2LXEA

S4wyild
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVEDENKQSEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUVR4
publication title S4WYILD structure
rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 18
structure length 109
sequence length 109
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10440 WIYLD Ubiquitin-binding WIYLD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.850 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lxeA01
2LXEA
chains in the Genus database with same CATH superfamily
2GQFA 4RNAA 3SAVA 1JR3D 1N77A 1QVRA 5JI2E 1PJQA 2JY7A 3SMSA 4G4NA 1RU3A 1E9SA 3LCVB 1VEGA 1TR8A 4IBFA 4K0KM 2DZNB 2XZFA 2VDBB 4L4UA 2WSEF 2DAKA 3A45A 3VFDA 3IG5A 5KPZA 1TH4A 2CEAA 5KPRA 2DAGA 3SATA 4X65M 5KPTA 2KHHA 2OPFA 3LQQA 2OQ4A 3MK6A 3SC3A 2A5YB 2EO2A 3VK7A 1OJLA 3JR4A 1WR1B 2UXBM 5KO3A 3HGIA 2C9CA 2CV0A 4X64M 3PFIA 4JI3M 2RRUA 3FUUA 4R71A 5C1BA 4DV6M 2DXIA 4GKKM 1FNNA 1HQCA 1OAIA 1AIPC 1IXSA 2HKJA 2VF8A 2V1CA 4GHAA 2LH0A 1WIVA 2CV2A 3U6MA 3L27A 3AOGA 1NY5A 3U6CA 2C9OA 3HHXA 2K9DA 1BVSA 1QQWA 1SXJB 1YSYA 2QHOB 2WSFF 4R3DA 1IY0A 2J5YA 2CRUA 4B3SM 4FCTA 4B7GA 4FWGA 3A98B 1EE8A 3AL0C 4FCVA 2R46A 3I4YA 4L6V6 4R7GA 1Q3CA 3J80S 2FNAA 1K82A 4LF8M 1DO2A 2CFOA 3IG8A 1JR3E 2EJSA 5EP4A 4GKJM 1R5LA 2WSCF 4EIWA 1GJTA 1Z59A 1XB2B 1L1TA 3SASA 2DWZB 7CATA 2F5NA 3U6EA 2QBYB 1NSFA 1VDLA 1XXHE 2E5LM 4OW0A 2EKKA 3JAMS 1TDHA 1G41A 4GITA 4A3VB 4NXMM 3KS8A 1AUAA 3IECA 2DAEA 5KQ8A 5EXSA 4AI6A 1T3TA 4G4QA 3JR5A 2G5GX 3GPPA 2CP8A 1VG5A 2APLA 4KODA 1DGHB 4MB7A 5EJCA 3D8LA 1Q39A 1G8PA 2CHGA 1E9RA 2ZAOA 4IBGA 5FTMA 4LG2A 2ERCA 4PDGA 2MH8A 2HWJA 3GLHA 4LZZA 4AW4A 2D7GA 4B7FA 3SHFA 1L1ZA 3FRHA 3KOXE 4PCZA 2F5SA 4IJEA 3ZQJA 2KZUA 1T43A 3CF2A 4IBCA 8CATA 2BWBA 2AHMA 3BXWA 1IN8A 5KQDA 3LVWA 1GLNA 1NNJA 1XXHB 4JI4M 4JI5M 1QAMA 1NHWC 2JWSA 3K9OA 3W0LB 3WHKA 3U6PA 2DKLA 4AQYM 4P17A 1OAOC 2R0IA 1IN6A 4REZA 3SAWA 3B7QA 4FVMA 3MHVC 4DV5M 2YR0A 1SXJD 3KSJA 4CHTB 3J81S 4NSOB 3C9PA 1F4IA 2QZ4A 2L4EA 1J5EM 2Q2EB 4DV1M 2QP9X 1HT1E 2J7NA 1TDZA 3J2PB 3L25A 1J7KA 4G3OA 3M0EA 3IHPA 3J27B 4GC5A 2KRUA 4JI7M 3HZJA 2LTUA 1PGYA 3W67A 2MR9A 2J7OA 3U6LA 1NV8A 4XGIA 3OTOM 4LF5M 4M0DA 1IM2A 1Q3BA 4IBBA 3A46A 1NVMA 3GRUA 3T15A 5DYIA 2XLJA 3UZUA 2VQEM 4II7A 2BNKA 3GLFE 1K3XA 5EP3A 1MX0A 4MGYE 4MGHA 1QAOA 4LFCM 3F92A 3K8ZA 3UMMA 1I4WA 3AKZA 3KOYE 1PRBA 4I5SA 4Q7JA 3UK6A 3GP1A 4G4OA 1R2YA 1UFZA 1R7RA 3K1JA 4MGZE 1V34A 3U60B 1S3SA 1KYIA 2Z4SA 3HY5A 3TPZA 5H37D 1XMOM 1PM5A 1EIJA 2RKOA 3TL4X 3U61B 2DWMA 2R6FA 3SAUA 2FFJA 3KW6A 2R4JA 1DGFA 1L2CA 1IN5A 3U6OA 2XGNA 4LJ9A 2L7IA 3VK8A 2B3TA 1Z5CA 3ZC7B 3HHYA 2M5ZA 4IBEA 3GLIA 1XWIA 2QSFX 3WHLA 2O25A 1DO0A 3FKEA 4WP2A 4L16A 1WXQA 3RGSA 2ZANA 3Q8XA 3PNVA 4BBAA 1G3IA 2HAKA 4LJ4A 3SYKA 2ZBKB 4OVZA 3U6QA 2K47A 3GLFB 4B08A 3HWSA 3K2LA 3SFZA 2LVNC 3PNYA 4QHSA 3DOAA 4XK8F 3M7GA 2ZAMA 3W68A 1N34M 2N35A 4I4LA 3KFUG 3B74A 5JI3E 1IN4A 4LF4M 1ZQ9A 4LF9M 1G71A 4LF7M 1V92A 1GVNA 4D82A 2JZ1A 4G6ZA 3VKHA 1GJSA 1XNRM 5ITYA 4CJ6A 3UGJA 1NJFA 2CWBA 3RGPA 3LVVA 4LFBM 4L8RC 1OIPA 1MN3A 2KA6B 1ZMVA 1C1KA 2HCBA 5F3WA 2LVAA 3QAUA 2QENA 3CF6E 3MMPA 1WGLA 2C96A 2JY5A 4AKGA 3B9PA 1LTMA 4NL4H 1WGNA 3GQ5A 2LHGA 3SBJA 1DGGA 3QYEA 4LZJA 4YHHM 1QDRA 4Z8XA 1KFVA 2UXCM 3PXGA 3FD9A 2UU9M 1IXSB 2X49A 1PJTA 1W5TA 4CGYB 4X62M 3SMPA 1IFYA 1MJGM 2CHQA 3ZH9B 2JZ0A 2KW0A 3L2AA 4NRWA 4FWHA 4NXNM 3HJ8A 1MU5A 4IJFA 3CTWB 3V76A 1G4AE 2XFSA 3C3DA 1GKIA 1LV7A 2CE7A 3NBIA 2KXEA 3GLHE 2NQ8C 4JYAM 3H4MA 4QOZC 4JI6M 1QDTA 3VDUA 4MGKE 4NRVA 3FTCA 2UXDM 4LJ6A 