2LXEA

S4wyild
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVEDENKQSEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUVR4
publication title S4WYILD structure
rcsb
source organism Arabidopsis thaliana
total genus 18
structure length 109
sequence length 109
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10440 WIYLD Ubiquitin-binding WIYLD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.850 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lxeA01
2LXEA
chains in the Genus database with same CATH superfamily
3TWMA 3U61A 2MH8A 2CV2A 4CHTB 2QHOB 2J5YA 4I5SA 1XNQM 4LGYA 2RGOA 4JI1M 4DR6M 1Z59A 3GLIE 2CRUA 1DGHB 1WJ7A 1IXZA 3J80S 4AI6A 1IN6A 3HHWA 4DV1M 4WP2A 1A5TA 2I7NA 2JZ0A 5A2QS 1JR3E 3M0EA 1YLAA 4IBKA 3UGJA 2XZUA 1SXJD 3SAWA 4FWDA 4KT0F 1L1TA 2CEAA 1HJPA 1W5TA 2CP8A 3GPXA 1IXRC 3U6OA 2ZANA 3GLHE 1G41A 2ZTDA 4QOSA 4DV0M 3HU1A 1QZMA 2HWJA 2R18A 3IG8A 4DV6M 2XZFA 1PJJA 1DO0A 4LFAM 3SAUA 1D2NA 5IZ7D 4NC6A 3ZC7B 2MR9A 4AW4A 2JY7A 5E26A 1NVMA 4MH0E 3LVWA 3K8ZA 4LRTA 3GLGB 2R45A 1HQCA 3LW5F 2XGNA 1GJTA 1GKIA 1Q39A 2JA2A 1Z6TA 3GRUA 1DO2A 4ZPXA 3GLFA 3W0LB 4Z6YA 1L2DA 3FUXA 5GKNA 4R71A 4X64M 2DHRA 2HCBA 3I01M 1FJGM 4RF1A 4MGYE 3B7NA 1QVRA 3FRHA 4CIZA 3A42A 5IWAM 3VK7A 2XFSA 2Z4RA 3RGPA 4X65M 3U5ZB 3K2LA 2DKLA 1Q02A 1TF0B 4OW0A 2M60A 3I04M 4I4LA 3RFWA 1OAOC 1WGLA 3GLIA 1JQJC 1DGFA 1QZEA 5C1BA 1V34A 3JAMS 4LFBM 3GO8A 2YNMD 3Q8GA 5JI3E 3HGIA 1VEKA 2HHHM 4BB9A 2DAMA 5FTKA 4RF0A 2DAEA 2DHYA 1N32M 3CF0A 3FUUA 3KDSE 4FW9A 4OX9M 4FWGA 2JNHA 2FS1A 3FUTA 1NV8A 3U6CA 1GL6A 3TQSA 3SAVA 2ZAOA 3H4MA 1P3QQ 2Y20A 1FNNA 4NSOB 1IFYA 2EKFA 2R65A 4M9SA 1R7RA 1VEJA 1K3XA 4YHHM 2XFTA 3JR4A 2QZ4A 2Z4SA 1VQ1A 3DOAA 3E21A 1WHCA 4NL4H 3KVWA 1TH4A 2KDLA 2YFQA 2X4AA 3CTWB 4LF6M 1RU3A 4BBAA 4G3OA 4Y28F 1T3TA 3FTFA 5ITQA 2Z8YM 3KOYE 2V1UA 3AKZA 1DGHA 4AKHA 3B74A 2H5XA 3C58A 4R7GA 3QAUA 1SXJC 3VLFB 4JI5M 4YY3M 1G8PA 1PM5A 4L8RC 3AOEC 3SYKA 4D82A 1ZMVA 5ITUA 5EXPA 5E6JA 4HEOA 4I8OA 3KOZE 4LJ6A 2D7GA 3QWLA 1AUAA 2ZAMA 2DWNA 4P17A 5ITXE 1J09A 1D0LA 3TWLA 3A46A 1C1KA 3ZCBB 3WHKA 4AZFA 2BWEA 2R62A 4G4QA 4FWHA 3I4VA 3SASA 2Q2EB 3HU2A 4DR1M 2VF8A 3GLGA 1EIJA 3D8LA 4JI3M 1Z5CA 1J7KA 1ZV1A 3E46A 2CHVA 1G4AE 4M0WA 4FCVA 2OOAA 3FUVA 4CISA 3WHLA 4AG5A 3HWSA 4FCTA 4P16A 1XXHB 3SMSA 3U5ZA 4DV4M 1G59A 2Y21A 1E9SA 4M9XA 4PDIA 1NNJA 2D7EA 4MM3B 4S12A 5FTJA 2ERCA 2V1CA 3UK6A 2W82A 5ITTA 3K9PA 3L29A 3PFIA 2BNKA 4LJAA 1R2YA 2KNAA 3T15A 1VDLA 2DZOB 2K0BX 4GITA 2XLJA 2I7PA 2N35A 3K1JA 4IJEA 4GKKM 4I81A 1QAQA 2HL7A 2R4EA 3EIEA 4LF9M 3SMPA 1L2CA 4IBCA 2QENA 5ITRA 3GLHB 4IBDA 2JXNA 2Z3XA 3GRVA 5ITXA 1NY6A 1TTEA 4R3DA 3DZDA 2RGHA 2C96A 4BLCA 2QBYB 4JXJA 4MGIE 1XXHE 2A5YB 2QQ8A 3LCVB 3SARA 2G5GX 4DR2M 4OVZB 1Q3CA 2Y0TA 3KFUG 1OQYA 1OTRA 2LHCA 5C18A 3LMMA 3HX3A 3KSXA 3QYEA 3W0FA 2DWLA 1IQPA 2F4VM 2OO9A 2WSFF 3GP1A 1L1ZA 5EP1A 1D0KA 2BWBA 1MJGM 1HT2E 2LTUA 2F5SA 3KXEC 2F5QA 2UUAM 3C3EA 2OOBA 3KP0E 4LJ8A 4FCWA 1NV9A 3GQ3A 3EIHA 3FUWA 3J27B 1Z5BA 3U6EA 1SXJB 4L78A 4LJ5A 1ZAEA 4LZJA 1ORYB 4GRIA 4GH9A 4L6V6 2E5LM 2LVPC 1OKSA 1N33M 4PT5A 1T6OA 1DGGA 3U6QA 3KW6A 1PGYA 1MU5A 3KOXE 3W68A 1SG9A 2KA6B 1PJTA 3BOSA 3GQ5A 2D7HA 4LG2A 3HHXA 7CATA 2R0IA 3C9PA 1XXHA 2DENA 2GQFA 1PRBA 4FVMA 4MGHA 2KHHA 3GPPA 3J7AS 2JY8A 3AJIB 4D81A 4DR4M 2L09A 2XSZD 3J2PB 2QNJA 2WSEF 2L4EA 2LVOC 5KQDA 3PVSA 3GQ4A 1JR3A 1SXJE 1L8QA 2O25A 3UJNA 1OIZA 5LMNM 1GL7A 1V92A 3MHVC 3SHFA 3T38A 1KFVA 3GLHA 1YE9A 3LQQA 2ZM6M 2KXEA 2C5RA 2OQ4A 3VDUA 8CATA 4PCZA 2QP9X 4JI2M 5FTMA 2LVAA 2JZ1A 3HU3A 1NO1A 2KRUA 