3FTEA

Crystal structure of a. aeolicus ksga in complex with rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
VSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
molecule keywords Dimethyladenosine transferase
total genus 60
structure length 233
sequence length 233
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fteA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fteA01
3T0IA 2ZZMA 3ELYA 2KW5A 4PCLA 2PWYA 2C7QA 2C7OA 1PJZA 4IV0A 4HTFA 3MTEA 4PYJA 1KIAA 2YQZA 4PYMA 4X60A 5LSAA 3ANXA 4E32A 5DM2A 1VE3A 1RI5A 5DX8A 1FPQA 1ZGJA 3REOA 3CJQA 4YV2A 4RYLA 3MQ2A 5EKXA 9MHTA 1VQ1A 3ELDA 3L8DA 3LL7A 3UJAA 4ER3A 1R74A 4XUCA 3BKXA 3LPMA 2ONYA 5K0BA 5FHRA 4P7FA 3CCFA 4FS8A 2BM8A 4RTLA 1B42A 2NP7A 1X1CA 3QOXA 1D2GA 2WA1A 4HG2A 4U7PB 2CKDA 2NXEA 4QDKA 3HTXA 3FTCA 2NNWB 5CVEA 2GAFA 5FADA 3FUWA 4E30A 1NT2A 3G88A 4LWPA 5E9JA 5HIIA 2AOTB 1SKMA 3R6TA 5EHIA 5LQAA 1R6AA 1MJFA 1DL5A 1BC5A 2V74B 3FUUA 3E7PA 4YMGA 1KYWA 3UWPA 4CKCA 2UZ4A 2BH2A 5LQJA 2UYOA 2VDUE 4U7TB 5EGSA 3EEOA 1EAMA 1VL5A 2YXEA 3SSMA 2P7HA 4QQKA 3JWGA 2GA9A 2ZBPA 2O06A 2FYTA 2EJTA 2PT6A 3P2IA 4PGGA 2OYRA 1VP3A 1Z3CA 1BHJA 2BZGA 3G2QA 5DSXA 4XUDA 5DXJA 1UIRA 4C03A 2IH2A 3B89A 3KQQA 5E9WA 3EVAA 1T43A 1KHHA 4KIFA 3JWHA 2IP2A 2BM9A 4DQ0A 2XBMA 3EVFA 3OZSA 2PX8A 3I64A 3EGIA 3M33A 3QV2A 1N2XA 2PSSA 3G89A 4E2YA 5HEKA 3EMBA 3EPPA 1SUSA 5K8VA 1P91A 4OQDA 1FP2A 1O54A 2HMYB 4P7JA 1JG1A 3A7EA 5EMLA 5F2NA 1G8AA 1WXXA 4BP3A 3OU7A 2JHAA 5T67A 2HNKA 3AJDA 5EKUA 1XCLA 4PNEA 3IEIA 4DKJA 4X63A 4RTQA 1WY7A 4DM3A 4LG1A 5CCXA 5E1MA 3KR1A 3HA5A 4YV0A 3KQOA 5GOZA 3TMAA 4P58A 3BXOA 4AUKA 4YMHA 1WS6A 3FTDA 2AN5A 3P2EA 1NW7A 3P2KA 4MWZA 3JWIA 3CJTA 3SX0A 1YZ3A 5DX1A 5GINE 4F86A 3FTEA 2EX4A 3MGGA 3PT9A 2IH4A 3EVDA 2ORED 5DTQA 3KQSA 4CKBA 1TW3A 3KR9A 3DMGA 5E2BA 4ZTBA 4RVHA 2R6ZA 3CVOA 1HMYA 5E1DA 3KPJA 3GGDA 2QY6A 5M5BA 1XCJA 2G72A 2ZBRA 2ZIFA 4GEKA 3C6KA 2PJDA 3SVZA 2OY0A 4YV1A 2JHPA 5KYGA 3MCTA 2ZVJA 3A4TA 4QPNA 1EQAA 3V97A 5CCBA 2WA2A 3T7RA 2H11A 1G8SA 1JSZA 2OB1A 1EJ6A 4IKPA 4LWOA 5GIPE 1X1BA 1VIDA 2JH9A 2P40A 2GB4A 2Y1XA 5KQRA 4M38A 1G6Q1 4EK9A 2AOWA 3DULA 3P9KA 3ER8A 2FCAA 4PYOA 5BW5A 1AV6A 3K0BA 3KPYA 2ZFUA 2O0LA 1DUSA 3LCVB 3BGIA 5EMJA 4YUWA 5JR3A 4K6MA 3BWMA 3AY0A 2G1PA 2PXCA 1SUIA 4DMGA 2VDWA 5LQKA 1O9HA 1R00A 2O05A 3EVGA 3ID6C 3NTVA 3O7WA 4X41A 3SMQA 1EJ0A 3HA3A 4CXMA 3GO4A 3OU6A 5GP1A 3K6RA 4AZWA 1KPIA 2I9KA 1XDSA 3E8SA 3PX2A 5CIYA 1VP9A 2B78A 4FGZA 2NXJA 5EMMA 3U81A 4EQZA 5K0GA 3R9XB 4RTRA 3G2PA 4KVZA 1AF7A 4AZTA 1RI4A 5HIKA 4GOND 3LBFA 4C4AA 1L3BA 5HIMA 2ZIEA 2I7CA 3R24A 3A27A 1H1DA 2YXLA 5FHQA 5FA5A 4OBWA 4PWYA 2XYVA 3DMFA 5EMKA 2OO3A 3X0DA 3BKWA 5BXYA 4GQBA 3UJBA 1JQ3A 1D2CA 3FPGA 2PLWA 1RJFA 5DLYA 3TKAA 4GC9A 3BWCA 3KQPA 5EEGA 5FQOA 4BLWA 5EZSA 2IBTA 3I5UA 2GPYA 3LDUA 3MERA 2B2CA 5CM2Z 5DT2A 2OB2A 1V39A 2FPOA 3RW9A 1D2HA 2HV9A 2CMGA 4GBED 4F84A 2XYRA 3TKYA 5LQNA 1NBIA 2XYQA 2HTEA 5DTRA 3GRYA 3UFBA 3EMDA 3F4KA 5EG5A 4CKEA 3LCCA 3V8VA 4OA8A 3TFWA 5C9ZA 3KHKA 2QM3A 2ZULA 3GIWA 3TLJA 4HTFB 2B25A 3PFHA 3C0KA 2FK7A 3NJRA 2OBFA 5GM2A 1YZHA 3MTIA 4HRAA 2O07A 2P3OA 3KPWA 4FSXA 5ERGB 4KDCA 4AZVA 3EEYA 4PYIA 4AX8A 2IFTA 3FUXA 1KPGA 3BWYA 3UJ9A 3UBTA 4E2WA 4ER6A 4GOOD 1N7IA 1XXLA 5EIFA 2IGTA 3IYLW 4E70A 5P8WA 3G8AA 4C05A 2G71A 1INLA 1IXKA 1YUBA 2YUIA 3QOWA 4KW7A 1NE2A 5E9QA 3T7SA 5F2OA 3KQYA 4GUAA 4LECA 3GWZA 5K0EA 4RWZA 4V0QA 1XDUA 2H00A 5DM0A 5ICEA 3GRVA 3P71T 2YR0A 3SR4A 4GC5A 3KKZA 1JTFA 4YUYA 1KYZA 1P1BA 3DXZA 4R6WA 3LSTA 2IH5A 2JJQA 2O57A 4O29A 4QTTB 1NW6A 4BLVA 4BP1A 1KR5A 2XVAA 4A6DA 1ZQ9A 5LQCA 5CVVA 3PLAE 3OZRA 3TOSA 4H0NA 1L3IA 1WXWA 2ZTHA 4RVDA 1Q0TA 3HEMA 5B1SA 5EQJB 3G2MA 1XTPA 3UJDA 1R18A 2Z6AA 4UOEA 4RV9A 1ZG3A 5GIOE 5IKMA 1RJGA 2P35A 5F2KA 3KR2A 2P1DA 4JXJA 4IV8A 1XDZA 1RI1A 3PB3A 5CUQA 2PKWA 2QE6A 3M6WA 5GWXA 3SSNA 4RTSA 2I62A 4DA4A 1QAMA 3DMHA 1AQJA 3BWBA 4M37A 3TR6A 1AQIA 4HSGA 4RTPA 1VLMA 3BGVA 5LQRA 4PONA 3P97A 1X1DA 3LKZA 3UA4A 3G5TA 3DXXA 2ZIGA 5U4XA 3NVMB 3OZTA 5ICGA 3VSEA 2P3LA 4EVIA 5MHTA 4POOA 4EKGA 2UYQA 4QDJA 1L9KA 4C07A 3G7UA 3PFGA 2BR5A 1U2ZA 1JQEA 2ZZNA 3ORHA 2PV0A 2C7RA 3HVHA 5EZQA 1WZNA 4FSDA 3HM2A 3FPJA 4IWNA 1XJ5A 5FTWA 3SGLA 2VZ9A 4HGYA 5T6BA 5K05A 3NMUF 2DULA 5C0OE 5E8RA 4E2ZA 1SG9A 2FK8A 1ORIA 3M4XA 4Y30A 2AVNA 2OXTA 2R3SA 3FRIA 1QZZA 2IDJA 3OU2A 3EGEA 1G38A 4XCXA 2CL5A 5FUBA 1RI2A 5DTMA 1BKYA 3M70A 4R6XA 3TM5A 4PYKA 2PX2A 1EIZA 3AWIA 3GJYA 4PCAA 2H1RA 2P7IA 4PIPA 5EC8A 2UYCA 3PS9A 1ZHFA 1JG2A 3HVKA 3G2OA 2ZW9A 3HVJA 3R0QA 4C04A 3KQWA 3BGDA 2PY6A 1YFJA 4QPPA 1UWVA 3I53A 3RODA 1JTEA 2BR3A 2Q41A 3BUSA 5DPMA 3FRHA 4KIGA 3ME5A 5DXAA 1RI3A 4RTKA 3GRUA 2AZTA 3S68A 3ELUA 3GRZA 4P7KA 3C3PA 3E23A 2Y1WA 3OE5A 2E5WA 2B9EA 2PBFA 3LCUA 5FULA 5H02A 1YFLA 2PX4A 3NWBA 3FPEA 1EG2A 2G8NA 4HC4A 5FWAA 4XUEA 2AS0A 2JG3A 1NBHA 5DRTA 2F8LA 5E1BA 5K0FA 2B3TA 3NDJA 4RX1A 3THSA 3PTAA 2AR0A 5IH3A 3THRA 3LGAA 1VPTA 3B3FA 1NV9A 3VC2A 5HFJA 3HCAA 3R3HA 2GS9A 3PX3A 4M7RA 4ER5A 1JG4A 3EVBA 1Y8CA 4C08A 3DLCA 3AXSA 3DLIA 5E2AA 4G56A 5ICCA 4Y2HA 3FTFA 4C06A 5CVJA 