3FTEA

Crystal structure of a. aeolicus ksga in complex with rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
b'VSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 60
structure length 233
sequence length 233
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fteA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fteA01
4Y30A 3OPNA 3HVJA 4RX1A 2OXTA 2OY0A 1VL5A 4QDJA 5GM1A 5DX8A 4HSGA 3EVEA 3M33A 2IDJA 4AZSA 4RTOA 3O7WA 5EZSA 4GOOD 2HR1A 4HG2A 2NXCA 2NXEA 1UFKA 2P1DA 3CKKA 4HRAA 1RI1A 2QE6A 4RWZA 5CM2Z 1VIDA 5FQOA 3UJ8A 3V97A 5MHTA 3P71T 1PJZA 4V0RA 4RVDA 3SX0A 3V8VA 4GOLD 2UYQA 4OA5A 3EVGA 3K6RA 2G71A 3KQYA 1P1BA 1WS6A 5EMLA 4E30A 4FS8A 2IFTA 2AN3A 1M0EA 2P3OA 4XCXA 1H1DA 1SQGA 3ANXA 3FRHA 1IY9A 3FPEA 3OZTA 4M38A 3HVKA 5JR3A 4DZRA 1WZNA 4GOMD 4ER7A 5FADA 1NBHA 5BXYA 4Z2YA 3NMUF 5DT2A 2PT6A 1YZHA 1KP9A 5GINE 4U7TB 2VP3A 4OX9Y 2HTEA 3M6VA 2O05A 2ZZKA 3GDHA 2UYOA 2ZCJA 2VDVE 3OU7A 1NV8A 4AZWA 2JHAA 2EG5A 5FA8A 5T67A 5ICCA 1SG9A 3PLAE 3O4FA 4X61A 2G8NA 3KPWA 5EQJB 4R6XA 1FP2A 2EX4A 4WXHA 3TLJA 3H2BA 2G72A 3LCUA 1UWVA 3NW9A 3G89A 3DH0A 3S68A 1NW6A 2OKCA 2O06A 4FR0A 4P58A 2BR5A 4QQKA 3T7SA 1JQEA 1NKVA 1O54A 3HCDA 3M4XA 3LHDA 3FUWA 2PXCA 4FT4A 5K05A 3F4KA 1IXKA 5LQKA 3DXZA 2I7CA 3HVIA 5FQNA 5FUBA 2P41A 3TPZA 5K0GA 1R18A 1KPGA 2OO3A 1KPHA 3LDUA 4KIGA 1I4WA 4BLUA 2AOWA 2VS1A 1QANA 3HA7A 5EIWA 2PVCA 3C0KA 5GIPE 1FJXA 3TMAA 3EGVA 4HTFB 4CTKA 2NP7A 4RTKA 5C0OE 3EGIA 4ER6A 2PX5A 3E7PA 2IP2A 3DLCA 1G55A 2AN5A 2UZ4A 3C3PA 3G2MA 2CMHA 3B7PA 5K0BA 3GRUA 3PB3A 1ORIA 3SMQA 2IH5A 5KVAA 1R6AA 5CVJA 5FTWA 2WA2A 5CVVA 3GRYA 1YFLA 2C7PA 4R05A 1FBNA 3TM5A 1MJFA 3DTNA 3TRKA 3FPJA 5M5BA 4K6MA 4OA8A 5FULA 4U7PB 5EMMA 3MTIA 2HMYB 3QOXA 1RJFA 3UZUA 5H02A 1WXWA 3BT7A 2YXDA 4KDCA 1G60A 1WXXA 1KHHA 1QYRA 4DF3A 4P7KA 1EIZA 3KQTA 4CTJA 5K0FA 2PX2A 4PINA 3AJDA 5E2BA 3SSMA 4RTJA 2KW5A 4E31A 3GCZA 5E9JA 2AOVA 4M7RA 3VYWA 4CKBA 4M36A 1U2ZA 5EVJA 5EOVA 1JQDA 5K0LA 1D2CA 1VQ1A 4RSRA 3NDJA 5DXJA 5DTMA 2AR0A 2QRVB 5HILA 4HGYA 3A7DA 5P8WA 5CCXA 4B17A 3EGEA 4PYLA 2AOTB 3JWGA 4PYMA 3ELYA 4RVHA 1L3BA 3P9IA 5EG5A 5HEKA 3BWMA 1JSZA 3I9FA 3BWCA 5K0EA 4R6WA 5HIMA 3LPMA 3SVZA 2FHPA 2B78A 2UYHA 4GF5A 4GBED 1XDSA 5KQSA 2C7QA 3K0BA 3BGIA 2PXXA 1BOOA 3KR9A 5DWQA 3SM3A 3PT9A 5LQNA 4OQDA 5DM4A 5ICGA 3QOWA 1R8XA 1DL5A 5K09A 2JG3A 4YV2A 3ORHA 2EJTA 5HFJA 4PYIA 3RODA 2IDKA 1QAMA 3OZSA 4RTPA 1ZQ9A 4FZVA 5EKXA 3C3YA 10MHA 2ZSUA 3UWPA 2CL5A 1PRYA 1TW3A 3DMFA 3LL7A 4AZVA 2HV9A 2ZLBA 3HP7A 3GRVA 3QV2A 3UJCA 3P8ZA 1QAQA 5E8JA 3NJRA 4HGZA 3HCFA 3KPYA 3TKYA 2WA1A 3HCCA 5HOQA 3PFGA 3BGDA 4FSDA 4CKCA 3ER9A 5KYGA 2IIPA 2ONZA 1L3IA 3DLIA 1KR5A 3ID6C 1JG4A 3Q87B 1VBFA 3HA5A 3ER8A 2H1RA 3BXOA 3NWBA 3SR4A 1AQJA 4JXJA 1NW3A 3HNRA 3R24A 4MIKA 1RJGA 4FGZA 5E2AA 4UOEA 2PX8A 2NP6A 2ZBPA 4PGHA 1ZKDA 3JWIA 4PIMA 3SXJA 4PNEA 1XVAA 2CMGA 1L1EA 7MHTA 4MWZA 4E32A 4C04A 1F3LA 2EFJA 4OBWA 3EEOA 4ER0A 5EPEA 3RIEA 3NTVA 4KIFA 1R8YA 1TW2A 3KR0A 2R6ZA 3I64A 5G02A 4FP9A 2F8LA 3GWZA 3MTEA 4PWYA 3GJYA 4P7JA 5K03A 3HCAA 2JHPA 3KR1A 2PKWA 3THRA 3PFHA 3SGLA 3ME5A 1INLA 3FTEA 5LSAA 3Q7EA 2AOUB 5EKUA 5GIOE 4WVLA 3U81A 1SUSA 2OB2A 3TR6A 4DCGA 2YR0A 1BHJA 2PGXA 4O29A 2I6GA 2B25A 3KPUA 4BP3A 2ORED 3OZRA 4QQNA 2YVLA 3LDGA 1QZZA 4RTQA 3C6KA 3LCVB 4QTTB 4R8SA 4E2WA 5EGSA 5FWAA 3BKWA 5LQJA 3FZGA 5E8RA 1VE3A 4H0NA 5FHRA 2P40A 1O9HA 1KYWA 1RI5A 2Q41A 5K0JA 3FUUA 2FCAA 2PBFA 3G2OA 3GIWA 5F2OA 3EVCA 2JHCA 3OFKA 4E33A 2ZWAA 1Q0SA 3GNLA 1ZGAA 2ERCA 1WG8A 3P9CA 1AF7A 3TM4A 4GC9A 3BGVA 3LECA 1DCTA 4QVGA 3FTFA 3JWJA 3IHTA 5GP1A 4OQEA 2NXJA 3FTCA 2BM9A 2BM8A 1G38A 3NDIA 2B2CA 5E9QA 2PJDA 3LSTA 3FPFA 5FCDA 5LQAA 3UJDA 2G1PA 1P91A 1EQAA 2IBTA 3M6XA 5CVDA 2C7RA 4PGGA 2PLWA 2YX1A 2ZFUA 1V39A 3P2KA 2DULA 2YQZA 3DULA 5E1BA 3UJ7A 3GXOA 3HCEA 2BZGA 3G5LA 3PS9A 2OZVA 4RYLA 5KS2A 4FSXA 1O9GA 3E23A 5GOZA 4C07A 4GUAA 2I62A 4ZTBA 1I9GA 2ZULA 4C08A 4DQ0A 3OE5A 2ZZNA 2HWKA 4ER5A 2NYUA 1UIRA 1L3CA 1R00A 3P9KA 2IBSA 3HCBA 3CBGA 1G8SA 5E1DA 4BY9E 4OBXA 3B89A 2BR3A 3UFBA 1X1CA 2JH8A 5CUQA 2H11A 3ELWA 2P3QA 2PV0A 2FK7A 4M37A 1SQFA 1NBIA 3KU1A 4MQ4A 1L9KA 4FT2A 4AX8A 5E1OA 3KR2A 4Y2HA 1KXZA 2QYOA 1RJDA 2ZBRA 4E2XA 1VPTA 1X1BA 2PY6A 3E05A 4P7FA 3UJBA 2ADMA 3EVAA 2V7EA 3D2LA 4XUCA 5KQRA 1JSXA 3GGDA 3P2EA 3CGGA 3EVDA 4QVKA 3P2IA 4QTUB 1HNNA 1NW8A 3PTAA 3KPVA 5DM2A 5CD1A 1P39A 3DMHA 4BLWA 3OE4A 3B5IA 3G8AA 3FYDA 4HTFA 5DTRA 3UBTA 3L8DA 3LBFA 1M6EX 2ZIGA 3FPGA 2VDUE 2XVAA 3T0IA 4X60A 5LQRA 5ICFA 3OU2A 4KDRA 5DSXA 1JR4A 4QPPA 4G56A 4LG1A 1ZHFA 5DTQA 1N2XA 1B42A 1ZGJA 3MCZA 5F2NA 1KIAA 4RTRA 1XCLA 3R3HA 3TKAA 3X0DA 5EIFA 4PYKA 1X1AA 5T64A 3OFJA 4IV0A 3NVKI 5DM1A 1KYZA 1JTEA 3BKXA 3KQWA 2ONYA 3R9XB 3B3JA 3HEMA 4RVGA 5FHQA 5HIJA 3GO4A 5U4XA 2ZVJA 4V0QA 5K0CA 2WK1A 4GEKA 4X41A 3NWEA 3G2PA 3DOUA 3PX2A 3LKZA 3T7TA 3VC2A 5K8VA 2AOXA 1YB2A 3DP7A 2I9KA 1NT2A 3GU3A 5DX1A 1R74A 4DCMA 2ESRA 3OU6A 3DXXA 4YUWA 5CIYA 2QRVA 3SSOA 4IV8A 5K0NA 4YV0A 5BW4A 3ERCA 1NW5A 2AOTA 2P8JA 4P7GA 3KHKA 3DUWA 3P9NA 4LWOA 1EJ6A 4X1OA 1WY7A 1I1NA 4C4AA 2AN4A 