2L7HA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
b'GSHMSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 20
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7hA00
2L7IA 2Y0TA 2Y21A 4I5SA 2Y0QA 2L7HA 2Y20A
chains in the Genus database with same CATH superfamily
2HAKA 2DI0A 1QYRA 1NVMA 4LRSA 5LMNM 4GMQA 1W5SA 1LV7A 2KW0A 3J27B 1IY0A 2LHCA 4QNRA 1KSFX 1S3SA 3RGSA 2J5YA 2L6OA 2G5GX 2MR9A 3FUTA 3DFZA 5E6JA 3AL0C 4TUWA 4LF5M 1EE8A 2OO9A 3I04M 2LVQD 4AZFA 2Q2EB 1QZEA 4KODA 4DV4M 2QENA 5ITXA 3IECA 3D8LA 1IN7A 1WJ7A 4NC6A 2HHHM 3U61B 1L8QA 3BBZA 3OTOM 4KO8A 2XSZA 4LF8M 3MMPA 5FSWA 1XWIA 1AIPC 1DGBA 4JXJA 2KNAA 3B7NA 3FUUA 4NL4H 3M0EA 4LJAA 1OKSA 4M0WA 3SHFA 4PD2A 1PGYA 5BR8M 4B3TM 4KLNA 4DBGB 4K0KM 4GHAA 2ZAOA 3KDSE 2CP8A 4X64M 3SYLA 4LFCM 3FD9A 2KDLA 4GRIA 1IXRC 2CWBA 3CF2A 3E21A 2OOAA 3FTCA 3U6PA 2LVNC 3L28A 1OJLA 3VFDA 1V34A 3LQQA 2VDBB 1OAIA 3SASA 2E5LM 3R9XB 3TL4X 5KO3A 3U6DA 2FH0A 2R65A 3PNVA 4CISA 1NNUC 1G71A 2F5NA 2F5QA 2UUCM 1DO2A 3HHWA 5IWAM 4DUYM 2Z4RA 4XK8F 1QVRA 2AHMA 2DVWB 2YNMD 4MM3B 1NNJA 1SXJA 1XXHA 2UXCM 4LJ6A 2MROB 4LFAM 1DGFA 1IN8A 2ZAMA 2B3TA 1JB0F 4IBIA 4YHHM 2JY6B 4AKIA 3HU1A 4IBKA 3GLHE 3JAMS 4OU7A 1IBLM 1QQWA 4MB7A 2DZOB 2XFSA 3U5ZB 3J80S 1R2YA 3B9PA 3FUVA 3I01M 2DKLA 4Q7JA 4NSRA 5FLXS 3ZH9B 4G4NA 1Z5AA 1R7RA 1N32M 3U6EA 3UGJA 1HNZM 4AKHA 3K92A 1HR0M 3DA1A 3HHZA 2C9OA 2JY5A 1PJSA 3K2LA 3ZCBB 3GQ3A 1FJGM 3GLIE 3U60A 1HJPA 3GLIB 1CUKA 3LVVA 3C3DA 1I94M 1N78A 1F4IA 2CE7A 3D8BA 5EP3A 1KYIA 2DZNB 1HT1E 3HU2A 2F5OA 1MJGM 3K8ZA 1SXJC 1OIZA 2LTUA 5EQTA 1Z59A 4FW9A 4GEWA 5E26A 2LWXA 2CUZA 3HU3A 5ITTA 2RGOA 2L2DA 4NXNM 1L2BA 1QANA 1DGHA 3B7ZA 3KP1E 3AJIB 1L1TA 1N33M 4RKUF 1N34M 1ZMWA 1IN5A 3FE3A 2HWJA 5IZ7D 3VDPA 3SMSA 4PDGA 4I81A 3HJSA 2D7HA 2L4EA 3I4VA 4DR1M 1PM5A 2ZANA 4JI0M 1L2CA 3J7BA 4B08A 4DR6M 2K9DA 2Z3XA 3T15A 4R3DA 3L27A 4EIWA 3W68A 3QAUA 4UN2B 5EXXA 4B7FA 1V92A 3SATA 2O25A 4G4RA 1MX0A 4BB9A 1VEKA 5C1BA 2VQEM 3SAUA 2LNHC 3LQRA 4D82A 1QAOA 2P5TA 2K47A 5ITUA 1L2DA 1VDDA 3ZQJA 2R44A 4LZZA 1C1KA 1VQ1A 1T43A 3T6PA 3J7AS 4IBGA 4D81A 4MGYE 2QBYB 1NSFA 3GO8A 1ZMVA 3DOAA 2DAKA 3SBJA 4FD2A 3HZJA 2KXEA 1YLAA 2DAIA 4RF0A 1GVNA 3SARA 5ITRA 1QUTA 1PJJA 2CV0A 1TH3A 1Y8GA 1JR3A 3A45A 5GKNA 1EFUB 4RF1A 5KPZA 3FUXA 1T6OA 2C9CA 3GRUA 3FYCA 5H37D 4LJ8A 2XGNA 4IBEA 4DV1M 4DR2M 1NHWC 1XNQM 2VF8A 3CGWA 2JZ1A 3HJ8A 3C3EA 1IY2A 2D7GA 4IJEA 4GC9A 4X66M 2JA2A 1A5TA 1VG5A 4JI6M 1XXHE 4OVZA 2OOBA 4G3OA 3T1YM 1R4GA 3VK7A 1DO0A 1UM8A 2GNOA 2JP7A 1SXJB 1XXHB 3VLFB 4IBJA 2DWNA 2K6BA 2RRUA 3VKGA 4GIPA 1QUSA 2EA0A 1IXZA 2R46A 3KVWA 2LXEA 2QP9X 2GQFA 3TWLA 3KXEC 1WXQA 2KHHA 4GKJM 3FRHA 1TGUA 4AG6A 3I51A 3LMMA 4FCVA 4CIZA 4DUZM 1N36M 1D0KA 2K0BX 5EP2A 3KOXE 4F1IA 2UU9M 2DWZB 3FTDA 5JI2E 1C7YA 1P3QQ 3QYEA 1YUBA 2ZBKB 3FUWA 4DR5M 4DV3M 5ITYA 3A98B 3W67A 4AQYM 3T38A 4QNMA 4QOSA 4JI3M 4LCBA 5FTJA 3U60B 3R8FA 4QOZC 2L7IA 1VDLA 5BPVA 5EXSA 4JI8M 3K9PA 3FTEA 4M9XA 1K82A 4S12A 2I7PA 3TPZA 4NSOB 2R0IA 1K3XA 2YQZA 4CJ6A 1XC8A 3GP1A 2EKKA 2FOIC 1R6BX 1WGLA 2N35A 1VEJA 3NWLA 3AOGA 2R18A 2X8AA 3IG5A 1DGHB 2DAGA 2V1CA 4LJ9A 1Q39A 1GL6A 2DNAA 2QHOB 2R6FA 3LCUA 4I4LA 8CATA 1RU3A 2C99A 2QPAA 4GITA 2X49A 1Q02A 1TF0B 1IM2A 2MJ5B 1QDTA 1R2ZA 3SHGB 4IBDA 1NO1A 2ZM6M 2XEPA 1G41A 4JI4M 3M6AA 3KS4A 2XZFA 1OTRA 3GLFA 3W0FA 4LJ4A 5A2QS 1ZMUA 2QCUA 1QDRA 5KPRA 1JQJC 3HY5A 4FWDA 2HKJA 5FTKA 3RGPA 1D0MA 2DWLA 4JYAM 4OX9M 2OPFA 1GJTA 1TDHA 4LGYA 1GL7A 2JY8A 2VIIA 4IBBA 3AKZA 1NJGA 4WW0A 3KSJA 4MGHA 3GQ4A 1TDZA 2G8LA 1H6UA 