3HKPA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with protocatechuate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTDPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 71
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hkpA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hkpA02
2AZQA 3HJQA 3PCAA 2BUUA 3LXVM 3LMXA 3N9TA 2BV0B 3MV4M 4WHSD 2BUZA 2BURA 1YKPB 3PCCM 1EOCA 1EOBB 4WHOB 3PCHM 4WHRB 3MFLA 4ILVA 3PCBM 2PCDM 3MV6M 3PCHA 4WHSB 1YKOA 4WHOD 1YKMA 3O5UA 3PCMM 3PCKA 3I4YA 3PCDA 3MI1M 3PCFA 1DLQA 2BUWB 4WHPD 1YKKA 3LXVA 3MV4A 3O6RA 1DLTA 3HJ8A 4WHQB 1DLMA 3T67M 3PCLM 2BOYA 3HKPA 3I4VA 2BUMB 2BUYB 1EOAB 2BV0A 3TH1A 3PCCA 3O6JA 5TD3A 1YKLB 2BUQB 1YKNB 3PCGM 4WHPB 3PCBA 3T63M 1EO9B 2PCDA 1YKPA 3MV6A 2XSRA 3PCJM 1EOBA 3PCIM 4WHOA 1EO2B 2BUYA 3PCEM 4WHRA 2BUVB 3PCNM 2BUXB 3HJSA 1TMXA 2BUUB 2BUTB 3PCMA 3HGIA 3PCIA 1YKNA 3PCEA 4ILTA 4WHSA 1S9AA 2XSVA 3MI1A 3PCNA 3MI5M 3HHYA 3PCAM 2BUZB 3T67A 3PCLA 3O32A 2BUXA 1EOCB 2BUWA 4WHRF 2BUTA 4WHQA 3I51A 1YKOB 2BUMA 3MFLM 3PCGA 3LKTM 1EOAA 3HHXA 3T63A 1YKMB 1DMHA 3PCJA 1YKLA 2BUQA 2XSUA 3LKTA 4WHPA 1EO9A 1YKKB 3PCKM 3LMXM 3PCDM 1EO2A 2BURB 3MI5A 2BUVA 3PCFM
chains in the Genus database with same CATH superfamily
3VKGA 1E9SA 2FE8A 3W68A 2KNAA 4CIZA 3GLFB 5ITUA 3LXVM 3GQ4A 4I5SA 3SAUA 3J7AS 1GLNA 4KT0F 2L09A 5EXXA 2QHOB 2Z8YM 5C1BA 3C58A 2CP8A 4B7HA 3U6DA 1DGFA 4G4RA 4G4OA 1E32A 4TUWA 4MM3B 1K3WA 3U6OA 3R8FA 3AV0A 1P3QQ 2UXDM 1T3TA 3HX3A 3BBZA 5FLXS 4L15A 4ILVA 5EP2A 2BJWA 2EKKA 3PCBM 3KXEC 2JUJA 3K2LA 4GEWA 4JXJA 4UN2B 5FTMA 4AQYM 1D0LA 4DR4M 2XFSA 5GKNA 1D2NA 3MV6M 1TH2A 3TQSA 2UXCM 3PCHA 2JNHA 3E46A 1C7YA 4WHSB 2K6BA 1XHBA 1N75A 1QQWA 2K47A 3FTDA 1NO1A 4WHOD 3GRYA 1YKMA 5BPVA 4P17A 3E21A 3PNVA 3GLIA 3L29A 1HT1E 1IBMM 1FNNA 2CV2A 4QHSA 2KZUA 2ZM6M 2F5SA 3L26A 2UU9M 4DV0M 1QVRA 3NWLA 2FOIC 4LRSA 4NRVA 2C96A 1KSFX 3QYEA 3SATA 3PCLM 3I4VA 2XFTA 2V6ZM 1HNXM 1IN8A 1IN5A 2H1RA 2YQZA 3CF6E 2G5GX 2UUBM 4IBFA 4W5WA 1ORYB 2DAKA 1MX0A 1OIZA 3EIHA 3O6JA 1OKSA 1SXJA 4I8OA 4NXNM 3J2PB 2J7OA 3UK6A 4BLCA 4WHPB 4IBGA 3SC3A 5C18A 2BWEA 2KW0A 4MGYE 2DENA 4LJ8A 3A42A 3JAMS 3PCEM 4IBKA 3LW5F 3HU2A 3K9PA 3AOEC 3NBIA 4JI5M 3B9PA 3SHGB 3V76A 3IHPA 2Y0TA 1L2BA 1V92A 3AFHA 3TWLA 5EP4A 3U5ZA 2XSVA 2I7NA 2KXEA 2L4EA 2R65A 3DOAA 1OTRA 2JA2A 1IXSB 3KVWA 4XK8F 3GPXA 2HHHM 1DGHA 1IN6A 1QAMA 1HT2E 1VEJA 4PCZA 1NY5A 4GRIA 3DA1A 2J7NA 3W67A 2OQ4A 4CISA 1UFZA 4LJ7A 3LMMA 1GABA 3GPUA 1EOCB 2DWNA 2BUWA 1Z59A 3M0EA 1OFIA 2LWXA 4LF7M 2RGOA 1XXHA 5IT9S 4HEOA 4AKIA 1IY1A 1ZQ9A 1OIPA 1MN3A 1IXRC 5DFLA 1NV9A 3W0LB 4AZFA 2Y20A 5FTLA 4WURA 2QBYB 5DYGA 4KHPM 4F2LA 2DHRA 5FTJA 2Y0QA 3JR5A 4FVMA 5EXSA 1YKOB 5LMUM 3LKTM 1E94E 1JR3E 2O5RA 3FRHA 3VDPA 3GLHB 5FTKA 3GO8A 3U60B 1DMHA 4FW9A 4MGHA 3J27B 3FYDA 3B74A 1PJTA 3GLIE 1QZMA 4LF8M 1JR3D 1EO9A 3LQQA 1YKKB 1ZMWA 3HU3A 1K82A 3LMXM 3PCKM 3PCDM 2V1CA 3QWLA 1EO2A 3MI5A 2JWSA 1HQCA 3CTWB 1N32M 3C9PA 3FD9A 1IBKM 3VKHA 1HR0M 3N9TA 1NSFA 3E4RA 2BV0B 3PVSA 2JZ1A 4GMQA 2DZOB 4LCBA 2VQEM 2XZFA 2FH0A 2DI0A 2R62A 3K8ZA 4WHSD 3U6MA 3D8LA 2VQFM 4JI4M 1N77A 2C98A 1XMQM 4DR6M 1SXJE 4LJ9A 1WJ7A 2C5RA 4WP2A 4LFBM 3LVWA 2BUZA 3U6EA 2DNAA 1OJLA 3RFWA 2QENA 1SG9A 1K3XA 4G4QA 3PCCM 3U6SA 2M60A 5IREB 1G59A 4PT5A 1NY6A 3FUVA 4JV5M 1EOBB 1SXJD 1G3IA 1VDDA 1VDLA 2KA6B 2CV0A 4JI3M 3MFLA 5E6JA 4REZA 4QHTA 3WHLA 2LTUA 2PCDM 3B7QA 1J09A 2CUZA 2WSFF 4IBCA 1AIPC 4JN6A 4LJ4A 1OAOC 4QNRA 4L6V6 3SAVA 2JY7A 4PD2A 3UJNA 2QZ4A 2BNKA 5ITRA 2UUCM 1IN4A 1GO5A 3EIEA 2DZNB 3TWKA 1D0KA 3PCMM 2XLJA 3U6LA 3AKZA 2KDLA 1GL7A 3J7BA 4DV3M 5KPTA 1DLQA 4WHPD 4K0KM 3KFUG 2RKOA 3I01M 3SASA 3MV4A 1XXHE 2ZAOA 3HJ8A 1R5LA 3GP1A 4WHQB 4AW4A 4LZZA 2H5XA 3T1YM 2DKLA 2L6OA 4L78A 1PJJA 2BUMB 3GLFA 1I94M 3ZCBB 4X66M 3HWSA 3GPPA 3U6QA 3KOZE 2UUAM 4KLNA 5TD3A 1YKLB 2F5OA 1QDTA 3KP1E 3WHKA 3PCGM 4NRWA 1JR3A 4RNAA 3T63M 4CHTB 3CF2A 4LGMA 4PDGA 2QSFX 3L28A 2XSRA 3PCJM 1NHWC 2F5PA 4G6ZA 4ITQA 2BUVB 1Q02A 3H4JA 2BUXB 3PCNM 1TMXA 1X37A 2FNAA 1N33M 2DZLA 2BUUB 2CFOA 4DV5M 3GRUA 3HGIA 2HKJA 3GLHE 1PJQA 4M9ZA 4HLQA 4R3DA 3PCEA 1HQYE 4WHSA 3HHYA 1PJSA 2Z3XA 4DR2M 2DHYA 3AOEA 2LVAA 1GKIA 5JI3E 1Z5BA 1TH4A 4DV1M 1VEKA 2XZUA 1D0MA 4IBEA 1YLAA 3T67A 1UM8A 3O32A 4DV7M 2BUXA 2Q2EB 3IECA 2O25A 3VLFB 1XNRM 5E26A 4LRTA 1QZEA 4QOZC 3M7GA 3FTCA 