2FOIC 2X49A 1IXSB 5KPRA 2CWBA 3K9OA 3M7GA 2QBYA 2WZJA 1QUSA 3B9PA 3VKGA 4JN6A 4G4NA 4IBEA 1ZQ9A 2FH0A 1QDTA 3QYBA 1G3IA 3VK8A 4RKUF 1LV7A 4OVZA 1HNXM 2F5PA 4JI4M 4DV7M 3SBJA 2HAKA 3B7QA 4QHTA 3PNVA 4ANRA 4KODA 4DR7M 3SHGB 4W5WA 4K0KM 2V6ZM 2YQZA 3H4JA 3VFDA 3U6LA 4JI6M 2VDBB 2FFJA 1PJQA 1ZMUA 1XWIA 5DYGA 3PXGA 3RE8A 1NJGA 5EP4A 5EXTA 2J7NA 2QPAA 2LHGA 2L6OA 2RKOA 3LVVA 5EXXA 1SXJA 4D80A 2EA0A 5EQTA 3R8FA 2DZNB 2FE8A 5DNYA 4LJ7A 2C99A 3FTEA 3AOEA 1DGBA 4IBBA 4QHSA 3Q8XA 4UN2B 3PNYA 3T1HM 2F5NA 1XNRM 4B3RM 2DAGA 1L2BA 1W5SA 2LWXA 1EFUB 3GRRA 2R6FA 4IBGA 4LF5M 4JYAM 2NQ8C 2CFOA 4OU7A 2JUJA 5DFLA 4B7FA 1ZMWA 3CF2A 5EXSA 1IBLM 2DWZB 3R9XB 2DXIA 1GLNA 2DVWB 2UXDM 3F92A 1KYIA 3L28A 1IN8A 3MJ5A 1IY0A 4Q7JA 4PDGA 3HJSA 2KEBA 3GPUA 5BR8M 4LF7M 5KO3A 4JV5M 2MJ5B 3IHPA 2DI0A 4LZZA 3FTDA 2R4JA 3A98B 4HL4A 3SC3A 3T1YM 2O01F 2F5OA 1TR8A 1NNUC 3FYDA 1GO5A 2K6BA 3K92A 3TWKA 1N36M 2B3TA 2CHGA 3CF6E 2C98A 2ZBKB 1JR3D 1NHGC 4GMQA 3AV0A 3I51A 3U60B 4LF8M 3C3DA 4GIPA 1GVNA 1IXSA 2LBCA 1YSYA 3GRYA 5KPZA 3AOGA 3W67A 5FSWA 5L8RF 3OTOM 3ZQJA 4DUZM 3FKEA 3M6AA 1KSFX 2UUBM 3HHYA 2L2DA 2XF3A 2Z7JA 2LVQD 4QOZC 4LGMA 4II7A 4DV3M 4GHAA 3J7BA 4M0DA 3I4YA 1G71A 1R2ZA 2LNHC 2L4FA 3E9SA 4GEWA 4EIWA 4F1IA 1IN7A 3BXWA 2KNZA 3MK6A 3THGA 4RNAA 1CUKA 1DV0A 2KW0A 2VF7A 4B08A 1IBMM 1QAMA 1R6BX 2DNAA 1H6UA 2R44A 4L15A 2YR0A 2JY5A 1R5LA 1T43A 2BJWA 5EP3A 3U6SA 4AQYM 2C9OA 5FTLA 1NJFA 4DR3M 1OIPA 4NOOB 3NBIA 1PJIA 3HJ8A 5JI2E 1IBKM 1V33A 1OAIA 1VEGA 2QSFX 2CUZA 5BPVA 3L25A 1NY5A 1HQYE 4ITQA 1R4GA 1X37A 2L7IA 2UU9M 2GNOA 3HJQA 1E9RA 2XEPA 3HHZA 4JI0M 2VQEM 4GC5A 1QQWA 2EO2A 5KQ8A 4NRWA 1XC8A 2KRKA 2EJSA 4B7HA 3D8BA 3U6DA 2QCUA 1E32A 2J7OA 3SATA 4QNRA 1Q3BA 4LCBA 4LY6A 4MB7A 4AKGA 1VG5A 2K47A 3KSJA 4MGZE 3DFZA 1D0MA 4DBGB 2UXBM 3DA1A 4JI8M 4B3MM 3RGSA 3VKHA 2MGWA 2EUCA 1TH3A 5F3WA 3ZH9B 1N78A 4LRSA 4CGYB 3IECA 2G3QA 1HT1E 1OFHA 3LQRA 5IT9S 3HKPA 1QANA 2BJVA 3U60A 3J81S 2K9DA 3SFZA 3UZUA 4JI7M 2AHMA 4DV5M 4KHPM 3U6MA 5EP2A 2DAKA 1IN4A 3FYCA 1K82A 1WIVA 1OFIA 5ITYA 4DR5M 2ZTCA 2VQFM 4IIWA 1EE8A 5LMUM 3T6PA 3B7ZA 3IG5A 4WURA 4G4OA 3KS8A 2CE7A 2FNAA 4M9ZA 4IJFA 1C7YA 2H1RA 3E4RA 1PJSA 1JB0F 1TGUA 4IBJA 4F2LA 5KPTA 4FD2A 4NXNM 1WR1B 2CHQA 4X62M 3GLGE 4DV2M 3TPZA 1I94M 2C9CA 3L26A 1MX0A 1N77A 4MGKE 4LFCM 3HZJA 2CV1A 5H37D 4CJ6A 4IBIA 5IREB 3KP1E 1K3WA 3NBXX 3B89A 5EJCA 3U61B 4NRVA 3TL4X 2R46A 2G8LA 2UXCM 5FLXS 2L7HA 1YUBA 4LF4M 4GC9A 2M5ZA 1Z5AA 5DYIA 2LVNC 2O5RA 1HNWM 2XH9A 1QUTA 2HKJA 3BBZA 3AFHA 1LTMA 1N75A 4X66M 1TDHA 2KNVA 1XB2B 1MN3A 3L2AA 4REZA 1J5EM 3GPYA 3LCUA 2MROB 1IN5A 1IY1A 2WSCF 4KLNA 3JR5A 2JY6B 4B3TM 2DZLA 1XHBA 4NXMM 4G4RA 1IM2A 3HY5A 1UM8A 1WGNA 4HLQA 4Z8XA 3FD9A 1XMQM 3V76A 2KZSA 1I4WA 1NSFA 3VDPA 4TUWA 3KS4A 4GHLA 3CGWA 3L27A 1QYRA 1UFZA 3U6PA 4A3VB 1TH2A 2APLA 2DAIA 3GLFB 2XSZA 1GJSA 2VIIA 1XMOM 2Y0QA 1GABA 2JP7A 3UMMA 1IY2A 1NHWC 1QDRA 3A45A 4NSRA 1N34M 2LH0A 2EKKA 4L4UA 1TDZA 1HR0M 3GLIB 4DUYM 2OPFA 4WW0A 4B3SM 1Y8GA 1F4IA 3MMPA 4LJ4A 3AL0C 3NWLA 2KZUA 1OJLA 4QNMA 4AG6A 4B7GA 4XK8F 1E94E 3ILKA 4L16A 4KO8A 2DWMA 3KOWE 1QAOA 1HNZM 2UUCM 1VDDA 1BVSA 2LXEA 3FTCA 2P5TA 3TE6A 4AKIA 4LJ9A 2JWSA 2RRUA 4GKJM 3FRIA 4XBOA 1S3SA 5FTNA 3SYLA 1WXQA 3FE3A 4XGIA 3GLFE 2CV0A 2X8AA 4PD2A 1AIPC 4G6ZA 4IBFA
chains in the Genus database with same CATH topology
