3HKPA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with protocatechuate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
256
Chain Sequence
b'ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTDPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 71
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hkpA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hkpA02
2XSVA 3PCBA 2PCDA 3PCAM 1EOAA 4WHPA 3PCBM 1YKNB 2PCDM 4WHOB 2BUUA 4WHQA 2BURA 3T67A 3PCLM 3PCDM 3PCHM 3I51A 2BUYA 3PCGA 3T67M 3MI1A 1YKOB 1YKKA 3HGIA 4WHSD 3PCJM 1EO2A 1S9AA 3PCMA 2BV0B 2BUWA 2BUXB 1YKLA 1DLTA 3LKTM 3PCAA 5TD3A 2BUTA 4WHSA 2BUMB 3MI5M 3PCLA 3PCDA 3PCHA 1EOAB 1YKMA 2BUVA 3PCFM 3HHYA 3HJQA 4WHOD 4WHQB 3I4VA 3PCJA 3O6RA 1DLQA 1EOBB 1EO9A 1YKPB 2BUYB 4ILTA 2XSRA 2BUZB 3LKTA 4WHRA 4WHRF 4WHOA 3HHXA 2AZQA 3T63A 3MI5A 3I4YA 1DMHA 1YKLB 1YKOA 3T63M 3LXVM 3PCFA 3PCEM 3MV4A 2XSUA 3PCNA 4ILVA 2BUTB 2BV0A 1EOCA 3MV4M 2BUQA 3PCNM 4WHPB 3O6JA 2BUUB 3MV6M 2BURB 2BUVB 3PCCM 3O32A 3N9TA 3PCIM 3LMXM 3HJ8A 3TH1A 2BOYA 1YKKB 3PCKM 3MFLA 1YKNA 1EO9B 1TMXA 1EO2B 3MFLM 2BUWB 3LXVA 4WHRB 3PCEA 3HJSA 1DLMA 1EOBA 1YKPA 3O5UA 4WHSB 2BUZA 3MV6A 3PCCA 2BUXA 3PCGM 3MI1M 1YKMB 3PCIA 3LMXA 1EOCB 2BUQB 3HKPA 3PCKA 4WHPD 3PCMM 2BUMA
chains in the Genus database with same CATH superfamily
4B3RM 4LZZA 1R4GA 3B74A 2KNZA 3J7AS 4LJ4A 2F5SA 1EOAA 3PCAM 4JXJA 2JA2A 1MU5A 1TH3A 4REZA 2ZANA 3PCBM 2PCDM 4WHPA 5FTKA 2J7NA 1YUBA 2FE8A 2X8AA 2JY5A 3U60A 4KO8A 2EUCA 2YR0A 3BXWA 3CGWA 4JI8M 3PCLM 3T67A 2QP9X 4AW4A 1NV8A 1IXZA 1OTRA 3TWLA 1OAIA 1PJTA 1WJ7A 2DZLA 3I51A 3U6OA 4F2LA 1XMQM 3PCGA 4ANRA 5ITUA 2V1CA 4YY3M 2CRUA 2BWBA 4LGYA 4LJAA 4JI2M 2R45A 1V33A 4JYAM 4WHSD 1EO2A 3WHKA 2BV0B 1WXQA 2BUWA 1GLNA 4DBGB 1V92A 4FW9A 1D2NA 3LVWA 1YLAA 2XSZA 4GKKM 2Q2EB 4FWHA 1ZMWA 1VEJA 3FUXA 3LMMA 4HL4A 1MJGM 4LFCM 3LKTM 4B7HA 1Z5AA 3PCAA 3D8BA 1OKSA 5EXPA 3FRHA 4DV1M 4QOSA 2BUTA 2R62A 4B3TM 2YFQA 4D82A 3MK6A 4IBIA 4KODA 3PCHM 1QAOA 2NQ8C 1IFYA 3GQ4A 2JY8A 4B7FA 3PCLA 2R4EA 3QYEA 4DR4M 3PCHA 3GRVA 3M0EA 5EJCA 1XNQM 1R2ZA 2OOBA 3MMPA 2XEPA 2MGWA 1IXSA 4WHOD 1N32M 4WHQB 3FTEA 1XB2B 4G4NA 4JI4M 3SYLA 1DLQA 2C9CA 4L16A 1Z5CA 5FTNA 1YKPB 4AKIA 4NXNM 3FKEA 4R3DA 5LMUM 4B3MM 3LKTA 1HQYE 4WHRA 4LFAM 4XK8F 2Z8YM 1IBMM 4LFBM 2QHOB 2ZAMA 3GO8A 3L27A 2HKJA 2LVPC 2P5TA 2OPFA 5KPTA 4NXMM 2LXEA 1PJQA 3GRUA 3MHVC 2CE7A 2XLJA 4JI1M 3GRYA 4I5SA 1TH4A 1HQCA 2Y20A 4QHSA 4XGIA 5EP3A 4JI6M 4CJ6A 3NWLA 2KA6B 2LNHC 3AFHA 3IG5A 3ZH9B 2BV0A 2FOIC 3T6PA 3HY5A 2CV2A 1EOCA 3MV4M 4CIZA 3B89A 5KQDA 1HT2E 2DI0A 3B9PA 4S12A 4RF0A 5DNYA 4DR1M 2DZOB 2BURB 3MV6M 4I8OA 3LCVB 3L29A 2JWSA 3PNVA 1PM5A 2WSFF 2H5XA 4BB9A 3FYDA 3LQRA 3HJ8A 1SXJD 5EP1A 1E9RA 2BOYA 2KRUA 4NL4H 1YKKB 3GQ5A 2O5RA 5DYGA 1EO9B 1NJFA 2LVNC 2O25A 4D81A 1TMXA 1VDLA 5FSWA 3V76A 1AIPC 3U6CA 3GP1A 1G71A 5H37D 3SMPA 4WP2A 2C96A 1NSFA 2DENA 3F92A 3K1JA 2J7OA 3HJSA 4IBJA 5L8RF 1OJLA 1YKPA 4FCVA 1IY2A 3W67A 3L26A 3TWMA 2L4FA 3MV6A 4WURA 4MB7A 1I94M 4GKJM 2BUXA 3GQ3A 3A45A 1HNXM 3KOXE 2CFOA 3CF0A 3C3DA 8CATA 3AL0C 3HKPA 4P16A 1YE9A 3SARA 2DHYA 3SMSA 1JQJC 3J2PB 1NNUC 3KSJA 2BUMA 2KNAA 2KNVA 4LGMA 1DO2A 2CHQA 3U6MA 4I4LA 2XSVA 1TTEA 2DHRA 4KLNA 3PVSA 1G4AE 3CTWB 4PT5A 3W0LB 2JY6B 2DKLA 2K0BX 3SATA 3SASA 2UXBM 2UXCM 2G8LA 1YKNB 1JB0F 1ZQ9A 2L7HA 2BURA 1QAQA 4DR2M 2HAKA 3WHLA 1SXJE 1F4IA 4GIPA 3T15A 3U6QA 1IN6A 3SAWA 3PCDM 2O01F 2M60A 4DV2M 4DV3M 2BUYA 3IHPA 3RFWA 1L1ZA 4QOZC 3T67M 1SXJB 1YKKA 5LMNM 2N35A 5EXXA 2LWXA 1DGHB 3OTOM 1D0LA 3U61B 1S9AA 4LF8M 4BBAA 1GJSA 1E32A 1NY6A 1YKLA 2FS1A 3GPUA 1TF0B 1UFZA 2MJ5B 4RNAA 5KPRA 5BPVA 5FLXS 5TD3A 5EXTA 3U5ZA 4FCTA 4OU7A 3GLIA 1VQ1A 1IBKM 1IY0A 4JN6A 5ITTA 2XFTA 2D7GA 1V34A 1JR3A 3DFZA 4NSOB 1L2DA 3LCUA 2V6ZM 4MM3B 2RGOA 3FUWA 1GVNA 4A3VB 4DV4M 3PCDA 2KEBA 4KHPM 2XZFA 2BUVA 2FFJA 3HHYA 1E94E 3HU1A 4IBKA 4PCZA 3BBZA 1K3WA 1T3TA 4YHHM 3D8LA 1WIVA 3FRIA 2QSFX 3KVWA 2BJWA 5ITYA 3O6RA 1T6OA 1X37A 3W0FA 4OX9M 2APLA 3QAUA 1TDZA 1LTMA 4MH0E 4KT0F 2F5NA 4FVMA 4M0WA 4LG2A 1HJPA 2WSEF 3GLHA 1CUKA 4FWDA 1N77A 3T1HM 7CATA 3PNYA 3CF6E 2UU9M 1IN5A 4XBOA 4IJFA 3K9PA 2LHGA 1OIPA 1H6UA 1VEKA 2AHMA 1IN7A 2GNOA 2Y0TA 2F5OA 4R7GA 1DGHA 5EP2A 4GHAA 2XSUA 4X64M 3PCEM 3PCNA 3U61A 4LJ7A 2QPAA 4JI0M 2XFSA 1DGBA 3DZDA 4P17A 2EA0A 2ZM6M 3K8ZA 1KFVA 3KS8A 2LH0A 