1TTEA 3C9PA 2KZUA 1XNRM 3UZUA 1L1ZA 3KFUG 3GRRA 4DV0M 1IXSA 1GLNA 1HT2E 2DHRA 2ERCA 2FE8A 2ZTCA 3MJ5A 3GLGE 3U6MA 3NBXX 2DZLA 3IHPA 2JUJA 3K9OA 5C18A 4IIWA 3GLGB 1IBMM 4BBAA 1G4AE 1JR3E 2CHGA 5EXPA 4ANRA 2W82A 3W0LB 1NV9A 1WR1B 4JI1M 1GABA 2DHYA 4R71A 5JI3E 3IG8A 1J7KA 4PT5A 4JV5M 2EKFA 2LBCA 5FTNA 5ITXE 2JNHA 4P16A 3HHXA 2R4JA 4OVZB 1PRBA 3QWLA 1GJSA 3GLHA 4FCTA 5FTMA 4LRTA 4GC5A 1E32A 5DFLA 1J5EM 2V6ZM 3MHVC 1NY5A 5KPTA 2CHVA 3SYKA 2WZJA 3KOZE 2CHQA 3LW5F 1QAQA 4DV2M 1IBKM 3ZC7B 1OFHA 2XSZD 4HEOA 4WP2A 2RGHA 3L2AA 2LVOC 5EP4A 1NJFA 1DV0A 3BXWA 2YFQA 4QHTA 4G4OA 2RKOA 1E9SA 2KRUA 3GPPA 5IREB 1OQYA 3K1JA 2DENA 2Y0QA 2CEAA 3AOEA 2LHGA 3KP0E 1ZV1A 5L8RF 2QSFX 2ZTDA 4FWGA 4LJ7A 4MGKE 5EJCA 1PJQA 1TH2A 2C98A 3J2PB 1SXJE 2J7NA 4LF4M 3EIHA 2XH9A 2QZ4A 1KFVA 3KS8A 3F92A 4YY3M 2R45A 1N75A 4L78A 2JY7A 2MH8A 2Y20A 3RFWA 3MK6A 1I4WA 3KOYE 4X62M 2DAEA 1IN4A 2EO2A 1V33A 4RNAA 2BJVA 2O5RA 2F5PA 1E9RA 3THGA 4DR7M 1SXJD 3B89A 3GRVA 4JN6A 1HQYE 1G59A 1MU5A 4JI7M 5KQ8A 4HLQA 5FTLA 1ZQ9A 2D7EA 3Q8XA 2MGWA 4LF9M 3HWSA 5ITQA 2VF7A 2KA6B 4L8RC 3FKEA 4L16A 1G3IA 3TWKA 1ORYB 2WSEF 3LCVB 4FWHA 4D80A 3GLFE 4P17A 4I5SA 1J09A 1NHGC 1PJTA 3E46A 3CF6E 3L29A 2G3QA 4X65M 2V1UA 3GLFB 4AG5A 3AOEC 2C5RA 3AFHA 4B3MM 2QNJA 4G6ZA 1Z5CA 2QBYA 3J81S 1OAOC 2X4AA 1ZAEA 3KSXA 3H4MA 4KHPM 1TR8A 4L6V6 2FFJA 2APLA 4LF7M 2Z7JA 3JR5A 5EXTA 4F2LA 4REZA 2HL7A 2FS1A 1Q3CA 1D0LA 3HGIA 4B7HA 4PDIA 2BWEA 3U6SA 1OFIA 2BNKA 1IY1A 5EP1A 1VEGA 2R4EA 4B3SM 3T1HM 1GO5A 3M7GA 4A3VB 2F5SA 3VDUA 2CV1A 4JI5M 1HNXM 1IXSB 2BWBA 1T3TA 3I4YA 2CFOA 3H4JA 4DV6M 2Z8YM 3EIEA 3HHYA 1HQCA 1D2NA 4W5WA 2F4VM 1NV8A 4IBFA 3C58A 4II7A 1NY6A 3CTWB 3PFIA 3SFZA 3QYBA 1Z5BA 2DAMA 4B3RM 4M0DA 2LVPC 5KQDA 3U61A 4HL4A 4MGIE 4LF6M 2KRKA 2UXBM 1UFZA 4CHTB 2DXIA 3B7QA 3ILKA 1W5TA 3KW6A 4DV5M 1WGNA 2C96A 2UUAM 3UJNA 3CF0A 3LVWA 3UK6A 3L26A 4ITQA 3FTFA 1MN3A 4XBOA 4MGZE 2QQ8A 4Z6YA 2JWSA 1QZMA 2R62A 4R7GA 4AKGA 4B7GA 2M5ZA 3JR4A 3GLHB 3HX3A 2DWMA 4Y28F 4L15A 4IJFA 3FYDA 4NXMM 1Q3BA 2WSCF 2EJSA 4PCZA 1E94E 4QHSA 5IT9S 3PVSA 1PJIA 1AUAA 1XB2B 4M9SA 2UUBM 2O01F 4LZJA 1YSYA 2J7OA 4BLCA 2H5XA 3FRIA 3WHLA 2OQ4A 1HNWM 1EIJA 2KNZA 1IFYA 5DYIA 7CATA 1GKIA 1X37A 3V76A 3DZDA 5DYGA 4M9ZA 1QAMA 2CRUA 1G8PA 3E4RA 2KNVA 4LFBM 1R5LA 3RE8A 4NRVA 4DR4M 4GHLA 2NQ8C 3GPXA 2XLJA 4FCWA 4MH0E 4OW0A 2Z4SA 3VK8A 2LH0A 2EUCA 1JR3D 3HKPA 3AV0A 2I7NA 4XGIA 2FNAA 2Y21A 1WIVA 3A42A 3GRYA 1FNNA 4ZPXA 3PXGA 3UMMA 5DNYA 2JXNA 2VQFM 2A5YB 1IN6A 3GPYA 3U5ZA 3SC3A 5F3WA 4L4UA 1SG9A 4G4QA 4GKKM 3U6LA 1WHCA 2H1RA 4I8OA 1TH4A 2WSFF 3SMPA 3VKHA 3BOSA 4JI2M 2YR0A 3WHKA 4LG2A 3NBIA 4DR3M 2M60A 4CGYB 1XHBA 4AI6A 4DV7M 3GQ5A 1LTMA 2L4FA 3GLIA 4LGMA 3Q8GA 4IBCA 1BVSA 1K3WA 2HCBA 3E9SA 4FVMA 2LVAA 3GPUA 3U6QA 3TE6A 4GH9A 1N77A 2CV2A 2XF3A 1OIPA 5LMUM 4Z8XA 1XMQM 3SAWA 3SAVA 1Z6TA 3TWMA 3KOWE 3HJQA 1YE9A 3PNYA 3U6OA 2KZSA 2UXDM 3U6CA 4KT0F 2XZUA 3GLGA 2JZ0A 3B74A 3TQSA 2KEBA 4NRWA 2BJWA 1DGGA 4AW4A 2Y0TA 4WURA 2XFTA 4LJ5A 1IQPA 4NOOB 2L09A 3A46A 4LY6A 1XMOM 3L25A 2L7HA
chains in the Genus database with same CATH topology
