3FTEA

Crystal structure of a. aeolicus ksga in complex with rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
VSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 60
structure length 233
sequence length 233
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fteA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fteA01
2BM8A 5GOZA 4YUYA 1ZGAA 1I9GA 4DF3A 5HILA 4BP3A 4ER3A 3CJRA 2OBFA 3EMDA 3R6TA 5F2KA 3P2KA 5HEKA 3KR9A 3OPNA 5EC8A 3A25A 5KQRA 3EEOA 2IDKA 3P71T 3NVKI 2QRVB 4IV8A 5EPEA 3EGVA 3TPZA 4RTPA 2B9EA 1RJEA 3B3JA 5DM4A 3FUXA 3G2PA 1FP1D 1NV9A 4RTSA 2P40A 3ANXA 1X1CA 2P7IA 4HRAA 3BGVA 3GO4A 4HG2A 4KDRA 5EMLA 4C08A 3R3HA 1P91A 2FYTA 1ORHA 3F4KA 5DM1A 3MAGA 2ERCA 4FSDA 4XUCA 5FA8A 5LQCA 3A7EA 2PX2A 2R6ZA 4PWYA 3GWZA 5M5BA 3EVAA 3ID6C 1KYZA 4R8SA 5DXJA 4L7VA 3SGLA 1JQEA 3M6XA 4RYLA 2IH5A 2C7RA 2PX4A 2NP7A 3S68A 4RTMA 3KKZA 3BGIA 1WG8A 2UZ4A 3PTAA 2Z6UA 3NJRA 5EHGA 2CL5A 3P2EA 4FS8A 2JG3A 3FZGA 1BOOA 2ZBRA 2ZLBA 4K6MA 4DQ0A 4E31A 3O7WA 3LSTA 3SSMA 5K0JA 5C0OE 1XCLA 1DCTA 7MHTA 2JHPA 3L8DA 4HGYA 4RTQA 4PNEA 1JQ3A 3QOXA 1UWVA 3E05A 1F38A 3HCEA 3KPYA 3CVOA 1SG9A 2CWWA 2IP2A 1U2ZA 1NW3A 3GNLA 5E1MA 3OE5A 5E1OA 1JG2A 2O05A 5EMJA 1TPYA 4EVIA 4MHTA 3P9CA 4ATNA 3HA3A 2YQZA 3NTVA 4GOLD 4EKIA 3LDFA 4CKBA 1YB2A 2OO3A 4QPNA 4PCLA 2PBFA 2VP3A 3G8BA 1O54A 4PIMA 1NKVA 3FUVA 2G72A 4E70A 4PYIA 4IKPA 3LDUA 2NXNA 1RI3A 2PXXA 4X41A 3DLIA 5EG5A 3FPFA 1R74A 4POOA 4X63A 2XVMA 1X19A 2FK7A 3CJQA 3JWJA 3ELWA 3FPGA 3FUWA 2AN5A 3C3YA 1VIDA 1VQ1A 2BZGA 3EEYA 3FTFA 3D2LA 3O31A 4XCXA 4ER6A 3MCTA 5E1DA 2JH9A 4PGGA 3LPMA 2IGTA 3NDJA 1SKMA 4YV1A 2WA2A 2YR0A 5GM1A 3MERA 4U7PB 1YFLA 3G89A 1JQDA 2PT9A 3HCDA 3B3FA 5E1BA 5EEGA 2O07A 3PLAE 2ZWVA 4Y30A 1MJFA 1I1NA 2ZZNA 5DM2A 5GINE 5KS2A 4EKGA 3PVCA 3HCBA 4P58A 3VC1A 2AN3A 2ZCJA 3DULA 2GS9A 4A6DA 3IHTA 4H0NA 4RSRA 3UA4A 3TFWA 1JG3A 3DMGA 2AOWA 3E7PA 4ZTBA 4V0RA 2ESRA 4AX8A 5CIYA 1XCJA 2VDUE 2WK1A 3BWBA 4GF5A 4Y2HA 4C05A 3EVBA 4YUVA 4YUZA 4GOOD 3FPHA 4R6XA 3CBGA 3EVDA 3G2QA 1RJFA 5FCDA 1QAMA 2NXEA 3G2OA 3KR0A 4PYOA 4BLUA 1IM8A 3FPJA 3KPJA 2QYOA 2GPYA 3GU3A 3LKDA 3OU6A 4HTFA 3SSOA 1M0EA 1JSXA 3EPPA 2BM9A 3T7RA 5GM2A 3P8ZA 5KYGA 1L3BA 1XDSA 4CTJA 3LKZA 4GBED 2JH8A 1O9HA 3K6RA 4C4AA 5K0FA 3UZUA 1NBHA 5P8WA 1QAOA 4M36A 2PWYA 1SQGA 1I4WA 3V97A 3JWIA 1KYWA 3ELUA 5EQJB 1FP2A 1R8XA 5EVJA 2PKWA 5EZSA 4E2WA 2VS1A 2UYOA 2PY6A 1HNNA 4RVHA 1Q0TA 3VYWA 3EGEA 5KQSA 4KWCA 2YX1A 4KVZA 4QTUB 1D2CA 2NP6A 5EKXA 2H1RA 3OZSA 5ICEA 4OX9Y 4KIFA 2CMGA 2ZZKA 3LCCA 2ZFUA 1YUBA 3PB3A 3TLJA 4R6WA 5DM0A 1KPGA 4HSGA 2YXLA 3FTCA 3LBFA 3LCUA 3LX6A 4QDJA 4X61A 3P97A 5HIKA 3EVGA 3MHTA 2NYUA 2GA9A 2PXAA 3UJ8A 2HR1A 2XBMA 5CD1A 1VLMA 4X1OA 3BWYA 3H2BA 3R0QA 4RV9A 2GLUA 2OYRA 4AZVA 3WSTA 3TM4A 3G88A 1NBIA 3UJDA 4AZTA 4E32A 3I9FA 5EKUA 1YF3A 5F2OA 4CKCA 2ONZA 5LQUA 4RTKA 2EFJA 5E2BA 4DMGA 5EHIA 3QOWA 3P9IA 1L3CA 2AOXA 3P2IA 5DPMA 2XYVA 5FQNA 2WA1A 2IBSA 3KPWA 2FHPA 1N7JA 3GIWA 2UYCA 5DX8A 3G5LA 4NECA 5DX0A 1JG1A 1V39A 3AXTA 5ICFA 3T7TA 4BY9E 2UYQA 1Y8CA 1G8SA 4PIPA 4RVGA 4V0QA 5CVJA 5K01A 2ZIGA 1AF7A 3M70A 4HH4A 5E8JA 3PFHA 1R00A 4M37A 4DCGA 1MHTA 5EZQA 5EOVA 4GQBA 4YV0A 3MCZA 1OR8A 3HCCA 3M6UA 5FQOA 1QANA 1KIAA 1YZHA 3A26A 4RX1A 9MHTA 2B78A 3FPEA 4RTRA 3X0DA 3FYDA 3SX0A 1INLA 1G55A 1PJZA 2PVCA 3ERCA 5K0EA 2P41A 5FHRA 2HMYB 4AZWA 3FRIA 3R24A 3GJYA 2AOUB 2OB2A 3K0BA 4WVLA 3UJ9A 2V7EA 3HVJA 3GCZA 1NT2A 3KQTA 4DA4A 4OBWA 2Q41A 1NW8A 5GIPE 2VZ9A 4M38A 3A7DA 1ZHFA 1EIZA 1L1EA 1R18A 2LD4A 3AXSA 4OA8A 5DLYA 1ZQ9A 2AS0A 1XDUA 2Z6AA 2YVLA 1R8YA 2HNKA 3ELDA 4GOMD 1WZNA 4CXMA 2EG5A 2AOTA 3T7SA 5FULA 5K0CA 1EAMA 3KQYA 4YMGA 3EVFA 2PV0A 2QM3A 3PT9A 1UFKA 1EG2A 2I6GA 5FTWA 4OA5A 3SVZA 4DZRA 3UBTA 5G02A 3OCJA 1VP3A 3HCFA 5CVEA 3FUUA 3FRHA 5EIFA 5FWDA 5U4XA 3C3PA 3DP7A 1XVAA 1KPHA 3DXXA 2PSSA 2Y1WA 5DSXA 1R6AA 1Z3CA 5BP7A 2OPBA 4R8RA 5FA5A 1D2GA 5K0GA 2IH2A 4QDKA 2E5WA 3CC8A 1T43A 3EMBA 2P8JA 3BKWA 5DX1A 1JR4A 3EVEA 3C6KA 5EIWA 2YXDA 2Y1XA 1WY7A 1NE2A 3GXOA 2IH4A 2P3QA 5F2NA 4G56A 2R3SA 2ZBPA 4PINA 3UWPA 5K03A 5LSAA 1RJDA 1VL5A 2DULA 2OZVA 5C9ZA 1ZKDA 1H1DA 3P9KA 3LECA 1XDZA 3ELYA 4PGHA 1EJ6A 5DRTA 4HGZA 1M6EX 3I5UA 3HA5A 2ZW9A 1NW7A 4C06A 3ER9A 1PRYA 1FBNA 3KHKA 3RIEA 2BH2A 4FR0A 3LCVB 2YTZA 1IY9A 3GRZA 3TM5A 4DCMA 3KQVA 2QY6A 2B25A 5CVUA 2C7QA 5E9JA 3HP7A 2XVAA 1N2XA 1RI4A 3BWCA 3HEMA 3JWHA 3KQPA 3O4FA 4MQ4A 4OQEA 3CGGA 4RWZA 1RI1A 3FTDA 5LQAA 2FRXA 5H02A 10MHA 5BXYA 1RI5A 3DMFA 3SR4A 4R05A 5K09A 5CCXA 3M33A 3UJCA 4LWOA 1VE3A 3EGIA 3UJ7A 3VSEA 3KR2A 1F3LA 4YUXA 4PYNA 4UOEA 5K0BA 1G60A 3HTXA 4C07A 3GRRA 3G7UA 2ZSUA 3B7PA 5BW5A 2I7CA 1SUSA 1SVUA 2QRVA 2AZTA 1X1DA 2F8LA 2NNWB 2BR3A 3AY0A 3Q87B 5GWXA 3GRYA 5FHQA 5HIIA 1YZ3A 5ERGB 5K8VA 1G8AA 3BWMA 4RVFA 3CJTA 4PYKA 1QAQA 3C0KA 5LQKA 2O0LA 4X60A 3TKYA 2P3LA 3UFBA 4P7FA 5DTQA 3UJBA 1AQIA 2B3TA 2ZULA 3DXYA 3LGAA 4QPPA 5HFJA 5MHTA 3BT7A 4WXHA 3TKAA 3AJDA 4F86A 2OKCA 4FT2A 3I53A 4B17A 4DKJA 4ER7A 2HTEA 2IBTA 3M4XA 1QZZA 4OQDA 1HMYA 2EJTA 3FYCA 5D1HA 2P7HA 1JG4A 4QTTB 2H11A 3V8VA 1DUSA 2A14A 