4RTRA 5K0GA 1EG2A 1X1AA 2YX1A 3BXOA 4JXJA 1VLMA 3OFJA 2O07A 4M36A 4HG2A 2YTZA 5E9JA 3NVKI 4P7GA 1FP2A 3FPGA 2ZFUA 1YZHA 3V97A 5P8WA 1P1BA 5KQSA 4IWNA 5HIJA 4XCXA 4CKEA 4B17A 1G8SA 5CM2Z 4PNEA 2Y1XA 1DL5A 2WA2A 2IP2A 3BKXA 3IYLW 3A27A 2ADMA 3EVBA 5E2AA 2H11A 3U81A 1D2HA 1JSZA 2GPYA 2ZWAA 3PVCA 5CD1A 2ZTHA 4RX1A 3DUWA 4Y30A 3PT9A 5K03A 3X0DA 4GUAA 3E05A 2OKCA 2FRXA 4X1OA 1QAQA 5FWAA 2JJQA 3V8VA 2ZBPA 4P7JA 4QPPA 5DLYA 3GWZA 4OX9Y 5K0NA 3R24A 5EMMA 1JSXA 3TQSA 3OPNA 1KPHA 3JWGA 4O29A 3SSOA 3P97A 3UJ6A 4C03A 5ICEA 2NP7A 4G56A 4YUXA 2LD4A 3PTAA 1VIDA 3NVMB 2QYOA 1G38A 5EPEA 4R8RA 3TFWA 1X19A 5K8VA 3KR9A 4DKJA 1EJ6A 3DMGA 1NV8A 2IH2A 4FT2A 5EHIA 3UJCA 5GOZA 1NW6A 4C04A 3HVIA 4YMGA 1R18A 5EOVA 5HILA 5EC8A 2YR0A 5E1OA 5K0LA 3O7WA 3DMHA 2QRVB 1VP9A 5G02A 3G7UA 2P41A 5EKXA 3I58A 2ZW9A 4C05A 5F2OA 2NXEA 1RI3A 1UWVA 5FCDA 2VP3A 4ZTBA 3T7RA 5K0FA 3K0BA 3TPZA 5FADA 3FPJA 3BGDA 3UA3A 1YUBA 1JR4A 3NTVA 4CTKA 3R0QA 2AOUA 4OA5A 4E32A 4RVDA 1O9HA 3HA5A 1N2XA 4P7FA 5DTQA 3KPJA 3R3HA 3SM3A 5IH3A 2YVLA 4EVIA 4PYJA 5EG5A 3HCEA 1Y8CA 2OB2A 3BGIA 3LSTA 3KR2A 1TW2A 2PXXA 2AOTB 3M4XA 4IV8A 4XUEA 1JG1A 2AVNA 3THSA 4PYKA 1DUSA 5DM1A 4HGZA 2Z6QA 2JH8A 2AS0A 3H2BA 1Z3CA 3G2PA 1I4WA 3EEYA 5E1BA 4YUYA 1QYRA 2C7QA 3GGDA 3OFKA 4OBWA 2YQZA 3O31A 3GNLA 5FQNA 3G8BA 4PYMA 3FUWA 2GLUA 5EEHA 1O54A 1YF3A 3F4KA 1P91A 1H1DA 1JG3A 4DQ0A 1N7JA 1R8YA 1WXWA 2HWKA 2OZVA 4PIMA 4V0RA 3TM5A 5K01A 3DTNA 4QDKA 3UJBA 1SUSA 3EVDA 1HNNA 1KXZA 2ESRA 1SQGA 2I9KA 4YV0A 2ZCJA 3VC1A 2V74B 1IY9A 3MCTA 4RTSA 5ICGA 1KPIA 4KDCA 1I1NA 3G5TA 4AZWA 2QRVA 3JWIA 5HOQA 3LKZA 3KQSA 4EMSA 3FUTA 2IH4A 2IGTA 3TKYA 5BXYA 5K0EA 3KQWA 4AX8A 3G2OA 2JHAA 5EHGA 4KVZA 5HFJA 4RTQA 3FTFA 4MQ4A 1NBHA 1KPGA 3FTEA 5EKUA 5U4XA 2ZIGA 1YFJA 5CCXA 2AOTA 1JQDA 2CKDA 2UYOA 2NXCA 3CC8A 3LBYA 3MCZA 2YXEA 4DM3A 3DLIA 3UBTA 4AZSA 3GJYA 3CBGA 4E2XA 5LQJA 3LKDA 2OXTA 5LQCA 1R6AA 3O4FA 1XDUA 3FYCA 5F2NA 1FP1D 2AOUB 5K09A 2B2CA 2ZLBA 3P2EA 3AXTA 5E9QA 5ERGB 4Z2YA 2PJDA 5KS2A 2UYQA 3OE4A 3GRZA 1VBFA 2BM8A 2XVAA 4PIPA 5HEKA 3SVZA 3OZTA 4KWCA 5DRTA 4DA4A 3OU6A 3EVCA 4P7KA 3GU3A 3K6RA 10MHA 1ORIA 1P39A 2BM9A 3KKZA 2EJTA 2HTEA 3EVGA 3PFGA 3RW9A 3UJ9A 5EMLA 2IBSA 2A14A 2BZGA 3DXZA 2FHPA 3BWMA 3M6VA 1QANA 1RI1A 3MTEA 3NWEA 3FUXA 3HNRA 4PYLA 1JTFA 4R6WA 4POOA 5K0BA 1D2GA 1RI2A 1XTPA 4PYIA 7MHTA 1ZQ9A 3MAGA 2ERCA 4PGGA 3ELWA 1AQJA 2OY0A 4QVKA 4EQZA 3IHTA 5LR6A 1NV9A 1HMYA 3LDGA 3A4TA 4OBXA 3ORHA 3SGLA 2PX8A 3MHTA 3TMAA 2IPXA 3EMDA 1FJXA 3G2QA 3REOA 1UFKA 5ICFA 4H0NA 2IFTA 1NBIA 5EMKA 1VP3A 1ZG3A 3GRVA 4HTFA 4RVHA 3UJDA 8MHTA 2ZSUA 3UWPA 4EKIA 4ISCA 3LECA 2YXDA 2VDWA 2BR4A 3KQQA 4PWYA 3FPEA 3TRKA 2ZVJA 3KPVA 3GRUA 3I64A 2O06A 3TLJA 3HCFA 3AY0A 3P9KA 1XCLA 3G89A 3B3GA 4F84A 2AN3A 3CJQA 2VS1A 3DLCA 4X41A 1U2ZA 1KIAA 4PYQA 5EZQA 4LWPA 1YB2A 3ANXA 2PLWA 3KR1A 1RJGA 2NXNA 2XYQA 3HCBA 5M5BA 1F3LA 3CVOA 1RI5A 2PX2A 2P8JA 3A26A 5DPMA 4BLVA 5LSAA 1P1CA 3T7TA 2WK1A 3M6WA 3E23A 2PBFA 5FULA 2B3TA 4R8SA 2JHPA 4YV2A 3M6UA 3QOXA 1MJFA 2IIPA 5LQRA 4X63A 2NNWB 1O9GA 1KYWA 2FK7A 3FTDA 2HMYB 3LGAA 5FA5A 2C7OA 4RVGA 4X60A 5BP7A 2VDVE 3ER8A 3AXSA 3ERCA 1L3IA 4MHTA 3BGVA 5KQRA 4QPNA 2R3SA 1XVAA 3DXXA 4QQNA 2UYCA 3G2MA 3B3FA 4FT4A 1XJ5A 3FPFA 3M33A 4C4AA 3GO4A 1UIRA 4Y2HA 3CCFA 4GEKA 2JG3A 3GXOA 4UOEA 2G1PA 5LQKA 5DX8A 2ZWVA 1BHJA 3E8SA 4GOND 5HZMA 3EEOA 4DCMA 5CVVA 5T64A 1XDSA 2F8LA 3VYWA 3UJAA 3PX3A 4HC4A 2G72A 3C6MA 3EVFA 5HIIA 3HP7A 3P2KA 4FZVA 1YZ3A 3GDHA 4YUVA 3IEIA 5DTRA 5CVUA 3OU7A 3SSMA 5FQOA 1KHHA 3DOUA 5B1SA 4DMGA 3DXYA 4GC5A 1JQ3A 2O0LA 4GOMD 3LL7A 1SKMA 1WG8A 4FSDA 4E33A 4P58A 2QM3A 2ORED 2PX4A 3T0IA 2PV0A 2ZZKA 5DM4A 1PJZA 3UZUA 3I9FA 2PGXA 3EGEA 3KPYA 3P71T 3M6XA 4WVLA 4RTOA 5DSXA 3LCUA 4HGYA 3G88A 3CJTA 3A7EA 4CWAA 1G6Q1 5EGSA 2PX5A 5C0OE 2AR0A 2JHCA 3EGIA 3SX0A 4EK9A 1RJFA 3OCJA 1KP9A 3P9CA 2N47A 3HA3A 5CUQA 4CKBA 2FCAA 2Z6AA 4OQDA 3UFBA 1SUIA 1Q0SA 2PVCA 3PB3A 4KRGA 4XUDA 1SVUA 3HCDA 1VL5A 3Q87B 2I7CA 1VE3A 5BW5A 2OYRA 2OO3A 3FZGA 3KR0A 1TPYA 3PLAE 1I9GA 2I62A 3KPWA 3FTCA 2AN5A 4GBED 3RODA 4E70A 4F86A 5KYGA 4A6DA 4CXMA 3JWHA 3PX2A 2GAFA 2ZBRA 3P9IA 4RSRA 3OZSA 1G60A 5CVEA 4KIGA 2PSSA 2P35A 4ER0A 3B3JA 3DR5A 5IKMA 4YUWA
chains in the Genus database with same CATH superfamily