3HX3A 2F5OA 2FH0A 1D2NA 3HKPA 5DYGA 4IBKA 3TQSA 3B7ZA 2R65A 1OKSA 4MM3B 4QNRA 4TUWA 2R18A 1TH3A 4IIWA 3ILKA 4LY6A 1OQYA 1PJJA 3K92A 1HNWM 3R8FA 4BLCA 2WZJA 2QQ8A 2LVQD 3BOSA 1HNXM 2RGOA 3AOEC 2DZOB 1N36M 3HU3A 3QWLA 1D0LA 4MH0E 2K6BA 1SG9A 1QUTA 1EFUB 2Y21A 2Y0QA 4G4RA 2YQZA 5BPVA 2DVWB 4PT5A 3GLGA 3RE8A 4LJ5A 4HL4A 2Z8YM 3H4JA 4DR5M 2I7PA 3Q8GA 2KRKA 4JXJA 2G3QA 3KDSE 2ZM6M 3GRYA 3GLHB 2C99A 2RGHA 2XEPA 3VDPA 2KEBA 3U6DA 2QNJA 4QNMA 1IBMM 2QCUA 3AV0A 1GL7A 3R9XB 2JA2A 2K0BX 1A5TA 1IY2A 2QPAA 1G59A 2UUAM 2VQFM 1OTRA 1VEJA 1I94M 2CHVA 1SXJC 4AKHA 3I04M 2V6ZM 5FTLA 5EXXA 4DV0M 1J09A 2BJWA 4FW9A 4DR4M 2XF3A 2X8AA 1ORYB 5IT9S 4LJ7A 2DWLA 1IXRC 1VQ1A 4RF1A 4I8OA 1JQJC 3KVWA 4B3MM 1DV0A 3PVSA 1XC8A 3FUXA 4GHLA 1QUSA 3B89A 4ANRA 1IN7A 4D81A 3TWMA 1ZAEA 2W82A 4FD2A 3J7AS 4B3RM 5IZ7D 5E26A 4M0WA 2O5RA 5L8RF 4DV4M 4DR7M 3C3EA 1HT2E 2JUJA 4LGMA 3FTEA 3FUWA 4NC6A 4DV2M 4HLQA 2JY8A 2P5TA 3GLIE 4DUZM 1NY6A 4KT0F 1IXZA 2XH9A 3E9SA 3FRIA 3UJNA 2L7HA 5ITXA 4X66M 3GQ4A 1XHBA 1L2DA 1KSFX 2OO9A 3T38A 1JB0F 4DV7M 1HNZM 2L09A 2Z7JA 4AG5A 2XSZA 5FLXS 3U5ZB 2F4VM 4KHPM 2R44A 4DV3M 1N75A 1QZEA 5FTJA 3VLFB 2GNOA 2OOBA 1ZMUA 2I7NA 3FTDA 2MROB 4MGIE 5GKNA 3W0FA 5ITUA 3J7BA 2LBCA 2OOAA 2JY6B 3I51A 5LMNM 4JI8M 2X4AA 4ITQA 4JI1M 1IY1A 1OFHA 4L15A 1QAQA 1OFIA 5C18A 2BWEA 1CUKA 1SXJA 4IBIA 4Y28F 4LF6M 4FWDA 1YLAA 3TWLA 1HR0M 3E46A 4M9XA 1XMQM 4PD2A 3THGA 3AJIB 2FOIC 4I81A 4GEWA 4B3TM 3CF0A 3DZDA 2JNHA 2LHCA 4AKIA 3B7NA 3E21A 3I4VA 4LJAA 2KDLA 5FTKA 3FYDA 4LFAM 3A42A 3GLIB 3T1YM 1Z5AA 2KNVA 2DZLA 3SARA 5IREB 2BJVA 1ZV1A 5EXTA 2QBYA 3TE6A 3DA1A 1E94E 4WURA 4OX9M 4BB9A 4OVZB 2JXNA 4QHTA 2D7HA 3L28A 3L29A 2VIIA 2R4EA 4WW0A 2F5QA 1QYRA 4JN6A 5EXPA 3HJSA 1OIZA 4D80A 1XNQM 1DGHA 3LCUA 2G8LA 3T6PA 1NHGC 3FUTA 2DHYA 3KP0E 1P3QQ 1X37A 2M60A 4LGYA 1R2ZA 3NBXX 2Y20A 3MJ5A 3KP1E 3VKGA 1NNUC 1VEKA 3K9PA 2VF7A 4HEOA 3KSXA 4LRSA 2ZTCA 1TH2A 2EKFA 2KNAA 2D7EA 3RFWA 4AG6A 1N33M 1JR3A 1WJ7A 4NSRA 1D0KA 1NJGA 1V33A 1T6OA 3E4RA 3GO8A 4JI2M 2L6OA 3KXEC 1XXHA 3EIHA 3LW5F 3FTFA 3EIEA 2LXEA 1C7YA 1YE9A 3KOZE 3GPYA 2UUBM 2YNMD 2MJ5B 3ZCBB 1Z6TA 1PJIA 3GQ3A 2LVPC 2FE8A 3HJQA 3KOWE 5ITRA 1QANA 1W5SA 1Y8GA 1QZMA 3QYBA 3CGWA 1Z5BA 1N78A 4DR1M 3LQRA 4F2LA 3SHGB 2DAIA 1E32A 1ZMWA 5E6JA 4IBDA 3GPXA 2ZTDA 4GC9A 4KO8A 2DNAA 4GRIA 4RKUF 4S12A 2C98A 2DAMA 2MGWA 4IBJA 3AFHA 4OU7A 3GLGE 4F1IA 2EUCA 1IBKM 3KS4A 2R45A 2O01F 5EQTA 4JV5M 4L78A 4LJ8A 1NV9A 2DHRA 2XSZD 3FE3A 2Y0TA 5IWAM 2H1RA 1TTEA 3U6SA 5DNYA 2Z3XA 2L2DA 2YFQA 4PDIA 4Z6YA 2F5PA 1TGUA 2V1UA 5EP1A 1L8QA 1WHCA 1N32M 4CIZA 1K3WA 1L2BA 2HHHM 2KZSA 3HU2A 4DBGB 1DGBA 1H6UA 2FS1A 4DR2M 3C58A 3HHZA 2XFTA 2DWNA 1HQYE 3U60A 3GRVA 3GRRA 5BR8M 4W5WA 1HJPA 4DR6M 1PJSA 3U61A 1TF0B 1D0MA 1FJGM 2L4FA 5EP2A 3FYCA 4AZFA 1R6BX 2Z4RA 3NWLA 1VDDA 1Q02A 5FSWA 3GLGB 1NO1A 4DR3M 5LMUM 2XZUA 2CUZA 3D8BA 3M6AA 1UM8A 3HU1A 4ZPXA 3I01M 4LCBA 4DUYM 3AOEA 3SYLA 5ITTA 4LRTA 5DFLA 3U5ZA 1GABA 3TWKA 3GLFA 4YY3M 1GL6A 3HHWA 5ITXE 2EA0A 5FTNA 4B7HA 5A2QS 2DENA 3DFZA 2CV1A 2R62A 2JP7A 4M9SA 2LNHC 5ITQA 4FCWA 1IBLM 2HL7A 4P16A 4JI0M 2DI0A 3FUVA 4M9ZA 3L26A 3BBZA 2UUCM 4RF0A 2C5RA 2KNZA 4NOOB 4GMQA 4XBOA 3T1HM 4UN2B 2H5XA 1YUBA 3LMMA 4CISA 4KLNA 4GH9A 1IQPA 1GO5A 2LVOC 4GIPA 4QOSA 1SXJE 3GPUA 2LWXA 1R4GA
chains in the Genus database with same CATH topology
