2L7HA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 20
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7hA00
2Y21A 2Y0TA 4I5SA 2Y20A 2L7IA 2L7HA 2Y0QA
chains in the Genus database with same CATH superfamily
1KSFX 2XSZD 5GKNA 1D0MA 4I5SA 4L6V6 2HL7A 3GRYA 5KO3A 2QZ4A 3HHXA 5FTLA 2EUCA 4B3MM 1XNQM 1V34A 3KXEC 4MH0E 1T3TA 5EJCA 5LMNM 1PJQA 4FWGA 1Q3BA 3AV0A 4FWDA 4FWHA 3B7ZA 4JI3M 5IWAM 3THGA 3U6SA 4Y28F 4FW9A 2C9CA 4D82A 2KZSA 4PDGA 3U6EA 3HZJA 3U6CA 1IN5A 3GLHE 3TL4X 4ANRA 3U6PA 1DGFA 4FCTA 2ZM6M 1N36M 4G4NA 2DWMA 3J81S 3FYCA 1T43A 4DR1M 4JI0M 3HJQA 2CHGA 4PDIA 2Y0QA 1HNZM 3K8ZA 2VQFM 3AL0C 1NV8A 2VDBB 2ZAMA 2J7NA 3GQ3A 2H5XA 3VKGA 5KPTA 5BPVA 2MROB 2D7EA 5FLXS 5EP4A 1TH4A 2ZBKB 2UXDM 3CF6E 1GABA 3E21A 4KHPM 4D81A 4GHAA 2KRKA 5ITXA 3UJNA 2X49A 1IY2A 3SYLA 3GLGA 1IBMM 4K0KM 2HAKA 4FCVA 4LZJA 4AG5A 1W5TA 2ZTCA 2CUZA 3QWLA 1L2CA 3HKPA 4B3SM 5EXTA 1XC8A 2Z4SA 3CTWB 1R4GA 1KYIA 2V1CA 4TUWA 4AKHA 3HX3A 3L28A 4DUZM 3SAVA 5DYGA 2WSFF 3C3DA 4NXMM 3BXWA 3AOGA 3FUWA 3GLFE 3KDSE 3L27A 3U6QA 2HKJA 3Q8XA 2ZANA 2DZOB 1L2DA 2ERCA 2K0BX 2XGNA 4LJ5A 3ZC7B 4B7HA 1E9RA 1VDLA 3J7BA 3HHZA 3KP0E 2OO9A 4GEWA 3GQ4A 3SMSA 3AOEA 1OFIA 4Z6YA 2R6FA 1VG5A 4MM3B 5IZ7D 3RGSA 4JYAM 3T38A 3LVVA 3LQQA 2DXIA 2HWJA 2L7IA 2LHCA 4M9XA 4DBGB 4LF8M 1DV0A 4F2LA 1L1TA 3DZDA 3PFIA 1I94M 1HT1E 1QZEA 1NVMA 5H37D 3MHVC 5KQDA 1VDDA 4CHTB 5BR8M 4LFCM 1QAOA 1Q02A 2GNOA 1GVNA 2P5TA 4LRSA 4QHSA 1Q3CA 4LJ8A 1QAMA 1IN8A 5L8RF 2O5RA 1OTRA 4NSOB 1W5SA 2LVOC 4IIWA 2EKKA 2G5GX 3HY5A 3GPPA 1WJ7A 3T1HM 4JI4M 5EQTA 1C1KA 2QBYB 1TF0B 2CEAA 2AHMA 1E32A 3U5ZB 2CWBA 3NWLA 2G3QA 3AFHA 1PJJA 3HJ8A 1QUSA 2QPAA 2VF8A 3R8FA 4LF4M 1PJSA 3H4MA 4L8RC 2R0IA 3ILKA 2L4FA 3LVWA 2XFSA 2Y20A 1J7KA 2M60A 4BB9A 2R62A 4PT5A 4AZFA 3FTEA 2YNMD 4NOOB 2JY7A 3QYBA 5FTJA 2CV2A 4GMQA 5EXSA 2KHHA 3FYDA 4DV4M 4GKJM 2KDLA 5F3WA 