3IEIA 3DOUA 1G6Q1 2EJUA 2PWPA 2I9KA 1P39A 1O9GA 4M7RA 4RVDA 3KPUA 3TR6A 5IKMA 2YUIA 3T0IA 1VBFA 2G8NA 5B1SA 4P7JA 2FPOA 3CCFA 4GEKA 3OFKA 1EQAA 1RI2A 3C6MA 3E23A 3G8AA 3IV6A 5ICGA 1FJXA 3BZBA 2FK8A 2IDJA 2XYRA 3PFGA 4CTKA 4YUWA 1RJGA 3BUSA 4MTLA 3AWIA 5CVVA 1JTFA 4E33A 2JJQA 1AQJA 1ZGJA 1Q0SA 1BKYA 4KIGA 5ICCA 2ZBQA 3LL7A 4P7KA 5DT2A 3HCAA 4ER5A 5LR6A 3LBYA 4C04A 4EMSA 3GRUA 2PGXA 4OBXA 2PT6A 3OU2A 1KPIA 4HTFB 2AOVA 2ZTHA 4FP9A 5E8RA 3A27A 3KQMA 3OU7A 3SSNA 2NXJA 2YXEA 1P1BA 4PYQA 4PYMA 3RW9A 2N47A 2NXCA 5DRYA 4QVGA 1N7IA 4BP1A 4ER0A 4RTLA 1P1CA 5GP1A 5T64A 3HVHA 5K05A 2BR5A 3IYLW 3LHDA 4MIKA 3TMAA 3KU1A 4RTJA 2ZZMA 5EMMA 1KR5A 3DMHA 2GAFA 8MHTA 3E8SA 4IWNA 4EK9A 4QQNA 2BR4A 5EGSA 2G70A 1JTEA 2AVNA 5FADA 5FUBA 5KVAA 5CUQA 3SM3A 1FPQA 3A4TA 2P3OA 2CMHA 2DPMA 4XUDA 1KXZA 1VPTA 2OB1A 3DH0A 3RODA 4BLVA 1WS6A 2C7OA 4PCAA 4E2ZA 3EVZA 4YV2A 2C7PA 5K0NA 5EEHA 3M6VA 2VDVE 3OFJA 5IH3A 1L9KA 3Q7EA 1XTPA 2PJDA 3HA7A 3I64A 4GOND 5LQJA 1X1BA 5C1IA 4A6EA 4ISCA 1VP9A 2ADMA 5CVDA 5LQNA 4QQKA 3SXJA 3KQQA 3GRVA 2IFTA 3BKXA 4BLWA 3KQOA 5T6BA 3VC2A 4KRGA 2PX5A 3DLCA 1KHHA 1QYRA 4P7GA 1NW6A 5HOQA 5EMKA 2ZIEA 3ME5A 2P35A 5HIJA 1YFJA 1X1AA 2JHCA 4AZSA 1NW5A 4LECA 1D2HA 1G38A 1TW2A 1NV8A 3G2MA 3LDGA 1WXXA 5K0LA 3HM2A 5HZMA 2UYHA 5E2AA 4AUKA 4LWPA 4FT4A 2AR0A 5CCBA 4U7TB 2KW5A 3TOSA 3GDHA 3REOA 2CKDA 3NWBA 1TW3A 3G5TA 3MB5A 4O29A 5T67A 5GIOE 2G1PA 5DTRA 3PX3A 3SMQA 3MTEA 3NVMB 2O57A 4FSXA 4MWZA 2ZIFA 3DTNA 3MQ2A 3FUTA 5DXAA 1UIRA 2HV9A 3FTEA 2Z6QA 3THSA 3CKKA 4E2XA 3MGGA 1B42A 4GC5A 2FCAA 5E9QA 3KR1A 4IV0A 3GGDA 1SQFA 2K4MA 3PS9A 3THRA 3U81A 4EQZA 4QVKA 3PX2A 5DSTA 2OXTA 4PYJA 1WXWA 2ZWAA 1M6YA 2AOTB 4Z2YA 4CKEA 4C03A 2VDWA 5DTMA 2HWKA 5LQRA 3ORHA 3ER8A 2EX4A 2PLWA 4PONA 1AV6A 3NWEA 2GB4A 3BXOA 2AN4A 4E2YA 3OE4A 4KW7A 1EJ0A 2OY0A 3B89A 2V74B 3DXZA 3B5IA 1JSZA 5D1NA 3UA3A 5CM2Z 5JR3A 5JUWA 5DWQA 4JXJA 2ZVJA 2GH1A 4KDCA 5HIMA 4F85A 2PXCA 4RTOA 3JWGA 3B3GA 1ORIA 2ORED 3OZTA 2XYQA 3MTIA 3P9NA 3KPVA 4LG1A 2O06A 3EVCA 3DUWA 3NDIA 3UJ6A 3OZRA 3I58A 2ONYA 5E9WA 2IIPA 1IXKA 3NMUF 4PYLA 3TRKA 3DR5A 3KQWA 3QV2A 3TQSA 1DL5A 3KQSA 4DM3A 1ZG3A 2AVDA 4E30A 1KP9A 2QE6A 4FGZA 1BHJA 4F84A 2PX8A 1SUIA 4RTNA 5BW4A 4XUEA 2H00A 3HNRA 3NW9A 2AOUA 4GC9A 3R9XB 4YMHA 3HVIA 1BC5A 1XJ5A 2G71A 4CWAA 4FZVA 3HVKA 1L3IA 3M6WA 2IPXA 2B2CA 4GUAA 2P1DA 2JHAA 3BGDA 3UJAA 5FWAA 4HC4A 2I62A 1XXLA
chains in the Genus database with same CATH superfamily
4NEGA 2KMLA 5HEKA 3P71T 4C0KA 4NMWA 1USGA 2QLJA 3C41J 3IBSA 2VPZA 5LBIA 4HXGA 4BNLA 1L1RA 1P91A 1YQDA 2GCGA 4XQ0A 4B80A 3JR5A 3WLPA 1AUXA 3U9LA 1HR0B 2V6FA 5LZ5A 2ZP1A 5HK9A 3UKOA 3O7WA 4REQA 3F71A 1DC8A 2QTFA 4MS4B 3ZKWA 4NX2A 1AIPC 3RHFA 4IZHA 2GHQA 3W8RA 2HPZA 2XVMA 1T13A 4NU6A 3FUWA 1GCAA 3ZWWA 3QMPA 4YRQA 4BKOA 2SNIE 1UMCA 4BC1A 4ITQA 5SYMA 1KK2A 1VBNA 3WIEA 2Q3EA 4I1IA 4BMZA 1L7VC 1R6XA 3QPBA 4FFOA 1VGQA 4K0KB 1PJCA 2WJ3A 1YDMA 3EA4A 2NT4A 4RK7A 1UJNA 4DMUB 1GL3A 2GERA 4DTIA 1EGHA 3KB1A 3WLLA 3TMYA 2E87A 2HJRA 8OHMA 2ZFUA 3W7BA 5HRCA 2HR1A 5JH7F 4OYRA 1TGYA 3DLHA 2VYND 1KWGA 4HXEB 3CX4A 3KFXA 1YF3A 2W8BB 5FR2A 2PU5A 1QUEA 2RGDA 4B3HA 5KNDA 2XKJE 2XPCA 5BYKA 4NECA 3LCRA 5EL0A 2UZAA 3VNSA 2QAGA 3CO5A 3WWCA 3T1TA 4OHVA 1F8GA 1RHJA 5FJJA 1YACA 1INLA 4P4TA 2PVCA 4RM3A 2FB9A 1Z4KA 3W6PA 1K8ZB 3MXTA 4MLZA 1YAHA 2R18A 1EFRD 3I04A 3CLTC 3UNXA 1P7PA 1K97A 3CO0S 2W0MA 2CLEB 1QLJA 2W6PA 2OCYC 2QN3A 1TCUA 2WMNB 3PL1A 1QQAA 1FSGA 1E7RA 4R98A 2XXAB 2JBHA 5IC5A 3AQ4A 3GX1A 4G89A 4FE3A 1TNDA 4V2UA 5CD9A 3F74A 2FQXA 1XLVA 4F6RA 4UM9D 2WV7A 4JI7M 2ZVDA 2C2YA 4JLNA 1NNLA 3KV1A 4PYKA 5KJEA 3GEGA 5AWFC 3LVVA 2FP4A 3AOEC 1VCNA 4YDQA 1IZ8A 4NG4A 3ZE9A 3NCHA 4KDFA 2VTBA 4BIMA 2Y1GA 2NLOA 3KNZA 4LDQA 2X2EA 2H3EA 5K3FB 3ZHSA 2VNIA 4GHAA 4MV5A 1ZM2A 4O08A 1BXRA 1JHRA 2Y9PB 2BZ0A 5M2QA 3A31A 3R4CA 2VUHB 1I1QB 1JDUA 2V45A 4HLUC 5DRYA 4P34A 3VDNB 2ZUCA 5CH3A 1UJCA 2D7DA 4DV0M 1QOZA 5CUQA 1CRZA 5EWMB 5IPFA 5HM6A 1U7TA 3ESXA 3CLSC 4BNVA 2FEXA 2RGGA 1QIHA 5C1IA 3ADOA 3LO5A 4BCCA 4CCWA 3STTA 4JI2B 3EH1A 4OK5A 2ZBUA 2B3DA 4XR9A 4RF2A 4WK0B 2L18A 1YK0A 2O57A 3IDZA 5EE3A 2QVLA 3NP9A 5SV2A 5COBA 3QNWA 2FCAA 3U81A 1G63A 2VBCA 4L3WA 1V5IA 5A2QA 3FSGA 3NI2A 1TM1E 1N9GA 4MVXA 4TWAA 3G1TA 3ZI7A 3OO0A 1MXHA 4DKXA 4E4TA 3FWZA 2IXBA 3SZOA 4EZBA 3NDIA 4KBFA 4NYMQ 5GONA 4G1UC 1OKKA 4C4SA 2WSCF 3EZXA 4FGZA 2H00A 3M5PA 2AOUA 5IJ9A 3NDPA 1V4NA 4PXYA 1UJMA 3L46A 2EF1A 4XDYA 3RE1A 1MQ8B 1P6XA 5KYKA 5BPFA 3R5FA 3VH3A 1GN8A 3B78A 1OAOA 5JAMA 2VXOA 1PDOA 4DV1B 3VJMA 2VUIB 1GOTA 3OD5A 1DJMA 3RV4A 1M1NA 2JH3A 2D7EA 3BEDA 2ZRBA 3S2UA 3DOFA 3IAHA 4UZEA 3GMDA 4GKVA 4H1HA 4UUPA 2OP0A 3KVYA 1ZWLA 1PHRA 1UR5A 1L4YA 1ZV1A 5TY0A 1EP1B 3LTNC 3IP1A 2AFHA 4CLRA 2IX9A 4MYTA 4QJIA 2HWXA 4XCXA 3SU8A 1CQZA 4PGGA 3DWFA 2VH2A 4MUEA 2P4QA 4KO3S 2IKSA 1WU7A 3EW7A 3KZMA 1A9YA 4V0RA 1KRHA 4EW1A 3ED5A 4MUKA 1QNFA 5AVVA 1KJWA 1PT9A 2YMQA 4C88A 1M2KA 2Z2JA 4ZCSA 1DPFA 4QASA 3R7AA 2JI6A 2IYEA 1I0ZA 2W6QA 4J4HA 4J0EA 3P97A 4PQRA 4CUZA 3BWYA 2ZJ4A 1AZLA 4HDAA 3I9V1 1K89A 1F8UA 1AHNA 4RTKA 2DBRA 