4RNAA 3SAVA 1JR3D 1N77A 1QVRA 5JI2E 3SMSA 4G4NA 1E9SA 4K0KM 4IBFA 2DZNB 2XZFA 4L4UA 3VFDA 3A45A 3IG5A 5KPZA 1TH4A 2CEAA 5KPRA 3SATA 4X65M 5KPTA 2OPFA 3LQQA 2OQ4A 3MK6A 3SC3A 2A5YB 2EO2A 3VK7A 1OJLA 3JR4A 2UXBM 5KO3A 3HGIA 2C9CA 2CV0A 4X64M 3PFIA 4JI3M 3FUUA 4DV6M 2DXIA 5C1BA 4GKKM 1FNNA 1HQCA 2HKJA 4GHAA 2V1CA 2LH0A 2CV2A 3U6MA 3L27A 3AOGA 1NY5A 3U6CA 2C9OA 3HHXA 4AKGA 1QQWA 1SXJB 1YSYA 4R3DA 1IY0A 4B3SM 4FCTA 4B7GA 4FWGA 3A98B 1EE8A 3AL0C 4FCVA 2R46A 3I4YA 4R7GA 1Q3CA 3J80S 2FNAA 1K82A 4LF8M 1DO2A 2CFOA 3IG8A 5EP4A 4GKJM 4EIWA 1Z59A 1L1TA 3SASA 2DWZB 7CATA 2F5NA 3U6EA 2QBYB 1NSFA 2E5LM 4OW0A 3JAMS 1TDHA 1G41A 4GITA 4A3VB 4NXMM 3KS8A 5KQ8A 5EXSA 4AI6A 1T3TA 4G4QA 3JR5A 2G5GX 3GPPA 5EJCA 4KODA 1DGHB 4MB7A 3D8LA 1Q39A 1G8PA 2CHGA 1E9RA 2ZAOA 4IBGA 5FTMA 4LG2A 2ERCA 4PDGA 3GLHA 4LZZA 4AW4A 2D7GA 4B7FA 3SHFA 1L1ZA 3KOXE 4PCZA 2F5SA 4IJEA 2KZUA 3CF2A 4IBCA 8CATA 2AHMA 1IN8A 5KQDA 3LVWA 1GLNA 1NNJA 1XXHB 4JI4M 4JI5M 1QAMA 1NHWC 3WHKA 3W0LB 3U6PA 4AQYM 1IN6A 4REZA 3SAWA 4FVMA 3MHVC 4DV5M 2YR0A 1SXJD 3KSJA 4CHTB 3J81S 4NSOB 2QZ4A 1J5EM 2Q2EB 4DV1M 2QP9X 1HT1E 2J7NA 1TDZA 3J2PB 3L25A 1J7KA 3M0EA 3J27B 4GC5A 2KRUA 4JI7M 2J7OA 3U6LA 4XGIA 3OTOM 4LF5M 4M0DA 1IM2A 1Q3BA 4IBBA 3A46A 1NVMA 3GRUA 3T15A 5DYIA 2XLJA 3UZUA 2VQEM 4II7A 2BNKA 1K3XA 5EP3A 1MX0A 4MGYE 4MGHA 1QAOA 4LFCM 3K8ZA 3UMMA 1I4WA 3AKZA 3KOYE 1R2YA 4I5SA 3UK6A 3GP1A 4G4OA 1R7RA 3K1JA 4MGZE 3U60B 1S3SA 1KYIA 2Z4SA 3TPZA 1XMOM 5H37D 1PM5A 2RKOA 3TL4X 3U61B 2DWMA 3SAUA 2FFJA 3KW6A 2R4JA 1DGFA 1L2CA 1IN5A 3U6OA 2XGNA 4LJ9A 2L7IA 3VK8A 1Z5CA 3ZC7B 3HHYA 2M5ZA 4IBEA 3GLIA 1XWIA 3WHLA 1DO0A 3FKEA 4L16A 1WXQA 3RGSA 2ZANA 3Q8XA 3PNVA 4BBAA 1G3IA 4LJ4A 3SYKA 2ZBKB 4OVZA 3U6QA 2K47A 3GLFB 4B08A 3HWSA 3K2LA 3SFZA 3PNYA 4QHSA 3DOAA 3M7GA 2ZAMA 1N34M 4I4LA 3KFUG 5JI3E 1IN4A 4LF4M 1ZQ9A 4LF9M 4LF7M 1GVNA 4D82A 4G6ZA 3VKHA 1XNRM 5ITYA 3UGJA 1NJFA 3RGPA 3LVVA 4LFBM 4L8RC 2KA6B 5F3WA 1C1KA 2HCBA 3QAUA 2QENA 3CF6E 2C96A 3B9PA 4NL4H 3GQ5A 3SBJA 1DGGA 4LZJA 4YHHM 4Z8XA 1KFVA 2UXCM 3PXGA 3FD9A 2UU9M 1IXSB 2X49A 1W5TA 4CGYB 4X62M 3SMPA 2CHQA 3ZH9B 2KW0A 3L2AA 4NRWA 4FWHA 4NXNM 3HJ8A 1MU5A 4IJFA 3CTWB 1G4AE 2XFSA 3NBIA 1GKIA 1LV7A 2CE7A 2KXEA 2NQ8C 4JYAM 3H4MA 4QOZC 4JI6M 3VDUA 4MGKE 4NRVA 3FTCA 2UXDM 4LJ6A 2F5OA 1D2NA 3HKPA 5DYGA 4IBKA 3TQSA 2R65A 4MM3B 4QNRA 4TUWA 2R18A 1TH3A 4IIWA 3ILKA 4LY6A 1PJJA 3K92A 1HNWM 3R8FA 4BLCA 1HNXM 3BOSA 2RGOA 3AOEC 2DZOB 1N36M 3HU3A 3QWLA 4MH0E 2Y21A 4G4RA 2Y0QA 2YQZA 5BPVA 2DVWB 4PT5A 3GLGA 3RE8A 4LJ5A 4HL4A 4DR5M 2I7PA 2KRKA 4JXJA 3KDSE 2ZM6M 3GRYA 3GLHB 2C99A 2RGHA 2XEPA 3VDPA 2KEBA 3U6DA 1IBMM 4QNMA 3AV0A 2QCUA 1GL7A 3R9XB 2JA2A 1IY2A 2QPAA 1G59A 2UUAM 2VQFM 1I94M 2CHVA 1SXJC 4AKHA 2V6ZM 5FTLA 5EXXA 4DV0M 1J09A 2BJWA 4FW9A 4DR4M 2XF3A 2X8AA 1ORYB 5IT9S 4LJ7A 2DWLA 1IXRC 4RF1A 4I8OA 1JQJC 3KVWA 4B3MM 3PVSA 1XC8A 3FUXA 4GHLA 4D81A 4B3RM 1IN7A 3TWMA 1ZAEA 2W82A 4FD2A 3J7AS 5IZ7D 5E26A 4M0WA 2O5RA 4DV4M 4DR7M 3FTEA 1HT2E 4LGMA 3FUWA 4DV2M 4HLQA 2P5TA 4DUZM 1NY6A 1IXZA 2XH9A 3E9SA 3UJNA 2L7HA 5ITXA 4X66M 3GQ4A 1XHBA 1L2DA 1KSFX 3T38A 4DV7M 1HNZM 2L09A 2Z7JA 4AG5A 2XSZA 5FLXS 3U5ZB 2F4VM 4KHPM 4DV3M 1N75A 5FTJA 3VLFB 2I7NA 3FTDA 4MGIE 3W0FA 5GKNA 5ITUA 3J7BA 3I51A 5LMNM 4JI8M 4JI1M 2X4AA 4ITQA 1IY1A 1OFHA 4L15A 1QAQA 1OFIA 5C18A 1SXJA 4IBIA 4LF6M 4FWDA 1HR0M 3TWLA 4M9XA 1XMQM 4PD2A 3THGA 3AJIB 2FOIC 4I81A 4B3TM 3CF0A 3DZDA 4AKIA 3I4VA 4LJAA 5FTKA 3FYDA 4LFAM 3A42A 3GLIB 3T1YM 1Z5AA 3SARA 5IREB 2BJVA 5EXTA 2QBYA 3TE6A 3DA1A 1E94E 4WURA 4OX9M 4BB9A 4OVZB 4QHTA 2D7HA 3L28A 3L29A 2VIIA 2R4EA 4WW0A 2F5QA 1QYRA 4JN6A 5EXPA 3HJSA 4D80A 1XNQM 1DGHA 2G8LA 1NHGC 3FUTA 3KP0E 1X37A 2M60A 4LGYA 1R2ZA 2Y20A 3MJ5A 3KP1E 3VKGA 1NNUC 3KSXA 4LRSA 1TH2A 2D7EA 3RFWA 4AG6A 1N33M 1JR3A 4NSRA 