1IQPA 1CR2A 3PIRA 3U26A 4EELA 3I0ZA 2NUTB 3JAMS 1J7JA 4JGGA 5EUQB 3PFNA 3TUIC 4EATA 2BKVA 3MINA 4F3NA 3WLOA 2JS7A 4U7FA 1DIRA 3SN6A 3M83A 5CXXA 3AEQA 1TE2A 3UA4A 2NU9A 1HQDA 1YB6A 1CYEA 3B5JA 3L7CA 1AGXA 1OBVA 4B2YA 1RRFA 1LXCA 1V5EA 2C1XA 3NC4A 5JYCA 4TV9F 5EGNA 1Q3CA 2DHRA 1R9JA 2A5GA 1GP2A 2A3NA 3TLGA 3EIFA 2HYIC 3TIFA 3OQJA 5FUVA 1I14A 1MHPA 2RAFA 1XRMA 4OBBA 3TOSA 4D3YA 4H35A 3HHYA 1WSDA 3BFKA 3U16A 1RKXA 4F8EA 3CGGA 3E84A 1Q21A 3TECE 5BW4A 1J42A 4CPDA 5IT9A 2XWQA 1D2CA 2P2NA 1BGXT 1O4WA 1YJ8A 3LGXA 1QLWA 4GSLA 5LMNB 1UFZA 1XZDA 3DMYA 4GMXA 1T6NA 2LVBA 2WLSA 4QYIA 1VMIA 2XIQA 3AHJA 1XA4A 2RK6A 3NBUA 1J21A 4US1R 3WQRA 1O1YA 5IG2A 2FSHA 1DHTA 4UAJA 4JQCA 1XCMA 2ZG6A 3ONEA 3SLGA 4L50A 2WT8A 1NSFA 4AY5A 4IO1A 3NASA 1Z0ZA 1NI3A 1SBQA 4HDNA 5H3LA 4V0QA 3B1VA 1NJ6A 2V98A 3UM9A 1ZH4A 3QBDA 3AWIA 3TTWA 1U02A 2DF8A 3B8EA 3LU1A 3OO0A 4MEBA 4BLRA 1L3BA 4RCYA 5ITUA 4BNIA 1N1DA 3AINA 4NYJR 2E18A 1HFKA 2FP4B 4XLLA 1S4MA 1KORA 2QL6A 4D3DA 3LDFA 2NO0A 1Z4IA 1AK1A 2FPOA 2H1IA 1N0VC 1ZMUA 3E4CA 4X94A 3C8HA 2G71A 4H1VA 1U2QA 3DAGA 3FR8A 3CYFA 1LJ8A 3BB3A 1Z33A 4PVDA 4BLQA 3AKEA 4DLTA 1U3GA 4KXXA 2O2JA 1NYQA 4E94A 1NX6A 1U5AA 3NDJA 4PZEA 3KFLA 3ADPA 4TS9A 5H3HA 1OY1A 4F06A 1HWYA 4Q4JB 1XNRM 4XX1A 4CM3A 3DZDA 1AH2A 2W2VA 3A45A 1U2DC 1S2OA 1L4NA 1W49A 3C3PA 3L02A 2ZTUA 4C87A 4TL7A 4CTJA 5AHWA 4GZ3A 4EPVA 3U5TA 2E2WA 3OCZA 5AW0A 1EDOA 4B45A 10MHA 3T9DA 1DDGA 3RG8A 1PKXA 2OFWA 2HA6A 3THRA 1M1NA 5CP8A 3WWCA 2LW7A 2H57A 3SASA 3IOBA 5NULA 1CZHA 4DWWA 3PNKA 3CWZA 3MSXA 3Q9SA 5B1IA 1C30A 4EYQA 3H13A 1JIQA 3D8SA 3MTDA 3HZZA 1KYIA 1MMFB 3C7AA 3VVBA 1DRWA 2W4MA 2HK7A 4UMDA 2YN0A 4XTCS 1JN0A 2OQIA 5GP1A 1ESZA 3LQ2A 1VHTA 2BZ0A 3PITA 1VKHA 5KWIA 1X1QA 4YAGA 2GCIA 4LG1A 4PY2A 1DTSA 4NJOA 4DR4B 3WHIA 4B3MB 2XITA 3BD7A 2O52A 4X1KA 3A9RA 5AOVA 3HCNA 4Q19A 4F3CA 1IBKM 1IK6A 1OI7A 1MC1A 3SXPA 2J09A 1EKXA 2GAJA 5BVGA 2P75A 1ISFA 3KPUA 4HDKB 4DZRA 3T1OA 1TEVA 1U3CA 4UM8B 4XQ9A 2CWWA 4NE7A 1TTQB 2LP4Y 2P2SA 1V4NA 4BN0A 2GBIA 4GRDA 2HIAA 4QU8A 4WN9B 5F9HA 1B4DA 2RGCA 5BW6B 5IREB 1LBQA 1RABA 2XTMA 5DNAA 1RIIA 4MCJA 1JHVA 2ONKA 3OEWA 4CKBB 9GPBA 3IO3A 3NAQA 4IICA 3RT7A 1PO7A 2JAPA 4D6YA 1V3TA 4GO1A 1F2UB 3EZYA 3BZBA 2DQYA 1XHLA 2Q0QA 4XCVA 4XRRA 3K94A 3GA0A 2EDCA 5AK5A 4HAYA 4NCJA 1BFUA 5FORA 2O3QA 4LFBM 4A73A 3WLJA 1DFIA 1WBJB 2EFJA 3TLKA 4MW9A 5BN4B 1TVKA 4KDFA 2I5PO 4RD1A 2Q3JA 4Q93A 2G6BA 2BHRA 4CG3A 1AF7A 1QYVA 4KTVE 4BP1A 3FZQA 3F49S 3H2KA 1EFDN 2X40A 2XWSA 2R79A 3DKRA 2WWVD 1KP3A 4G5HA 1QCYA 4M46A 2HL6A 3ZDAA 1MP0A 2A9FA 1LFAA 4XOIA 2VH1A 4DCGA 4QYSA 3TMYA 2J4DA 4FGJA 5IHXA 1C41A 2JJ2A 3SF8B 4RXUA 1DU4A 4GBJA 1WDWB 2ZRLA 4O4LB 1T1RA 4MTCA 4HUTA 3K20A 3L26A 1XX6A 1Z16A 1ZIOA 2Q99A 3N2YA 5EZ5A 3E9MA 4BFUA 2CL5A 3Q4GA 4RZIA 4CL3A 3FWHA 1G7SA 3A3NA 1ZBQA 3C2QA 3FPKA 2J5YA 3NEJA 3VZPA 5FPHA 2ZULA 1UMDA 5CCDA 3T4EA 3PRHA 2IV3A 3B5IA 3AUKA 4IMIB 3W5IA 3WLMA 2AEMA 2GJAA 1PJCA 1EB8A 4C7KA 4NS4A 4G0XA 1UK6A 3K1ZA 2SKEA 1IVYA 2HJSA 1O0CA 2IXEA 2XUIA 2HMUA 2Y0EA 3PE4A 4OXIA 4PLWA 2DEUA 1XPOA 3WLNA 3Q1LA 5D8DA 1RJ9B 4E5UA 4QOGA 4B3TM 3WRVA 1KRXA 3OMXA 1WIVA 1K3WA 2FWBA 3AESA 4OJYA 3SM9A 1TUGA 1CJTC 2C2XA 1OKSA 1JQEA 1ZM7A 2Z8YM 3QUCA 2V1XA 3B1JA 1BXGA 5TQVA 1H5QA 1U3VA 3RREA 3OZEA 4LDPA 3WB9A 4JA0A 3VNBA 3T1YM 1ATIA 4INJA 2R7AA 3BRQA 2YTZA 4M1MA 3SHQA 4DQLA 1YULA 5JV5A 3CZ4A 2X4DA 2FN4A 3MXTA 1FP2A 3IIIA 3OHSX 3TWLA 4MKIA 2ZBGA 1J8FA 5DLDA 5EZ6B 5F35A 4TV8A 1RC8A 2WWFA 4LDZA 2DQ4A 4NICA 1NUAA 1Q3BA 3LXXA 5CM2Z 4M1OA 3M6AA 4C22A 1CUZA 4RK0A 2VH2A 3A27A 3IBSA 5HQJA 3NZEA 1QP4A 1A0OA 3UT0A 2CLFB 2VCHA 2O2IA 1WCXA 5DB4A 5B58C 3KW6A 1M8JA 1TMOA 4Y30A 3RYIB 5K03A 5EKSA 2EWMA 1ST2A 4UU8A 2XF3A 3BYZA 2C59A 4LFCM 1D2RA 1UC5B 2FRXA 2ZBPA 3AKYA 2CNWA 4KXFB 1NYTA 3OFND 3BGWA 4N6OA 5A9TA 2J9GA 3L8YA 3K1JA 1IN8A 1AUVA 1ZM3A 2FP4A 2XECA 3H0EA 3U4IA 4R81A 3HM9A 3ZS9A 1HM5A 1P2DA 2XB9A 4FDUA 1A8SA 4JBIA 1VTKA 3JYPA 3DWGA 5JOQA 3O4GA 4UBIA 3VJLA 3LUDA 1O96A 4KQKA 4B6QA 1C7JA 2WYWA 4XW2A 4CODB 4LI3X 2XI4A 3HBAA 3FVTA 3G0HA 3CZQA 1KJ8A 1XA3A 1S0UA 3ZGVA 3MJCA 2C4NA 1U9ZA 3A6ZA 3L18A 4ZRDA 4GQAA 2FFBA 2C94A 5FV7A 3JQGB 1U3DA 5BN1A 1B8NA 1C7FA 1AF4A 3M5CA 2QVGA 4QT4A 3KE8A 2LWIA 1ECJA 3RFTA 2P4UA 1PQUA 4C9BA 1VYHA 3A9VA 2Y0TA 3NTUA 2WAMA 3MC1A 4FZRA 3PXUA 4MPTA 4TTQA 5IW8A 1ECFA 2OXIA 1VEJA 3GZJA 3RT1A 2OCAA 2ZRHA 3H4JA 2VA9A 3C15C 4LMAA 2LHGA 4L9WA 1J25A 2WDPA 2D4HA 4G0MA 5DTQA 4YAIA 4ZRMA 4JYAB 1KMHA 4Z51A 1YDFA 5C37A 1I7DA 3AR4A 3LOUA 2WSBA 4HVTA 2MH8A 1SVOA 5DSZA 3EPHA 3BGIA 3LC2O 5ALRA 2BFFB 3WK9A 1RIFA 2QYHA 4FHZA 1D03A 2FE4A 4TTAA 2NO1A 4KMSA 4NOKA 2CNDA 3ABIA 5BOSA 1MIHA 5BXQC 1CEQA 1MW9X 3T6PA 3TW0A 2QE7A 4JR0A 4NU8X 4K6OA 2O25A 3U61A 3A6GA 3DCJA 1MKYA 2NU9B 3QELB 5EJ5A 4CLEA 3FUWA 3GLHB 2WZQA 2DLCX 1E9FA 3RCBA 1L5QA 4NATA 3EUWA 4QVIA 2RARA 1YDEA 5K3SA 4LHXA 3CVWA 2PX6A 1HLDA 2QENA 4NHEA 5BQXA 3GY0A 4IJVA 4PHHA 1NKTA 3OX1A 1V8DA 3V1MA 4FFMA 3RVOA 2XA9A 4FDTA 3H9JA 1KMNA 1U0RA 4R31A 2QMUA 2H4YA 1GAEO 2J45A 3E9EA 2K2WA 1WL8A 1KYQA 1R4NA 2W70A 