1OQYA 1ZAEA 2YQZA 4MGHA 4L15A 3V76A 3U6LA 2V1UA 4RF1A 4JI7M 2QENA 3MMPA 1G71A 4QHTA 3HU1A 2VQEM 4II7A 3K9PA 3HHWA 2X4AA 1WGNA 3U61A 4LGMA 2RGOA 1IM2A 2KXEA 2KZUA 4EIWA 1EIJA 1DO0A 2VF7A 4X64M 2DKLA 3CF0A 4IBCA 5LMUM 1XXHA 1GKIA 1VEGA 4LJAA 1IXRC 2JZ0A 3PNVA 4JI5M 1TGUA 2L6OA 1YSYA 1OIZA 2DAMA 4KLNA 4LJ7A 1QUTA 2UUAM 2R4EA 3NBXX 4LJ6A 4JN6A 2KW0A 1YE9A 1FNNA 1WIVA 4PD2A 2ZAOA 4KT0F 3L2AA 1SXJB 5E26A 4CGYB 2F5OA 1R6BX 1XXHB 1TDHA 2O25A 4RKUF 2LVQD 2LVAA 1NNJA 1PGYA 2JUJA 2FNAA 2LVNC 3ZQJA 1OJLA 4G4QA 5EXPA 4DR7M 3HWSA 4FCWA 1IY1A 2K47A 1HR0M 1ZMVA 4HEOA 4IBJA 2JXNA 4MGZE 4R3DA 3SHFA 4DR5M 3BBZA 4I8OA 1C7YA 3U60A 2K9DA 3MK6A 1UM8A 4MGYE 3IHPA 2GQFA 5ITYA 5FTMA 1JR3D 1PJTA 8CATA 4IJFA 3GLIA 2E5LM 4QNMA 1VEJA 5A2QS 2CHQA 1GJTA 2OQ4A 3SAWA 3J80S 4AQYM 1K82A 2UXCM 5KPRA 2CRUA 2KNVA 4NXNM 1R5LA 2Z8YM 3U60B 5E6JA 1DGHA 4P16A 4LF7M 3CGWA 3K1JA 1TH2A 3KP1E 4IBFA 4S12A 4FD2A 2DAGA 4LF9M 5DFLA 1N33M 2EKFA 4LCBA 2QP9X 2R44A 4W5WA 2JY6B 1G8PA 5FTNA 1VQ1A 2XZUA 1BVSA 1R2YA 3TPZA 3HJSA 1DGHB 4AI6A 2FOIC 2JP7A 1UFZA 2R45A 4I81A 1XMOM 1TR8A 5DNYA 3TWMA 4DV6M 2JWSA 1NHGC 4UN2B 3MJ5A 1IXZA 2N35A 4LJ4A 1E94E 2RKOA 4B7GA 3E9SA 4XK8F 2Z7JA 4GIPA 4JI2M 3I4VA 2DNAA 1NNUC 4M9SA 5JI3E 3FRHA 4ZPXA 1NY6A 2XZFA 3SATA 3TQSA 2DHRA 3UMMA 3GLGB 1V92A 2VIIA 4RF0A 5ITQA 2L4EA 3GLHA 3FUTA 3A45A 3SARA 3K2LA 1NJFA 4WURA 3SASA 3VLFB 3C3EA 1LV7A 3D8LA 4OX9M 2HCBA 3QYEA 4IBEA 3WHLA 2OPFA 4X62M 3B9PA 2OOBA 3E4RA 1SXJE 4P17A 1XXHE 3GP1A 4DR2M 4OVZA 3IG5A 2F5SA 4QOSA 4YY3M 2MGWA 4LF6M 2RRUA 4G3OA 4KO8A 4LZZA 3OTOM 3L26A 2FE8A 3GPUA 4LFAM 1QAQA 2UU9M 1ZV1A 1S3SA 1IXSA 1WGLA 3SFZA 5FSWA 4IJEA 3TE6A 5ITUA 4BBAA 3GPYA 4OW0A 2LWXA 3KOYE 3Q8GA 2LH0A 4F1IA 4QOZC 3FTCA 2K6BA 1PJIA 4GKKM 1HJPA 1G4AE 4Z8XA 7CATA 4OVZB 2DAKA 2O01F 2XH9A 3F92A 3GRRA 1EE8A 3L29A 2BWEA 3DOAA 3SBJA 1MU5A 3ZH9B 5ITRA 3GRUA 3VK7A 