1ISPA 4UHJA 1TKAA 5A2GA 1E4OA 2ZUDA 1X7XA 1Y6GA 4FDVA 4YV0A 1AKEA 4RXTA 2QRHA 4DTCA 2M1XA 1L7NA 1NN1A 2ZSDA 2FZLA 3R6DA 4IOKA 2Z09A 2PM8A 3T9FA 1LH0A 2WP0A 1KAGA 2HUPA 3OP4A 3D4LA 1UP4A 2HJHA 2CP8A 1SKYB 4I0WB 3LECA 4LHXA 3GUVA 5BV1A 3DT9A 2PNJA 1N3YA 1BA2A 4OQEA 1YFKA 1A2BA 2FOIC 1OUMA 2H0AA 4KAAA 2Q9AA 4YECA 5HS6A 1ZD1A 3WRXA 3LUCA 2ZYGA 4EFMA 3GR6A 2NO6A 3Q1LA 4MVJD 1ZU4A 2MMCA 3WFIA 5DKFA 1IOVA 1XEFA 4M1QA 4XTCS 2K6GA 3KE8A 3GFPA 1A2KC 3D6HA 3RSHA 1FLAA 1G21A 4AY4A 1GCIA 1VI5A 3B6EA 3RFCA 3NKFA 3ZV4A 1QE0A 5JXHA 4LJ8A 3BZBA 1GP2A 5HF5A 3VVCA 4EG3A 5ALLA 4PO3X 3R7SA 1D9XA 1E20A 4ER5A 4ENVA 2E5LB 2G9RA 1KAOA 1VECA 4BFUA 4LQ4A 4DZTA 4QIHA 2JKZA 1XQ6A 3VR6A 2XT9A 2P6PA 4EO9A 3PJDA 3EB9A 1OQYA 4ZVPA 3T7KA 2HLDA 3HI6A 2BMDA 4ZEOA 3DZIA 3DFKA 1QG2A 2PH1A 1AMNA 3GPCA 4GOND 1ZJ6A 2ZAGA 3NRJA 3BKXA 2QLTA 5HCIA 1JKJB 3HABA 2F6RA 1QHHB 1RYMA 4X0EA 4OLHA 2P35A 4A0SA 1KDOA 1TTPB 4HPWA 3WO1A 3TVTA 3R6LA 3TQRA 1E2IA 4RQAA 4DLNA 3WADA 5IBRA 3EULA 4H7KA 3UKDA 2R7KA 3AEUB 1HDYA 1KNXA 1YZUA 4L72A 5B2EA 2CUTA 5C1DA 2V5AA 1YWGO 4P82A 4XEUA 5LOVB 4NS1A 3GPBA 1E1RA 3GEBA 1XB2B 4CFYA 2GD1O 2Y1EA 2VYQA 4PVCA 3B1ZA 1FP4B 2RGHA 2RB5A 3VPBA 4IIEA 2X1LA 1IZ0A 3WMXA 5FOVA 4NE7A 3QV1A 2F62A 4UUAA 1TQ6A 4XDHA 3TLAA 3R9XB 1GSIA 1ECGA 3A58B 2XH9A 1WUHS 5TQ2A 1HTWA 1M6VB 1A9ZA 2IK8A 2VYVA 2GTPA 1YJ8A 3HKDA 1PQWA 4CGYB 4IGFA 1JAXA 3C1AA 2BEWB 3G2HA 3RYFB 3FM9A 1A1SA 3CONA 3CT6A 3U3DA 3DWEX 3VO8A 3GFBA 2EFHB 1Y37A 4JY7A 2AK3A 1KGSA 4FYYA 2WDPA 4IJ5A 5J40A 3WNZA 2YJTD 2HDHA 3GPXA 3R7LA 2Q5JA 2VP3A 2DHQA 4KZPA 5B7GA 4R2JA 2Z95A 4LK2A 4D96A 2BGLA 5TGDA 4FYWA 1UPXA 1GTL1 5E7MA 3VJRA 3G89A 2NVUB 1I1NA 4D0LB 4BYGA 3W5HA 4Z7JA 4IGEA 1H1LA 2H08A 1D4FA 1OIVA 4JR0A 1NRXA 4AFNA 4OXQA 4DAEA 1K8YB 2I6UA 2CNBA 4MQUA 4PYOA 1FEZA 1H2HA 4JXZA 3ND7A 1FVOA 4URFA 1JFFB 4UCXA 1E2JA 4HQLA 4RF4A 5EVJA 1WIWA 1JW9B 2O7SA 4KP7A 4WEOA 3G2IA 3O2SB 3QXJA 5B6IA 4BV9A 3LBFA 3K3PA 2WKRA 1E0DA 3X2SA 4C76A 3TM4A 5FORA 2CWDA 4C0XA 4YRLA 2XUIA 4WBNA 4NMHA 3K0SA 4N5DA 3KLOA 3RNOA 4J1SA 3CWZA 1NUSA 4QNRA 3HA2A 1ZM7A 4YMWA 2J3JA 3UEOA 1H6UA 4XIGS 1DB3A 3NHLA 1RCTE 3IQIX 4AZWA 1YRYE 1V1RB 4BQNA 2VEOA 3CRRA 1Q7CA 4I9NA 1CZLA 1UXKA 1E1QA 2FSPA 2L42A 5DWVA 3H3XA 4CR8A 5J2TA 4Q6WA 4G5QA 1XZQA 2WSIA 2ZJ1A 1PZEA 5FPQA 3LP8A 5CA1B 3V4LA 1OW3B 2FEWB 3D3JA 4NMMA 4AVYA 3KELA 1FDRA 3E9YA 1WR8A 3FBTA 3ENQA 1R27A 4FVMA 1NMSA 2YH2A 1RI1A 5BWOA 5LQDA 2H1WA 1DI0A 5G4LA 1IOWA 3JQ6A 3UJ7A 2ENUA 2WC1A 3G9XA 2Q6IA 5K0BA 1EWKA 1BHSA 2ZDQA 4J1QA 2NU9A 2FQQA 3WHIA 1H2XA 4EGFA 4DR3B 3M9XA 1ISSA 4HDOB 4KE6A 1GDDA 4O8ZA 4ZYVA 5ALGA 2CF6A 3DF7A 4TKVB 1T5LA 4RS3A 4IW3B 3OTOB 2VCYA 3F97A 5A7GA 1KPIA 1RQNA 1N0IA 1ZD2P 1L5LA 4KE7A 5H0IA 3NUGA 1ZO8A 1Z2NX 1P1KA 1E5VA 2WUEA 4RL6A 1LNSA 3RGPA 2GN4A 3E4DA 2DKLA 4RVOA 3LUBA 4MKIA 4RESA 3SJCA 4AU1A 4LXXA 3NBUA 2I7PA 1Q1NA 1VPVA 1QP0A 4OF4A 1R88A 1TRHA 3OPVA 3CU5A 4LSWA 3K8ZA 5IYZA 5T8KA 4Z8XA 3KUXA 2HHAA 3W2HA 4CT5A 3FJYA 2X3UA 4KLRA 1QH1A 1QLWA 3E9DA 1IM2A 3KR1A 3RUEA 2DY0A 3SEZA 1YNSA 4LZAA 3F6SA 3FNHA 5ALIA 1JFRA 2PS0A 3F92A 1NZJA 1JU9A 3WMWA 4MR9A 2O06A 1V37A 3KXEC 3I58A 1XRMA 4RD3A 2W8ZA 4PSDA 1GJTA 2GJ9A 1A50B 1E2LA 1AZSC 3IECA 3C3AA 5C80A 3KTAB 3TIFA 4I99A 2P9ZA 3OPQA 1XTVA 1L5ZA 4PC7A 3N8GA 2SCUB 4PHCA 3VR3D 4YUAA 4BP3A 1XJCA 3NBAA 2LBPA 4RTPA 4BPRA 1T0UA 2CXPA 4JN6B 4DY6A 3Q8WA 3ZS8A 5LQCA 3WP0A 2EQBA 4RYLA 1LV7A 3JZIA 5FOXA 4IYRA 4RD4A 2UZ4A 3AJ9A 2XGOA 3LPNA 3O95A 5BNWA 2G3YA 3B2QA 3M49A 1TM2A 1W6UA 4EKIA 3WLQA 1UFVA 1Y6FA 2QD5A 2DHCA 4GLOA 5IYZF 2BTQA 1FRZA 2I6TA 1J2JA 2BTOA 1VB3A 2JJYA 4PV7A 1YVDA 3SAWA 1Z0UA 3IG8A 1CW2B 1NUHA 3GLHE 1GADO 3BD6A 2QG9A 4NG5A 1KYIA 3ECSA 3F7OA 4MVYA 3IVAA 2QTNA 3ZXYA 3DL2A 5LMNM 1M2VB 1ABBA 2VWPA 2QR5A 1HNZM 4C4AA 3RIYA 3V97A 3OZUA 1PR6A 1F48A 4MWCA 2RONA 1HC7A 4I36A 3AETB 1BX0A 2GWRA 3VR5H 4TLCA 2A5DA 4FW8A 3EEFA 3FJ1A 4HB4A 1MORA 4KAJA 4PC1A 2FW9A 3DZDA 3HPQA 4HCJA 421PA 2CXNA 2D59A 1EQ2A 3H4MA 3KU4A 4ARUA 3H4VA 4RGYA 3QTTA 3PPXA 4HDKA 2XAAA 4B76A 3DR3A 4GSLA 3DV0A 2HA3A 2CE7A 2A9RA 4LF7M 5F76A 3GLFA 5F9FA 4N40A 1CS0B 4MWTA 3SKYA 2QAGC 5DHQA 3TLYA 3LQ4A 3GGGA 5ALYA 1V3VA 3M4NA 2AXPA 1VKOA 4DHWA 1K75A 1AK2A 5CXQA 3FSJX 4QQRA 3WZMA 5FR1A 1Z37A 4GR9A 3BREA 2IH4A 5AI6A 3A6JA 4S3MA 1XTRA 2JD2A 2W82A 3QUAA 1Z74A 1L5KA 3URKA 5CT9A 1YZTA 5DNCA 1TO2E 5FV4A 2OESA 3KR2A 1S3FA 5KC8A 1X42A 3KEMA 3VDUA 1QWOA 4I1OA 3OF2A 2Z2ZA 1FSFA 4H7DA 1NJ1A 3VSBA 3ASUA 4WXMA 5HFJA 3L9XA 2O1SA 4DIUA 3DD5A 2ONJA 2CJXA 5HA5A 4F11A 5LN1A 4BXOB 3NBKA 1EA7A 3WGMA 3HWWA 3U5ZB 1UAGA 4RHEA 2VIIA 1NYRA 4C04A 2VZLA 4BRUA 3ONDA 3RW9A 1P1CA 2UUOA 2E2WA 3DBHB 4IVQA 3KWJA 2AF3C 2GETA 4NZ9A 3MAAC 4UNNA 1ILEA 1GG8A 3TVDA 1QTRA 5FADA 1FXSA 4RD2A 3ZLUA 4MGIE 4HZUB 1KO7A 3RS7A 3AONB 5AJZA 1I2MA 4ENRA 2VDVE 2QD3A 3WTBA 2M6RA 1GCOA 4ZKDA 2HWYA 3G0GA 3K5HA 2R6FA 4D92A 1W5AA 2DG2A 4U2CA 4F4HA 5F78A 5DI9A 3B53X 3VJLA 2XMCA 3TOSA 3EA0A 1IWBB 2YDXA 3IPXA 5D86A 1UIRA 3K05A 4EW6A 1MTZA 5EJAA 5ARCA 5LNK6 3IQWA 8ATCA 4G85A 1M6YA 3H0CA 1BAPA 4G5YA 1JR3A 4CF6A 2PV7A 4ZQFA 