1QYRA 1NVMA 4LRSA 5LMNM 4GMQA 1W5SA 1LV7A 2KW0A 3J27B 1IY0A 3RGSA 4QNRA 1KSFX 1S3SA 4JI1M 3AL0C 2L6OA 2G5GX 3FUTA 5E6JA 3DFZA 4TUWA 4LF5M 1EE8A 4AZFA 2Q2EB 4KODA 4DV4M 2QENA 5ITXA 3D8LA 1IN7A 2HHHM 3U61B 1L8QA 3OTOM 4KO8A 2XSZA 4LF8M 5FSWA 1XWIA 1DGBA 4JXJA 3FUUA 4NL4H 3M0EA 4LJAA 3SHFA 4M0WA 4PD2A 5BR8M 4B3TM 4KLNA 4K0KM 4GHAA 2ZAOA 3KDSE 4X64M 3SYLA 4LFCM 3FD9A 4GRIA 1IXRC 3CF2A 3FTCA 3U6PA 3L28A 1OJLA 3VFDA 3LQQA 3SASA 2E5LM 3R9XB 3TL4X 5KO3A 3U6DA 2R65A 3PNVA 4CISA 1NNUC 2F5NA 2UUCM 2F5QA 1DO2A 3HHWA 5IWAM 4DUYM 2Z4RA 1QVRA 2AHMA 2DVWB 2YNMD 4MM3B 1NNJA 1SXJA 1XXHA 2UXCM 4LJ6A 4LFAM 1DGFA 1IN8A 2ZAMA 4IBIA 4YHHM 4AKIA 3HU1A 4IBKA 3JAMS 4OU7A 1IBLM 1QQWA 4MB7A 2DZOB 2XFSA 3U5ZB 3J80S 1R2YA 3B9PA 3FUVA 4NSRA 5FLXS 3ZH9B 4G4NA 1Z5AA 1R7RA 1N32M 3U6EA 3UGJA 1HNZM 4AKHA 3K92A 1HR0M 3DA1A 3HHZA 2C9OA 3K2LA 3ZCBB 3GQ3A 1FJGM 3U60A 3GLIB 3LVVA 1I94M 1N78A 2CE7A 3D8BA 5EP3A 1KYIA 2DZNB 1HT1E 3HU2A 2F5OA 3K8ZA 1SXJC 5EQTA 1Z59A 4FW9A 5E26A 2LWXA 2CUZA 3HU3A 5ITTA 2RGOA 4NXNM 1L2BA 1QANA 1DGHA 3KP1E 3AJIB 1L1TA 1N33M 1N34M 1IN5A 5IZ7D 3VDPA 3SMSA 4PDGA 4I81A 3HJSA 2D7HA 3I4VA 4DR1M 1PM5A 2ZANA 4JI0M 1L2CA 3J7BA 4B08A 4DR6M 2Z3XA 3T15A 4R3DA 3L27A 4EIWA 3QAUA 5EXXA 4B7FA 3SATA 4G4RA 1MX0A 4BB9A 5C1BA 2VQEM 3SAUA 2LNHC 3LQRA 4D82A 1QAOA 2P5TA 2K47A 5ITUA 1L2DA 1VDDA 4LZZA 1C1KA 3J7AS 4IBGA 4D81A 4MGYE 2QBYB 1NSFA 3GO8A 3SBJA 3DOAA 4FD2A 2KXEA 3SARA 4RF0A 1GVNA 5ITRA 2CV0A 1PJJA 1TH3A 1JR3A 3A45A 5GKNA 4RF1A 5KPZA 3FUXA 2C9CA 3GRUA 3FYCA 5H37D 4LJ8A 2XGNA 4IBEA 4DV1M 4DR2M 1NHWC 1XNQM 3HJ8A 1IY2A 2D7GA 4IJEA 4GC9A 4X66M 2JA2A 4JI6M 4OVZA 3T1YM 3VK7A 1DO0A 1UM8A 1SXJB 1XXHB 3VLFB 4IBJA 2DWNA 3VKGA 4GIPA 2EA0A 1IXZA 2R46A 3KVWA 2LXEA 2QP9X 3TWLA 3KXEC 1WXQA 4GKJM 1TGUA 4AG6A 3I51A 3LMMA 4FCVA 4DUZM 1N36M 5EP2A 3KOXE 2UU9M 2DWZB 3FTDA 5JI2E 1YUBA 2ZBKB 3FUWA 4DR5M 4DV3M 5ITYA 3A98B 4AQYM 3T38A 4QNMA 4QOSA 4JI3M 4LCBA 5FTJA 3U60B 3R8FA 4QOZC 2L7IA 5BPVA 5EXSA 4JI8M 3FTEA 4M9XA 1K82A 4S12A 2I7PA 3TPZA 4NSOB 1K3XA 2YQZA 1XC8A 3GP1A 2FOIC 1R6BX 3NWLA 3AOGA 2R18A 2X8AA 3IG5A 1DGHB 2V1CA 4LJ9A 1Q39A 1GL6A 4I4LA 8CATA 2C99A 2QPAA 4GITA 2X49A 1IM2A 1R2ZA 3SHGB 4IBDA 2ZM6M 2XEPA 1G41A 4JI4M 3M6AA 3KS4A 2XZFA 3GLFA 3W0FA 4LJ4A 5A2QS 2QCUA 5KPRA 1JQJC 4FWDA 2HKJA 5FTKA 3RGPA 4JYAM 2DWLA 4OX9M 2OPFA 1TDHA 4LGYA 3AKZA 1GL7A 2VIIA 4IBBA 1NJGA 4WW0A 3KSJA 4MGHA 3GQ4A 1TDZA 2G8LA 1H6UA 2KZUA 1XNRM 3UZUA 1L1ZA 3KFUG 3GRRA 1GLNA 2DHRA 1HT2E 2ERCA 2FE8A 3MJ5A 3U6MA 5C18A 4IIWA 3GLGB 1IBMM 4BBAA 1G4AE 2CHGA 5EXPA 2W82A 3W0LB 5JI3E 3IG8A 1J7KA 4PT5A 4JV5M 5FTNA 5ITXE 4P16A 3HHXA 2R4JA 4OVZB 3QWLA 3GLHA 4FCTA 5FTMA 4LRTA 4GC5A 1E32A 1J5EM 2V6ZM 3MHVC 1NY5A 5KPTA 2CHVA 3SYKA 3KOZE 2CHQA 1QAQA 4DV2M 1IBKM 3ZC7B 1OFHA 2XSZD 2RGHA 3L2AA 5EP4A 1NJFA 2YFQA 4QHTA 4G4OA 2RKOA 1E9SA 2KRUA 3GPPA 5IREB 3K1JA 2Y0QA 2CEAA 3AOEA 3KP0E 4FWGA 4LJ7A 4MGKE 5EJCA 1TH2A 2C98A 3J2PB 1SXJE 2J7NA 4LF4M 3EIHA 2XH9A 2QZ4A 1KFVA 3KS8A 4YY3M 2R45A 1N75A 4L78A 2Y20A 3RFWA 3MK6A 1I4WA 3KOYE 4X62M 1IN4A 2EO2A 4RNAA 2F5PA 2BJVA 2O5RA 1E9RA 3THGA 4DR7M 1SXJD 3GRVA 4JN6A 1HQYE 1G59A 1MU5A 4JI7M 5KQ8A 4HLQA 5FTLA 1ZQ9A 2D7EA 3Q8XA 4LF9M 3HWSA 5ITQA 2KA6B 4L8RC 3FKEA 4L16A 1G3IA 3TWKA 1ORYB 4FWHA 4D80A 4DV0M 4I5SA 1J09A 1NHGC 3L29A 3CF6E 4X65M 2V1UA 3GLFB 4AG5A 3AOEC 2C5RA 3AFHA 4B3MM 4G6ZA 1Z5CA 2QBYA 3J81S 2X4AA 3KSXA 1ZAEA 3H4MA 4KHPM 2FFJA 4LF7M 2Z7JA 3JR5A 5EXTA 4REZA 2HL7A 1Q3CA 3HGIA 4B7HA 4PDIA 3U6SA 1OFIA 2BNKA 1IY1A 5EP1A 4B3SM 2R4EA 3T1HM 3M7GA 4A3VB 2F5SA 3VDUA 4JI5M 1HNXM 1IXSB 1T3TA 3I4YA 2CFOA 4DV6M 3EIEA 3HHYA 1HQCA 1D2NA 4W5WA 2F4VM 4IBFA 3C58A 4II7A 1NY6A 3CTWB 3PFIA 3SFZA 1Z5BA 4B3RM 4M0DA 5KQDA 3U61A 4HL4A 4MGIE 4LF6M 2KRKA 2UXBM 4CHTB 2DXIA 3ILKA 1W5TA 3KW6A 4DV5M 2C96A 2UUAM 3UJNA 3CF0A 3LVWA 3UK6A 3L26A 4ITQA 3FTFA 4XBOA 4MGZE 4Z6YA 1QZMA 2R62A 4R7GA 4AKGA 4B7GA 2M5ZA 3JR4A 3GLHB 2DWMA 4L15A 4IJFA 3FYDA 4NXMM 1Q3BA 4PCZA 1E94E 4QHSA 5IT9S 3PVSA 1PJIA 