3TWMA 3U61A 4CHTB 4I5SA 1XNQM 4LGYA 2RGOA 4JI1M 4DR6M 1Z59A 1DGHB 1IXZA 3J80S 4AI6A 1IN6A 3HHWA 4DV1M 2I7NA 5A2QS 3M0EA 2XZUA 4IBKA 3UGJA 1SXJD 3SAWA 4FWDA 1L1TA 2CEAA 1W5TA 3GPXA 3U6OA 1IXRC 2ZANA 1G41A 4DV0M 3HU1A 1QZMA 2R18A 3IG8A 4DV6M 2XZFA 1PJJA 1DO0A 4LFAM 3SAUA 1D2NA 5IZ7D 3ZC7B 4AW4A 5E26A 1NVMA 4MH0E 3LVWA 3K8ZA 4LRTA 3GLGB 2R45A 1HQCA 2XGNA 1GKIA 1Q39A 2JA2A 1Z6TA 3GRUA 1DO2A 4ZPXA 3GLFA 3W0LB 4Z6YA 1L2DA 3FUXA 5GKNA 4X64M 2DHRA 2HCBA 1FJGM 4RF1A 4MGYE 1R2ZA 1QVRA 2CV2A 5IWAM 3A42A 3VK7A 2XFSA 2Z4RA 3RGPA 4X65M 3U5ZB 3K2LA 4OW0A 2M60A 4I4LA 3RFWA 3GLIA 1JQJC 1DGFA 5C1BA 3JAMS 4LFBM 3GO8A 2YNMD 5JI3E 3HGIA 2HHHM 4BB9A 5FTKA 4RF0A 1N32M 3CF0A 3FUUA 3KDSE 4FW9A 4OX9M 4FWGA 3FUTA 3U6CA 1GL6A 3TQSA 3SAVA 2ZAOA 3H4MA 2Y20A 1FNNA 4NSOB 2R65A 4M9SA 1R7RA 1K3XA 4YHHM 2XFTA 3JR4A 2QZ4A 2Z4SA 3DOAA 4NL4H 3KVWA 1TH4A 2YFQA 3CTWB 2X4AA 4LF6M 4BBAA 3FTFA 1T3TA 5ITQA 3KOYE 2V1UA 4AKHA 3AKZA 1DGHA 3C58A 4R7GA 3QAUA 1SXJC 3VLFB 4JI5M 4YY3M 1G8PA 1PM5A 4L8RC 3AOEC 3SYKA 4D82A 5ITUA 5EXPA 5E6JA 4I8OA 3KOZE 4LJ6A 2D7GA 3QWLA 2ZAMA 2DWNA 5ITXE 1J09A 3TWLA 3A46A 1C1KA 3ZCBB 3WHKA 4AZFA 4G4QA 2R62A 4FWHA 3I4VA 3SASA 2Q2EB 3HU2A 4DR1M 3GLGA 3D8LA 4JI3M 1Z5CA 1J7KA 2CHVA 1G4AE 4M0WA 4FCVA 3FUVA 4CISA 3WHLA 4AG5A 3HWSA 4FCTA 4P16A 1XXHB 3SMSA 3U5ZA 4DV4M 1G59A 2Y21A 1E9SA 4M9XA 4PDIA 1NNJA 2D7EA 4MM3B 4S12A 5FTJA 2ERCA 2V1CA 3UK6A 2W82A 5ITTA 3L29A 3PFIA 2BNKA 4LJAA 1R2YA 3T15A 2DZOB 4GITA 2XLJA 2I7PA 3K1JA 4IJEA 4GKKM 4I81A 1QAQA 2HL7A 2R4EA 3EIEA 4LF9M 3SMPA 1L2CA 4IBCA 2QENA 5ITRA 3GLHB 4IBDA 2Z3XA 3GRVA 5ITXA 1NY6A 4R3DA 3DZDA 2RGHA 2C96A 4BLCA 2QBYB 4JXJA 4MGIE 2A5YB 3SARA 2G5GX 4DR2M 4OVZB 1Q3CA 2Y0TA 3KFUG 5C18A 3LMMA 3KSXA 3W0FA 2DWLA 1IQPA 2F4VM 3GP1A 1L1ZA 5EP1A 1HT2E 2F5SA 3KXEC 2F5QA 2UUAM 3KP0E 4LJ8A 4FCWA 3GQ3A 3EIHA 3FUWA 3J27B 1Z5BA 3U6EA 1SXJB 4L78A 4LJ5A 1ZAEA 4LZJA 1ORYB 4GRIA 4GH9A 2E5LM 1N33M 4PT5A 1DGGA 3U6QA 3KW6A 3KOXE 1MU5A 2KA6B 3BOSA 3GQ5A 2D7HA 4LG2A 3HHXA 7CATA 4MGHA 3GPPA 1XXHA 4FVMA 3J7AS 3AJIB 4D81A 4DR4M 2L09A 2XSZD 3J2PB 5KQDA 3PVSA 3GQ4A 1JR3A 1SXJE 1L8QA 3UJNA 5LMNM 1GL7A 3SHFA 3MHVC 3T38A 1KFVA 3GLHA 1YE9A 3LQQA 2ZM6M 2KXEA 2C5RA 2OQ4A 3VDUA 8CATA 4PCZA 2QP9X 4JI2M 5FTMA 3HU3A 2KRUA 2X49A 2FOIC 5KPRA 1IXSB 3M7GA 2QBYA 3B9PA 3VKGA 4JN6A 4G4NA 4IBEA 1ZQ9A 1G3IA 3VK8A 1LV7A 4OVZA 1HNXM 2F5PA 4JI4M 4DV7M 3SBJA 4QHTA 3PNVA 4DR7M 4KODA 3SHGB 4W5WA 4K0KM 2V6ZM 2YQZA 3VFDA 3U6LA 4JI6M 2FFJA 5DYGA 1XWIA 3PXGA 3RE8A 1NJGA 5EP4A 5EXTA 2J7NA 2QPAA 2L6OA 2RKOA 3LVVA 5EXXA 1SXJA 4D80A 2EA0A 5EQTA 3R8FA 2DZNB 2FE8A 5DNYA 4LJ7A 2C99A 3FTEA 3AOEA 1DGBA 4IBBA 4QHSA 3Q8XA 3T1HM 3PNYA 2F5NA 1XNRM 4B3RM 1L2BA 1W5SA 2LWXA 3GRRA 4IBGA 4LF5M 4JYAM 2NQ8C 2CFOA 4OU7A 4B7FA 3CF2A 5EXSA 1IBLM 2DWZB 3R9XB 2DXIA 1GLNA 2DVWB 3KS8A 1KYIA 3L28A 1IN8A 3MJ5A 1IY0A 4PDGA 3GPUA 3HJSA 2KEBA 4LF7M 5BR8M 4JV5M 5KO3A 2UXDM 4LZZA 3FTDA 2R4JA 3A98B 4HL4A 3SC3A 3T1YM 2F5OA 1NNUC 3FYDA 3K92A 3TWKA 1N36M 2CHGA 3CF6E 2C98A 2ZBKB 1JR3D 1NHGC 4GMQA 3AV0A 3I51A 3U60B 4LF8M 4GIPA 1GVNA 1YSYA 3GRYA 5KPZA 3AOGA 5FSWA 3OTOM 4DUZM 3FKEA 3M6AA 1KSFX 2UUBM 3HHYA 2XF3A 2Z7JA 4QOZC 4LGMA 4II7A 4DV3M 4GHAA 3J7BA 4M0DA 3I4YA 2LNHC 3E9SA 4EIWA 1IN7A 3MK6A 3THGA 4RNAA 2KW0A 4B08A 1IBMM 1QAMA 1R6BX 4L15A 1H6UA 2YR0A 5EP3A 2BJWA 3U6SA 4AQYM 2C9OA 5FTLA 1NJFA 4DR3M 4NOOB 3NBIA 1PJIA 3HJ8A 5JI2E 1IBKM 2CUZA 5BPVA 3L25A 1NY5A 1HQYE 4ITQA 1X37A 2L7IA 2UU9M 3HJQA 1E9RA 2XEPA 3HHZA 4JI0M 2VQEM 4GC5A 1QQWA 2EO2A 5KQ8A 4NRWA 1XC8A 2KRKA 4B7HA 3D8BA 3U6DA 2QCUA 1E32A 2J7OA 3SATA 4QNRA 1Q3BA 4LCBA 4LY6A 4MB7A 4AKGA 2K47A 3KSJA 4MGZE 3DFZA 2UXBM 3DA1A 4JI8M 4B3MM 3RGSA 3VKHA 2EUCA 1TH3A 5F3WA 3ZH9B 1N78A 4LRSA 4CGYB 1HT1E 1OFHA 3LQRA 5IT9S 3HKPA 1QANA 2BJVA 3U60A 3J81S 3SFZA 3UZUA 