1NJGA 3E4RA 3GO8A 4JI2M 2L6OA 3KXEC 1XXHA 3EIHA 3FTFA 3EIEA 2LXEA 1YE9A 3KOZE 3GPYA 2UUBM 2YNMD 3ZCBB 1PJIA 1Z6TA 3GQ3A 2FE8A 3HJQA 3KOWE 5ITRA 1QANA 1W5SA 1QZMA 1Z5BA 1N78A 4DR1M 3LQRA 3SHGB 1E32A 5E6JA 4IBDA 3GPXA 4GC9A 4KO8A 4GRIA 4S12A 4OU7A 2C98A 4IBJA 3AFHA 2EUCA 1IBKM 3KS4A 2R45A 5EQTA 4JV5M 4L78A 4LJ8A 2DHRA 2XSZD 2Y0TA 5IWAM 2H1RA 3U6SA 5DNYA 2Z3XA 4PDIA 2YFQA 4Z6YA 2F5PA 1TGUA 2V1UA 5EP1A 1L8QA 1N32M 1K3WA 1L2BA 2HHHM 2KZSA 3HU2A 1DGBA 1H6UA 4DR2M 3C58A 3HHZA 2XFTA 2DWNA 1HQYE 3U60A 3GRVA 3GRRA 5BR8M 4W5WA 4DR6M 3U61A 1FJGM 4AZFA 5EP2A 3FYCA 1R6BX 2Z4RA 3NWLA 1VDDA 5FSWA 3GLGB 4DR3M 5LMUM 2XZUA 2CUZA 3D8BA 3M6AA 1UM8A 3HU1A 4ZPXA 4DUYM 4LCBA 3AOEA 3SYLA 5ITTA 4LRTA 3U5ZA 3TWKA 3GLFA 4YY3M 1GL6A 3HHWA 5ITXE 2EA0A 5FTNA 4B7HA 5A2QS 2CV1A 3DFZA 2R62A 4M9SA 2LNHC 5ITQA 4FCWA 1IBLM 2HL7A 4P16A 4JI0M 4M9ZA 3FUVA 3L26A 2UUCM 4RF0A 2C5RA 4NOOB 4GMQA 4XBOA 3T1HM 1YUBA 3LMMA 4CISA 4KLNA 4GH9A 1IQPA 4GIPA 4QOSA 1SXJE 3GPUA 2LWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXE A; 
#chains in the Genus database with same CATH topology
 2GQF A;  4RNA A;  3SAV A;  1JR3 D;  1N77 A;  1QVR A;  5JI2 E;  1PJQ A;  2JY7 A;  3SMS A;  4G4N A;  1RU3 A;  1E9S A;  3LCV B;  1VEG A;  1TR8 A;  4IBF A;  4K0K M;  2DZN B;  2XZF A;  2VDB B;  4L4U A;  2WSE F;  2DAK A;  3A45 A;  3VFD A;  3IG5 A;  5KPZ A;  1TH4 A;  2CEA A;  5KPR A;  2DAG A;  3SAT A;  4X65 M;  5KPT A;  2KHH A;  2OPF A;  3LQQ A;  2OQ4 A;  3MK6 A;  3SC3 A;  2A5Y B;  2EO2 A;  3VK7 A;  1OJL A;  3JR4 A;  1WR1 B;  2UXB M;  5KO3 A;  3HGI A;  2C9C A;  2CV0 A;  4X64 M;  3PFI A;  4JI3 M;  2RRU A;  3FUU A;  4R71 A;  5C1B A;  4DV6 M;  2DXI A;  4GKK M;  1FNN A;  1HQC A;  1OAI A;  1AIP C;  1IXS A;  2HKJ A;  2VF8 A;  2V1C A;  4GHA A;  2LH0 A;  1WIV A;  2CV2 A;  3U6M A;  3L27 A;  3AOG A;  1NY5 A;  3U6C A;  2C9O A;  3HHX A;  2K9D A;  1BVS A;  1QQW A;  1SXJ B;  1YSY A;  2QHO B;  2WSF F;  4R3D A;  1IY0 A;  2J5Y A;  2CRU A;  4B3S M;  4FCT A;  4B7G A;  4FWG A;  3A98 B;  1EE8 A;  3AL0 C;  4FCV A;  2R46 A;  3I4Y A;  4L6V 6;  4R7G A;  1Q3C A;  3J80 S;  2FNA A;  1K82 A;  4LF8 M;  1DO2 A;  2CFO A;  3IG8 A;  1JR3 E;  2EJS A;  5EP4 A;  4GKJ M;  1R5L A;  2WSC F;  4EIW A;  1GJT A;  1Z59 A;  1XB2 B;  1L1T A;  3SAS A;  2DWZ B;  7CAT A;  2F5N A;  3U6E A;  2QBY B;  1NSF A;  1VDL A;  1XXH E;  2E5L M;  4OW0 A;  2EKK A;  3JAM S;  1TDH A;  1G41 A;  4GIT A;  4A3V B;  4NXM M;  3KS8 A;  1AUA A;  3IEC A;  2DAE A;  5KQ8 A;  5EXS A;  4AI6 A;  1T3T A;  4G4Q A;  3JR5 A;  2G5G X;  3GPP A;  2CP8 A;  1VG5 A;  2APL A;  4KOD A;  1DGH B;  4MB7 A;  5EJC A;  3D8L A;  1Q39 A;  1G8P A;  2CHG A;  1E9R A;  2ZAO A;  4IBG A;  5FTM A;  4LG2 A;  2ERC A;  4PDG A;  2MH8 A;  2HWJ A;  3GLH A;  4LZZ A;  4AW4 A;  2D7G A;  4B7F A;  3SHF A;  1L1Z A;  3FRH A;  3KOX E;  4PCZ A;  2F5S A;  4IJE A;  3ZQJ A;  2KZU A;  1T43 A;  3CF2 A;  4IBC A;  8CAT A;  2BWB A;  2AHM A;  3BXW A;  1IN8 A;  5KQD A;  3LVW A;  1GLN A;  1NNJ A;  1XXH B;  4JI4 M;  4JI5 M;  1QAM A;  1NHW C;  2JWS A;  3K9O A;  3W0L B;  3WHK A;  3U6P A;  2DKL A;  4AQY M;  4P17 A;  1OAO C;  2R0I A;  1IN6 A;  4REZ A;  3SAW A;  3B7Q A;  4FVM A;  3MHV C;  4DV5 M;  2YR0 A;  1SXJ D;  3KSJ A;  4CHT B;  3J81 S;  4NSO B;  3C9P A;  1F4I A;  2QZ4 A;  2L4E A;  1J5E M;  2Q2E B;  4DV1 M;  2QP9 X;  1HT1 E;  2J7N A;  1TDZ A;  3J2P B;  3L25 A;  1J7K A;  4G3O A;  3M0E A;  3IHP A;  3J27 B;  4GC5 A;  2KRU A;  4JI7 M;  3HZJ A;  2LTU A;  1PGY A;  3W67 A;  2MR9 A;  2J7O A;  3U6L A;  1NV8 A;  4XGI A;  3OTO M;  