1L2CA 2ZTCA 4AQYM 4JI3M 3L28A 4UN2B 1DO0A 1N78A 2VQFM 5F3WA 3VK8A 4LF6M 1IBLM 3N9TA 2WSCF 2R4JA 3PCIM 2KHHA 4MGKE 3UK6A 1TDHA 3MFLA 1C1KA 2K47A 2JZ0A 2XZUA 3GPYA 4B3SM 1XMOM 2Z7JA 1XXHE 2X49A 2YQZA 2E5LM 4L78A 4D80A 3PCEA 2DAKA 1QDTA 1HT1E 2DAGA 1BVSA 2CV1A 2DAEA 2I7NA 3O5UA 3VDPA 1QDRA 2MROB 2OO9A 2HL7A 4WHSB 2JUJA 5E26A 1DV0A 4DV0M 2V1UA 1WGLA 4AG6A 1Q02A 2QCUA 1QAMA 1GL7A 4QNMA 1IN4A 3PCIA 2ZBKB 2CHVA 2VF7A 1N33M 2BUQB 4WHPD 3GPXA 3HU3A 3PCMM 2LVQD 3AV0A 2L6OA 3H4JA 1TH2A 2J5YA 3VDUA 3C9PA 3E21A 3JR4A 1QVRA 1NJGA 2Y0QA 4FD2A 3TL4X 4CHTB 1SG9A 1UM8A 3FD9A 3RGPA 1I4WA 1ZAEA 4L6V6 4IJEA 4GEWA 5ITRA 2R18A 3T1YM 2D7HA 1DGFA 3I01M 4WHOB 1L2BA 3M7GA 4WHQA 1ZMVA 2EKKA 1QUSA 1VDDA 1P3QQ 4WW0A 3KP0E 4Z8XA 2XSZD 3DOAA 4R71A 3C58A 1YKOB 3UJNA 2WZJA 4AKGA 2DZNB 2QBYB 3FUVA 3HGIA 1WR1B 3SYKA 5E6JA 1D0KA 1MX0A 2FNAA 3PCJM 3PCMA 1VEGA 2CP8A 2Z4SA 1NHWC 1GJTA 4L8RC 1KSFX 2GQFA 3HZJA 2OQ4A 3A46A 3VLFB 5IT9S 4DR7M 4M9ZA 1DLTA 1OFIA 1A5TA 4JI7M 2CEAA 4FCWA 2XF3A 4WHSA 4JV5M 5BR8M 2DWLA 5C1BA 2C99A 4NRVA 5FTLA 3AOEA 3FUUA 5JI2E 4G4RA 4LRSA 1J5EM 1EOAB 1ZMUA 3PCFM 2Y21A 2HCBA 3HJQA 4GC9A 3R9XB 5ITQA 3ILKA 4IBGA 4RF1A 4B08A 3I4VA 3PCJA 2R44A 1HNZM 1EO9A 3UMMA 4JI5M 1EIJA 3UZUA 4F1IA 3A42A 3J80S 2XSRA 4PDGA 3KP1E 1PGYA 3PXGA 5KPZA 5GKNA 1OQYA 3VKHA 4Q7JA 4WHOA 3SBJA 3GLFE 3ZC7B 3EIEA 3HHXA 3AKZA 3FYCA 4LCBA 3T63A 4LJ8A 1R5LA 2B3TA 4GH9A 3AOGA 4QNRA 1DMHA 4AKHA 1OFHA 3GLFB 2DWMA 1YKOA 1NY5A 1QUTA 1HR0M 2QBYA 3MJ5A 4DUZM 5A2QS 4LJ9A 3PCFA 3HX3A 2RGHA 4MGHA 4GITA 2JXNA 3RGSA 4AG5A 2BUTB 2UUBM 2H1RA 2G5GX 4IBDA 3DA1A 4IBEA 1IXRC 4DUYM 5IWAM 3PCNM 3HHWA 2DAIA 3TQSA 3O6JA 4LZJA 3L25A 4L4UA 3JR5A 2BUUB 1QQWA 3CF2A 2VQEM 1YSYA 4DV6M 2KZSA 4X65M 2CHGA 1PRBA 4LF5M 3TE6A 1R7RA 2Z3XA 1N36M 1GKIA 3KOZE 1YKNA 1G41A 2MH8A 4LJ6A 3U6LA 2K6BA 1FJGM 1PJIA 1D0MA 3SFZA 3U6PA 3VK7A 3MFLM 2RKOA 5IZ7D 1WGNA 4WHRB 1G3IA 2C98A 4IBFA 1SXJA 3KS4A 4M9XA 2D7EA 1DLMA 2ZTDA 5IREB 4L15A 2QNJA 2DWNA 1K3XA 4NRWA 2L09A 3QWLA 2CWBA 1IM2A 3UGJA 2M5ZA 1EE8A 4M9SA 2UUCM 2XGNA 4OW0A 4QHTA 5EQTA 4B7GA 2LTUA 3VKGA 2C5RA 3MI1M 4GMQA 4I81A 1YKMB 1IN8A 1RU3A 2JNHA 2KW0A 2OOAA 3FUTA 1NHGC 3KDSE 1NNJA 2MR9A 2DXIA 1EOCB 3IG8A 3Q8XA 4IBCA 3LW5F 3GLFA 3W68A 2ERCA 2LVAA 1QZMA 1KYIA 2LHCA 4IIWA 3TPZA 4X62M 1MN3A 3PCBA 2PCDA 4MGZE 4G4QA 1QANA 3KOYE 4Y28F 3B7NA 3K9OA 4NC6A 3THGA 4Z6YA 4DV5M 1XWIA 3E46A 4MGYE 2UXDM 3SHFA 1IY1A 3NBXX 4MGIE 2BNKA 2VF8A 3H4MA 2BUUA 2VDBB 4M0DA 4II7A 2L4EA 1R6BX 1XXHB 3SC3A 2LBCA 5DFLA 1XC8A 3E4RA 3GLGE 1PJSA 3M6AA 4CGYB 4DR5M 2EJSA 2KDLA 1QZEA 2F5PA 4OVZB 3MI1A 4GHLA 1OAOC 1G59A 3AJIB 1DGGA 3KSXA 3GLGB 4PDIA 3ZQJA 2QZ4A 4HEOA 1JR3D 5EP4A 2L7IA 1LV7A 2DAMA 1R2YA 3K2LA 2BUXB 1J7KA 3HU2A 2X4AA 2KZUA 3Q8GA 1ORYB 1N75A 1W5SA 2JP7A 4GRIA 2R65A 2C9OA 2QQ8A 3ZCBB 3SAUA 3FTFA 2EKFA 1C7YA 2BUMB 2FH0A 2A5YB 3MI5M 4DR6M 1TGUA 4AZFA 3J7BA 3AOEC 3PFIA 4AI6A 1XNRM 4LF9M 2CV0A 1YKMA 1Q39A 3KOWE 3B7ZA 3FE3A 1QYRA 4DR3M 1AUAA 1Q3CA 3T38A 3FTCA 2JY7A 1N34M 3GPPA 4IBBA 3KFUG 4CISA 3LVVA 3K92A 3EIHA 3U6EA 1EOBB 1Z59A 4LJ5A 3U6DA 4W5WA 3E9SA 4K0KM 1VG5A 2K9DA 3BOSA 3HWSA 2BUYB 4ILTA 2BUZB 4LRTA 5KO3A 5ITXE 4G3OA 3SAVA 1PJJA 1NO1A 4WHRF 3HHZA 4G6ZA 3RE8A 1XXHA 3QYBA 5DYIA 2AZQA 1W5TA 3GLIE 3MI5A 3I4YA 2LVOC 1YKLB 2JZ1A 1T43A 4ZPXA 1JR3E 3A98B 4OVZA 1FNNA 3LXVM 5EXSA 3T63M 2XH9A 3U5ZB 3GLIB 2BWEA 2ZAOA 3GLGA 3MV4A 1L8QA 3C3EA 4DV7M 4ILVA 1NV9A 4NOOB 2R46A 1HNWM 2BJVA 3B7QA 2BUQA 2CUZA 4WHPB 1Z6TA 3J81S 1Q3BA 3FTDA 3U60B 2BUVB 3PCCM 1TR8A 1S3SA 1E9SA 3KW6A 3O32A 3SHGB 3TWKA 4ITQA 3IECA 4NSRA 2F5QA 5FTJA 5C18A 3LMXM 2EO2A 3TH1A 3GLHE 3J27B 3PCKM 1OIZA 4BLCA 1WHCA 1EFUB 1G8PA 2YNMD 2DVWB 1J09A 3GRRA 5KQ8A 1EO2B 2F4VM 4G4OA 2UUAM 3GLHB 2BUWB 4EIWA 3LXVA 4HLQA 4PD2A 1XHBA 2G3QA 2DNAA 2W82A 4FWGA 1GABA 2HWJA 3R8FA 2RRUA 3JAMS 1SXJC 1EOBA 1IQPA 2R6FA 2Z4RA 3U6SA 4LF7M 4RKUF 1GL6A 1Y8GA 1Z5BA 1ZV1A 2DWZB 1NVMA 3NBIA 5FTMA 4X66M 4LF4M 4GC5A 2BUZA 3VFDA 2I7PA 5JI3E 3PCCA 2KRKA 3PCGM 4TUWA 4LY6A 5ITXA 3I04M 2L2DA 2HHHM 3LMXA 2R0IA 2VIIA 3KXEC 3LQQA 3PCKA 1L1TA 2QENA 1IXSB 1GO5A 3L2AA 2KXEA 1K82A
chains in the Genus database with same CATH topology