3GRRA 3KQVA 3FPHA 1R8YA 4PYLA 4B17A 2IBSA 3NVKI 2ERCA 2AN3A 1I1NA 5HIJA 3IV6A 1ZGAA 5HZMA 1O9GA 2PVCA 3ERCA 2VDVE 3A7DA 3UJ7A 4V0RA 5CVDA 4R8RA 3HP7A 3TRKA 4L7VA 1RJEA 2BR4A 3CJRA 3G5LA 3SSOA 5K09A 3B3GA 2GLUA 1P1CA 4PINA 4CTKA 5K01A 2AOTA 3B7PA 2NYUA 4KWCA 4MHTA 3T7TA 1L1EA 4DCGA 3HA7A 3CKKA 4FZVA 3KQTA 4E2XA 2PWPA 4RTNA 2P41A 1FJXA 4PYNA 4PGHA 2ESRA 4DF3A 3DOUA 5CD1A 3C6MA 3H2BA 2ADMA 1G55A 1M6EX 2JH8A 4GOMD 3LECA 5KS2A 7MHTA 3P9IA 3EVCA 3GXOA 3PVCA 2GH1A 2ZWVA 5K0LA 1M0EA 2CMHA 3GCZA 4EMSA 4CTJA 2A14A 2PXXA 4OQEA 3EGVA 4RVFA 1DCTA 4ATNA 1R8XA 1XVAA 1OR8A 1ZKDA 2YVLA 3M6VA 5K0NA 1QAQA 3UJ8A 3WSTA 3OCJA 3B5IA 2ZBQA 2VS1A 3TM4A 3D2LA 5CVUA 1JG3A 3KU1A 2AN4A 10MHA 4GF5A 4FT2A 2UYHA 1RJDA 3C3YA 3GU3A 4X61A 3FUTA 3O31A 4MTLA 2ZCJA 5FWDA 3ER9A 1PRYA 1NV8A 2ZWAA 3DR5A 3FPFA 5JUWA 1P39A 4OX9Y 5DSTA 5C1IA 1NW3A 3NWEA 3P9CA 1JSXA 3FUVA 2FHPA 3HCEA 3IHTA 2PXAA 5ICFA 4ER0A 1QYRA 4RVGA 3LDFA 3KR0A 4MIKA 4M36A 3FYCA 2JHCA 1YB2A 3NDIA 5E8JA 5LQUA 3I9FA 2P8JA 2PT9A 3HCFA 3UJ6A 2NP6A 2FRXA 2HWKA 1JQDA 1I9GA 5DRYA 1HNNA 2P3QA 5HILA 1X1AA 5HOQA 4BLUA 3DUWA 1ORHA 2VP3A 4OA5A 4DZRA 4YUXA 5BW4A 4QTUB 5FA8A 1IM8A 1WG8A 3Q7EA 3DTNA 2YX1A 3UJCA 3FZGA 1VBFA 3LBYA 5FQNA 3LX6A 4YUZA 5KVAA 5DM1A 2EG5A 3EVEA 5E1OA 3OE4A 3TQSA 5BP7A 5EEHA 5EHGA 2EFJA 4OBXA 4YUVA 3MB5A 3CBGA 2V7EA 5G02A 3O4FA 1KP9A 2YXDA 3OFKA 3MHTA 1F3LA 2DPMA 4HH4A 2OZVA 3CC8A 3HCCA 3LKDA 1QANA 3KQMA 4GOLD 5EOVA 4KRGA 2EJUA 5EVJA 2PGXA 3HCBA 3LDGA 1NW8A 3SM3A 5T64A 1NW5A 3TPZA 3A25A 1I4WA 1SVUA 1TPYA 3MCZA 3BT7A 3P8ZA 3UZUA 3GNLA 5DX0A 1Q0SA 1IY9A 5D1NA 5LR6A 3EVZA 3A26A 3HCDA 8MHTA 2ZSUA 2AOVA 2LD4A 4E33A 2K4MA 2AVDA 3NW9A 4P7GA 4QVKA 1FBNA 4HGZA 1YF3A 1SQGA 4AZSA 1TW2A 1JR4A 4ER7A 4Z2YA 4A6EA 3AXTA 1SQFA 1QAOA 1KXZA 2AOUA 3HVIA 4E31A 3DP7A 1NKVA 3GDHA 5D1HA 4F85A 2IPXA 3LHDA 2I6GA 4RSRA 4FR0A 1L3CA 5FCDA 3OFJA 1M6YA 2QRVB 2ZLBA 3CGGA 1UFKA 3OPNA 4R05A 4DCMA 2HR1A 3E05A 2YTZA 2QRVA 2N47A 3VYWA 2Z6UA 2G70A 3M6UA 5DM4A 3KPVA 1N7JA 5K0JA 2IDKA 4KDRA 4QVGA 5EIWA 3M6XA 1KPHA 5EPEA 2QYOA 5KQSA 4NECA 4QQNA 3B3JA 3ELWA 4CWAA 3FYDA 3UA3A 3BZBA 4MQ4A 3MAGA 3RIEA 2OKCA 4RTOA 4WVLA 2ONZA 3SXJA 2ZZKA 2NXNA 5DWQA 4RTMA 2Z6QA 4PYQA 5K03A 1F38A 3HNRA 4EKIA 4RTJA 2WK1A 2C7PA 2XVMA 1FP1D 4X1OA 3DH0A 1G60A 4WXHA 3I58A 5GM1A 4FT4A 4BY9E 3DXYA 3Q87B 2AOUB 4PIMA 2OPBA 1X19A 4ISCA 2NXCA 1MHTA 3G8BA 3KPUA 2IIPA 5K0CA 2CWWA 2AOXA 2PX5A 3VC1A 3P9NA 1BOOA 4R8SA 4FP9A 3JWJA
chains in the Genus database with same CATH superfamily
1ZOSA 3WRXA 4BX8A 1IEVA 2QV7A 2QTWB 2XGMA 3MMZA 2RG1A 2NYRA 1OBOA 2QZZA 2FFHA 1FFHA 2ZVQX 4R0VA 4RADA 2WLSA 2WDPA 3DV0B 4DCVA 4G85A 4XBOA 1P1KA 1P73A 4I55F 2UYGA 3TFQA 5KSOA 1VL8A 5A4IS 3O74A 4B71A 1N7GA 5LSAA 2VZ0A 1PFKA 3NHPA 1GCUA 1YVRA 2HPAA 2OXCA 1K4MA 2FPSA 3DVSX 3HRHA 4G4IA 3DT6A 5DM2A 2IS2A 1Y3CE 2WWHA 1IY1A 2ZKLA 2EVWX 1ZMVA 1CE8B 4ZRDA 4TMKA 2ZRLA 1Y63A 1UMDB 2JGFA 4XUCA 4AN1A 4CI9A 4EG7A 1S5PA 1H8HA 2QKYA 1II9A 3KSXA 2PV7A 4US1R 1G18A 3BERA 3CTPA 3DR3A 4Z7NB 4ZMRA 1U0SY 5K0BA 5ALRA 3F97A 4DMMA 1VG8A 2DKOA 3SF8B 3AHJA 2CE7A 2CKDA 4DV0B 2F1OA 3VKHA 1IZ8A 3FYUA 4E30A 2RBEA 3F5FA 4CTOA 2J46A 2G6TA 1AQNA 2E1RA 3EE6A 2YJ5A 2JLRA 1PG0A 4PFSA 5HVNA 1K8RA 2CXRA 5ARCA 2C8VA 2ZGVA 3AYZB 4HDOB 3HC7A 3OOYA 5E7QA 3V2UA 4BX2A 4N6NA 1UK6A 2VT3A 3D8TA 2FSSA 3O4HA 1V95A 1D8TA 3A6KA 5LQJA 1OI2A 5FNVB 5L9AA 2FJPA 2VI5A 2VQEM 1GNLA 4BWGA 1RQRA 2WJVA 1XALA 2M2IA 4OREX 4X0EA 1MT3A 3R3ZA 4PGGA 2NO0A 3VDMA 1N3LA 2YXBA 3E9YA 1G5FA 3QA9A 1G17A 4QDZA 1FUKA 4D45A 1L4MA 1E9SA 1T43A 2UUCM 3H9CA 4UE2A 4YJGA 3PJGA 4M0UA 2HRQA 2WJIA 1LD3A 4JJGA 2P6UA 3M33A 3R23A 3WHLA 2X9QA 5FFNA 3L8FA 2OBNA 4LDZA 2VPWA 3K20A 3AI7A 4TTRA 3J27B 1A8PA 3ZHBA 2RH4A 4U3JB 1EM6A 3CF0A 4YJ3F 1MPTA 2JLVA 3N8DA 2YMPA 1M2HA 4OLHA 3PNYA 2AXQA 1XCLA 2JFPA 3MW8A 3PWZA 4RPGA 1LPBB 4JDUA 2OC4A 4MVJG 4CL8A 1QXSA 1X7DA 3FMOB 4BMPB 4IDNA 2DF8A 2IEGA 2B1QA 3DBHB 4ROTA 1NJFA 1KFCB 1SWWA 2H4ZA 2OBLA 4GG1A 1NSFA 5JNRA 3DDOA 2H7XA 2QW0X 1T2CA 5FI3A 2GN2A 2GAIA 1V7PC 3K0HA 4QQFA 1LZLA 1M0WA 4MZXA 4ZIRB 4BFSA 5IAAA 3VDQA 2ZRMA 1MN3A 1JAXA 1I0IA 2PKXA 4NYIQ 3HGMA 1EWYA 2PSHA 4LYYA 4A3VB 2VDRB 3N87A 4R81A 3KR9A 5E2BA 4E5KA 1WD5A 2R6ZA 2FX2A 4CLOB 1QQAA 2JRLA 4REZA 3HRIA 1Q6YA 2PWZA 3TD9A 4EJFA 1AMNA 4EUSA 4YECA 2DQKA 3H2SA 2W2NA 3IOCA 4E51A 3P5SA 4BRSA 5HW0A 4M1ZA 3ITEA 4HSEA 1BEEA 4IXDA 1GOTA 2P40A 3EXAA 1GPJA 2PU7A 4AZFA 4Q66C 3JQ8B 4RY9A 1CZUA 4YGXB 2WC1A 4ZQEA 3VGJA 3V7NA 1DBSA 5JXIA 1TZ2A 1Z6AA 4A1OA 1XHLA 2ECFA 3NANA 3DS8A 1V9SA 4UDYX 5C4GB 1Z5CA 3JATA 3S2ZA 4YP9A 2G5TA 4QATA 2KS6A 4DMGA 3DT9A 5ESWA 3HZJA 3GPLA 1NQVA 4K3VA 3NTVA 3OM0A 3WGTA 3UMRA 3BFPA 2HH9A 3U16A 1G71A 1XQ9A 1ZK1A 2ATIA 2Z5LA 3KZKA 4FGUA 1SXGA 4G8BA 4MVJH 4XGKA 5BSUA 4KX5A 4DRZA 5KYNA 2RE8A 4WK2B 5ECDA 3E8SA 2WRZA 3A3YA 4YRGA 3H8JA 3TQRA 3IR5A 1HE5A 2C5LA 3PJFA 4OHMA 4OH1A 3R9XB 4QEZA 4DREA 3KO8A 5ITZB 1RI4A 3GOQA 3PXGA 1UBEA 2FZEA 2UUAM 2QT9A 1TJPB 2X6QA 2X6TA 3FGZA 3N0WA 3NXKA 4MGEA 4XEHA 5C8YA 4KNVA 1S1MA 4DR6B 2PPLA 5HF9A 4BFTA 3UT6A 3ZY5A 1C1DB 4UHHA 5JAIA 