3FKEA 4KODA 3I01M 2JA2A 3HHYA 3FE3A 3TWLA 1H6UA 1Q39A 4HL4A 1XMQM 1HNXM 2JZ1A 4L78A 2WSEF 3M6AA 2F5QA 4LJ9A 3SAUA 2F5PA 3KW6A 2Z3XA 1OAOC 1R2ZA 3ZCBB 2NQ8C 1N32M 4MB7A 4QNRA 3W0FA 1G41A 1ZMWA 4YHHM 1HT2E 1GL6A 3AJIB 3DA1A 2FS1A 1DGBA 2L2DA 2XEPA 3RE8A 4DV7M 1OKSA 4JXJA 4WP2A 1D0LA 4X65M 2WSCF 1AUAA 1HQCA 4CJ6A 1Z5BA 4M9ZA 4B7FA 4B3RM 1V33A 2Y21A 3GLFA 1N34M 4JI1M 4IBIA 1F4IA 1PRBA 4JV5M 3FTFA 1L2BA 2W82A 4MGKE 2XSZA 3U61B 2CV0A 4LFBM 3VFDA 3PVSA 2CP8A 2DWZB 3VK8A 3B89A 3GQ5A 3SYKA 5ITXE 1K3XA 4R7GA 4DV0M 4GITA 3GLGE 2QNJA 3UK6A 1N77A 1NO1A 3H4JA 1IN4A 2C9OA 5KQ8A 2OOAA 1Z5AA 1D0KA 1Z6TA 1NJGA 3UZUA 2CFOA 1SXJD 3E46A 1IN6A 3A42A 1IBLM 4GHLA 2DZNB 3DFZA 4BLCA 3FRIA 1P3QQ 1YLAA 3M0EA 1JR3A 1A5TA 4CIZA 2G8LA 3SMPA 2H1RA 3WHKA 2Z4RA 3UGJA 4LRTA 2UUCM 4JI6M 2J7OA 4DR3M 1XNRM 1TTEA 1IN7A 3B7QA 2MJ5B 3K92A 1NV9A 2EJSA 2QHOB 2YR0A 3W67A 1DO2A 2L09A 2KA6B 3C9PA 1OFHA 2C99A 5IT9S 2F5NA 4A3VB 2JY8A 1WR1B 2M5ZA 1NY5A 2QSFX 3I51A 1HNWM 2MH8A 4LF5M 3GLIB 2CV1A 1J5EM 5JI2E 2CE7A 3HU3A 3IG8A 4DV3M 4DV5M 2Y0TA 3KVWA 3LQRA 3GPXA 1TH3A 2C5RA 1MJGM 1T6OA 2L7HA 4NL4H 1GO5A 2DWLA 2DZLA 2DAIA 4FVMA 4WW0A 1Z5CA 2MR9A 2XLJA 3J7AS 2EO2A 2UXBM 1ZQ9A 2DHYA 3HU2A 2A5YB 1LTMA 3M7GA 1JB0F 3VDUA 3VDPA 4LGYA 4GC5A 1QANA 1QDRA 4CISA 1VEKA 3FUVA 2UUBM 4REZA 3B7NA 4G4OA 3SHGB 1IFYA 4L16A 1G59A 2HHHM 3R9XB 2ZTDA 3TWKA 2V6ZM 3FTDA 3JAMS 3FD9A 1NHWC 4OU7A 3AKZA 3B74A 1MN3A 1NSFA 4GC9A 4DV1M 2EA0A 4DR4M 1EFUB 1GLNA 4G6ZA 4NSRA 4PCZA 3KOZE 4D80A 5EXXA 1AIPC 1X37A 2WZJA 3AOEC 1CUKA 2I7PA 2QCUA 3PXGA 3L25A 3T15A 1QVRA 3FUUA 4R71A 3A98B 2CHVA 3W0LB 2BWBA 2X8AA 5C18A 3GLHB 1XHBA 1PM5A 1FJGM 1R7RA 3KSXA 4IBKA 2R18A 2C96A 2YFQA 2FH0A 2LHGA 1QYRA 3J27B 4Q7JA 2XF3A 3KSJA 1IBKM 2KRUA 2LVPC 3I04M 3W68A 2DENA 2KEBA 3KOWE 1G3IA 4DR6M 2Q2EB 4AKGA 2DVWB 1YUBA 4DV2M 4XBOA 1L8QA 2JY5A 4IBDA 3JR4A 4XGIA 2DI0A 