3N8DA 3MS4A 4YR7A 1DPGA 4AX8A 3OX4A 4ZJPA 4OAQA 3GEEA 2P2YA 4WAUA 4CFZA 4HP8A 4DR5M 4MQ4A 8ATCA 4AAYA 1Y33E 3I2KA 4M22A 1SXPA 2CXHA 2YJGA 3RRFA 1Z13A 2J9XB 3MILA 3ANSA 3CS3A 4PLCA 1M1NB 2W5UA 1BKDR 1ZWKA 4OFBA 1SEVA 1A7KA 1Q1BA 1Z8HA 2UYOA 2JGIA 2VJBA 3QUQA 1P2FA 3B52X 3G1UA 3OIUA 5K1ZA 3ZBPA 1YTUA 2XEDA 2BFFA 4GXTA 3SIXA 3TNJA 4HZIA 3E03A 2QDXA 1H5UA 3A1NA 3T3DA 1QF9A 4X7RA 4ARCA 5DDIP 1CV2A 1OLXA 1U0JA 1UEIA 1T4CB 4EF4A 1DRKA 2R86A 1TF7A 4WEOA 4Z2YA 1LBEA 1C4WA 3H9EO 4WHMA 3TNDA 4ZVOA 4L76A 3KT3A 4LZWA 1XQXA 1WCV1 1JWAB 3S55A 2GO7A 1AKTA 2FWIA 1V8FA 4W1SA 2YIVX 1U8YA 5ITQA 2XZUA 4FMBB 2W2XA 4Y2QA 1JEJA 4G5OA 1KOLA 3VO1A 4HLCA 2XMSA 4TXLA 4G9EA 1EUDA 2INGX 4V2UA 3Q2OA 4LK2A 4V02A 4DLKA 3UAOA 3BWMA 4PYLA 1I0LA 1DO0A 2ZIZA 3FUXA 2M98A 1OXUA 3O9MA 4K6CA 5IT4A 5FO1A 1C9YA 2NTEA 4R01A 3GUHA 1F7VA 1A95A 1KI1A 4O0MA 2QZ4A 1RE1A 3DR3A 3QV1A 1O3YA 4UUMA 1K6IA 4EITA 2EW8A 1GUDA 2YZMA 4KWTA 3QVJA 5LP6F 4KGZA 1P8JA 3DDZX 4Z2AA 3CV3A 2CDRA 4AL4A 1LTMA 1QE5A 4FR2A 4U2BA 1OIPA 5CDFE 3ORHA 3M0EA 1TQ8A 1C7ZA 3F9IA 3RS2A 4DG9A 3TMAA 2BJHA 3EMDA 5LA6F 2O0MA 3UJ3X 4EKNB 2EFEB 2GN6A 3LY7A 2C7BA 2DGDA 2CCKA 2IFTA 1Y98A 1H9AA 1JHAA 2R6CA 1I2CA 1NE7A 3HNPA 5KTRA 4LF7M 2WSSD 3C39A 4IDGA 1R0CA 3U4CA 4D74A 1DIBA 1D04A 4LHYA 1DWPA 3I64A 2VHCA 1OFTA 1TEZA 1XEFA 2Q6VA 2MOKA 4CQJA 4GOJA 1GV1A 1RRMA 4WA7A 3WTCA 1H8HD 3I72A 4S2UA 5CYPA 1FRVA 2E49A 1YB2A 1KSHA 1Z4MA 5U4QA 1V9LA 4OSOA 1XP8A 3KR1A 3L5KA 3AY7A 4R16A 4GITA 2WSEF 5AJVB 1RI5A 2AJCA 2NUTA 5DPMA 4DDHA 5IT0A 4GNRA 4J0QA 2E5LB 1C1XA 4IR7A 1Y6FA 1IY8A 1XTJA 3LRTA 3NWLA 5JCXA 4IAOA 1M0WA 1GA6A 4MVJI 1N5RA 1ZC3A 1EVYA 2FPPB 3PNPA 4TRRA 4GS5A 4HNRA 1F2UA 1E59A 1P7ZA 3N59A 3V00A 1EIJA 1E2GA 1PNQA 2IYTA 4LJSA 1U0OC 4MWTA 5CU7A 1Z6AA 2PQ2A 4IZIA 3D8TA 4FINA 4YPOA 1BXRB 4R69A 1B8PA 1F0KA 1N2EA 1ARZA 2L18A 3H97A 4CDNA 3U62A 4P2GA 4H3VA 4EVQA 4IOJA 5HPYB 1EDZA 2HU5A 2YMPA 4UOEA 5BNFA 1DV0A 3S70A 3CUVA 2VHXA 3AVUA 4JI3M 2AEFA 1T10A 1TRHA 1V1MA 4DCMA 5TQ2A 2ILTA 3TRJA 3RI3A 1H9CA 1HE5A 4BTEA 3PX3A 4U02A 3MAJA 1T25A 1YA8A 1SHKA 2PS0A 3NTLA 4FZVA 2H2DA 3GDHA 2VATA 4CG0A 1QHNA 2F8SA 1Y1TA 4HDSB 2HKIA 3GRKA 4E09A 2X76A 1CRQA 4RS4A 1SG0A 4RH3A 3LL7A 3RTBA 3KVWA 4FSDA 4PR3A 5FUQA 4LFAM 4D8UA 4V24A 3TDKA 3U6QA 4GYKA 2H7YA 3T0IA 4WWHA 5DM4A 3WMEA 3I9MA 4HOYA 2P1RA 1QHIA 2V9PA 1VCOA 2FUKA 2FN3A 2IYZA 3LA6A 4JN6B 2AZ4A 4KLNA 1IAQA 5ALEA 4KT0F 3BULA 2LRHA 4HGYA 4WV3A 5K6RA 4ZTZB 1ODTC 1OIXA 1G6Q1 1ZH0A 2CNNA 1WBBA 4GVXA 3K5IA 4MYTA 5JZVA 2JHCA 5E0KB 3TLEA 3GMTA 1X92A 3EC7A 3LX5A 4F5ZA 3HA3A 2FCAA 3VPDA 1E98A 1IEQA 4OGFA 4OKNA 1ZK4A 5BW5A 3CMCO 3KR0A 2P9CA 4RPLA 2O2EA 3BH7A 4CQMD 1F4LA 4HB0A 3D3JA 3KCQA 4NYMQ 3URMA 3VSBA 5INTA 4GBED 1PWZA 5C8VA 1YE5A 1NHGC 3F8TA 4QGHA 5KYGA 2V96A 5ALMA 4BFXA 4ZHQF 3RADC 1MGPA 2ZBRA 1CY6A 1HDIA 1JYFA 2Q49A 3BRCA 3E5MA 3FBGA 2FZ5A 3JQ8B 3SBOA 3BBPA 2XHZA 2TS1A 5IARA 3L1UA 3PJFA 3G2KA 4OLHA 4ESEA 1N75A 2ID8A 2VP0A 2Z83A 5C7OO 4K9DA 2VCEA 5AHXA 1XYYA 2IL1A 4ZOAA 3TQTA 1Q16A 3RSLA 3ZQKA 4YONB 4MIKA 1T26A 2PWPA 2P6RA 4KW7A 4YRLA 4Y7CA 4CIBA 4PYRA 3NJ4A 3WQBA 3DAYA 1FU8A 3L07A 3ACCA 3PPVA 2N42A 4G1CA 4F6LA 1RYEA 4KACA 4UNSA 1UJBA 4E5SA 1WCWA 2R62A 2WMNB 1JKIA 4KKVA 2O14A 2BGUA 3GGOA 1OB5A 5IUKC 2J0EA 3LCJA 2CUKA 1N9GB 4ZVVA 3RFVA 3UENA 4YRZA 5JYEA 1Z2PX 1ICIA 1ODFA 2FPXA 2GZMA 2Q9AA 1Y8RB 1MXHA 1YZQA 3CY6A 4TKZA 3NHMA 1FX0A 4ARSA 1O0BA 3QY0A 2XBLA 4KAFA 3UOGA 3U4MA 1GL9B 1LW7A 4HQKA 2PEZA 3K9PA 3BJZA 1ZMXA 1L7EA 4RZHA 2P2LA 3WA7A 3CURA 4AF7A 5JAQA 3U49A 1E6WA 5JVDB 4ETNA 3RYCA 4ARVA 3UUGA 4AZ0B 1TGYA 2Y99A 2BR3A 3KOZA 4GIPA 4BP8A 1GXSB 4RQTA 4YJGB 2AXEA 5K0ZA 1SXJA 1G19A 1M2OA 1NVEA 1Z7GA 1CD5A 3FI9A 1JU9A 1YZYA 2A8YA 2BDTA 3WKEA 2YWXA 4I9NA 2YFHA 1DTEA 3GAMA 4E5PA 3FYDA 1UPBA 1ZK1A 2KQUA 3HEBA 4GLLA 1OB2A 3GV0A 5FWNA 2OPBA 2WIDA 1CJBA 4G0PA 2V8OA 2H4FA 2WV9A 3ASZA 3EGCA 2JF0A 3MUEA 3KJIA 5KYKA 4RD4A 1DLIA 1EBBA 4ZAWA 4EW1A 1YVEI 1Z9BA 4WNIA 2FMHA 2LTAA 1GEGA 2XUGA 2GA9A 1ZFNA 4PYNA 5DASA 2JGDB 5EIWA 4Q02A 5JADA 3ZHSA 2B21A 2R6FA 3FDJA 1MO5A 3AUUA 4GT1A 5ALPA 3RU7A 1GZHB 2QTAA 1Z0KA 4M87A 3ZK8A 2E1PA 4KPUA 2QN1A 1NFQA 1EVQA 3WNBA 4EW6A 3RE8A 5EHNA 4ML3A 4NQZA 5G53C 3ZOKA 4FWGA 5REQB 4AXBA 3K2IA 1CQWA 2ZBKB 1GITA 2ZE8A 3IBCA 3GMSA 5K3DA 1ENPA 5HSGA 1KR5A 1JALA 2OO7A 3D4IA 2CKMA 3CKKA 4HLUC 3LW8A 4NK4A 5CHEA 4RL6A 4JWTA 1DELA 5ESDA 5ILGA 1HNXM 4KIUA 1HE3A 1FTWA 2QU8A 4MYSA 3EQ2A 1YGYA 3BFJA 3BMQB 3IBYA 1E96A 4FYKA 4N7MA 4FGWA 3FY4A 2HPZA 3IHLA 3M1YA 5ALNA 3ZXXA 3ZZNA 1Q7BA 3HYCA 5C1IA 3WMGA 1I7SB 3CGWA 2BH2A 2ZATA 3PL1A 4CKWB 4ZYLA 2ADFA 3KYCB 3SKVA 1O95A 1O94A 1IK4A 1GO2A 2BR5A 4TPKA 5DF1A 4ZVUA 