4JI7M 2AHMA 4DV5M 4KHPM 3U6MA 5EP2A 1IN4A 3FYCA 1K82A 5ITYA 1OFIA 4DR5M 2VQFM 4IIWA 1EE8A 5LMUM 3IG5A 4WURA 4G4OA 2CE7A 2FNAA 4M9ZA 4IJFA 2H1RA 3E4RA 1TGUA 4IBJA 5KPTA 4FD2A 4NXNM 2CHQA 4X62M 4DV2M 1I94M 3TPZA 2C9CA 3L26A 1MX0A 1N77A 4MGKE 4LFCM 2CV1A 5H37D 4IBIA 5IREB 3KP1E 1K3WA 5EJCA 3U61B 4NRVA 3TL4X 2R46A 2G8LA 2UXCM 5FLXS 2L7HA 1YUBA 4LF4M 4GC9A 1Z5AA 2M5ZA 5DYIA 1HNWM 2O5RA 2XH9A 2HKJA 3AFHA 1N75A 4X66M 1TDHA 3L2AA 4REZA 1J5EM 3GPYA 1IN5A 1IY1A 4KLNA 3JR5A 4B3TM 1XHBA 4NXMM 4G4RA 1IM2A 1UM8A 4HLQA 4Z8XA 3FD9A 1XMQM 2KZSA 1I4WA 1NSFA 3VDPA 4TUWA 3KS4A 4GHLA 3L27A 1QYRA 3U6PA 4A3VB 1TH2A 3GLFB 2XSZA 2VIIA 1XMOM 2Y0QA 3UMMA 1IY2A 1NHWC 3A45A 4NSRA 1N34M 2LH0A 4L4UA 1TDZA 1HR0M 3GLIB 4DUYM 2OPFA 4WW0A 4B3SM 4LJ4A 3AL0C 3NWLA 2KZUA 1OJLA 4QNMA 4AG6A 4B7GA 1E94E 3ILKA 4L16A 4KO8A 2DWMA 3KOWE 1QAOA 1HNZM 2UUCM 1VDDA 2LXEA 3FTCA 2P5TA 3TE6A 4AKIA 4LJ9A 4GKJM 4XBOA 1S3SA 5FTNA 3SYLA 1WXQA 4XGIA 2CV0A 2X8AA 4PD2A 4QOSA 4G6ZA 4IBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXE A; 
#chains in the Genus database with same CATH topology
 3TWM A;  3U61 A;  2MH8 A;  2CV2 A;  4CHT B;  2QHO B;  2J5Y A;  4I5S A;  1XNQ M;  4LGY A;  2RGO A;  4JI1 M;  4DR6 M;  1Z59 A;  3GLI E;  2CRU A;  1DGH B;  1WJ7 A;  1IXZ A;  3J80 S;  4AI6 A;  1IN6 A;  3HHW A;  4DV1 M;  4WP2 A;  1A5T A;  2I7N A;  2JZ0 A;  5A2Q S;  1JR3 E;  3M0E A;  1YLA A;  4IBK A;  3UGJ A;  2XZU A;  1SXJ D;  3SAW A;  4FWD A;  4KT0 F;  1L1T A;  2CEA A;  1HJP A;  1W5T A;  2CP8 A;  3GPX A;  1IXR C;  3U6O A;  2ZAN A;  3GLH E;  1G41 A;  2ZTD A;  4QOS A;  4DV0 M;  3HU1 A;  1QZM A;  2HWJ A;  2R18 A;  3IG8 A;  4DV6 M;  2XZF A;  1PJJ A;  1DO0 A;  4LFA M;  3SAU A;  1D2N A;  5IZ7 D;  4NC6 A;  3ZC7 B;  2MR9 A;  4AW4 A;  2JY7 A;  5E26 A;  1NVM A;  4MH0 E;  3LVW A;  3K8Z A;  4LRT A;  3GLG B;  2R45 A;  1HQC A;  3LW5 F;  2XGN A;  1GJT A;  1GKI A;  1Q39 A;  2JA2 A;  1Z6T A;  3GRU A;  1DO2 A;  4ZPX A;  3GLF A;  3W0L B;  4Z6Y A;  1L2D A;  3FUX A;  5GKN A;  4R71 A;  4X64 M;  2DHR A;  2HCB A;  3I01 M;  1FJG M;  4RF1 A;  4MGY E;  3B7N A;  1QVR A;  3FRH A;  4CIZ A;  3A42 A;  5IWA M;  3VK7 A;  2XFS A;  2Z4R A;  3RGP A;  4X65 M;  3U5Z B;  3K2L A;  2DKL A;  1Q02 A;  1TF0 B;  4OW0 A;  2M60 A;  3I04 M;  4I4L A;  3RFW A;  1OAO C;  1WGL A;  3GLI A;  1JQJ C;  1DGF A;  1QZE A;  5C1B A;  1V34 A;  3JAM S;  4LFB M;  3GO8 A;  2YNM D;  3Q8G A;  5JI3 E;  3HGI A;  1VEK A;  2HHH M;  4BB9 A;  2DAM A;  5FTK A;  4RF0 A;  2DAE A;  2DHY A;  1N32 M;  3CF0 A;  3FUU A;  3KDS E;  4FW9 A;  4OX9 M;  4FWG A;  2JNH A;  2FS1 A;  3FUT A;  1NV8 A;  3U6C A;  1GL6 A;  3TQS A;  3SAV A;  2ZAO A;  3H4M A;  1P3Q Q;  2Y20 A;  1FNN A;  4NSO B;  1IFY A;  2EKF A;  2R65 A;  4M9S A;  1R7R A;  1VEJ A;  1K3X A;  4YHH M;  2XFT A;  3JR4 A;  2QZ4 A;  2Z4S A;  1VQ1 A;  3DOA A;  3E21 A;  1WHC A;  4NL4 H;  3KVW A;  1TH4 A;  2KDL A;  2YFQ A;  2X4A A;  3CTW B;  4LF6 M;  1RU3 A;  4BBA A;  4G3O A;  4Y28 F;  1T3T A;  3FTF A;  5ITQ A;  2Z8Y M;  3KOY E;  2V1U A;  3AKZ A;  1DGH A;  4AKH A;  3B74 A;  2H5X A;  3C58 A;  4R7G A;  3QAU A;  1SXJ C;  3VLF B;  4JI5 M;  4YY3 M;  1G8P A;  1PM5 A;  4L8R C;  3AOE C;  3SYK A;  4D82 A;  1ZMV A;  5ITU A;  5EXP A;  5E6J A;  4HEO A;  4I8O A;  3KOZ E;  4LJ6 A;  2D7G A;  3QWL A;  1AUA A;  2ZAM A;  2DWN A;  4P17 A;  5ITX E;  1J09 A;  1D0L A;  3TWL A;  3A46 A;  1C1K A;  3ZCB B;  3WHK A;  4AZF A;  2BWE A;  2R62 A;  4G4Q A;  4FWH A;  3I4V A;  3SAS A;  2Q2E B;  3HU2 A;  4DR1 M;  2VF8 A;  3GLG A;  1EIJ A;  3D8L A;  4JI3 M;  1Z5C