4RH1A 2VHUA 4P5EA 3IURA 3THYA 2XYHA 3ZWOA 2R6JA 3ROFA 1DKUA 1VG5A 2XOKD 3HYSA 4QHSA 1QZTA 3PNYA 2Q3HA 3NOVA 1XEAA 5AI4A 5JJKA 2RGXA 4M6WA 1GWNA 1T8YA 1SUPA 2OCAA 4OUKX 4W1RA 1R0ZA 4YH1A 1XWFA 4PAGA 3E1GA 5GOZA 1ZLYA 4IKEA 2OBFA 1I1OA 5H4GA 4R54A 2VP5A 4LRTA 4DCNA 5M3BA 1YJCA 3A6ZA 2XQIA 1ZY2A 1T5DX 4BWGA 4WRRA 3B1WA 4J90A 1QDUA 3LBAA 2GXAA 2PX4A 4B4UA 2ZBRA 2PNFA 2VCHA 1OAOC 4WSOA 4DYHA 3WXMA 3RC9A 1TKCA 1F8FA 2YQZA 3GT7A 1XN4A 5C7YA 1UMKA 3VGPA 3UMRA 4K9NA 1UADA 4DDVA 3D3WB 1G5QA 1LI7A 2KE5A 3TBFA 2ROQA 1JX6A 3O1IC 2QG4A 4YB8A 2P4EA 1JLSA 3E8MA 3WNCA 4LOKA 3U6CA 1RFLA 4CDNA 1ZONA 2WJZB 4I08A 4ZT5A 2VVTA 5E6UA 3OH8A 4QEZA 4YO7A 4KVGA 4BLUA 3GRAA 2OCPA 4WY5A 3H97A 3FPSA 1D5WA 4RD1A 4X64M 4Q18A 4EY4A 1Z22A 1FFHA 3I5XA 5F35A 3DBRA 1H9BA 2HMUA 4I7EA 4KPGA 2XB2A 1XTKA 2CHFA 3RRZA 4QJ5A 2DM6A 2WTMA 3RC8A 2C31A 2EIXA 2WTEA 5EHZA 4DBLE 1C0LA 3LA8A 3OPYB 3U44B 2AOXA 3PKIA 2ZB3A 4UHFA 2VRNA 2DKNA 2ZDHA 1ZK3A 4V0QA 1EM8A 4EARA 1E69A 3VDQA 6REQB 2DTXA 2DFDA 2KS6A 5I6DA 4K26A 4OJKA 1EX1A 3PQCA 4FDTA 2E6KA 4I9HA 2RD2A 3FTNA 3IVRA 3IIEA 2V55B 3CEPB 3NQ41 4LX8A 4HX9A 4XSGA 2LDBA 4G4RA 2JY7A 2Q9CA 3MNFA 4KRFA 1KXJA 2LPMA 4HEQA 2FPUA 4JIGA 4M1WA 2QY6A 4Z7QB 3J7BA 5LIPA 4LGMA 3ZQKA 1FTQA 3C14C 1G17A 1U0JA 4GGPA 2CJPA 3DE3X 3B7PA 2FX2A 2PZFA 2QQ0A 2WZCA 4HEJA 4LC9A 4URWR 5DTQA 3K92A 1M0WA 5I4KA 1ONBA 2AXEA 3W2TA 2F5NA 1H2BA 2QNBA 2JLZA 1V8FA 3TB4A 5D8DA 1CWUA 3WY9A 3WRXC 2P2CA 4NH0A 4AJKA 1S7CA 2HL6A 4BFCA 1X80A 3GRCA 4P92A 4MQ6A 1B16A 4PR3A 3QX3A 4H6WA 1G59A 1X0XA 5KDOA 1Q11A 1Q20A 1C14A 3BRCA 2JGIA 3MUFA 2COUA 4A1FA 1IZYA 2BR5A 2J3IA 2QY9A 1S3GA 2D1SA 4C0WA 4D6YA 1E7WA 1U80A 1ICEA 3DEAA 2QTLA 1GT91 4XIJA 3RSZA 2FSIA 3KQNA 4BN5A 3A36A 2VDKB 1SC9A 3D2CA 1F2DA 4MWOA 1IHYA 3TZEA 2V4ZA 3RADC 4B73A 3ZNQA 2PFKA 5K3DA 3FVRA 3HSSA 3F1LA 3NP7A 3AP3A 1J0XO 1TK9A 3DTNA 3FNBA 3HU2A 1EX7A 1U28A 1QHGA 3BQMB 4NCAA 2ZS9A 2HWKA 3ORHA 1A5AB 3GHYA 2GN6A 2JNHA 2X0KA 2ERXA 2HHCA 1WEKA 1QRSA 4QBTA 2HU7A 1NBME 1RIIA 4KX5A 4R83A 5JAZA 3NHJA 4MUGA 3BK2A 1YULA 2MMGA 2W70A 1ES9A 2SICE 3IT1A 1XXLA 4CIBA 3H9JA 5EFOA 4OJYA 3DVSX 1A71A 3FZNA 4OFZA 1S2OA 3V3TA 4RORA 1B1AA 2AFRA 3TGPA 4EI8A 3HWRA 4TYWA 3SDSA 4CEJA 3ICCA 1N4AA 4H3SA 2ZCVA 2XYGA 4ADSG 4WKCA 3GA7A 5B64A 1UMDA 1YU6A 3ZWCA 1MA0A 4DDTA 4HQFA 4M9SA 4FHCA 1JHDA 1S8OA 4GOJA 1JU4A 1YI8A 1CXZA 1P2BA 5B3LA 4FE4A 5EIEA 2D3TA 4XGKA 3AKYA 1YZLA 3JZDA 3TDNA 1GZVA 1OU0A 2H2AA 5DO9A 4D8TA 4JT8A 3EFHA 1ZGZA 1N3LA 3I09A 1XA3A 3ENNA 1U5CA 4YLGA 1P0PA 1N1GA 1BQ4A 2R1VA 2BGKA 4P58A 3EARA 2PG3A 1IU9A 4A6DA 1OOEA 1FFXA 3U6OA 2F4VM 5KYUA 2AI1A 2YIVX 4UM5A 3BDAA 4YN3A 3HJTA 4X1KB 4DSOA 3HJGA 5DYIA 3BHIA 4RA9A 3A1TA 2FWAA 4F9GA 3OTGA 3VPFA 2CYAA 3MWLA 5EZSA 4E2WA 1RXYA 1NSYA 4INJA 1PQ4A 1QVWA 1YS6A 5JBQA 1RPNA 1NE7A 2X19A 5FWYA 4UARA 3CA8A 5CNKA 2AMFA 4LRUA 2DKFA 1PGQA 4KE9A 2ODWA 4ROSA 4Y1FA 1PLJA 2PRIA 2JW5A 2CDAA 4G0QA 3PIDA 5B6PA 2OSVA 1Q1EA 3MJHA 4OHMA 3Q3JB 3K1JA 2H51A 1GR1A 1RJWA 3FE2A 3M34A 4BMPB 4M8NE 4KXFB 3RRJA 1NBEA 1K27A 2O01F 3I2IA 2G17A 3A05A 4MKRA 5BOSA 4DUYM 5D3QA 4QHTA 4R84A 4MP3A 4YBZA 2IHYA 4OH7A 1IEVA 4OB8A 3UJPA 4ZHQA 3QU5A 3ENKA 3I9V6 1O58A 4UJ5A 2AR7A 3RU2A 4N0DA 2W5UA 4L08A 2BH2A 4L16A 3KHKA 2I2FA 4CM5A 4BV8A 4RJJA 4BNMA 4CQMA 4R05A 3QVTA 4INAA 2GNPA 2DUUA 2JIDA 1W49A 2UYYA 3FVVA 3SBEA 5JZMA 4Y2GA 3TX2A 1CHNA 3G2KA 4QUJA 5L40A 3IAEA 4HYYA 2DVMA 1HE4A 1X70A 1U2DA 3TR6A 4LF5B 2Y4NA 3AILA 3EGDB 2OMEA 1SCAA 3I1YA 1QGUA 4EG0A 2O7RA 4HTFB 3U1VA 5IAEA 1ULAA 2FZCA 3V2UA 3T12A 4LDPA 4N9QA 2RGBA 3H2SA 4UTVA 3ZI0A 1L4KA 4JYMA 1PZXA 1A4IA 2ZGVA 4Q66C 3J7AC 3GLKA 1Y33E 3C3WA 1RM3A 1IK6A 4ZHQF 3Q7EA 1UBEA 5F3DA 5HZHA 1LRKA 3DFMA 5LIRA 2UXDB 1UJBA 1CUVA 1CUEA 1QQWA 3KSAC 4GBJA 3D5QA 5CDGA 3TWKA 4XPIA 2W11A 5HZMA 4C4RA 4G1VA 3HO8A 3VO2A 4Q3NA 4X3PA 1W85B 1G71A 5BV7A 2BF7A 3K6SA 1R15A 1A5TA 2VH1A 2XV1A 1Z4QA 1W88B 3DCJA 4F9EA 3O3NB 4AROA 2PLWA 4NZYA 4JLBA 5T8KC 3SPXA 3OZXA 4KQCA 4KW7A 3MJTA 1MA3A 4I9UA 5D1NA 4ZK6A 2C9CA 2XRZA 3QUCA 3HR7A 2FHSA 3QLVA 4G9GA 4HVAA 5IAAA 4MUNA 5JWRA 3U26A 5CYFA 3BOSA 1VFNA 1H2EA 4IV8A 4AQDA 1DCFA 4HRAA 2P7IA 5DGCA 3U6DA 2XNDD 1SM4A 4IXNA 7AT1A 3EVAA 3LX5A 3OECA 4PFQA 3ROEA 1GPLA 1AVTA 3AHFA 5TQJA 1TFUA 4OM7A 4B6OA 1ZNXA 3IV9A 4U5XA 1X15A 4GOXA 4DNFA 2QRMA 3LT5A 4W99A 3ON5A 4G26A 3T5PA 5I9TA 1G19A 2F3RA 3WL8A 1X8XA 3DZKA 3VU1A 4HLQA 4O4JF 3C5EA 1YFLA 3RKSA 4HH3C 2R00A 2QPAA 4A6XA 3PVZA 4ALKA 1KRWA 1E4EA 3OZ7A 5IT9A 2FU5C 3SHGB 1P7VA 3QUSA 2I66A 4CODB 4I5IA 1CULC 4D8XA 3GBSA 2I1LA 4AMUA 3VI3B 1GG2A 1PU2A 1U99A 3KO8A 4O1HA 3P32A 1N5KA 5K6AA 3CR3C 1C7RA 2YHAA 1VBKA 2WG2A 3TW8B 3IOYA 5J23A 1VKJA 1XLUA 2ZE6A 3CCBA 4D82A 4LNUA 1LSOA 1NLUA 2ISQA 3D8LA 1Y9JA 4KAXA 3NLLA 5EIBC 1PLKA 4GXNA 1L4UA 4M37A 1JIXA 4IP0A 3P4YA 3SZRA 3ZLBA 3W9YA 4HFMA 4DZZA 4X71A 5LNK1 3GCZA 1J06A 4U02A 1XMIA 1ZMWA 2BBOA 3N0TA 4GWKA 4Q3EA 4HX2A 2OT3B 1COZA 2I2AA 4WKGA 2MJ5B 4YJ2B 5FA5A 1H6BA 2E5WA 4EY6A 2MYNA 1K68A 2DHDA 2SKDA 3CUUA 4NXMM 4FMPA 2JGKA 4FEEA 3HA5A 3CPSA 2CLCX 4Q34A 5GVSA 3LQRA 3RBZA 1E2KA 3PPIA 