5TLSA 2IKQA 2R68A 5B1YA 4B7AA 2X15A 4YH1A 4KHZA 4B7XA 3ZX4A 2RGHA 3K0KA 2AA3A 4YO7A 3DYIA 1V9CA 1EAYA 1OZHA 4FLMA 1W581 2BEJA 2PKYX 2GN1A 3B6EA 4AJHA 1AGPA 4Z4IA 1GHTA 2GB4A 3W05A 2IVZA 4LKOA 3ZG6A 3B48A 1TJYA 4FYHA 3ZWNA 4LDQA 1EWKA 1UK9A 3A1UA 2Z4TA 2G9QA 5I8WA 1PX0A 1TM3E 2WFZA 1RMQA 1B6TA 2HQRA 1VCNA 3QE0A 4XYBA 2CLKB 1E6EA 1ZMTA 4JUFA 5E6UA 5F5XA 5D3KA 1SVKA 3PUHA 5FJJA 4B08A 1JT9A 1QB8A 1RBYA 4FJ2A 1VSBA 1TVEA 1V16A 1UPFA 3KOMA 2Q6OA 1W9MA 4WNAA 5A0FA 4FHCA 4PZLA 3NCTA 1FLVA 2OTCA 3BMOA 3C6ZA 2ZTDA 1J2YA 1R00A 3EG9A 3TAUA 7ABPA 1LWNA 4YRGA 1Y8AA 1JEQB 4FYPA 4PS0A 5BN5A 3ZWBA 4K86A 5I8PA 2H59A 5ULLA 1WXEA 2YUIA 2VK8A 5B4VA 3O5AA 1WLYA 4O4HA 1Z5OA 4L5BA 2ZXEA 4LYJA 4NAVA 2CD7A 3PXDA 2IIVA 3KWLA 4LYYA 4CKXA 1KMIY 2VDWB 3KDAA 1A1VA 1G5TA 4N5HX 5LQNA 1MT3A 3LLUA 4AZ3B 1R8QA 3RJZA 3Q3IA 3NRCA 3SQWA 2L82A 2OP0A 4XYEA 3ZJVA 4DIFA 3GQ4A 1ZJ5A 1TJ5A 4RPGA 1BS2A 1NONA 3OZVA 3U09A 1OTHA 5JSZB 2QJWA 3G49A 3AKCA 4DUZM 3S4YA 4UFNA 2CNWD 2Y21A 2FYTA 4M76B 1ZEJA 3M6FA 4PTYA 1GQYA 1QQ6A 1XB2A 3I4LA 5SY9A 4LF8M 2XNCA 1X7HA 2X0DA 5IDWA 3J81S 1AZTA 2W48A 4DNOA 1PT5A 5FUBA 1E4EB 5LZ2A 3WMXA 3LHIA 2GJ4A 3AF5A 3DUFA 1OASA 1COWA 1Q91A 5JNSA 1OAOA 5SV2A 2WFAA 2BFPA 3LP8A 3GRRA 3GOHA 5LQUA 4JI2B 4LZPA 3AW9A 4NG4A 1RRGA 3TM4A 3IURA 4EG0A 1U11A 4I50F 5FOSA 4B3CA 5GIPE 1VIAA 5FBHA 4DLNA 1EQAA 1LWOA 1V8OA 2Q07A 1MQ9A 2VPXA 1RD4A 1UFVA 4LXGA 4WFQA 3ZGZA 5JSKA 3PFWO 1KQNA 4M36A 3BL5A 5ADHA 2AJTA 1MH1A 4P3OA 1M66A 1ADFA 3CLHA 4ILEA 1GGVA 2A5LA 4S04A 3RVKA 4K0KM 2A57A 4IWNA 3PPIA 4JOSA 1JJFA 1K75A 1U28C 2D7JA 4J7UA 2ADMA 1I6LA 2A4MA 2XMDA 1D2HA 1OBHA 5DIFA 3HB4X 1S6YA 2H9IA 2QLNA 2ZTHA 1JFTA 5AJTA 2X6TA 4XGIA 1A97A 1FVOA 3ZE6A 1SXGA 1NNUA 5KX5F 1G18A 3P9QA 2PKQP 4E7OA 2C88A 4BZQA 1M2GA 2YVKA 3E9RA 3WRXA 3ZGLA 1M2JA 3OTOB 3R9IA 3HI6A 1Y80A 2HCTA 4MB0A 2JIRA 2LIPA 1T15A 4HEJA 1L1FA 1XDWA 4B8WA 1NU8A 3FGNA 3MMNA 3O8DA 2A5JA 3DMGA 1FVHA 4XI9A 1COZA 1R2YA 1M7BA 1BMFA 2CL0X 2R84A 2RGEA 2ZAIA 3VXKA 3RYCB 1BA2A 1ID8A 2ZUWA 4WESB 3CISA 2B4QA 3DZIA 3DOJA 3W1WA 3FF4A 1P1FA 2VF7A 3T94A 1Y7LA 1L1QA 4GSYA 3H5OA 3SI7A 2J6BA 4AURA 1PP4A 1EVJA 4AX4A 2ZW9A 3L2OB 1C2YA 2I34A 2XGGA 2EOAA 2QRJA 3K8OE 1DCFA 3KJHA 4K9PA 5EYPA 3O8CA 5DYNA 3O90A 4XSVA 4ASUA 1C9MA 4ACBA 3TTYA 3OIGA 4BJ1A 5BR1A 5KCMA 1OTYA 5EZYF 3TCKA 4KN6A 4E32A 1ZICA 4AJNA 1X8JA 1O9HA 1RRVA 4YRRA 1NAIA 3P4UA 4ZYVA 4YIHA 3R3HA 1UKZA 5BSRA 5T3UA 1LB1B 5EJGA 1RYFA 1UFQA 2ODAA 5EINA 3U40A 2GERA 2GYWA 4IV8A 3H4MA 5MF6A 2GDZA 3CFYA 4OHVA 3EIOA 2BWJA 5K8TA 1CE8A 1TQHA 4N7RA 4I55A 3D5EA 4S0ZA 4NLLA 3I2IA 2VDKB 1L4BA 5IT9S 1KMHB 1I4WA 3IVCA 2AI3A 1A7JA 5DCYA 2AZMA 3WJ2A 1E18A 1QQ7A 1XN4A 5LMUB 2GZ2A 2WMOB 3G8CA 4H77A 1WGLA 4CF4A 5CFOA 2ADOA 4ND8A 2P6MA 5BPHA 1R8YA 1W52X 1ZBDA 5D86A 3VNRA 3HO1A 1KJQA 2A2ZA 2ZJ6A 3DTNA 4JLOA 3INYA 2ZYGA 2XNKA 2OC9A 3MHPA 4ZQIA 4LQCA 1PFUA 2ZS7A 3FSGD 3AWDA 3VC1A 2MHCA 1WHTA 1C1KA 1YHZA 2BEUB 2Y27A 3C5WP 3EBOA 1I1NA 4YHBA 1LSJA 1QONA 3AFIA 3DYBA 1E3LA 1YAJA 1D09A 5H9WA 2HWWA 3GJTA 4WESA 4BGVA 3UWKA 2IGTA 2PH5A 3ECAA 2HIHA 1V41E 4YMHA 2H7CA 2P68A 2MU1A 1NWCA 4IHAA 4PEVA 4G4IA 1QKIA 1HDYA 1L1RA 1DG9A 4Y2RA 3GJQA 3KOXA 3MSCA 4BL5A 4KGXA 2ZP1A 4QJ5A 3JQEA 2PZFA 4OHZA 2V3VA 2JJMA 2OSVA 1NVVQ 2IUEA 2YXEA 4G1FA 3LC7O 3QBJA 2RRUA 2J07A 1JVBA 3BCSA 3NHUA 3WIOA 5LQJA 1FFBA 2BUCA 3KOOA 3LKDA 5C46F 4DBZA 5U9CA 3ROGA 1I5RA 2WIKA 4B6OA 1SOVA 5DYGA 2DPHA 2GJKA 2HGSA 3VO8A 3KZMA 4HLNA 1VKZA 2WIJA 1E2QA 3U3JA 1JDUA 4PAOA 4A8PA 2PJDA 4B35A 1MO6A 5KKAA 1K7FB 3EASA 3MJTA 5HEKA 3TQQA 3UG6A 2X5OA 4DJTA 4DLWA 4MQEA 1G21E 1Y34E 3PDUA 2F5QA 4BZZA 3OU6A 4MCHA 2BRUC 1SUWA 2G88A 4X7PA 3R20A 5AXBA 4C01A 3CLSD 4E1VA 4HNQA 2Q0HA 2XHEA 4NRDA 2ORWA 2YWDA 1FA9A 1KI4A 2H4ZA 3JW8A 2LNDA 1U1CA 4NRWA 1V11B 3M6VA 3DXZA 4C08A 4QG3A 4NU5A 3ROMA 2A5YB 3ZDCA 5A3JA 4YROA 4D45A 1XTPA 2WOOA 2ZI7A 4D43A 5JNTA 5KTPA 7MHTA 1TK3A 4LWZA 3WDLA 3R74A 4G01B 3BSWA 4HAWA 1HYEA 1SOWA 4PQFA 1MB9A 1SOMA 1M1YB 3WZ2A 4HH3C 2XMBA 4IQ4A 1K06A 3FETA 1T6XA 3QG5A 5CB8A 3M1LA 3UXMA 5LR6A 2VOEA 3H9BA 3QYPA 1CG6A 4AB1A 4EYGA 3PPYA 1P2VA 2PMBA 3T5AA 4CIZA 2D13A 2GHTA 1RT9A 4KWIA 3MWFA 1MX5A 5AK4A 5HTKA 1LZLA 3ASUA 4HJXA 3RS4A 2VBFA 5EMKA 3DQZA 4JBWA 1UAYA 4EEXA 4QECA 4U1RA 3QYBA 1B73A 1U7DA 2HQBA 1M2HA 1ST3A 2FCRA 1T1SA 3R5HA 1TK2A 5IAJA 2MIIA 3VR5A 4RIEA 1TQDA 2KZUA 4RXMA 3DEFA 2DTEA 4UHCA 4BB0A 3H7AA 3TGLA 1DGGA 1V6AA 3QLVA 9LDTA 4DUGA 2DVWB 2EW2A 1GPUA 1SCNE 2VDPB 3DLCA 3ZWMA 4HS4A 3R8CA 1VL2A 2NVBA 5IC6A 4D46A 4EGJA 2I3BA 4MQFB 4GWGA 3OPYB 4PCVA 2HQ1A 4YCDA 5ALDA 4Q1BA 3W5SA 2NTVA 4BX0A 2CVZA 1LTQA 3ZDRA 1G16A 3N5KA 1MABB 2NZUG 3EXHB 4AIIA 2WK1A 1RQ7A 