A;  1J7K A;  1ZV1 A;  3E46 A;  2CHV A;  1G4A E;  4M0W A;  4FCV A;  2OOA A;  3FUV A;  4CIS A;  3WHL A;  4AG5 A;  3HWS A;  4FCT A;  4P16 A;  1XXH B;  3SMS A;  3U5Z A;  4DV4 M;  1G59 A;  2Y21 A;  1E9S A;  4M9X A;  4PDI A;  1NNJ A;  2D7E A;  4MM3 B;  4S12 A;  5FTJ A;  2ERC A;  2V1C A;  3UK6 A;  2W82 A;  5ITT A;  3K9P A;  3L29 A;  3PFI A;  2BNK A;  4LJA A;  1R2Y A;  2KNA A;  3T15 A;  1VDL A;  2DZO B;  2K0B X;  4GIT A;  2XLJ A;  2I7P A;  2N35 A;  3K1J A;  4IJE A;  4GKK M;  4I81 A;  1QAQ A;  2HL7 A;  2R4E A;  3EIE A;  4LF9 M;  3SMP A;  1L2C A;  4IBC A;  2QEN A;  5ITR A;  3GLH B;  4IBD A;  2JXN A;  2Z3X A;  3GRV A;  5ITX A;  1NY6 A;  1TTE A;  4R3D A;  3DZD A;  2RGH A;  2C96 A;  4BLC A;  2QBY B;  4JXJ A;  4MGI E;  1XXH E;  2A5Y B;  2QQ8 A;  3LCV B;  3SAR A;  2G5G X;  4DR2 M;  4OVZ B;  1Q3C A;  2Y0T A;  3KFU G;  1OQY A;  1OTR A;  2LHC A;  5C18 A;  3LMM A;  3HX3 A;  3KSX A;  3QYE A;  3W0F A;  2DWL A;  1IQP A;  2F4V M;  2OO9 A;  2WSF F;  3GP1 A;  1L1Z A;  5EP1 A;  1D0K A;  2BWB A;  1MJG M;  1HT2 E;  2LTU A;  2F5S A;  3KXE C;  2F5Q A;  2UUA M;  3C3E A;  2OOB A;  3KP0 E;  4LJ8 A;  4FCW A;  1NV9 A;  3GQ3 A;  3EIH A;  3FUW A;  3J27 B;  1Z5B A;  3U6E A;  1SXJ B;  4L78 A;  4LJ5 A;  1ZAE A;  4LZJ A;  1ORY B;  4GRI A;  4GH9 A;  4L6V 6;  2E5L M;  2LVP C;  1OKS A;  1N33 M;  4PT5 A;  1T6O A;  1DGG A;  3U6Q A;  3KW6 A;  1PGY A;  1MU5 A;  3KOX E;  3W68 A;  1SG9 A;  2KA6 B;  1PJT A;  3BOS A;  3GQ5 A;  2D7H A;  4LG2 A;  3HHX A;  7CAT A;  2R0I A;  3C9P A;  1XXH A;  2DEN A;  2GQF A;  1PRB A;  4FVM A;  4MGH A;  2KHH A;  3GPP A;  3J7A S;  2JY8 A;  3AJI B;  4D81 A;  4DR4 M;  2L09 A;  2XSZ D;  3J2P B;  2QNJ A;  2WSE F;  2L4E A;  2LVO C;  5KQD A;  3PVS A;  3GQ4 A;  1JR3 A;  1SXJ E;  1L8Q A;  2O25 A;  3UJN A;  1OIZ A;  5LMN M;  1GL7 A;  1V92 A;  3MHV C;  3SHF A;  3T38 A;  1KFV A;  3GLH A;  1YE9 A;  3LQQ A;  2ZM6 M;  2KXE A;  2C5R A;  2OQ4 A;  3VDU A;  8CAT A;  4PCZ A;  2QP9 X;  4JI2 M;  5FTM A;  2LVA A;  2JZ1 A;  3HU3 A;  1NO1 A;  2KRU A;  2FOI C;  2X49 A;  1IXS B;  5KPR A;  2CWB A;  3K9O A;  3M7G A;  2QBY A;  2WZJ A;  1QUS A;  3B9P A;  3VKG A;  4JN6 A;  4G4N A;  4IBE A;  1ZQ9 A;  2FH0 A;  1QDT A;  3QYB A;  1G3I A;  3VK8 A;  4RKU F;  1LV7 A;  4OVZ A;  1HNX M;  2F5P A;  4JI4 M;  4DV7 M;  3SBJ A;  2HAK A;  3B7Q A;  4QHT A;  3PNV A;  4ANR A;  4KOD A;  4DR7 M;  3SHG B;  4W5W A;  4K0K M;  2V6Z M;  2YQZ A;  3H4J A;  3VFD A;  3U6L A;  4JI6 M;  2VDB B;  2FFJ A;  1PJQ A;  1ZMU A;  1XWI A;  5DYG A;  3PXG A;  3RE8 A;  1NJG A;  5EP4 A;  5EXT A;  2J7N A;  2QPA A;  2LHG A;  2L6O A;  2RKO A;  3LVV A;  5EXX A;  1SXJ A;  4D80 A;  2EA0 A;  5EQT A;  3R8F A;  2DZN B;  2FE8 A;  5DNY A;  4LJ7 A;  2C99 A;  3FTE A;  3AOE A;  1DGB A;  4IBB A;  4QHS A;  3Q8X A;  4UN2 B;  3PNY A;  3T1H M;  2F5N A;  1XNR M;  4B3R M;  2DAG A;  1L2B A;  1W5S A;  2LWX A;  1EFU B;  3GRR A;  2R6F A;  4IBG A;  4LF5 M;  4JYA M;  2NQ8 C;  2CFO A;  4OU7 A;  2JUJ A;  5DFL A;  4B7F A;  1ZMW A;  3CF2 A;  5EXS A;  1IBL M;  2DWZ B;  3R9X B;  2DXI A;  1GLN A;  2DVW B;  2UXD M;  3F92 A;  1KYI A;  3L28 A;  1IN8 A;  3MJ5 A;  1IY0 A;  4Q7J A;  4PDG A;  3HJS A;  2KEB A;  3GPU A;  5BR8 M;  4LF7 M;  5KO3 A;  4JV5 M;  2MJ5 B;  3IHP A;  2DI0 A;  4LZZ A;  3FTD A;  2R4J A;  3A98 B;  4HL4 A;  3SC3 A;  3T1Y M;  2O01 F;  2F5O A;  1TR8 A;  1NNU C;  3FYD A;  1GO5 A;  2K6B A;  3K92 A;  3TWK A;  1N36 M;  2B3T A;  2CHG A;  3CF6 E;  2C98 A;  2ZBK B;  1JR3 D;  1NHG C;  4GMQ A;  3AV0 A;  3I51 A;  3U60 B;  4LF8 M;  3C3D A;  4GIP A;  