4GE0A 5JNTA 3DDWA 2L17A 4QO7A 1ELOA 4CCAA 1F3LA 4ZAFA 3O83A 2VP6A 2YUTA 3A9CA 2AH5A 3FWNA 2MINB 5K3CA 2NG1A 1PYGA 2PSFA 2Q1SA 3FPBA 2HHHB 4JBGA 2O8EA 1X7YB 5MFPA 3D6JA 3AVVA 1SRQA 2OXFA 5D1HA 2I2XB 4JODA 4QPCA 2MCFA 1SCNE 3MTGA 3IOMA 1J5EB 4EG8A 2I9KA 1O0SA 3DW1X 2V7QA 4ZCLA 4TZTA 4Q0MA 4E08A 1WHTB 1EESA 2REQA 1UJ2A 2GZSA 3S5JA 1YV9A 2H2HA 4NBSA 4WZBE 1FL9A 3QBDA 3RHZA 4NBNA 4DC9A 3TMAA 2NU6A 3DMHA 3FHLA 4UMFA 2X41A 1D1SA 3ZV5A 2Y4OA 1YJAA 1E1DA 5EWLA 5CR9A 4YQZA 2OXRA 4JYPA 3PQ3A 5F23A 3KQLA 2JDID 3KRTA 4IZIA 2ZIEA 1NJFA 1XL0A 3E5RA 4L4SA 4FDAA 4IZ6A 4U6SA 3DAGA 4JDPA 2C7GA 2J7PD 4FXPA 1NPDA 4IFTA 3TFOA 3Q7TA 4E2XA 1AO0A 4XQCA 4CEHA 3L49A 3AFHA 2DETA 4EKYA 1LBQA 5CDFA 4E5DA 1LF0A 3URMA 5A3VA 4B45A 1V96A 3IMFA 2PANA 4YCLA 1MNAA 2XE4A 4CV3A 1T4DA 2WWXA 2WWGA 2YCLA 2OV4A 3LT0A 2ZTVA 3NHKA 1E3MA 1DMRA 4PYLA 4UFPA 3EVNA 1HYEA 4WP2A 1ND5A 4E09A 3ZPXA 2HAEA 3M82A 3B6IA 2JAUA 1CJMA 3TI7A 1SZDA 2ZJ0A 1ZGAA 3HV0A 2WFMA 2QRVB 5T41A 4ZICA 3U31A 2W6IA 3ANXA 1MG5A 3FROA 3AP1A 3BQNB 3NJ8A 2B8TA 1I2AA 4FZJA 3GLUA 1G3RA 3SS7X 2WJHA 1YB1A 4DQKA 1CQPA 4PO8A 2UZ1B 2HRCA 1L4BA 3D6FA 5HZKA 4AKEA 4ACAA 4LF8M 1JFTA 3AO0B 2I67A 3DO8A 3OQMA 3W1WA 1Q0RA 2A9PA 1J8VA 3D8UA 5HK8A 2XZFA 2QMOA 1H93A 2GN1A 1OTYA 2FPGB 4LYGA 1TA9A 2O0JA 5G0SA 2G83A 2C2KA 4FNMA 3RSSA 2GD0A 5E6SA 1GABA 4NS4A 4CG3A 3HADA 3CNHA 1CIPA 3C7CB 1CR2A 4IVNA 3LKDA 2I7XA 1PWHA 1OV6A 4TROA 1HFWA 1VTKA 2FMFA 2O7VA 5CB4A 3AEYA 4MOWA 4CIAA 5HDBB 1RXIA 4KWCA 4RV4A 1T35A 3RK0A 3HGQA 1MBZA 1SZJG 2YXLA 3C45A 4HDRA 2CFIA 2EGUA 4RXUA 1ZMBA 1VPWA 2R5WA 3SLGA 3JD0A 2OHXA 1ZM9A 1EUDA 4HAYA 4IUYA 2Q1UA 4DJJA 3L6UA 2BKEA 4TMYA 2GKOA 1I2ZA 2Q6OA 2R4TA 4KIWA 5DV9A 4RKYA 4HGRA 2Q3CA 3C5HA 3GHHA 1XDUA 1REQA 4YACA 4KI7A 2TS1A 4DIBA 3HC7A 1W30A 2ZAYA 4NIMA 1D1QA 3ZDCA 4QUKA 2JJ1A 5TVGA 3FOCA 1Z6YA 2IVFA 1QOPB 2AEJA 1UEIA 3HFJA 1A7UA 1CB7A 2J0QA 3WMFA 2BW0A 2W98A 2FOXA 3GFGA 3AI1A 4AJ1A 4MARA 3E9RA 3T54A 2IYOA 3L0CA 1EE9A 3T8YA 3AR7A 5TMEA 3AY0A 4GLJA 1Z28A 3ICEA 1XDDA 3X1DA 1S5PA 3WOVA 1IQUA 4FFSA 3FYCA 2XNCA 4ZGGA 3JD4A 3PRYA 4QEKA 1LDNA 4FFLA 2VDWB 2W2MA 4JGIA 2QTBA 4LY6A 3V8NA 4PR0A 1ZCBA 1YVUA 2XGJA 2DT8A 1WMEA 1J0EA 4PYMA 3D7NA 1BXGB 4P32A 2Z7JA 3JQ7B 1I14A 3U6MA 2FWNA 3CRVA 3U2QA 2JFOA 2V54A 2VQFB 1H8HD 3WRYA 4JB2A 2G40A 3L8HA 4O2BA 2M98A 1ISHA 4YYZA 4XM2A 3GRVA 2V5UA 2BHTA 3I2JA 2UU9M 3OESA 3AGPA 2N0SA 2YJ3A 4L6AA 3OE7D 4LWPA 5I4BA 2AR0A 5CXXA 5ADHA 3ZD8A 2TMDA 2IYVA 1E7SA 4H0FA 3IR5A 2IC5A 3I9OA 2UVPA 2ZI6A 1AKNA 1URPA 4QVIA 4N48A 3GNTA 2HREA 1QFSA 3GGDA 1F6DA 5BSUA 1I13A 4KQHA 3ZVLA 2EFYA 1SQ0A 2O2IA 5JUWA 4P3NA 3DTYA 5GONF 3PF8A 13PKA 4LGYA 1TIKA 2BEUA 3W2FA 4XA8A 1U28C 4BLTA 1RJ9B 2J5RA 4PZ0A 4QRIA 3HVKA 5HJ5A 4L73A 1XBTA 4HGNA 5FL7A 3CLTD 1ZK2A 2B5VA 3AERB 1U2TA 3AFOA 4F96A 5A9SB 1MOZA 1O6BA 4XSVA 2O3RA 1L5WA 4IIYA 1E18A 1R7RA 2OV1A 4IMRA 2HSJA 1JBKA 4UDYX 5CA0A 3Q3HA 4OYHA 2ID8A 3HMKA 4S04A 1JQ3A 2IV3A 1TZJA 3LDFA 5FBKA 4ZO9A 3ZNPA 5KO2A 2ZRMA 5BOVA 1HBJA 4OMFG 3IJ5A 3G9UA 5ECDA 3COYA 4PQGA 1MX9A 1RBQA 3NORA 2QLBA 1O6ZA 1AOXA 1Z6GA 2IEZA 5TS2A 4DLZA 1DIAA 1EVEA 4B7AA 4C05A 1Q7EA 1FFAA 3GN1A 2YZ2A 4IUDS 3TD9A 3RK1A 1PT6A 1CYEA 2CEKA 2NM0A 3AIKA 2WD8A 2XEDA 1SQGA 4H27A 3R77A 3QE0A 3HL4A 4D4JA 1K6XA 2VS1A 4KR6A 3LQYA 2WPDA 5DM0A 1L4LA 3LX6A 3CLSD 4RNAA 1YTUA 1DKLA 5CD1A 2OYRA 1Y1KE 1J2TA 5ETJA 2HMVA 4AO8A 3VVBA 4R1OA 3LX4A 2HGZA 4ZO6A 1USIA 2GZ3A 5CA0F 4ZI2A 1DU4A 2OBBA 5EOVA 3A0RB 4QJBA 3HZHA 3N2KA 5KQLA 3T41A 5F64A 1QXSA 3AF1A 3BJMA 3IRVA 3FRIA 2V3WA 3AFNA 4MQMA 2UKDA 3DYIA 1JBEA 2QJFA 1ZHFA 3GFQA 2A9VA 3BXPA 3WQHA 3BA6A 2C61A 4O0LA 4EHLA 3I37X 5F4ZA 3HFGA 3K6KA 1AKUA 2BPOA 4JQOA 1LNZA 1XGKA 2R3SA 4I3HA 1PI3A 5GVRA 2HADA 5HVNA 1Q44A 2P9QA 3L1UA 5JRZA 1QOQB 1C3EA 3BWCA 1PS9A 3FW1A 5AOCA 1UOPA 1RI5A 1NRJB 3ZWQA 4YUXA 2FF7A 5T57A 2WQ6A 1ADBA 4O4IA 4L4UA 3H7IA 4RK4A 4JI4B 2C1EA 5DNDA 4D9MA 1HX7A 4B17A 1DJOA 1IG0A 1RC0A 4C3ZA 1QPBA 3R7WB 3HU5A 2AV6A 4QGAA 1RI2A 3G0CA 3OFSA 5F33A 1P74A 1WQ3A 5F3WB 2LV8A 3WJ2A 1Z2OX 2WWIA 5U1PA 5TR9A 1TT7A 7GPBA 5FEUA 4XE5A 1SKYE 1NRIA 3EW9A 1UOQA 5E2IA 3HXTA 4ER0A 5K05A 1U2DC 2WDZA 1RBMA 5LQSA 4LJLA 1Z8HA 1UXOA 4BFVA 3O0TA 5KYWB 4O0MA 1NVMA 1XMOM 3EDMA 1G6HA 4BX8A 4XYGA 5AK0A 2GEJA 4G81A 2W2LD 5CVDA 1KE1A 3CLVA 2WSSA 2VDQB 1IVNA 1U0HC 1UBKS 1SQ6A 3LF2A 3PZRA 4QD3A 3AIOA 3JQFA 1P1FA 3AW9A 5H1YA 1RWBA 3ZHUA 3E3MA 7ABPA 3MBOA 1N5LA 1US8A 1TEHA 5I9LA 1AHHA 3PQFA 4F1WA 1HEUA 1PFYA 2ZE7A 5CM2Z 1NI4B 1RWKA 2AZDA 1E6UA 1F9EA 2R8ZA 1NXOA 1A9TA 2PUAA 1YQUA 3MZ0A 4JLSA 1V16A 5DZSA 3LQKA 1WDTA 2I2CA 3ETGA 3NC1C 4BTLA 1KDPA 4AS1A 1L1QA 4BKMA 2EQAA 3WX0A 4PT5A 3BGVA 1JMYA 1ZNYA 4K86A 4L7VA 4OQYA 1KI9A 3JY6A 3PD7A 2O48X 3VQTA 2B6HA 1M66A 1HEYA 3ZYCA 4G5FA 1C1XB 2HNAA 2R1TA 1U3WA 2I80A 1ISMA 3A1FA 1ZC4A 1NMXA 2ASVA 4OVZB 3ROPA 4RQUA 1UPCA 3VR4A 3PLAE 3DL7A 3KK0A 1YKSA 2PZMA 3V1TC 3BXWA 3W0LB 3EXG2 4BEWA 2QTCA 4F45A 4CGZA 1YB4A 4PZLA 4AS3A 4IO1A 1FVXA 1UXJA 4OI1A 5IDYA 4CG1A 2HU2A 1WA5A 4Z4HA 2R00C 3NVDA 1IM5A 2R97A 3IP3A 4I50B 2XITA 2N46A 2Z3ZA 3WYBA 4F2LA 