1M6YA 5GM2A 2FK8A 2XVMA 4C06A 4RV9A 2NNWB 5EHIA 5DX0A 1RI3A 2XYQA 1XDZA 1VP9A 4YUXA 2UYCA 2JH9A 1Y8CA 4YUVA 4RTLA 1RJEA 2YTZA 4IKPA 5EC8A 1QAOA 1VP3A 2GB4A 1IM8A 4KRGA 4XUDA 5DXAA 4PCLA 4DM3A 2AZTA 4AUKA 3AWIA 1OR8A 4RTMA 1YZ3A 3VSEA 3KKZA 5K01A 1AV6A 5FWDA 5ICEA 1XTPA 4GC5A 3HM2A 1F38A 3E8SA 2Y1WA 3ELUA 3MAGA 3OCJA 4PYNA 2QY6A 2HNKA 3IYLW 2NXNA 2ZWVA 2ZTHA 3KQMA 2OB1A 3T7RA 1XXLA 1AQIA 4PIPA 5B1SA 3LGAA 1KPIA 5HIIA 3VC1A 1YF3A 9MHTA 3LCCA 4HH4A 1Z3CA 3G2QA 3SSNA 4GOND 3FUVA 4CWAA 2LD4A 3M6UA 3A26A 4E2ZA 5IH3A 5EMJA 3MCTA 3EMDA 2EJUA 2VZ9A 5LQUA 1N7JA 4KVZA 2FRXA 2A14A 3R0QA 1EG2A 3UA4A 3FTDA 3EVBA 3G8BA 3CCFA 2ZZMA 3WSTA 4QDKA 4MTLA 5T6BA 4F86A 1XJ5A 1SUIA 3HTXA 5LR6A 4BLVA 2AVNA 2CKDA 2FPOA 1TPYA 5JUWA 4A6DA 5EEGA 2YXEA 5HZMA 4PYOA 2PT9A 5GWXA 3MHTA 4MHTA 3KQSA 3AXSA 4CKEA 2P7IA 4RTNA 2CWWA 3HA3A 5F2KA 4RVFA 2GA9A 2XYRA 3TQSA 1BKYA 3TFWA 4YUYA 3G7UA 3RW9A 4RTSA 3FUTA 5ERGB 2AOUA 2QM3A 3CJQA 3UJ6A 2AS0A 1YUBA 1RI4A 4KWCA 1FPQA 3DMGA 4ER3A 4POOA 3THSA 2OBFA 4EVIA 2GAFA 5EHGA 1X19A 2O57A 4YV1A 1NW7A 2Y1XA 8MHTA 3A7EA 2PWPA 4PYQA 3DR5A 2XBMA 3KQQA 4NECA 3PX3A 2B3TA 3I5UA 3A25A 1NV9A 2GS9A 3C6MA 1VLMA 2B9EA 2K4MA 3LKDA 3A4TA 3B3GA 3CC8A 4YUZA 1JQ3A 4PCAA 1G6Q1 3M70A 2IH2A 5IKMA 1HMYA 3NVMB 2IH4A 3BUSA 2FYTA 1D2GA 1T43A 4EK9A 1ZG3A 2O07A 3HVHA 1YFJA 4R8RA 3EVFA 2YXLA 1EJ0A 2ZW9A 4ATNA 4C03A 4BP1A 3MB5A 2ZIEA 3I58A 5CVEA 5DM0A 5CVUA 5HIKA 1XCJA 3REOA 2ZBQA 5BW5A 2BH2A 3KQVA 2YUIA 5EEHA 3DXYA 4HC4A 2VDWA 2AVDA 3EMBA 2BR4A 3KQPA 5DSTA 5EMKA 1BC5A 5C9ZA 2PSSA 3EVZA 4F84A 1N7IA 1RI2A 2GPYA 2G70A 4ISCA 4C05A 4QPNA 5DLYA 3EEYA 4YMHA 3ELDA 1JG1A 4X63A 2PX4A 3B3FA 4LWPA 1G8AA 2C7OA 2PWYA 3M6WA 3FYCA 2OYRA 1Q0TA 5FA5A 1XDUA 2O0LA 1DUSA 4E70A 5LQCA 4KW7A 2XYVA 4LECA 3A27A 1ORHA 3CVOA 3FPHA 1JTFA 4EQZA 1P1CA 1D2HA 3EPPA 2P3LA 5D1NA 2JJQA 3UJAA 3BWBA 1SVUA 3G5TA 3MQ2A 4DKJA 2P35A 3LBYA 2PXAA 4GQBA 3FUXA 3G88A 4L7VA 4F85A 2Z6AA 4DA4A 3IV6A 1JG2A 3GRZA 4CXMA 1MHTA 3KQOA 3CJRA 3I53A 4EKGA 4XUEA 5DPMA 2N47A 3FRIA 3IEIA 2H00A 3MGGA 2V74B 3AY0A 2IGTA 3AXTA 1SKMA 3R6TA 4PONA 5EZQA 3TOSA 4PYJA 2Z6QA 5DRYA 2GLUA 4EKIA 3KPJA 3BWYA 5CCBA 3O31A 2ZIFA 3PVCA 5E9WA 1X1DA 5DRTA 4A6EA 4EMSA 4AZTA 1JG3A 3MERA 2Z6UA 3CJTA 3JWHA 5C1IA 2DPMA 3UA3A 5BP7A 2GH1A 4E2YA 3LX6A 3UJ9A 3P97A 4DMGA 2IPXA 1EAMA 4YMGA 2OPBA 2P7HA 5D1HA 1FP1D 3BZBA 4IWNA 3LDFA 5E1MA 2E5WA 1NE2A 3GRRA 2R3SA
chains in the Genus database with same CATH superfamily
1JPJA 3OWOA 5ITWA 2C7VA 3TPFA 4JI1B 1IZZA 5IASA 2WHXA 2DCMA 4UHJA 1U65A 1HEYA 4CMIB 1Q7BA 1E1LA 3ANXA 5JNUA 1G5RA 4TZ6A 5AJUA 4DTCA 2C1EA 1JXQA 3I1YA 2NUBA 3D6NB 1QGZA 5JO9A 3W5JA 4AQ7A 3ZDXB 2C20A 3SCZA 4ZOLA 1ST3A 1AGRA 4HRVA 1ZBDA 4FFDA 3PUIA 5FH9A 4X3CA 3RFVA 1C8LA 4Y0VA 3QKWA 2YXDA 3DM5A 2AXNA 5G1PA 4RXTA 2AW3A 4NYMR 1XA3A 4KITB 3Q6IA 1ZH0A 1RLOA 2DUMA 4HV4A 4HAIA 1K8RA 3JQAD 4URYR 4R5HA 3TLEA 1X80B 1SOVA 3IBFA 3ORHA 3B36A 2XDQA 5E95A 4LTMA 1CRPA 4HLDA 2H5IA 4V0OA 1KFCB 2PH1A 3NTXA 4GH9A 3W6ZA 5I51A 1KH2A 1T0UA 5B1EA 4URXR 4Q4HA 5FF9A 5AUNB 1H66A 2WVHA 3L1JA 3ET4A 2Q1UA 4TTQA 2R8RA 5JCPA 2VHXA 2JIZA 2JLAA 1MJNA 2PUCA 4YJ2F 4JI0B 4COOA 3HHYA 3GUZA 4AJ2A 3STXA 3V4PB 2CB0A 4WOPA 2PS9A 4LI0A 5HJEA 5DM70 2IYAA 5AOCA 4X54A 1V2GA 3EGOA 5AK6A 1P4HA 1P9LA 1I36A 3TW6A 1FEZA 3UCEA 1D0SA 5LU9A 4D56A 3OIYA 1IONA 1BXRB 1EBUA 4ZDJA 3I04M 1U3WA 4XM0A 2EYUA 3PUKA 2DEUA 4NG5A 3ZZUA 3KKOA 3KVWA 2ZYVX 1RVDA 1YDWA 4R8KA 5HRUA 2WF9A 2ZU6A 3WK7A 2I87A 1VSVA 3VSDA 3BHNA 3E7WA 3BTOA 3O75A 2X15A 2FB9A 3NT2A 3DC7A 4ZA2A 4QVKA 3MQFA 1F4VA 2H8GA 5AIBA 1DEAA 2EZ8A 4G8DA 1I30A 4YPOA 1OASA 3OOJA 3MCZA 4YMIA 1RYFA 4CLOA 3KK0A 3H0CA 3D3QA 3BSFA 5CPBA 5K0CA 4JQSA 3BICA 2YV4A 1YB2A 3NC0C 3GBPA 3DPSA 4BTEA 4F71A 2B21A 4W7SA 3L8EA 1CSEE 2AWNA 3DUWA 5JADA 2RK6A 3OX2A 5CXSA 3UPUA 4YUVA 4P31A 4KVAA 4AUKA 1L5KA 1Z5AA 1GPH1 4RIHA 1RQLA 4JLVA 4ZAVA 1PQYA 3F7TA 4AY5A 1H3NA 4L6CA 2XR1A 4MWDA 3A3NA 4CDMA 3WP1B 4UU8A 1VBKA 3DTVD 3EUFA 4F5EA 4GE3A 5T6BA 4ENTA 3IQZA 4LFBM 1DKUA 4TX1A 1SIUA 3E9YA 4PX9A 2IRWA 4KFTA 3OZGA 5F98A 5E6JA 1UBSB 3TSAA 4KH1A 3KXPA 2DTEA 3L6DA 4OJNA 4OQXA 2XZPA 2GHRA 4ZK2A 4RPGA 4RYDA 4M1KA 1RRFA 2UZ1B 4KRYA 3N58A 2X0JA 3DFUA 2AR7A 4EK9A 4RF1A 3RUEA 3FCSB 4N0EA 2VJOA 4YRMA 1TU3A 4MYSA 5EEHA 3CXUA 2FKNA 2G88A 4GQAA 4CKCB 2DCUA 4XEHA 5D1NA 3RVNA 2LHCA 1BYIA 3KQOA 4RVSA 1KHTA 4OTZA 3VHXB 3C2QA 1XVUA 3BIWA 2CJWA 5CX1B 1SHUX 2HW8A 1UBJS 3TNFA 3NCHA 2J3IA 2UV8A 3F9IA 4CTOA 1UC8A 2WMYA 3GRFA 3NUZA 4V02A 1XRQA 3DEYX 3JQEA 4E5UA 3I6YA 5KKAA 1N9KA 1WSAA 4IDQA 3PPYA 2DZNB 1PL6A 4TSFD 3DWIA 3Q41A 5K3EA 2ROQA 5ESWA 1GPBA 3M3DA 2HMWA 1FK8A 4IV5A 5CM9C 1U3CA 4IDOA 1V5EA 1Y1TA 3OHPA 1DQZA 1ZL0A 3IV7A 2W71A 1IG0A 3PT5A 4BJHB 3U62A 1DCKA 1B6GA 3IUEA 3UV7A 3N8GA 4ILKA 4MVJP 4LX0A 2F6RA 2LWXA 2QIOA 5DXFA 5KVAA 5CVVA 1WD7A 3PTLA 1SXGA 3PUWA 1GAWA 3NHMA 2IOHA 4GZ6A 4DF3A 1LF5A 1QOPB 3WIEA 1JNYA 4FOOA 2XUZA 2J4CA 3H2SA 4MR9B 3T1HB 1E0SA 3P9IA 3PJDA 2R7AA 2QUIA 4X1KA 4BKPA 1OE0A 1E5LA 2CVQA 5KJ6A 4D0RA 2G17A 3ABSB 1GVNB 5EHNA 2V9PA 2D3TA 3CYFA 5LDGA 3VISA 