2ZANA 4DUYM 2JP7A 4OU7A 2MH8A 2DAGA 3I51A 1PRBA 1XC8A 2X8AA 2JXNA 2NQ8C 2HWJA 2K0BX 4M0DA 4IBJA 1IY0A 1R4GA 2I7PA 4NC6A 5EP3A 4FWDA 2WSCF 5FTNA 4X62M 1Z6TA 2KHHA 2WSEF 3LKTA 3B7NA 2KZSA 3SAWA 2CE7A 2EO2A 2VF8A 4WHPA 3KSJA 4LFCM 3FKEA 1Z5CA 4GKJM 3W0FA 4GH9A 8CATA 4F1IA 4II7A 1EE8A 3SBJA 2F5QA 2A5YB 2DAEA 2B3TA 3OTOM 3HHZA 2X4AA 1Q39A 2VF7A 5EP1A 2EA0A 2ZTCA 1TH3A 1RU3A 2R6FA 2LXEA 4D80A 4ZPXA 3PCAA 4GIPA 4B3SM 5DYIA 1TR8A 3LMXA 4M0WA 3GLFE 3I04M 2F5NA 3A46A 2RRUA 3HZJA 1EFUB 1XB2B 1LTMA 1IXSA 3IG5A 4LFAM 5ITQA 1LV7A 3SFZA 2EUCA 2L7HA 4MGKE 3ZC7B 5JI2E 3KOYE 5LMNM 2UXBM 5H37D 3KS8A 4FWHA 4R71A 1KFVA 1YKPB 3VDUA 1EOCA 2YNMD 4WHOB 3SARA 1W5SA 2M5ZA 4WHRB 1MJGM 2XSZA 3UGJA 2BWBA 4M9XA 4EIWA 2QBYA 2AHMA 4HL4A 1EO9B 2G8LA 4D82A 1YKOA 1XNQM 4LJ6A 3RGPA 4L16A 4MH0E 4GHAA 3U60A 3GLHA 3I4YA 3Q8GA 3A98B 3U61B 4DR1M 3MI1M 3PCFA 2G3QA 3C3DA 2QNJA 1YKKA 3LXVA 2C99A 2D7HA 3FUUA 2LBCA 4GITA 1A5TA 1DLTA 4KODA 1AUAA 1R6BX 1TDHA 2R4EA 2K9DA 3D8BA 1TGUA 7CATA 4DR3M 4OX9M 1GL6A 3MI1A 2BOYA 3HKPA 3GLGB 2BUYB 1EOAB 1IQPA 5L8RF 4A3VB 3UZUA 2BV0A 2LVOC 4FCTA 3TH1A 3KP0E 2HCBA 2BUQB 1IBLM 1NHGC 4IBIA 1NVMA 1WHCA 3HHWA 1YSYA 2CHQA 2VDBB 3PCBA 2O01F 1N34M 1YE9A 1W5TA 2QP9X 4RKUF 4JI2M 3AL0C 4FCVA 4LG2A 3L2AA 3A45A 1V33A 2D7GA 1EOBA 3MV6A 3GLGA 1VQ1A 4DR7M 2BUYA 3PCIM 2DWZB 4NSOB 3KS4A 4QOSA 4I4LA 1XMOM 2DXIA 1NJFA 3HJSA 2R45A 4NL4H 1DO0A 3DFZA 4FD2A 4M9SA 4L8RC 4DV6M 3CGWA 3LQRA 3UMMA 4AG6A 2JY5A 2Z7JA 3PCNA 3MK6A 2JY6B 4IJEA 3MI5M 3LCUA 1N78A 2EKFA 1G41A 1Y8GA 5KPRA 2C9CA 1DGGA 2XEPA 1QAOA 2R18A 1G4AE 3NBXX 4AG5A 5KO3A 3MJ5A 2MGWA 1PM5A 3FTFA 3PCLA 4GKKM 2X49A 1TDZA 2WZJA 2EJSA 3QAUA 3ILKA 4DBGB 2LVNC 4B08A 2DAMA 4WHQA 4MGIE 1Q3BA 2GNOA 2Y21A 1TTEA 3SHFA 5IWAM 2BUMA 3FUWA 4BBAA 3MFLM 2R46A 4WW0A 2D7EA 2KRUA 2L7IA 2XSZD 3E9SA 1PGYA 4OW0A 4LGYA 1WIVA 4IJFA 3GLIB 1YKMB 3GQ3A 2LH0A 1E9RA 1NJGA 2R0IA 3KSXA 4OVZB 1YKLA 2XSUA 5ITYA 1L1TA 1JB0F 2ZAMA 3TL4X 4LZJA 2OOBA 4GHLA 4LF9M 2VIIA 3U6PA 1HJPA 2CEAA 4G4NA 1IFYA 2FFJA 2R4JA 2RGHA 3DZDA 3GRRA 2BURB 2JY8A 3J81S 1I4WA 4CGYB 2BUVA 2YR0A 5ITXE 5ITTA 4BB9A 2AZQA 1VG5A 2DVWB 3HJQA 1PJIA 3AOGA 2BUUA 3SMPA 3MV4M 4OVZA 2CRUA 1QYRA 1QUSA 3SMSA 3L27A 4XBOA 2R44A 1SXJB 1ZMVA 3PXGA 2ZBKB 4YY3M 4Y28F 4JI6M 2DAIA 1L2DA 3SYKA 3KDSE 5KPZA 4B7FA 5A2QS 2DWLA 3IG8A 5EJCA 2L4FA 3BXWA 4GC5A 2BURA 1WGLA 2APLA 4JI1M 1ZV1A 4D81A 3HU1A 4DR5M 3PCHM 2KNZA 3THGA 3VFDA 4R7GA 3GLGE 2C9OA 4FWGA 1HNZM 1DV0A 1T43A 1QUTA 2JZ0A 3U5ZB 1WGNA 3C3EA 1DGBA 1KYIA 1VEGA 1XWIA 5KQ8A 4KO8A 1DGHB 4Z6YA 2LVQD 2L2DA 1QDRA 3O5UA 3PCKA 4CJ6A 1J7KA 1QAQA 4JI8M 4JI0M 3PCDA 1J5EM 2Z4RA 3GPYA 4LF6M 2KEBA 2QCUA 2BUWB 1IN7A 5FSWA 4B3MM 1XXHB 4DV2M 1YUBA 3PCFM 3JR4A 3QYBA 3O6RA 3KOWE 1NNJA 3VK8A 1NV8A 4RF0A 1V34A 5BR8M 1DLMA 1SXJC 3T67M 3HY5A 3FUTA 4AKHA 4L4UA 2W82A 2XH9A 1L8QA 2GQFA 3T6PA 1MU5A 1OFHA 3GRVA 3SYLA 3B7ZA 2MROB 4GC9A 3PCCA 2MJ5B 2MR9A 1OQYA 4NXMM 1YKNB 2YFQA 1WXQA 4I81A 4S12A 2J5YA 4DUZM 3PNYA 4Z8XA 3FE3A 5DNYA 1IM2A 1R2YA 1NNUC 4IBDA 2LVPC 5EXTA 1GJTA 3T1HM 1YKPA 2PCDA 3LCVB 4QNMA 2CHGA 2CWBA 1EO2B 4WHOA 5KQDA 4WHRA 1C1KA 1S3SA 3ZH9B 4LJ5A 4B7GA 4YHHM 1N36M 2CV1A 1GJSA 1OAIA 1BVSA 1Q3CA 3RGSA 2V1UA 2BUTB 3U6CA 3TPZA 3PCMA 3FUXA 4MGZE 3PCIA 4NOOB 3ZQJA 4AI6A 3AJIB 1YKNA 4ILTA 1QANA 3PFIA 5ITXA 1S9AA 4NSRA 2ZTDA 4LF5M 3LVVA 1FJGM 1JQJC 2KNVA 3J80S 1L1ZA 3T38A 4JYAM 1F4IA 1Z5AA 4ANRA 2BUZB 3PCAM 2N35A 3Q8XA 4LJAA 4X64M 1G8PA 2BJVA 3M6AA 1L2CA 3U61A 4JI7M 2HAKA 2FS1A 2LHCA 3VK7A 5IZ7D 4LF4M 4WHRF 1DO2A 1GVNA 2BUTA 5EQTA 3F92A 4AKGA 1R7RA 1G71A 4FCWA 2LNHC 3K1JA 4RF1A 4B3TM 2CHVA 1ZMUA 2QQ8A 3B89A 2QPAA 3K92A 2F4VM 2BUQA 2Z4SA 3KOXE 3TWMA 4Q7JA 3FTEA 2ERCA 1EOAA 3BOSA 4B3RM 3PCGA 3HHXA 3T63A 1IY2A 3GQ5A 5F3WA 4G3OA 4X65M 2XF3A 2E5LM 3PCJA 4PDIA 5EXPA 2XGNA 3FRIA 3RE8A 3CF0A 3MMPA 4DV4M 1CUKA 4P16A 2DWMA 2OOAA 3FYCA 1EIJA 4IIWA 1R2ZA 4MB7A 3T15A 1HNWM 2HL7A 4LY6A 2LHGA 4XGIA 2OPFA 2P5TA 3H4MA 3L25A 3KW6A 4IBBA 1H6UA 1IXZA 2OO9A 3K9OA 3MHVC 1T6OA 2KRKA 3TE6A 1WR1B 3R9XB 1TF0B 1ZAEA
chains in the Genus database with same CATH topology