4F6RA 4RVSA 3AL2A 3DWIA 4FGUA 3M7GA 3WNQA 4B46A 4MAMA 4D3SA 4BX2A 2J5RA 1QO0A 2YY7A 4WZBB 4UQLA 3HWX1 3CKLA 2A33A 3NU1A 1LNQA 2DG2A 2HMYB 3PWSA 3ERCA 3HE3A 4B85A 4FFOA 1NXVA 4QPNA 3DXXA 5CHYA 5DNYA 4URXR 4N54A 3OOEA 3STVA 3TZEA 4C4AA 4JENA 3D6HA 3MJDA 4CU5A 2JG3A 4ALJA 1NF9A 1TGUA 1KU6A 1UQTA 3E0XA 3GXOA 4ZYXA 2Y9MB 1VI6A 2OILA 3HP4A 1G8PA 1D4FA 2C4KA 3F6SA 3E61A 3ZWQA 5EIOA 2F90A 1UKVY 3I23A 4YRQA 2ZSEA 3ZHYA 1EUCB 4L02A 4I99A 4OQQA 1FRZA 1VJTA 2PFSA 3PXXA 2Q3FA 2RHHA 5H16A 1CBUA 2Y8EA 3RT9A 3IJEB 1E2HA 2WQ7A 1SGWA 1G98A 3L8HA 1ADGA 3H18A 4R1LA 3DEAA 3E48A 1KHHA 5B1SA 1ZIPA 4ZKEA 1SCAA 5C32A 1SKMA 2O7RA 3HKDB 1QP7A 1S2IA 2Z2KA 1Q1QA 3MPOA 4PNHA 1ZO8A 4EG3A 4QUIA 2RH4A 1XNQB 1DEHA 4I1VA 3W9SA 2AMJA 5K4HA 2O20A 1Q1AA 5ALSA 1OH8A 5JEDA 2RHGB 1GJSA 4RK4A 5K3CA 2VYND 3X1DA 3ROXA 3EA4A 3Q8WA 4OGWA 3O73A 1F48A 1UZUA 2VHZA 4KI0A 2FPKA 2IEGA 2ZWIA 3PICA 1PD0A 4NARA 5JYDA 3ZJ5A 4YJ2F 2VRNA 3Q87B 2VHJA 3UK1A 5IWAM 3DO8A 3DV2A 2XDQB 1XRRA 1D7AA 1I9GA 2P9YA 4HZUB 1U8CB 5KPRA 3RTCA 5TSDA 2P90A 5IXYA 1IUPA 4KIGA 1N9KA 1IOWA 2BYTA 1YKSA 2ZANA 2VT7A 4INOA 2BCGY 3U3ZA 3AI3A 3AIIA 3C5CA 1Z08A 2E87A 2FSPA 2ISQA 4IHJF 4NVRA 5GV7A 3BQNB 1WZNA 1XAHA 2Q6TA 4R9NA 4BMDA 1EWVA 1S2NA 2N1MA 3M7IA 2COEA 5FDFA 5JNVA 4Y6GB 4KN8A 2D2FA 1KK3A 3HJAA 1KKMA 1UDRA 1X3SA 2ODBA 1QRAA 1C8LA 1JHRA 1O6GA 3PQ3A 4EFLA 4BNMA 2JXNA 4JEMA 1JJ7A 1LCIA 1VKNA 4INAA 1S2GA 2D0IA 3NUQA 4S1OA 2Z3VA 4WVFA 4YJHB 1XU7A 5AKIA 3M34A 2YJTD 3RUDA 1XVVA 1N92A 3SYKA 2OHHA 4H7EA 3GWGA 4ZAGA 5DK6A 1P72A 1RJDA 3AC0A 3T38A 4FX2A 2OV2A 2VDNB 1A69A 3JVUA 2ZAOA 1D4OA 4N8DA 4YLGA 5F1OA 5HUHA 3QEBZ 1E3MA 1H0HA 3LI2A 4HGRA 5EWJA 2BFAA 2A5FA 2PRSA 2QPAA 1RBMA 3KQMA 3Q88A 3IPAA 5C4MA 5IZ4A 1Z8NA 4O4IF 3JZDA 4DB4A 4J0FA 1Y63A 5IAOA 1G55A 1OX6A 2NVOA 3AIMA 2DU8A 4M8IA 2OBMA 2IU3A 4L5IA 1X1BA 4XM1A 5E8JA 1GZDA 1ETUA 1NLUA 2FQ1A 3AUXA 3KRTA 2R7NA 3QXXA 5LXTB 4D8VA 2ZAYA 4KSBA 4TMZA 1E4OA 2OFOA 1K9VF 3MINB 4FGLA 2HTFA 4Y6QA 3WS7A 5LCXA 3VHXA 4MGKR 5CITA 1PW7A 3LH5A 3NIDB 3TD9A 1ORTA 4GGPA 4KNYA 5KO2A 5ER6A 2HAEA 4AS2A 1K8RA 4LZLA 5J23A 2BT4A 2DULA 3DE1X 1MQSA 3E18A 3K0HA 5ANRB 5TB5A 1PTJA 1CF4A 4BXOA 1W9HA 3DV9A 3ZK9A 3FE2A 1FSPA 2OGSA 2AG1A 4X7BA 3UG7A 4ND3A 1T8PA 1KQGA 2CUNA 1JI0A 3RRNA 1SUAA 2PH3A 4J1QA 2NZXA 2O8CA 1WHSA 5J2UA 3V46A 3F6RA 1N5KA 3KOZE 1RLTA 1YONA 2IJGX 2JZOA 3EMBA 4GKBA 5DEOA 1D9ZA 3HEMA 4NNPA 4PHCA 3W3AH 1N2HA 2IS6A 1QG4A 4JI0B 3KIPA 5CDGA 1EGHA 1XHFA 4IQ0A 2PYDA 1CUCA 2NUBA 2PFGA 2IA5A 3BFPA 2I4IA 2PUTA 4RPIA 1SZDA 4V39A 2JCXA 1IMOA 3L0OA 5EAIA 1TOAA 3PHHA 1UWKA 3G5UA 2JLZA 2H5IA 1E77A 2R1TA 4IF6A 1KIFA 3OLCX 4RPCA 3VGJA 2ZJ2A 1DARA 1TKAA 3FYSA 3QMPA 4Q9IA 4B6PA 2WJWA 4BN4A 4YRMA 3ODPA 4EB6A 1IUNA 3SJUA 3H05A 2HW8A 3STUA 4NS1A 1G2QA 3PHCA 4TL9A 2SCUA 1B23P 1XZQA 2V4ZA 3MT9A 4J4TA 4KIWA 4MW7A 5JNUA 3H5RA 1CUJA 1L4YA 1T5LA 2GK6A 3C98A 1I4OA 3T99A 4F3RA 3PHIA 5JLJA 1YFLA 3GO8A 1HC7A 2OXEA 2KBFA 4EO9A 4LF4M 1AGNA 2PFKA 4WA8A 4XEUA 5F51A 1BDHA 3RGWS 3DC7A 1YTLA 5FWDA 2PR7A 1PDOA 2KWIA 1M33A 4PGHA 1ILEA 3TLZA 3U7QB 3H5WA 1USIA 3G0CA 1UPAA 4LJYA 2ZE5A 1M7GA 3LYLA 3OM0A 5DBHX 5KNCA 1SK9A 1FMLA 2GVNA 1NVBA 4MRRA 3O0TA 4RY8A 1QIMA 3E9CA 3KL2A 3S2EA 1V5GA 3TJMA 3THYB 1JS1X 1KDRA 3AF6A 5M7EA 2G06A 1XEWY 2XNDD 2C2BA 1LI5A 1TEXA 3S27A 3U2QA 1J99A 2HM7A 4BBAA 4HGNA 1WY5A 3NUZA 5DM2A 1WXGA 1E9CA 4QWWA 4R8KA 1S3SA 4P2BA 4R2LA 4YJ3B 1MA0A 1CFZA 1B1CA 4N82A 4RTMA 4RKUF 1Q84A 4EYEA 4RIFA 5EMJA 2XADA 2ZUSA 3BWDD 3H8WA 2DVMA 1CUWA 2WTNA 1C29B 1FUYB 1PR6A 1RI4A 4IDBA 7AT1A 1JDBB 4WPGA 1G3UA 4NXNM 4MLPA 2BC9A 3PCRB 3WYFA 4MZXA 3C3DA 1O8BA 2W6QA 4UEJA 4CF6A 5I3ZA 5F2KA 2J7KA 3FOAA 3L7DA 5EIBC 5LLSA 3KYDA 3TSOA 4ZJZA 1XZCA 1HYGA 2EO2A 3PRJA 3K70B 5ENDA 3LQ4A 4MQ5A 3ENQA 5F98A 3L27A 4A0RA 3KO8A 3ZDYB 1PGPA 3QVMA 4RYLA 1R4ZA 2ZUTA 4JXZA 3U0BA 3QVOA 3NYQA 2C5EA 2Y1KA 3PUWA 4R41A 4X92A 1FJGB 2IZ7A 1UPTA 2B5WA 1Q0PA 1UBKS 2XUFA 4RHYA 4M0KA 4WLFA 4UPEA 3JR7A 1CW2B 1YOVB 1OQYA 1C0PA 3VDUA 1U7HA 2X9LA 2XCOA 3NO4A 5IAKA 4ZIRA 2I4OA 3OQ1A 2JWSA 1VSUA 3DE6X 3RYFB 1E3DA 3ZHCA 3IQWA 4DCSA 4EDHA 2VDUE 1YRAA 3DOHA 2FQWA 3R4VA 4AI6A 2RIRA 4MQFA 5AKHA 2LZ0A 1TMKA 3CIFA 3RF7A 3OQIB 4IQ8A 3HO8A 3AR5A 1GZ3A 1THTA 3U6SA 1NNUC 2QY9A 4WECA 4BLUA 2FA9A 1OLSA 4RQUA 5KQGA 1E7WA 2HI0A 3CF4A 1GLVA 2B5OA 1QTNA 3QPDA 4J9UE 4XDZA 1H6UA 1O9BA 1X1AA 4XJVA 4JXJA 2L17A 1I10A 1JR3D 5CM8B 1JV2B 3A2LA 4U9IS 3L0ZA 1NPTO 1ZX1A 1OGYA 4O59O 3N0XA 1LTHR 5KYXB 4YY3B 2IY9A 1IBRA 2X4GA 1C0KA 1YZHA 1N3LA 2ZFUA 3ABSB 5JXGA 1QV6A 1ZVKA 3MD9A 4CKEA 4DWVA 1G8SA 4ZVSA 2ETVA 4DG5A 3HK2A 3NCHA 1YQ9A 2BFBA 1T8RA 5ELLA 3BJIC 2FPUA 1RKBA 4EX6A 2VP4A 3PHLA 5BVHA 