5E8JA 3QOYA 5CLHA 1U4SA 2GYUA 5AVTA 3Q87B 4MQEB 3V4OA 1YRAA 1NW3A 3DHYA 3HB1A 4KYUA 4QNMA 3RRNA 2AH5A 2AC2A 3ABRB 2XNKA 2F8LA 3MTEA 3E21A 2F9MA 3J7AS 2MU1A 4ZI5A 5C37A 3MUEA 4ZXFA 1Y42X 3O5AA 1ZIPA 4LYFA 2XXJA 4JBWA 4UQPA 3JQ9C 4XTRA 2OP1A 2IPMA 3LNCA 5IDYA 1KZ9A 2DWNA 2AZDA 3H5VA 1W47A 4PCVA 2BM8A 3FPFA 4IWXA 3B9QA 1D7AA 1KO1A 1B00A 2O50A 2NTEA 4L4SA 2HGSA 2Y0BA 4FHFA 3CCCA 3IJRA 5F3DA 1KJWA 3ZZNA 1LDGA 4KT0F 1E59A 4UARA 3EVAA 4IIDA 3IVXA 3OHMA 2ES4A 2V54A 5CJ2A 4Q1FA 1NJ6A 2F64A 1ZSYA 2XTNA 5B6IA 5C5DA 4WN3A 4CQMA 3RFCA 3C3EA 4PSCA 3CSSA 4FC7A 4YRKA 5LMZA 2GEFA 3K8YA 4L27A 1L5GB 2D5AA 2QROA 4OB7A 3ZWVA 1I6MA 4KQHA 1ZNYA 1GRRA 2P9QA 1TAHA 4M2LA 4L02A 1R37A 3KHKA 5AICA 2P9CA 2DY0A 4KV9A 2DH5A 1Z5UA 2HEGA 4DSTA 3TB4A 1QAOA 2V6MA 2QG4A 4H6PA 3LWDA 5IP5A 4XLLA 3KOWE 4HH4A 4D9BA 1U0LA 2IEZA 2BMDA 2LD4A 4CHGA 1CJSA 4BP8A 1I4TD 2Y0CA 2F3UA 2VNAA 3U13A 1HLGA 2B2XA 4MRVA 2CKDA 3T15A 4N0PA 1T8WA 2JJ2D 1BGVA 2EC5A 4XGNA 5FI5A 3TH5A 5D8DA 2VSYA 2QUBA 4I5IA 2ZJ8A 3MJSA 3E5NA 4C0JA 3VKFA 3SASA 1SB9A 3M7GA 3JQQA 1F2TA 7CATA 1Q0LA 4L4RA 2B4RO 1MB0A 2W83A 3BRCA 1GGJA 2P5TA 1F0YA 4KDEA 3LW7A 1ZCAA 3SXUA 3QI7A 1W52X 3MGCA 1K7EB 1ULTA 5FBVB 2FOIA 1USUA 1J2JA 4FFSA 3RK0A 3QWFA 4MVWA 1TTQB 2B6NA 3GEIA 2H92A 2PRKA 2H2AA 1Y7IA 1QZTA 2X86A 1O0BA 3MCWA 1CZHA 3RGWS 1EAMA 1QG4A 5A7HA 3COVA 4J49A 5IT5A 1QHNA 1FX1A 2OCBA 2GKGA 2QLFA 3NANA 4RVDA 1YL5A 1QC5A 1Z3IX 4G0VA 2W0MA 4DJJA 3P0IA 4B46A 1TYZA 1E9RA 5AKKA 1A4RA 2OSVA 5FA8A 2IYTA 2W11A 2GCGA 3AVVA 3VH3A 4LHWA 3KZKA 4ZPXA 1QG2A 2CXSA 1I10A 3I9NA 5DIFA 3FOCA 1CKEA 3H8SA 4TTVA 5JSYA 4FYKA 1Z5PA 3QUAA 1QDLB 3K1AB 1GTG1 4CEJB 1LC0A 2ZR9A 3JPYA 1QK4A 4OQPA 1AGNA 1N5OX 5ADUS 2DAKA 2ZROA 3KT6A 1AA9A 4BFWA 1L6RA 4TQUS 2G08A 3BQ9A 3ZOZA 3SOPA 4YV7A 4OI4A 4YAKA 1JPUA 1PDWA 3IKLA 4G97A 5HR5A 4YAOA 4BZZA 3F3MA 4RENA 3H9UA 4TRNA 2B82A 1GLNA 4DA8A 2BEVA 1Z0KA 4DRXA 3ITKA 4L3WA 1WCIB 4MLPA 1K8ZB 3T12A 2Q2NA 2H9AA 2FMFA 2E2WA 2I22A 2I6FA 4IIVA 5HNKA 3TAHA 4ZCQA 3DLIA 1SA0A 4Z99A 1HDRA 3PTZA 4JLOA 1AUPA 2EHDA 5JBNA 2R6ZA 3X1KA 1OTRA 1GL6A 3N6RA 4DEXA 3QVJA 3PFHA 4BVLA 2CXTA 3D4LA 5FNVA 1P7WA 1YDGA 3ZBQA 1U6KA 2YR0A 1ZITA 3ZDZB 4AW9A 4C0QC 3E9SA 2HDNB 1L0BA 4Z7NB 3BXZA 1OIPA 2A3RA 1RI5A 1K7CA 3ZY2A 2FMKA 1QDUA 1J33A 5A3VA 3D54D 1WV0A 4YLGA 2PJDA 4DCTA 5DN9A 1V3UA 1AB6A 1R16A 4LJ7A 2J9FB 2AEEA 2ZANA 1HE4A 1XCOA 4NR0A 4URUR 4L78A 2Y99A 4IOMA 2HN9A 2Z1DA 3K1ZA 3ZDFA 3TNJA 4AXBA 3HDJA 2O8CA 4MJXA 1NZFA 2QTNA 5ERYA 4N3AA 4QXQA 4MVJA 3KT8A 1QH9A 1DADA 3TN7A 1O9BA 1C1DB 5AHWA 1A1SA 1Z4PX 2WD9A 3DMHA 5H16A 3P1JA 5SV2A 3NHWA 2V7PA 2A78A 1TM1E 1CUEA 1UINA 3KG2A 4UMFA 2WTAA 1AN9A 1KJ8A 2WZCA 1YDEA 3WXBA 4HDRA 3R40A 2Y1GA 1IVSA 2FPLA 3P45A 4DR5B 3HKBB 2XWQA 4CV1A 2OCLA 2FTKE 3ZDYB 1VP9A 2GHIA 4E3ZA 4YUXA 1VYUA 3HSYA 1IZ9A 3DAFA 2DKLA 3S7TA 1AV6A 4I1IA 2J6HA 2CEAA 1L1QA 3ELUA 1Q0UA 2YICA 3IHKA 4NMXB 3WRXA 4N39A 1QUTA 4M99A 1PV4A 3KB2A 3OMXA 2ASEA 4CRWB 3T7CA 2AZ4A 3NOQA 1GO2A 1D04A 1UBKS 5F52A 2VPQA 2EO2A 1ZISA 1BJKA 5EEGA 4BS9A 4X92A 2EZ9A 5EJAA 4XVUA 1P9OA 3TFOA 1EWRA 1GNQA 3OT1B 2PGOA 1W0KA 1GLGA 4X91A 1PR1A 4HAOA 3QG5A 1U9IC 3K0CA 4EDHA 2YV2A 5DNWA 2WSBA 1WMEA 2Y93A 4CLXA 1NWHA 4HL6A 3TIGA 1NOIA 4HFMA 2HV8A 4ZQGA 3AKEA 3SYKA 1S8AA 1FYDA 4J0KA 5FFNA 1UKBA 2E4VA 2IHTA 1U0FA 4LF7M 4W9RA 5BOSA 2BVNA 2JB9A 1Z5CA 2WWHA 4PGAA 2HQSA 2MT9A 4L6IA 3HSKA 1MW9X 2IUSA 3NS7A 1KI8A 5LZ9A 2V74B 1RM5A 1EWYA 3DT6A 4KNYA 3BWYA 3KEFA 3BRSA 1VJTA 3QUCA 2FG6C 3F67A 1FRZA 4AP6A 1SOWA 4EVQA 5T3UA 3CTMA 4N0MA 4HG2A 2NYAA 1OGJA 2DAIA 4HFJA 1YR9A 3CUYA 3ZJYA 4UBNA 1XTRA 4LRSB 2G76A 4BV2A 1FUKA 1GWNA 3UKOA 4A1FA 4DZZA 1E1MA 3WQHA 5AW9A 2BFCB 3NW9A 1CDZA 1I7PA 2GBIA 4MMYB 3ZV4A 5ESXA 3CF6R 3CWCA 1CY2A 5AXDA 2ZYIA 3N2EA 1S6YA 2NO7A 4ZYLA 3BK1A 4LE1A 3DHEA 4LZPA 4FX2A 4ER6A 3G2MA 4WDQA 4D0NA 2DT5A 2CJXA 4UNNA 1DKQA 2H4JA 5BMVF 1FX0A 5H02A 4B4VA 4OHPA 1WXWA 3WK5A 4E4TA 3OFSA 4JYPA 4BVBA 5CITA 2YFYA 1UKEA 4HQKA 2D3WA 5GZ1A 3PIDA 4LCBA 4ZJZA 3KW6A 1DXHA 1CQWA 2VTVA 4QE3A 5CFLA 4Q4AB 4TMVA 4Y0NA 2WMDA 3GG9A 2JY5A 1PD0A 2XEDA 1PNQA 5MFZA 3HCFA 3AV3A 1IQRA 3Q8XB 1MNAA 2W4QA 3UTCA 4E08A 3E3LA 2WHPB 3P2JA 1A2OA 3SYRA 3WGOA 2H2GA 1B23P 2JFZA 4YFYA 4QM7A 2ACEA 5L4LA 1TLTA 1QKKA 2FLKA 4JGGA 4Q7KA 4EFNA 2OB2A 2O2GA 3WO1A 4MMXB 1CD5A 1I3NA 4OSEA 4XLZA 4IGIA 1IN8A 3INNA 4O4IB 2DJIA 2VN8A 1CUBA 2EGHA 3L02A 2X58A 3F6YA 4LS3A 4LTNA 3KVNA 4J29A 4UUBA 5EUBA 5JT1A 1O9GA 4H0CA 3GEBA 5DLDA 4Q9IA 3ZLVA 4M9QA 1SUCA 1N8NA 1B7GO 1QIIA 3PWTA 3MYYA 3AF6A 4QYIA 1UMCA 3VYUB 2IP1A 4PLYA 3BXWA 1Y6RA 5AM2A 1TMGE 4P0PB 1XYGA 1I2AA 4QOJA 4G0XA 3NO4A 4RJJA 4UD2A 2BGGA 1E6WA 2ZUDA 4IHJF 3PE3A 3VSBA 4M8IA 2GJ4A 3K2QA 3JD2A 3R7WA 2C99A 4MRPA 4U00A 4D3DA 3E70C 2JEOA 4DJTA 3UMCA 1QYCA 3ODGA 4RHTA 3MJCA 1TZ2A 3NWEA 3C8DA 2WNSA 3I05A 3IBGA 1E18A 1A50B 4R1QA 1M7HA 4IOJA 1P1KA 1L7VC 3KWLA 3OO1A 3OPXA 1VIYA 1YOBA 4KACA 1RJEA 4X66M 421PA 3LO5A 1GXSA 2HXGA 2N1BA 3DQQA 4JUCA 2E1RA 5A0VA 4A91A 3X44A 2PUAA 1MHPA 1KOJA 3SK0A 4KQMA 1M2EA 3MOIA 1F6WA 4BNMA 3CUSA 4D6PA 1E60A 4F5YA 3AXSA 2WY2D 