3VKGA 1E9SA 2FE8A 3GLFB 3LXVM 5ITUA 3GQ4A 4I5SA 3SAUA 3J7AS 1GLNA 2L09A 5EXXA 5C1BA 3C58A 4B7HA 3U6DA 1DGFA 4G4RA 4G4OA 1E32A 4TUWA 4MM3B 1K3WA 3U6OA 3R8FA 3AV0A 2UXDM 1T3TA 5FLXS 4ILVA 4L15A 5EP2A 2BJWA 3PCBM 3KXEC 3K2LA 4JXJA 5FTMA 4AQYM 4DR4M 2XFSA 5GKNA 1D2NA 3MV6M 1TH2A 3TQSA 2UXCM 3PCHA 4WHSB 1XHBA 4WHOD 1N75A 1QQWA 2K47A 3FTDA 3GRYA 1YKMA 5BPVA 2CV2A 3PNVA 3GLIA 3L29A 1HT1E 1IBMM 1FNNA 4QHSA 2KZUA 2ZM6M 2F5SA 3L26A 2UU9M 4DV0M 1QVRA 3NWLA 2FOIC 4LRSA 4NRVA 2C96A 1KSFX 3SATA 3PCLM 3I4VA 2XFTA 2V6ZM 1HNXM 1IN8A 1IN5A 2H1RA 2YQZA 3CF6E 2G5GX 2UUBM 4IBFA 4W5WA 1ORYB 1MX0A 3EIHA 3O6JA 4I8OA 1SXJA 4NXNM 3J2PB 2J7OA 3UK6A 4BLCA 4WHPB 4IBGA 3SC3A 5C18A 2KW0A 4MGYE 4LJ8A 3A42A 3JAMS 3PCEM 4IBKA 3HU2A 3AOEC 3NBIA 4JI5M 3B9PA 3SHGB 2Y0TA 1L2BA 3AFHA 3TWLA 5EP4A 3U5ZA 2XSVA 2I7NA 2KXEA 2R65A 3DOAA 3KVWA 2JA2A 3GPXA 1IXSB 4DR3M 2HHHM 3MI1A 1DGHA 1IN6A 1QAMA 1HT2E 4PCZA 1NY5A 4GRIA 3DA1A 2J7NA 2OQ4A 4CISA 4LJ7A 3LMMA 3GPUA 1EOCB 2DWNA 2BUWA 1Z59A 3M0EA 1OFIA 2LWXA 4LF7M 2RGOA 1XXHA 5IT9S 4AKIA 1IY1A 1ZQ9A 1IXRC 3W0LB 4AZFA 5FTLA 2Y20A 2QBYB 4WURA 5DYGA 4KHPM 2DHRA 5FTJA 2Y0QA 3JR5A 4FVMA 5EXSA 1YKOB 5LMUM 3LKTM 1E94E 2O5RA 3VDPA 3GO8A 3GLHB 5FTKA 3U60B 1DMHA 4FW9A 4MGHA 3J27B 3FYDA 1QZMA 4LF8M 1JR3D 1EO9A 3LQQA 1YKKB 3PCKM 3HU3A 1K82A 3LMXM 3PCDM 2V1CA 3QWLA 1EO2A 3MI5A 1HQCA 3CTWB 1N32M 3FD9A 1IBKM 3VKHA 1HR0M 3N9TA 1NSFA 3E4RA 2BV0B 3PVSA 4GMQA 2VQEM 2DZOB 4LCBA 2XZFA 2R62A 3K8ZA 4WHSD 3U6MA 3D8LA 2VQFM 4JI4M 1N77A 2C98A 1XMQM 4DR6M 1SXJE 4LJ9A 2C5RA 2BUZA 4LFBM 3LVWA 3U6EA 1OJLA 3RFWA 2QENA 1K3XA 4G4QA 3PCCM 3U6SA 2M60A 5IREB 1G59A 4PT5A 1NY6A 3FUVA 4JV5M 1EOBB 1SXJD 1G3IA 1VDDA 2KA6B 2CV0A 3MFLA 4JI3M 5E6JA 4REZA 4QHTA 3WHLA 2PCDM 1J09A 2CUZA 4IBCA 4JN6A 4LJ4A 4QNRA 3SAVA 4PD2A 3UJNA 2UUCM 2QZ4A 2BNKA 5ITRA 1IN4A 3EIEA 2DZNB 3TWKA 3PCMM 2XLJA 3U6LA 3AKZA 1GL7A 3J7BA 4DV3M 5KPTA 1DLQA 4WHPD 4K0KM 3KFUG 2RKOA 3SASA 3MV4A 2ZAOA 3HJ8A 3GP1A 4WHQB 4AW4A 4LZZA 3T1YM 4L78A 2L6OA 1PJJA 2BUMB 3GLFA 1I94M 3ZCBB 4X66M 3HWSA 3GPPA 3U6QA 3KOZE 2UUAM 4KLNA 5TD3A 1YKLB 2F5OA 3KP1E 3WHKA 3PCGM 4NRWA 1JR3A 4RNAA 3T63M 4CHTB 3CF2A 4LGMA 4PDGA 3L28A 2XSRA 3PCJM 1NHWC 2F5PA 4G6ZA 4ITQA 2BUVB 3PCNM 2BUXB 1TMXA 1X37A 2FNAA 2BUUB 2CFOA 4DV5M 3GRUA 3HGIA 2HKJA 4M9ZA 4R3DA 3PCEA 4HLQA 4WHSA 1HQYE 3HHYA 4DR2M 2Z3XA 3AOEA 1GKIA 5JI3E 1Z5BA 1TH4A 4DV1M 2XZUA 4IBEA 3T67A 1UM8A 3O32A 4DV7M 2BUXA 2Q2EB 1XNRM 3VLFB 5E26A 4LRTA 4QOZC 3M7GA 3FTCA 2ZANA 4DUYM 4OU7A 3I51A 1XC8A 2X8AA 2NQ8C 4M0DA 4IBJA 1IY0A 2I7PA 5EP3A 4FWDA 5FTNA 4X62M 1Z6TA 3LKTA 2KZSA 3SAWA 2CE7A 2EO2A 4WHPA 3KSJA 4LFCM 3FKEA 1Z5CA 4GKJM 3W0FA 4GH9A 8CATA 4II7A 1EE8A 3SBJA 2F5QA 2A5YB 3OTOM 3HHZA 2X4AA 1Q39A 5EP1A 2EA0A 1TH3A 4D80A 2LXEA 4ZPXA 3PCAA 4GIPA 4B3SM 5DYIA 3LMXA 4M0WA 2F5NA 3A46A 3IG5A 4LFAM 5ITQA 1LV7A 3SFZA 2EUCA 2L7HA 4MGKE 3ZC7B 5JI2E 3KOYE 5LMNM 2UXBM 5H37D 3KS8A 4FWHA 1YKPB 1KFVA 3VDUA 1EOCA 2YNMD 4WHOB 3SARA 1W5SA 2M5ZA 4WHRB 2XSZA 3UGJA 4M9XA 4EIWA 2QBYA 2AHMA 4HL4A 2G8LA 4D82A 1YKOA 1XNQM 4LJ6A 3RGPA 4L16A 4MH0E 4GHAA 3U60A 3GLHA 3I4YA 3A98B 3U61B 4DR1M 3MI1M 3PCFA 1YKKA 3LXVA 2C99A 2D7HA 3FUUA 4GITA 1DLTA 4KODA 7CATA 1R6BX 1TDHA 2R4EA 3D8BA 1TGUA 4OX9M 1GL6A 2BOYA 3HKPA 3GLGB 2BUYB 1EOAB 1IQPA 4A3VB 3UZUA 2BV0A 4FCTA 3TH1A 3KP0E 2HCBA 2BUQB 1IBLM 1NHGC 4IBIA 1NVMA 3HHWA 1YSYA 2CHQA 3PCBA 1YE9A 1W5TA 2QP9X 4JI2M 3AL0C 4FCVA 4LG2A 3L2AA 3A45A 3MV6A 2D7GA 1EOBA 3PCIM 3GLGA 4DR7M 2BUYA 2DWZB 4NSOB 3KS4A 4QOSA 4I4LA 1XMOM 2DXIA 1NJFA 3HJSA 2R45A 4NL4H 1DO0A 3DFZA 4FD2A 4M9SA 4L8RC 4DV6M 3LQRA 3UMMA 4AG6A 2Z7JA 3PCNA 3MK6A 4IJEA 3MI5M 1N78A 1G41A 5KPRA 2C9CA 1DGGA 2XEPA 1QAOA 2R18A 1G4AE 4AG5A 5KO3A 3FTFA 3MJ5A 1PM5A 3PCLA 4GKKM 2X49A 1TDZA 3QAUA 3ILKA 4B08A 4WHQA 4MGIE 1Q3BA 2Y21A 3SHFA 5IWAM 2BUMA 3FUWA 4BBAA 3MFLM 2R46A 4WW0A 2D7EA 2KRUA 2L7IA 2XSZD 3E9SA 4OW0A 1N34M 4LGYA 1YKMB 4IJFA 3GLIB 3GQ3A 2LH0A 1E9RA 1NJGA 3KSXA 4OVZB 1YKLA 2XSUA 5ITYA 1L1TA 2ZAMA 3TL4X 4LZJA 4GHLA 4LF9M 2VIIA 3U6PA 2CEAA 4G4NA 2FFJA 2R4JA 2RGHA 3DZDA 3GRRA 2BURB 3J81S 1I4WA 4CGYB 2BUVA 2YR0A 5ITXE 5ITTA 4BB9A 2AZQA 3HJQA 2DVWB 1PJIA 3AOGA 2BUUA 3SMPA 3MV4M 4OVZA 1QYRA 3SMSA 3L27A 4XBOA 1SXJB 3PXGA 2ZBKB 4YY3M 4JI6M 1L2DA 3SYKA 3KDSE 5KPZA 4B7FA 5A2QS 2DWLA 3IG8A 5EJCA 4GC5A 2BURA 4JI1M 4D81A 3HU1A 4DR5M 3PCHM 3THGA 3VFDA 4R7GA 2C9OA 4FWGA 1HNZM 3U5ZB 1DGBA 1KYIA 1XWIA 5KQ8A 4KO8A 1DGHB 4Z6YA 3O5UA 3PCKA 1J7KA 1QAQA 4JI8M 4JI0M 3PCDA 1J5EM 2Z4RA 3GPYA 4LF6M 2KEBA 2QCUA 2BUWB 1IN7A 5FSWA 4B3MM 1XXHB 4DV2M 1YUBA 3PCFM 