4M9SA 2UUBM 4LZJA 1YSYA 2J7OA 4BLCA 3WHLA 1HNWM 2OQ4A 5DYIA 7CATA 1GKIA 1X37A 3DZDA 5DYGA 4M9ZA 1QAMA 1G8PA 3E4RA 4LFBM 3RE8A 4DR4M 4NRVA 4GHLA 2NQ8C 3GPXA 2XLJA 4FCWA 4MH0E 4OW0A 2Z4SA 3VK8A 2LH0A 2EUCA 3HKPA 1JR3D 3AV0A 2I7NA 4XGIA 2FNAA 2Y21A 3A42A 3GRYA 3PXGA 1FNNA 4ZPXA 3UMMA 5DNYA 2VQFM 4DR3M 2CV1A 2A5YB 1IN6A 3GPYA 3U5ZA 3SC3A 5F3WA 4L4UA 4G4QA 4GKKM 3U6LA 2H1RA 4I8OA 1TH4A 3SMPA 3VKHA 3BOSA 4JI2M 2YR0A 3WHKA 4LG2A 3NBIA 2M60A 4CGYB 1XHBA 4AI6A 4DV7M 3GQ5A 3GLIA 4LGMA 4IBCA 1K3WA 2HCBA 3E9SA 4FVMA 3GPUA 3U6QA 3TE6A 4GH9A 1N77A 2CV2A 2XF3A 5LMUM 4Z8XA 1XMQM 3SAWA 3SAVA 1Z6TA 3TWMA 3KOWE 3HJQA 1YE9A 3PNYA 3U6OA 2KZSA 2UXDM 3U6CA 2XZUA 3GLGA 3TQSA 2KEBA 4NRWA 2BJWA 1DGGA 4AW4A 2Y0TA 4WURA 2XFTA 4LJ5A 1IQPA 4NOOB 2L09A 3A46A 4LY6A 1XMOM 3L25A 2L7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7I A;  2Y0T A;  2Y21 A;  4I5S A;  2Y0Q A;  2L7H A;  2Y20 A; 
#chains in the Genus database with same CATH topology
 2HAK A;  2DI0 A;  1QYR A;  1NVM A;  4LRS A;  5LMN M;  4GMQ A;  1W5S A;  1LV7 A;  2KW0 A;  3J27 B;  1IY0 A;  2LHC A;  4QNR A;  1KSF X;  1S3S A;  3RGS A;  2J5Y A;  2L6O A;  2G5G X;  2MR9 A;  3FUT A;  3DFZ A;  5E6J A;  3AL0 C;  4TUW A;  4LF5 M;  1EE8 A;  2OO9 A;  3I04 M;  2LVQ D;  4AZF A;  2Q2E B;  1QZE A;  4KOD A;  4DV4 M;  2QEN A;  5ITX A;  3IEC A;  3D8L A;  1IN7 A;  1WJ7 A;  4NC6 A;  2HHH M;  3U61 B;  1L8Q A;  3BBZ A;  3OTO M;  4KO8 A;  2XSZ A;  4LF8 M;  3MMP A;  5FSW A;  1XWI A;  1AIP C;  1DGB A;  4JXJ A;  2KNA A;  3B7N A;  3FUU A;  4NL4 H;  3M0E A;  4LJA A;  1OKS A;  4M0W A;  3SHF A;  4PD2 A;  1PGY A;  5BR8 M;  4B3T M;  4KLN A;  4DBG B;  4K0K M;  4GHA A;  2ZAO A;  3KDS E;  2CP8 A;  4X64 M;  3SYL A;  4LFC M;  3FD9 A;  2KDL A;  4GRI A;  1IXR C;  2CWB A;  3CF2 A;  3E21 A;  2OOA A;  3FTC A;  3U6P A;  2LVN C;  3L28 A;  1OJL A;  3VFD A;  1V34 A;  3LQQ A;  2VDB B;  1OAI A;  3SAS A;  2E5L M;  3R9X B;  3TL4 X;  5KO3 A;  3U6D A;  2FH0 A;  2R65 A;  3PNV A;  4CIS A;  1NNU C;  1G71 A;  2F5N A;  2F5Q A;  2UUC M;  1DO2 A;  3HHW A;  5IWA M;  4DUY M;  2Z4R A;  4XK8 F;  1QVR A;  2AHM A;  2DVW B;  2YNM D;  4MM3 B;  1NNJ A;  1SXJ A;  1XXH A;  2UXC M;  4LJ6 A;  2MRO B;  4LFA M;  1DGF A;  1IN8 A;  2ZAM A;  2B3T A;  1JB0 F;  4IBI A;  4YHH M;  2JY6 B;  4AKI A;  3HU1 A;  4IBK A;  3GLH E;  3JAM S;  4OU7 A;  1IBL M;  1QQW A;  4MB7 A;  2DZO B;  2XFS A;  3U5Z B;  3J80 S;  1R2Y A;  3B9P A;  3FUV A;  3I01 M;  2DKL A;  4Q7J A;  4NSR A;  5FLX S;  3ZH9 B;  4G4N A;  1Z5A A;  1R7R A;  1N32 M;  3U6E A;  3UGJ A;  1HNZ M;  4AKH A;  3K92 A;  1HR0 M;  3DA1 A;  3HHZ A;  2C9O A;  2JY5 A;  1PJS A;  3K2L A;  3ZCB B;  3GQ3 A;  1FJG M;  3GLI E;  3U60 A;  1HJP A;  3GLI B;  1CUK A;  3LVV A;  3C3D A;  1I94 M;  1N78 A;  1F4I A;  2CE7 A;  3D8B A;  5EP3 A;  1KYI A;  2DZN B;  1HT1 E;  3HU2 A;  2F5O A;  1MJG M;  3K8Z A;  1SXJ C;  1OIZ A;  2LTU A;  5EQT A;  1Z59 A;  4FW9 A;  4GEW A;  5E26 A;  2LWX A;  2CUZ A;  3HU3 A;  5ITT A;  2RGO A;  2L2D A;  4NXN M;  1L2B A;  1QAN A;  1DGH A;  3B7Z A;  3KP1 E;  3AJI B;  1L1T A;  1N33 M;  4RKU F;  1N34 M;  1ZMW A;  1IN5 A;  3FE3 A;  2HWJ A;  5IZ7 D;  3VDP A;  3SMS A;  4PDG A;  4I81 A;  3HJS A;  2D7H A;  2L4E A;  3I4V A;  4DR1 M;  1PM5 A;  2ZAN A;  4JI0 M;  1L2C A;  3J7B A;  4B08 A;  4DR6 M;  2K9D A;  2Z3X A;  3T15 A;  4R3D A;  3L27 A;  4EIW A;  3W68 A;  3QAU A;  4UN2 B;  5EXX A;  4B7F A;  1V92 A;  3SAT A;  2O25 A;  4G4R A;  1MX0 A;  4BB9 A;  1VEK A;  5C1B A;  2VQE M;  3SAU A;  2LNH C;  3LQR A;  4D82 