4L5IA 3K70B 4L9AA 2HLDA 1Z07A 1JH8A 1TU4A 2JVIA 4X8OA 1UJBA 4X65M 4U2KA 1RACA 3EGXB 3GV0A 3AI2A 3W9UA 3Q12A 3HEBA 3NAZA 1Q0QA 2QR3A 3DMYA 4NMHA 3MERA 2WHXA 2ID8A 2OB2A 1DX9A 1FU8A 1F12A 4YPFA 4HUTA 4PSCA 1S7CA 2PZFA 3R1IA 1RQLA 1D0LA 1C2YA 1JHUA 3MD0A 1IEWA 4MUJA 2G4LA 1YIDA 2F3TA 3RT7A 1T3GA 2D7EA 1ZM9A 2JCYA 1OB5A 4NCNA 5AI9A 2KXEA 2FRDA 3GGGA 3JZAA 3LCCA 4NONA 1UDAA 3C1OA 4XYBA 4LRYA 4BKMA 2RDMA 1TZMA 3AUXA 3KHKA 1PDOA 3PPVA 2J0VA 2XGSA 1MIOB 3L25A 5A71A 1VCNA 2RGYA 4R2XA 4TQUS 1QGDA 1JSCA 2XVYA 2PKCA 3FUCA 3TXYA 4KHPB 1PJQA 1NBME 3EEYA 1P3Y1 2OVFA 1ZMRA 4LTNA 1IATA 2CFRA 3M7GA 4KWEA 4NG5A 3TW4A 3E2IA 3PHJA 1DAIA 1LWOA 1O6FA 1YAJA 3EXHB 5JZBA 1JDJA 5AHRA 4YJHB 3LYUA 3LQRA 1T5HX 3KELA 1KYYA 4JL5A 3MG9A 5KAMA 3TR5A 1SXJA 4DM4A 5AUQA 4Q1AA 4KW7A 3QOWA 2GJ4A 3SHWA 1HYGA 4LZPA 2RGRA 3JQPA 3DEHA 3QLVA 4FXOA 4LECA 5KYXB 5E6JA 1F2UB 3O4GA 2WYOA 4Z49A 1D6MA 4R9UC 5HCIA 1GGFA 4AZ3A 3K0SA 1KFVA 2KE5A 1KYZA 4UTOA 2NUAB 3RAFC 1GL6A 1B1AA 5HDQA 5TMBA 1B8PA 4B85A 2NUPA 1TZJA 3VH3A 2IPLA 4XTCS 1BX1A 2QOEA 4GOKA 3GUCA 4P93A 5A3JA 1TM7E 3OZRA 4AY6A 3PLAE 3EISA 1YI8A 3L7OA 1AOXA 5L6MB 2H59A 3QG1A 4UARA 3ET4A 1GR0A 1Z36A 3JAWA 1OZGA 5LC1A 4HCJA 2QG9A 2F00A 3FNBA 3ZJUA 3PEYA 4N65A 1E8MA 4ZT7A 5BSMA 4A23A 3FAKA 2QPTA 2D2XA 4KRYA 4XVCA 2YIVX 4RACA 1YS6A 4RELA 3HZOA 3LP6A 3WAKA 4YP1A 5GY7A 2EJBA 4XTRA 4ZALA 1YS9A 5ILQA 3DFKA 2OQVA 3G2LA 5CK5A 3QTTA 1N34B 2NPIA 3H2KA 2AXEA 3KLOA 1M1YE 1WSWA 4G5HA 2EP7A 2F8MA 4WZBE 3TTTA 3QBDA 5EJFA 1ZIDA 1ZUD1 3IJ5A 3K9BA 4CG1A 2TECE 4UUNA 3LVWA 2IYYA 1I4OA 1SUEA 3BXGA 3NJ4A 1LLFA 2BFFB 2PGLA 4HLQB 4Y9RA 4CF7A 4F60A 1D6NA 4A15A 1M2WA 2AQKA 1LSOA 3D02A 3DW1X 3U4GA 1ZD5A 1JEOA 2DWZB 1SOAA 1F2TB 2CVZA 4UCWA 4AROA 4MYSA 2G07A 1C8VB 2PV0A 3Q40A 2LKDA 3OI7A 4G36A 3RS9A 4JV5B 3WFIA 3AVPA 4QBTA 4JEMA 2NU9A 3ASVA 2CNLA 3A3NA 1Z17A 1LSSA 1V5IA 3DT8A 2RI0A 5A02A 2H9AA 4ZAGA 1YDMA 4Y30A 4R2KA 1FNMA 3VUEA 3MJVA 2OXTA 3SVLA 5KX5F 1A7JA 4A0HA 4EG0A 1BX3A 3NU1A 5AK5A 2XMGA 3ZV4A 1H3FA 1LK7A 1WJGA 4EHDA 2BGGA 3FSRA 2QM7A 2G09A 2EF1A 2H7YA 3PC6A 4NXNB 1ZD3A 1D04A 3KUCA 2FHSA 1GXSB 1L5HA 3NTLA 1Y4AE 4X1KA 4O4IA 5E7JA 4JI6B 3WLTA 1JLLB 3W0LB 1P9LA 3F0TA 1BWPA 2JC3A 1R4ZA 2P3SA 2ZW9A 1TJ3A 3GK3A 4MYTA 5H4HA 2I80A 1C1XA 3PXAA 5H68A 4QPPA 1E8NA 3DMRA 3RYFB 3UW1A 3Q8MA 3H9BA 3OPYI 4WOKA 3RANA 1EX6A 3ME5A 4MSUA 4Q3LA 1TTPB 1KSJA 4WDRA 3T4XA 2XWSA 4AG6A 1OYYA 2UDPA 4IIYA 5D85A 3EWAA 2G67A 3F1KA 4KE7A 4YGYA 4OXQA 5ADVA 4JBHA 5C8VA 1MLDA 3EIUA 2B7LA 1KVTA 2IIBA 1J0BA 2J3MA 2Y1WA 5F64A 1IL0A 5KTRA 2GN8A 1KERA 4JENA 1U3WA 1EG2A 4CEHB 4D8UA 3LOPA 3AVUA 5K0FA 1SBYA 4HAZA 3T1TA 4X64B 1L7RA 5KEIA 3VDXA 2GZ1A 3HI4A 3VC2A 1LZKA 5FI1B 3TQQA 1N6IA 5HGJA 3I9OA 2G25A 5E3IA 3NNDA 3T9EA 3SQNA 2DUWA 3H1GA 3VU8A 5F77A 2QAGC 3QHQA 1Q1ZA 4C06A 3T7AA 5FP0A 2D4HA 4DLVA 5FXMA 1R8YA 1ZGZA 3EB9A 5BQ5A 3KALA 3WIBA 1Q15A 3ZI7A 1B23P 5HIJA 1XDWA 4RETA 3U6SA 3LHFA 4RGYA 3R5TA 4Q02A 4HHEA 1FDOA 4YT5A 4AJNA 2H5EA 3A2NA 3KZ1E 1E77A 1LC3A 2VJYA 1RPTA 2ZUDA 3DZJA 3FZNA 3PHGA 2FZGA 2FZ5A 1SVOA 2AUNA 1ZIXA 4PS0A 2D0IA 4JYAM 2C1EA 4RCZA 3I8OA 4K9PA 3R5KA 4CTKA 1A8IA 1JN0A 2AOTA 5TPZD 1RAEA 3NYRA 4JP3A 2G9NA 2VWQA 4YASA 3T7TA 3PTZA 4KQHA 1G5PA 5HKKA 3K0CC 3DW3X 2GVZC 2ZBKB 5CVTA 2ESRA 1H4QA 3IALA 4OHZA 2A35A 4DL9A 1XVLA 1GTJ1 1SU4A 1UPAA 2XCIA 4LNHA 1SNYA 1NW4A 1BDBA 3AX6A 1RM5A 2GUGA 5ALXA 1DS6A 3QYJA 3DTVB 2VPQA 1MC8A 3ZU3A 1NNLA 2QROA 4CM9D 2AMLA 1X9IA 3R7NA 1E7QA 1DKRA 4MGIR 5FBQB 2VJLA 2PQMA 1EM8B 2WT8A 2ZR8A 1JG3A 1E2EA 1GT6A 3UMSA 1XFDA 2C4NA 3EGOA 4HDKB 1ZBQA 1ONSA 2OFOA 3GPUA 3I4VA 1P39A 2HA4A 2JGMA 4LG2A 4X6XA 2JGEA 3FUVA 5JPIA 4V1CI 2B94A 1XYGA 2FN8A 2X3FA 1APBA 1V11B 1BX0A 1ZVJA 2JZCA 3QF7A 4LNUA 4NF2A 4TKVB 3ZZ1A 1W4BA 2AW5A 4PZDA 4KQ2A 1D0IA 4MI6A 1GGNA 1PLJA 2WSEF 4LF8M 1EVKA 2CN1A 2IKSA 3Q0EA 3RQSA 3UJ6A 3GVXA 5FNZA 2NP6A 4HDSB 2YMMA 4G4JA 1EYZA 1COZA 1RXYA 2HWKA 2JFOA 4H9GA 4MKGA 4NBWA 1HNNA 4I5FA 3VXKA 1BTOA 4IO1A 3LZ6A 2VP3A 2CUKA 4IR7A 2K87A 3D59A 2E4YA 3PEVA 4GYKA 5D5QA 4BKQA 2H17A 1VFNA 2FFAA 2NM0A 1XMPA 1Y6RA 3H2YA 3KWLA 3ORFA 4HEA1 3B1ZA 1P33A 1SOVA 4QREA 2A59A 2HFJA 3SAVA 2I2XB 3GX1A 4YJ3A 3WOHA 4F2GA 3H4VA 1JAHA 2JGDB 4DRXA 1TH2A 1E3DA 4EIWA 2O0MA 2KNVA 4EBBA 1NUHA 1AXEA 2YV5A 3H8SA 4URZR 3UAYA 1HGXA 1OGJA 3U4QA 2VNJA 4C30A 3F92A 1F3LA 1EINA 3H65A 3MMNA 1TIBA 3LH5A 1EGAA 1YDGA 5F3WA 5AW9A 1B73A 1L5OA 2I3BA 2REBA 1KJ9A 4AW9A 3VYUB 4HLDA 1NW5A 1UAYA 4HJXA 3I52A 2JJMA 4U9HS 4MO2A 2X6RA 3HJHA 3C8MA 5FJJA 2ZRBA 3HCDA 5B37A 2EIHA 1E0KA 2O59A 3BB3A 3BEDA 5DOVA 1E6CA 2WIAA 1UEXC 2YRWA 3CLKA 4Q1VA 3VNAA 5DYWA 5MGNA 3DZFA 1VEKA 3AY3A 4WGFA 1KZHA 4EO7A 4P4SB 1OXMA 1Y8GA 2IEBA 4KGXA 2AOUA 2QTRA 3DMPA 4L4ZA 4BMCA 5KNCH 3VR6A 1ZY2A 3D5EA 4HNAA 2NTYC 4I5IA 3ICOA 4OEHA 2FEAA 1X94A 1B8OA 1YZYA 1Q1BA 4NULA 2ZLBA 3USCS 1XEWX 4KU4A 5HKBA 1MA0A 1EFCA 3H1PA 2BRUA 2V7XA 5L6LB 1JEQB 1O58A 4A36A 5ITRA 2AFIA 3NT5A 2G70A 2Y8EA 1R5OA 3MK31 1ZHHA 3ICQB 3CNEA 3GELA 4YI3A 1IVSA 2BWBA 1ZR2A 3DONA 4X8MA 1ZNYA 1RE0A 4FPXA 2FLVA 2ZYVX 3T4EA 1P45A 2UV8A 1E1MA 1EFRA 3EH2A 