3JR4A 3O6RA 3KOWE 1NNJA 3VK8A 4RF0A 1DLMA 3T67M 5BR8M 1SXJC 3FUTA 4AKHA 4L4UA 2W82A 2XH9A 1L8QA 1MU5A 1OFHA 3GRVA 3SYLA 4GC9A 3PCCA 4NXMM 1YKNB 2YFQA 1WXQA 4I81A 4S12A 4DUZM 3PNYA 4Z8XA 5DNYA 1R2YA 1IM2A 1EO9B 1NNUC 4IBDA 5EXTA 3T1HM 2PCDA 1YKPA 4QNMA 2CHGA 4WHOA 1EO2B 5KQDA 4WHRA 1C1KA 1S3SA 3ZH9B 4LJ5A 4B7GA 4YHHM 1N36M 2CV1A 3RGSA 1Q3CA 2V1UA 2BUTB 3U6CA 3TPZA 3PCMA 3FUXA 4MGZE 3PCIA 4NOOB 1YKNA 4AI6A 3AJIB 4ILTA 1QANA 3PFIA 5ITXA 1S9AA 4NSRA 4LF5M 1FJGM 3LVVA 1JQJC 3J80S 1L1ZA 3T38A 4JYAM 2BUZB 1Z5AA 3PCAM 3Q8XA 4LJAA 1L2CA 4X64M 1G8PA 2BJVA 3M6AA 3U61A 4JI7M 3VK7A 5IZ7D 4LF4M 4WHRF 1DO2A 1GVNA 2BUTA 5EQTA 4AKGA 1R7RA 4FCWA 2LNHC 3K1JA 4RF1A 4B3TM 2CHVA 3K92A 2QPAA 2F4VM 2Z4SA 3KOXE 3TWMA 3PCGA 3FTEA 2ERCA 1EOAA 3BOSA 4B3RM 3HHXA 3T63A 1IY2A 3GQ5A 5F3WA 4X65M 2XF3A 2E5LM 3PCJA 4PDIA 5EXPA 2XGNA 3RE8A 2BUQA 3CF0A 4DV4M 4P16A 2DWMA 3FYCA 4IIWA 1R2ZA 4MB7A 3T15A 1HNWM 2HL7A 4LY6A 4XGIA 2OPFA 2P5TA 3H4MA 3L25A 3KW6A 4IBBA 1H6UA 1IXZA 3TE6A 3MHVC 1N33M 2KRKA 3R9XB 1ZAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZQ A;  3HJQ A;  3PCA A;  2BUU A;  3LXV M;  3LMX A;  3N9T A;  2BV0 B;  3MV4 M;  4WHS D;  2BUZ A;  2BUR A;  1YKP B;  3PCC M;  1EOC A;  1EOB B;  4WHO B;  3PCH M;  4WHR B;  3MFL A;  4ILV A;  3PCB M;  2PCD M;  3MV6 M;  3PCH A;  4WHS B;  1YKO A;  4WHO D;  1YKM A;  3O5U A;  3PCM M;  3PCK A;  3I4Y A;  3PCD A;  3MI1 M;  3PCF A;  1DLQ A;  2BUW B;  4WHP D;  1YKK A;  3LXV A;  3MV4 A;  3O6R A;  1DLT A;  3HJ8 A;  4WHQ B;  1DLM A;  3T67 M;  3PCL M;  2BOY A;  3HKP A;  3I4V A;  2BUM B;  2BUY B;  1EOA B;  2BV0 A;  3TH1 A;  3PCC A;  3O6J A;  5TD3 A;  1YKL B;  2BUQ B;  1YKN B;  3PCG M;  4WHP B;  3PCB A;  3T63 M;  1EO9 B;  2PCD A;  1YKP A;  3MV6 A;  2XSR A;  3PCJ M;  1EOB A;  3PCI M;  4WHO A;  1EO2 B;  2BUY A;  3PCE M;  4WHR A;  2BUV B;  3PCN M;  2BUX B;  3HJS A;  1TMX A;  2BUU B;  2BUT B;  3PCM A;  3HGI A;  3PCI A;  1YKN A;  3PCE A;  4ILT A;  4WHS A;  1S9A A;  2XSV A;  3MI1 A;  3PCN A;  3MI5 M;  3HHY A;  3PCA M;  2BUZ B;  3T67 A;  3PCL A;  3O32 A;  2BUX A;  1EOC B;  2BUW A;  4WHR F;  2BUT A;  4WHQ A;  3I51 A;  1YKO B;  2BUM A;  3MFL M;  3PCG A;  3LKT M;  1EOA A;  3HHX A;  3T63 A;  1YKM B;  1DMH A;  3PCJ A;  1YKL A;  2BUQ A;  2XSU A;  3LKT A;  4WHP A;  1EO9 A;  1YKK B;  3PCK M;  3LMX M;  3PCD M;  1EO2 A;  2BUR B;  3MI5 A;  2BUV A;  3PCF M; 
#chains in the Genus database with same CATH topology
 3VKG A;  1E9S A;  2FE8 A;  3W68 A;  2KNA A;  4CIZ A;  3GLF B;  5ITU A;  3LXV M;  3GQ4 A;  4I5S A;  3SAU A;  3J7A S;  1GLN A;  4KT0 F;  2L09 A;  5EXX A;  2QHO B;  2Z8Y M;  5C1B A;  3C58 A;  2CP8 A;  4B7H A;  3U6D A;  1DGF A;  4G4R A;  4G4O A;  1E32 A;  4TUW A;  4MM3 B;  1K3W A;  3U6O A;  3R8F A;  3AV0 A;  1P3Q Q;  2UXD M;  1T3T A;  3HX3 A;  3BBZ A;  5FLX S;  4L15 A;  4ILV A;  5EP2 A;  2BJW A;  2EKK A;  3PCB M;  3KXE C;  2JUJ A;  3K2L A;  4GEW A;  4JXJ A;  4UN2 B;  5FTM A;  4AQY M;  1D0L A;  4DR4 M;  2XFS A;  5GKN A;  1D2N A;  3MV6 M;  1TH2 A;  3TQS A;  2UXC M;  3PCH A;  2JNH A;  3E46 A;  1C7Y A;  4WHS B;  2K6B A;  1XHB A;  1N75 A;  1QQW A;  2K47 A;  3FTD A;  1NO1 A;  4WHO D;  3GRY A;  1YKM A;  5BPV A;  4P17 A;  3E21 A;  3PNV A;  3GLI A;  3L29 A;  1HT1 E;  1IBM M;  1FNN A;  2CV2 A;  4QHS A;  2KZU A;  2ZM6 M;  2F5S A;  3L26 A;  2UU9 M;  4DV0 M;  1QVR A;  3NWL A;  2FOI C;  4LRS A;  4NRV A;  2C96 A;  1KSF X;  3QYE A;  3SAT A;  3PCL M;  3I4V A;  2XFT A;  2V6Z M;  1HNX M;  1IN8 A;  1IN5 A;  2H1R A;  2YQZ A;  3CF6 E;  2G5G X;  2UUB M;  4IBF A;  4W5W A;  1ORY B;  2DAK A;  1MX0 A;  1OIZ A;  3EIH A;  3O6J A;  1OKS A;  1SXJ A;  4I8O A;  4NXN M;  3J2P B;  2J7O A;  3UK6 A;  4BLC A;  4WHP B;  4IBG A;  3SC3 A;  5C18 A;  2BWE A;  2KW0 A;  4MGY E;  2DEN A;  4LJ8 A;  3A42 A;  3JAM S;  3PCE M;  4IBK A;  3LW5 F;  3HU2 A;  3K9P A;  3AOE C;  3NBI A;  4JI5 M;  3B9P A;  3SHG B;  3V76 A;  3IHP A;  2Y0T A;  1L2B A;  1V92 A;  3AFH A;  3TWL A;  5EP4 A;  3U5Z A;  2XSV A;  2I7N A;  2KXE A;  2L4E A;  2R65 A;  3DOA A;  1OTR A;  2JA2 A;  1IXS B;  3KVW A;  4XK8 F;  3GPX A;  2HHH M;  1DGH A;  1IN6 A;  1QAM A;  1HT2 E;  1VEJ A;  4PCZ A;  1NY5 A;  4GRI A;  3DA1 A;  2J7N A;  3W67 A;  2OQ4 A;  4CIS A;  1UFZ A;  4LJ7 A;  3LMM A;  1GAB A;  3GPU A;  1EOC B;  2DWN A;  2BUW A;  