4B3RM 4LZZA 3J7AS 4LJ4A 2F5SA 1EOAA 3PCAM 4JXJA 2JA2A 1MU5A 1TH3A 4REZA 2ZANA 3PCBM 2PCDM 4WHPA 5FTKA 2J7NA 1YUBA 2FE8A 2X8AA 3U60A 4KO8A 2EUCA 2YR0A 4JI8M 3T67A 3PCLM 2QP9X 4AW4A 3PCHM 1IXZA 3TWLA 3I51A 3PCGA 3U6OA 1XMQM 5ITUA 2V1CA 4YY3M 4LGYA 4LJAA 4JI2M 2R45A 4JYAM 4WHSD 1EO2A 3WHKA 2BV0B 1WXQA 2BUWA 1GLNA 4FW9A 1D2NA 3LVWA 2XSZA 4GKKM 2Q2EB 4FWHA 3FUXA 3LMMA 4HL4A 4LFCM 3LKTM 3PCAA 4B7HA 1Z5AA 3D8BA 5EXPA 4DV1M 4QOSA 2BUTA 2R62A 4B3TM 2YFQA 4D82A 3MK6A 4IBIA 4KODA 1QAOA 2NQ8C 3GQ4A 4B7FA 3PCLA 2R4EA 4DR4M 3PCHA 3GRVA 3M0EA 5EJCA 1XNQM 1R2ZA 2XEPA 4WHOD 1N32M 4WHQB 3FTEA 4G4NA 4JI4M 3SYLA 1DLQA 2C9CA 4L16A 1Z5CA 5FTNA 1YKPB 4AKIA 4NXNM 3FKEA 4R3DA 5LMUM 4B3MM 3LKTA 1HQYE 4WHRA 4LFAM 1IBMM 4LFBM 2ZAMA 3GO8A 3L27A 2HKJA 2P5TA 2OPFA 5KPTA 4NXMM 2LXEA 3GRUA 3MHVC 2XLJA 2CE7A 4JI1M 3GRYA 4I5SA 1TH4A 1HQCA 2Y20A 4QHSA 4XGIA 5EP3A 4JI6M 3NWLA 2KA6B 2LNHC 3AFHA 3IG5A 3ZH9B 2BV0A 2FOIC 2CV2A 1EOCA 3MV4M 5KQDA 1HT2E 3B9PA 4S12A 4RF0A 5DNYA 4DR1M 2DZOB 2BURB 3MV6M 4I8OA 3L29A 3PNVA 1PM5A 4BB9A 3FYDA 3LQRA 3HJ8A 1SXJD 5EP1A 1E9RA 2BOYA 2KRUA 4NL4H 1YKKB 3GQ5A 2O5RA 5DYGA 1EO9B 1NJFA 1TMXA 4D81A 5FSWA 3U6CA 3GP1A 5H37D 3SMPA 2C96A 1NSFA 3K1JA 4IBJA 2J7OA 3HJSA 1OJLA 1YKPA 4FCVA 1IY2A 3L26A 3TWMA 3MV6A 4WURA 4MB7A 1I94M 4GKJM 2BUXA 3GQ3A 3A45A 1HNXM 3KOXE 2CFOA 3CF0A 8CATA 3AL0C 3HKPA 4P16A 1YE9A 3SARA 3SMSA 1JQJC 3J2PB 3KSJA 1NNUC 2BUMA 4LGMA 3U6MA 1DO2A 2CHQA 2XSVA 4I4LA 2DHRA 4KLNA 3PVSA 1G4AE 3CTWB 4PT5A 3W0LB 2UXBM 3SASA 3SATA 2UXCM 2G8LA 1YKNB 1ZQ9A 2L7HA 2BURA 1QAQA 4DR2M 3WHLA 1SXJE 4GIPA 3T15A 3U6QA 1IN6A 3SAWA 3PCDM 2M60A 4DV2M 4DV3M 2BUYA 3RFWA 4QOZC 1L1ZA 3T67M 1SXJB 1YKKA 5LMNM 5EXXA 2LWXA 1DGHB 3OTOM 3U61B 1S9AA 4LF8M 4BBAA 1YKLA 1NY6A 1E32A 3GPUA 4RNAA 5KPRA 5BPVA 5FLXS 5TD3A 5EXTA 3U5ZA 4FCTA 4OU7A 3GLIA 1IBKM 1IY0A 4JN6A 5ITTA 2XFTA 2D7GA 3DFZA 1JR3A 4NSOB 1L2DA 2V6ZM 4MM3B 2RGOA 3FUWA 1GVNA 4A3VB 4DV4M 3PCDA 2KEBA 4KHPM 2XZFA 2BUVA 2FFJA 3HHYA 1E94E 3HU1A 4IBKA 4PCZA 1K3WA 1T3TA 4YHHM 3D8LA 3KVWA 5ITYA 2BJWA 3O6RA 1X37A 3W0FA 4OX9M 1TDZA 3QAUA 2F5NA 4MH0E 4FVMA 4M0WA 4LG2A 3GLHA 4FWDA 1N77A 3T1HM 7CATA 3PNYA 3CF6E 2UU9M 1IN5A 4XBOA 4IJFA 1H6UA 2AHMA 1IN7A 2Y0TA 2F5OA 4R7GA 1DGHA 5EP2A 4GHAA 2XSUA 4X64M 3PCEM 3PCNA 3U61A 4LJ7A 2QPAA 4JI0M 2XFSA 1DGBA 3DZDA 2EA0A 2ZM6M 3K8ZA 1KFVA 3KS8A 2LH0A 1L2CA 4AQYM 4JI3M 3L28A 1N78A 1DO0A 2VQFM 5F3WA 3VK8A 4LF6M 1IBLM 3N9TA 2R4JA 3PCIM 4MGKE 3UK6A 1TDHA 3MFLA 1C1KA 2K47A 2XZUA 3GPYA 4B3SM 1XMOM 2Z7JA 2X49A 2YQZA 2E5LM 4L78A 4D80A 3PCEA 2CV1A 1HT1E 2I7NA 3O5UA 3VDPA 4WHSB 2HL7A 5E26A 4DV0M 2V1UA 4AG6A 2QCUA 1QAMA 1GL7A 4QNMA 1IN4A 3PCIA 2ZBKB 2CHVA 1N33M 2BUQB 4WHPD 3GPXA 3HU3A 3PCMM 3AV0A 2L6OA 1TH2A 3VDUA 3JR4A 1QVRA 1NJGA 2Y0QA 4FD2A 3TL4X 4CHTB 1UM8A 3FD9A 3RGPA 1I4WA 1ZAEA 5ITRA 4IJEA 3T1YM 2R18A 2D7HA 1DGFA 4WHOB 1L2BA 3M7GA 4WHQA 1VDDA 4WW0A 3KP0E 4Z8XA 2XSZD 3DOAA 3C58A 1YKOB 3UJNA 4AKGA 2DZNB 2QBYB 3FUVA 3HGIA 3SYKA 5E6JA 1MX0A 2FNAA 3PCJM 3PCMA 2Z4SA 1NHWC 4L8RC 1KSFX 2OQ4A 3A46A 3VLFB 5IT9S 4DR7M 4M9ZA 1DLTA 1OFIA 4JI7M 2CEAA 4FCWA 2XF3A 4WHSA 4JV5M 5BR8M 2DWLA 5C1BA 2C99A 4NRVA 5FTLA 3AOEA 3FUUA 5JI2E 4G4RA 4LRSA 1J5EM 1EOAB 3PCFM 2Y21A 2HCBA 3HJQA 4GC9A 3R9XB 5ITQA 3ILKA 4IBGA 4RF1A 4B08A 3I4VA 3PCJA 1HNZM 1EO9A 3UMMA 4JI5M 3UZUA 3A42A 3J80S 2XSRA 4PDGA 3KP1E 5KPZA 3PXGA 5GKNA 3VKHA 4WHOA 3SBJA 3ZC7B 3EIEA 3HHXA 3AKZA 3FYCA 4LCBA 3T63A 4LJ8A 4GH9A 4QNRA 3AOGA 1DMHA 4AKHA 1OFHA 3GLFB 2DWMA 1YKOA 1NY5A 1HR0M 2QBYA 3MJ5A 4DUZM 5A2QS 4LJ9A 3PCFA 2RGHA 4MGHA 4GITA 2BUTB 3RGSA 4AG5A 2UUBM 2H1RA 2G5GX 4IBDA 3DA1A 4IBEA 1IXRC 4DUYM 5IWAM 3PCNM 3HHWA 3TQSA 3O6JA 4LZJA 3L25A 4L4UA 3JR5A 2BUUB 1QQWA 3CF2A 2VQEM 1YSYA 4DV6M 2KZSA 4X65M 2CHGA 4LF5M 3TE6A 1R7RA 2Z3XA 1N36M 1GKIA 3KOZE 1YKNA 1G41A 4LJ6A 3U6LA 1FJGM 1PJIA 3SFZA 3U6PA 3MFLM 3VK7A 2RKOA 5IZ7D 4WHRB 1G3IA 2C98A 4IBFA 1SXJA 3KS4A 4M9XA 2D7EA 1DLMA 5IREB 4L15A 2DWNA 1K3XA 4NRWA 2L09A 3QWLA 1IM2A 3UGJA 2M5ZA 1EE8A 4M9SA 2UUCM 2XGNA 4OW0A 4QHTA 5EQTA 4B7GA 3VKGA 3MI1M 2C5RA 4GMQA 4I81A 1YKMB 1IN8A 2KW0A 3FUTA 1EOCB 3KDSE 1NHGC 1NNJA 2DXIA 3IG8A 3Q8XA 4IBCA 3GLFA 2ERCA 1QZMA 1KYIA 4IIWA 3TPZA 4X62M 3PCBA 2PCDA 4MGZE 4G4QA 1QANA 3KOYE 3THGA 4Z6YA 4DV5M 1XWIA 4MGYE 2UXDM 3SHFA 1IY1A 2BUUA 4MGIE 2BNKA 3H4MA 4M0DA 3SC3A 4II7A 1XC8A 1R6BX 1XXHB 3E4RA 3M6AA 4CGYB 4DR5M 2F5PA 3MI1A 4OVZB 4GHLA 1G59A 3AJIB 1DGGA 3KSXA 3GLGB 4PDIA 2QZ4A 1JR3D 5EP4A 2L7IA 1LV7A 1R2YA 3K2LA 2BUXB 1J7KA 3HU2A 2X4AA 2KZUA 