3NDRA 2IE0A 2JIOA 4LE2A 1B0ZA 3EZNA 3QFFA 4Y6LA 1FLVA 2DYKA 4K8OA 1ZA1A 3D7RA 3EC7A 1QZ3A 4XFJA 3HGQA 5C34B 3T7CA 6ABPA 3D6TB 1HLFA 2B61A 1NJ1A 1CLEA 1LY1A 1X14A 1FDWA 4HLUC 4XM1A 4BN5A 2RC6A 3OQPA 3GFBA 4D9GA 1CEYA 5CBKA 4K28A 1UPXA 3ONFA 3CVJA 4F04A 2XE7A 3W67A 4JBNA 3BJMA 4PZEA 2FA9A 3V7WA 5A4MS 3L77A 4QEDA 2H2IA 3AUYA 4EHLA 4HT3B 2PNFA 2AOUB 3MOIA 4OL9A 2KQUA 1KI6A 3L07A 5CXQA 3KPUA 3GAFA 1E1RD 3QWHA 2J6CA 2WE7A 4KKVA 2VP6A 4FWIB 1QKJA 5EJCA 3VC1A 1MAAA 3LZDA 4YAOA 1IE3A 1MO3A 4O6VA 4KQ1A 1AZSC 4R1TA 4G84A 5JDIA 4PAWA 1OMOA 5DGTA 3E35A 2EQAA 1EK2A 1ODCA 4IIBA 1WB6A 4MLZA 4N3BA 4PYMA 3B1FA 5FIUA 3B13B 4G1FA 3FOWA 4WZAB 5A4DA 1NTOA 1UJ5A 4PSVA 4TL8A 4DSZA 2J3DA 1O94A 4I46A 4TWBA 4KYVA 5IAJA 4PO1A 1V9LA 2VJBA 1KZ9A 3OJFA 5F76A 1KE1A 3WMFA 4CMKA 1XN4A 4BMVA 2B2XA 4CTNA 1U3DA 3CCFA 4JVSB 1Y3FE 1XFAA 1X1CA 3RBXA 2XYPA 2QTAA 2BGNA 3W34A 4AM8A 3HTXA 2QF7A 5D87A 1X2EA 3M4JA 5I7FA 1BFUA 2XF2A 4U4AA 5KPJA 4MVJF 3WQHA 1GAQA 1LRJA 2C83A 2JI7A 2YXNA 2HKIA 1LV8A 2WM2A 5LQAA 3N28A 3ZDDA 4PHTA 1ZWKA 4E5NA 3L49A 4TXLA 1NQWA 1A8QA 1MENA 1KFKB 1CQPA 4GKAA 1XSEA 1KJJA 1NXSA 2P62A 2R86A 3SAJA 3UQZA 5KU1A 4RXTA 3GAZA 4E7PA 3HDYA 3EEOA 1EU1A 1EX7A 2YW9A 4QQKA 5MDHA 3BBZA 3PD0A 1KORA 4GQAA 4J0HA 4C3VA 4B35A 5ITVA 2CFCA 3KKEA 2CHGA 3IG5A 3GFQA 1FMFA 4BP8A 3AY6A 4P1ZA 1KO1A 1YVEI 3CEPB 1AK9A 1R3UA 4IHJA 3RLFA 4F3KA 1YIAA 2BM9A 2VSYA 1C0PA 4CG0A 1ONNA 1N5IA 3HL4A 4Y67A 2LUOA 2QUKA 2VDOB 5JJIA 2O8CB 3KAQA 3PGXA 3W2HA 4E21A 5E6UA 1KY2A 1P2TA 1YUNA 4X5OA 4NR0A 4FGSA 4PAMA 3TW8B 3ENWA 3KUXA 1XGKA 3WLJA 2G5GX 2RH8A 4KUGA 4DA6A 4DWOA 3OMXA 4FQ8A 2COEA 5I8ZA 4A3SA 1SELA 2Z3XA 2GD0A 5FBRB 4BJ1A 3WIOA 3A11A 1PK8A 5CCXA 3FDXA 3JYLA 4X84A 1AUVA 2PIAA 2ZTLA 3AHEA 4UQPA 5EYPA 3LFTA 4FONA 1DQPA 3UT0A 1AKUA 2HCFA 4Z8XA 1IQRA 2V65A 1ML3A 1ZR4A 5FWYB 2Y71A 5DM70 1H2BA 1YZ3A 2VLBA 5IVKA 2KNAA 4P2GA 4U6QA 4DANA 2FLKA 3KKOA 3FYTA 3L0BA 4UBMA 1FU4A 2OUKA 1TW3A 2P0EA 2CFOA 2BNKA 2Q2NA 4ICIA 1WDMA 3JQAA 1O0CA 2IA5A 3GGDA 3OAAD 1YFKA 1NKSA 4K03A 3T5AA 2YOHA 1FNCA 1PP4A 2UZ1A 1SG0A 2FE4A 2TMKA 4NG4A 2I8CA 4C5BA 1SD1A 5CCBA 4RVOA 2PYIA 4MS4A 2ROQA 3BH7A 3D6JA 5H9WA 4Q3OA 1Z4JA 4C4RA 3WL3A 2Y21A 2FMHA 1F17A 3CW8X 1YBVA 1T34A 4IJEA 1T8PA 1YHYA 2AOWA 1MABA 4URFA 2W2LA 5HF8A 1LEHA 1N25A 1L4KA 4KT0F 1NWHA 2D2IA 3KPYA 4BJ6A 2RHGB 4EMUA 2APLA 1A9TA 3DDNA 1ZCBA 2W70A 2CCGA 3CVVA 2F2TA 1SC3A 4N18A 3M2PA 4KPYA 1ZI6A 3VZCA 4O8ZA 1CP2A 1JFRA 3BJEA 5IKOA 1NNEA 2O05A 4MB6A 1E98A 2WF6A 3WK9A 4AT1A 1IBLB 4X41A 1U7PA 3SMQA 4QD3A 5G1NA 3GPYA 2YQ5A 5TIIA 1U2RA 3ZJYA 2D1RA 5D5PA 4EELA 4F4HA 1H2ZA 2DHYA 1NHGA 4FDTA 5JSZB 5CDHA 2VHXA 1A9YA 1IK4A 1QYIA 2JBAA 2WAMA 4FGZA 4HZGA 3I5MA 5EMMA 3W5HA 1CV2A 4U2CA 5KYYA 2Q1XA 2OR3A 1WGNA 4BZPA 1AV7A 1L3BA 2MSWA 2GSDA 1XL0A 4UPEA 2I7CA 4CM8B 2JGRA 2HIGA 4BJHB 1SZDA 2YNMA 1RRFA 4HF7A 4DTIA 5BXYA 4LRTA 1CR0A 3FGOA 4WADA 1EI9A 1A2OA 1VKRA 3AEKA 3LKVA 3PWTA 2FPIA 3P0RA 4WWHA 5JSQA 5FPQA 1L1FA 3RSZA 2MSCB 3T3DA 3QHPA 3SQDA 3U1TA 2RMKA 2EQ5A 1JBQA 1V7CA 3FA2A 4JB8A 4HD8A 1BIFA 1EP2B 1HMPA 1SBZA 3DV2A 2CEAA 1X7WB 5J5CA 3TEFA 3BIXA 4BAGA 2FE1A 3K5HA 3ESAA 1X8LA 1U1CA 1VMDA 1C0LA 1O7JA 1F8UA 3QU2A 1CRWG 2XYQA 4Z9YA 5GV7A 4F7DA 3KJHA 1RIFA 2OVBA 1VBMA 2AG1A 1C30A 2P2ZA 1YD7A 4I19A 5JLJA 2XBUA 1K6XA 1RHRA 2GCOA 2WNSA 2WF9A 2LPMA 3K1TA 3ZH2A 3RC7A 1TAHA 1U9IC 3SEQA 1JE0A 2VBGA 4DCTA 5B64A 1P19A 3KPWA 2P3OA 4K9OA 4AS3A 1RR6A 3DDCA 4QFCA 1WXQA 2IDZA 2GZAA 3JYQA 4PYIA 1IHXA 2R6HA 5B2FA 2Q5IA 1IPHA 4S1WA 1EUYA 3I9V1 5EINA 3HSYA 2V8BA 1GRVA 2CGEA 3Q3HA 3T4UA 1O5TA 1XZQA 5CFNA 1VIYA 5E6RB 3TN7A 1FNDA 4E5DA 4C4PA 2RAPA 1Z88A 1SXHA 4WH0A 4G4NA 1BO6A 1S3IA 1PT8A 2XIJA 4FZ3A 2I03A 5CCDA 1W36D 4KBYA 1CERA 3SF8A 4IEFB 5IVDA 1YHNA 1YRAA 4DE5A 5HF6A 4A26A 3USES 3ACBA 1ZH2A 1T36A 1XZBA 3AQ4A 2DJIA 5C1PA 2EL7A 1FYXA 2EEZA 2Q3JA 3GEHA 4UUMA 4QU5A 4UMFA 3FY4A 1K7XB 1EFRD 3SKYA 1ZNXA 5BW6B 5LOVF 3T3GA 2IHZA 3MT7A 1NRXA 1PR0A 3NIWA 4J94A 4P5EA 4UXJA 3ZNPA 1QFXA 4PZYA 3KYJB 3WLRA 2HSGA 5AM1A 4RVDA 2CNWA 4FEGA 4AF6A 3SX2A 1EFHA 1UBJS 1IG3A 3OPXA 5FV4A 2VDJA 1R0RE 2Z09A 5AI6A 3UB3A 4Z0TA 3LX8A 4I66A 4D4GA 2DUNA 3RIHA 4AP6A 2NU8B 3ZHZA 4BLQA 3H05A 3SYMA 2CXHA 4QUEA 5A04A 4EZIA 1OFHA 3DMHA 1K88A 4PLPA 3BWBA 3IO5A 1EXWA 3A9CA 4M6WA 4Q24A 4YDRA 5NULA 2I6SA 1M1XB 3C8HA 3FM9A 3ZUGA 5I8PA 4JR1A 5LMUM 1OVMA 2Y0QA 3G6WA 1TM1E 2QRPA 4PRZA 3OZXA 1U90A 1G5RA 4KOAA 3LKZA 1QHFA 3ZCRA 1T4BA 3ZTYA 4BEBA 3B70A 1IUNA 4IUDS 3HJQA 2FZWA 2B7CA 4GR9A 1RDFA 4POOA 2ZJ6A 4GVLA 4UM9B 1KY3A 1NVWQ 1U2ZA 2H2DA 2VQEB 1QVRA 3FYHA 3AM5A 1MX0A 3MCWA 3QYPA 4EL5A 3KOXA 1WZNA 1P31A 1OV4A 5JASA 5KTKA 2JI4A 2OFFA 1TM2A 5H3HA 3I8SA 5JRDS 3TBKA 3SIPA 2D74A 4JLPA 1N8KA 4R7ZA 3TDNA 3F74A 4G89A 2F5QA 5CA1F 5I7WA 4O1MA 3VX4A 1BVRA 2FK8A 5K5EA 5K3FA 3BBPA 1H2XA 1R6XA 2VK8A 1E2LA 3RS3A 1HZJA 2CHQA 1BMDA 4ND2A 3OF2A 1JDUA 1M2OB 1YZTA 2ZJZA 4RJLA 3W5JA 1JDSA 4DCSA 3C87A 3AWIA 1GKIA 4PHFA 1S2IA 1A04A 4NC6A 2BP7B 3LA8A 5AP9A 1ZHFA 4QRDA 2IITA 1PD0A 2QN6A 1ULUA 1M75A 4JL8A 5BWOA 2V1XA 2X7JA 3O92A 3ZUPA 4C04A 3EEIA 3BGDA 