1Z59 A;  3M0E A;  1OFI A;  2LWX A;  4LF7 M;  2RGO A;  1XXH A;  5IT9 S;  4HEO A;  4AKI A;  1IY1 A;  1ZQ9 A;  1OIP A;  1MN3 A;  1IXR C;  5DFL A;  1NV9 A;  3W0L B;  4AZF A;  2Y20 A;  5FTL A;  4WUR A;  2QBY B;  5DYG A;  4KHP M;  4F2L A;  2DHR A;  5FTJ A;  2Y0Q A;  3JR5 A;  4FVM A;  5EXS A;  1YKO B;  5LMU M;  3LKT M;  1E94 E;  1JR3 E;  2O5R A;  3FRH A;  3VDP A;  3GLH B;  5FTK A;  3GO8 A;  3U60 B;  1DMH A;  4FW9 A;  4MGH A;  3J27 B;  3FYD A;  3B74 A;  1PJT A;  3GLI E;  1QZM A;  4LF8 M;  1JR3 D;  1EO9 A;  3LQQ A;  1YKK B;  1ZMW A;  3HU3 A;  1K82 A;  3LMX M;  3PCK M;  3PCD M;  2V1C A;  3QWL A;  1EO2 A;  3MI5 A;  2JWS A;  1HQC A;  3CTW B;  1N32 M;  3C9P A;  3FD9 A;  1IBK M;  3VKH A;  1HR0 M;  3N9T A;  1NSF A;  3E4R A;  2BV0 B;  3PVS A;  2JZ1 A;  4GMQ A;  2DZO B;  4LCB A;  2VQE M;  2XZF A;  2FH0 A;  2DI0 A;  2R62 A;  3K8Z A;  4WHS D;  3U6M A;  3D8L A;  2VQF M;  4JI4 M;  1N77 A;  2C98 A;  1XMQ M;  4DR6 M;  1SXJ E;  4LJ9 A;  1WJ7 A;  2C5R A;  4WP2 A;  4LFB M;  3LVW A;  2BUZ A;  3U6E A;  2DNA A;  1OJL A;  3RFW A;  2QEN A;  1SG9 A;  1K3X A;  4G4Q A;  3PCC M;  3U6S A;  2M60 A;  5IRE B;  1G59 A;  4PT5 A;  1NY6 A;  3FUV A;  4JV5 M;  1EOB B;  1SXJ D;  1G3I A;  1VDD A;  1VDL A;  2KA6 B;  2CV0 A;  4JI3 M;  3MFL A;  5E6J A;  4REZ A;  4QHT A;  3WHL A;  2LTU A;  2PCD M;  3B7Q A;  1J09 A;  2CUZ A;  2WSF F;  4IBC A;  1AIP C;  4JN6 A;  4LJ4 A;  1OAO C;  4QNR A;  4L6V 6;  3SAV A;  2JY7 A;  4PD2 A;  3UJN A;  2QZ4 A;  2BNK A;  5ITR A;  2UUC M;  1IN4 A;  1GO5 A;  3EIE A;  2DZN B;  3TWK A;  1D0K A;  3PCM M;  2XLJ A;  3U6L A;  3AKZ A;  2KDL A;  1GL7 A;  3J7B A;  4DV3 M;  5KPT A;  1DLQ A;  4WHP D;  4K0K M;  3KFU G;  2RKO A;  3I01 M;  3SAS A;  3MV4 A;  1XXH E;  2ZAO A;  3HJ8 A;  1R5L A;  3GP1 A;  4WHQ B;  4AW4 A;  4LZZ A;  2H5X A;  3T1Y M;  2DKL A;  2L6O A;  4L78 A;  1PJJ A;  2BUM B;  3GLF A;  1I94 M;  3ZCB B;  4X66 M;  3HWS A;  3GPP A;  3U6Q A;  3KOZ E;  2UUA M;  4KLN A;  5TD3 A;  1YKL B;  2F5O A;  1QDT A;  3KP1 E;  3WHK A;  3PCG M;  4NRW A;  1JR3 A;  4RNA A;  3T63 M;  4CHT B;  3CF2 A;  4LGM A;  4PDG A;  2QSF X;  3L28 A;  2XSR A;  3PCJ M;  1NHW C;  2F5P A;  4G6Z A;  4ITQ A;  2BUV B;  1Q02 A;  3H4J A;  2BUX B;  3PCN M;  1TMX A;  1X37 A;  2FNA A;  1N33 M;  2DZL A;  2BUU B;  2CFO A;  4DV5 M;  3GRU A;  3HGI A;  2HKJ A;  3GLH E;  1PJQ A;  4M9Z A;  4HLQ A;  4R3D A;  3PCE A;  1HQY E;  4WHS A;  3HHY A;  1PJS A;  2Z3X A;  4DR2 M;  2DHY A;  3AOE A;  2LVA A;  1GKI A;  5JI3 E;  1Z5B A;  1TH4 A;  4DV1 M;  1VEK A;  2XZU A;  1D0M A;  4IBE A;  1YLA A;  3T67 A;  1UM8 A;  3O32 A;  4DV7 M;  2BUX A;  2Q2E B;  3IEC A;  2O25 A;  3VLF B;  1XNR M;  5E26 A;  4LRT A;  1QZE A;  4QOZ C;  3M7G A;  3FTC A;  2ZAN A;  4DUY M;  2JP7 A;  4OU7 A;  2MH8 A;  2DAG A;  3I51 A;  1PRB A;  1XC8 A;  2X8A A;  2JXN A;  2NQ8 C;  2HWJ A;  2K0B X;  4M0D A;  4IBJ A;  1IY0 A;  1R4G A;  2I7P A;  4NC6 A;  5EP3 A;  4FWD A;  2WSC F;  5FTN A;  4X62 M;  1Z6T A;  2KHH A;  2WSE F;  3LKT A;  3B7N A;  2KZS A;  3SAW A;  2CE7 A;  2EO2 A;  2VF8 A;  4WHP A;  3KSJ A;  4LFC M;  3FKE A;  1Z5C A;  4GKJ M;  3W0F A;  4GH9 A;  8CAT A;  4F1I A;  4II7 A;  1EE8 A;  3SBJ A;  2F5Q A;  2A5Y B;  2DAE A;  2B3T A;  3OTO M;  3HHZ A;  2X4A A;  1Q39 A;  2VF7 A;  5EP1 A;  2EA0 A;  2ZTC A;  1TH3 A;  1RU3 A;  2R6F A;  2LXE A;  4D80 A;  4ZPX A;  3PCA A;  4GIP A;  4B3S M;  5DYI A;  1TR8 A;  3LMX A;  4M0W A;  3GLF E;  3I04 M;  2F5N A;  3A46 A;  2RRU A;  3HZJ A;  1EFU B;  1XB2 B;  1LTM A;  1IXS A;  3IG5 A;  4LFA M;  5ITQ A;  1LV7 A;  3SFZ A;  2EUC A;  2L7H A;  4MGK E;  3ZC7 B;  5JI2 E;  3KOY E;  5LMN M;  2UXB M;  5H37 D;  3KS8 A;  4FWH A;  4R71 A;  1KFV A;  1YKP B;  3VDU A;  1EOC A;  2YNM D;  4WHO B;  3SAR A;  1W5S A;  2M5Z A;  4WHR B;  1MJG M;  2XSZ A;  3UGJ A;  2BWB A;  4M9X A;  4EIW A;  2QBY A;  2AHM A;  4HL4 A;  1EO9 B;  2G8L A;  4D82 A;  1YKO A;  1XNQ M;  4LJ6 A;  3RGP A;  4L16 A;  4MH0 E;  4GHA A;  3U60 A;  3GLH A;  3I4Y A;  3Q8G A;  3A98 B;  3U61 B;  4DR1 M;  3MI1 M;  3PCF A;  2G3Q A;  3C3D A;  2QNJ A;  1YKK A;  3LXV A;  2C99 A;  2D7H A;  3FUU A;  2LBC A;  4GIT A;  1A5T A;  1DLT A;  4KOD A;  1AUA A;  1R6B X;  1TDH A;  2R4E A;  2K9D A;  3D8B A;  1TGU A;  7CAT A;  4DR3 M;  4OX9 M;  1GL6 A;  3MI1 A;  2BOY A;  3HKP A;  3GLG B;  2BUY B;  