4LF5 M;  4M0D A;  1IM2 A;  1Q3B A;  4IBB A;  3A46 A;  1NVM A;  3GRU A;  3T15 A;  5DYI A;  2XLJ A;  3UZU A;  2VQE M;  4II7 A;  2BNK A;  3GLF E;  1K3X A;  5EP3 A;  1MX0 A;  4MGY E;  4MGH A;  1QAO A;  4LFC M;  3F92 A;  3K8Z A;  3UMM A;  1I4W A;  3AKZ A;  3KOY E;  1PRB A;  4I5S A;  4Q7J A;  3UK6 A;  3GP1 A;  4G4O A;  1R2Y A;  1UFZ A;  1R7R A;  3K1J A;  4MGZ E;  1V34 A;  3U60 B;  1S3S A;  1KYI A;  2Z4S A;  3HY5 A;  3TPZ A;  5H37 D;  1XMO M;  1PM5 A;  1EIJ A;  2RKO A;  3TL4 X;  3U61 B;  2DWM A;  2R6F A;  3SAU A;  2FFJ A;  3KW6 A;  2R4J A;  1DGF A;  1L2C A;  1IN5 A;  3U6O A;  2XGN A;  4LJ9 A;  2L7I A;  3VK8 A;  2B3T A;  1Z5C A;  3ZC7 B;  3HHY A;  2M5Z A;  4IBE A;  3GLI A;  1XWI A;  2QSF X;  3WHL A;  2O25 A;  1DO0 A;  3FKE A;  4WP2 A;  4L16 A;  1WXQ A;  3RGS A;  2ZAN A;  3Q8X A;  3PNV A;  4BBA A;  1G3I A;  2HAK A;  4LJ4 A;  3SYK A;  2ZBK B;  4OVZ A;  3U6Q A;  2K47 A;  3GLF B;  4B08 A;  3HWS A;  3K2L A;  3SFZ A;  2LVN C;  3PNY A;  4QHS A;  3DOA A;  4XK8 F;  3M7G A;  2ZAM A;  3W68 A;  1N34 M;  2N35 A;  4I4L A;  3KFU G;  3B74 A;  5JI3 E;  1IN4 A;  4LF4 M;  1ZQ9 A;  4LF9 M;  1G71 A;  4LF7 M;  1V92 A;  1GVN A;  4D82 A;  2JZ1 A;  4G6Z A;  3VKH A;  1GJS A;  1XNR M;  5ITY A;  4CJ6 A;  3UGJ A;  1NJF A;  2CWB A;  3RGP A;  3LVV A;  4LFB M;  4L8R C;  1OIP A;  1MN3 A;  2KA6 B;  1ZMV A;  1C1K A;  2HCB A;  5F3W A;  2LVA A;  3QAU A;  2QEN A;  3CF6 E;  3MMP A;  1WGL A;  2C96 A;  2JY5 A;  4AKG A;  3B9P A;  1LTM A;  4NL4 H;  1WGN A;  3GQ5 A;  2LHG A;  3SBJ A;  1DGG A;  3QYE A;  4LZJ A;  4YHH M;  1QDR A;  4Z8X A;  1KFV A;  2UXC M;  3PXG A;  3FD9 A;  2UU9 M;  1IXS B;  2X49 A;  1PJT A;  1W5T A;  4CGY B;  4X62 M;  3SMP A;  1IFY A;  1MJG M;  2CHQ A;  3ZH9 B;  2JZ0 A;  2KW0 A;  3L2A A;  4NRW A;  4FWH A;  4NXN M;  3HJ8 A;  1MU5 A;  4IJF A;  3CTW B;  3V76 A;  1G4A E;  2XFS A;  3C3D A;  1GKI A;  1LV7 A;  2CE7 A;  3NBI A;  2KXE A;  3GLH E;  2NQ8 C;  4JYA M;  3H4M A;  4QOZ C;  4JI6 M;  1QDT A;  3VDU A;  4MGK E;  4NRV A;  3FTC A;  2UXD M;  4LJ6 A;  3HX3 A;  2F5O A;  2FH0 A;  1D2N A;  3HKP A;  5DYG A;  4IBK A;  3TQS A;  3B7Z A;  2R65 A;  1OKS A;  4MM3 B;  4QNR A;  4TUW A;  2R18 A;  1TH3 A;  4IIW A;  3ILK A;  4LY6 A;  1OQY A;  1PJJ A;  3K92 A;  1HNW M;  3R8F A;  4BLC A;  2WZJ A;  2QQ8 A;  2LVQ D;  3BOS A;  1HNX M;  2RGO A;  3AOE C;  2DZO B;  1N36 M;  3HU3 A;  3QWL A;  1D0L A;  4MH0 E;  2K6B A;  1SG9 A;  1QUT A;  1EFU B;  2Y21 A;  2Y0Q A;  4G4R A;  2YQZ A;  5BPV A;  2DVW B;  4PT5 A;  3GLG A;  3RE8 A;  4LJ5 A;  4HL4 A;  2Z8Y M;  3H4J A;  4DR5 M;  2I7P A;  3Q8G A;  2KRK A;  4JXJ A;  2G3Q A;  3KDS E;  2ZM6 M;  3GRY A;  3GLH B;  2C99 A;  2RGH A;  2XEP A;  3VDP A;  2KEB A;  3U6D A;  2QNJ A;  4QNM A;  1IBM M;  2QCU A;  3AV0 A;  1GL7 A;  3R9X B;  2JA2 A;  2K0B X;  1A5T A;  1IY2 A;  2QPA A;  1G59 A;  2UUA M;  2VQF M;  1OTR A;  1VEJ A;  1I94 M;  2CHV A;  1SXJ C;  4AKH A;  3I04 M;  2V6Z M;  5FTL A;  5EXX A;  4DV0 M;  1J09 A;  2BJW A;  4FW9 A;  4DR4 M;  2XF3 A;  2X8A A;  1ORY B;  5IT9 S;  4LJ7 A;  2DWL A;  1IXR C;  1VQ1 A;  4RF1 A;  4I8O A;  1JQJ C;  3KVW A;  4B3M M;  1DV0 A;  3PVS A;  1XC8 A;  3FUX A;  4GHL A;  1QUS A;  3B89 A;  4ANR A;  1IN7 A;  4D81 A;  3TWM A;  1ZAE A;  2W82 A;  4FD2 A;  3J7A S;  4B3R M;  5IZ7 D;  5E26 A;  4M0W A;  2O5R A;  5L8R F;  4DV4 M;  4DR7 M;  3C3E A;  1HT2 E;  2JUJ A;  4LGM A;  3FTE A;  3FUW A;  4NC6 A;  4DV2 M;  4HLQ A;  2JY8 A;  2P5T A;  3GLI E;  4DUZ M;  1NY6 A;  4KT0 F;  1IXZ A;  2XH9 A;  3E9S A;  3FRI A;  3UJN A;  2L7H A;  5ITX A;  4X66 M;  