1QQWA 4AKIA 3VKHA 3KOXE 3HGIA 2BJVA 2B3TA 3PNYA 4M0WA 1IXSB 2QBYA 1OIPA 1WXQA 1QDTA 3T6PA 3U5ZA 1D2NA 1SG9A 4LY6A 4I4LA 1GJSA 2BNKA 2KNZA 5IREB 1JR3E 5C1BA 1Z59A 3KFUG 3J2PB 4GRIA 3QAUA 2R46A 1ORYB 5FTKA 1TDZA 4B3TM 3GLIE 3LCUA 4LG2A 5ITTA 3GRVA 3EIHA 2QQ8A 3U6OA 1MX0A 2DWNA 3JR5A 4G4RA 4HLQA 2KNAA 4L4UA 4NRWA 2D7GA 3KS4A 1I4WA 3C58A 2R4JA 1N78A 1RU3A 5KPZA 1OAIA 4ITQA 2RGHA 3RGPA 2C98A 4MGIE 1SXJC 1Y8GA 3FUXA 5EP2A 1HQYE 2LTUA 2R65A 3LCVB 3RFWA 1ZMUA 1IY0A 2DAEA 3IECA 3U6DA 1L1ZA 4JI8M 4X66M 1DGGA 2I7NA 4DUYM 2LBCA 2F4VM 3I4YA 4AW4A 1XWIA 1N75A 1KFVA 2LXEA 2JNHA 3KS8A 4M0DA 4IBGA 3EIEA 2D7HA 3LMMA 2FFJA 1E9SA 3CF2A 4AG6A 4NRVA 3GLFB 2APLA 3A46A 3SC3A 3T1YM 4B08A 1SXJA 5DYIA 2J5YA 1IQPA 1K3WA 2BJWA 3BOSA 4NC6A 3U6MA 1XB2B 3NBIA 1WHCA 1QZMA 4GH9A 2XFTA 4IBBA 1JQJC 1J09A 2LNHC 3LW5F 5EP3A 1GL7A 4RNAA 5EP1A 3GO8A 3D8BA 3K9OA
chains in the Genus database with same CATH topology
1KSFX 2XSZD 5GKNA 4I5SA 2HL7A 3GRYA 5KO3A 2QZ4A 3HHXA 5FTLA 2EUCA 4B3MM 1XNQM 3KXEC 4MH0E 1T3TA 5EJCA 5LMNM 4FWGA 1Q3BA 3AV0A 4FWDA 4FWHA 5IWAM 4JI3M 3THGA 3U6SA 4FW9A 2C9CA 4D82A 2KZSA 4PDGA 3U6EA 3U6CA 1IN5A 3TL4X 1N36M 3U6PA 1HNZM 1DGFA 4FCTA 2ZM6M 4G4NA 2DWMA 3J81S 3FYCA 4DR1M 4JI0M 3HJQA 2CHGA 4PDIA 2Y0QA 3K8ZA 2VQFM 3AL0C 2ZAMA 2J7NA 3GQ3A 3VKGA 5KPTA 5BPVA 2D7EA 5FLXS 5EP4A 1TH4A 2ZBKB 2UXDM 3CF6E 4KHPM 4D81A 4GHAA 2KRKA 5ITXA 3UJNA 2X49A 1IY2A 3SYLA 3GLGA 1IBMM 4K0KM 4FCVA 4LZJA 4AG5A 1W5TA 2CUZA 3QWLA 1L2CA 3HKPA 4B3SM 5EXTA 1XC8A 2Z4SA 3CTWB 1KYIA 2V1CA 4TUWA 4AKHA 3L28A 4DUZM 3SAVA 5DYGA 4NXMM 3AOGA 3FUWA 3KDSE 3L27A 3U6QA 2HKJA 3Q8XA 2ZANA 2DZOB 1L2DA 2ERCA 2XGNA 4LJ5A 3ZC7B 4B7HA 1E9RA 3J7BA 3HHZA 3KP0E 3GQ4A 3SMSA 3AOEA 1OFIA 4Z6YA 4MM3B 5IZ7D 3RGSA 4JYAM 3T38A 3LVVA 3LQQA 2DXIA 2L7IA 4LF8M 4M9XA 1L1TA 3DZDA 3PFIA 1I94M 1HT1E 1NVMA 5H37D 3MHVC 5KQDA 1VDDA 4CHTB 5BR8M 