1EOA B;  1IQP A;  5L8R F;  4A3V B;  3UZU A;  2BV0 A;  2LVO C;  4FCT A;  3TH1 A;  3KP0 E;  2HCB A;  2BUQ B;  1IBL M;  1NHG C;  4IBI A;  1NVM A;  1WHC A;  3HHW A;  1YSY A;  2CHQ A;  2VDB B;  3PCB A;  2O01 F;  1N34 M;  1YE9 A;  1W5T A;  2QP9 X;  4RKU F;  4JI2 M;  3AL0 C;  4FCV A;  4LG2 A;  3L2A A;  3A45 A;  1V33 A;  2D7G A;  1EOB A;  3MV6 A;  3GLG A;  1VQ1 A;  4DR7 M;  2BUY A;  3PCI M;  2DWZ B;  4NSO B;  3KS4 A;  4QOS A;  4I4L A;  1XMO M;  2DXI A;  1NJF A;  3HJS A;  2R45 A;  4NL4 H;  1DO0 A;  3DFZ A;  4FD2 A;  4M9S A;  4L8R C;  4DV6 M;  3CGW A;  3LQR A;  3UMM A;  4AG6 A;  2JY5 A;  2Z7J A;  3PCN A;  3MK6 A;  2JY6 B;  4IJE A;  3MI5 M;  3LCU A;  1N78 A;  2EKF A;  1G41 A;  1Y8G A;  5KPR A;  2C9C A;  1DGG A;  2XEP A;  1QAO A;  2R18 A;  1G4A E;  3NBX X;  4AG5 A;  5KO3 A;  3MJ5 A;  2MGW A;  1PM5 A;  3FTF A;  3PCL A;  4GKK M;  2X49 A;  1TDZ A;  2WZJ A;  2EJS A;  3QAU A;  3ILK A;  4DBG B;  2LVN C;  4B08 A;  2DAM A;  4WHQ A;  4MGI E;  1Q3B A;  2GNO A;  2Y21 A;  1TTE A;  3SHF A;  5IWA M;  2BUM A;  3FUW A;  4BBA A;  3MFL M;  2R46 A;  4WW0 A;  2D7E A;  2KRU A;  2L7I A;  2XSZ D;  3E9S A;  1PGY A;  4OW0 A;  4LGY A;  1WIV A;  4IJF A;  3GLI B;  1YKM B;  3GQ3 A;  2LH0 A;  1E9R A;  1NJG A;  2R0I A;  3KSX A;  4OVZ B;  1YKL A;  2XSU A;  5ITY A;  1L1T A;  1JB0 F;  2ZAM A;  3TL4 X;  4LZJ A;  2OOB A;  4GHL A;  4LF9 M;  2VII A;  3U6P A;  1HJP A;  2CEA A;  4G4N A;  1IFY A;  2FFJ A;  2R4J A;  2RGH A;  3DZD A;  3GRR A;  2BUR B;  2JY8 A;  3J81 S;  1I4W A;  4CGY B;  2BUV A;  2YR0 A;  5ITX E;  5ITT A;  4BB9 A;  2AZQ A;  1VG5 A;  2DVW B;  3HJQ A;  1PJI A;  3AOG A;  2BUU A;  3SMP A;  3MV4 M;  4OVZ A;  2CRU A;  1QYR A;  1QUS A;  3SMS A;  3L27 A;  4XBO A;  2R44 A;  1SXJ B;  1ZMV A;  3PXG A;  2ZBK B;  4YY3 M;  4Y28 F;  4JI6 M;  2DAI A;  1L2D A;  3SYK A;  3KDS E;  5KPZ A;  4B7F A;  5A2Q S;  2DWL A;  3IG8 A;  5EJC A;  2L4F A;  3BXW A;  4GC5 A;  2BUR A;  1WGL A;  2APL A;  4JI1 M;  1ZV1 A;  4D81 A;  3HU1 A;  4DR5 M;  3PCH M;  2KNZ A;  3THG A;  3VFD A;  4R7G A;  3GLG E;  2C9O A;  4FWG A;  1HNZ M;  1DV0 A;  1T43 A;  1QUT A;  2JZ0 A;  3U5Z B;  1WGN A;  3C3E A;  1DGB A;  1KYI A;  1VEG A;  1XWI A;  5KQ8 A;  4KO8 A;  1DGH B;  4Z6Y A;  2LVQ D;  2L2D A;  1QDR A;  3O5U A;  3PCK A;  4CJ6 A;  1J7K A;  1QAQ A;  4JI8 M;  4JI0 M;  3PCD A;  1J5E M;  2Z4R A;  3GPY A;  4LF6 M;  2KEB A;  2QCU A;  2BUW B;  1IN7 A;  5FSW A;  4B3M M;  1XXH B;  4DV2 M;  1YUB A;  3PCF M;  3JR4 A;  3QYB A;  3O6R A;  3KOW E;  1NNJ A;  3VK8 A;  1NV8 A;  4RF0 A;  1V34 A;  5BR8 M;  1DLM A;  1SXJ C;  3T67 M;  3HY5 A;  3FUT A;  4AKH A;  4L4U A;  2W82 A;  2XH9 A;  1L8Q A;  2GQF A;  3T6P A;  1MU5 A;  1OFH A;  3GRV A;  3SYL A;  3B7Z A;  2MRO B;  4GC9 A;  3PCC A;  2MJ5 B;  2MR9 A;  1OQY A;  4NXM M;  1YKN B;  2YFQ A;  1WXQ A;  4I81 A;  4S12 A;  2J5Y A;  4DUZ M;  3PNY A;  4Z8X A;  3FE3 A;  5DNY A;  1IM2 A;  1R2Y A;  1NNU C;  4IBD A;  2LVP C;  5EXT A;  1GJT A;  3T1H M;  1YKP A;  2PCD A;  3LCV B;  4QNM A;  2CHG A;  2CWB A;  1EO2 B;  4WHO A;  5KQD A;  4WHR A;  1C1K A;  1S3S A;  3ZH9 B;  4LJ5 A;  4B7G A;  4YHH M;  1N36 M;  2CV1 A;  1GJS A;  1OAI A;  1BVS A;  1Q3C A;  3RGS A;  2V1U A;  2BUT B;  3U6C A;  3TPZ A;  3PCM A;  3FUX A;  4MGZ E;  3PCI A;  4NOO B;  3ZQJ A;  4AI6 A;  3AJI B;  1YKN A;  4ILT A;  1QAN A;  3PFI A;  5ITX A;  1S9A A;  4NSR A;  2ZTD A;  4LF5 M;  3LVV A;  1FJG M;  1JQJ C;  2KNV A;  3J80 S;  1L1Z A;  3T38 A;  4JYA M;  1F4I A;  1Z5A A;  4ANR A;  2BUZ B;  3PCA M;  2N35 A;  3Q8X A;  4LJA A;  4X64 M;  1G8P A;  2BJV A;  3M6A A;  1L2C A;  3U61 A;  4JI7 M;  2HAK A;  2FS1 A;  2LHC A;  3VK7 A;  5IZ7 D;  4LF4 M;  4WHR F;  1DO2 A;  1GVN A;  2BUT A;  5EQT A;  3F92 A;  4AKG A;  1R7R A;  1G71 A;  4FCW A;  2LNH C;  3K1J A;  4RF1 A;  4B3T M;  2CHV A;  1ZMU A;  2QQ8 A;  3B89 A;  2QPA A;  3K92 A;  2F4V M;  2BUQ A;  2Z4S A;  3KOX E;  3TWM A;  4Q7J A;  3FTE A;  2ERC A;  1EOA A;  3BOS A;  4B3R M;  3PCG A;  3HHX A;  3T63 A;  1IY2 A;  3GQ5 A;  5F3W A;  4G3O A;  4X65 M;  2XF3 A;  2E5L M;  3PCJ A;  4PDI A;  5EXP A;  2XGN A;  3FRI A;  3RE8 A;  3CF0 A;  3MMP A;  4DV4 M;  1CUK A;  4P16 A;  2DWM A;  2OOA A;  3FYC A;  1EIJ A;  4IIW A;  1R2Z A;  4MB7 A;  3T15 A;  1HNW M;  2HL7 A;  4LY6 A;  2LHG A;  4XGI A;  2OPF A;  2P5T A;  3H4M A;  3L25 A;  3KW6 A;  4IBB A;  1H6U A;  1IXZ A;  2OO9 A;  3K9O A;  3MHV C;  1T6O A;  2KRK A;  3TE6 A;  1WR1 B;  3R9X B;  1TF0 B;  1ZAE A; 