1GVN A;  1IXS A;  2LBC A;  1YSY A;  3GRY A;  5KPZ A;  3AOG A;  3W67 A;  5FSW A;  5L8R F;  3OTO M;  3ZQJ A;  4DUZ M;  3FKE A;  3M6A A;  1KSF X;  2UUB M;  3HHY A;  2L2D A;  2XF3 A;  2Z7J A;  2LVQ D;  4QOZ C;  4LGM A;  4II7 A;  4DV3 M;  4GHA A;  3J7B A;  4M0D A;  3I4Y A;  1G71 A;  1R2Z A;  2LNH C;  2L4F A;  3E9S A;  4GEW A;  4EIW A;  4F1I A;  1IN7 A;  3BXW A;  2KNZ A;  3MK6 A;  3THG A;  4RNA A;  1CUK A;  1DV0 A;  2KW0 A;  2VF7 A;  4B08 A;  1IBM M;  1QAM A;  1R6B X;  2DNA A;  1H6U A;  2R44 A;  4L15 A;  2YR0 A;  2JY5 A;  1R5L A;  1T43 A;  2BJW A;  5EP3 A;  3U6S A;  4AQY M;  2C9O A;  5FTL A;  1NJF A;  4DR3 M;  1OIP A;  4NOO B;  3NBI A;  1PJI A;  3HJ8 A;  5JI2 E;  1IBK M;  1V33 A;  1OAI A;  1VEG A;  2QSF X;  2CUZ A;  5BPV A;  3L25 A;  1NY5 A;  1HQY E;  4ITQ A;  1R4G A;  1X37 A;  2L7I A;  2UU9 M;  2GNO A;  3HJQ A;  1E9R A;  2XEP A;  3HHZ A;  4JI0 M;  2VQE M;  4GC5 A;  1QQW A;  2EO2 A;  5KQ8 A;  4NRW A;  1XC8 A;  2KRK A;  2EJS A;  4B7H A;  3D8B A;  3U6D A;  2QCU A;  1E32 A;  2J7O A;  3SAT A;  4QNR A;  1Q3B A;  4LCB A;  4LY6 A;  4MB7 A;  4AKG A;  1VG5 A;  2K47 A;  3KSJ A;  4MGZ E;  3DFZ A;  1D0M A;  4DBG B;  2UXB M;  3DA1 A;  4JI8 M;  4B3M M;  3RGS A;  3VKH A;  2MGW A;  2EUC A;  1TH3 A;  5F3W A;  3ZH9 B;  1N78 A;  4LRS A;  4CGY B;  3IEC A;  2G3Q A;  1HT1 E;  1OFH A;  3LQR A;  5IT9 S;  3HKP A;  1QAN A;  2BJV A;  3U60 A;  3J81 S;  2K9D A;  3SFZ A;  3UZU A;  4JI7 M;  2AHM A;  4DV5 M;  4KHP M;  3U6M A;  5EP2 A;  2DAK A;  1IN4 A;  3FYC A;  1K82 A;  1WIV A;  1OFI A;  5ITY A;  4DR5 M;  2ZTC A;  2VQF M;  4IIW A;  1EE8 A;  5LMU M;  3T6P A;  3B7Z A;  3IG5 A;  4WUR A;  4G4O A;  3KS8 A;  2CE7 A;  2FNA A;  4M9Z A;  4IJF A;  1C7Y A;  2H1R A;  3E4R A;  1PJS A;  1JB0 F;  1TGU A;  4IBJ A;  4F2L A;  5KPT A;  4FD2 A;  4NXN M;  1WR1 B;  2CHQ A;  4X62 M;  3GLG E;  4DV2 M;  3TPZ A;  1I94 M;  2C9C A;  3L26 A;  1MX0 A;  1N77 A;  4MGK E;  4LFC M;  3HZJ A;  2CV1 A;  5H37 D;  4CJ6 A;  4IBI A;  5IRE B;  3KP1 E;  1K3W A;  3NBX X;  3B89 A;  5EJC A;  3U61 B;  4NRV A;  3TL4 X;  2R46 A;  2G8L A;  2UXC M;  5FLX S;  2L7H A;  1YUB A;  4LF4 M;  4GC9 A;  2M5Z A;  1Z5A A;  5DYI A;  2LVN C;  2O5R A;  1HNW M;  2XH9 A;  1QUT A;  2HKJ A;  3BBZ A;  3AFH A;  1LTM A;  1N75 A;  4X66 M;  1TDH A;  2KNV A;  1XB2 B;  1MN3 A;  3L2A A;  4REZ A;  1J5E M;  3GPY A;  3LCU A;  2MRO B;  1IN5 A;  1IY1 A;  2WSC F;  4KLN A;  3JR5 A;  2JY6 B;  4B3T M;  2DZL A;  1XHB A;  4NXM M;  4G4R A;  1IM2 A;  3HY5 A;  1UM8 A;  1WGN A;  4HLQ A;  4Z8X A;  3FD9 A;  1XMQ M;  3V76 A;  2KZS A;  1I4W A;  1NSF A;  3VDP A;  4TUW A;  3KS4 A;  4GHL A;  3CGW A;  3L27 A;  1QYR A;  1UFZ A;  3U6P A;  4A3V B;  1TH2 A;  2APL A;  2DAI A;  3GLF B;  2XSZ A;  1GJS A;  2VII A;  1XMO M;  2Y0Q A;  1GAB A;  2JP7 A;  3UMM A;  1IY2 A;  1NHW C;  1QDR A;  3A45 A;  4NSR A;  1N34 M;  2LH0 A;  2EKK A;  4L4U A;  1TDZ A;  1HR0 M;  3GLI B;  4DUY M;  2OPF A;  4WW0 A;  4B3S M;  1Y8G A;  1F4I A;  3MMP A;  4LJ4 A;  3AL0 C;  3NWL A;  2KZU A;  1OJL A;  4QNM A;  4AG6 A;  4B7G A;  4XK8 F;  1E94 E;  3ILK A;  4L16 A;  4KO8 A;  2DWM A;  3KOW E;  1QAO A;  1HNZ M;  2UUC M;  1VDD A;  1BVS A;  2LXE A;  3FTC A;  2P5T A;  3TE6 A;  4AKI A;  4LJ9 A;  2JWS A;  2RRU A;  4GKJ M;  3FRI A;  4XBO A;  1S3S A;  5FTN A;  3SYL A;  1WXQ A;  3FE3 A;  4XGI A;  3GLF E;  2CV0 A;  2X8A A;  4PD2 A;  1AIP C;  4G6Z A;  4IBF A; 
#chains in the Genus database with same CATH homology