4LFCM 1QAOA 2P5TA 1GVNA 4LRSA 4QHSA 1Q3CA 4LJ8A 1QAMA 1IN8A 2O5RA 4NSOB 1W5SA 4IIWA 3GPPA 2G5GX 4JI4M 3T1HM 5EQTA 1C1KA 2QBYB 2CEAA 2AHMA 1E32A 3U5ZB 3NWLA 3AFHA 1PJJA 3HJ8A 2QPAA 3R8FA 4LF4M 4AKGA 3H4MA 4L8RC 3ILKA 3LVWA 2XFSA 2Y20A 1J7KA 2M60A 4BB9A 2R62A 4PT5A 4AZFA 3FTEA 2YNMD 4NOOB 5FTJA 2CV2A 4GMQA 5EXSA 3FYDA 4DV4M 4GKJM 5F3WA 1ZAEA 4JI7M 2YQZA 4MGHA 4L15A 3U6LA 2V1UA 4RF1A 2QENA 2VQEM 4QHTA 3HU1A 4II7A 3HHWA 2X4AA 3U61A 4LGMA 2RGOA 1IM2A 2KXEA 2KZUA 4EIWA 1DO0A 4X64M 3CF0A 4IBCA 5LMUM 1XXHA 1GKIA 4LJAA 1IXRC 3PNVA 4JI5M 1TGUA 2L6OA 1YSYA 4LJ7A 4KLNA 2UUAM 2R4EA 4LJ6A 4JN6A 2KW0A 1YE9A 1FNNA 4PD2A 2ZAOA 3L2AA 1SXJB 5E26A 4CGYB 2F5OA 1R6BX 1XXHB 1TDHA 1NNJA 2FNAA 1OJLA 4G4QA 5EXPA 4DR7M 3HWSA 4FCWA 1IY1A 2K47A 1HR0M 4IBJA 4MGZE 4R3DA 3SHFA 4DR5M 4I8OA 3U60A 3MK6A 1UM8A 4MGYE 5ITYA 5FTMA 1JR3D 8CATA 4IJFA 3GLIA 2E5LM 4QNMA 5A2QS 2CHQA 2OQ4A 3SAWA 3J80S 4AQYM 1K82A 2UXCM 5KPRA 4NXNM 3U60B 5E6JA 1DGHA 4P16A 4LF7M 3K1JA 1TH2A 3KP1E 4IBFA 4S12A 4FD2A 4LF9M 1N33M 4LCBA 2QP9X 4W5WA 1G8PA 5FTNA 2XZUA 1R2YA 3TPZA 3HJSA 1DGHB 4AI6A 2FOIC 2R45A 4I81A 1XMOM 5DNYA 3TWMA 4DV6M 1NHGC 3MJ5A 1IXZA 4LJ4A 1E94E 2RKOA 4B7GA 3E9SA 2Z7JA 4GIPA 4JI2M 3I4VA 1NNUC 4M9SA 5JI3E 4ZPXA 2XZFA 1NY6A 3SATA 3TQSA 2DHRA 3UMMA 3GLGB 2VIIA 4RF0A 5ITQA 3GLHA 3FUTA 3A45A 3SARA 3K2LA 1NJFA 4WURA 3SASA 3VLFB 3D8LA 1LV7A 4OX9M 2HCBA 4IBEA 3WHLA 2OPFA 4X62M 3B9PA 3E4RA 1SXJE 3GP1A 4DR2M 4OVZA 3IG5A 2F5SA 4QOSA 4YY3M 4LF6M 4KO8A 4LZZA 3OTOM 3L26A 3GPUA 2FE8A 4LFAM 1QAQA 2UU9M 1S3SA 5FSWA 3SFZA 4IJEA 3TE6A 5ITUA 4BBAA 3GPYA 4OW0A 2LWXA 3KOYE 4QOZC 2LH0A 3FTCA 1PJIA 4GKKM 1G4AE 4Z8XA 7CATA 4OVZB 2XH9A 3GRRA 1EE8A 3L29A 3SBJA 3DOAA 1MU5A 3ZH9B 5ITRA 3GRUA 3VK7A 3FKEA 4KODA 2JA2A 3HHYA 3TWLA 1XMQM 1H6UA 1Q39A 4HL4A 2F5QA 1HNXM 4L78A 3M6AA 4LJ9A 3SAUA 2F5PA 3KW6A 2Z3XA 1R2ZA 3ZCBB 2NQ8C 