1I9CA 4FHCA 1HDIA 1YE9A 4DBLE 3HZRA 1A97A 4ILEA 1XC8A 1RKXA 2HNAA 4G4QA 4ZTZB 4A16A 2Y68A 2C84A 1H05A 3HB9A 4L51A 4M1YA 4TL7A 4RTKA 2AZTA 3FVTA 1CULC 3ORYA 3ZI4A 2AEMA 2Y1GA 4BUJA 1DGHA 3FX2A 1XYYA 3ZLVA 2B9EA 4NCBA 3WX0A 3CSDA 1TVKA 3L7BA 1DTSA 4JC4A 1Y9JA 4MA5A 5K3AA 1TYCA 2FUKA 2L19A 2XNKA 3F6CA 4FMDF 1EWQA 3OTWA 5AJYA 2F3UA 2F7SA 1EJ2A 2W00A 4UAUA 4BZWA 2E7ZA 1JR6A 3LDAA 3B3FA 1WQ4A 1RWBA 1QH8B 2JIMA 4HRVA 1UWKA 1CYEA 2I1VB 3AYXB 1C80A 3Q7PA 4PLHA 1V8PA 3DLHA 2K0BX 1J5XA 1ZD2P 3BK7A 2B1IA 4Q47A 5BWLA 3WK7A 3CE6A 3ND8A 1BDHA 3PLRA 3I73A 5DFLA 3DLCA 4FK8A 4OHKA 2FMTA 2CP8A 3B3AA 3RVQA 4FBLA 5I9SA 5CFRA 3N5KA 3ETHA 5DOZA 3RKSA 4IH1A 2LVQD 4I08A 1WL8A 1NJ2A 2HT6A 4BX9A 4O2BA 4DC1A 2OL4A 2NXWA 4MZDA 4ESHA 3RU9A 1BN6A 1FMCA 2OOBA 1FYDA 1TM4E 2FOLA 3CR8A 3I3OA 3W3AD 1MFZA 3BSSA 5HZMA 1U0TA 4GRDA 1GUAA 3T9AA 3OSUA 4ZCIA 3B3GA 3QLUA 2DHCA 2ACKA 4M99A 3MLEA 2AFHB 2Q4OA 2NYUA 4XM0A 2JATA 1L1EA 2NGRA 2IELA 5TV2A 1WVIA 4UCXA 1JEEA 1KK2A 2OZEA 3QNMA 5DEIA 1C3OA 3RWBA 1N1GA 3KSRA 1I7LA 4PYNA 5REQA 4B7AA 4DADA 1MDFA 3OP1A 4Z0NA 3UK6A 1UMKA 4YMVA 1F8FA 1SQ6A 2ZJ8A 1ZNQO 3D6MA 3G68A 2OG1A 4YUWA 5CB4F 1H2RS 4I1VA 4XJXA 1ZLXA 2NO4A 3ZD8A 4Q03A 4EMSA 3B1WA 4OQEA 4L4YA 3QVGA 1QM5A 3DC7A 3ICCA 1U11A 5EXPA 4ZZIA 3QXCA 1TPZA 2JHFA 3JQAB 10MHA 2UYHA 4DV7B 2ZR0A 3J2PB 5JI2E 4YJGB 3SZOA 1K9VF 1GU0A 2P2YA 1N2EA 1GKYA 1B15A 4KXLA 1PRYA 4DDKA 3A9SA 5BQOA 3FPFA 5JUWA 3ZWQA 3C39A 1HY3A 3RIMA 4PRKA 2P90A 2Y0PA 3TTYA 4RK5A 3K8OE 4B3FX 4DAEA 4X65B 4Z99A 1AIPA 1CT9A 3Q85A 1XP5A 1WMFA 2ZB4A 3AP3A 5DTEA 3AF6A 1I3LA 1HEYA 3M4ZA 2PT9A 1PYGA 1HKHA 2WP0A 1VLHA 2XXJA 2ZBDA 2XOKD 4BFUA 1BAPA 3BH0A 3Q9SA 1ZUNA 3H2IA 1E2UA 1FVXA 4BLUA 3BXWA 1K8YB 3PX7A 3NZEA 2J5XA 1UBSB 1O95C 4FX5A 4UFPA 1JXAA 2WM3A 2ZP1A 5E7IA 3LLUA 5EFOA 4A8JC 1E5VA 1R37A 3Q3JB 4EY4A 3R6DA 3UJCA 1WZ2A 3NYQA 4PLZA 4QU9A 1CR6A 3WDSA 1EBFA 5ALWA 3L7JA 3WJAA 4Z1MA 1GGEA 5B4VA 1Z4NA 1KEKA 1DVRA 1GUBA 1FTSA 2F1IA 3JAWB 1IY8A 3K31A 3QVWA 4NDNE 2CLCX 4RJJA 4RAOA 5JAQA 3ESCA 3IAM1 1WNFA 2OBYA 3V6MA 4ACBA 3P7MA 1YQQA 4JHXA 4ND3A 2DPMA 2ZUVA 4GOLD 1GFSA 1NN5A 4MUHA 3UF0A 4BCDA 2EJUA 5H4GA 4CLRA 3R74A 3C7AA 5JADA 2BZSA 3W2EA 1BCRB 3KK0A 4L6V6 3IKVA 4GXRA 5B1EA 3IHWA 1UPCA 3SHQA 5BPFA 3PHLA 5HTOA 4GWGA 1ZJWA 2ZWPA 1LBEA 3HP1A 4PSUA 8MHTA 2AZ4A 1A0OA 2G06A 1JTVA 2FETA 3DFIA 3O8BA 3ZV7A 1XZEA 2QLNA 3UH1A 2PMDA 3IAM6 2K47A 3HHEA 4YS6A 1B43A 3VC7A 1OVGA 5JCJD 3G49A 3FJ1A 4WKBA 3UPTA 1XT6A 3KUUA 4HH3C 2Q5LA 1F7UA 2ASVA 2HFKA 2VP2A 2VQ3A 2WIBA 2F64A 3UCEA 4D41A 4E31A 4PNPA 1NKVA 3KT0A 4JMLA 4ZAXA 4B40A 5F7OA 1T9CA 1XNGA 4EA7A 1AMUA 4J2HA 3FWZA 2OCPA 1VRCA 4ZEXA 1WXEA 5E6SB 2B21A 3HCWA 5L7TA 3SD7A 4Q7QA 4JFRA 2B35A 2QRVA 4HEA6 2BI4A 2HWWA 3R09A 2Q1YA 4K6FA 2X15A 1QSGA 5I5GA 5IBQA 4BWFB 5FYDA 5HWSA 3ZDYB 4BDTA 2Z3WA 4DG9A 4QWMA 5KQSA 1FP6A 5MN6A 3OX3A 3LQ2A 4V0KA 4EJ0A 1DXHA 2ODPA 4GLFA 1GN8A 2B8EA 4JBXA 3QU4A 4FD2A 3PC3A 5DIFA 2ECQA 2C57A 3B6MA 2JEZA 3H3JA 5FUWA 4TT8A 2Q1TA 1L4NA 2R6GA 1GUZA 3GFVA 2VLIA 4Q3EA 1LNSA 2QENA 4L57A 4B8YA 3QE4A 2SNIE 1O03A 2CNDA 1OY1A 2W8ZA 1FRVA 5A5EA 1G3RA 2QHXA 5B58T 1UFVA 3VTKA 2WV9A 4BFYA 4BMNA 3U31A 1DFHA 1I10A 1T5OA 1YE5A 2OXFA 3NNNA 1TM3E 4RXMA 1TYBE 1VKHA 2V03A 5AJXA 2EGHA 2ATXA 5I7VA 3C1TA 2QL9A 3M5DA 2M6SA 4JU9A 1RU3A 3TF5A 3BJIC 2DBYA 4R5MA 2GPWA 1B16A 1L7XA 3KJZA 4JT9A 3U7RA 2XF3A 1NVBA 1QG0A 4PC1A 5CR9A 5GJWC 5ITXA 1R9JA 3LT0A 4CM5A 2AHRA 5CDFE 1G8YA 1NUSA 4M2LA 4PN7A 3JR7A 3A4YA 3SZMA 2IYFA 1IMJA 2FN4A 5EWLB 3RRYA 1FPQA 3L4BC 5G41A 1XCGB 1D9XA 1M34B 3JD2A 3REOA 1PDWA 1VE5A 4J75A 1VQ1A 1XKXA 4QTZA 4RPCA 9MHTA 4MCJA 2XCTB 5HP4A 4M9CA 4IBDA 2QZJA 2W2VA 3CX6A 2PA3A 4X1IB 2BKVA 2CYAA 4FGLA 3ROKA 2IHYA 3K35A 2AC4A 2X0KA 1IBKM 1T5LA 2OQRA 1Y34E 5C8ZA 2KZUA 1M2KA 2GAFA 3M3HA 1HETA 4L2IA 5JV5A 2YJTD 1PF7E 5E9JA 1VECA 1Z7YA 2I8AA 1XZFA 2QWXA 3BL6A 1ZCAA 1L1QA 3SARA 1V3VA 1W75A 3GEGA 4RS3A 4B79A 1QF6A 3I9KA 2BSAA 4B3XA 4YMGA 2FLWA 1AQUA 1KYWA 2QX9A 3LUDA 1R0ZA 1B0UA 3GEBA 2JAPA 4BVBA 1L8QA 1TMKA 4KO8A 1U8UA 2COUA 4QTYA 3PIDA 4KHZA 4E1BA 3Q8KA 5GAJA 2QTZA 3TZQA 3SSMA 2PZBA 4C3UA 3KL4A 3ZWWA 1VP3A 2SKEA 3AKZA 1AK1A 1RWOA 2VK2A 4II7A 2RARA 2Y77A 3OSZA 4MPTA 3U48A 5LZ9A 1DHTA 3BCSA 4RK7A 1RJ9B 4CR8A 2R6FA 1RYDA 1GJTA 2R6CA 4GIBA 2JEYA 4WASA 3TSYA 1LVUA 2BP7A 5A5GA 1RLTA 3CZPA 4G3OA 4LF7M 1XV5A 2C82A 4PZLA 1AGRA 1CR2A 1Y80A 4KR3A 3REQB 1FNBA 4CQMA 3K9CA 2ZCVA 4PZAA 4YJ2F 4ZV4A 4LDQA 5C8YF 1RKQA 1SUSA 2FPPB 1SFRA 3WMWA 2HMYB 2NYAA 2W22A 1GTZA 4NJEA 4P7JA 4RD0A 3GLQA 1WXXA 1ISMA 1V4VA 2MINA 2J4FA 5HK8A 4IIJA 3W05A 1LPNA 3I05A 4BZXA 4JLJA 1XZPA 3EARA 3EXG1 4GXTA 5KI6A 3C3EA 5T4EA 4NMLA 5KTYA 5C8DA 1WY7A 2PZGA 3SQOA 4C14A 3HN7A 3KR1A 3DE4X 2O7QA 4MQ5A 5CT9A 2AC2A 1GO2A 2VDWB 3AVOA 1MHTA 4UDOA 2O1XA 2CDRA 2V8OA 2MJ5B 4US2R 4TZ6A 4AKHA 3K96A 3OJCA 4WN9B 3H0CA 1C9NA 4F86A 1NBWB 2XDAA 3PPYA 4DV1M 3FHLA 4CKBA 3V9PA 2ZG6A 1M2OA 2D00A 5CYFA 5CFMA 1D1TA 4K8RB 1D9ZA 4ZQGA 2LCIA 2R8YA 3MGBA 3UMYA 4IOLA 4MQEB 3AFIA 1TVMA 3BD7A 3I2HA 1E6KA 2AMVA 4G1CA 3MCTA 3WP1B 2WA2A 1C41A 1VBKA 3T7RA 