3PC7A 2QTRA 4RF0A 1ZUHA 2D7CA 5J2TB 2R1UA 3F8SA 1QTIA 1XTVA 2JJQA 4TTVA 3TQIA 1BRTA 2G5CA 3TIXB 2FPGA 2OUIA 1RADA 4LISA 4WKBA 1YRQA 4REQA 4MKHA 1L1ZA 3X1MA 3EQ6A 2J59A 1UL1X 3U5ZB 1O0SA 1QYIA 1UOEA 2B4YA 2XOKA 2O3TA 3NVMB 2QYOA 2ZYHA 3IVMA 1NMYA 4GZ5A 3ROEA 4EPWA 4NMXB 3FMIA 2P65A 3GAFA 3A2NA 2IPLA 4RZUA 1P2BA 1YQUA 4QDXA 5AIAA 1DAEA 5HBGA 1Y5NA 2X22A 4YMGA 2Y77A 3O7WA 3EXFB 1EK0A 1Q7GA 3LAWA 1RYYA 2XE7A 3LWBA 1V7CA 4RSHA 4ZCSA 4TWAA 1K4KA 1E6LA 3AFMA 4U39A 3EFOA 5GV8A 3WQHA 5C2JB 5IU6A 3P96A 3NBIA 4ZDWA 1FDIA 4IQGA 3GCDA 2EJBA 1GTRA 1W96A 4IIBA 1ISPA 1ZN2A 4S12A 4MUGA 3W0LB 1S2LA 5EI5A 3I9KA 1ADBA 1GTMA 1NOIA 4RIHA 4RD3A 4UVHA 4LRSA 2HH9A 3GC6A 4CF3A 2R5NA 2C4UA 3HKCB 3HMKA 3MGBA 1KEPA 3O93A 4IIEA 2ZPAA 1FL9A 2ZRDA 5DLPA 4C20A 2HLPA 2VNAA 5IP5A 2DMRA 1VE9A 1WPGA 2GVDC 4OFWA 5PGMA 2PUFA 2W98A 4NE9A 1U6JA 5KNLA 4C0JA 3N0RA 3E82A 5G40A 1CZUA 3Q85A 4MS1B 4N12A 2AS0A 3EXHC 1SUEA 2ZUBA 2A84A 3EEYA 3LO8A 1BKSB 2QTHA 4OBWA 4QUJA 1XMOB 2RC5A 3G8BA 1YKFA 4PYMA 1D6MA 2VPYA 3QU4A 4K9QA 1ZJWA 3ILHA 4V38A 5THQA 2RK3A 2A9KA 1GQRA 3LFTA 3LNTA 2G8LA 3WGKA 4L3OA 1SUSA 1XQWA 1EHYA 2OXRA 2OV1A 1VMEA 1VGQA 3TXYA 1J33A 1P60A 2Q1XA 4Y7DA 4LDRA 4DMLA 2Y0CA 2VJAA 1OXTA 1H2ZA 1P9WA 4NR0A 2H0AA 1HJPA 1ZNXA 1RDFA 4L75A 5AJZA 1RQXA 1RXIA 1VJ5A 2Y68A 2AQIA 1UBFA 3LKZA 3MELA 1T5DX 4CUZA 1C8VB 2GTPA 1E2DA 1UK7A 4KVZA 1KDYA 4E6PA 3Q98A 3X1WA 4DAOA 4YT4A 2JGEA 1KPGA 1QP8A 2HWYA 2ZCUA 4N0MA 1ZW6A 2JCYA 3B6KA 3CZAA 5LXTF 4ENTA 5LLDA 3IPRA 3K72B 4HTAA 3Q8GA 2Y93A 3MBOA 4U2DA 1T0BA 3AGQA 3VYTB 1Z62A 4BV3A 4JYAM 3HRKA 4GKKB 5F23A 4OTZA 4TYYA 3RDPA 3PR1A 4UCXA 4LZNA 1TZCA 2H1CA 4P32A 4WQMA 2GX6A 4GDMA 3QWIA 1DHRA 3RRBA 3U7HB 2V7QA 4DAEA 1XDUA 3E7FA 4IBJA 1N5IA 3VKGA 3OLWA 5CIQA 2C1ZA 3FKQA 2R8YA 1K5GA 2OYCA 1UWLA 1Z37A 3MJ5A 5EL0A 5K09A 2G5GX 1IPEA 4IFTA 1X1SA 4MWGA 1Z17A 2XW6A 4AKIA 3QWLA 3HHZA 3GCXA 1PEKE 3OE1A 4NDNE 2CDCA 1SZCA 4EQ6A 821PA 3KBOA 3VR6D 3O47A 4RMNA 1ESDA 4ANRA 1OKKA 4TZTA 3BBZA 1YZNA 3PD7A 4M1SA 4UZFA 2Q4RA 3MWDA 1UBNA 4R1TA 1AA9A 1R2QA 2CJWA 4DV1M 2A9QA 3BRWD 2ZT7A 5KVAA 2I8LA 2I6XA 1PTJC 5K4AA 1SUBA 4IHJB 1IU9A 1ZP6A 2G82A 4V0SA 2YHUA 3JXEA 4DJEC 5L7TA 1ACJA 3F6BX 4B9EA 3CE9A 1G21A 4OHOA 4MS3B 2OECA 4B6EA 1RXWA 1HV8A 4XYLA 1R5JA 5K0TA 2BEVB 1CQIA 2WJVA 5IC5A 3MW8A 1R1DA 2HXSA 3PQ8A 4FDLA 3MD0A 3S6JA 3RNOA 4UM9B 2FPMA 4IF4A 3LVWA 4L8LA 1R0WA 1XK7A 4V1CA 3IVRA 1UDCA 4D8YA 5CAEA 1RFGE 3IPCA 3NIBA 4YJ2B 5DW0A 1JGTA 1XNJA 4DFDA 4JC8A 2ZXFA 4GI1A 4HTFA 2F67A 2WWGA 1WWKA 2Q21A 4L08A 2F43B 1S3FA 3NHZA 4H0FA 5G0WA 3FPEA 3UK0A 5ITZB 3GAAA 3SOPA 1BA3A 2H85A 3C43A 3WYDA 4ZHSA 1GD1O 2O06A 1MF7A 3G5MA 2AQ8A 3MK6A 1E5DA 3OVMA 1E3WA 2G7ZA 2XEPA 5E6RA 3HKEB 1O03A 4QIHA 2G9RA 5DLEA 2K9DA 3HJSA 4P34A 3CVJA 4KXLA 4ZPJA 4LWPA 2I55A 2WTEA 2X3FA 4I1YA 4FILA 3ICOA 4OOFA 1RJGA 2Z8YA 4CI9A 3HCBA 3E3AA 3MJ4A 3NALA 5AM4A 2OZLA 4GL2A 1L7AA 3SYLA 1F5NA 3GNSA 1G41A 3KU4A 3L7JA 1JEYB 2ZE7A 4R8LA 5EJCA 1GVHA 1T5IA 2AF3C 1FXWA 4Q24A 3FNBA 4P80A 5EWLB 4F4DA 1W48A 4K87A 4J8PA 1D3AA 5DK4A 3FUCA 1UJCA 5DNWA 4IOKA 2O59A 3Q41A 2C1EA 3HSYA 2KX7A 1TZKA 4HMOA 3VZBA 2FP3A 3ER8A 4Z7OB 3R41A 4PQGA 2MYTA 1JG7A 4MJXA 3ZXSA 4OI0A 1JKJA 1TAQA 4RGBA 2HYDA 2FGJA 2C9DA 2JY6B 7CATA 1YVUA 2ZYTX 3OOSA 1T2NA 1OXBB 3TBKA 1OSNA 1UKCA 1R27A 1U0EA 1V2HE 1I80A 2E85A 2E3JA 1Y8ZA 3K9WA 1AS3A 2XUOA 5P21A 2VTVA 6CHYA 4P4SA 1XDSA 4WASA 1W4ZA 5D2CA 2R8ZA 3R9WA 2WJAA 1U0GA 4NJMA 1HFEL 1VEGA 1T8WA 2G36A 4QJIA 4TL8A 4Z9FA 4TKVA 3OQNA 4KWEA 1TTHA 3S1AA 4BMSA 5CVUA 2AKEA 3K0EA 2AMLA 4JJFA 4MARA 3QJYA 3PCXA 4HZGA 1L6IA 1E4VA 3B2QA 2VI5A 2IW3A 4M55A 3VR6A 4P58A 3OCVA 4D82A 1Z0JA 2MMGA 4FU0A 4PZ9A 4CL8A 5HRUA 2GFQA 2CNBA 3H2HA 1PJZA 1RZVA 1PQPA 4KB5A 1TH3A 3HHWA 1NMSA 1SC1A 2D2VA 1TUBA 3D6MA 3QFCA 3DTYA 1I01A 1P1JA 3OZBA 2JNHA 1YBHA 1ZH8A 4I55F 4O3FA 3SEAA 1FMTA 3PLRA 3T7EA 4MS4A 3ZIDA 1DQYA 1KVQA 4RLFA 2EIHA 5BMVB 5C0OE 1OI4A 5BYAA 5DHSA 3HKBB 2QVLA 2R8PA 2ZYRA 4TV8F 3SYMA 4PO8A 3TVDA 2IPNA 1XD2A 4MUMA 1AKVA 3PB3A 2HEIA 4N9QA 5JRJA 4V1CB 1QK4A 3QYFA 1E9DA 1JIUA 2VLBA 1XC8A 2C58A 3C3KA 3JYHA 3KEQA 2FN8A 3KYJB 4IJWA 4QUEA 3WDSA 4E4TA 2AN5A 5TARA 5CFLA 5JCJD 4A6DA 2GUWA 1IEWA 1VI5A 4N5IX 3RRJA 1KU0A 5BSHA 3OZSA 5KTKA 2VPPA 5L3QB 2NZ8A 3IR7A 1MTZA 4HD8A 3WISA 1OF1A 1AKUA 1M2OB 4UJ5A 4JLWA 2TSYB 4YJGA 3TSZA 4LGCA 3KAKA 4DV0B 2Q28A 4KWHA 1FS5A 1SK8A 2I8CA 3OUTA 3C4JA 1BVRA 4JYZA 2HJWA 4RU1A 5AI6A 1Y6RA 4ZOLB 5C34B 3W1EA 2BHNA 3NT5A 3KFUG 2EZTA 2ODWA 4X65M 3B6JA 3DFKA 3OP1A 4JSYA 1EQ2A 4MS1A 3V34A 1Q2XA 2XRYA 1YDHA 3CPHA 2P6PA 2BSAA 4D0NA 3K15A 4EJ6A 2ZIXB 5FTKA 4EJSA 1KARA 2EXXA 3KS9A 5KOHA 4MAAA 1JFLA 4YP1A 1WIWA 2VJNA 