1N32M 4MB7A 4QNRA 3W0FA 1G41A 4YHHM 1HT2E 1GL6A 3AJIB 3DA1A 1DGBA 2XEPA 3RE8A 4DV7M 4JXJA 4X65M 1HQCA 1Z5BA 4M9ZA 4B7FA 4B3RM 2Y21A 3GLFA 1N34M 4JI1M 4IBIA 4JV5M 3FTFA 1L2BA 2W82A 4MGKE 2XSZA 3U61B 2CV0A 4LFBM 3VFDA 3PVSA 2DWZB 3VK8A 3GQ5A 3SYKA 5ITXE 1K3XA 4R7GA 4DV0M 4GITA 3UK6A 1N77A 1IN4A 2C9OA 5KQ8A 1Z5AA 1Z6TA 1NJGA 3UZUA 2CFOA 1SXJD 1IN6A 3A42A 1IBLM 4GHLA 2DZNB 3DFZA 4BLCA 3M0EA 1JR3A 2G8LA 3SMPA 2H1RA 3WHKA 2Z4RA 3UGJA 4LRTA 2UUCM 4JI6M 2J7OA 4DR3M 1XNRM 1IN7A 3K92A 2YR0A 1DO2A 2L09A 2KA6B 1OFHA 2C99A 5IT9S 2F5NA 4A3VB 1HNWM 2M5ZA 1NY5A 3I51A 4LF5M 3GLIB 2CV1A 1J5EM 5JI2E 2CE7A 3HU3A 3IG8A 4DV3M 4DV5M 2Y0TA 3KVWA 3LQRA 3GPXA 1TH3A 2C5RA 2L7HA 4NL4H 2DWLA 4FVMA 4WW0A 1Z5CA 2XLJA 3J7AS 2EO2A 2UXBM 1ZQ9A 3HU2A 2A5YB 3M7GA 3VDUA 3VDPA 4LGYA 4GC5A 1QANA 4CISA 3FUVA 2UUBM 4REZA 4G4OA 3SHGB 4L16A 1G59A 2HHHM 3R9XB 3TWKA 2V6ZM 3FTDA 3JAMS 3FD9A 1NHWC 4OU7A 3AKZA 1NSFA 4GC9A 4DV1M 2EA0A 4DR4M 1GLNA 4G6ZA 4NSRA 4PCZA 3KOZE 4D80A 5EXXA 1X37A 3AOEC 3PXGA 2I7PA 2QCUA 3L25A 3T15A 1QVRA 3FUUA 3A98B 2CHVA 3W0LB 2X8AA 5C18A 3GLHB 1XHBA 1PM5A 1FJGM 1R7RA 3KSXA 4IBKA 2R18A 2C96A 2YFQA 1QYRA 3J27B 2XF3A 3KSJA 1IBKM 2KRUA 2KEBA 3KOWE 4DR6M 1G3IA 2Q2EB 2DVWB 1YUBA 4DV2M 4XBOA 1L8QA 4IBDA 3JR4A 4XGIA 4AKIA 1QQWA 3VKHA 3KOXE 3HGIA 2BJVA 3PNYA 4M0WA 1IXSB 2QBYA 1WXQA 3U5ZA 1D2NA 4LY6A 4I4LA 2BNKA 5IREB 5C1BA 1Z59A 3KFUG 3J2PB 4GRIA 3QAUA 2R46A 1ORYB 5FTKA 1TDZA 4B3TM 4LG2A 5ITTA 3GRVA 3EIHA 3U6OA 1MX0A 2DWNA 3JR5A 4G4RA 4HLQA 4L4UA 4NRWA 2D7GA 3KS4A 1I4WA 3C58A 2R4JA 1N78A 5KPZA 4ITQA 2RGHA 3RGPA 2C98A 4MGIE 1SXJC 3FUXA 5EP2A 1HQYE 2R65A 3RFWA 1IY0A 3U6DA 1L1ZA 4JI8M 4X66M 1DGGA 2I7NA 4DUYM 2F4VM 3I4YA 4AW4A 1XWIA 1N75A 1KFVA 2LXEA 3KS8A 4M0DA 4IBGA 3EIEA 2D7HA 3LMMA 2FFJA 1E9SA 3CF2A 4AG6A 4NRVA 3GLFB 3A46A 3SC3A 3T1YM 4B08A 1SXJA 5DYIA 1IQPA 1K3WA 2BJWA 3BOSA 3U6MA 3NBIA 1QZMA 4GH9A 2XFTA 4IBBA 1JQJC 1J09A 2LNHC 5EP3A 5EP1A 1GL7A 4RNAA 3GO8A 3D8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y21 A;  2Y0T A;  4I5S A;  2Y20 A;  2L7I A;  2L7H A;  2Y0Q A; 