A;  1QAO A;  2P5T A;  2K47 A;  5ITU A;  1L2D A;  1VDD A;  3ZQJ A;  2R44 A;  4LZZ A;  1C1K A;  1VQ1 A;  1T43 A;  3T6P A;  3J7A S;  4IBG A;  4D81 A;  4MGY E;  2QBY B;  1NSF A;  3GO8 A;  1ZMV A;  3DOA A;  2DAK A;  3SBJ A;  4FD2 A;  3HZJ A;  2KXE A;  1YLA A;  2DAI A;  4RF0 A;  1GVN A;  3SAR A;  5ITR A;  1QUT A;  1PJJ A;  2CV0 A;  1TH3 A;  1Y8G A;  1JR3 A;  3A45 A;  5GKN A;  1EFU B;  4RF1 A;  5KPZ A;  3FUX A;  1T6O A;  2C9C A;  3GRU A;  3FYC A;  5H37 D;  4LJ8 A;  2XGN A;  4IBE A;  4DV1 M;  4DR2 M;  1NHW C;  1XNQ M;  2VF8 A;  3CGW A;  2JZ1 A;  3HJ8 A;  3C3E A;  1IY2 A;  2D7G A;  4IJE A;  4GC9 A;  4X66 M;  2JA2 A;  1A5T A;  1VG5 A;  4JI6 M;  1XXH E;  4OVZ A;  2OOB A;  4G3O A;  3T1Y M;  1R4G A;  3VK7 A;  1DO0 A;  1UM8 A;  2GNO A;  2JP7 A;  1SXJ B;  1XXH B;  3VLF B;  4IBJ A;  2DWN A;  2K6B A;  2RRU A;  3VKG A;  4GIP A;  1QUS A;  2EA0 A;  1IXZ A;  2R46 A;  3KVW A;  2LXE A;  2QP9 X;  2GQF A;  3TWL A;  3KXE C;  1WXQ A;  2KHH A;  4GKJ M;  3FRH A;  1TGU A;  4AG6 A;  3I51 A;  3LMM A;  4FCV A;  4CIZ A;  4DUZ M;  1N36 M;  1D0K A;  2K0B X;  5EP2 A;  3KOX E;  4F1I A;  2UU9 M;  2DWZ B;  3FTD A;  5JI2 E;  1C7Y A;  1P3Q Q;  3QYE A;  1YUB A;  2ZBK B;  3FUW A;  4DR5 M;  4DV3 M;  5ITY A;  3A98 B;  3W67 A;  4AQY M;  3T38 A;  4QNM A;  4QOS A;  4JI3 M;  4LCB A;  5FTJ A;  3U60 B;  3R8F A;  4QOZ C;  2L7I A;  1VDL A;  5BPV A;  5EXS A;  4JI8 M;  3K9P A;  3FTE A;  4M9X A;  1K82 A;  4S12 A;  2I7P A;  3TPZ A;  4NSO B;  2R0I A;  1K3X A;  2YQZ A;  4CJ6 A;  1XC8 A;  3GP1 A;  2EKK A;  2FOI C;  1R6B X;  1WGL A;  2N35 A;  1VEJ A;  3NWL A;  3AOG A;  2R18 A;  2X8A A;  3IG5 A;  1DGH B;  2DAG A;  2V1C A;  4LJ9 A;  1Q39 A;  1GL6 A;  2DNA A;  2QHO B;  2R6F A;  3LCU A;  4I4L A;  8CAT A;  1RU3 A;  2C99 A;  2QPA A;  4GIT A;  2X49 A;  1Q02 A;  1TF0 B;  1IM2 A;  2MJ5 B;  1QDT A;  1R2Z A;  3SHG B;  4IBD A;  1NO1 A;  2ZM6 M;  2XEP A;  1G41 A;  4JI4 M;  3M6A A;  3KS4 A;  2XZF A;  1OTR A;  3GLF A;  3W0F A;  4LJ4 A;  5A2Q S;  1ZMU A;  2QCU A;  1QDR A;  5KPR A;  1JQJ C;  3HY5 A;  4FWD A;  2HKJ A;  5FTK A;  3RGP A;  1D0M A;  2DWL A;  4JYA M;  4OX9 M;  2OPF A;  1GJT A;  1TDH A;  4LGY A;  1GL7 A;  2JY8 A;  2VII A;  4IBB A;  3AKZ A;  1NJG A;  4WW0 A;  3KSJ A;  4MGH A;  3GQ4 A;  1TDZ A;  2G8L A;  1H6U A;  1TTE A;  3C9P A;  2KZU A;  1XNR M;  3UZU A;  1L1Z A;  3KFU G;  3GRR A;  4DV0 M;  1IXS A;  1GLN A;  1HT2 E;  2DHR A;  2ERC A;  2FE8 A;  2ZTC A;  3MJ5 A;  3GLG E;  3U6M A;  3NBX X;  2DZL A;  3IHP A;  2JUJ A;  3K9O A;  5C18 A;  4IIW A;  3GLG B;  1IBM M;  4BBA A;  1G4A E;  1JR3 E;  2CHG A;  5EXP A;  4ANR A;  2W82 A;  3W0L B;  1NV9 A;  1WR1 B;  4JI1 M;  1GAB A;  2DHY A;  4R71 A;  5JI3 E;  3IG8 A;  1J7K A;  4PT5 A;  4JV5 M;  2EKF A;  2LBC A;  5FTN A;  5ITX E;  2JNH A;  4P16 A;  3HHX A;  2R4J A;  4OVZ B;  1PRB A;  3QWL A;  1GJS A;  3GLH A;  4FCT A;  5FTM A;  4LRT A;  4GC5 A;  1E32 A;  5DFL A;  1J5E M;  2V6Z M;  3MHV C;  1NY5 A;  5KPT A;  2CHV A;  3SYK A;  2WZJ A;  3KOZ E;  2CHQ A;  3LW5 F;  1QAQ A;  4DV2 M;  1IBK M;  3ZC7 B;  1OFH A;  2XSZ D;  4HEO A;  4WP2 A;  2RGH A;  3L2A A;  2LVO C;  5EP4 A;  1NJF A;  1DV0 A;  3BXW A;  2YFQ A;  4QHT A;  4G4O A;  2RKO A;  1E9S A;  2KRU A;  3GPP A;  5IRE B;  1OQY A;  3K1J A;  2DEN A;  2Y0Q A;  2CEA A;  3AOE A;  2LHG A;  3KP0 E;  1ZV1 A;  5L8R F;  2QSF X;  2ZTD A;  4FWG A;  4LJ7 A;  4MGK E;  5EJC A;  1PJQ A;  1TH2 A;  2C98 A;  3J2P B;  1SXJ E;  2J7N A;  4LF4 M;  3EIH A;  2XH9 A;  2QZ4 A;  1KFV A;  3KS8 A;  3F92 A;  4YY3 M;  2R45 