4IQFA 4KFCA 3FNIA 1E5QA 1JDBC 2VXOA 1T9ZA 4BMCA 1JPJA 1F5SA 2EHJA 3FNFA 3AVXA 2WYOA 2WWYA 4AYTA 3B70A 5DOZA 2YJ3A 4DHEA 1GKUB 2G09A 5LOVB 4RTKA 1CZKA 2XJ9A 4F2DA 3IBGA 4R9RA 3VTFA 2COUA 5CXUA 2WR8A 3Q7TA 3AT1A 1X9IA 2VTBA 4HAZA 4BXOB 3FPLA 2CL7X 4XZ3A 3RHZA 4CG1A 1AUAA 4P84A 4D9MA 5AVWA 1XG5A 4TLBA 1CQZA 5IASA 1FOEB 2RGNA 2NTNA 4MJ7A 1SC3A 5LQMA 4IJFA 3MTJA 4I2VA 3K6SB 1CUIA 4KP7A 3OG9A 3RVBA 4DRXB 4F85A 2B9EA 3LT2A 1A8QA 4ZT3A 1C50A 2QIPA 4QYMA 2AC2A 4QOIA 3LS2A 5AI9A 4JI7M 4E3WA 2HRQA 1T9GS 1N0IA 3PQ6A 1WNFA 4JCCA 1QH8B 5I7OA 4RD6A 3MGGA 4PW0A 2Q5HA 5LP6A 2FG5A 4C6RA 5DHUA 3EWIA 4PVCA 4AJEA 4NXNB 1XHBA 1WULS 4CV1A 1OLUB 3ILKA 4G1BA 1NFFA 4QUHA 1M6WA 3EXIA 4L5CA 1OILA 1PRYA 3V48A 1LK5A 5B2EA 2Z08A 5HCIA 2FVYA 4FFNA 3JATA 4MI6A 3RJ5A 1C3VA 1F2DA 1XTRA 2OOAA 1V45E 3AR3A 4M60A 4MUNA 1KJZA 4AWAA 2IH5A 2B9VA 3QKSB 4NBLA 1VPTA 1IDOA 2I2XB 1EIWA 2PXAA 1XC7A 2FKNA 3D59A 1AURA 3KLNA 1TT7A 1U0SY 1W1UA 2WM9B 3HY3A 4D0GA 2VOJA 5KOHB 3HTXA 3MUNA 1RTTA 4JNKA 3ZWYA 2I65A 1FYDA 4DBVO 1U9IC 3RVMA 3ZY2A 3U7GA 2FWJA 2EKZA 1K0UA 1DBVO 2ET6A 5JAIA 1GRCA 4EUNA 5TPZA 3BK2A 3RE1A 2YQ5A 4FEYA 4ZN6A 2HKJA 1E5VA 2B8WA 3N8IA 5K05A 5FX2A 2UVQA 4H15A 4UHDA 2PA3A 2W2MA 1XVLA 5AUOB 1DZ3A 1BAPA 4D96A 1JB9A 1ML4A 1P3Y1 1H2RS 2N75A 4P33A 4QQKA 2NQ2C 1LVUA 1TO2E 4MQLA 4X3CA 2ATXA 3PFCA 5J40A 1G6HA 1OFUX 4M8LA 3AF0A 2VSYA 3GFBA 3MA0A 2X42A 2Y4OA 5HZHA 5THKA 3UWSA 3MIZA 2GRAA 3C5VA 4ZYTA 3I28A 3U6BA 4AJLA 1EIZA 3D4OA 4RPKA 1NVWQ 5HMMA 4X24A 1EH5A 1KFEB 3DEJA 4GHWA 3LMKA 5T67A 1E6UA 1R50A 1IBCA 1NR5A 4RK1A 1AV7A 3RSQA 5A4JA 3UQZA 5CXQA 3DVLA 1SVIA 3L7AA 1R0RE 4RBNA 2BI4A 4F4UA 1ZKMA 5CBPA 2GEJA 2H18A 2C2YA 3C6QA 3M6LA 3IUEA 4JI7B 3V7NA 2F5NA 3I37X 2QXYA 4CEJB 4HQLA 3OEEA 4XPZA 3KS4A 4F3KA 1NBMA 3CF4G 3SNHA 1PNRA 1JTFA 3FIJA 1NW8A 1XLWA 4JV5B 1W5FA 3R3WA 1M6HA 1FBTA 4QHSA 3RIHA 4ZVNA 1C14A 1U6IA 1VE7A 3BIOA 4B9AA 1UINA 5HF6A 5LL6P 3GVCA 2JFNA 1SKQA 1SXJE 1TKRA 1S8AA 2D59A 2BFCB 3AM1A 3WI7A 1M8PA 5DCUA 3H3XA 1ZU5A 2Q1YA 1KKUA 3LT1A 1H2BA 1OPXA 3ON5A 4HH0A 1N2OA 2WF7A 4GX2A 1IPFA 5D6OA 3TJZA 5IVPA 3ELYA 1M0EA 4RAQA 2JD2A 4IGAA 5DLQC 5FNVF 4AMGA 2B82A 3ZVRA 3QV2A 5K45A 3GIWA 8ABPA 4XD7A 1WMFA 4HYTA 1QIHA 1FJHA 3JRXA 3JQ7B 2P78A 4TYMA 3ZWAA 5DM60 2P2ZA 2O8DB 2NZWA 1HZJA 1GTVA 2Z5FA 3LPCA 5IUNC 5TQ0A 1RLJA 1IM8A 3T1TA 2IS4A 4PFJA 1GN9A 1G5IA 2R00C 2DKFA 2Z95A 1EDBA 5FHQA 5CLQA 2QMOA 1U1DA 3EOBI 1CPYA 1UMKA 3NTOA 2F48A 5IKMA 3QX3A 3K1TA 1E92A 1F4PA 1UADA 1ZA2A 2FRVA 4GVLA 1C5KA 1PNOA 3EAGA 4JUBA 4HDQB 2OBFA 4H27A 1DG3A 2YHIA 1HX7A 2FEKA 1H0RA 3C4VA 1L7XA 4K5QA 4YCSA 2AYYA 3OD1A 2ZBFA 1YL7A 3H16A 2Y1WA 2DAMA 4EFMA 1DC5A 4YMVA 2GH1A 1CF9A 4K2HA 5JZMA 3UGQA 1KR2A 1XL1A 2I76A 3B7QA 1HNZM 1PUJA 3R7SA 1VJRA 4KOEC 2K4MA 3FMFA 1NHWC 2NUPB 1HE1C 4E1AA 1BWQA 2W6OA 4BATA 1IOZA 1EG2A 4H3SA 3DMNA 4LPKA 1VJ0A 3SHWA 1S8NA 4ND5A 3M49A 2WHEA 3WJ7A 3I52A 4FMDF 4JAVC 1CEXA 4KXUA 4L2IA 4NL4H 3STYA 1M2VA 5JD6A 3MCAA 2XTZA 3B1FA 3A58B 5JWOA 1NVKA 3AKZA 1LI7A 2WA2A 2GPNA 3JYQA 4DLUA 5F2EA 1W73A 1VZ3A 1YI0A 2X1LA 4IUYA 1VPVA 2WWRA 4GX5A 3HDYA 2GBGA 1AUPA 1K89A 4MUHA 1DQPA 1C0IA 2EYUA 4RX1A 4TUYF 5JPDA 1YHYA 1F51E 2MYUA 2FEPA 2P11A 3K30A 1D1QA 5I7WA 5ALKA 3GQBA 3KJFA 4DA8A 1KAOA 2ATEA 2V6GA 3M5DA 3FOCA 3ADBA 1USWA 2A9JA 1BOFA 5JYBA 3D8NA 3X0DA 5EWMB 3C58A 1UOQA 2UZ0A 4C29A 1CUUA 3TQSA 2R8BA 1DIGA 4Z6YA 2QZSA 2VUSA 3PE6A 4FHDA 4FN4A 2WM3A 4ZZ3A 3RKUA 1QIFA 5DGDA 3JR4A 2WKPA 3KM0A 2ZS8A 4YRAA 5M29A 1QQBA 3L4KA 3T3MB 1YR9A 2BOVA 2R6DA 2GM5A 3VR5D 1Q11A 1WF6A 2NN3C 1U3TA 4TRNA 4UXIA 3ZI4A 4C04A 4R0MA 5HKAA 3JD1A 4KJXA 1EFPA 5HILA 4DJAA 2YR0A 1JIIA 4MNTA 3DMHA 2QRVB 2W6PA 2UUPA 1P4AA 4G24A 4Z1OA 2B20A 2OQRA 3B9QA 1KWKA 2A3RA 4ZGBA 5A6VA 1CP3A 3AHIA 1CLUA 1K7SN 3CKYA 1A50B 4ZMBA 1H4SA 5CMLA 3MOGA 3TQRA 3ZGNA 1ZNQO 2Q50A 2VP3A 5TQJA 3BPSA 1RYMA 4RS3A 2RGWA 2OOKA 1IN7A 1MO2A 5AM0A 1H6DA 2KB0A 1YBAA 1NF3A 1G5FA 1CR6A 4WLVA 1V3UA 1QIGA 2WIAA 3QFHA 4C0BA 1PG2A 1Z8DA 4XB6B 4MICA 1ZXLA 1OXMA 4LYGA 1R5NA 1OH7A 1C9EA 3N53A 4S1NA 1LNSA 2QJTA 2OB2A 3U6PA 3WC4A 4XVHA 2JFOA 3DBIA 3TD2A 1NMXA 4GSKA 5BNWA 3DFFA 4I0WB 2W22A 4LNUB 4CR6A 3K0SA 3THYA 1LPBB 5LUBA 2CT8A 1OFHA 1VIMA 3DLBA 4RM3A 1R4GA 3ZJYA 3SHGB 4IIYA 4P53A 4KR3A 3EH1A 4U2GA 1U5CA 3IILA 4FNOA 3IEKA 3LXMA 4H16A 4U4AA 4RZQA 4FVTA 1T0IA 3UT5A 1W0KA 4AG5A 3ZD6A 5EEHA 3TR0A 1NXOA 5D51S 3HZOA 1QIKA 1FPMA 1N7JA 3JQAB 3L6EA 2IHYA 5IBPA 4IDFA 3RHTA 4C2AA 1RWQA 4KQJA 1IBLB 2CY0A 3MCVA 4LSMA 3VU9B 5F9FA 4QO7A 3FCXA 3L0SA 5AK3A 5GVRA 2GSWA 1ZINA 1JHMA 5BUCA 3MYRA 5JQWA 3RYHB 3RVSA 5TNXA 1GGEA 4FFRA 3UH1A 4WNCA 2AFHA 3A4VA 4KHPB 2B4KA 8CATA 1YT5A 2PWZA 2QR3A 4JI8M 