2DJIA 1EP3B 2G06A 3LKVA 5HF8A 3TLJA 3PFIA 4B6FA 1C1KA 3ZHTA 2Q6TA 4BASA 4WBNF 4MB6A 5F2OA 3OEYA 3RM3A 5I7AA 1JAIA 1XIVA 1HNWM 3PRJA 5K6AC 3I61A 3SBXA 3KJXA 4UBIA 2VAWA 4MKHA 2YASA 2KI5A 4L4RA 2GN9A 1LD3A 5JI2E 3CZPA 3O8RA 2H9AA 3P52A 1X8LA 4M7WA 5IBPA 3UO8B 4W5RA 4KGVA 5C37A 4LDJA 1AKMA 4CZ2A 3B1VA 5J2TF 4P33A 1WZNA 1F7VA 4Q3LA 4M0MA 1GNPA 2E0IA 2O8FB 3C3PA 2QBYA 1GA6A 2RAFA 3GUZA 1V6SA 1FJGM 2FPSA 3ZHBA 1VFPA 4Z9YA 2IZ5A 3T7EA 2AQHA 3QU7A 1N2XA 1PTKA 3PLRA 1W19A 3IIMA 4HDNA 1F2UB 3PP8A 3M6IA 4RGQA 3S0JA 1Q84A 1YE5A 4FCTA 3CJTA 4R31A 4P0TA 3W05A 3DEHA 3CF4G 4TTPA 2QLNA 4Q9JA 2DZOB 5AK3A 3V6MA 2RC5A 3AJEA 4XFJA 1II0A 2W6NA 1F20A 1WXFA 1PZFA 1OH6A 4UEJA 1M8PA 2FJUA 1LQTA 3VC7A 3TLGB 5IT9S 4CIWA 3QKUA 5GP1A 5AQEA 3H2JA 3WDMA 1N1DA 3WLIA 1CUSA 4FGLA 1WDMA 1JEDA 1G8MA 5CVCA 4EK9A 2EXXA 4AD8A 3TXYA 2GWHA 2XWQA 1A2QA 1LC0A 1UBCA 3L6CA 3H5TA 1FJ2A 1ZUD1 4PCAA 3REGA 4UATA 3P0RA 4YMSA 1I6LA 4M9XA 3OMXA 1MOPA 3T38A 5CDYA 1YS4A 5BQ5A 1P4JA 4HNTA 1U4OA 3OIFA 5A4DA 3N58A 1M74A 1W75A 2BFAA 2AHMA 3R0VA 4Z5XA 5C34B 2V98A 1DUVG 4IQ0A 2I4MA 4FLEA 4IJWA 2VQEB 5DLEA 5CITA 1FU4A 1QTQA 3O73A 4MV7A 2VEDA 1HKUA 1NJ6A 1CRPA 4GKBA 2P0YA 5AK5A 4FDUA 3K8QA 1PEKE 3CPEA 5A4IS 5K0ZA 4BO4A 4B74A 3U60B 1L4NA 3UV3A 2WBLC 1VSBA 3D0RA 3CWCA 4FN4A 3C1OA 3AVOA 2QHXA 3ESZA 4PY2A 2Z9DA 5KWVA 3K8OE 2EHJA 3IVCA 1FW6A 4NK5A 1KZ1A 4DF3A 2XW6A 5BUZA 3EMDA 5F2KA 5D00A 2QN9A 1JKFA 2OLJA 1VMEA 4M46A 4DJDC 3WTCA 4F5EA 3L28A 2AG1A 3BB3A 1XTTA 3LIPA 1KERA 2PX2A 3GWZA 1CJTC 1WUTA 1ILWA 2ZSFA 4GNKA 5KVSA 1ULTA 1Z0AA 4BQQA 4IQFA 3P9CA 2PHZA 4TTSA 3AHGA 4IRUB 1TT5A 3NRCA 2G72A 4LYFA 2O1XA 4D56A 2WUDA 1RI3A 3IEUA 1LA2A 3ELWA 3N3BC 2YOFA 2ZRAA 1TLTA 2XHZA 3TUJC 3T1YM 5HF9A 4B31A 1NQAO 1S6YA 2IYPA 2DRIA 4CCYB 1Z83A 1TK2A 1QWSA 4TOIA 3F96A 1U1FA 3P9QA 1JH9A 3RUCA 2C5AA 4GZMA 2GAOA 3P8ZA 4RPCA 5K0FA 1XYVA 2GVDC 1E96A 3ELUA 4YJ3B 2C20A 4PX3A 3W4IA 3FVQA 3IODA 3WDLA 4MUJA 1UP7A 5DYWA 1SB8A 2H16A 1E32A 4ERNA 3IBTA 5KEIA 1P9RA 1RAGA 1IJFA 2FPPB 4DUPA 5TS3A 3LUAA 3EE6A 5CB6A 2E4WA 3VNQA 1G8SA 5TB5A 3ZVKA 2LXNA 4L8RC 1OIWA 4AMBA 4YALA 2WYWA 4EAQA 3SICE 4MUIA 4BJ1A 3DJFA 1NT2A 3NHFA 1EIZA 1R18A 3AOGA 1O0BA 1T9BA 4LOLA 1C3LA 1NUTA 3HB5X 1GL6A 3WGUA 1GJRA 1JAHA 5AVOA 1JEEA 1KEUA 4PRZA 1KZ4A 3T1VA 2B8WA 3H84A 3GK3A 4R1TA 5IVIA 4FDMA 3RU9A 2H5IA 5LQAA 2BEVA 1A8SA 3K6JA 2Y27A 4LWOA 3JQ9A 1DOAA 3GEIA 1W4RA 4A5OA 4D3SA 4JROA 4Q1EA 3ZC7B 5HCNA 2ZQYA 2C0CA 2C4WA 1P31A 3DA8A 1CUCA 1DUSA 3O2NA 1VMIA 4RVDA 2NU8A 4BMDA 2A5LA 4NBKA 4NRWA 2EEPA 3UPDA 2AB0A 4CIVA 4GLLA 4KLCA 2MSKA 2FDRA 1CX9B 2F3PA 2FPWA 4BV3A 1WHSB 2NXCA 1M2JA 2IW3A 4FZRA 3GJ3A 3STYA 1SVOA 1CFJA 3A6EA 3A4TA 4JFRA 1KXZA 4X44A 4XEHA 3R1IA 4D9NA 4BVEA 5EJIA 1XZGA 1YE3A 3R75A 3H4TA 5A7HA 5I9IA 4NK4A 1R6DA 3RUHA 1CPYA 5E7IA 2LCQA 1R6TA 4GI7A 3UXYA 3DE0X 2B82A 3WRYC 5K0TA 1GPUA 1W1IA 1CRWG 4OKIA 3E9QA 2YYAA 1Z16A 5CAEA 2WG0A 5EA2A 3H5LA 3VTAA 5JASA 3MGGA 1T26A 4JU8A 2XA9A 1ZXLA 3LZ6A 3CUTA 2GCOA 3VDRA 5DE3A 4DM7A 2VCEA 1P0FA 3PCTA 2ZVJA 3QYFA 5FYDA 4XW2A 4OGFA 1PEDA 4I5SA 1P80A 2HK8A 3Q7PA 4W5HA 4WADA 2YC4C 2KZSA 2ZRIA 2VHVA 1GDTA 3HNRA 5KNDD 2WIKA 4BNZA 1RRPA 3RYHB 2H92A 2C8LA 2H4FA 3L06A 4OUDB 1U7WA 4IIDA 2O54A 2CFOA 3BERA 3HFRA 1Z6TA 5FUXA 3R3ZA 4XUCA 3GV0A 1KYZA 3QU9A 1E2PA 1U0RA 5A2QS 1N6IA 2J3MA 4YRAA 1VL2A 4OREX 2N42A 3IERA 1JECA 3BMOA 2OBXA 4MHTA 2JVJA 4BS9A 2A88A 4MYUA 4A26A 3UB2A 3LYHA 4Q7JA 4F21A 1PYOA 3R76A 2DC1A 1L8AA 2WU1A 5BVHB 1P6UA 1RHRA 1C1DA 1TEVA 1X9IA 1SXJA 5K2MA 4OM8A 5T5QA 1EXWA 3ZU2A 3OIDA 4OB6A 5JC1A 1OLXB 1JIKA 5AW6A 2WWYA 4WZAA 4IJEA 4FGSA 2XQJA 3IAAA 4D9IA 2GAAA 1DDGA 2C99A 3FPHA 3CBGA 4XQ9A 3G2QA 4TVSA 4MS1A 1N33M 2QYOA 5GTDA 2YHUA 4G8BA 3KEGA 2AYZA 5DBEX 4QBHA 3HO1A 3GQ3A 4B2YA 4QFBA 4QTUB 2GZ1A 2QKYA 4LN1A 4BLSA 1A7AA 1KPGA 4Y7DA 2EHDA 2GDZA 4NJOA 1IBSA 4D8UA 2WA1A 3I52A 3LI2A 2Q29A 3ILSA 4B3DA 4BNHA 3VMMA 1PR0A 1FB5A 2UYQA 1KIMA 3R5JA 2WSEF 3GL9A 4H3HB 4ZT6A 2VT2A 5K0EA 4DWJA 2XZLA 2ON6A 4E12A 4HJXA 4CM1A 4M38A 1PR5A 3VKUA 1KEEB 4MQFB 4I8OA 2PIDA 5LA6B 3UATA 3LM8A 1UC5B 3IUMA 1MQAA 1T8UA 3AF3A 3DP7A 1OZFA 5IHXA 4NJEB 2OORA 1XVIA 4G0NA 2YXDA 4NWIA 1DJQA 1P0MA 3RHTA 1H1DA 3KUCA 2NMVA 3JQAB 5JXIA 2HPAA 3FSGD 5JSHA 4GW3A 2B4AA 3GQBA 4ZYZA 4A2PA 3W67A 1OKKD 2NNWB 1WSAA 3MOIA 3HL0A 4DDMA 2JIBA 4F93B 2QAJA 3EQ2A 4LJYA 1E1CB 3OIGA 4INOA 5FYQA 1HQCA 2G9ZA 2MOKA 4XJVA 1JG4A 4ESEA 1ZOPA 4ZJZA 3EEBA 1QF6A 3I8SA 3GW8A 5DGHA 2IHBA 4E5SA 3GMIA 3U3XA 4UDNA 4CN8A 3OU2A 4JL5A 2AOVA 1FS4A 4MDHA 4R2KA 2X23A 1YVEI 5DBHX 3CF6R 3WLTA 5C5IA 4RTLA 5FXMA 4KU4A 3QJ5A 1WTCA 1Z2AA 1EFKA 1QRUA 4Z0PA 2NPFA 1C8BA 4N8EA 4GDFA 1AA6A 3B6MA 4X66B 3OCWA 1WW3A 3ADDA 4Q12A 4U3JB 3F4BA 3E27A 5LDGA 1TH3A 3VC2A 1PFUA 4ZFNA 5IXYA 1V1JA 1A8HA 4DV2M 1ZUHA 3HM2A 2V0CA 4C4PA 4PG4A 5KPZA 1K6JA 1F0KA 3EFOA 4DLPA 3UQYS 1VM6A 3GQ5A 3ZI4A 1Y9EA 3GZNB 1QQ5A 4QVKA 1CUGA 4C3UA 5HMMA 3PDJA 3AUXA 5JHGB 4MLCA 4OH1A 5JZ9A 4QPDA 4N41A 1NMZA 2M9MA 2F9LA 3P4UA 4U2EA 1RAEA 3RFUA 4MYHA 1WEHA 2PFSA 2FEAA 3JQFC 5FI5A 3B3GA 1U2QA 4HD8A 1P2VA 3N2YA 2IEAA 