#chains in the Genus database with same CATH topology
 1KSF X;  2XSZ D;  5GKN A;  1D0M A;  4I5S A;  4L6V 6;  2HL7 A;  3GRY A;  5KO3 A;  2QZ4 A;  3HHX A;  5FTL A;  2EUC A;  4B3M M;  1XNQ M;  1V34 A;  3KXE C;  4MH0 E;  1T3T A;  5EJC A;  5LMN M;  1PJQ A;  4FWG A;  1Q3B A;  3AV0 A;  4FWD A;  4FWH A;  3B7Z A;  4JI3 M;  5IWA M;  3THG A;  3U6S A;  4Y28 F;  4FW9 A;  2C9C A;  4D82 A;  2KZS A;  4PDG A;  3U6E A;  3HZJ A;  3U6C A;  1IN5 A;  3GLH E;  3TL4 X;  4ANR A;  3U6P A;  1DGF A;  4FCT A;  2ZM6 M;  1N36 M;  4G4N A;  2DWM A;  3J81 S;  3FYC A;  1T43 A;  4DR1 M;  4JI0 M;  3HJQ A;  2CHG A;  4PDI A;  2Y0Q A;  1HNZ M;  3K8Z A;  2VQF M;  3AL0 C;  1NV8 A;  2VDB B;  2ZAM A;  2J7N A;  3GQ3 A;  2H5X A;  3VKG A;  5KPT A;  5BPV A;  2MRO B;  2D7E A;  5FLX S;  5EP4 A;  1TH4 A;  2ZBK B;  2UXD M;  3CF6 E;  1GAB A;  3E21 A;  4KHP M;  4D81 A;  4GHA A;  2KRK A;  5ITX A;  3UJN A;  2X49 A;  1IY2 A;  3SYL A;  3GLG A;  1IBM M;  4K0K M;  2HAK A;  4FCV A;  4LZJ A;  4AG5 A;  1W5T A;  2ZTC A;  2CUZ A;  3QWL A;  1L2C A;  3HKP A;  4B3S M;  5EXT A;  1XC8 A;  2Z4S A;  3CTW B;  1R4G A;  1KYI A;  2V1C A;  4TUW A;  4AKH A;  3HX3 A;  3L28 A;  4DUZ M;  3SAV A;  5DYG A;  2WSF F;  3C3D A;  4NXM M;  3BXW A;  3AOG A;  3FUW A;  3GLF E;  3KDS E;  3L27 A;  3U6Q A;  2HKJ A;  3Q8X A;  2ZAN A;  2DZO B;  1L2D A;  2ERC A;  2K0B X;  2XGN A;  4LJ5 A;  3ZC7 B;  4B7H A;  1E9R A;  1VDL A;  3J7B A;  3HHZ A;  3KP0 E;  2OO9 A;  4GEW A;  3GQ4 A;  3SMS A;  3AOE A;  1OFI A;  4Z6Y A;  2R6F A;  1VG5 A;  4MM3 B;  5IZ7 D;  3RGS A;  4JYA M;  3T38 A;  3LVV A;  3LQQ A;  2DXI A;  2HWJ A;  2L7I A;  2LHC A;  4M9X A;  4DBG B;  4LF8 M;  