 3TWM A;  3U61 A;  4CHT B;  4I5S A;  1XNQ M;  4LGY A;  2RGO A;  4JI1 M;  4DR6 M;  1Z59 A;  1DGH B;  1IXZ A;  3J80 S;  4AI6 A;  1IN6 A;  3HHW A;  4DV1 M;  2I7N A;  5A2Q S;  3M0E A;  2XZU A;  4IBK A;  3UGJ A;  1SXJ D;  3SAW A;  4FWD A;  1L1T A;  2CEA A;  1W5T A;  3GPX A;  3U6O A;  1IXR C;  2ZAN A;  1G41 A;  4DV0 M;  3HU1 A;  1QZM A;  2R18 A;  3IG8 A;  4DV6 M;  2XZF A;  1PJJ A;  1DO0 A;  4LFA M;  3SAU A;  1D2N A;  5IZ7 D;  3ZC7 B;  4AW4 A;  5E26 A;  1NVM A;  4MH0 E;  3LVW A;  3K8Z A;  4LRT A;  3GLG B;  2R45 A;  1HQC A;  2XGN A;  1GKI A;  1Q39 A;  2JA2 A;  1Z6T A;  3GRU A;  1DO2 A;  4ZPX A;  3GLF A;  3W0L B;  4Z6Y A;  1L2D A;  3FUX A;  5GKN A;  4X64 M;  2DHR A;  2HCB A;  1FJG M;  4RF1 A;  4MGY E;  1R2Z A;  1QVR A;  2CV2 A;  5IWA M;  3A42 A;  3VK7 A;  2XFS A;  2Z4R A;  3RGP A;  4X65 M;  3U5Z B;  3K2L A;  4OW0 A;  2M60 A;  4I4L A;  3RFW A;  3GLI A;  1JQJ C;  1DGF A;  5C1B A;  3JAM S;  4LFB M;  3GO8 A;  2YNM D;  5JI3 E;  3HGI A;  2HHH M;  4BB9 A;  5FTK A;  4RF0 A;  1N32 M;  3CF0 A;  3FUU A;  3KDS E;  4FW9 A;  4OX9 M;  4FWG A;  3FUT A;  3U6C A;  1GL6 A;  3TQS A;  3SAV A;  2ZAO A;  3H4M A;  2Y20 A;  1FNN A;  4NSO B;  2R65 A;  4M9S A;  1R7R A;  1K3X A;  4YHH M;  2XFT A;  3JR4 A;  2QZ4 A;  2Z4S A;  3DOA A;  4NL4 H;  3KVW A;  1TH4 A;  2YFQ A;  3CTW B;  2X4A A;  4LF6 M;  4BBA A;  3FTF A;  1T3T A;  5ITQ A;  3KOY E;  2V1U A;  4AKH A;  3AKZ A;  1DGH A;  3C58 A;  4R7G A;  3QAU A;  1SXJ C;  3VLF B;  4JI5 M;  4YY3 M;  1G8P A;  1PM5 A;  4L8R C;  3AOE C;  3SYK A;  4D82 A;  5ITU A;  5EXP A;  5E6J A;  4I8O A;  3KOZ E;  4LJ6 A;  2D7G A;  3QWL A;  2ZAM A;  2DWN A;  5ITX E;  1J09 A;  3TWL A;  3A46 A;  1C1K A;  3ZCB B;  3WHK A;  4AZF A;  4G4Q A;  2R62 A;  4FWH A;  3I4V A;  3SAS A;  2Q2E B;  3HU2 A;  4DR1 M;  3GLG A;  3D8L A;  4JI3 M;  1Z5C A;  1J7K A;  2CHV A;  1G4A E;  4M0W A;  4FCV A;  3FUV A;  4CIS A;  3WHL A;  4AG5 A;  3HWS A;  4FCT A;  4P16 A;  1XXH B;  3SMS A;  3U5Z A;  4DV4 M;  1G59 A;  2Y21 A;  1E9S A;  4M9X A;  4PDI A;  1NNJ A;  2D7E A;  4MM3 B;  4S12 A;  5FTJ A;  2ERC A;  2V1C A;  3UK6 A;  2W82 A;  5ITT A;  3L29 A;  3PFI A;  2BNK A;  4LJA A;  1R2Y A;  3T15 A;  2DZO B;  4GIT A;  2XLJ A;  2I7P A;  3K1J A;  4IJE A;  4GKK M;  4I81 A;  1QAQ A;  2HL7 A;  2R4E A;  3EIE A;  4LF9 M;  3SMP A;  1L2C A;  4IBC A;  2QEN A;  5ITR A;  3GLH B;  4IBD A;  2Z3X A;  3GRV A;  5ITX A;  1NY6 A;  4R3D A;  3DZD A;  2RGH A;  2C96 A;  4BLC A;  2QBY B;  4JXJ A;  4MGI E;  2A5Y B;  3SAR A;  2G5G X;  4DR2 M;  4OVZ B;  1Q3C A;  2Y0T A;  3KFU G;  5C18 A;  3LMM A;  3KSX A;  3W0F A;  2DWL A;  1IQP A;  2F4V M;  3GP1 A;  1L1Z A;  5EP1 A;  1HT2 E;  2F5S A;  3KXE C;  2F5Q A;  2UUA M;  3KP0 E;  4LJ8 A;  4FCW A;  3GQ3 A;  3EIH A;  3FUW A;  3J27 B;  1Z5B A;  3U6E A;  1SXJ B;  4L78 A;  4LJ5 A;  1ZAE A;  4LZJ A;  1ORY B;  4GRI A;  4GH9 A;  2E5L M;  1N33 M;  4PT5 A;  1DGG A;  3U6Q A;  3KW6 A;  3KOX E;  1MU5 A;  2KA6 B;  3BOS A;  3GQ5 A;  2D7H A;  4LG2 A;  3HHX A;  7CAT A;  4MGH A;  3GPP A;  1XXH A;  4FVM A;  3J7A S;  3AJI B;  4D81 A;  4DR4 M;  2L09 A;  2XSZ D;  3J2P B;  5KQD A;  3PVS A;  3GQ4 A;  1JR3 A;  1SXJ E;  1L8Q A;  3UJN A;  5LMN M;  1GL7 A;  3SHF A;  3MHV C;  3T38 A;  1KFV A;  3GLH A;  1YE9 A;  3LQQ A;  2ZM6 M;  2KXE A;  2C5R A;  2OQ4 A;  3VDU A;  8CAT A;  4PCZ A;  2QP9 X;  4JI2 M;  5FTM A;  3HU3 A;  2KRU A;  2X49 A;  2FOI C;  5KPR A;  1IXS B;  3M7G A;  2QBY A;  3B9P A;  3VKG A;  4JN6 A;  4G4N A;  4IBE A;  1ZQ9 A;  1G3I A;  3VK8 A;  1LV7 A;  4OVZ A;  1HNX M;  2F5P A;  4JI4 M;  4DV7 M;  3SBJ A;  4QHT A;  3PNV A;  4DR7 M;  4KOD A;  3SHG B;  4W5W A;  4K0K M;  2V6Z M;  