4UM9D 3IB3A 1EE2A 1CVRA 4MARA 5AK4A 3KDAA 2NTNA 1IJFA 3H65A 5IFKA 3QOFA 3KHUA 3PQEA 1WPRA 2ZSFA 2ZUVA 3S2EA 1YH3A 5D51S 3IAXA 2W2PA 2WKQA 2PFSA 2IHBA 1XTBA 2ZBQA 1VHQA 2R4QA 2ZUCA 3UG6A 1ZCFA 3GPUA 4D4LA 3EVZA 1Q11A 5LB4A 2C82A 4YMHA 1AZWA 3ZIAA 4G4RA 5EHQA 3NAZA 1J2TA 1A04A 4OGGA 2RHRA 3HJAA 2GSWA 2V7QD 2LKDA 1TJNA 3U9LA 3DPUA 16PKA 1MV5A 2ZIFA 3HA2A 4BEBA 4CMKA 2W4MA 4M98A 4HNUA 3K0FA 4YK7A 4NOOB 4M1OA 3UHFA 4N54A 3ETCA 3OQOA 1F7UA 2FXIA 2HMUA 4HSGA 2C54A 3N0WA 4DJAA 1LQTA 3EOBI 2OEPA 3ZY5A 2XODA 5C53B 4EF5A 4PG4A 3AVYA 1KSJA 5G4LA 5AVYA 5JSFA 4U0KA 5TPZD 3U7HB 1Y4DE 2WFZA 1YB5A 4E88A 4ENVA 2I3DA 5DCWA 5M2QA 2BR5A 4HDCA 3SF8A 1RMYA 2V98A 1T3HA 1G8PA 1ESEA 2RH8A 2R46A 2JIDA 2C98A 3IIKA 3VI3B 3RE1A 1I4WA 2WB4A 3LI2A 4NMWA 4HTFB 4HH3C 4QFBA 3EFBA 4JYZA 2X14A 3CX8A 4QUBA 2DH6A 3O8OA 3DTNA 3G0CA 1MN3A 1OAIA 2J3LA 2BEKA 2JZOA 2IYVA 3K6SA 3B13B 3TX6A 1F3OA 3O83A 5L3VA 1LTQA 4FFWA 1T4BA 4GBED 1JKMA 1VCHA 2PGIA 3JQ9A 1G1MA 1YT5A 4JQCA 1GEGA 1JDPA 3DDNA 4O63O 5DLQC 5IAAA 4O4HF 3M0EA 4Q7LA 1TGVA 2B1RA 1G7SA 4X62M 3ID6C 1E2HA 4IUBS 4FQ8A 5E2AA 1DKLA 2FLVA 1MR3F 1QF7A 2W5UA 4YFVA 2JHGA 3EZ6A 4BO2A 5EY5B 1J5XA 3ITEA 1X7DA 3ZY6A 4RBNA 3EDMA 2Q41A 3C7DB 4MS3B 4RDIA 2W93A 2BGMA 1DIOB 3M7IA 4JLWA 1C2TA 5KMGA 2CLKB 3TQTA 4NESA 4X5OA 2QYTA 1FDOA 1P91A 2A0YA 1BFDA 3A0RB 1UZMA 4P5DA 1H0SA 3O1JC 4G1CA 1J4AA 4GUAA 4NZOA 3CTWB 2HL6A 4OHUA 1M8KA 1CUXA 1L4KA 4HUQB 2LIPA 2I7PA 4FGSA 3D2CA 4N3NA 4R7TA 1RJDA 4PLZA 1KQFA 4BCBA 4PSKA 3GVXA 4JI5B 3RFFA 4LG2A 1HNNA 2BOVA 4RY8A 3DBHA 5D85A 4FWIB 4BLWA 1ECFA 2NU7B 3SHOA 1BQ3A 4PNPA 3OU2A 4J6FA 4BMDA 2OC9A 3MRXA 3X0DA 5G0TA 1YMUA 5T64A 2CCGA 1E66A 3WBKA 1YZYA 4Z2AA 3LKZA 1YVEI 4IM7A 5KTNA 2YRFA 3L7JA 1PI3A 3BH0A 4LFAM 1MVNA 2XITA 5EIXA 4IBFA 5L40A 4J43A 4B6SA 2QU7A 1T0PA 4NARA 3ZK7A 1SQ5A 2OM6A 3AYZB 3JZFA 1P7PA 3LC0A 5ALOA 4X8MA 1NJ2A 2W90A 3AERB 2NZ8A 2EBUA 5EMJA 1KMMA 1MKYA 3S8EA 5M7EA 3SR0A 4Z9AA 3QKUA 2YKGA 3URKA 1YCHA 4XYMA 5LP6C 2QM3A 4IFEA 2II6A 2Y1LA 4B9AA 1U8TA 4I1SA 3THSA 4LVNA 3STWA 4BPBA 4JI1M 2G4LA 1R9GA 5EJCA 3DHVA 2H4FA 4ZYXA 4S1OA 4DZTA 1RPJA 3IP8A 2ZSDA 4L0QA 4ALJA 2ZBFA 3H87A 5DBHX 1EBFA 4MW0A 3C1UA 4DR1M 1KJJA 2FZVA 4RMHA 5LM3A 5F21A 2HCBA 1IRIA 4ESHA 4XVHA 4MO9A 5JWRA 1HQKA 1PX0A 4JJ8A 1V5IA 1JBEA 1JG2A 3EY4A 4HQNA 4MGZR 1MUUA 4JBIA 3F8TA 1E3WB 1RW4A 1AJEA 1XJ0A 3ONVA 2WICA 2HI0A 1SIOA 2MIIA 3QLUA 4Q7QA 4WKCA 3ZLTA 3ZVKA 4JCOA 5LQDA 1W44A 2X0IA 1SAYA 2BZ1A 3U7FB 3PC2A 1O6BA 3N5KA 1QGYA 1T5HX 1JHVA 2ANBA 2VQ6A 1LJLA 4KO2S 1FJGB 1WP4A 2QGFA 2FW9A 3QVKA 4OGLA 1JLRA 2ZZKA 4MW5A 1FP2A 3RYHB 4AC9A 3NNNA 1NVWQ 3DXZA 1Y6JA 3I42A 1Z34A 1RAAA 5ITZA 4K1LA 2P9HA 4GT1A 5A7GA 1LJUA 5GIPE 1LDNA 1OV6A 4LDQA 3TINA 4HGQA 3ZJ5A 3WL7A 4JI0M 1ZXXA 3ZE7A 4YUAA 1EX7A 1HY3A 3DT8A 1MOZA 4UDNA 1XQYA 3U5TA 3NBQA 4N03A 2OXIA 2VHWA 3LIPA 3T5BA 1G3RA 5TC4A 4LSZA 5TT0A 3R6DA 1W4ZA 4YRCA 3UTDA 3BWMA 2DPGA 3SEFA 1S3GA 3NV7A 3CIOA 4G5OA 5KYVA 1PW7A 4E5PA 2AF3C 4W5OA 4I9FA 4XGIA 1A9PA 1YE8A 3AJIB 4PYIA 2ZB7A 2VRNA 5FORA 4XFDA 4R7ZA 1TYEB 1XDDA 4DIEA 3E9ZA 2BJVA 2H1RA 2WHEA 5D7BA 1VGRA 2LDXA 4GMXA 1RAFA 1M75A 4X84A 4NONA 1ODTC 1WDTA 2MMGA 5EESA 4X8LA 5SYMA 2R8XA 4ND8A 1XELA 2XWSA 4PZCA 4TGLA 2XCOA 3L6CA 2DWOA 3WGUA 4BB0A 5EJ7A 2Z1NA 4FHGA 2L09A 4KQEA 2PEYA 3GIWA 4ROTA 5I48A 4NU8X 4LVOA 4TRJA 1V9LA 3QSYA 4JX8A 2X0KA 1L7EA 4LC0A 3UHPA 4IEIA 4YAJA 3E9DA 2NM0A 3ZCXA 3RWBA 4BLOA 1YLAA 1C3XA 1Q0HA 4CGYA 4DBZA 2HRDA 1Z0JA 4K9QA 1NBIA 1VKZA 1IPHA 4YP5A 4FEGA 4ACAA 1KK1A 4TVSA 2C9DA 3PUXA 3VM6A 3T4EA 1JIKA 3IKVA 3NM4A 3DEFA 3D8LA 1MA0A 1P39A 4F46A 1OFUA 5F35A 2ZG6A 1M1UA 4JY7A 2Q3BA 1ULAA 3T3GA 1QUEA 1VKJA 4RZHA 2HOQA 2ZDHA 5BV7A 1YVDA 3AJRA 3PX2A 3NHYA 4WAUA 5EWLB 4PAOA 1J8VA 4M1SA 1XHLA 1NT2A 2CHQA 1Y9ZA 1TJ5A 2ESRA 4OFXA 3LQ4A 2FQQA 1NX9A 1JDNA 3EC1A 2X4AA 2E4WA 1VECA 1FQWA 1FRQA 4INZA 4N0DA 1IOZA 1TOAA 2LGJA 3LCJA 5FWDA 4DCPA 1ZXLA 4UFPA 2X4LA 5GONF 3LK7A 5TVGA 3VC7A 1OC2A 2ZSEA 3DZFA 4OBEA 4C01A 5D3ZA 4PZPA 1VE6A 5F1YA 5JQGA 1CQIB 1PLLA 4G01B 3DOEA 3W5SA 3ESQA 3L8YA 1U7XA 4BNIA 3IXQA 5K3BA 3QIVA 2ZETA 1MAUA 3ZX5A 1CR1A 5FOSA 3FFAA 2VP4A 3KB8A 4L4XA 3V76A 4FGWA 2HPVA 2ECFA 4TMYA 4U7JA 5LYJF 1W46A 4GYWA 4ISCA 4TN1A 1PUJA 4WK0B 3L0BA 1QQ7A 1U3VA 2L2QA 4C7BA 1VCMA 3NEPX 4A3SA 1R4GA 3I92A 2HHLA 4R1UA 4X1IB 2Q2OA 3H1GA 1GITA 1SQ0A 3W5BA 1YRWA 2NYRA 4DC9A 4L07A 4KRXA 3K9NA 3VOSA 3IQEA 4I3FA 1VL5A 3T1HM 1M10A 4DLZA 4IIBA 3RT1A 4E30A 4GKJB 1GABA 2B7CA 2JGKA 5AJVB 3CVVA 3VR3D 2PD4A 1WIVA 3W79A 1YRHA 1EFRA 3OQBA 4AZWA 1SG9A 4K6CA 2MSWA 3MMNA 5I5GA 3OO0A 3DH0A 1ZCZA 5KYXA 1QTRA 1XD2A 5A2QA 5EMNA 3OSZA 4R3WA 4QA9A 3ABZA 4MQFA 4F2PA 3ZXIA 2DETA 1DG1G 4P93A 4JHLA 5AI8A 2ZIZA 5F51A 2ZYUX 5FTJA 1E3MA 4K6FA 3S81A 3VHLB 4C43A 2H51A 2JLSA 2GRJA 1AG9A 2POCA 3ZU3A 4XIFA 2BMJA 1XEWX 2GMWA 1E61A 3B12A 1H85A 1AUOA 4PAMA 5CLIA 2O3QA 4N8SA 1WAMA 1CERA 4DUZB 1REQA 5E7JA 4TSRA 3RVJA 5ADWA 1P8JA 2VOJA 3EAFA 3SMPA 5J23A 2C4UA 1RLJA 1JKXA 1N33M 1E1QA 2RC5A 3SC2B 3PR3A 2Q27A 3OT5A 4AY6A 4B74A 3TZEA 5L3ZA 4NFHA 4G3OA 2PCLA 4BLRA 5HGXA 