3G5TA 4G8JA 4HF7A 3ND6A 3I32A 4GMDA 1E5LA 4JB0A 4AQYB 1K98A 1WUTA 1DJQA 4IBFA 1O87A 1ZD9A 2DT8A 3DE4X 1SRRA 3KQWA 4H59A 4R3NA 3SFTA 4DYVA 3IE0A 2ZWOA 4F72A 3F7TA 3I62A 1G3RA 4I1UA 3HGIA 3O82A 4ZI5A 2YS6A 2OAP1 3UXEA 1F8GA 4FHGA 4QFCA 3ZWDA 3COYA 2K2QB 5C52B 4R7TA 2OKGA 5DMHA 1ZJ4A 5KTOA 1RMTA 5B64A 2C98A 1GZ7A 4JC4A 5WRFA 3GJYA 1UC4B 5KYWB 3QE9Y 2CUZA 1M1YE 4HLUA 1GPDG 1KGSA 4M0LA 1MRZA 4RVOA 5AFSA 1PIWA 2A78A 1SAYA 2G17A 4FTWA 4R40A 5EQTA 1EXDA 1XEXA 3HO6A 3QVGA 2NV0A 2H1VA 2C2ZA 4KLRA 2NO6A 3PDCA 1NJFA 2V1UA 1T4BA 2B2CA 2BTQB 5ERGB 4BWYA 2FV8A 2EEZA 4OB7A 3O1HB 5LLTA 5KOYA 1E94E 4EW3A 3I2FA 4FWDA 4M21A 4TYNA 1OIVA 4W99A 2C20A 1FZQA 3EUAA 1KI9A 3EVCA 1N8NA 4DR2B 5IH7A 4DSTA 3GU3A 1C4XA 1FRNA 5CK5A 1XNHA 1JLRA 2BM9A 4YNBA 4YN3A 3VX4A 1IBSA 1CZNA 1FTQA 1KEVA 3I1YA 3RSGA 2CFOA 1GU1A 1LC0A 1MPTA 1TL7C 1W29A 2NAPA 1FMJA 1ZRNA 3EVGA 4RHEA 4H17A 2WIFA 5KTYA 5EE3A 1YASA 4PC3A 1RYHA 3HNRA 3W7AA 1QH1B 2JBAA 1N34B 4DIOA 5JI2E 4M4SA 2PUCA 1BHQ1 1KGDA 1Z0DA 3OICA 4V03A 5JBNA 2TMKA 4HN4B 3EHDA 4FW9A 1E89A 1XRQA 1JAIA 2BZSA 1JBQA 2ZSHA 2NGRA 4W8GA 1CC1S 4EZEA 1MUUA 2IEAA 1Y8GA 1IY2A 1SXJC 3W8RA 2UUAB 1MJNA 1VBMA 4QRHA 5FPSA 2IYQA 2P6UA 4CLRB 4H7DA 3QY9A 1ZH2A 3S29A 2JI8A 3H5AA 4B47A 2YY5A 1II8B 1LZKA 3LDGA 5KO3A 1BE0A 4ZCQA 2GESA 2PX8A 4ZEOA 1H8ED 1EGMB 4EMBA 2QIOA 2X1VA 1VDLA 2QLFA 4C4TA 2A7XA 1KY4A 3OLXA 4EHDA 1UBOS 3J81k 3R3ZA 1PT6A 3CNHA 4M53A 4QDOA 1JEOA 4EI2A 4Z9XA 1RVDA 1WSWA 2QWXA 3BWVA 1N6IA 4I14A 3FVRA 1TAGA 4BLCA 1TQ4A 4QEKA 5LMCA 4WRRA 5GONF 4JP5A 2ZVJA 4JN6A 1HQYE 3E53A 1Z22A 3BXWA 5CX4A 5F7XA 4MQEB 4WOKA 3ENWA 4Q9HA 2JJ2D 3D8RA 3TLXA 2WAXA 1R10A 3V4VB 2B92A 5D3MA 3F92A 3MJEA 4TMYA 3K6JA 2HUNA 4H08A 2BDEA 3ZNQA 4PGAA 3MLBA 4PX2A 2PGIA 1VE6A 5AHOA 4KR7A 1LSOA 3LOQA 4HVCA 4F1WA 4BP9A 2R8EA 3KG2A 1PZNA 1XAJA 2AEJA 1EESA 1JTVA 1JFSA 2J6HA 5LSAA 3WRYC 5LD2C 3OTIA 2AKAB 3AG6A 5CBPB 5ICSA 1FZTA 2BISA 4LPSA 4XM2A 1ZQ1A 1SQ6A 2F4VM 1X3LA 2QBYB 2BHSA 5CURA 3PF9A 5ERXA 5LQRA 3LGAA 3FPBA 4LRYA 4RSGA 4O4HF 4XQGA 3T3EA 3O3MB 3VYRB 5EXXA 2FGKA 2GEDA 1C9DB 1B6RA 3MG9A 3RU9A 4BQQA 4EO4A 4I4TB 3QF7A 1DAOA 4Q01A 1T5HX 2A9OA 1R4NB 1DCKA 1NVAA 1XJ5A 3TZCA 4YQEA 1WVGA 3UEOA 4B3BA 1USKA 1USUA 2P69A 5HGJA 3OZGA 1ZVVA 4YXWA 1T2EA 3O75A 2VSQA 3SIPA 4QATA 3O1LA 5E0OA 3PEWA 2QLBA 4YCBA 2PBZA 3T5BA 5L4NA 2QI9F 1FRFS 4MUBA 4Y2SA 1N57A 3RSHA 1JAXA 4L4YA 3IIJA 4DZTA 3IAAA 2LR0A 3C7KA 3AJIB 5IBCA 3R7AA 4XGNA 1P6UA 3GEHA 3DMTA 3FSGA 3FCCA 4J0CA 3Q8KA 3HXLA 1D2AA 4PZDA 4WGFA 4NI5A 1L5KA 2A1UB 1Y4UA 3GLHA 2DT5A 2H29A 3K4PA 4DR1B 4DMGA 3GPLA 2YV3A 3FHTA 4Y2YA 2VK1A 2I4RA 4Y9RA 8GPBA 1KSFX 5L3VA 1EFUA 3DHVA 1Z73A 4NMWA 2PV0A 4B0OA 1YA6A 1ZVQA 1X74A 4GH9A 4HQNA 4MH0R 5FF9A 4HYEA 2VYQA 3F6PA 3LY5A 3OT1B 4NC6A 4JLBA 1AS0A 3NM4A 1TU0A 3DMTC 4UW9A 4EFNA 1Q1EA 2IZ0A 2BM1A 3R0IA 1TTPB 4JYMA 2O19A 3JZAA 3LA8A 2W42A 2V1CA 3R5XA 1CRLA 3AP3A 5DMXA 2GPAA 1JLLB 2IYRA 1YS9A 5IRCD 4IBEA 3HDGA 3N8NA 3JYOA 2QP9X 3W68A 2VH5R 4BO6A 2RE8A 1MB2A 5TGDA 4DQXA 4QBHA 3AVTA 5BR7A 5KSPA 2MYPA 2LCFA 3B60A 3G9UA 4PLZA 5EIBD 2OHOA 3FJYA 1G66A 1XJWA 4EB0A 4CXMA 1ILWA 2GAFA 4OPMA 4LJ7A 5GJWC 4WXEA 4JI3B 2UXCB 4MOWA 4KH1A 5FOXA 5AVRA 3OPYA 4KBYA 2JIZA 5ILOA 1I13A 3TFQA 1PG0A 3D1JA 3SAUA 3TD6A 5CFPA 1ULUA 3ZXYA 4Q1VA 2QSYA 3I6QA 3GFPA 1P4SA 1ZI9A 3QH4A 5E3HA 3KSUA 4YS6A 2ZYAA 1JLKA 2J5BA 4ENQA 4RNDB 3EDCA 1BQEA 1GEEA 2P4HX 3OU2A 3P19A 4YT5A 4A4DA 3VNUA 1M10A 2AL7A 3IP6A 3O38A 4JYPA 3UFXB 5ICCA 3KKKA 4BO1A 4MVCA 1OA0A 2EF1A 1I6MA 2V0CA 1A27A 1L7RA 3GCZA 3CF2A 2V6MA 3F6YA 2FZEA 3GRYA 1N2CE 3GUYA 5E8RA 3TOXA 4CMAA 2B1JA 5EZYB 1JNYA 2WYVA 5LDDC 2OG2A 3CEJA 1XQVA 3PUJA 3QPAA 4BUZA 4ZIRB 2PL5A 1NXXA 2PT6A 4WI1A 5JPIA 4YRTA 2ZIXA 2VYFA 2GJ8A 3CJRA 4KHPM 2XCLA 1OAOC 3ZKAA 4AJ4A 4D0RA 4IIWA 3RTEA 5ALHA 2UZ4A 4A91A 1RR6A 3ELUA 1UXKA 2DWQA 3PTLA 4LQDA 3R7WB 2NT4A 5LDGA 5AOCA 4CV2A 5CNKA 2RGUA 1JU4A 2FLWA 1JJIA 3LBFA 2JLRA 3IVXA 4NECA 4ESHA 4HT3B 4YT8A 1NIPA 1JQAA 4GKVA 4P1ZA 4U00A 3RUAA 1OGJA 1AKYA 1GPMA 1R5LA 1ZESA 2QRHA 5LQDA 2GBLC 1UBLS 1PDWA 2WILA 1GJTA 5IM5A 5P8WA 1P1RA 4HQRA 2BBWA 4HI0E 1FK8A 1J90A 2FU5C 4RL4A 1K88A 2APJA 3VZQA 5GIOE 2XUKA 1M2WA 1ZAEA 1PR9A 2BTQA 3L93A 1TMGE 1AQNA 3ROZA 1TKBA 1MAVA 3PFFA 3QVGB 2XTAA 4FSHA 2BLLA 3AJEA 5FI0B 4ZICA 2WSMA 4UCFA 3SQXA 3ORYA 1A9QA 3OTOM 1E5TA 1W0JA 2IRWA 4ZVKA 1PJIA 3T5GA 4LK3A 3U3MA 3ZU3A 1NGSA 4AQ7A 3CVVA 3H1BA 4BMVA 1N1EA 2G9VA 4L6IA 1QMGA 1Q7EA 5DXJA 1CXZA 3KKEA 4LSGA 2IOHA 2VF4X 3B2NA 3CUSA 2C8LA 3OF3A 4NONA 3AH8A 2ATIA 1DX9A 3QBVA 1IXSA 4FXPA 5CFQA 1XCOA 1NG1A 2DSNA 3WZLA 1PQYA 3TQHA 1U9YA 3TQFA 4JGBA 1IRIA 2MSKA 3D3WA 2P5SA 3T7SA 1LSUA 2GN2A 3HR4A