A;  1N75 A;  4L78 A;  2JY7 A;  2MH8 A;  2Y20 A;  3RFW A;  3MK6 A;  1I4W A;  3KOY E;  4X62 M;  2DAE A;  1IN4 A;  2EO2 A;  1V33 A;  4RNA A;  2BJV A;  2O5R A;  2F5P A;  1E9R A;  3THG A;  4DR7 M;  1SXJ D;  3B89 A;  3GRV A;  4JN6 A;  1HQY E;  1G59 A;  1MU5 A;  4JI7 M;  5KQ8 A;  4HLQ A;  5FTL A;  1ZQ9 A;  2D7E A;  3Q8X A;  2MGW A;  4LF9 M;  3HWS A;  5ITQ A;  2VF7 A;  2KA6 B;  4L8R C;  3FKE A;  4L16 A;  1G3I A;  3TWK A;  1ORY B;  2WSE F;  3LCV B;  4FWH A;  4D80 A;  3GLF E;  4P17 A;  4I5S A;  1J09 A;  1NHG C;  1PJT A;  3E46 A;  3CF6 E;  3L29 A;  2G3Q A;  4X65 M;  2V1U A;  3GLF B;  4AG5 A;  3AOE C;  2C5R A;  3AFH A;  4B3M M;  2QNJ A;  4G6Z A;  1Z5C A;  2QBY A;  3J81 S;  1OAO C;  2X4A A;  1ZAE A;  3KSX A;  3H4M A;  4KHP M;  1TR8 A;  4L6V 6;  2FFJ A;  2APL A;  4LF7 M;  2Z7J A;  3JR5 A;  5EXT A;  4F2L A;  4REZ A;  2HL7 A;  2FS1 A;  1Q3C A;  1D0L A;  3HGI A;  4B7H A;  4PDI A;  2BWE A;  3U6S A;  1OFI A;  2BNK A;  1IY1 A;  5EP1 A;  1VEG A;  2R4E A;  4B3S M;  3T1H M;  1GO5 A;  3M7G A;  4A3V B;  2F5S A;  3VDU A;  2CV1 A;  4JI5 M;  1HNX M;  1IXS B;  2BWB A;  1T3T A;  3I4Y A;  2CFO A;  3H4J A;  4DV6 M;  2Z8Y M;  3EIE A;  3HHY A;  1HQC A;  1D2N A;  4W5W A;  2F4V M;  1NV8 A;  4IBF A;  3C58 A;  4II7 A;  1NY6 A;  3CTW B;  3PFI A;  3SFZ A;  3QYB A;  1Z5B A;  2DAM A;  4B3R M;  4M0D A;  2LVP C;  5KQD A;  3U61 A;  4HL4 A;  4MGI E;  4LF6 M;  2KRK A;  2UXB M;  1UFZ A;  4CHT B;  2DXI A;  3B7Q A;  3ILK A;  1W5T A;  3KW6 A;  4DV5 M;  1WGN A;  2C96 A;  2UUA M;  3UJN A;  3CF0 A;  3LVW A;  3UK6 A;  3L26 A;  4ITQ A;  3FTF A;  1MN3 A;  4XBO A;  4MGZ E;  2QQ8 A;  4Z6Y A;  2JWS A;  1QZM A;  2R62 A;  4R7G A;  4AKG A;  4B7G A;  2M5Z A;  3JR4 A;  3GLH B;  3HX3 A;  2DWM A;  4Y28 F;  4L15 A;  4IJF A;  3FYD A;  4NXM M;  1Q3B A;  2WSC F;  2EJS A;  4PCZ A;  1E94 E;  4QHS A;  5IT9 S;  3PVS A;  1PJI A;  1AUA A;  1XB2 B;  4M9S A;  2UUB M;  2O01 F;  4LZJ A;  1YSY A;  2J7O A;  4BLC A;  2H5X A;  3FRI A;  3WHL A;  2OQ4 A;  1HNW M;  1EIJ A;  2KNZ A;  1IFY A;  5DYI A;  7CAT A;  1GKI A;  1X37 A;  3V76 A;  3DZD A;  5DYG A;  4M9Z A;  1QAM A;  2CRU A;  1G8P A;  3E4R A;  2KNV A;  4LFB M;  1R5L A;  3RE8 A;  4NRV A;  4DR4 M;  4GHL A;  2NQ8 C;  3GPX A;  2XLJ A;  4FCW A;  4MH0 E;  4OW0 A;  2Z4S A;  3VK8 A;  2LH0 A;  2EUC A;  1JR3 D;  3HKP A;  3AV0 A;  2I7N A;  4XGI A;  2FNA A;  2Y21 A;  1WIV A;  3A42 A;  3GRY A;  1FNN A;  4ZPX A;  3PXG A;  3UMM A;  5DNY A;  2JXN A;  2VQF M;  2A5Y B;  1IN6 A;  3GPY A;  3U5Z A;  3SC3 A;  5F3W A;  4L4U A;  1SG9 A;  4G4Q A;  4GKK M;  3U6L A;  1WHC A;  2H1R A;  4I8O A;  1TH4 A;  2WSF F;  3SMP A;  3VKH A;  3BOS A;  4JI2 M;  2YR0 A;  3WHK A;  4LG2 A;  3NBI A;  4DR3 M;  2M60 A;  4CGY B;  1XHB A;  4AI6 A;  4DV7 M;  3GQ5 A;  1LTM A;  2L4F A;  3GLI A;  4LGM A;  3Q8G A;  4IBC A;  1BVS A;  1K3W A;  2HCB A;  3E9S A;  4FVM A;  2LVA A;  3GPU A;  3U6Q A;  3TE6 A;  4GH9 A;  1N77 A;  2CV2 A;  2XF3 A;  1OIP A;  5LMU M;  4Z8X A;  1XMQ M;  3SAW A;  3SAV A;  1Z6T A;  3TWM A;  3KOW E;  3HJQ A;  1YE9 A;  3PNY A;  3U6O A;  2KZS A;  2UXD M;  3U6C A;  4KT0 F;  2XZU A;  3GLG A;  2JZ0 A;  3B74 A;  3TQS A;  2KEB A;  4NRW A;  2BJW A;  1DGG A;  4AW4 A;  2Y0T A;  4WUR A;  2XFT A;  4LJ5 A;  1IQP A;  4NOO B;  2L09 A;  3A46 A;  4LY6 A;  1XMO M;  3L25 A;  2L7H A; 
#chains in the Genus database with same CATH homology