1QVWA 4ALIA 3TI9A 5C8ZA 5K8UA 2XCUA 5BXQC 3L6RA 4RU1A 5ILQA 4ZIRA 1ZP6A 4JEHA 3M5PA 1IOVA 1KJYA 1K08A 3AIMA 3C3AA 4FOTA 2ZM6M 1FNCA 2R11A 5GTDA 2BEWA 4Z4HA 3P2KA 3BEDA 4L50A 5DYTA 2UKDA 2PUHA 1T9AA 1E6UA 2H63A 4QYXA 2AG1A 1A72A 4TROA 5ER9A 1KZHA 3C3MA 3N0TA 1ISSA 3RREA 1LDEA 3WDSA 1WJ7A 4DLXA 3WRXC 3PTAA 2J9YB 2R751 4ZI7A 1QO7A 3GP3A 4KQJA 4K5QA 4CEIB 4CKYA 2GVDC 1M1NB 4FHCA 1CCWA 4KOAA 1PBTA 5M34A 4X41A 1IXZA 1E92A 1QVAA 2OXEA 4ANFA 2EFCB 4RD0A 4U39A 3E84A 3OU6A 2X5XA 4IV8A 1XEAA 2F1HA 5G4KB 1NQXA 3QEAZ 2CDNA 2Q07A 3E9CA 4H6VA 5L51A 4FZRA 4ARCA 2DU8A 1FMJA 3FXAA 3LHSA 4HBZA 3K70B 4I6GA 3LGAA 3K92A 3LCCA 1OFGA 4ZT7A 4MI9A 3IKJA 5FNZA 3GLGB 3BF8A 1I8TA 4DR1B 1TADA 2VYVA 3MHTA 2P2DA 4XDZA 3CGWA 3VGJA 4S3MA 5CB8A 1BMFA 4CLHA 4RCVA 4B3XA 2H4XA 2UZAA 4G0MA 3JWPA 1EK1A 3K9GA 3RTBA 3GV0A 4Q3DA 4RPIA 3DMDA 4JP2A 1II8B 4OU7A 3GBSA 5C32A 1GNPA 4IDDA 3RJMA 1CZLA 3IRVA 3WL5A 5AVZA 2D5LA 5HSGA 3TUIC 1XDUA 2K6BA 1EUDA 1ZMBA 5BVHA 4Q19A 2IY8A 1N36B 3OIFA 5HKKD 3QTTA 1L7QA 2I6XA 1A9QA 4UTOA 3KOYA 1G98A 3W2EA 4A6EA 5IXSA 2D5BA 1MJGM 3AW8A 4LHYA 4PS0A 4PRLA 3LQYA 4G84A 1BCSA 3TJRA 4KQXA 3EVEA 3PC4A 1PR2A 1EZZA 5H3HA 3AHHA 2X8LA 4PLPA 2QQ8A 3BXPA 4OL0A 1BS2A 1JU9A 2C1XA 1XNJA 3VR4D 2HIAA 4W1RA 3D6VA 1PJTA 2ORVA 1BCRB 1M6NA 3JCZA 4PZ9A 4Y18A 3B51X 1NNLA 2COUA 2H2IA 4KKVA 4JMLA 2WT8A 3VDUA 2DPYA 1NLZA 2WJGA 1HFKA 2VJMB 2HIGA 3GRYA 3Q9NA 5BN1A 1YFLA 1XTQA 3T3DA 1XEWY 4ARUA 4O1IA 3QOXA 1XKQA 5DMHA 1JHMA 2QUKA 3FSGA 4S35A 4CMHA 3ZGLA 4CIBA 3CEMA 2G3QA 3GF4A 1R3UA 3TIXB 3KJGA 1K82A 1G5QA 3C3YA 2Q5HA 3L1KA 5I7WA 2EAUA 3GRVA 4EVRA 4DFDA 3GRPA 2WA1A 3WC4A 1NDQA 3Q11A 3EXHA 2IIPA 1E3QA 4MIKA 5DBFA 5KX5A 2ODEA 2J09A 3EEOA 1E58A 1GARA 5CFOA 4PAWA 2RBEA 3O84A 3L7AA 3GFBA 4KN6A 3TZ6A 1Z7BA 3T52A 4OLBA 1JQAA 4KYTA 4PWZA 2JY8A 4FFVA 2YVLA 2H59A 4RTQA 5J2TF 2UVPA 3HWRA 1Q0SA 3L7OA 5FJIA 5MF6A 5GP1A 4LXHA 3L7BA 5KNDD 4CIZA 4DR5M 2ZRFA 3TDNA 3VR0A 4DNOA 3RGGA 1E9FA 4KQIA 4RMIA 2HT1A 4PV7A 1YNOA 2OC4A 5KSPA 2PUBA 3OEYA 4FFMA 2HA7A 4BBJA 3U1VA 3TZBA 3FSJX 1H05A 4EFKA 4AF7A 4BKMA 4ND2A 3FDZB 2XAUA 3O8RA 4R4JA 2RONA 2Q29A 1UK7A 3RS8A 1ULUA 5IM4A 2RI6A 1N75A 3L40A 1OIWA 1GCGA 1D1PA 1V5GA 2ZB4A 1HL3A 1KC1A 4OL9A 2WYIA 5EKDA 4JJ6A 2IWRA 5LP6A 3SSOA 2VBGA 3TZHA 4FC6A 2QHXA 2GLTA 5AI9A 3LT5A 3CF4G 3K94A 3DDWA 3VMMA 4GFDA 5H80A 1QE3A 3WK6A 2CDBA 1E2KA 1XTPA 1KI3A 1XVVA 4YBRA 2H5XA 1CZKA 1RLIA 3MWEA 4UFNA 4WX2B 1UT6A 4D0SA 3ZDQA 3TPCA 1WL8A 3GW8A 3GMIA 2CWBA 2BHRA 1OYOA 3BTVA 4RAOA 2AWOA 1U8UA 2FSIA 1ONBA 1U1EA 4Y9UA 1J5PA 1EFVA 3HX3A 2YIJA 3T7EA 4A0QA 5LZ4A 3DKVA 1DX6A 5FWNA 4FBGA 2QP3A 4PO9A 5G2OA 5IW8A 4JL6A 4QU9A 3EUWA 4NRVA 3BWBA 1ZV1A 2K7ZA 3TRJA 1BXGA 1MHTA 4DPMA 2L0XA 3NORA 2VP5A 2Y0DA 5CH3A 3WE7A 1U94A 1S4QA 4WGFA 1FP1D 3M89A 4A8HA 3CLKA 5I7VA 1FSFA 2ZI5A 4EP1A 3BOSA 1DE0A 4D3FA 3K6RA 2QZ4A 5CHEA 3AY3A 1MO4A 1VLHA 5BT9A 2EYQA 1HX7A 1ZSNA 3OTQA 2YJZA 4I4TA 5CT4A 3KD2A 5HHTA 1NHGA 2NU9A 5D87A 5IBQA 1YJAA 5KYNA 4LX8A 2H18A 3ZTYA 1IZ0A 5LNK1 2DF8A 3JU3A 4OUDA 2A67A 1DBWA 4DDUA 5I4IA 3PUVA 2PX5A 2ILVA 1MX0A 2DWUA 3CUKA 4BFTA 2WUGA 1YA6A 5BRAA 2QRZA 1NAHA 2C5RA 3WK8A 3L8HA 5DEIA 1N33B 2JKYA 3GGSA 3WBBA 4CM8B 4KO3S 1VE7A 5AFSA 2OD9A 2WV7A 5ENVA 2ID4A 3BWDD 4JN6B 4KAXA 5AK5A 1WP9A 1VHLA 2Z9BA 2X5OA 3NBFA 3WI7A 1N0IA 5I9BA 1OV4A 2QNIA 2OFFA 2D0PB 4UE2A 1GADO 4HEA1 1V26A 4D43A 2ZM6B 1TTTA 2LNHC 4FGZA 1EXMA 4H7EA 3EPHA 2VDNB 1I2CA 2DG2A 3F5SA 2VA8A 1WHSB 5EKUA 1BDBA 2YV3A 4WVLA 2QSYA 2B25A 4Q48A 2YMQA 3VX4A 1ZKMA 1VM6A 5CFPA 3UUEA 5JATA 2BGLA 3TM4A 2E5LM 2ZI6A 3RS2A 3W04A 1NMZA 3MYRA 4Z7JA 1CR2A 3GQBB 4DBVO 2YQZA 3NRCA 4P4LA 3UV6A 3RQIA 2XTJA 2ZXUA 1N57A 1N9GB 5BSUA 4OH7A 1SHJA 3HCBA 3VZCA 1RQPA 2RHGB 3P9PA 5EWJB 4AX4A 1R9NA 2CJPA 3MINB 5F9MA 3TL3A 3WGYA 1EDZA 2PKQO 2JBWA 3FPBA 3QXXA 2ZITA 5KCZA 4LXIA 1FFBA 2GWHA 2FPPB 4X60A 2WWXA 4M6WA 3I0ZA 4XRRA 5H0IA 3AL2A 1CUIA 4RPCA 3ZHYA 4KQGA 3KQWA 3SZ3A 2CLFB 3GLRA 5J63A 4EA7A 2BGWA 1KMHB 2H2WA 3JAMA 1Z36A 5CIYA 2IKSA 5BNTA 1NULA 4ID3A 1EJ6A 3U3OA 3BGSA 2GSDA 2I4TA 1CJKC 3OFNA 2JGMA 3X43A 5AK0A 5DBEX 4E15A 5FOQA 4L75A 4M1MA 1NR1A 1BU8A 1T26A 4I0WB 4HNRA 4XOUA 2CLIB 1QGUA 2P27A 4N9WA 4G09A 4D9NA 3O4IA 2JIOA 3I2KA 4FB5A 4MUHA 5ECYA 4QULA 4RXMA 2CDRA 1X1SA 1P3Y1 1R5OA 4C4YA 1JHUA 4KK3A 4CT0A 3WNDA 4DG9A 2PKEA 3UHOA 1PFKA 2H1SA 1L7DA 2Q5FA 3CHYA 1WPQA 3AKYA 1NT4A 4QATA 2C9MA 2KW0A 2N42A 1NUSA 3HU5A 1ZHHA 1NO1A 1JQ5A 1QS0A 3H1BA 2FFAA 4PRYA 3QLUC 4R8VA 2W48A 3MF4A 3L92A 4CM7A 4J0GA 1GOTA 1UPCA 1KRHA 4QXRA 3BE4A 4BGUA 1S3IA 5T4EA 3SM9A 3BJEA 1PJIA 4BZPA 2AK2A 4NZNA 3QFTA 1IAQA 2GCEA 3T6PA 5ALRA 3QLTA 1C9NA 2LVPC 3RUAA 5EJ4A 1QG6A 1XPRA 4EFLA 1D9ZA 1JG3A 2WKRA 3OVMA 2V6JA 3V4FA 2I6UA 3IESA 1PR4A 3DXFA 3N2IA 3WKAA 3GEDA 2OZEA 3FWZA 3U60B 2NVUA 3ZV6A 4UVEA 1ZD5A 1W0CA 1X8JA 2QB5A 1CFJA 2CK3D 5B53A 2BI7A 5A5DA 1H93A 1I0IA 1QFYA 1Q77A 1Q7EA 1IXKA 3S1SA 4TL9A 3TXXA 1E8MA 4BO5A 1JJBA 4N0QA 1TCVA 3K8ZA 3NH9A 1K5GA 1SC4A 4WZBB 1G6HA 2CXXA 1BE8A 2VHUA 3WGKA 4K05A 3OJXA 4OA8A 2HPHA 1Q84A 1MJHA 2F55A 1G60A 3H6GA 3V8RA 5IYZB 