2YQZ A;  3VFD A;  3U6L A;  4JI6 M;  2FFJ A;  5DYG A;  1XWI A;  3PXG A;  3RE8 A;  1NJG A;  5EP4 A;  5EXT A;  2J7N A;  2QPA A;  2L6O A;  2RKO A;  3LVV A;  5EXX A;  1SXJ A;  4D80 A;  2EA0 A;  5EQT A;  3R8F A;  2DZN B;  2FE8 A;  5DNY A;  4LJ7 A;  2C99 A;  3FTE A;  3AOE A;  1DGB A;  4IBB A;  4QHS A;  3Q8X A;  3T1H M;  3PNY A;  2F5N A;  1XNR M;  4B3R M;  1L2B A;  1W5S A;  2LWX A;  3GRR A;  4IBG A;  4LF5 M;  4JYA M;  2NQ8 C;  2CFO A;  4OU7 A;  4B7F A;  3CF2 A;  5EXS A;  1IBL M;  2DWZ B;  3R9X B;  2DXI A;  1GLN A;  2DVW B;  3KS8 A;  1KYI A;  3L28 A;  1IN8 A;  3MJ5 A;  1IY0 A;  4PDG A;  3GPU A;  3HJS A;  2KEB A;  4LF7 M;  5BR8 M;  4JV5 M;  5KO3 A;  2UXD M;  4LZZ A;  3FTD A;  2R4J A;  3A98 B;  4HL4 A;  3SC3 A;  3T1Y M;  2F5O A;  1NNU C;  3FYD A;  3K92 A;  3TWK A;  1N36 M;  2CHG A;  3CF6 E;  2C98 A;  2ZBK B;  1JR3 D;  1NHG C;  4GMQ A;  3AV0 A;  3I51 A;  3U60 B;  4LF8 M;  4GIP A;  1GVN A;  1YSY A;  3GRY A;  5KPZ A;  3AOG A;  5FSW A;  3OTO M;  4DUZ M;  3FKE A;  3M6A A;  1KSF X;  2UUB M;  3HHY A;  2XF3 A;  2Z7J A;  4QOZ C;  4LGM A;  4II7 A;  4DV3 M;  4GHA A;  3J7B A;  4M0D A;  3I4Y A;  2LNH C;  3E9S A;  4EIW A;  1IN7 A;  3MK6 A;  3THG A;  4RNA A;  2KW0 A;  4B08 A;  1IBM M;  1QAM A;  1R6B X;  4L15 A;  1H6U A;  2YR0 A;  5EP3 A;  2BJW A;  3U6S A;  4AQY M;  2C9O A;  5FTL A;  1NJF A;  4DR3 M;  4NOO B;  3NBI A;  1PJI A;  3HJ8 A;  5JI2 E;  1IBK M;  2CUZ A;  5BPV A;  3L25 A;  1NY5 A;  1HQY E;  4ITQ A;  1X37 A;  2L7I A;  2UU9 M;  3HJQ A;  1E9R A;  2XEP A;  3HHZ A;  4JI0 M;  2VQE M;  4GC5 A;  1QQW A;  2EO2 A;  5KQ8 A;  4NRW A;  1XC8 A;  2KRK A;  4B7H A;  3D8B A;  3U6D A;  2QCU A;  1E32 A;  2J7O A;  3SAT A;  4QNR A;  1Q3B A;  4LCB A;  4LY6 A;  4MB7 A;  4AKG A;  2K47 A;  3KSJ A;  4MGZ E;  3DFZ A;  2UXB M;  3DA1 A;  4JI8 M;  4B3M M;  3RGS A;  3VKH A;  2EUC A;  1TH3 A;  5F3W A;  3ZH9 B;  1N78 A;  4LRS A;  4CGY B;  1HT1 E;  1OFH A;  3LQR A;  5IT9 S;  3HKP A;  1QAN A;  2BJV A;  3U60 A;  3J81 S;  3SFZ A;  3UZU A;  4JI7 M;  2AHM A;  4DV5 M;  4KHP M;  3U6M A;  5EP2 A;  1IN4 A;  3FYC A;  1K82 A;  5ITY A;  1OFI A;  4DR5 M;  2VQF M;  4IIW A;  1EE8 A;  5LMU M;  3IG5 A;  4WUR A;  4G4O A;  2CE7 A;  2FNA A;  4M9Z A;  4IJF A;  2H1R A;  3E4R A;  1TGU A;  4IBJ A;  5KPT A;  4FD2 A;  4NXN M;  2CHQ A;  4X62 M;  4DV2 M;  1I94 M;  3TPZ A;  2C9C A;  3L26 A;  1MX0 A;  1N77 A;  4MGK E;  4LFC M;  2CV1 A;  5H37 D;  4IBI A;  5IRE B;  3KP1 E;  1K3W A;  5EJC A;  3U61 B;  4NRV A;  3TL4 X;  2R46 A;  2G8L A;  2UXC M;  5FLX S;  2L7H A;  1YUB A;  4LF4 M;  4GC9 A;  1Z5A A;  2M5Z A;  5DYI A;  1HNW M;  2O5R A;  2XH9 A;  2HKJ A;  3AFH A;  1N75 A;  4X66 M;  1TDH A;  3L2A A;  4REZ A;  1J5E M;  3GPY A;  1IN5 A;  1IY1 A;  4KLN A;  3JR5 A;  4B3T M;  1XHB A;  4NXM M;  4G4R A;  1IM2 A;  1UM8 A;  4HLQ A;  4Z8X A;  3FD9 A;  1XMQ M;  2KZS A;  1I4W A;  1NSF A;  3VDP A;  4TUW A;  3KS4 A;  4GHL A;  3L27 A;  1QYR A;  3U6P A;  4A3V B;  1TH2 A;  3GLF B;  2XSZ A;  2VII A;  1XMO M;  2Y0Q A;  3UMM A;  1IY2 A;  1NHW C;  3A45 A;  4NSR A;  1N34 M;  2LH0 A;  4L4U A;  1TDZ A;  1HR0 M;  3GLI B;  4DUY M;  2OPF A;  4WW0 A;  4B3S M;  4LJ4 A;  3AL0 C;  3NWL A;  2KZU A;  1OJL A;  4QNM A;  4AG6 A;  4B7G A;  1E94 E;  3ILK A;  4L16 A;  4KO8 A;  2DWM A;  3KOW E;  1QAO A;  1HNZ M;  2UUC M;  1VDD A;  2LXE A;  3FTC A;  2P5T A;  3TE6 A;  4AKI A;  4LJ9 A;  4GKJ M;  4XBO A;  1S3S A;  5FTN A;  3SYL A;  1WXQ A;  4XGI A;  2CV0 A;  2X8A A;  4PD2 A;  4QOS A;  4G6Z A;  4IBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...