4G2TA 2LHCA 1G8SA 2DKNA 4K6KA 4LCJA 1E2QA 1MG0A 3RUCA 3VSDA 4DLRA 1GRCA 4WCFC 4JK3A 4RFSA 2ZUUA 1AN0A 2VF4X 4QOIA 2QP3A 3PC8A 2WWIA 5BW5A 1QGZA 1DGHB 3NH6A 4HWRA 4YNBA 5TJHA 2UXDM 4D6YA 2CXQA 1ZUNB 1UZLA 5A6VA 5LKAA 1QVWA 3KSMA 4N39A 2GJKA 3M5WA 3HDVA 3V3KA 4A0RA 3JD3A 4FU0A 3I6BA 4EPRA 4F2PA 4KFRA 1BZYA 5I4BA 1C1YA 3HA3A 1K27A 5FPTA 2O3SA 5JI3E 5JJKA 2WJHA 3I0MA 3K6RA 1GSIA 1XDSA 5I3ZA 5JISA 1VP9A 2G5PA 3AEYA 5HKLA 1TEXA 1JPNA 1JXOA 1NZFA 1AKVA 2ZRHA 2XCOA 4OKIA 5JCZA 4C5CA 5I8WA 3WNCA 2NNLD 4Y9TA 4G5RA 1GTRA 1RBYA 5B55A 3LBNA 4JU8A 4WT7A 1C1DA 3IHLA 5F52A 1HZZA 4IBJA 1OROA 2V6IA 2Z5FA 1NX6A 1YA8A 1JRLA 3BMCA 4PXAA 4ALIA 3QUAA 2EWMA 3W7BA 1PR4A 4B3IA 3T7IA 4JQSA 3VH2A 5AHXA 3U6KA 2ZYWX 4Z4QA 4RH0A 1EUDB 4GI3A 4KX3A 3EPRA 1OZAA 2E4XA 1MPXA 3CXRA 4QUDA 2O7NA 3KW6A 3NWLA 1Y48E 3OG9A 1FPMA 4XWGA 3W2TA 1Z06A 5ITWA 3ZE7A 3IHKA 3CF6R 4BNLA 2W9XA 2MR5A 3KRTA 1W30A 2X19A 3F6PA 4LA4A 4M1TA 4TLAA 1E1LA 3AF3A 4O4HA 5J5AA 4XB1A 4XIYA 5BVHA 4QBHA 2AK3A 3QP9A 1OH7A 4GBED 4ZVRA 4NOJA 4R9NA 3GLGA 2BDEA 5LQNA 1JDNA 3DEJA 5FPSA 3ZCTA 2R5WA 4RK4A 1G7TA 3TZCA 1THGA 1KQPA 2OC9A 3F6BX 4NEHB 3LP5A 5DBOA 3R7FA 4CKEA 4RJTA 2TS1A 3M5CA 3TFWA 2O01F 4F3TA 3PFHA 2C4UA 4H08A 4EY7A 1ZIPA 4AJ1A 4HV4A 5HQ3B 2OBFA 3BRWA 2NZJA 3LBIA 1LQUA 1QYVA 4IFBA 1PWEA 3G1WA 5FO0A 3TLZA 3L4SO 4BECA 3ILYA 3IP1A 1JQLB 3UJ9A 1YU9A 1YNOA 1G7CA 2XODA 3HB1A 3MJRA 3MVEA 1TK2A 2PEYA 4OFWA 2C59A 1KGDA 3K9FC 1DV0A 3IYLW 4Z53A 3O75A 4UQOA 2BCEA 3A46A 3WWZA 4GMGA 3NNSA 6REQA 1VJ1A 1E6MA 3I72A 3DO5A 4DRYA 1BXGA 1BCSB 3U2QA 4KQ9A 2VDBB 1JTFA 2PM8A 3DXZA 5K3CA 4F9FA 2IH5A 3KVNA 4F6LA 1NW6A 1FSFA 4HLNA 5CEFA 5TB5A 1I4TD 1TLTA 1SXJD 1H0HA 4O33A 4DBGB 2ODNA 4J1TC 1TCAA 2V7GA 1HFEL 2LHGA 3E4RA 1PZFA 3LQKA 4DUZM 2PAAA 1H65A 2ZTHA 2ZSDA 1J39A 3NKFA 4N82A 5BUZA 8LDHA 1UXOA 3DBRB 3KTFA 4MV0A 4Q4DA 4BTEA 1H0KA 4EFLA 3U4QB 1N5DA 3GZTB 3RH0A 3UBMA 1O9BA 2BZ1A 2RHBA 1KH1A 3CX7A 3E9RA 4CL0A 721PA 3JD0A 3P45A 1FMJA 2I2DA 5GWXA 4ZEOA 1CDEA 3VYVA 1TCVA 1UOOA 4ENTA 5BOSB 4PS1A 5SYAA 1JB1A 3IUEA 3DMNA 3SQXA 2GDJA 5JNTA 1GKUB 4EF6A 4C05A 1PTJA 4CQJA 4NEGA 3V2IA 2OCKA 4HSGA 4LHZA 3GLKA 1F6DA 1ND6A 1O3YA 1FP7A 2OFWA 4WRRA 5T57A 3TGWA 2BFFA 3BFJA 4LMBA 3IE1A 1ZM2A 1N2CE 1N33B 3O4JA 1NPDA 1DAPA 3VSEA 3KDSE 3L29A 3IPCA 5IYZB 4GOXA 4MW9A 4X92A 1SULA 3DM9B 1NMXA 2JK0A 4WY2A 5MN4A 2P9QA 1YB6A 4BGIA 3DBVO 3DAYA 3ND5A 4MULA 2H1VA 2ISQA 1Z7BA 3DWGA 1QJ4A 4S1TA 1P1IA 3TNFA 2WAOA 3KLNA 4YMLA 3TZBA 5K05A 3E0XA 3A2KA 4DCPA 1ECLA 1Z12A 3F47A 3T3PB 4DLKA 4ETIA 3RYIB 3M4XA 3F8SA 2R3SA 3GRAA 2NU8A 3SBXA 3VSAA 2PJRA 3D2AA 2CF6A 4B8WA 1RI2A 1TH3A 4JSTA 4D1YA 4UNRA 4FYKA 3SVTA 1TJ4A 1BJKA 2VYNA 4X1IA 4HQKA 5EA2A 1FNSA 3JXEA 1E3EA 3UV3A 3EZLA 2LNDA 1IPEA 4MWDA 4W9MC 4TZ0A 2HWXA 3DEKA 4R9VA 2Q6OA 5CB6A 5JXHA 2XRZA 1QS0A 2XZOA 1N6KA 1UEIA 2Y05A 4RESA 1CVLA 1ZSYA 2JFWA 4M1KA 4UVHA 2XT9A 3P0JA 1V45E 2LBPA 4BBAA 4MB0A 1ZU5A 1RMTA 1FRQA 4EUKA 2QMYA 1EUQA 3L7AA 4CMAA 2FFJA 4DR2B 3A8TA 2WHRA 1MV5A 1OYOA 1V3UA 1MQAA 1UANA 2E5WA 4IOKA 1CRQA 5HQJA 1LKZA 4CF3A 2AA3A 2ORWA 2IX9A 2VAVA 2V7UA 3BC1A 3CO0S 3DM5A 5FNVA 3R3YA 1M1YB 4KXUA 1HDEA 2AS0A 2PQ0A 5FWAA 4GKVA 3E4DA 5B1HA 5T4FA 3RE1A 3VYSB 1UDBA 3THSA 4NXMM 3THRA 4Y2TA 3RI3A 2W4MA 3N9IA 2ZR9A 1F3OA 3KD2A 3RYIA 5F78A 3G1TA 1YL6A 1QP7A 1U3GA 1ZXXA 4MWGA 4ER5A 1AHNA 4TS4A 1Q0ZA 3PPWA 3PFNA 1O08A 3R7BA 2ODQA 3IUYA 5IF3A 3A3KA 3DE2X 4CLEA 4FFLA 5DWVA 1DXYA 1W5TA 1IFXA 1ORYB 4JC8A 1YS2X 1G291 1K1EA 5J4VA 4B3RB 2R8RA 4NVRA 1FQWA 2CLOB 2XDYA 2PS0A 3ON5A 3AH8A 3ZKWB 3NV9A 3UJ7A 4BMDA 3TWLA 2VAXA 3CJRA 4EO9A 2HJRA 3I8XA 2GLUA 3DE1X 1V71A 4IGAA 3G0HA 4O08A 5K01A 3RTDA 3FH0A 1VDLA 1RABA 4BEVA 4MHTA 5CB4A 1IWOA 2COKA 1HE8B 3G8YA 3AI1A 3COWA 4KB5A 3SOPA 2AE1A 2NVBA 3KT8A 3TOCA 4ZQIA 4WUVA 4DUGD 3C6MA 4AUMA 2I1WA 2ZSJA 2EZ8A 1ZINA 3WHPA 3D6UA 4C4SA 4ZEVA 2VSXA 3DL4A 4CZ2A 5CB8A 5DBHX 1WEHA 2CMHA 2F59A 2NQ8A 2NW6A 3BFXA 3O91A 1AU9A 4L4RA 4MKFA 4RW0A 5F5LA 4X8LA 2J08A 2LDXA 4D0NA 1KZ6A 1HQDA 2JY8A 3LNTA 2ZAGA 1PFWA 3D2LA 5BMOA 1ZMOA 5CVUA 4CLOA 1W0KD 1Z34A 1OC4A 3JQGB 5C3UA 1DMRA 1SRRA 5TQVA 5A3VA 3EQ2A 3U6OA 1CUHA 1GTG1 1H93A 1XTKA 3KU4A 3PC4A 5JS8A 1BYIA 1EUCB 2HYDA 2ZT5A 4JJ8A 4JYPA 4Y9SA 3WFZA 1GFWA 2PS3A 5ICFA 3JZFA 2XUQA 3RHFA 1ECFA 2VRNA 4P4LA 4X45A 3S3TA 3RUIA 1WZEA 2E4WA 1ZMBA 3QX8A 5E8JA 5JPCA 3E9QA 3PE4A 3UMGA 2O2GA 4DLNA 2H0RA 3HVRA 5G3YA 3WJ2A 4UHKA 1P5HA 4DR4B 3M9XA 1E18A 2V5AA 4IJKA 1SKQA 3EQ6A 2D0OB 3HCOA 4GP6A 4PFJA 1AGXA 2WZQA 3FCAA 4QTUB 3GCDA 1WG8A 5IDVA 4L8GA 2GTIA 2I22A 2IQIA 4GHWA 1CJSA 4NJMB 2IEAA 3W7VA 5KOHB 2YX1A 2O0HA 1OLOA 2WJZB 3FWKA 3PFFA 1I5OA 1FLAA 2FEWB 2TYSB 3N07A 5FLXS 4Q7LA 4EKNB 2RGWA 5ICSA 3TSWA 2YMLA 3ZU6A 3CRZA 3C5VA 1E9DA 2YXDA 1AIPC 1QPGA 3CKYA 3NHRA 4P22A 3C3MA 3GWGA 3P2JA 4DVJA 3TTXA 3EXFA 2OZVA 2OM6A 2EW8A 2B4AA 3EH1A 3PCXA 1GL3A 4BAZA 5LZ4A 3WAJA 4ZVKA 4DJFC 4LS3A 3GQ3A 4CUKA 4A1FA 1SVUA 1LI7A 3AF5A 5C7OO 4BXOA 2XTJA 3GNLA 2ZQZA 1DEKA 3ZNNA 4M0EA 3AC0A 1IHPA 1H23A 1Z74A 1X7GA 3MILA 3KEGA 2WJWA 3PC7A 1PW7A 4L85A 3AFOA 5DGDA 3VTAA 4MR8A 4MGIE 2J0UB 