1ORYB 1N75A 1W5SA 4GRIA 2R65A 2C9OA 3ZCBB 3SAUA 3FTFA 2BUMB 2A5YB 3MI5M 4DR6M 1TGUA 4AZFA 3J7BA 3AOEC 3PFIA 4AI6A 1XNRM 4LF9M 2CV0A 1YKMA 1Q39A 3KOWE 1QYRA 4DR3M 1Q3CA 3T38A 3FTCA 1N34M 3GPPA 4IBBA 3KFUG 4CISA 3LVVA 3K92A 3EIHA 3U6EA 1EOBB 1Z59A 4LJ5A 3U6DA 4W5WA 3E9SA 4K0KM 3BOSA 3HWSA 2BUYB 4ILTA 2BUZB 4LRTA 5KO3A 5ITXE 3SAVA 1PJJA 4WHRF 3HHZA 4G6ZA 3RE8A 1XXHA 5DYIA 2AZQA 1W5TA 3MI5A 3I4YA 1YKLB 4ZPXA 3A98B 4OVZA 1FNNA 3LXVM 5EXSA 3T63M 2XH9A 3U5ZB 3GLIB 2ZAOA 3GLGA 3MV4A 1L8QA 4DV7M 4ILVA 4NOOB 2R46A 1HNWM 2BJVA 2BUQA 2CUZA 4WHPB 1Z6TA 3J81S 1Q3BA 3FTDA 3U60B 2BUVB 3PCCM 1S3SA 1E9SA 3KW6A 3O32A 3SHGB 3TWKA 4ITQA 4NSRA 2F5QA 5FTJA 5C18A 3LMXM 2EO2A 3TH1A 3PCKM 3J27B 4BLCA 1G8PA 2YNMD 2DVWB 1J09A 3GRRA 5KQ8A 1EO2B 2F4VM 4G4OA 2UUAM 3GLHB 2BUWB 4EIWA 3LXVA 4HLQA 4PD2A 1XHBA 2W82A 4FWGA 3R8FA 3JAMS 1SXJC 1EOBA 1IQPA 2Z4RA 3U6SA 4LF7M 1GL6A 1Z5BA 2DWZB 5FTMA 4X66M 1NVMA 3NBIA 2BUZA 4LF4M 4GC5A 3PCCA 3VFDA 2I7PA 5JI3E 2KRKA 3PCGM 4TUWA 4LY6A 5ITXA 2HHHM 3LMXA 3KXEC 2VIIA 3LQQA 3PCKA 1L1TA 2QENA 1IXSB 3L2AA 2KXEA 1K82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSV A;  3PCB A;  2PCD A;  3PCA M;  1EOA A;  4WHP A;  3PCB M;  1YKN B;  2PCD M;  4WHO B;  2BUU A;  4WHQ A;  2BUR A;  3T67 A;  3PCL M;  3PCD M;  3PCH M;  3I51 A;  2BUY A;  3PCG A;  3T67 M;  3MI1 A;  1YKO B;  1YKK A;  3HGI A;  4WHS D;  3PCJ M;  1EO2 A;  1S9A A;  3PCM A;  2BV0 B;  2BUW A;  2BUX B;  1YKL A;  1DLT A;  3LKT M;  3PCA A;  5TD3 A;  2BUT A;  4WHS A;  2BUM B;  3MI5 M;  3PCL A;  3PCD A;  3PCH A;  1EOA B;  1YKM A;  2BUV A;  3PCF M;  3HHY A;  3HJQ A;  4WHO D;  4WHQ B;  3I4V A;  3PCJ A;  3O6R A;  1DLQ A;  1EOB B;  1EO9 A;  1YKP B;  2BUY B;  4ILT A;  2XSR A;  2BUZ B;  3LKT A;  4WHR A;  4WHR F;  4WHO A;  3HHX A;  2AZQ A;  3T63 A;  3MI5 A;  3I4Y A;  1DMH A;  1YKL B;  1YKO A;  3T63 M;  3LXV M;  3PCF A;  3PCE M;  3MV4 A;  2XSU A;  3PCN A;  4ILV A;  2BUT B;  2BV0 A;  1EOC A;  3MV4 M;  2BUQ A;  3PCN M;  4WHP B;  3O6J A;  2BUU B;  3MV6 M;  2BUR B;  2BUV B;  3PCC M;  3O32 A;  3N9T A;  3PCI M;  3LMX M;  3HJ8 A;  3TH1 A;  2BOY A;  1YKK B;  3PCK M;  3MFL A;  1YKN A;  1EO9 B;  1TMX A;  1EO2 B;  3MFL M;  2BUW B;  3LXV A;  4WHR B;  3PCE A;  3HJS A;  1DLM A;  1EOB A;  1YKP A;  3O5U A;  4WHS B;  2BUZ A;  3MV6 A;  3PCC A;  2BUX A;  3PCG M;  3MI1 M;  1YKM B;  3PCI A;  3LMX A;  1EOC B;  2BUQ B;  3HKP A;  3PCK A;  4WHP D;  3PCM M;  2BUM A; 
#chains in the Genus database with same CATH topology
 4B3R M;  4LZZ A;  1R4G A;  3B74 A;  2KNZ A;  3J7A S;  4LJ4 A;  2F5S A;  1EOA A;  3PCA M;  4JXJ A;  2JA2 A;  1MU5 A;  1TH3 A;  4REZ A;  2ZAN A;  3PCB M;  2PCD M;  4WHP A;  5FTK A;  2J7N A;  1YUB A;  2FE8 A;  2X8A A;  2JY5 A;  3U60 A;  4KO8 A;  2EUC A;  2YR0 A;  3BXW A;  3CGW A;  4JI8 M;  3PCL M;  3T67 A;  2QP9 X;  4AW4 A;  1NV8 A;  1IXZ A;  1OTR A;  3TWL A;  1OAI A;  1PJT A;  1WJ7 A;  2DZL A;  3I51 A;  3U6O A;  4F2L A;  1XMQ M;  3PCG A;  4ANR A;  5ITU A;  2V1C A;  4YY3 M;  2CRU A;  2BWB A;  4LGY A;  4LJA A;  4JI2 M;  2R45 A;  1V33 A;  4JYA M;  4WHS D;  1EO2 A;  3WHK A;  2BV0 B;  1WXQ A;  2BUW A;  1GLN A;  4DBG B;  1V92 A;  4FW9 A;  1D2N A;  3LVW A;  1YLA A;  2XSZ A;  4GKK M;  2Q2E B;  4FWH A;  1ZMW A;  1VEJ A;  3FUX A;  3LMM A;  4HL4 A;  1MJG M;  4LFC M;  3LKT M;  4B7H A;  1Z5A A;  3PCA A;  3D8B A;  1OKS A;  5EXP A;  3FRH A;  4DV1 M;  4QOS A;  2BUT A;  2R62 A;  4B3T M;  2YFQ A;  4D82 A;  3MK6 A;  4IBI A;  4KOD A;  3PCH M;  1QAO A;  2NQ8 C;  1IFY A;  3GQ4 A;  2JY8 A;  4B7F A;  3PCL A;  2R4E A;  3QYE A;  4DR4 M;  3PCH A;  3GRV A;  3M0E A;  5EJC A;  1XNQ M;  1R2Z A;  2OOB A;  3MMP A;  2XEP A;  2MGW A;  1IXS A;  4WHO D;  1N32 M;  4WHQ B;  3FTE A;  1XB2 B;  4G4N A;  4JI4 M;  3SYL A;  1DLQ A;  2C9C A;  4L16 A;  1Z5C A;  5FTN A;  1YKP B;  4AKI A;  4NXN M;  3FKE A;  4R3D A;  5LMU M;  4B3M M;  3LKT A;  1HQY E;  4WHR A;  4LFA M;  4XK8 F;  2Z8Y M;  1IBM M;  4LFB M;  2QHO B;  2ZAM A;  3GO8 A;  3L27 A;  2HKJ A;  2LVP C;  2P5T A;  2OPF A;  5KPT A;  4NXM M;  2LXE A;  1PJQ A;  3GRU A;  3MHV C;  2CE7 A;  2XLJ A;  4JI1 M;  3GRY A;  4I5S A;  1TH4 A;  1HQC A;  2Y20 A;  4QHS A;  4XGI A;  5EP3 A;  4JI6 M;  4CJ6 A;  3NWL A;  2KA6 B;  2LNH C;  3AFH A;  3IG5 A;  3ZH9 B;  2BV0 A;  2FOI C;  3T6P A;  3HY5 A;  2CV2 A;  1EOC A;  