#chains in the Genus database with same CATH homology
 3VKG A;  1E9S A;  2FE8 A;  3GLF B;  3LXV M;  5ITU A;  3GQ4 A;  4I5S A;  3SAU A;  3J7A S;  1GLN A;  2L09 A;  5EXX A;  5C1B A;  3C58 A;  4B7H A;  3U6D A;  1DGF A;  4G4R A;  4G4O A;  1E32 A;  4TUW A;  4MM3 B;  1K3W A;  3U6O A;  3R8F A;  3AV0 A;  2UXD M;  1T3T A;  5FLX S;  4ILV A;  4L15 A;  5EP2 A;  2BJW A;  3PCB M;  3KXE C;  3K2L A;  4JXJ A;  5FTM A;  4AQY M;  4DR4 M;  2XFS A;  5GKN A;  1D2N A;  3MV6 M;  1TH2 A;  3TQS A;  2UXC M;  3PCH A;  4WHS B;  1XHB A;  4WHO D;  1N75 A;  1QQW A;  2K47 A;  3FTD A;  3GRY A;  1YKM A;  5BPV A;  2CV2 A;  3PNV A;  3GLI A;  3L29 A;  1HT1 E;  1IBM M;  1FNN A;  4QHS A;  2KZU A;  2ZM6 M;  2F5S A;  3L26 A;  2UU9 M;  4DV0 M;  1QVR A;  3NWL A;  2FOI C;  4LRS A;  4NRV A;  2C96 A;  1KSF X;  3SAT A;  3PCL M;  3I4V A;  2XFT A;  2V6Z M;  1HNX M;  1IN8 A;  1IN5 A;  2H1R A;  2YQZ A;  3CF6 E;  2G5G X;  2UUB M;  4IBF A;  4W5W A;  1ORY B;  1MX0 A;  3EIH A;  3O6J A;  4I8O A;  1SXJ A;  4NXN M;  3J2P B;  2J7O A;  3UK6 A;  4BLC A;  4WHP B;  4IBG A;  3SC3 A;  5C18 A;  2KW0 A;  4MGY E;  4LJ8 A;  3A42 A;  3JAM S;  3PCE M;  4IBK A;  3HU2 A;  3AOE C;  3NBI A;  4JI5 M;  3B9P A;  3SHG B;  2Y0T A;  1L2B A;  3AFH A;  3TWL A;  5EP4 A;  3U5Z A;  2XSV A;  2I7N A;  2KXE A;  2R65 A;  3DOA A;  3KVW A;  2JA2 A;  3GPX A;  1IXS B;  4DR3 M;  2HHH M;  3MI1 A;  1DGH A;  1IN6 A;  1QAM A;  1HT2 E;  4PCZ A;  1NY5 A;  4GRI A;  3DA1 A;  2J7N A;  2OQ4 A;  4CIS A;  4LJ7 A;  3LMM A;  3GPU A;  1EOC B;  2DWN A;  2BUW A;  1Z59 A;  3M0E A;  1OFI A;  2LWX A;  4LF7 M;  2RGO A;  1XXH A;  5IT9 S;  4AKI A;  1IY1 A;  1ZQ9 A;  1IXR C;  3W0L B;  4AZF A;  5FTL A;  2Y20 A;  2QBY B;  4WUR A;  5DYG A;  4KHP M;  2DHR A;  5FTJ A;  2Y0Q A;  3JR5 A;  4FVM A;  5EXS A;  1YKO B;  5LMU M;  3LKT M;  1E94 E;  2O5R A;  3VDP A;  3GO8 A;  3GLH B;  5FTK A;  3U60 B;  1DMH A;  4FW9 A;  4MGH A;  3J27 B;  3FYD A;  1QZM A;  4LF8 M;  1JR3 D;  1EO9 A;  3LQQ A;  1YKK B;  3PCK M;  3HU3 A;  1K82 A;  3LMX M;  3PCD M;  2V1C A;  3QWL A;  1EO2 A;  3MI5 A;  1HQC A;  3CTW B;  1N32 M;  3FD9 A;  1IBK M;  3VKH A;  1HR0 M;  3N9T A;  1NSF A;  3E4R A;  2BV0 B;  3PVS A;  4GMQ A;  2VQE M;  2DZO B;  4LCB A;  2XZF A;  2R62 A;  3K8Z A;  4WHS D;  3U6M A;  3D8L A;  2VQF M;  4JI4 M;  1N77 A;  2C98 A;  1XMQ M;  4DR6 M;  1SXJ E;  4LJ9 A;  2C5R A;  2BUZ A;  4LFB M;  3LVW A;  3U6E A;  1OJL A;  3RFW A;  2QEN A;  1K3X A;  4G4Q A;  3PCC M;  3U6S A;  2M60 A;  5IRE B;  1G59 A;  4PT5 A;  1NY6 A;  3FUV A;  4JV5 M;  1EOB B;  1SXJ D;  1G3I A;  1VDD A;  2KA6 B;  2CV0 A;  3MFL A;  4JI3 M;  5E6J A;  4REZ A;  4QHT A;  3WHL A;  2PCD M;  1J09 A;  2CUZ A;  4IBC A;  4JN6 A;  4LJ4 A;  4QNR A;  3SAV A;  4PD2 A;  3UJN A;  2UUC M;  2QZ4 A;  2BNK A;  5ITR A;  1IN4 A;  3EIE A;  2DZN B;  3TWK A;  3PCM M;  2XLJ A;  3U6L A;  3AKZ A;  1GL7 A;  3J7B A;  4DV3 M;  5KPT A;  1DLQ A;  4WHP D;  4K0K M;  3KFU G;  2RKO A;  3SAS A;  3MV4 A;  2ZAO A;  3HJ8 A;  3GP1 A;  4WHQ B;  4AW4 A;  4LZZ A;  3T1Y M;  4L78 A;  2L6O A;  1PJJ A;  2BUM B;  3GLF A;  1I94 M;  3ZCB B;  4X66 M;  3HWS A;  3GPP A;  3U6Q A;  3KOZ E;  2UUA M;  4KLN A;  5TD3 A;  1YKL B;  2F5O A;  3KP1 E;  3WHK A;  3PCG M;  4NRW A;  1JR3 A;  4RNA A;  3T63 M;  4CHT B;  3CF2 A;  4LGM A;  4PDG A;  3L28 A;  2XSR A;  3PCJ M;  1NHW C;  2F5P A;  4G6Z A;  4ITQ A;  2BUV B;  3PCN M;  2BUX B;  1TMX A;  1X37 A;  2FNA A;  2BUU B;  2CFO A;  4DV5 M;  3GRU A;  3HGI A;  2HKJ A;  4M9Z A;  4R3D A;  3PCE A;  4HLQ A;  4WHS A;  1HQY E;  3HHY A;  4DR2 M;  2Z3X A;  3AOE A;  1GKI A;  5JI3 E;  1Z5B A;  1TH4 A;  4DV1 M;  2XZU A;  4IBE A;  3T67 A;  1UM8 A;  3O32 A;  4DV7 M;  2BUX A;  2Q2E B;  1XNR M;  3VLF B;  5E26 A;  4LRT A;  4QOZ C;  3M7G A;  3FTC A;  2ZAN A;  4DUY M;  4OU7 A;  3I51 A;  1XC8 A;  2X8A A;  2NQ8 C;  4M0D A;  4IBJ A;  1IY0 A;  2I7P A;  5EP3 A;  4FWD A;  5FTN A;  4X62 M;  1Z6T A;  3LKT A;  2KZS A;  3SAW A;  2CE7 A;  2EO2 A;  4WHP A;  3KSJ A;  4LFC M;  3FKE A;  1Z5C A;  4GKJ M;  3W0F A;  4GH9 A;  8CAT A;  4II7 A;  1EE8 A;  3SBJ A;  2F5Q A;  2A5Y B;  3OTO M;  3HHZ A;  2X4A A;  1Q39 A;  5EP1 A;  2EA0 A;  1TH3 A;  4D80 