2XMQA 4ER7A 2X1LA 1C7IA 2OWDA 2ZJOA 2XPCA 3KJGA 1W48A 4JBWA 1YMQA 4YRSA 3OECA 4QOSA 1YB7A 1AZWA 4LAFA 3SYNA 1YOBA 1E2PA 1VMAA 4UEJA 1AURA 4DGQA 1F9AA 3V8BA 5FCDA 2HYIC 3OFJA 3E9NA 5FL3A 4YMUA 3W5CA 2EW1A 2VH2A 4XCVA 1EGVB 1H6AA 4A0SA 1IOLA 1IUKA 3L9WA 4CKEB 4BNTA 2XRMA 2Z83A 1S8AA 1AQ6A 1BQEA 3EEQA 3GJRA 3M6UA 4Z9FA 1I36A 3LBAA 4LF8B 2JDIA 1ECPA 1W47A 2WSYB 3HJBA 1P7WA 2AEFA 3M34A 4HDNA 4OXIA 3IAXA 2XOKA 3L0IB 4HYYA 1OXVA 1M3SA 3LM8A 4F2LA 1SKAA 1FX1A 1U7WA 2H08A 3LG2A 3OPQA 3BZBA 4TN5A 5DCYA 1XVUA 1E2FA 2EFCB 2X49A 1L5YA 5KJ1A 1C8BA 3LWDA 1F38A 4GH5A 4RTJA 4P81A 3HJRA 1G5IA 3EUWA 1EFAA 2NZ8A 3H5VA 1MX5A 5LP6C 4CM9A 1BNCA 1UZUA 3QZUA 5JO0A 3DXYA 3O8OB 1JYSA 4PIMA 1NVMA 5L4LA 1OBCA 3PVZA 4X3OA 2IUEA 1B8NA 5LWQA 2FPXA 4Q00A 1C9YA 3CVWA 3SFZA 1ZK0A 1IIBA 2CWWA 2X22A 3G17A 1YR7A 3RFUA 1YZKA 5FPKA 4GVXA 5KHOC 3CLRD 2I5PO 1XZAA 2QRUA 3N0XA 4R8SA 3D8SA 3UWKA 1L7NA 4IDQA 4PCLA 2LBCA 4RE6A 3ZV6A 5AM4A 1XUOA 1PNTA 5TQ2A 5KTOA 4ABYA 1W4AA 3KOMA 3PC2A 4GGMX 1ISIA 1KIAA 1NOKA 4NE9A 3Q3CA 5CRIA 1G6KA 5K0TA 4RE5A 2GARA 3RE8A 3BIOA 1FLDA 3L7DA 3CXUA 3OQJA 1XNQB 1OGIA 1RBZA 2QN3A 2IQ5A 4LISA 1Q77A 1WLYA 4C7MA 3EFEA 4YLYA 1QR2A 4FN5A 3ENQA 4QBIA 1QV7A 4DM7A 4LRSA 3TEJA 2CCJA 4D3SA 1LX7A 4E6EA 4K9NA 2O1SA 1ZEMA 1Y6QA 4IBEA 3F6SA 3B6JA 4ES6A 4P7BA 4ZKEA 4RVUA 4Y8VA 1EP3B 4QXMA 3VVBA 3AHCA 4QDKA 1ZM4A 1W6RA 4XEUA 2JF0A 3PQCA 2QT1A 3PHHA 2P9YA 4KMRA 1G4AE 3CBQA 1I2CA 2ZRAA 4MYRA 2VDQB 1HH4A 4B0OA 2P6NA 4E6PA 5LQDA 3DL7A 2QUZA 2PHZA 1QDLB 1NQOA 1XF9A 3FPSA 3I92A 4EA9A 5AQEA 4F3RA 3D0OA 5FBZA 4LBVA 2ZAOA 4UU7A 4EGCB 5LB2A 4DR4M 2IXEA 4ZAVA 3UV7A 4FS3A 2PX3A 4ZO9A 4OQQA 3GVIA 1JMKC 4PLCA 4PV7A 2MSEB 1KDPA 1T5SA 1W4RA 4OHRA 4PX9A 3OJWA 3RRBA 3PL5A 3HPRA 4JYMA 1XZNA 3SPXA 3LCMA 5AKZA 3ZIUA 3JV7A 3QX7A 2A0XA 2J59A 3NHFA 4F2HA 3I04A 1U28C 1W73A 4KPUB 4FHGA 5HFAA 2JPDA 3QYFA 4AKGA 4C03A 2IH2A 1Q92A 2XHZA 1P7PA 1ZOOA 2HCTA 2A4KA 3L1KA 5LYYA 4D4IA 4R40A 1GXSA 1L5HB 1GAWA 3G5UA 4OSOA 4Q7EA 3KHUA 4LRUA 3AW9A 3I1IA 5J47A 2AEJA 4P3XA 3LC2O 2YV1A 3QV2A 4WVFA 3QBVA 3G23A 2Y6VA 1B8UA 5D00A 2B92A 3HJTA 4EFMA 5CXUA 4URXR 5JATA 3JVVA 3M49A 3REQA 4B6PA 4DB4A 1OH8A 1DQNA 1MR3F 1OTXA 4FUTA 5EMLA 5I01A 4JLUA 3RSQA 3S5JA 3ZNOA 2L6OA 5IJWA 4C87A 1VC2A 2OK8A 3F4BA 4CMJA 3QNWA 3W1VA 4FJ1A 1KOLA 5KKAA 2MROB 1AO3A 4BNMA 3GFGA 2BE7A 1V8DA 1D07A 4JJEA 2R1UA 3BXOA 3LOQA 2DERA 2CD7A 4GM4A 4JMPA 1HTTA 1TUBB 3ULKA 3RADC 2NVOA 4FW9A 1V8FA 2IYEA 2Q50A 2XTMA 2GM5A 1M0SA 2O8VA 2B37A 3G9UA 4X7MA 5IM5A 1SQ5A 3FFWA 3OZUA 3FTEA 3IXQA 3THYB 4EATA 4DV6M 3WLQA 4GI1A 4NWIA 3SHFA 3S8MA 2I1LA 1BKDR 3N2KA 4RYDA 5DM60 4BBPA 2OHJA 1BEZA 1F0YA 1VJ0A 5I7RA 1T2DA 5J63A 3SJ7A 3U13A 4LI0A 3TLMA 5M5BA 1T1SA 4TYQA 1DJOA 1Y9AA 1MIHA 1XVVA 2AMYA 4GEKA 3E46A 4HWSA 3ABQB 4ZO4A 3TLAA 4UTRA 1FUIA 3GHHA 1NC3A 2QI9F 3ZBTA 3ZIAD 4W1RA 4GDFA 4NRVA 1U9IA 3ZU4A 2AWOA 1XXHE 2RI1A 3FKJA 3C3AA 1XQXA 5AVKA 2JH9A 1NDHA 4RSMA 4GU5A 4M38A 5ECGC 5ALFA 2XGNA 3QU9A 5AWFC 3Q9UA 5BWBA 1LQ2A 4QHTA 2QUJA 3K0BA 4IIXA 1QE3A 3HBMA 5DWDA 4DQKA 1PTKA 1ZH0A 4DR1M 1TDJA 2CZCA 3BGIA 4RLSA 5EMJA 2GKGA 3EVTA 3H6HA 5JR3A 5KNBH 3BWMA 4NDZA 4KUHA 4ZO7A 3GD7A 3ZYCA 3WAGA 3KZMA 5EP2A 2VTVA 3O6VA 5LMNM 3QXSA 5KOHA 1XPOA 4RUKA 3VJRA 2J9GA 4M8KA 1WMDA 2CUNA 1U3TA 5J4KA 4JVOA 4JODA 2E5LB 2FDCA 2BW0A 3T6KA 1WIVA 3ILHA 5K7SA 2ICAA 5CGQB 4O3MA 4QYMA 4S2UA 1SHKA 2AX4A 3HM9A 4HDKA 5HIKA 1IULA 4MQMA 4J0QA 4ZV9A 3TTSA 1TRHA 1Q50A 3COJA 4OLAA 3R24A 1ZVQA 1JDZA 4CGZA 4IWYA 4R54A 4GEGA 2V3WA 4B87A 4B5LA 3E03A 3T5GA 3FWNA 1ILWA 3UUWA 1UK7A 3FWHA 2H0QA 4FOOA 3LIIA 3M83A 3BOSA 4LBYA 1V43A 1RJFA 2RCYA 4ML3A 4XGQA 1IQUA 4P5DA 3K6KA 2F48A 4JB3A 3G9QA 1TQHA 3FOZA 2BEJA 5CU7A 3OCYA 3F73A 1C9MA 1KJ8A 3RW9A 1EA5A 2WZJA 1ELOA 2FPOA 3S2GA 3WKBA 2BWEA 1ATIA 1FYVA 4O4HB 3R4VA 5LIRA 1UL1X 3PK0A 4D8TA 1AO0A 2HJ9A 2OILA 4S1PA 5BSKA 1FTGA 4CLHA 3JQDA 13PKA 2R11A 4WEOA 4IIFA 4XOIA 1PT9A 1AZTA 2NPFA 2ZULA 3A1TA 2F43A 5D6OA 4R8VA 3NIGB 3NFRA 1VZ2A 4B3TB 4YH1A 1KEEB 4WA8A 4DSNA 2IOFA 2IXFA 3ITKA 4LVOA 3BK2A 3J7AC 3FUXA 2IFTA 3WLLA 1SCKA 3UM9A 1TE2A 3N2YA 3E3MA 3LO5A 5EIFA 4CDRA 2ZRQA 1CX9B 2R0QC 2ZYUX 1XLTC 1NQTA 4XKJA 3B52X 4LJ9A 1WP9A 3PD1A 2EGGA 3AKEA 3ZIAA 1I3OA 1P5FA 2WP8J 5DNEA 3DGEC 5WRFA 2HRBA 1UJ6A 1ANKA 1YKSA 2JLZA 5DCWA 1Q1QA 1T36B 1TKRA 4UC0A 4EF4A 2YY7A 4N12A 2UXCB 1P1FA 1MOSA 1YJXA 3PENA 2HLPA 4HQLA 4YXWD 3MC1A 4REQB 4UPVA 1TA4A 2HREA 3FTNA 1E3WA 2OV2A 3K0FB 1NLFA 1ADBA 1BRTA 2BMEA 3NAGA 4H7HA 2CV0A 3IOYA 1KR5A 2NSDA 1G19A 2XVAA 4HAWA 4L5AA 1SZJG 1NAHA 3OF3A 4S2EA 5CVVA 1YR6A 2H6EA 5CA0F 4UUBA 2C9OA 5L7WA 2C3YA 4UMEA 2M60A 3GARA 2HO4A 4RQAA 3G2MA 1R6UA 3G3EA 3MS2A 4MGKR 3C1AA 1R18A 1XTUA 3EA4A 4RV9A 1ZG3A 2V6ZM 2RB4A 2PMFA 1AVTA 2Q3LA 4MUXA 4NZYA 4Q4AA 1TXGA 3IPXA 4YLEA 5EWMA 5A5VA 3MXOA 2I4LA 3GRCA 2V7QD 2QRJA 4JJ7A 1VKZA 2HRDA 2W6NA 4G5YA 5K0ZA 1MJHA 2A1TS 4HNQA 1EGMB 4OUDB 2X77A 2PR7A 2ST1A 4E4RA 1RJWA 4XDYA 1YDFA 4N0PA 5FYQA 5EJMA 3KLPX 2XITA 4GE3A 4W8HA 1CQWA 1GQRA 2XE6A 3UA4A 2WQ7A 1P5RA 3RC8A 3JQAD 1L9XA 2P3LA 2W71A 4NBTA 5TVGA 1AQLA 4OJQA 