3MV4 M;  4CIZ A;  3B89 A;  5KQD A;  1HT2 E;  2DI0 A;  3B9P A;  4S12 A;  4RF0 A;  5DNY A;  4DR1 M;  2DZO B;  2BUR B;  3MV6 M;  4I8O A;  3LCV B;  3L29 A;  2JWS A;  3PNV A;  1PM5 A;  2WSF F;  2H5X A;  4BB9 A;  3FYD A;  3LQR A;  3HJ8 A;  1SXJ D;  5EP1 A;  1E9R A;  2BOY A;  2KRU A;  4NL4 H;  1YKK B;  3GQ5 A;  2O5R A;  5DYG A;  1EO9 B;  1NJF A;  2LVN C;  2O25 A;  4D81 A;  1TMX A;  1VDL A;  5FSW A;  3V76 A;  1AIP C;  3U6C A;  3GP1 A;  1G71 A;  5H37 D;  3SMP A;  4WP2 A;  2C96 A;  1NSF A;  2DEN A;  3F92 A;  3K1J A;  2J7O A;  3HJS A;  4IBJ A;  5L8R F;  1OJL A;  1YKP A;  4FCV A;  1IY2 A;  3W67 A;  3L26 A;  3TWM A;  2L4F A;  3MV6 A;  4WUR A;  4MB7 A;  1I94 M;  4GKJ M;  2BUX A;  3GQ3 A;  3A45 A;  1HNX M;  3KOX E;  2CFO A;  3CF0 A;  3C3D A;  8CAT A;  3AL0 C;  3HKP A;  4P16 A;  1YE9 A;  3SAR A;  2DHY A;  3SMS A;  1JQJ C;  3J2P B;  1NNU C;  3KSJ A;  2BUM A;  2KNA A;  2KNV A;  4LGM A;  1DO2 A;  2CHQ A;  3U6M A;  4I4L A;  2XSV A;  1TTE A;  2DHR A;  4KLN A;  3PVS A;  1G4A E;  3CTW B;  4PT5 A;  3W0L B;  2JY6 B;  2DKL A;  2K0B X;  3SAT A;  3SAS A;  2UXB M;  2UXC M;  2G8L A;  1YKN B;  1JB0 F;  1ZQ9 A;  2L7H A;  2BUR A;  1QAQ A;  4DR2 M;  2HAK A;  3WHL A;  1SXJ E;  1F4I A;  4GIP A;  3T15 A;  3U6Q A;  1IN6 A;  3SAW A;  3PCD M;  2O01 F;  2M60 A;  4DV2 M;  4DV3 M;  2BUY A;  3IHP A;  3RFW A;  1L1Z A;  4QOZ C;  3T67 M;  1SXJ B;  1YKK A;  5LMN M;  2N35 A;  5EXX A;  2LWX A;  1DGH B;  3OTO M;  1D0L A;  3U61 B;  1S9A A;  4LF8 M;  4BBA A;  1GJS A;  1E32 A;  1NY6 A;  1YKL A;  2FS1 A;  3GPU A;  1TF0 B;  1UFZ A;  2MJ5 B;  4RNA A;  5KPR A;  5BPV A;  5FLX S;  5TD3 A;  5EXT A;  3U5Z A;  4FCT A;  4OU7 A;  3GLI A;  1VQ1 A;  1IBK M;  1IY0 A;  4JN6 A;  5ITT A;  2XFT A;  2D7G A;  1V34 A;  1JR3 A;  3DFZ A;  4NSO B;  1L2D A;  3LCU A;  2V6Z M;  4MM3 B;  2RGO A;  3FUW A;  1GVN A;  4A3V B;  4DV4 M;  3PCD A;  2KEB A;  4KHP M;  2XZF A;  2BUV A;  2FFJ A;  3HHY A;  1E94 E;  3HU1 A;  4IBK A;  4PCZ A;  3BBZ A;  1K3W A;  1T3T A;  4YHH M;  3D8L A;  1WIV A;  3FRI A;  2QSF X;  3KVW A;  2BJW A;  5ITY A;  3O6R A;  1T6O A;  1X37 A;  3W0F A;  4OX9 M;  2APL A;  3QAU A;  1TDZ A;  1LTM A;  4MH0 E;  4KT0 F;  2F5N A;  4FVM A;  4M0W A;  4LG2 A;  1HJP A;  2WSE F;  3GLH A;  1CUK A;  4FWD A;  1N77 A;  3T1H M;  7CAT A;  3PNY A;  3CF6 E;  2UU9 M;  1IN5 A;  4XBO A;  4IJF A;  3K9P A;  2LHG A;  1OIP A;  1H6U A;  1VEK A;  2AHM A;  1IN7 A;  2GNO A;  2Y0T A;  2F5O A;  4R7G A;  1DGH A;  5EP2 A;  4GHA A;  2XSU A;  4X64 M;  3PCE M;  3PCN A;  3U61 A;  4LJ7 A;  2QPA A;  4JI0 M;  2XFS A;  1DGB A;  3DZD A;  4P17 A;  2EA0 A;  2ZM6 M;  3K8Z A;  1KFV A;  3KS8 A;  2LH0 A;  1L2C A;  2ZTC A;  4AQY M;  4JI3 M;  3L28 A;  4UN2 B;  1DO0 A;  1N78 A;  2VQF M;  5F3W A;  3VK8 A;  4LF6 M;  1IBL M;  3N9T A;  2WSC F;  2R4J A;  3PCI M;  2KHH A;  4MGK E;  3UK6 A;  1TDH A;  3MFL A;  1C1K A;  2K47 A;  2JZ0 A;  2XZU A;  3GPY A;  4B3S M;  1XMO M;  2Z7J A;  1XXH E;  2X49 A;  2YQZ A;  2E5L M;  4L78 A;  4D80 A;  3PCE A;  2DAK A;  1QDT A;  1HT1 E;  2DAG A;  1BVS A;  2CV1 A;  2DAE A;  2I7N A;  3O5U A;  3VDP A;  1QDR A;  2MRO B;  2OO9 A;  2HL7 A;  4WHS B;  2JUJ A;  5E26 A;  1DV0 A;  4DV0 M;  2V1U A;  1WGL A;  4AG6 A;  1Q02 A;  2QCU A;  1QAM A;  1GL7 A;  4QNM A;  1IN4 A;  3PCI A;  2ZBK B;  2CHV A;  2VF7 A;  1N33 M;  2BUQ B;  4WHP D;  3GPX A;  3HU3 A;  3PCM M;  2LVQ D;  3AV0 A;  2L6O A;  3H4J A;  1TH2 A;  2J5Y A;  3VDU A;  3C9P A;  3E21 A;  3JR4 A;  1QVR A;  1NJG A;  2Y0Q A;  4FD2 A;  3TL4 X;  4CHT B;  1SG9 A;  1UM8 A;  3FD9 A;  3RGP A;  1I4W A;  1ZAE A;  4L6V 6;  4IJE A;  4GEW A;  5ITR A;  2R18 A;  3T1Y M;  2D7H A;  1DGF A;  3I01 M;  4WHO B;  1L2B A;  3M7G A;  4WHQ A;  1ZMV A;  2EKK A;  1QUS A;  1VDD A;  1P3Q Q;  4WW0 A;  3KP0 E;  4Z8X A;  2XSZ D;  3DOA A;  4R71 A;  3C58 A;  1YKO B;  3UJN A;  2WZJ A;  4AKG A;  2DZN B;  2QBY B;  3FUV A;  3HGI A;  1WR1 B;  3SYK A;  5E6J A;  1D0K A;  1MX0 A;  2FNA A;  3PCJ M;  3PCM A;  1VEG A;  2CP8 A;  2Z4S A;  1NHW C;  1GJT A;  4L8R C;  1KSF X;  2GQF A;  3HZJ A;  2OQ4 A;  3A46 A;  3VLF B;  5IT9 S;  4DR7 M;  4M9Z A;  1DLT A;  1OFI A;  1A5T A;  4JI7 M;  2CEA A;  4FCW A;  2XF3 A;  4WHS A;  4JV5 M;  5BR8 M;  2DWL A;  5C1B A;  2C99 A;  4NRV A;  5FTL A;  3AOE A;  3FUU A;  5JI2 E;  4G4R A;  4LRS A;  1J5E M;  1EOA B;  