A;  2LXE A;  4ZPX A;  3PCA A;  4GIP A;  4B3S M;  5DYI A;  3LMX A;  4M0W A;  2F5N A;  3A46 A;  3IG5 A;  4LFA M;  5ITQ A;  1LV7 A;  3SFZ A;  2EUC A;  2L7H A;  4MGK E;  3ZC7 B;  5JI2 E;  3KOY E;  5LMN M;  2UXB M;  5H37 D;  3KS8 A;  4FWH A;  1YKP B;  1KFV A;  3VDU A;  1EOC A;  2YNM D;  4WHO B;  3SAR A;  1W5S A;  2M5Z A;  4WHR B;  2XSZ A;  3UGJ A;  4M9X A;  4EIW A;  2QBY A;  2AHM A;  4HL4 A;  2G8L A;  4D82 A;  1YKO A;  1XNQ M;  4LJ6 A;  3RGP A;  4L16 A;  4MH0 E;  4GHA A;  3U60 A;  3GLH A;  3I4Y A;  3A98 B;  3U61 B;  4DR1 M;  3MI1 M;  3PCF A;  1YKK A;  3LXV A;  2C99 A;  2D7H A;  3FUU A;  4GIT A;  1DLT A;  4KOD A;  7CAT A;  1R6B X;  1TDH A;  2R4E A;  3D8B A;  1TGU A;  4OX9 M;  1GL6 A;  2BOY A;  3HKP A;  3GLG B;  2BUY B;  1EOA B;  1IQP A;  4A3V B;  3UZU A;  2BV0 A;  4FCT A;  3TH1 A;  3KP0 E;  2HCB A;  2BUQ B;  1IBL M;  1NHG C;  4IBI A;  1NVM A;  3HHW A;  1YSY A;  2CHQ A;  3PCB A;  1YE9 A;  1W5T A;  2QP9 X;  4JI2 M;  3AL0 C;  4FCV A;  4LG2 A;  3L2A A;  3A45 A;  3MV6 A;  2D7G A;  1EOB A;  3PCI M;  3GLG A;  4DR7 M;  2BUY A;  2DWZ B;  4NSO B;  3KS4 A;  4QOS A;  4I4L A;  1XMO M;  2DXI A;  1NJF A;  3HJS A;  2R45 A;  4NL4 H;  1DO0 A;  3DFZ A;  4FD2 A;  4M9S A;  4L8R C;  4DV6 M;  3LQR A;  3UMM A;  4AG6 A;  2Z7J A;  3PCN A;  3MK6 A;  4IJE A;  3MI5 M;  1N78 A;  1G41 A;  5KPR A;  2C9C A;  1DGG A;  2XEP A;  1QAO A;  2R18 A;  1G4A E;  4AG5 A;  5KO3 A;  3FTF A;  3MJ5 A;  1PM5 A;  3PCL A;  4GKK M;  2X49 A;  1TDZ A;  3QAU A;  3ILK A;  4B08 A;  4WHQ A;  4MGI E;  1Q3B A;  2Y21 A;  3SHF A;  5IWA M;  2BUM A;  3FUW A;  4BBA A;  3MFL M;  2R46 A;  4WW0 A;  2D7E A;  2KRU A;  2L7I A;  2XSZ D;  3E9S A;  4OW0 A;  1N34 M;  4LGY A;  1YKM B;  4IJF A;  3GLI B;  3GQ3 A;  2LH0 A;  1E9R A;  1NJG A;  3KSX A;  4OVZ B;  1YKL A;  2XSU A;  5ITY A;  1L1T A;  2ZAM A;  3TL4 X;  4LZJ A;  4GHL A;  4LF9 M;  2VII A;  3U6P A;  2CEA A;  4G4N A;  2FFJ A;  2R4J A;  2RGH A;  3DZD A;  3GRR A;  2BUR B;  3J81 S;  1I4W A;  4CGY B;  2BUV A;  2YR0 A;  5ITX E;  5ITT A;  4BB9 A;  2AZQ A;  3HJQ A;  2DVW B;  1PJI A;  3AOG A;  2BUU A;  3SMP A;  3MV4 M;  4OVZ A;  1QYR A;  3SMS A;  3L27 A;  4XBO A;  1SXJ B;  3PXG A;  2ZBK B;  4YY3 M;  4JI6 M;  1L2D A;  3SYK A;  3KDS E;  5KPZ A;  4B7F A;  5A2Q S;  2DWL A;  3IG8 A;  5EJC A;  4GC5 A;  2BUR A;  4JI1 M;  4D81 A;  3HU1 A;  4DR5 M;  3PCH M;  3THG A;  3VFD A;  4R7G A;  2C9O A;  4FWG A;  1HNZ M;  3U5Z B;  1DGB A;  1KYI A;  1XWI A;  5KQ8 A;  4KO8 A;  1DGH B;  4Z6Y A;  3O5U A;  3PCK A;  1J7K A;  1QAQ A;  4JI8 M;  4JI0 M;  3PCD A;  1J5E M;  2Z4R A;  3GPY A;  4LF6 M;  2KEB A;  2QCU A;  2BUW B;  1IN7 A;  5FSW A;  4B3M M;  1XXH B;  4DV2 M;  1YUB A;  3PCF M;  3JR4 A;  3O6R A;  3KOW E;  1NNJ A;  3VK8 A;  4RF0 A;  1DLM A;  3T67 M;  5BR8 M;  1SXJ C;  3FUT A;  4AKH A;  4L4U A;  2W82 A;  2XH9 A;  1L8Q A;  1MU5 A;  1OFH A;  3GRV A;  3SYL A;  4GC9 A;  3PCC A;  4NXM M;  1YKN B;  2YFQ A;  1WXQ A;  4I81 A;  4S12 A;  4DUZ M;  3PNY A;  4Z8X A;  5DNY A;  1R2Y A;  1IM2 A;  1EO9 B;  1NNU C;  4IBD A;  5EXT A;  3T1H M;  2PCD A;  1YKP A;  4QNM A;  2CHG A;  4WHO A;  1EO2 B;  5KQD A;  4WHR A;  1C1K A;  1S3S A;  3ZH9 B;  4LJ5 A;  4B7G A;  4YHH M;  1N36 M;  2CV1 A;  3RGS A;  1Q3C A;  2V1U A;  2BUT B;  3U6C A;  3TPZ A;  3PCM A;  3FUX A;  4MGZ E;  3PCI A;  4NOO B;  1YKN A;  4AI6 A;  3AJI B;  4ILT A;  1QAN A;  3PFI A;  5ITX A;  1S9A A;  4NSR A;  4LF5 M;  1FJG M;  3LVV A;  1JQJ C;  3J80 S;  1L1Z A;  3T38 A;  4JYA M;  2BUZ B;  1Z5A A;  3PCA M;  3Q8X A;  4LJA A;  1L2C A;  4X64 M;  1G8P A;  2BJV A;  3M6A A;  3U61 A;  4JI7 M;  3VK7 A;  5IZ7 D;  4LF4 M;  4WHR F;  1DO2 A;  1GVN A;  2BUT A;  5EQT A;  4AKG A;  1R7R A;  4FCW A;  2LNH C;  3K1J A;  4RF1 A;  4B3T M;  2CHV A;  3K92 A;  2QPA A;  2F4V M;  2Z4S A;  3KOX E;  3TWM A;  3PCG A;  3FTE A;  2ERC A;  1EOA A;  3BOS A;  4B3R M;  3HHX A;  3T63 A;  1IY2 A;  3GQ5 A;  5F3W A;  4X65 M;  2XF3 A;  2E5L M;  3PCJ A;  4PDI A;  5EXP A;  2XGN A;  3RE8 A;  2BUQ A;  3CF0 A;  4DV4 M;  4P16 A;  2DWM A;  3FYC A;  4IIW A;  1R2Z A;  4MB7 A;  3T15 A;  1HNW M;  2HL7 A;  4LY6 A;  4XGI A;  2OPF A;  2P5T A;  3H4M A;  3L25 A;  3KW6 A;  4IBB A;  1H6U A;  1IXZ A;  3TE6 A;  3MHV C;  1N33 M;  2KRK A;  3R9X B;  1ZAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...