1XAIA 1VSBA 2J59A 4LJYA 1ZK0A 3BSYA 2PYZA 2UXCB 3ICWA 4ZICA 2C0CA 4YJ2A 1ENPA 2AG6A 2QVYX 4GLLA 4ZEVA 4B3MM 2FMIA 1JMKC 2ACWA 1N8SA 2FUNB 2C95A 3LFTA 4G4OA 2Z8ZA 1Z6PA 2A4KA 2WMOB 1RYNA 2DI0A 3BE8A 2VWHA 3L0CA 4JI5M 2PX8A 5JEEA 3R8CA 2HLNA 5BV0A 1IXSB 1ZUNB 3ZHXA 1SQSA 4MW2A 1K0FA 4ARAA 1K5PA 3ZHUA 3IFSA 1FVXA 4DGSA 1CUAA 4YJDA 3W78A 1RYMA 4F56A 3AESB 1A5TA 3HXLA 4QTTB 4TMTA 1VJ1A 1U5BA 5LA6B 1UBOS 1IIBA 5LUAA 1EVKA 2VJQA 3NPMA 3ZWOA 4TZTA 5JAMA 3OKCA 2ATVA 3ND6A 5ES3A 1AKRA 5J47A 4HRYA 4R3UC 3M4NA 1P7YA 3DV0B 4AJOA 2CDAA 2GFQA 2BR3A 5ARBA 4YCMA 1RCTE 2GZRA 1XNHA 3LQRA 1LSUA 2A9OA 1YBMA 4JT9A 6ABPA 4H1WA 3HWSA 3B8HA 4URZR 3HRKA 4D9JA 3CV3A 4IG9A 1H0KA 2VT2A 3BH7A 4JR0A 3BMCA 3N70A 1PTKA 1RWOA 2XY4A 1V7QA 4CJ6A 4Q1VA 2PBRA 2WHRA 2TYSB 2Q9BA 4LRTA 1C14A 3ST7A 2BGRA 1JTEA 2WG1A 3MS2A 3SLKA 1Q16A 1LDMA 2WK1A 2Y68A 1XALA 2BP7B 1BX3A 3A6HA 4BO4A 5JECA 3L29A 1OXKB 2NG1A 4MA5A 6PFKA 4DIUA 2V59A 4DNFA 1X92A 2F3QA 2GLXA 1P6QA 3UXHA 2A94A 2WUDA 4IDEA 2VWGA 4TKMA 1ZMVA 1IL0A 1AKEA 4PPGA 3RBXA 4CCYB 1TNDA 5K0ZA 5DASA 3P27A 3PKJA 1D2AA 1NTOA 2VVTA 3R5TA 1SVIA 3E2MA 2FVXA 2CNOA 1H8EA 4WKGA 3DJYA 4K9MA 2H2FA 1ZN9A 4PE5B 5KYYA 1KH1A 3GZNA 1QBKC 4D9IA 3I9KA 1SURA 4QODA 3T5MA 2QT1A 2WIBA 5EHGA 3PRYA 1V5WA 1JDVA 1GZDA 2ENUA 1AHHA 4TMWA 4YXWA 1U2QA 1FJGM 2FF7A 4NENB 3BUSA 4HADA 3MT0A 4GXRA 5JD3A 3BXHA 3S44A 1CS0A 4OAOA 2LCQA 2JLCA 3PPWA 1M1ZA 3RSSA 1D8AA 3Q3IA 4XD2A 2XYVA 3UO8B 4I55F 3R3XA 3ENNA 4FMBB 1I0LA 5JC8A 3UMSA 4L5IA 3ZJTA 3ICPA 2X22A 1J8QA 1KY2A 4NXMB 1VE9A 2B1QA 3ZXUB 2KLBA 5SZIA 1GZSA 3DAHA 1V2HE 1DXQA 3M49A 1K6EA 1WS6A 4F4CA 4BN5A 2PNJA 2HFJA 1XRSB 4MR7A 1LY1A 1GGNA 2JL1A 2IW1A 3QENA 2F67A 2J3DA 2NU6B 4KGXA 5JH7F 3G2LA 4HWOA 4BMYA 5FTKA 2JZ1A 1T2NA 4E6EA 1LK5A 3K6KA 3OM1A 5EIWA 1OH6A 1PZGA 1UPFA 2BFEB 2JDID 2IP2A 1M73E 1B1CA 4PD2A 4IXWA 4NABA 4XB1A 1VEKA 4B2IA 2HCJB 2Y27A 2DAMA 2YN2A 2A9KA 3UZUA 5A4IS 1P5FA 2ZSKA 2C88A 1WXXA 4OKNA 3OQ6A 4P7KA 3GJ8A 2IIQA 3A6GA 2NX2A 1D2CA 2B8NA 4P1ZA 3WB2A 2JFWA 3C1OA 2NSHA 4H15A 5FPYA 4YJ3B 2IZ6A 5KTKA 2KYRA 5A3RA 5ALDA 3Q3VA 4K0KB 2B8TA 3Q3EA 1HE2A 1UMBA 2CJFA 5KTRA 1LI7A 1A7UA 1KZ1A 3LUHA 2E5LB 3VI4B 3IA7A 1JG4A 1N78A 1YASA 4LBWA 2C5EA 4Q4LA 4RVUA 3JSAA 5FBWB 2VUUA 4J07A 1WZIA 4NJEB 4L5AA 1KI7A 3LQFA 1G9XA 1WQ4A 4DLKA 1C9DB 3OQPA 2AKAB 4J75A 4UHEA 5EPUA 2YJNA 5FWXB 4QXAA 1K98A 1QNFA 1XHEA 3D5EA 4FE3A 2W6IA 5T4BA 1EQAA 1NMEA 5IBPA 3JD4A 5BUZA 1V39A 1HLPA 1GPJA 2ZR8A 1ISRA 5C7LO 4RYLA 3H5OA 3UMMA 2JFGA 1U8FO 3FWPA 2HLDA 3K9CA 5HCNA 4H17A 4FEEA 2ZQ5A 1M2VB 2HF2A 4R1SA 2IZ1A 2ZBRA 1I6LA 1HA3A 3T7JA 3E05A 3TVYA 3L9WA 3P2IA 1ZUIA 4CFZA 2P9BA 2VHQA 1MZPA 1A9XA 4ZGWA 4PQGA 2EX1A 2ORIA 1DXOA 3VU0A 4I4NA 4OQYA 4CVNA 2L17A 1BOFA 3EDRA 2B34A 5T8KA 4RSGA 1WZ2A 4HGPA 3FNFA 2AOTA 1TU0A 2XQVA 3NWOA 2BMAA 3MBIA 1YB1A 5DX0A 3WX0A 2F00A 5IANA 2OGZA 3M1AA 1Q1BA 1KK2A 4KIJA 2KBEA 2WJWA 3V33A 2VQDA 1PE0A 2BTQB 4Q12A 1UJCA 2IT1A 2P9TA 3MTJA 2OHJA 1C0PA 1O6FA 4UNIA 4KR6A 2QPTA 1I3OA 2P65A 1YZLA 1KKLA 2GF2A 1WSWA 1CNEA 1ZZGA 2AFHA 4PNHA 2WWIA 2GPTA 2QD4A 2A35A 4LMPA 3KQSA 4YP1A 3U19A 1NQTA 1EA7A 3TLYA 1CV2A 3PXAA 5KSZA 1UFQA 3BK7A 3F97A 2CF5A 1NV9A 2GS9A 1TDJA 2ZJ0A 1JWAB 4GKJM 4YUZA 3JQ7B 1GD1O 4M83A 4OQNA 4D82A 5BWOA 1NJSA 3CZ9A 4C03A 2L2DA 4OHOA 4OYHA 4ND4A 4ZPJA 4EMTA 5B2EA 1K6JA 5BSVA 4TYWA 4P86A 1N0HA 1QP8A 2A86A 3LTEA 2DWZB 3I3SR 3FPHA 4OLJA 1KTVA 4NSRA 1NUTA 3G0BA 4QOGA 2FG7C 2AG0A 5LOVF 2NQTA 3COJA 4LXYA 3AXTA 2QAGA 2B4AA 4WZAB 4W7IA 3QKRB 3LDFA 1D2RA 4LHSA 1GQQA 2YJ4A 5H4HA 2NXWA 3CRQA 1NLUA 3ESZA 4DUZM 3NBXX 3DGFC 5B7PA 4KR7A 1T34A 1NNUA 4O59O 3LX4A 2AJBA 4B3MB 3HI4A 4Q05A 5KPZA 3TZQA 2Z4TA 5C0OE 1JEEA 3EGIA 1DTWB 3EXHC 2HTFA 1E77A 4S1VA 4B5KA 5K0BA 1L2DA 4MIOA 5KNLA 4M46A 2YNMA 1B0PA 2WA2A 1E64A 4TQAA 1D09A 3EXG2 2Z9DA 4KLCA 5D5QA 3BT7A 1OIXA 2V3CC 1CUSA 5TMDA 1S0UA 3EXEB 1IC6A 4D8VA 5IULC 1X1TA 4E5NA 1D2NA 4LC9A 5HEKA 2AEFA 3HDVA 4FYWA 1PQPA 3H19A 1FB5A 4YRFA 1Z82A 4C4RA 3Q7PA 4Q66C 5B2FA 4Q3BA 2VF7A 4NSNA 4D25A 1F8UA 4IGEA 1YJCA 4KJXA 2F1KA 1RQXA 4NCHA 3ER9A 3WNQA 1QIMA 1XLVA 2IVZA 4WESB 2NP6A 1Q19A 2NTVA 1F0PA 5CLQA 4ETNA 1QVZA 2V6FA 3N0VA 5AQ1A 2B5WA 3I8OA 2PGXA 2QRNA 3LCVB 2VH2A 4IX9A 1JAHA 3K0SA 4ZHSA 5F2OA 5IUKC 3STVA 4C4TA 2AXQA 1R0YA 2I2XB 2GN8A 4FFPA 3F46A 4QGHA 3N6VA 4UU1A 1E5TA 1H0RA 3H1FA 3Q72A 2CVFA 4HLCA 3A1VA 1R0ZA 4GQIA 4C07A 1VKOA 4HWGA 3LBIA 1CZUA 3NWJA 1EK6A 1Y4UA 3ZKAA 2VZLA 1U98A 1HF3A 5I7FA 1C7IA 4OW0A 1FU7A 3FWHA 1R6XA 2PSHA 4E21A 4P7FA 121PA 1ILEA 4DQLA 2WNIA 1JLHA 3WKEA 3RADC 1L5SA 3HM9A 5J4VA 1JLMA 3NM6B 1RWKA 5A4KA 2IPOA 5LVAA 5ALIA 5EXXA 2X9GA 4JBLA 3V4LA 1F06A 3T5DA 4OHKA 1HDEA 4GP6A 3O0TA 2CNLA 1L4EA 4KPUA 4B79A 3E3MA 4AN0A 1IRXA 4H3KB 4TQ9A 1LQ2A 4QDZA 4L7QA 2OP0A 5AVUA 1E1RA 5FTLA 3WAKA 4IKPA 3TOVA 1EDEA 4JYBA 2A9QA 4F9EA 3VHQA 4GC5A 3OP1A 3FVTA 2CHEA 4KMSA 4YQEA 4ZCIA 4YY3M 1KPIA 4LZNA 4TT3D 1N36M 4QT4A 3M9WA 3L0YA 5FA6A 2J0SA 1GDHA 2OHGA 1T8PA 4CL2A 2I3AA 3TDKA 3IQGX 3KS9A 4K6OA 3KTOA 5E6RB 3GG2A 2Q3EA 4HNSA 4JXZA 1T91A 2O4CA 4WZ6A 1QE5A 2WUEA 3MWFA 