1ZMU A;  3PCF M;  2Y21 A;  2HCB A;  3HJQ A;  4GC9 A;  3R9X B;  5ITQ A;  3ILK A;  4IBG A;  4RF1 A;  4B08 A;  3I4V A;  3PCJ A;  2R44 A;  1HNZ M;  1EO9 A;  3UMM A;  4JI5 M;  1EIJ A;  3UZU A;  4F1I A;  3A42 A;  3J80 S;  2XSR A;  4PDG A;  3KP1 E;  1PGY A;  3PXG A;  5KPZ A;  5GKN A;  1OQY A;  3VKH A;  4Q7J A;  4WHO A;  3SBJ A;  3GLF E;  3ZC7 B;  3EIE A;  3HHX A;  3AKZ A;  3FYC A;  4LCB A;  3T63 A;  4LJ8 A;  1R5L A;  2B3T A;  4GH9 A;  3AOG A;  4QNR A;  1DMH A;  4AKH A;  1OFH A;  3GLF B;  2DWM A;  1YKO A;  1NY5 A;  1QUT A;  1HR0 M;  2QBY A;  3MJ5 A;  4DUZ M;  5A2Q S;  4LJ9 A;  3PCF A;  3HX3 A;  2RGH A;  4MGH A;  4GIT A;  2JXN A;  3RGS A;  4AG5 A;  2BUT B;  2UUB M;  2H1R A;  2G5G X;  4IBD A;  3DA1 A;  4IBE A;  1IXR C;  4DUY M;  5IWA M;  3PCN M;  3HHW A;  2DAI A;  3TQS A;  3O6J A;  4LZJ A;  3L25 A;  4L4U A;  3JR5 A;  2BUU B;  1QQW A;  3CF2 A;  2VQE M;  1YSY A;  4DV6 M;  2KZS A;  4X65 M;  2CHG A;  1PRB A;  4LF5 M;  3TE6 A;  1R7R A;  2Z3X A;  1N36 M;  1GKI A;  3KOZ E;  1YKN A;  1G41 A;  2MH8 A;  4LJ6 A;  3U6L A;  2K6B A;  1FJG M;  1PJI A;  1D0M A;  3SFZ A;  3U6P A;  3VK7 A;  3MFL M;  2RKO A;  5IZ7 D;  1WGN A;  4WHR B;  1G3I A;  2C98 A;  4IBF A;  1SXJ A;  3KS4 A;  4M9X A;  2D7E A;  1DLM A;  2ZTD A;  5IRE B;  4L15 A;  2QNJ A;  2DWN A;  1K3X A;  4NRW A;  2L09 A;  3QWL A;  2CWB A;  1IM2 A;  3UGJ A;  2M5Z A;  1EE8 A;  4M9S A;  2UUC M;  2XGN A;  4OW0 A;  4QHT A;  5EQT A;  4B7G A;  2LTU A;  3VKG A;  2C5R A;  3MI1 M;  4GMQ A;  4I81 A;  1YKM B;  1IN8 A;  1RU3 A;  2JNH A;  2KW0 A;  2OOA A;  3FUT A;  1NHG C;  3KDS E;  1NNJ A;  2MR9 A;  2DXI A;  1EOC B;  3IG8 A;  3Q8X A;  4IBC A;  3LW5 F;  3GLF A;  3W68 A;  2ERC A;  2LVA A;  1QZM A;  1KYI A;  2LHC A;  4IIW A;  3TPZ A;  4X62 M;  1MN3 A;  3PCB A;  2PCD A;  4MGZ E;  4G4Q A;  1QAN A;  3KOY E;  4Y28 F;  3B7N A;  3K9O A;  4NC6 A;  3THG A;  4Z6Y A;  4DV5 M;  1XWI A;  3E46 A;  4MGY E;  2UXD M;  3SHF A;  1IY1 A;  3NBX X;  4MGI E;  2BNK A;  2VF8 A;  3H4M A;  2BUU A;  2VDB B;  4M0D A;  4II7 A;  2L4E A;  1R6B X;  1XXH B;  3SC3 A;  2LBC A;  5DFL A;  1XC8 A;  3E4R A;  3GLG E;  1PJS A;  3M6A A;  4CGY B;  4DR5 M;  2EJS A;  2KDL A;  1QZE A;  2F5P A;  4OVZ B;  3MI1 A;  4GHL A;  1OAO C;  1G59 A;  3AJI B;  1DGG A;  3KSX A;  3GLG B;  4PDI A;  3ZQJ A;  2QZ4 A;  4HEO A;  1JR3 D;  5EP4 A;  2L7I A;  1LV7 A;  2DAM A;  1R2Y A;  3K2L A;  2BUX B;  1J7K A;  3HU2 A;  2X4A A;  2KZU A;  3Q8G A;  1ORY B;  1N75 A;  1W5S A;  2JP7 A;  4GRI A;  2R65 A;  2C9O A;  2QQ8 A;  3ZCB B;  3SAU A;  3FTF A;  2EKF A;  1C7Y A;  2BUM B;  2FH0 A;  2A5Y B;  3MI5 M;  4DR6 M;  1TGU A;  4AZF A;  3J7B A;  3AOE C;  3PFI A;  4AI6 A;  1XNR M;  4LF9 M;  2CV0 A;  1YKM A;  1Q39 A;  3KOW E;  3B7Z A;  3FE3 A;  1QYR A;  4DR3 M;  1AUA A;  1Q3C A;  3T38 A;  3FTC A;  2JY7 A;  1N34 M;  3GPP A;  4IBB A;  3KFU G;  4CIS A;  3LVV A;  3K92 A;  3EIH A;  3U6E A;  1EOB B;  1Z59 A;  4LJ5 A;  3U6D A;  4W5W A;  3E9S A;  4K0K M;  1VG5 A;  2K9D A;  3BOS A;  3HWS A;  2BUY B;  4ILT A;  2BUZ B;  4LRT A;  5KO3 A;  5ITX E;  4G3O A;  3SAV A;  1PJJ A;  1NO1 A;  4WHR F;  3HHZ A;  4G6Z A;  3RE8 A;  1XXH A;  3QYB A;  5DYI A;  2AZQ A;  1W5T A;  3GLI E;  3MI5 A;  3I4Y A;  2LVO C;  1YKL B;  2JZ1 A;  1T43 A;  4ZPX A;  1JR3 E;  3A98 B;  4OVZ A;  1FNN A;  3LXV M;  5EXS A;  3T63 M;  2XH9 A;  3U5Z B;  3GLI B;  2BWE A;  2ZAO A;  3GLG A;  3MV4 A;  1L8Q A;  3C3E A;  4DV7 M;  4ILV A;  1NV9 A;  4NOO B;  2R46 A;  1HNW M;  2BJV A;  3B7Q A;  2BUQ A;  2CUZ A;  4WHP B;  1Z6T A;  3J81 S;  1Q3B A;  3FTD A;  3U60 B;  2BUV B;  3PCC M;  1TR8 A;  1S3S A;  1E9S A;  3KW6 A;  3O32 A;  3SHG B;  3TWK A;  4ITQ A;  3IEC A;  4NSR A;  2F5Q A;  5FTJ A;  5C18 A;  3LMX M;  2EO2 A;  3TH1 A;  3GLH E;  3J27 B;  3PCK M;  1OIZ A;  4BLC A;  1WHC A;  1EFU B;  1G8P A;  2YNM D;  2DVW B;  1J09 A;  3GRR A;  5KQ8 A;  1EO2 B;  2F4V M;  4G4O A;  2UUA M;  3GLH B;  2BUW B;  4EIW A;  3LXV A;  4HLQ A;  4PD2 A;  1XHB A;  2G3Q A;  2DNA A;  2W82 A;  4FWG A;  1GAB A;  2HWJ A;  3R8F A;  2RRU A;  3JAM S;  1SXJ C;  1EOB A;  1IQP A;  2R6F A;  2Z4R A;  3U6S A;  4LF7 M;  4RKU F;  1GL6 A;  1Y8G A;  1Z5B A;  1ZV1 A;  2DWZ B;  1NVM A;  3NBI A;  5FTM A;  4X66 M;  4LF4 M;  4GC5 A;  2BUZ A;  3VFD A;  2I7P A;  5JI3 E;  3PCC A;  2KRK A;  3PCG M;  4TUW A;  4LY6 A;  5ITX A;  3I04 M;  2L2D A;  2HHH M;  3LMX A;  2R0I A;  2VII A;  3KXE C;  3LQQ A;  3PCK A;  1L1T A;  2QEN A;  1IXS B;  1GO5 A;  3L2A A;  2KXE A;  1K82 A; 