4IHKA 1AXRA 3B7GA 3PPXA 4CNQA 3PFGA 2HW8A 3ORHA 1MAUA 5HRAA 2JAUA 4P5PA 5CLJA 3HVHA 3PFKA 1ACMA 2ZXFA 4Z0HO 5A7GA 4NH0A 4PHHA 1W5FA 3ACCA 1UBNA 5KDLA 1NYTA 2EO2A 1R66A 3U37A 5A9RA 3NXSA 5BOVA 1SXJE 2ZI7A 1D6JA 1JBKA 1UADA 3TB4A 2D5IA 5G0UA 4UD6A 3UGTA 1Z2AA 1IWBB 1QUSA 2I4RA 3IXMA 3AOEA 1Q0HA 2WICA 4BVLA 3TOZA 1P7ZA 3A9UA 3JR3A 3HY4A 2VPZA 4ZMSA 3QWLA 1RHQA 3Q3GE 1HE4A 3KLMX 4TX1A 4Z4HA 3EC1A 4EG8A 1NG9A 1H1TA 1YRLA 3RABA 1QZUA 4MW2A 4M8NE 4XLLA 5C4MA 3LUAA 4CIBA 5HX7A 4Z4FA 3HVKA 1DJQA 2WSSA 3GLRA 2FPGB 3QVTA 4BZQA 1ESZA 3EUAA 4HX9A 5DVZA 2SBTA 4MWEA 4AF7A 2FR8A 2P67A 3JYPA 5ITQA 2Q41A 3L41A 5JDIC 5LOVB 2W11A 4KIGA 4BVJA 3ABRB 3SICE 1E69A 1ISJA 3UN1A 4G4OA 1MABB 2WOOA 3PA8A 1TM5E 1XU7A 3NCTA 3C3PA 2W5UA 5CLHA 4PC3A 3KS8A 4L02A 2PX4A 3H83A 3OKAA 2C9DA 1Q6ZA 3QJYA 4IMRA 1GQYA 1KS9A 4UNIA 3FNIA 2Q6VA 3BSFA 5FOVA 1PG5A 4M1SA 2YWXA 4MR9B 2GFQA 3IVRA 4D9MA 2PO7A 1N0VC 3DAOA 4FFWA 3T9FA 3BPSA 1JG4A 1E2KA 3G2KA 4HLUA 4I4TA 1GLVA 3QFTA 2GZ2A 4Y2QA 2I4NA 2IL1A 4TVSA 1SBIA 3FTFA 1I1QB 3GI1A 3QOYA 1USWA 4PYLA 4RL4A 1JILA 3IRVA 4KNYA 2AN3A 3T35A 5JS1A 2V0GA 2JIBA 1JEJA 4EENA 3FB4A 3HL0A 2VQFB 1U3FA 3UTDA 3LMMA 1PBNA 1QLWA 1T1JA 3HLKA 4G0QA 3QEKA 4QLAA 4CQNA 3U6PA 2HNBA 2HJVA 1G5QA 1N2HA 2DQZA 1WDKA 1IOWA 1ZJ4A 4EFNA 4HFNA 3PXXA 4DCGA 2CB0A 2BJVA 1E92A 2WU3A 2JDID 3UGQA 1G3QA 4EB6A 4S1NA 2IF0A 2BEWA 4CDNA 2EX0A 3QUSA 4MK4A 3OFSA 1G16A 2IYLD 4UPDA 4ZYZA 1NR5A 3RIYA 3GJ0A 2R65A 3TCNA 2RGXA 3PVCA 2AZMA 2YQ4A 3B1KA 3T41A 5BR8M 3GCZA 2HBQA 2PKQO 3AR3A 1F51E 3QGMA 4L0MA 1XNHA 4M8IA 4QUGA 4MEAA 3LSYA 5EIBD 5B3JA 4ATNA 3WGUA 5JRZA 5TEVA 3L04A 3MJHA 2JCGA 3B5IA 2ZBQA 3MTAA 4BGEA 2QD3A 2KNZA 3M6AA 2BMWA 4AG5A 3I0ZA 3E3AA 2ZJ1A 1IJBA 1P4GA 3A6JA 2Q8QA 3BQ9A 4NZNA 2L42A 2OHVA 2QM0A 4YA6A 5EXEA 4CTMA 2MSLA 3QSGA 4CLRB 3CFYA 3A6ZA 3Q4GA 4XX0A 1I7SB 4J0GA 2HA6A 1GGVA 3AJRA 3QKTA 2REOA 2IT1A 3QWAA 3OZFA 1EXMA 4LNUB 4MWOA 4RC9A 2GHQA 3VMMA 4TKVA 1ENOA 2C9YA 4EECA 3IIIA 1MVNA 4S3MA 1Y8QA 1AM4D 3GQ5A 1V47A 4NAUA 4OK6A 1YB2A 2L2QA 5EQDA 3DQPA 4K6CA 2Z43A 5THQA 1DBPA 2O3QA 3EGXA 5EMHA 3GG9A 3I12A 1T8SA 2VA9A 1VL2A 2O2CA 3NETA 2PU5A 3IPLA 3DYBA 4OA5A 1P4SA 5JSKA 4YJ3B 2P9GA 2R8OA 1MTZA 3TLXA 4CIDA 5LMZA 1E3MA 2HOQA 3EXIA 3GJZA 3JVDA 4E0BA 1MEJA 3TIIA 4HS4A 4P0PB 3DOOA 1U9CA 5FLXA 3OZGA 3PNSA 3EVEA 5E1OA 4D0GA 3CZAA 2NTNA 2MDTA 4KLRA 5DEOA 1NMYA 3C7DB 2B8JA 3DCIA 5AW3A 3OIUA 3KT6A 3R75A 3HU2A 4J29A 2OD7A 4JR0A 1HOTA 5H37D 4HWPA 4BWYA 1H6CA 1QANA 4TQAA 3SS8A 3ZHYA 5EE9A 4WKGA 4MPDA 1NW8A 1WR8A 2IEYA 2JD0A 1E96A 3LVVA 2FXIA 1YT5A 1OZ0A 1IPFA 4YRQA 1ZK4A 4KLCA 1XEWY 1Y89A 2QI9C 3PDUA 4QPCA 4AMZA 1Q0SA 4AQ7A 5TXGA 4G5QA 2ZSUA 2VHEA 2A9PA 1NP3A 3VTFA 4V1CB 2H85A 4CJXA 2VUSA 2YHIB 3DOHA 3FHOA 5DB4A 2AVDA 3C9PA 1NIJA 1TX4B 2GEJA 3PP8A 3EIWA 3PF8A 3WLPA 1JXMA 5AW0A 1KEWA 4DLYA 3RV3A 1PV4A 4ZOLA 2Z4SA 1KO5A 3AO0B 3HBAA 3HWSA 2ES4A 3BHJA 1WKCA 2VHWA 3AEXA 4L6IA 5J2TF 1JH9A 3PUHA 1YVPA 16PKA 3BRSA 3D7SA 4GKBA 4IDFA 5IJ9A 2QRVB 4RZHA 4TV8F 3AVWA 1NXWA 1T5DX 1TTQB 3BTUA 3CISA 5I9LA 4CF6A 1W96A 3WRWA 3OMWA 2GCPA 4FOPA 2C9MA 1PTJC 3HCPA 2HA5A 1E79D 4AMYA 2Q5OA 1EP9A 1PWYE 3B53X 5IMBA 2BLNA 4V0OA 4QUIA 4MINA 3SJUA 4JUCA 3A9WA 4TXNA 1XRPA 1KQOA 5ANRB 5TJ9A 4AO7A 2H1CA 3MTGA 1DIAA 1YXMA 3MHPA 5FI0B 5KCMA 2WSMA 3ESBA 3K6SB 3OT4A 4J76A 3ZDFA 4XZ3A 1A5BB 2QAGA 4QE3A 5KNDH 1FK8A 5LP6A 1QWOA 2IYUA 2VWPA 3STUA 3GMIA 5AVVA 1I0LA 3KYDB 4WVLA 3SM9A 4GDMA 1A9QA 4A6PA 2BGJA 4FWDA 2FQ1A 2IV7A 1GQQA 4J9UE 4A4DA 3ISJA 4PTYA 2IYOA 2PZAA 1PJJA 1M6WA 3CN7A 4IJQA 4OHWA 2VCEA 4HH0A 4E4TA 1TEHA 1ZCJA 4RPIA 1BDMA 3F1LA 4NYJR 3UENA 1YMVA 1KSHA 2OPBA 1DDGA 3FIJA 3LT2A 3AVTA 4PX3A 2NXCA 4R7GA 4P38A 1N6PA 4YY3M 1RW4A 2EFEB 4S24A 3ZE2B 1SUWA 5G53C 4ZVVA 4OP1A 1Z35A 5CG1A 4ITQA 1Q74A 4JLBA 3KQHA 5ALKA 4DV2M 2P6OA 4EOGA 5CLQA 1PEAA 2WF7A 3H1TA 4KK4A 4XQEA 1LGYA 1DEOA 4XSVA 4WTOA 4YO8A 3ZNQA 4J4BA 1DARA 3BA1A 1NFFA 3MTEA 3OLQA 1DGBA 2P78A 3I01M 1Y7HA 2X8JB 4DQLA 3QF4A 1XWIA 2GO1A 1OHHD 1PM5A 3P0HA 1VE6A 5JWHA 2IF2A 1T26A 1AKQA 4ZT2A 4LY9A 5TPZA 3ELDA 1FFXA 1NZJA 1Z0SA 4F5WA 3DBLA 1A82A 3N2EA 4JOCA 3V1UA 1HDYA 5E7MA 3F8TA 4B76A 5FHRA 1BQ3A 1I80A 1ODFA 4OMFG 1T4MA 1R7RA 2I67A 3DCNA 3R8FA 4EG1A 2A58A 1H5UA 3O9ZA 4AMBA 1V3TA 1QMPA 1GJSA 1D2AA 1HTBA 1H6BA 1NT2A 1NWCA 3PYXA 2GQ0A 4N7BA 4Q19A 4Q4HA 2OPHA 4BMOB 2FWRA 3VNBA 3AR8A 3PTLA 3R6TA 3DA8A 4WY5A 1F2TA 5H0IA 5E4JA 1DIBA 5ENVA 4CKCA 2L17A 5K6AC 5I9IA 1A4UA 2C00A 2CXXA 3Q5EA 4DNPA 2AG6A 1WU8A 2D0PB 2J9YB 4NU5A 3D3NA 1EAMA 2CLIB 3A70A 3BJRA 4KXNA 3DV0A 1C9KA 4OB7A 2GA9A 2ZBPA 1E3SA 1TOAA 1Z6ZA 2OYRA 2R4EA 3PQFA 5D86A 3G2QA 4RDXA 5I51A 5K8JB 1U2TA 4ZQBA 1UIRA 4BGUA 2I3ZA 1RPJA 4HDQB 4BB6A 1RHJA 4E5PA 3KQQA 1E20A 1QGED 4IL5A 1KHHA 4R1PA 1E3LA 1L5FA 3HBJA 4M76B 4RIGA 5F33A 1Z82A 1J8YF 2NUTA 1MJGM 1K75A 3O8QB 2MSNA 4XJVA 2O8BA 2EBHX 5CFQA 4HMPA 2GBLC 2H07A 3DBOB 3CNQS 4IG4A 3KOZE 1CY6A 3DZIA 2JY6B 1N77A 4U02A 1AGNA 4FFRA 1N9ZA 2HZBA 1JHPA 4MYCA 3H1AA 3T95A 4BP3A 2NVUA 2B8TA 4L9WA 1GZ5A 4YQEA 2HNKA 2HL6A 5EKUA 1DX6A 3MS7A 4I1UA 4K2AA 1PR1A 2WKQA 4AXBA