1YKSA 3QEKA 5C8XA 3AHGA 1CRQA 4I6JA 3A1DA 5B3AA 1DJNA 1A4XA 3QVSA 1XBTA 4YLYA 5LQCA 3FOWA 4Z7OB 1NHGC 4BYGA 1GKIA 3IDAA 2ZDGA 5BPHA 1XN4A 3IV6A 3E2PA 2BZSA 4BU0A 4L15A 1SHTX 4E6PA 5GV8A 1WW3A 4JD5A 2QRKA 3RWMB 5HRCA 5KYUB 3FX2A 4B47A 2HZBA 1FUIA 2VBCA 3LJKA 3RIGA 1Y3CE 1QHSA 4Y6LA 1TQHA 4IVNA 1AC5A 1EFAA 2ICAA 5AP9A 4HB2A 2I3GA 3RV3A 2RG1A 3FAZA 1CLEA 3VR2D 5I9IA 4GGMX 5BMVA 3G1WA 3AEQA 3BCRA 4BO1A 4NJMA 3HKEA 3E3NA 1WZEA 4F4IA 4MCAA 2BNKA 2MWMA 1ZD8A 5CFZA 4ZT2A 4I55A 1R18A 2BFAA 2R6HA 4U7GA 1X7WB 4CTKA 3L8GA 1J22A 1W49A 4YMLA 5JG7A 5DYWA 5J59A 4WINA 2QTLA 3WGZA 4DYVA 3TSWA 4FIDA 2QBYB 1WUIS 1J25A 3MK31 1ZIYA 5LWQA 1ZDMA 4IDFA 5TNXA 3RSFA 1AKUA 3Q7SA 4MV5A 3MFQA 3TLGB 2D0IA 3VVBA 1F5NA 621PA 3MJTA 1LV7A 1C3VA 3CU5A 3FFWA 3WISA 2O59A 4CEHA 2VF4X 5L6LB 3RFWA 4OGFA 2VK8A 1KOLA 1HSOA 1MNQA 2HF7A 4X6UA 2I8LA 4NK4A 1IFYA 1KR5A 5D5HA 1FS5A 2IHKA 4QRDA 4OYYA 1JLLA 2HA5A 3TTWA 4PIMA 3SXJA 4WEQA 4MQ6A 3RIEA 4EPTA 4FW8A 3AV0B 1E1KA 4M21A 3EY9A 1EM8B 4GMFA 3OY7A 1QOZA 3EZ9A 3KYBA 2Y21A 3P0HA 1MP0A 1KVUA 1XRLA 4MWTA 2VATA 1LJ8A 3O8LA 4B09A 5IAKA 1FYWA 4Z7QB 2KRKA 4U8HA 4KHZA 1CY7A 1GL9B 4IHJA 1K89A 2IA5A 1I3CA 2WJJA 3U4DA 4ECEA 1KKUA 3PS9A 4M1QA 1JHPA 3E53A 3TOZA 3L79A 3G0IA 3BJMA 4QQRA 4OX9B 1GQYA 3KEOA 2RB4A 2W43A 3NFRA 3WMGA 2QYOA 3INYA 4DG5A 2C2KA 1Q2UA 1EE9A 1H0HA 2TS1A 4AICA 3RVLA 3ZU4A 5LPNA 2VFAA 1N2EA 3MMPA 1W88B 3SJUA 1MAWA 4KN8A 3TCNA 1K3UB 2R87A 3HC7A 4V0QA 1RZUA 1V8FA 4YH1A 3VC2A 5DHRA 1FRFS 2Q8QA 3M6MD 4LNUA 1PZMA 3ZW7A 5CHYA 2UYYA 1BU5A 3R0ZA 4BO7A 5CA1B 2CVZA 4X97A 1WDMA 1N2CA 2XHEA 3ZDRA 5AKZA 4MKRA 3MTQA 4XUDA 4YRTA 1E4VA 3LK6A 1H1TA 3CPEA 4IHAA 3UBMA 1ZD3A 1UP6A 1G19A 1TCUA 3T7RA 2OB1A 3C14C 3BMQB 1HNZB 3Q5GA 1RC8A 1WJGA 4II7A 4CU5A 3KOOA 4OCZA 2BGIA 5F78A 4EY5A 4U9HS 1EDBA 1T8YA 1VXOA 3HLYA 4AROA 2VOEA 5ECDA 5GJVC 3CFYA 4XJVA 1A95A 3B7QA 2J6BA 1Z59A 1QYVA 2PL5A 4E5YA 2RJ3A 1H94A 3K2EA 1MU0A 2R8BA 3KX2A 4NEHB 4DDVA 4WNYA 4QXMA 4LV6A 3H2HA 1LPBB 2ZRJA 1CT9A 2CFIA 2XBLA 4KUHA 1SXJD 3T6KA 2IGBA 2ODWA 4K28A 1YE5A 3I1IA 1Q74A 4PR0A 1JDZA 5DM0A 2SCUB 1ZMTA 2JRCA 1T8SA 5JARA 2G80A 3RO7A 5C9ZA 3OCUA 3RI3A 3IEPA 5DB4A 2J4FA 2Q1WA 1UDCA 1MFZA 2XGSA 2KB0A 5AVVA 1EHCA 3GC6A 4AS2A 5IDWA 2QZ9A 3U61B 2G67A 1HMPA 2ZCUA 3TAUA 5FDFA 2QN7A 3WYNA 1L7MA 1EIJA 2ECQA 4XJXA 3EMKA 3C15C 4MROA 1GA4A 3AHIA 3UPDA 4TTSA 1T36B 4G5RA 3G7SA 2G7MC 2P7HA 3O03A 2JY6B 5C35A 5MN5A 1YS9A 5CLJA 4L4YA 4O3FA 4V0KA 4KXXA 3ROEA 3K4QA 4OLHA 1QP0A 2J7OA 3V00A 1CQZA 5LIPA 4BX2A 2FSSA 4HNVA 4XQEA 1OQYA 1LPNA 4JLPA 1BQ4A 1KY3A 1PJ2A 3V4SA 2O5CA 4ASUA 4ACBA 3KPWA 3ILHA 2FPGA 5HS4A 4E5MA 1RKXA 2FA9A 1CHDA 5EUCA 2P9EA 1DINA 3KZCA 5I7UA 3HZZA 4FS3A 3I73A 4AL4A 1MCZA 2DWCA 3VJLA 3TTUA 5HMMA 2CRUA 1HFJA 2QM0A 2RIPA 5FV7A 4O4HA 1UBMS 1BTOA 2JGJA 2OYCA 3NQ41 3ZD9A 4KZPA 1UDAA 1JBKA 3TQCA 2REQA 1JI3A 3KKQA 3NHBA 3TWMA 5HILA 1W8IA 3GROA 5TQ0A 2B98A 4DOMA 1LVGA 3HY3A 3OBBA 2WSEF 3NEYA 5BN3A 1BVHA 4CQLA 3AWDA 2XXAA 1AHNA 2HV9A 3N53A 1GTZA 4IAOA 1KOFA 3LKBA 4RS4A 4BNFA 3B1KA 1XVAA 3UPTA 4KXMA 5G02A 3LUFA 2AOUB 3BULA 4AS3A 4XYLA 4DCGA 4TTTS 4MK4A 2V55B 2EU8A 1HT1E 4BNXA 3FCUB 1JHAA 1VE3A 1KYWA 5FO1A 3GNLA 1ZGAA 4IH4A 1JZTA 1U0TA 3N2GB 4W4TA 1I0ZA 4LA4A 1MD9A 4HO1X 3FYUB 1F8XA 3OZCA 1MVOA 4TV9F 3HRIA 4QPZA 5B3LA 1UXOA 4LXUA 2BTOA 1E6EA 3VDMA 4GNRA 4YDQA 3W9SA 1TVMA 1W36C 4IF4A 3RC3A 2PZFA 2P2YA 4FGLA 2DFLA 3VMFA 3QU5A 3O7MA 2A5DA 3E15A 3ANMA 3OEWA 2VYND 4B3IA 1X7XB 4YY3B 5B7NA 2I55A 1XLWA 1EVQA 3DOUA 3EIXA 4IZHA 1MOSA 2WF7A 1N8KA 2VUSA 5FFFA 3MAAC 2WINI 4PQFA 4ICIA 4WN9B 5ALHA 1GG8A 1WY7A 5EZYF 4ZCPA 1UKCA 4V3BA 5CT9A 3CLTD 3LY7A 4RM2A 4V2UA 2O6LA 2YRXA 1YKGA 2NXNA 1O5IA 3OZDA 5BR1A 1Q22A 4QBFA 2VC2B 4G0ZA 2IU0A 1N7JA 3EISA 3RANA 1B0AA 4RPJA 4Y2PA 2YQ4A 4CF5A 1Z7GA 5JDIC 3EIOA 3VSAA 4GR9A 3TVTA 1ZD9A 4BNWA 4FSHA 1JEYA 4M0WA 4ZV7A 2DAEA 3HJGA 1II0A 3U3DA 2F5PA 3V34A 1PYGA 3KYDA 2O8FB 5IJWA 4EB3A 1EFKA 1V37A 3LV8A 3A0UA 2WIAA 1ZLYA 5JNWA 3WYBA 3LXUX 3A6JA 3ZS9A 4WOJA 1SK9A 2F17A 4LCEA 2W8BB 3HVUA 2NSJA 3Q6MA 2FP4B 3L0DA 4A9AA 2HT6A 1CX9B 5A5GA 3OCCA 1CY8A 4N65A 3CURA 3CNLA 4D9CA 1PFUA 1RC1A 4E70A 3RSLA 1XR3A 2E87A 1P1CA 4B3CA 2OOKA 1C80A 4P16A 2I2BA 2TRSB 1DV0A 1T5IA 3ANNA 3VJKA 1HQYE 3KKMA 1DTEA 3R6TA 3BIXA 3N2KA 2YUTA 3TWKA 1ZJ4A 3O26A 2IQ5A 1WDKA 2CFTA 5HS6A 1SXJE 3QMMA 5JZSA 1O0CA 2I7DA 2UXCM 1SVSA 1ZH8A 5H82A 3W3AD 2YZKA 1IEWA 4JBXA 4W99A 1M0EA 4CCWA 3U4AA 4DZRA 2XA1A 3U9TA 1DIAA 4NZPA 2CV1A 2QR3A 3EB9A 4X61A 2V1XA 4WXHA 2VJYA 1X0XA 1UWVA 2W22A 1ZGBA 2ET6A 3WIVA 3NLLA 2J45A 4PX2A 5JSKA 5K6AA 3ESYA 2O8BB 2FQYA 1F51E 4KIGA 3P2OA 4QGFA 2YJ5A 3EJ6A 1FQJA 4UQLA 2ZS9A 4M1ZA 3AEXA 4X0EA 4ZQIA 2BFNA 3DD5A 2QMOA 1KORA 2ZBVA 1XQXA 1P0QA 4XE5A 3UCFA 4BUJA 5HXAA 4Q9JA 2REOA 1WNFA 1NF8A 1XMVA 4H1HA 1JYFA 3IMEA 1LEHA 2FHPA 2UUAM 4U1RA 1PGNA 3PT9A 5F3RA 4DIBA 5CT8A 3KJHA 3U7QA 4IWYA 1OI7A 3DBOB 2JJ1D 3TCXB 3TW8B 2R96A 3CLVA 4J8PA 3VNRA 2IX9A 3LA8A 1C7JA 1F0KA 4Y9SA 3HB9A 4OM8A 2WSSA 4F96A 2JRLA 1VG1A 4IVPA 4CHTA 1L7XA 2QR5A 1AX9A 1Z7YA 2C4HA 3H84A 5B4UA 3V3KA 3CT4A 2IUFA 