 1QYR A;  1NVM A;  4LRS A;  5LMN M;  4GMQ A;  1W5S A;  1LV7 A;  2KW0 A;  3J27 B;  1IY0 A;  3RGS A;  4QNR A;  1KSF X;  1S3S A;  4JI1 M;  3AL0 C;  2L6O A;  2G5G X;  3FUT A;  5E6J A;  3DFZ A;  4TUW A;  4LF5 M;  1EE8 A;  4AZF A;  2Q2E B;  4KOD A;  4DV4 M;  2QEN A;  5ITX A;  3D8L A;  1IN7 A;  2HHH M;  3U61 B;  1L8Q A;  3OTO M;  4KO8 A;  2XSZ A;  4LF8 M;  5FSW A;  1XWI A;  1DGB A;  4JXJ A;  3FUU A;  4NL4 H;  3M0E A;  4LJA A;  3SHF A;  4M0W A;  4PD2 A;  5BR8 M;  4B3T M;  4KLN A;  4K0K M;  4GHA A;  2ZAO A;  3KDS E;  4X64 M;  3SYL A;  4LFC M;  3FD9 A;  4GRI A;  1IXR C;  3CF2 A;  3FTC A;  3U6P A;  3L28 A;  1OJL A;  3VFD A;  3LQQ A;  3SAS A;  2E5L M;  3R9X B;  3TL4 X;  5KO3 A;  3U6D A;  2R65 A;  3PNV A;  4CIS A;  1NNU C;  2F5N A;  2UUC M;  2F5Q A;  1DO2 A;  3HHW A;  5IWA M;  4DUY M;  2Z4R A;  1QVR A;  2AHM A;  2DVW B;  2YNM D;  4MM3 B;  1NNJ A;  1SXJ A;  1XXH A;  2UXC M;  4LJ6 A;  4LFA M;  1DGF A;  1IN8 A;  2ZAM A;  4IBI A;  4YHH M;  4AKI A;  3HU1 A;  4IBK A;  3JAM S;  4OU7 A;  1IBL M;  1QQW A;  4MB7 A;  2DZO B;  2XFS A;  3U5Z B;  3J80 S;  1R2Y A;  3B9P A;  3FUV A;  4NSR A;  5FLX S;  3ZH9 B;  4G4N A;  1Z5A A;  1R7R A;  1N32 M;  3U6E A;  3UGJ A;  1HNZ M;  4AKH A;  3K92 A;  1HR0 M;  3DA1 A;  3HHZ A;  2C9O A;  3K2L A;  3ZCB B;  3GQ3 A;  1FJG M;  3U60 A;  3GLI B;  3LVV A;  1I94 M;  1N78 A;  2CE7 A;  3D8B A;  5EP3 A;  1KYI A;  2DZN B;  1HT1 E;  3HU2 A;  2F5O A;  3K8Z A;  1SXJ C;  5EQT A;  1Z59 A;  4FW9 A;  5E26 A;  2LWX A;  2CUZ A;  3HU3 A;  5ITT A;  2RGO A;  4NXN M;  1L2B A;  1QAN A;  1DGH A;  3KP1 E;  3AJI B;  1L1T A;  1N33 M;  1N34 M;  1IN5 A;  5IZ7 D;  3VDP A;  3SMS A;  4PDG A;  4I81 A;  3HJS A;  2D7H A;  3I4V A;  4DR1 M;  1PM5 A;  2ZAN A;  4JI0 M;  1L2C A;  3J7B A;  4B08 A;  4DR6 M;  2Z3X A;  3T15 A;  4R3D A;  3L27 A;  4EIW A;  3QAU A;  5EXX A;  4B7F A;  3SAT A;  4G4R A;  1MX0 A;  4BB9 A;  5C1B A;  2VQE M;  3SAU A;  2LNH C;  3LQR A;  4D82 A;  1QAO A;  2P5T A;  2K47 A;  5ITU A;  1L2D A;  1VDD A;  4LZZ A;  1C1K A;  3J7A S;  4IBG A;  4D81 A;  4MGY E;  2QBY B;  1NSF A;  3GO8 A;  3SBJ A;  3DOA A;  4FD2 A;  2KXE A;  3SAR A;  4RF0 A;  1GVN A;  5ITR A;  2CV0 A;  1PJJ A;  1TH3 A;  1JR3 A;  3A45 A;  5GKN A;  4RF1 A;  5KPZ A;  3FUX A;  2C9C A;  3GRU A;  3FYC A;  5H37 D;  4LJ8 A;  2XGN A;  4IBE A;  4DV1 M;  4DR2 M;  1NHW C;  1XNQ M;  3HJ8 A;  1IY2 A;  2D7G A;  4IJE A;  4GC9 A;  4X66 M;  2JA2 A;  4JI6 M;  4OVZ A;  3T1Y M;  3VK7 A;  1DO0 A;  1UM8 A;  1SXJ B;  1XXH B;  3VLF B;  4IBJ A;  2DWN A;  3VKG A;  4GIP A;  2EA0 A;  1IXZ A;  2R46 A;  3KVW A;  2LXE A;  2QP9 X;  3TWL A;  3KXE C;  1WXQ A;  4GKJ M;  1TGU A;  4AG6 A;  3I51 A;  3LMM A;  4FCV A;  4DUZ M;  1N36 M;  5EP2 A;  3KOX E;  2UU9 M;  2DWZ B;  3FTD A;  5JI2 E;  1YUB A;  2ZBK B;  3FUW A;  4DR5 M;  4DV3 M;  5ITY A;  3A98 B;  4AQY M;  3T38 A;  4QNM A;  4QOS A;  4JI3 M;  4LCB A;  5FTJ A;  3U60 B;  3R8F A;  4QOZ C;  2L7I A;  5BPV A;  5EXS A;  4JI8 M;  3FTE A;  4M9X A;  1K82 A;  4S12 A;  2I7P A;  3TPZ A;  4NSO B;  1K3X A;  2YQZ A;  1XC8 A;  3GP1 A;  2FOI C;  1R6B X;  3NWL A;  3AOG A;  2R18 A;  2X8A A;  3IG5 A;  1DGH B;  2V1C A;  4LJ9 A;  1Q39 A;  1GL6 A;  4I4L A;  8CAT A;  2C99 A;  2QPA A;  4GIT A;  2X49 A;  1IM2 A;  1R2Z A;  3SHG B;  4IBD A;  2ZM6 M;  2XEP A;  1G41 A;  4JI4 M;  3M6A A;  3KS4 A;  2XZF A;  3GLF A;  3W0F A;  4LJ4 A;  5A2Q S;  2QCU A;  5KPR A;  1JQJ C;  4FWD A;  2HKJ A;  5FTK A;  3RGP A;  4JYA M;  2DWL A;  4OX9 M;  2OPF A;  1TDH A;  4LGY A;  3AKZ A;  1GL7 A;  2VII A;  4IBB A;  1NJG A;  4WW0 A;  3KSJ A;  4MGH A;  3GQ4 A;  1TDZ A;  2G8L A;  1H6U A;  2KZU A;  1XNR M;  3UZU A;  1L1Z A;  3KFU G;  3GRR A;  