#chains in the Genus database with same CATH homology
 4B3R M;  4LZZ A;  3J7A S;  4LJ4 A;  2F5S A;  1EOA A;  3PCA M;  4JXJ A;  2JA2 A;  1MU5 A;  1TH3 A;  4REZ A;  2ZAN A;  3PCB M;  2PCD M;  4WHP A;  5FTK A;  2J7N A;  1YUB A;  2FE8 A;  2X8A A;  3U60 A;  4KO8 A;  2EUC A;  2YR0 A;  4JI8 M;  3T67 A;  3PCL M;  2QP9 X;  4AW4 A;  3PCH M;  1IXZ A;  3TWL A;  3I51 A;  3PCG A;  3U6O A;  1XMQ M;  5ITU A;  2V1C A;  4YY3 M;  4LGY A;  4LJA A;  4JI2 M;  2R45 A;  4JYA M;  4WHS D;  1EO2 A;  3WHK A;  2BV0 B;  1WXQ A;  2BUW A;  1GLN A;  4FW9 A;  1D2N A;  3LVW A;  2XSZ A;  4GKK M;  2Q2E B;  4FWH A;  3FUX A;  3LMM A;  4HL4 A;  4LFC M;  3LKT M;  3PCA A;  4B7H A;  1Z5A A;  3D8B A;  5EXP A;  4DV1 M;  4QOS A;  2BUT A;  2R62 A;  4B3T M;  2YFQ A;  4D82 A;  3MK6 A;  4IBI A;  4KOD A;  1QAO A;  2NQ8 C;  3GQ4 A;  4B7F A;  3PCL A;  2R4E A;  4DR4 M;  3PCH A;  3GRV A;  3M0E A;  5EJC A;  1XNQ M;  1R2Z A;  2XEP A;  4WHO D;  1N32 M;  4WHQ B;  3FTE A;  4G4N A;  4JI4 M;  3SYL A;  1DLQ A;  2C9C A;  4L16 A;  1Z5C A;  5FTN A;  1YKP B;  4AKI A;  4NXN M;  3FKE A;  4R3D A;  5LMU M;  4B3M M;  3LKT A;  1HQY E;  4WHR A;  4LFA M;  1IBM M;  4LFB M;  2ZAM A;  3GO8 A;  3L27 A;  2HKJ A;  2P5T A;  2OPF A;  5KPT A;  4NXM M;  2LXE A;  3GRU A;  3MHV C;  2XLJ A;  2CE7 A;  4JI1 M;  3GRY A;  4I5S A;  1TH4 A;  1HQC A;  2Y20 A;  4QHS A;  4XGI A;  5EP3 A;  4JI6 M;  3NWL A;  2KA6 B;  2LNH C;  3AFH A;  3IG5 A;  3ZH9 B;  2BV0 A;  2FOI C;  2CV2 A;  1EOC A;  3MV4 M;  5KQD A;  1HT2 E;  3B9P A;  4S12 A;  4RF0 A;  5DNY A;  4DR1 M;  2DZO B;  2BUR B;  3MV6 M;  4I8O A;  3L29 A;  3PNV A;  1PM5 A;  4BB9 A;  3FYD A;  3LQR A;  3HJ8 A;  1SXJ D;  5EP1 A;  1E9R A;  2BOY A;  2KRU A;  4NL4 H;  1YKK B;  3GQ5 A;  2O5R A;  5DYG A;  1EO9 B;  1NJF A;  1TMX A;  4D81 A;  5FSW A;  3U6C A;  3GP1 A;  5H37 D;  3SMP A;  2C96 A;  1NSF A;  3K1J A;  4IBJ A;  2J7O A;  3HJS A;  1OJL A;  1YKP A;  4FCV A;  1IY2 A;  3L26 A;  3TWM A;  3MV6 A;  4WUR A;  4MB7 A;  1I94 M;  4GKJ M;  2BUX A;  3GQ3 A;  3A45 A;  1HNX M;  3KOX E;  2CFO A;  3CF0 A;  8CAT A;  3AL0 C;  3HKP A;  4P16 A;  1YE9 A;  3SAR A;  3SMS A;  1JQJ C;  3J2P B;  3KSJ A;  1NNU C;  2BUM A;  4LGM A;  3U6M A;  1DO2 A;  2CHQ A;  2XSV A;  4I4L A;  2DHR A;  4KLN A;  3PVS A;  1G4A E;  3CTW B;  4PT5 A;  3W0L B;  2UXB M;  3SAS A;  3SAT A;  2UXC M;  2G8L A;  1YKN B;  1ZQ9 A;  2L7H A;  2BUR A;  1QAQ A;  4DR2 M;  3WHL A;  1SXJ E;  4GIP A;  3T15 A;  3U6Q A;  1IN6 A;  3SAW A;  3PCD M;  2M60 A;  4DV2 M;  4DV3 M;  2BUY A;  3RFW A;  4QOZ C;  1L1Z A;  3T67 M;  1SXJ B;  1YKK A;  5LMN M;  5EXX A;  2LWX A;  1DGH B;  3OTO M;  3U61 B;  1S9A A;  4LF8 M;  4BBA A;  1YKL A;  1NY6 A;  1E32 A;  3GPU A;  4RNA A;  5KPR A;  5BPV A;  5FLX S;  5TD3 A;  5EXT A;  3U5Z A;  4FCT A;  4OU7 A;  3GLI A;  1IBK M;  1IY0 A;  4JN6 A;  5ITT A;  2XFT A;  2D7G A;  3DFZ A;  1JR3 A;  4NSO B;  1L2D A;  2V6Z M;  4MM3 B;  2RGO A;  3FUW A;  1GVN A;  4A3V B;  4DV4 M;  3PCD A;  2KEB A;  4KHP M;  2XZF A;  2BUV A;  2FFJ A;  3HHY A;  1E94 E;  3HU1 A;  4IBK A;  4PCZ A;  1K3W A;  1T3T A;  4YHH M;  3D8L A;  3KVW A;  5ITY A;  2BJW A;  3O6R A;  1X37 A;  3W0F A;  4OX9 M;  1TDZ A;  3QAU A;  2F5N A;  4MH0 E;  4FVM A;  4M0W A;  4LG2 A;  3GLH A;  4FWD A;  1N77 A;  3T1H M;  7CAT A;  3PNY A;  3CF6 E;  2UU9 M;  1IN5 A;  4XBO A;  4IJF A;  1H6U A;  2AHM A;  1IN7 A;  2Y0T A;  2F5O A;  4R7G A;  1DGH A;  5EP2 A;  4GHA A;  2XSU A;  4X64 M;  3PCE M;  3PCN A;  3U61 A;  4LJ7 A;  2QPA A;  4JI0 M;  2XFS A;  1DGB A;  3DZD A;  2EA0 A;  2ZM6 M;  3K8Z A;  1KFV A;  3KS8 A;  2LH0 A;  1L2C A;  4AQY M;  4JI3 M;  3L28 A;  1N78 A;  1DO0 A;  2VQF M;  5F3W A;  3VK8 A;  4LF6 M;  1IBL M;  3N9T A;  2R4J A;  3PCI M;  4MGK E;  3UK6 A;  1TDH A;  3MFL A;  1C1K A;  2K47 A;  2XZU A;  3GPY A;  4B3S M;  1XMO M;  2Z7J A;  2X49 A;  2YQZ A;  2E5L M;  4L78 A;  4D80 A;  3PCE A;  2CV1 A;  1HT1 E;  2I7N A;  3O5U A;  3VDP A;  4WHS B;  2HL7 A;  5E26 A;  4DV0 M;  2V1U A;  4AG6 A;  2QCU A;  1QAM A;  1GL7 A;  4QNM A;  1IN4 A;  3PCI A;  2ZBK B;  2CHV A;  1N33 M;  2BUQ B;  4WHP D;  3GPX A;  3HU3 A;  3PCM M;  3AV0 A;  2L6O A;  1TH2 A;  3VDU A;  3JR4 