1K9SA 3N6RA 2DPGA 5FLEX 3ITNA 4COOA 1VDLA 5GZ6A 5AM0A 1KKMA 4U8HA 2ZUVA 3SZMA 2BFBA 3V00A 3YASA 5B12A 5D7BA 4URYR 1N2CA 2JAPA 2Z0MA 2EFEB 3FDIA 2B94A 2CZCA 3G17A 4K8OA 4Z3KA 1HF3A 2P4SA 4I1RA 1RKQA 5KCZA 5FAXA 2GD2A 1X38A 1X1CA 1YZNA 1U1DA 3DHNA 1UUFA 4WCFB 3GNSA 2J0UB 3L1HA 1RXSA 1XG5A 1Z4IA 3V76A 5MFZA 1NL3A 5JFTA 4MGZE 4P0PB 2BUBA 1DLJA 4C29A 3AC0A 2OYSA 3G2LA 2X4DA 3SE0A 4PCLA 1T3TA 5G1NA 4LA4A 4MAAA 1PJQA 2DWCA 3GLRA 4JWTA 1TCAA 1VHWA 1U5BA 1KFEB 1RIFA 4CM8B 2Q2NA 2AF4C 1Q0HA 1ADFA 2JXNA 1ZVJA 3VPAA 4EUNA 2X49A 3VC1A 3V9PA 2B8JA 2WWVD 3K9NA 3D6NB 1WCIB 5EZYA 3PC7A 3CNQS 1OIXA 4AP5A 3CW8X 4YUZA 4ARBA 3T95A 3Q8KA 5I01A 3NR2A 4OGLA 4D25A 1KQGA 3NV7A 1DEAA 3IX7A 5K4AA 2FQ1A 2QDKA 4QT4A 4J0DA 1OIPA 3KSRA 5F51A 3F46A 1JWLA 4JC8A 1CIJA 1D2CA 1U8AA 1GHTA 3GZ4A 4DUZB 1N3BA 3KXKA 1RKXA 1ODIA 5BR8B 3W5BA 1JJ7A 3N28A 4X1OA 2CBGA 3EG5A 2RCNA 1NSTA 5B53A 4ZCQA 3VR6D 3KAJA 3KLBA 4OATA 1A4RA 5K8JB 5ICFA 2HLDD 1JT9A 2ODEA 2ZRHA 1LDYA 3W0FA 4U9IS 5JQGB 1P3QQ 3DO5A 1Z5UA 1ZMOA 1NNUA 3N0RA 3GEEA 3N8NA 2FE4A 1M67A 4E2FA 4F6LA 1NHWA 2HRQA 5FIUA 2AI2A 3P5SA 3NANA 3N75A 1JLKA 4XTRA 1E1RD 4ZU6X 3F7TA 4E6PA 1Y6RA 2P11A 2QGZA 1Y3BE 3IBYA 3SY8A 3P94A 2YZNA 4OHXA 4B85A 2F8LA 1XROA 3EF3A 1G8AA 4A92A 1U90A 4G1EB 2Q62A 2XZUA 2VYVD 4TQGA 1K5DA 4P4GA 4BNXA 3CM0A 1SCQA 4GZ3A 4P22A 3G8AA 4E4RA 1YASA 2IYSA 5HUJA 3D0KA 2ST1A 3I2FA 5E6RA 4P7KA 2Z58A 4N7MA 1XHBA 3GCXA 3F5QA 2NXJA 3ZYZA 3FG9A 5HYVA 5J4YA 1PZGA 3MPOA 5JNVA 4Z6YA 3ZY3A 3E7XA 2E1RA 4DXDA 2ACEA 5EGSA 2UUBM 3H5OA 1U7XA 4YR7A 3OURA 1M9NA 2OB1A 4Y2RA 3VFDA 1L9KA 4ZYLA 1TFRA 2DECA 4EA9A 2MSNA 1MQ9A 1UP6A 4G86A 5BSRA 1Q83A 2X8JB 2APLA 1Z6ZA 2WZJA 1N57A 2WUGA 1LEHA 1G38A 4BFSA 4XGIA 3P9SA 2UUAM 1H94A 3ZGLA 4ZDWA 1DPGA 3MINA 4W1PA 3KS4A 3RJ9A 3HUDA 1N5JA 3JAWB 3J7AS 1DQRA 1QQ6A 1NNJA 3PX3A 3KJZA 3M7IA 2XUZA 4UPEA 1ZMXA 2VLIA 1XZCA 4L2IA 5B1YA 3D8HA 4YDRA 4J6EA 4WGFA 3STXA 1P3DA 4FHZA 3DQPA 4YCMA 2B1JA 1Y7IA 2XGMA 4G09A 1NP3A 2FWMX 2JS7A 3Q5EA 4G8JA 1AE1A 4LEIA 4BEVA 3GFOA 4MKZA 1OIZA 4PLFA 4QULA 3TQOA 2IZZA 5I8WA 4EAAA 3KAPA 5AKEA 1N32M 4D0GA 2G3QA 3OD1A 4WXEA 2EDCA 3U4IA 1QUTA 4F5ZA 4RTSA 1XKTA 2MIIA 3IS3A 4UPDA 4XB1A 3KUDA 3ZC3A 1W47A 1E1QD 1QZMA 1TMYA 2JG3A 3DVAA 1GRCA 2ZT8A 4K6MA 4LVCA 2W4IA 3PDWA 1MVOA 2AT1A 3H5WA 4BVHA 1T5SA 4XB6B 4DV5M 3LUDA 3RB8A 3PFFA 2XTNA 4PIMA 2H85A 2H1IA 2CXXA 3C7TA 1ISIA 2PXXA 2JD0A 4NBUA 1MUUA 2ZETA 3ZU5A 4J0GA 4LRXA 5A4AA 1VI2A 1CJSA 3HXQA 1G8GA 5C5EA 3KVWA 2PUFA 3AG6A 1LZKA 1FYXA 5K4HA 4CMAA 4B0PA 3KT0A 2XNHA 3S29A 4M76B 3EF1A 5J4LA 4RACA 3GOHA 3L40A 1Z88A 4EMBA 3NAQA 3QPDA 1ISRA 4NOOB 3UZUA 4U7JA 2H17A 1B7GO 2BDEA 3AF2A 3OZSA 1RYEA 1KI8A 4B79A 2WJAA 4KO8A 3FFXA 4EL0A 3FAZA 1GT6A 5INTA 3U6KA 3EIHA 4GP6A 4MUAA 2KNAA 9ATCA 1J0BA 1I7NA 3DT8A 3H6HA 3L7OA 3MGBA 2VJOA 2ZRDA 3P4XA 2JCVA 3GG9A 2WSFF 1L8XA 1JJBA 3NPAA 4N5LA 4GG1A 1IBLB 5H82A 1XNQM 1POWA 2VDMB 4GKKM 3GYGA 3V2IA 3KP0E 2B78A 4RKEA 4TKZA 2QQFA 3E61A 4LWZA 1TJYA 3TG8A 4ARIA 4W5WA 1T0IA 4FX5A 2PV0A 4LJ7A 3QF4A 3BMQB 1LLQA 1SHZA 2JLWA 2RH4A 2OUKA 2AGVA 1CDEA 3EUEA 4JYAM 2QUKA 1PJAA 1Q7GA 2CMFA 3K9FC 3IQZA 4M2LA 1MFPA 4FWGA 5PGMA 4CL3A 5FPSA 1WR1B 1V7CA 2YV3A 4ZQEA 4KWTA 4BNWA 3G8DA 4Q37A 3QMVA 4Y3UA 4PZEA 3IMKA 3HUEA 2BDUA 5FNVB 1JA9A 1NVVR 2IHNA 1KAHA 3QE3A 4EHAA 1W8DA 4IBJA 2WV9A 1YZVA 5F4BA 3U6EA 2D4AA 3JQ9C 4MRMA 4N3BA 4JEIA 1S89A 3AH8A 3PFGA 3T7DA 1RQXA 4QFCA 4EBBA 5D51S 1DBQA 3TQIA 1PWZA 3A27A 4GX5A 3FGZA 4XPZA 3SE7A 4CTNA 4AJLA 2Q2EB 3KSJA 1VSVA 4YPVA 5J5VA 5I7UA 4TVOA 3IKVA 3THXA 3S1LA 3NTOA 4Q19A 4ARCA 2C57A 2CV0A 3LT4A 3B7NA 4C89A 4Y1RB 1IY2A 3DDUA 2OGSA 4WLOA 2C7PA 2IV7A 5CH8A 1Z63A 4XARA 1HMPA 4CPDA 1V5GA 2HF9A 3TJZA 1DIGA 4Q82A 5BN3A 4M9UA 1IY8A 3P0HA 2OV2A 2V6IA 4M8KA 2MR5A 4MQEA 5JOQA 2XCSB 2VFAA 2DT5A 1WCXA 2Z8ZA 4H4CA 5AHKA 5BNZA 2M32A 3TRJA 2WF8A 2IDMA 2AOTB 4EELA 3UVEA 1AV6A 2BGUA 1U6JA 5EIBD 3U4QB 2V74B 1HNXB 3OFVA 2VR1A 4LDNA 2JLRA 2I55A 1NVEA 2DUJA 3ECCA 3PTLA 1EBFA 3DUWA 2AX4A 2V9ZA 3ZZMA 4WJZA 4J43A 4MV0A 3QPWA 2QL6A 1YIOA 1DTWB 1EZZA 3WB0A 1VKHA 1YNOA 1HA3A 1HYHA 1U1EA 4NBTA 4UTXA 3T5AA 5D85A 1GFIA 3WKAA 1TQHA 3VR0A 1QFXA 4HJRA 2Q46A 5I9SA 1UJ5A 4I6EA 3ZY5A 1Q5PA 2OG1A 3BRSA 4RK1A 4N6NA 3SC2A 3L05A 2WFLA 1X7GA 4QPJC 4E31A 4EA6A 1XCLA 2I5PO 3TW6A 3GNLA 4OBEA 4IDQA 5DGTA 4EVIA 3P20A 3OBBA 4RLQA 1QKIA 4G4SP 4B7GA 3E9MA 4DDHA 2XHEA 2YMLA 2C92A 2VRBA 3BC1A 2Z04A 4PNHA 4HNAA 2C00A 1O5OA 1XK7A 1M75A 3WAKA 4ETNA 2K6BA 4WCDA 5L3SA 4CF7A 2XB6A 5EUCA 3I8XA 1SCIA 2PKEA 2O2YA 2GCNA 5JSYA 4Q9LA 3IIJA 5KAMA 1JHAA 2BCEA 1IH8A 2J32A 1D7AA 5CB4F 3NHMA 1SR8A 3HKBB 2BUCA 3EODA 4TTAA 3UHOA 5SICE 2QA5A 1NHGA 4KRXA 1JR6A 3TTWA 3ZDEA 2H1RA 3HK2A 4B1FA 1MVNA 2BFPA 3EPJA 2FVXA 2HD4A 3EVGA 4R4JA 2QDXA 2X0DA 4AZVA 1FSZA 4BZWA 1EB9A 1VMKA 2KYRA 5J1TB 4WDRA 3KOYA 4KJXA 4BTEA 1XMSA 4KUHA 2FEOA 3I9MA 5ILOA 4N0QA 4DMRA 5CT4A 3VC3A 2OENG 1PEYA 4DLXA 2BISA 2VPPA 4JP8A 2KXEA 3FPEA 3P9XA 2VP4A 1IJBA 2O8CA 5KU7A 2LKCA 4W6ZA 4DVGA 5AIAA 4R8VA 5IWAM 3K5WA 2B83A 2VJPA 3CVXA 3DB1A 5CNIA 3VPGA 2VHWA 3ICQB 3S6JA 4JI7B 