3GQ4 A;  1XHB A;  1L2D A;  1KSF X;  2OO9 A;  3T38 A;  1JB0 F;  4DV7 M;  1HNZ M;  2L09 A;  2Z7J A;  4AG5 A;  2XSZ A;  5FLX S;  3U5Z B;  2F4V M;  4KHP M;  2R44 A;  4DV3 M;  1N75 A;  1QZE A;  5FTJ A;  3VLF B;  2GNO A;  2OOB A;  1ZMU A;  2I7N A;  3FTD A;  2MRO B;  4MGI E;  5GKN A;  3W0F A;  5ITU A;  3J7B A;  2LBC A;  2OOA A;  2JY6 B;  3I51 A;  5LMN M;  4JI8 M;  2X4A A;  4ITQ A;  4JI1 M;  1IY1 A;  1OFH A;  4L15 A;  1QAQ A;  1OFI A;  5C18 A;  2BWE A;  1CUK A;  1SXJ A;  4IBI A;  4Y28 F;  4LF6 M;  4FWD A;  1YLA A;  3TWL A;  1HR0 M;  3E46 A;  4M9X A;  1XMQ M;  4PD2 A;  3THG A;  3AJI B;  2FOI C;  4I81 A;  4GEW A;  4B3T M;  3CF0 A;  3DZD A;  2JNH A;  2LHC A;  4AKI A;  3B7N A;  3E21 A;  3I4V A;  4LJA A;  2KDL A;  5FTK A;  3FYD A;  4LFA M;  3A42 A;  3GLI B;  3T1Y M;  1Z5A A;  2KNV A;  2DZL A;  3SAR A;  5IRE B;  2BJV A;  1ZV1 A;  5EXT A;  2QBY A;  3TE6 A;  3DA1 A;  1E94 E;  4WUR A;  4OX9 M;  4BB9 A;  4OVZ B;  2JXN A;  4QHT A;  2D7H A;  3L28 A;  3L29 A;  2VII A;  2R4E A;  4WW0 A;  2F5Q A;  1QYR A;  4JN6 A;  5EXP A;  3HJS A;  1OIZ A;  4D80 A;  1XNQ M;  1DGH A;  3LCU A;  2G8L A;  3T6P A;  1NHG C;  3FUT A;  2DHY A;  3KP0 E;  1P3Q Q;  1X37 A;  2M60 A;  4LGY A;  1R2Z A;  3NBX X;  2Y20 A;  3MJ5 A;  3KP1 E;  3VKG A;  1NNU C;  1VEK A;  3K9P A;  2VF7 A;  4HEO A;  3KSX A;  4LRS A;  2ZTC A;  1TH2 A;  2EKF A;  2KNA A;  2D7E A;  3RFW A;  4AG6 A;  1N33 M;  1JR3 A;  1WJ7 A;  4NSR A;  1D0K A;  1NJG A;  1V33 A;  1T6O A;  3E4R A;  3GO8 A;  4JI2 M;  2L6O A;  3KXE C;  1XXH A;  3EIH A;  3LW5 F;  3FTF A;  3EIE A;  2LXE A;  1C7Y A;  1YE9 A;  3KOZ E;  3GPY A;  2UUB M;  2YNM D;  2MJ5 B;  3ZCB B;  1Z6T A;  1PJI A;  3GQ3 A;  2LVP C;  2FE8 A;  3HJQ A;  3KOW E;  5ITR A;  1QAN A;  1W5S A;  1Y8G A;  1QZM A;  3QYB A;  3CGW A;  1Z5B A;  1N78 A;  4DR1 M;  3LQR A;  4F2L A;  3SHG B;  2DAI A;  1E32 A;  1ZMW A;  5E6J A;  4IBD A;  3GPX A;  2ZTD A;  4GC9 A;  4KO8 A;  2DNA A;  4GRI A;  4RKU F;  4S12 A;  2C98 A;  2DAM A;  2MGW A;  4IBJ A;  3AFH A;  4OU7 A;  3GLG E;  4F1I A;  2EUC A;  1IBK M;  3KS4 A;  2R45 A;  2O01 F;  5EQT A;  4JV5 M;  4L78 A;  4LJ8 A;  1NV9 A;  2DHR A;  2XSZ D;  3FE3 A;  2Y0T A;  5IWA M;  2H1R A;  1TTE A;  3U6S A;  5DNY A;  2Z3X A;  2L2D A;  2YFQ A;  4PDI A;  4Z6Y A;  2F5P A;  1TGU A;  2V1U A;  5EP1 A;  1L8Q A;  1WHC A;  1N32 M;  4CIZ A;  1K3W A;  1L2B A;  2HHH M;  2KZS A;  3HU2 A;  4DBG B;  1DGB A;  1H6U A;  2FS1 A;  4DR2 M;  3C58 A;  3HHZ A;  2XFT A;  2DWN A;  1HQY E;  3U60 A;  3GRV A;  3GRR A;  5BR8 M;  4W5W A;  1HJP A;  4DR6 M;  1PJS A;  3U61 A;  1TF0 B;  1D0M A;  1FJG M;  2L4F A;  5EP2 A;  3FYC A;  4AZF A;  1R6B X;  2Z4R A;  3NWL A;  1VDD A;  1Q02 A;  5FSW A;  3GLG B;  1NO1 A;  4DR3 M;  5LMU M;  2XZU A;  2CUZ A;  3D8B A;  3M6A A;  1UM8 A;  3HU1 A;  4ZPX A;  3I01 M;  4LCB A;  4DUY M;  3AOE A;  3SYL A;  5ITT A;  4LRT A;  5DFL A;  3U5Z A;  1GAB A;  3TWK A;  3GLF A;  4YY3 M;  1GL6 A;  3HHW A;  5ITX E;  2EA0 A;  5FTN A;  4B7H A;  5A2Q S;  2DEN A;  3DFZ A;  2CV1 A;  2R62 A;  2JP7 A;  4M9S A;  2LNH C;  5ITQ A;  4FCW A;  1IBL M;  2HL7 A;  4P16 A;  4JI0 M;  2DI0 A;  3FUV A;  4M9Z A;  3L26 A;  3BBZ A;  2UUC M;  4RF0 A;  2C5R A;  2KNZ A;  4NOO B;  4GMQ A;  4XBO A;  3T1H M;  4UN2 B;  2H5X A;  1YUB A;  3LMM A;  4CIS A;  4KLN A;  4GH9 A;  1IQP A;  1GO5 A;  2LVO C;  4GIP A;  4QOS A;  1SXJ E;  3GPU A;  2LWX A;  1R4G A; 
#chains in the Genus database with same CATH homology