1HT0A 4O6VA 3TJMA 1ZH6A 3L7MA 5I7EA 2I71A 2GM3A 2CNBA 1GT6A 4IGAA 1QH0A 2A5YB 1OC4A 3WGJA 2WSYB 4J3JA 5T8KC 2IE0A 2WIDA 1APBA 1BJTA 1C1YA 4IS3A 1KDOA 2CVOA 2GD0A 4UBKA 1MB3A 2A1UA 1UM8A 5K3FA 5IZCC 3TUJC 4C3ZA 4J4HA 8ADHA 2AI3A 4KRFA 5EXDA 4Y2TA 5LQRA 4UHHA 2WDZA 4KFRA 4L4UA 4R2IA 5GONA 3R74A 3W9YA 3KALA 1UZUA 2V8BA 3ZWNA 4OB6A 4ESOA 3UKJA 5I5EA 2G36A 4WJZA 1SZCA 4LK2A 4OEHA 1MQSA 2OHFA 2QRVA 4F0JA 1VYTA 1P4AA 3RHZA 3TRDA 2OSBA 1XLUA 3LA6A 1TIBA 5KU1A 3ZHVA 4AKTA 1K4KA 2GWRA 4IDHA 2OTCA 2D7GA 3FNEA 4DIFA 2GZSA 1F38A 3FMFA 2WTXA 3KYCA 3QWBA 1QO9A 4K0RA 3WDMA 1L4MA 5AW3A 5BR7A 1M67A 1TI7A 3AUAA 2GK4A 2VWQA 2XNJA 5BYKA 1PKEA 5LYJA 3ZUPA 5C5EA 5LCXA 1SBIA 4NXMM 2UDPA 2QAGC 1HEIA 2AS0A 1KQNA 4E13A 3WHLA 4ABYA 4ONEA 1OXVA 5KSWB 2B3TA 4ANRA 3P20A 3GMTA 3T3MB 4OO3A 2A33A 2X5JO 2VZ0A 1B8PA 2OO9A 3PITA 4E46A 2X0RA 1LGYA 2A6PA 2YW9A 2QTVB 3WIOA 3LLCA 5CNKA 2Y4NA 3I58A 2J3JA 3QHPA 2EKLA 4P82A 5MGNA 4XD7A 4YNBA 2PRSA 3TZLA 2IDZA 1YR8A 3ELDA 1NR5A 2OCGA 4J4TA 3DYVA 5J1SB 4LECA 1ZK3A 3G5TA 3B3AA 1TUGA 1NNUC 1Z73A 4I19A 2ZOSA 3QFFA 2ZEJA 4H7HA 4FYPA 4Z53A 2OZLA 4C0HA 3O31A 4RK4A 1RJ9A 4AZTA 3C6YA 1W2GA 2RBGA 5C18A 3EIUA 2KXEA 4QZVA 1TU4A 3F9CA 3NDBB 1U9ZA 2YNMC 2FZGA 4WGGA 1RSZA 4YECA 3CKKA 2O3UA 3M3HA 4EY3A 1C29B 4DWOA 3UEOA 3JAKA 1K63A 2CNNA 2EATA 3EFOB 5HW0A 4KWHA 4Y2UA 2WWRA 4YR9A 5REQB 2UVQA 1COWA 1SR8A 1L8QA 3B2EA 4K0KM 2VDMB 3MQ4A 3RTCA 1T5SA 4YRSA 2R5WA 3DE4X 3AFOA 1WA5A 4LKRA 4MLZA 1XZJA 1LSSA 2PTHA 3ROTA 1PR6A 3C3PA 1PRBA 3EZXA 1KQ3A 1D0LA 3CNQS 2CUZA 1GZHB 3DLPX 2E6UX 4F21A 3ZC7B 4EG8A 3PUYA 1C8BA 2A58A 4CKBA 5AVWA 2XIQA 1U2ZA 4P3KA 3GCGA 3NDJA 4AJHA 4Z4IA 5IJ9A 3AEKB 5I8PA 1OWOA 4OREX 4PIVA 1Q3TA 4MH0E 2P4EA 3FZQA 3A37A 3D2BA 4UHBA 5AHXA 1Q02A 4D57A 2M60A 4LHXA 5T5QA 2RGGA 5I6DA 3UWPA 3AR4A 3LL7A 3PHGA 5C51B 1E2NA 1OYYA 1G5HA 4QEKA 1GGHA 3PDJA 1JKJA 3MWKA 4C1BA 4GM4A 3K3PA 5DVZA 1KAQA 4AJ1A 2X3FA 3HJBA 5JVDB 2PUDA 3KAKA 4DQKA 3LT0A 3CE9A 3U81A 2WPDD 4KXYA 4P4SA 3AFGA 4R8SA 4C7MA 3E1KA 4QLAA 2DFPA 3RSHA 4GRIA 3NJ4A 2XCQA 3T9BA 2ZS8A 5AUQA 3TYXA 3CKYA 2AHOA 3U7JA 1NONA 3CSUA 2GA8A 2OLJA 3U4IA 1UH5A 4GYJA 2P91A 3OE5A 3TECE 5BNIA 1TT7A 2KLHA 3CWQA 2AV6A 4Q9DA 2B83A 2F43B 3E4DA 2O2XA 2X2OA 1I1QB 1VPTA 1EFPA 3WGHA 3GRCA 5E38A 4V3CA 4ND1A 1HYQA 5DFAA 2DKNA 2XWJI 2Q5QA 1WF6A 4P17A 3WLAA 3QU2A 4JP3A 2GQ0A 5K20A 1K68A 4CG0A 3UG7A 4EKYA 1WXEA 3L1UA 4RFLA 1TH3A 1Z2EA 2P6OA 4BLSA 2O2DA 1D5CA 4PXAA 2F9LA 1O87A 4LVCA 4QKQA 1GQFA 1QO0D 2CNWD 5DZSA 1R4NB 1WLSA 1DIRA 1G2OA 1A8PA 4OSPA 1SU6A 3VZRA 1FVHA 3OQMA 1RM0A 1C0LA 3KKZA 3QVGB 4BVKA 1UAAA 4BOYA 5HKOA 1KVTA 2IKQA 3MRVA 1QE0A 3DHWC 3S4YA 3WMWA 1LTKA 4WK6A 4HUTA 1VJRA 2CXNA 1DP4A 2R7KA 1YS7A 1MN6A 3OP4A 3R41A 3PDIB 3A9WA 7REQB 4N49A 4BYMA 1ZM2A 3UMFA 1MU5A 3W2TA 2FFBA 2P9JA 2JI8A 4Q03A 2DX7A 3JQAA 4LJSA 2O3SA 3PX3A 3TZCA 3VUEA 4HLQA 5HBRA 2OVBA 2JLVA 4DIDA 1Y8ZA 1RRPA 2GI4A 4MRMA 1AXRA 1Y3BE 2YQ5A 1R4AA 3WLSA 1WCV1 1PSWA 2NU8A 2D2VA 3QFRA 2D1TA 2WOJA 2BDTA 3GHYA 2VZ8A 4N5NA 3C58A 3AUFA 3C85A 1IXYA 1BYUA 2SNIE 1E6KA 1I5RA 3WLKX 2G9RA 3AM5A 4NCKA 1I32A 3V32A 4IMIB 3WGGA 3AW9A 2WTMA 4PYJA 2QRHA 4IXNA 3ZJVA 4A0SA 1DG9A 4E2YA 3DL4A 3LX6A 3LWBA 4ZVVA 2OOBA 4AMVA 1O57A 2AI2A 5G3ZA 2POQX 5IX8A 3X1DA 4Z4CA 4D46A 1KZYC 3GQ4A 3AEZA 2OV6A 3EVGA 4XLTA 4NE9A 1NJGA 1J9ZA 2C5AA 2OMKA 1EVZA 1Y7HA 1JEQA 4I2VA 2VDVE 3QFCA 1A9OA 2XFTA 4QAQA 5EQJB 4GVLA 1G41A 4BECA 2FVYA 3AB3A 1OH7A 1U2GA 4MW1A 1JJIA 3IOYA 2JGDB 1WXDA 3KOWA 1K7YA 1C50A 3ZWKA 1MT0A 2UUAB 3ZR4B 1QR2A 3PVZA 4EG1A 3R9WA 3JALB 1Q39A 4R68A 1R6AA 5CVJA 3I2JA 4O5AA 1YFKA 2P4HX 2IYQA 1PU2A 2JBAB 3RC9A 3K9FC 3ZD6A 2G8LA 4B7UA 4NYIQ 2V3VA 1AS0A 4XA8A 4ARZB 3J7BA 2YH2A 4D4JA 3AU9A 1YJQA 3LPMA 2YWJA 1S2MA 2JD2A 3UT5A 4XX0B 4P92A 1K0UA 3VZBA 3SHWA 5DM4A 2QCUA 5J2TA 1QAMA 1EGVB 1UAGA 4NLLA 1FLVA 4HGZA 3DTVA 1X39A 3U26A 1ISJA 4L57A 4MWOA 3I32A 2PXHA 1XZEA 3ICCA 1Y5RA 1CEQA 3SDZA 2XMPA 2P5UA 3RIYA 4UASA 1E0DA 1Y6FA 3WVNA 3QTLA 2W6MA 1SZJG 2GTHA 3KCQA 4R3DA 3KOXE 3QUBA 1T5DX 2QN8A 3Q8WA 5TXGA 2I7XA 4CI0B 2OPFA 4MGHA 4OU5A 3GEHA 5AK3A 1VHJA 1YI8A 5FCDA 5LXTB 4XVRA 4RH0A 3IRUA 1QOQB 3OOEA 4KXVA 5FPKA 3IHWA 5G40A 1ZUWA 1ZU5A 2DHYA 2VK2A 3LPDA 2AF4C 5KTYA 4YEDA 3GRKA 4E2FA 2R66A 3Q88A 4QDXA 2EFGA 2XW6A 2QENA 1XMOB 5H37D 4N12A 2WYHA 4QFDA 1LBHA 2MYPA 3KJEA 4C4ZA 3OPYA 3QF4B 3KJZA 3J2PB 4WZZA 1N2XA 5IT9S 1OPRA 1XKLA 3OLXA 2GCOA 4K1XA 4JSRA 4TSFA 8CATA 3I1JA 1T3GA 4QM6A 5A0TA 5JDIA 4N3CA 3ZG6A 3DBRA 3RJZA 1QLWA 4MDEA 4PHTA 2H52A 3LDAA 4Z4FA 4O0LA 3E22B 1ZWKA 2G1AA 1EIWA 3VC3A 2QX7A 5EHIA 3HHEA 2FWIA 1Z12A 3B1XA 1KQOA 4R31A 3VGPA 2WSFF 1KRXA 1BVUA 3D3EA 3T3IA 5IKXA 5FWYB 2IYEA 4NOLA 3AFIA 1Z3CA 1ZI8A 3FFBA 1T4MA 3GUYA 4O2AB 1WVIA 2FR1A 2A9PA 3AI3A 2JWSA 2BM0A 4F12A 4MTLA 2JCXA 4RGQA 4XYGA 4MEAA 1JAZA 3D7RA 1X42A 1IY0A 3ZHCA 3NXSA 1T5OA 1I2BA 1RFGE 3I5UA 4XPIA 3P9YA 1Y48E 1WVGA 4MINA 1FNNA 5LU8A 1X1QA 1DJOA 2OECA 5B37A 4EHKA 3KHTA 2JHFA 3E9QA 2E48A 4LZOA 4UULA 2Z7JA 2YC4C 5TS3A 2LWIA 1BN6A 4F5DA 4F84A 3CO0S 1WZUA 2ZI7A 2ZRHA 4IQ8A 3ZE8A 1KI6B 2VA9A