A;  1QVR A;  1NJG A;  2Y0Q A;  4FD2 A;  3TL4 X;  4CHT B;  1UM8 A;  3FD9 A;  3RGP A;  1I4W A;  1ZAE A;  5ITR A;  4IJE A;  3T1Y M;  2R18 A;  2D7H A;  1DGF A;  4WHO B;  1L2B A;  3M7G A;  4WHQ A;  1VDD A;  4WW0 A;  3KP0 E;  4Z8X A;  2XSZ D;  3DOA A;  3C58 A;  1YKO B;  3UJN A;  4AKG A;  2DZN B;  2QBY B;  3FUV A;  3HGI A;  3SYK A;  5E6J A;  1MX0 A;  2FNA A;  3PCJ M;  3PCM A;  2Z4S A;  1NHW C;  4L8R C;  1KSF X;  2OQ4 A;  3A46 A;  3VLF B;  5IT9 S;  4DR7 M;  4M9Z A;  1DLT A;  1OFI A;  4JI7 M;  2CEA A;  4FCW A;  2XF3 A;  4WHS A;  4JV5 M;  5BR8 M;  2DWL A;  5C1B A;  2C99 A;  4NRV A;  5FTL A;  3AOE A;  3FUU A;  5JI2 E;  4G4R A;  4LRS A;  1J5E M;  1EOA B;  3PCF M;  2Y21 A;  2HCB A;  3HJQ A;  4GC9 A;  3R9X B;  5ITQ A;  3ILK A;  4IBG A;  4RF1 A;  4B08 A;  3I4V A;  3PCJ A;  1HNZ M;  1EO9 A;  3UMM A;  4JI5 M;  3UZU A;  3A42 A;  3J80 S;  2XSR A;  4PDG A;  3KP1 E;  5KPZ A;  3PXG A;  5GKN A;  3VKH A;  4WHO A;  3SBJ A;  3ZC7 B;  3EIE A;  3HHX A;  3AKZ A;  3FYC A;  4LCB A;  3T63 A;  4LJ8 A;  4GH9 A;  4QNR A;  3AOG A;  1DMH A;  4AKH A;  1OFH A;  3GLF B;  2DWM A;  1YKO A;  1NY5 A;  1HR0 M;  2QBY A;  3MJ5 A;  4DUZ M;  5A2Q S;  4LJ9 A;  3PCF A;  2RGH A;  4MGH A;  4GIT A;  2BUT B;  3RGS A;  4AG5 A;  2UUB M;  2H1R A;  2G5G X;  4IBD A;  3DA1 A;  4IBE A;  1IXR C;  4DUY M;  5IWA M;  3PCN M;  3HHW A;  3TQS A;  3O6J A;  4LZJ A;  3L25 A;  4L4U A;  3JR5 A;  2BUU B;  1QQW A;  3CF2 A;  2VQE M;  1YSY A;  4DV6 M;  2KZS A;  4X65 M;  2CHG A;  4LF5 M;  3TE6 A;  1R7R A;  2Z3X A;  1N36 M;  1GKI A;  3KOZ E;  1YKN A;  1G41 A;  4LJ6 A;  3U6L A;  1FJG M;  1PJI A;  3SFZ A;  3U6P A;  3MFL M;  3VK7 A;  2RKO A;  5IZ7 D;  4WHR B;  1G3I A;  2C98 A;  4IBF A;  1SXJ A;  3KS4 A;  4M9X A;  2D7E A;  1DLM A;  5IRE B;  4L15 A;  2DWN A;  1K3X A;  4NRW A;  2L09 A;  3QWL A;  1IM2 A;  3UGJ A;  2M5Z A;  1EE8 A;  4M9S A;  2UUC M;  2XGN A;  4OW0 A;  4QHT A;  5EQT A;  4B7G A;  3VKG A;  3MI1 M;  2C5R A;  4GMQ A;  4I81 A;  1YKM B;  1IN8 A;  2KW0 A;  3FUT A;  1EOC B;  3KDS E;  1NHG C;  1NNJ A;  2DXI A;  3IG8 A;  3Q8X A;  4IBC A;  3GLF A;  2ERC A;  1QZM A;  1KYI A;  4IIW A;  3TPZ A;  4X62 M;  3PCB A;  2PCD A;  4MGZ E;  4G4Q A;  1QAN A;  3KOY E;  3THG A;  4Z6Y A;  4DV5 M;  1XWI A;  4MGY E;  2UXD M;  3SHF A;  1IY1 A;  2BUU A;  4MGI E;  2BNK A;  3H4M A;  4M0D A;  3SC3 A;  4II7 A;  1XC8 A;  1R6B X;  1XXH B;  3E4R A;  3M6A A;  4CGY B;  4DR5 M;  2F5P A;  3MI1 A;  4OVZ B;  4GHL A;  1G59 A;  3AJI B;  1DGG A;  3KSX A;  3GLG B;  4PDI A;  2QZ4 A;  1JR3 D;  5EP4 A;  2L7I A;  1LV7 A;  1R2Y A;  3K2L A;  2BUX B;  1J7K A;  3HU2 A;  2X4A A;  2KZU A;  1ORY B;  1N75 A;  1W5S A;  4GRI A;  2R65 A;  2C9O A;  3ZCB B;  3SAU A;  3FTF A;  2BUM B;  2A5Y B;  3MI5 M;  4DR6 M;  1TGU A;  4AZF A;  3J7B A;  3AOE C;  3PFI A;  4AI6 A;  1XNR M;  4LF9 M;  2CV0 A;  1YKM A;  1Q39 A;  3KOW E;  1QYR A;  4DR3 M;  1Q3C A;  3T38 A;  3FTC A;  1N34 M;  3GPP A;  4IBB A;  3KFU G;  4CIS A;  3LVV A;  3K92 A;  3EIH A;  3U6E A;  1EOB B;  1Z59 A;  4LJ5 A;  3U6D A;  4W5W A;  3E9S A;  4K0K M;  3BOS A;  3HWS A;  2BUY B;  4ILT A;  2BUZ B;  4LRT A;  5KO3 A;  5ITX E;  3SAV A;  1PJJ A;  4WHR F;  3HHZ A;  4G6Z A;  3RE8 A;  1XXH A;  5DYI A;  2AZQ A;  1W5T A;  3MI5 A;  3I4Y A;  1YKL B;  4ZPX A;  3A98 B;  4OVZ A;  1FNN A;  3LXV M;  5EXS A;  3T63 M;  2XH9 A;  3U5Z B;  3GLI B;  2ZAO A;  3GLG A;  3MV4 A;  1L8Q A;  4DV7 M;  4ILV A;  4NOO B;  2R46 A;  1HNW M;  2BJV A;  2BUQ A;  2CUZ A;  4WHP B;  1Z6T A;  3J81 S;  1Q3B A;  3FTD A;  3U60 B;  2BUV B;  3PCC M;  1S3S A;  1E9S A;  3KW6 A;  3O32 A;  3SHG B;  3TWK A;  4ITQ A;  4NSR A;  2F5Q A;  5FTJ A;  5C18 A;  3LMX M;  2EO2 A;  3TH1 A;  3PCK M;  3J27 B;  4BLC A;  1G8P A;  2YNM D;  2DVW B;  1J09 A;  3GRR A;  5KQ8 A;  1EO2 B;  2F4V M;  4G4O A;  2UUA M;  3GLH B;  2BUW B;  4EIW A;  3LXV A;  4HLQ A;  4PD2 A;  1XHB A;  2W82 A;  4FWG A;  3R8F A;  3JAM S;  1SXJ C;  1EOB A;  1IQP A;  2Z4R A;  3U6S A;  4LF7 M;  1GL6 A;  1Z5B A;  2DWZ B;  5FTM A;  4X66 M;  1NVM A;  3NBI A;  2BUZ A;  4LF4 M;  4GC5 A;  3PCC A;  3VFD A;  2I7P A;  5JI3 E;  2KRK A;  3PCG M;  4TUW A;  4LY6 A;  5ITX A;  2HHH M;  3LMX A;  3KXE C;  2VII A;  3LQQ A;  3PCK A;  1L1T A;  2QEN A;  1IXS B;  3L2A A;  2KXE A;  1K82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...