 4RNA A;  3SAV A;  1JR3 D;  1N77 A;  1QVR A;  5JI2 E;  3SMS A;  4G4N A;  1E9S A;  4K0K M;  4IBF A;  2DZN B;  2XZF A;  4L4U A;  3VFD A;  3A45 A;  3IG5 A;  5KPZ A;  1TH4 A;  2CEA A;  5KPR A;  3SAT A;  4X65 M;  5KPT A;  2OPF A;  3LQQ A;  2OQ4 A;  3MK6 A;  3SC3 A;  2A5Y B;  2EO2 A;  3VK7 A;  1OJL A;  3JR4 A;  2UXB M;  5KO3 A;  3HGI A;  2C9C A;  2CV0 A;  4X64 M;  3PFI A;  4JI3 M;  3FUU A;  4DV6 M;  2DXI A;  5C1B A;  4GKK M;  1FNN A;  1HQC A;  2HKJ A;  4GHA A;  2V1C A;  2LH0 A;  2CV2 A;  3U6M A;  3L27 A;  3AOG A;  1NY5 A;  3U6C A;  2C9O A;  3HHX A;  4AKG A;  1QQW A;  1SXJ B;  1YSY A;  4R3D A;  1IY0 A;  4B3S M;  4FCT A;  4B7G A;  4FWG A;  3A98 B;  1EE8 A;  3AL0 C;  4FCV A;  2R46 A;  3I4Y A;  4R7G A;  1Q3C A;  3J80 S;  2FNA A;  1K82 A;  4LF8 M;  1DO2 A;  2CFO A;  3IG8 A;  5EP4 A;  4GKJ M;  4EIW A;  1Z59 A;  1L1T A;  3SAS A;  2DWZ B;  7CAT A;  2F5N A;  3U6E A;  2QBY B;  1NSF A;  2E5L M;  4OW0 A;  3JAM S;  1TDH A;  1G41 A;  4GIT A;  4A3V B;  4NXM M;  3KS8 A;  5KQ8 A;  5EXS A;  4AI6 A;  1T3T A;  4G4Q A;  3JR5 A;  2G5G X;  3GPP A;  5EJC A;  4KOD A;  1DGH B;  4MB7 A;  3D8L A;  1Q39 A;  1G8P A;  2CHG A;  1E9R A;  2ZAO A;  4IBG A;  5FTM A;  4LG2 A;  2ERC A;  4PDG A;  3GLH A;  4LZZ A;  4AW4 A;  2D7G A;  4B7F A;  3SHF A;  1L1Z A;  3KOX E;  4PCZ A;  2F5S A;  4IJE A;  2KZU A;  3CF2 A;  4IBC A;  8CAT A;  2AHM A;  1IN8 A;  5KQD A;  3LVW A;  1GLN A;  1NNJ A;  1XXH B;  4JI4 M;  4JI5 M;  1QAM A;  1NHW C;  3WHK A;  3W0L B;  3U6P A;  4AQY M;  1IN6 A;  4REZ A;  3SAW A;  4FVM A;  3MHV C;  4DV5 M;  2YR0 A;  1SXJ D;  3KSJ A;  4CHT B;  3J81 S;  4NSO B;  2QZ4 A;  1J5E M;  2Q2E B;  4DV1 M;  2QP9 X;  1HT1 E;  2J7N A;  1TDZ A;  3J2P B;  3L25 A;  1J7K A;  3M0E A;  3J27 B;  4GC5 A;  2KRU A;  4JI7 M;  2J7O A;  3U6L A;  4XGI A;  3OTO M;  4LF5 M;  4M0D A;  1IM2 A;  1Q3B A;  4IBB A;  3A46 A;  1NVM A;  3GRU A;  3T15 A;  5DYI A;  2XLJ A;  3UZU A;  2VQE M;  4II7 A;  2BNK A;  1K3X A;  5EP3 A;  1MX0 A;  4MGY E;  4MGH A;  1QAO A;  4LFC M;  3K8Z A;  3UMM A;  1I4W A;  3AKZ A;  3KOY E;  1R2Y A;  4I5S A;  3UK6 A;  3GP1 A;  4G4O A;  1R7R A;  3K1J A;  4MGZ E;  3U60 B;  1S3S A;  1KYI A;  2Z4S A;  3TPZ A;  1XMO M;  5H37 D;  1PM5 A;  2RKO A;  3TL4 X;  3U61 B;  2DWM A;  3SAU A;  2FFJ A;  3KW6 A;  2R4J A;  1DGF A;  1L2C A;  1IN5 A;  3U6O A;  2XGN A;  4LJ9 A;  2L7I A;  3VK8 A;  1Z5C A;  3ZC7 B;  3HHY A;  2M5Z A;  4IBE A;  3GLI A;  1XWI A;  3WHL A;  1DO0 A;  3FKE A;  4L16 A;  1WXQ A;  3RGS A;  2ZAN A;  3Q8X A;  3PNV A;  4BBA A;  1G3I A;  4LJ4 A;  3SYK A;  2ZBK B;  4OVZ A;  3U6Q A;  2K47 A;  3GLF B;  4B08 A;  3HWS A;  3K2L A;  3SFZ A;  3PNY A;  4QHS A;  3DOA A;  3M7G A;  2ZAM A;  1N34 M;  4I4L A;  3KFU G;  5JI3 E;  1IN4 A;  4LF4 M;  1ZQ9 A;  4LF9 M;  4LF7 M;  1GVN A;  4D82 A;  4G6Z A;  3VKH A;  1XNR M;  5ITY A;  3UGJ A;  1NJF A;  3RGP A;  3LVV A;  4LFB M;  4L8R C;  2KA6 B;  5F3W A;  1C1K A;  2HCB A;  3QAU A;  2QEN A;  3CF6 E;  2C96 A;  3B9P A;  4NL4 H;  3GQ5 A;  3SBJ A;  1DGG A;  4LZJ A;  4YHH M;  4Z8X A;  1KFV A;  2UXC M;  3PXG A;  3FD9 A;  2UU9 M;  1IXS B;  2X49 A;  1W5T A;  4CGY B;  4X62 M;  3SMP A;  2CHQ A;  3ZH9 B;  2KW0 A;  3L2A A;  4NRW A;  4FWH A;  4NXN M;  3HJ8 A;  1MU5 A;  4IJF A;  3CTW B;  1G4A E;  2XFS A;  3NBI A;  1GKI A;  1LV7 A;  2CE7 A;  2KXE A;  2NQ8 C;  4JYA M;  3H4M A;  4QOZ C;  4JI6 M;  3VDU A;  4MGK E;  4NRV A;  3FTC A;  2UXD M;  4LJ6 A;  2F5O A;  1D2N A;  3HKP A;  5DYG A;  4IBK A;  3TQS A;  2R65 A;  4MM3 B;  4QNR A;  4TUW A;  2R18 A;  1TH3 A;  4IIW A;  3ILK A;  4LY6 A;  1PJJ A;  3K92 A;  1HNW M;  3R8F A;  4BLC A;  1HNX M;  3BOS A;  2RGO A;  3AOE C;  