3UOWA 4P3YA 1M6EX 2ID4A 4L8YA 1JR3D 4AWBA 2C4HA 1WLSA 2R751 2FI1A 1R5LA 3EGXB 2H2GA 2Q7DA 3M33A 2NUAB 2OORC 2EQ5A 1O6CA 1JG7A 5FTMA 2Z9BA 3MD0A 1C41A 1LGYA 4B43A 2FFHA 2ACWA 4IBEA 3PXBA 4QBGB 3MD9A 4K3VA 3UF0A 4JUBA 4ER7A 1WETA 1PFKA 5TDHA 1UANA 3JPYA 3C1TA 4YJDA 4EOGA 2VN8A 1W25A 3R09A 2LCFA 4JBHA 3SQWA 2DLNA 3C7AA 2ISCA 5JS6A 3B7QA 3IV6A 1BRTA 3WJ1A 4DV0B 1NNSA 2H2WA 3ZIDA 5LMUM 4F56A 3U48A 5LB2A 1AZTA 4XM0A 2PJRA 2IUYA 3CG4A 2C77A 3MK6A 4Y18A 5LD2B 2C04A 3LQQA 3IYLW 4NV3A 5EP2A 3U62A 1QC5B 2A7QA 2N9UA 2OILA 4O2BF 4DLRA 1PGJA 4NYIR 2BFFB 3F8SA 5L7TA 4MUMA 1D6JA 3HJSA 3M6VA 3FYUA 1XZEA 3HKCA 3O8NA 1A3CA 2XLCA 3W3AH 3T35A 4KXXA 2PGIA 1WSBA 1N36M 5K0LA 3Q72A 3DTTA 3Q7QA 4AUKA 4BO9A 2VATA 5JIBA 3LL4A 4DQLA 1F4VA 5ALUA 1QYDA 1SMKA 4KYIB 1U7DA 2HV9A 5HFAA 3THSA 1RXEA 3EDRA 1F0YA 4UFNA 1FUKA 2JNWA 2QT1A 3H11A 4MRAA 1VIVA 5FWNA 3VK8A 1ZRHA 3NHUA 1T8RA 2B36A 4DMMA 3GPDG 3IUNA 2BFOA 3VNBA 4OXKA 1V45E 3OZDA 2CHGA 3T9BA 2WP8J 4Y0AA 1WB9A 5JWOA 4RFSA 3GEHA 4LYJA 1UZNA 1U7ZA 5C31A 1BHJA 4X8MA 1M2OB 2GBLA 4V2IA 4D6XA 2PN1A 2G5CA 4OQPA 2A30A 2I91A 2OZKA 3CGWA 2BEJA 1FZQA 3OCCA 1P29A 3K8YA 1YCGA 4ZVNA 4QM7A 2ECPA 3ESCA 4Q4CA 5J2UA 5I4CA 2PUBA 2ZXUA 5H16A 3ENVA 1ZFNA 3UWOA 1JDNA 4I46A 3S8MA 2DFLA 1KFBB 1GZ4A 4DBVO 3LSTA 3NFYA 1QZ3A 5AVXA 4BRSA 1SG9A 3EXIB 3SATA 1G4HA 4DCUA 4ZOQI 2XJ4A 1II9A 1O54A 2UXCB 3N2LA 4HPXB 1M0TA 4G01B 2P91A 2P0EA 3QY9A 4XI9A 3FTFA 3O31A 1A82A 2FSGA 2PQ2A 1U3UA 3SFVA 2QP9X 4IGKA 2YR0A 1V7PC 3KJNA 1RU3A 3L8YA 4CVNA 2SBTA 3JQQA 5CYOA 1PVOA 2RG1A 5C1OA 2B1GA 3R3SA 1XRJA 4ZI7A 3ZIUA 4MEJA 1KOJA 4V0MA 5IDWA 2JEOA 2X9QA 3K9GA 1GUFA 4URZR 4QM6A 2YCBA 2VSQA 1KK0A 1JB0F 3NBYC 4CQLA 4S1OA 4Q7LA 1OVMA 2RIRA 1GRNA 2PYIA 4YRGA 1XTQA 5E9AA 2QSYA 4CMJA 1R4ZA 2GEUA 4J07A 2A0YA 3D7MA 3F5MA 3THWA 2Q3BA 1A76A 1JXOA 1LQ2A 3KT6A 1R0SA 4TMFA 3SNKA 3GPLA 1THGA 1RBYA 1IZ7A 1NR7A 1W36B 4YMGA 3CLRC 4PAQA 1K86A 2XB4A 3EDQA 1Q77A 2NO4A 3WQBA 1Z2DA 1KH3A 4F72A 5JARA 5DSXA 1NZDA 1XU4A 1GVHA 4HMOA 4FMBB 1SJ9A 4ZOEA 2OZVA 5FP0A 1EVLA 4FLMA 1NNUC 3C8UA 2IHJA 2R7LA 1GTZA 2A84A 4ZI7F 1NHWC 4TLMB 5H02A 1SVIA 1B73A 4F5DA 4O4IF 1SY7A 2H1HA 1HL3A 3JWPA 3C3CA 1UC8A 4FOPA 5DTIA 1WBJB 3TZLA 1WPRA 2YV2A 2W6CX 3GA5A 5F1KA 4M9CA 4JLUA 4YT5A 5ER6A 4F86A 3O8QA 5EERA 3LO8A 3NCTA 2A14A 5LM3A 3UT5B 2QN1A 2AK2A 1G5FA 4IQ4A 3CPHA 4NL4H 3BUSA 1X0VA 4AYXA 3FWPA 2R66A 2GRJA 2BGNA 2D7CA 5A0VA 1Y3AA 2DVWB 3QLVC 3TVYA 1PEAA 1TLFA 2CBZA 2P77A 4PLGA 5MDHA 1JG6A 3EHEA 2BYTA 2VBIA 1WNTA 2C7OA 5JZSA 3RVMA 3A9WA 1IBCA 2C58A 5JD3A 5BVGB 4D4GA 4G84A 1A97A 5T6BA 2COKA 2PZEA 3K1ZA 4A7PA 2HWJA 5JPCA 4NYMR 1Y81A 3ORSA 4UUNA 3KT3A 5SY6A 5CCBA 2F8TA 3FFWA 5H9VA 5DBOA 4Z7NB 4BMCA 3L29A 3LS2A 1MCZA 3ZZUA 4C7OA 1M0SA 5C8ZA 4GX2A 5KQGA 2I6QA 2YY7A 2PKQP 3UAOA 4CKEA 1SZPA 3NS7A 3SYRA 3UAXA 4BVLA 4E88A 4Z51A 4HB3A 2PGNA 3A1UA 4HN4B 3RD5A 5KTRA 3U7QB 2DUNA 1Z13A 3DXZA 1ZXBA 5AVQA 1DVRA 2AG0A 1JDBC 5CFOA 3OZTA 4JSTA 4CJ6A 4FGKA 4WK4B 3DEJA 2HX1A 3FMVA 2GA8A 5B1IA 2AVDA 2C83A 2E4XA 3ZHVA 4EI9A 3BK1A 3W5DA 2C5SA 1UAYA 3OJLA 1YHNA 4K81B 1R1DA 5MGNA 4HN9A 1QIJA 5LXTB 1ADCA 2VDNB 3EG9B 2YMMA 5FTLA 3WV5A 4N49A 4P9NA 2BIFA 2UUPA 3G2PA 1Y9ZA 3H2ZA 3UWMA 3B13B 2WE7A 3U1TA 4HWPA 4YCDA 1JEQB 3RTDA 3JYLA 2BFMA 1XRLA 1R3UA 1NOKA 3FCSB 3HCEA 3RYCB 5IK2A 3KFUG 2YC2C 4K9OA 3PNKA 1XZJA 4YJGA 4YS6A 4ATNA 1RQPA 5REQA 1DFIA 2X1VA 4JBIA 4E70A 1M1YB 2Q2WA 1L8LA 2REBA 2XBLA 5M7EA 5JYCA 2G82A 4MWEA 5ILQA 1M34A 4PG5A 3PI7A 1TYBE 4CQMD 1WBBA 2OSBA 2CL0X 1PGNA 5KSZA 1OMOA 2P9JA 3WC4A 5CFPA 2QZPA 1D1TA 4ID9A 1CJUC 3V4SA 4FIDA 5D84A 2Y20A 4DIMA 1C9NA 4DOMA 5B2ZA 3DDCA 4NQRA 4YWHA 4F9FA 4O3MA 3QXHA 1OSNA 3CVWA 1II8B 1Y8ZA 4HQOA 2QRZA 1EP9A 1H4SA 5E6JA 3HDHA 1LW7A 3D4BA 5F77A 4CFSA 1XZMA 5B58T 4MWDA 1G16A 3NYWA 3AUYA 1CP3A 3ANLA 4BNDB 1QIEA 4AZFA 2FSHA 2AE1A 2I7NA 4BAZA 3U3KA 4IY1A 1OR8A 1MDFA 4AX4A 3SOZA 3KTOA 1M6NA 2IUTA 3BTUA 1VYUA 2PK3A 2QUBA 3U7HB 2FX3A 4S1VA 2G0TA 1A1VA 1ZRMA 2ZWPA 5FTWA 1NVWQ 1IOLA 2CXQA 3DZ8A 3OQIB 2Q8NA 1SD5A 1BS1A 2CJFA 3NBFA 2AJBA 1VL5A 2FFAA 5EHQA 4UHKA 3VYTB 5EFZA 5K4GA 1CDZA 3TTTA 3HG7A 1Q39A 1WUYA 3VDMA 3R23A 1GGEA 1RI4A 3QVJA 3TXXA 3BF7A 4YPFA 3U39A 2Q7XA 3TAXA 4WURA 3QFHA 3VZBA 1V8BA 1YRWA 1J23A 5K8VA 3E5MA 1QAQA 1FFWA 1ZUNA 4G25A 3ILVA 1B23P 3ZDRA 1QZZA 5HQ3B 2J45A 3VYSB 3FAKA 4FILA 5MGBA 1EQAA 4CKWA 3D8SA 2WWFA 1L7MA 5JHHB 5B2FA 3DZFA 3GPUA 5DEOA 2VWGA 1D8AA 4CTMA 1AKVA 2QQ5A 1ZMVA 5F5NA 3PXAA 2QENA 4JU9A 3EWAA 3KOZA 4L9SA 1SKQA 3WG9A 4JI8M 5JDIA 2O6LA 2ZYIA 3KIPA 2AZ4A 1M10A 1D0VA 1T0PA 4NFLA 1R10A 3L9WA 4GFDA 3ILKA 4QQKA 5KWSA 2JAXA 4JI5M 3CV3A 2HDNB 4JX8A 4QOJA 3T7IA 4A82A 4ZYYA 2E85A 4DDKA 3FF1A 4N0MA 3HHYA 3AM1A 3AINA 4M7OA 3Q8MA 2RJ3A 4KGXA 4YRKA 5EWJA 4IS3A 2EDAA 2OLKA 4QGSA 2JFHA 4KPUA 1KEZA 1DIRA 4M1TA 3Q8LA 1HZZA 4GKAA 2YS6A 2JFXA 1FDOA 1T6YA 4RK5A 2Q3LA 3K7EA 1XMXA 2EX4A 3TIGA 3O8LA 3M6FA 1F14A 3KYBA 2OWEA 1LDMA 2DUWA 3COWA 4MHOA 1RQGA 2XI4A 4RZ2A 2GCIA 3NEAA 2Q8PA 4ES6A 3BCSA 1QCCA 1OFUX 1PSDA 2JBAB 3MTQA 2G71A 4WOJA 1MIOA 3UJAA 1UFOA 1WF3A 2XD9A 4JJFA