1GLN A;  2DHR A;  1HT2 E;  2ERC A;  2FE8 A;  3MJ5 A;  3U6M A;  5C18 A;  4IIW A;  3GLG B;  1IBM M;  4BBA A;  1G4A E;  2CHG A;  5EXP A;  2W82 A;  3W0L B;  5JI3 E;  3IG8 A;  1J7K A;  4PT5 A;  4JV5 M;  5FTN A;  5ITX E;  4P16 A;  3HHX A;  2R4J A;  4OVZ B;  3QWL A;  3GLH A;  4FCT A;  5FTM A;  4LRT A;  4GC5 A;  1E32 A;  1J5E M;  2V6Z M;  3MHV C;  1NY5 A;  5KPT A;  2CHV A;  3SYK A;  3KOZ E;  2CHQ A;  1QAQ A;  4DV2 M;  1IBK M;  3ZC7 B;  1OFH A;  2XSZ D;  2RGH A;  3L2A A;  5EP4 A;  1NJF A;  2YFQ A;  4QHT A;  4G4O A;  2RKO A;  1E9S A;  2KRU A;  3GPP A;  5IRE B;  3K1J A;  2Y0Q A;  2CEA A;  3AOE A;  3KP0 E;  4FWG A;  4LJ7 A;  4MGK E;  5EJC A;  1TH2 A;  2C98 A;  3J2P B;  1SXJ E;  2J7N A;  4LF4 M;  3EIH A;  2XH9 A;  2QZ4 A;  1KFV A;  3KS8 A;  4YY3 M;  2R45 A;  1N75 A;  4L78 A;  2Y20 A;  3RFW A;  3MK6 A;  1I4W A;  3KOY E;  4X62 M;  1IN4 A;  2EO2 A;  4RNA A;  2F5P A;  2BJV A;  2O5R A;  1E9R A;  3THG A;  4DR7 M;  1SXJ D;  3GRV A;  4JN6 A;  1HQY E;  1G59 A;  1MU5 A;  4JI7 M;  5KQ8 A;  4HLQ A;  5FTL A;  1ZQ9 A;  2D7E A;  3Q8X A;  4LF9 M;  3HWS A;  5ITQ A;  2KA6 B;  4L8R C;  3FKE A;  4L16 A;  1G3I A;  3TWK A;  1ORY B;  4FWH A;  4D80 A;  4DV0 M;  4I5S A;  1J09 A;  1NHG C;  3L29 A;  3CF6 E;  4X65 M;  2V1U A;  3GLF B;  4AG5 A;  3AOE C;  2C5R A;  3AFH A;  4B3M M;  4G6Z A;  1Z5C A;  2QBY A;  3J81 S;  2X4A A;  3KSX A;  1ZAE A;  3H4M A;  4KHP M;  2FFJ A;  4LF7 M;  2Z7J A;  3JR5 A;  5EXT A;  4REZ A;  2HL7 A;  1Q3C A;  3HGI A;  4B7H A;  4PDI A;  3U6S A;  1OFI A;  2BNK A;  1IY1 A;  5EP1 A;  4B3S M;  2R4E A;  3T1H M;  3M7G A;  4A3V B;  2F5S A;  3VDU A;  4JI5 M;  1HNX M;  1IXS B;  1T3T A;  3I4Y A;  2CFO A;  4DV6 M;  3EIE A;  3HHY A;  1HQC A;  1D2N A;  4W5W A;  2F4V M;  4IBF A;  3C58 A;  4II7 A;  1NY6 A;  3CTW B;  3PFI A;  3SFZ A;  1Z5B A;  4B3R M;  4M0D A;  5KQD A;  3U61 A;  4HL4 A;  4MGI E;  4LF6 M;  2KRK A;  2UXB M;  4CHT B;  2DXI A;  3ILK A;  1W5T A;  3KW6 A;  4DV5 M;  2C96 A;  2UUA M;  3UJN A;  3CF0 A;  3LVW A;  3UK6 A;  3L26 A;  4ITQ A;  3FTF A;  4XBO A;  4MGZ E;  4Z6Y A;  1QZM A;  2R62 A;  4R7G A;  4AKG A;  4B7G A;  2M5Z A;  3JR4 A;  3GLH B;  2DWM A;  4L15 A;  4IJF A;  3FYD A;  4NXM M;  1Q3B A;  4PCZ A;  1E94 E;  4QHS A;  5IT9 S;  3PVS A;  1PJI A;  4M9S A;  2UUB M;  4LZJ A;  1YSY A;  2J7O A;  4BLC A;  3WHL A;  1HNW M;  2OQ4 A;  5DYI A;  7CAT A;  1GKI A;  1X37 A;  3DZD A;  5DYG A;  4M9Z A;  1QAM A;  1G8P A;  3E4R A;  4LFB M;  3RE8 A;  4DR4 M;  4NRV A;  4GHL A;  2NQ8 C;  3GPX A;  2XLJ A;  4FCW A;  4MH0 E;  4OW0 A;  2Z4S A;  3VK8 A;  2LH0 A;  2EUC A;  3HKP A;  1JR3 D;  3AV0 A;  2I7N A;  4XGI A;  2FNA A;  2Y21 A;  3A42 A;  3GRY A;  3PXG A;  1FNN A;  4ZPX A;  3UMM A;  5DNY A;  2VQF M;  4DR3 M;  2CV1 A;  2A5Y B;  1IN6 A;  3GPY A;  3U5Z A;  3SC3 A;  5F3W A;  4L4U A;  4G4Q A;  4GKK M;  3U6L A;  2H1R A;  4I8O A;  1TH4 A;  3SMP A;  3VKH A;  3BOS A;  4JI2 M;  2YR0 A;  3WHK A;  4LG2 A;  3NBI A;  2M60 A;  4CGY B;  1XHB A;  4AI6 A;  4DV7 M;  3GQ5 A;  3GLI A;  4LGM A;  4IBC A;  1K3W A;  2HCB A;  3E9S A;  4FVM A;  3GPU A;  3U6Q A;  3TE6 A;  4GH9 A;  1N77 A;  2CV2 A;  2XF3 A;  5LMU M;  4Z8X A;  1XMQ M;  3SAW A;  3SAV A;  1Z6T A;  3TWM A;  3KOW E;  3HJQ A;  1YE9 A;  3PNY A;  3U6O A;  2KZS A;  2UXD M;  3U6C A;  2XZU A;  3GLG A;  3TQS A;  2KEB A;  4NRW A;  2BJW A;  1DGG A;  4AW4 A;  2Y0T A;  4WUR A;  2XFT A;  4LJ5 A;  1IQP A;  4NOO B;  2L09 A;  3A46 A;  4LY6 A;  1XMO M;  3L25 A;  2L7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...