2DZO B;  1N36 M;  3HU3 A;  3QWL A;  4MH0 E;  2Y21 A;  4G4R A;  2Y0Q A;  2YQZ A;  5BPV A;  2DVW B;  4PT5 A;  3GLG A;  3RE8 A;  4LJ5 A;  4HL4 A;  4DR5 M;  2I7P A;  2KRK A;  4JXJ A;  3KDS E;  2ZM6 M;  3GRY A;  3GLH B;  2C99 A;  2RGH A;  2XEP A;  3VDP A;  2KEB A;  3U6D A;  1IBM M;  4QNM A;  3AV0 A;  2QCU A;  1GL7 A;  3R9X B;  2JA2 A;  1IY2 A;  2QPA A;  1G59 A;  2UUA M;  2VQF M;  1I94 M;  2CHV A;  1SXJ C;  4AKH A;  2V6Z M;  5FTL A;  5EXX A;  4DV0 M;  1J09 A;  2BJW A;  4FW9 A;  4DR4 M;  2XF3 A;  2X8A A;  1ORY B;  5IT9 S;  4LJ7 A;  2DWL A;  1IXR C;  4RF1 A;  4I8O A;  1JQJ C;  3KVW A;  4B3M M;  3PVS A;  1XC8 A;  3FUX A;  4GHL A;  4D81 A;  4B3R M;  1IN7 A;  3TWM A;  1ZAE A;  2W82 A;  4FD2 A;  3J7A S;  5IZ7 D;  5E26 A;  4M0W A;  2O5R A;  4DV4 M;  4DR7 M;  3FTE A;  1HT2 E;  4LGM A;  3FUW A;  4DV2 M;  4HLQ A;  2P5T A;  4DUZ M;  1NY6 A;  1IXZ A;  2XH9 A;  3E9S A;  3UJN A;  2L7H A;  5ITX A;  4X66 M;  3GQ4 A;  1XHB A;  1L2D A;  1KSF X;  3T38 A;  4DV7 M;  1HNZ M;  2L09 A;  2Z7J A;  4AG5 A;  2XSZ A;  5FLX S;  3U5Z B;  2F4V M;  4KHP M;  4DV3 M;  1N75 A;  5FTJ A;  3VLF B;  2I7N A;  3FTD A;  4MGI E;  3W0F A;  5GKN A;  5ITU A;  3J7B A;  3I51 A;  5LMN M;  4JI8 M;  4JI1 M;  2X4A A;  4ITQ A;  1IY1 A;  1OFH A;  4L15 A;  1QAQ A;  1OFI A;  5C18 A;  1SXJ A;  4IBI A;  4LF6 M;  4FWD A;  1HR0 M;  3TWL A;  4M9X A;  1XMQ M;  4PD2 A;  3THG A;  3AJI B;  2FOI C;  4I81 A;  4B3T M;  3CF0 A;  3DZD A;  4AKI A;  3I4V A;  4LJA A;  5FTK A;  3FYD A;  4LFA M;  3A42 A;  3GLI B;  3T1Y M;  1Z5A A;  3SAR A;  5IRE B;  2BJV A;  5EXT A;  2QBY A;  3TE6 A;  3DA1 A;  1E94 E;  4WUR A;  4OX9 M;  4BB9 A;  4OVZ B;  4QHT A;  2D7H A;  3L28 A;  3L29 A;  2VII A;  2R4E A;  4WW0 A;  2F5Q A;  1QYR A;  4JN6 A;  5EXP A;  3HJS A;  4D80 A;  1XNQ M;  1DGH A;  2G8L A;  1NHG C;  3FUT A;  3KP0 E;  1X37 A;  2M60 A;  4LGY A;  1R2Z A;  2Y20 A;  3MJ5 A;  3KP1 E;  3VKG A;  1NNU C;  3KSX A;  4LRS A;  1TH2 A;  2D7E A;  3RFW A;  4AG6 A;  1N33 M;  1JR3 A;  4NSR A;  1NJG A;  3E4R A;  3GO8 A;  4JI2 M;  2L6O A;  3KXE C;  1XXH A;  3EIH A;  3FTF A;  3EIE A;  2LXE A;  1YE9 A;  3KOZ E;  3GPY A;  2UUB M;  2YNM D;  3ZCB B;  1PJI A;  1Z6T A;  3GQ3 A;  2FE8 A;  3HJQ A;  3KOW E;  5ITR A;  1QAN A;  1W5S A;  1QZM A;  1Z5B A;  1N78 A;  4DR1 M;  3LQR A;  3SHG B;  1E32 A;  5E6J A;  4IBD A;  3GPX A;  4GC9 A;  4KO8 A;  4GRI A;  4S12 A;  4OU7 A;  2C98 A;  4IBJ A;  3AFH A;  2EUC A;  1IBK M;  3KS4 A;  2R45 A;  5EQT A;  4JV5 M;  4L78 A;  4LJ8 A;  2DHR A;  2XSZ D;  2Y0T A;  5IWA M;  2H1R A;  3U6S A;  5DNY A;  2Z3X A;  4PDI A;  2YFQ A;  4Z6Y A;  2F5P A;  1TGU A;  2V1U A;  5EP1 A;  1L8Q A;  1N32 M;  1K3W A;  1L2B A;  2HHH M;  2KZS A;  3HU2 A;  1DGB A;  1H6U A;  4DR2 M;  3C58 A;  3HHZ A;  2XFT A;  2DWN A;  1HQY E;  3U60 A;  3GRV A;  3GRR A;  5BR8 M;  4W5W A;  4DR6 M;  3U61 A;  1FJG M;  4AZF A;  5EP2 A;  3FYC A;  1R6B X;  2Z4R A;  3NWL A;  1VDD A;  5FSW A;  3GLG B;  4DR3 M;  5LMU M;  2XZU A;  2CUZ A;  3D8B A;  3M6A A;  1UM8 A;  3HU1 A;  4ZPX A;  4DUY M;  4LCB A;  3AOE A;  3SYL A;  5ITT A;  4LRT A;  3U5Z A;  3TWK A;  3GLF A;  4YY3 M;  1GL6 A;  3HHW A;  5ITX E;  2EA0 A;  5FTN A;  4B7H A;  5A2Q S;  2CV1 A;  3DFZ A;  2R62 A;  4M9S A;  2LNH C;  5ITQ A;  4FCW A;  1IBL M;  2HL7 A;  4P16 A;  4JI0 M;  4M9Z A;  3FUV A;  3L26 A;  2UUC M;  4RF0 A;  2C5R A;  4NOO B;  4GMQ A;  4XBO A;  3T1H M;  1YUB A;  3LMM A;  4CIS A;  4KLN A;  4GH9 A;  1IQP A;  4GIP A;  4QOS A;  1SXJ E;  3GPU A;  2LWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...