1DV0 A;  4F2L A;  1L1T A;  3DZD A;  3PFI A;  1I94 M;  1HT1 E;  1QZE A;  1NVM A;  5H37 D;  3MHV C;  5KQD A;  1VDD A;  4CHT B;  5BR8 M;  4LFC M;  1QAO A;  1Q02 A;  2GNO A;  1GVN A;  2P5T A;  4LRS A;  4QHS A;  1Q3C A;  4LJ8 A;  1QAM A;  1IN8 A;  5L8R F;  2O5R A;  1OTR A;  4NSO B;  1W5S A;  2LVO C;  4IIW A;  2EKK A;  2G5G X;  3HY5 A;  3GPP A;  1WJ7 A;  3T1H M;  4JI4 M;  5EQT A;  1C1K A;  2QBY B;  1TF0 B;  2CEA A;  2AHM A;  1E32 A;  3U5Z B;  2CWB A;  3NWL A;  2G3Q A;  3AFH A;  1PJJ A;  3HJ8 A;  1QUS A;  2QPA A;  2VF8 A;  3R8F A;  4LF4 M;  1PJS A;  3H4M A;  4L8R C;  2R0I A;  3ILK A;  2L4F A;  3LVW A;  2XFS A;  2Y20 A;  1J7K A;  2M60 A;  4BB9 A;  2R62 A;  4PT5 A;  4AZF A;  3FTE A;  2YNM D;  4NOO B;  2JY7 A;  3QYB A;  5FTJ A;  2CV2 A;  4GMQ A;  5EXS A;  2KHH A;  3FYD A;  4DV4 M;  4GKJ M;  2KDL A;  5F3W A;  1OQY A;  1ZAE A;  2YQZ A;  4MGH A;  4L15 A;  3V76 A;  3U6L A;  2V1U A;  4RF1 A;  4JI7 M;  2QEN A;  3MMP A;  1G71 A;  4QHT A;  3HU1 A;  2VQE M;  4II7 A;  3K9P A;  3HHW A;  2X4A A;  1WGN A;  3U61 A;  4LGM A;  2RGO A;  1IM2 A;  2KXE A;  2KZU A;  4EIW A;  1EIJ A;  1DO0 A;  2VF7 A;  4X64 M;  2DKL A;  3CF0 A;  4IBC A;  5LMU M;  1XXH A;  1GKI A;  1VEG A;  4LJA A;  1IXR C;  2JZ0 A;  3PNV A;  4JI5 M;  1TGU A;  2L6O A;  1YSY A;  1OIZ A;  2DAM A;  4KLN A;  4LJ7 A;  1QUT A;  2UUA M;  2R4E A;  3NBX X;  4LJ6 A;  4JN6 A;  2KW0 A;  1YE9 A;  1FNN A;  1WIV A;  4PD2 A;  2ZAO A;  4KT0 F;  3L2A A;  1SXJ B;  5E26 A;  4CGY B;  2F5O A;  1R6B X;  1XXH B;  1TDH A;  2O25 A;  4RKU F;  2LVQ D;  2LVA A;  1NNJ A;  1PGY A;  2JUJ A;  2FNA A;  2LVN C;  3ZQJ A;  1OJL A;  4G4Q A;  5EXP A;  4DR7 M;  3HWS A;  4FCW A;  1IY1 A;  2K47 A;  1HR0 M;  1ZMV A;  4HEO A;  4IBJ A;  2JXN A;  4MGZ E;  4R3D A;  3SHF A;  4DR5 M;  3BBZ A;  4I8O A;  1C7Y A;  3U60 A;  2K9D A;  3MK6 A;  1UM8 A;  4MGY E;  3IHP A;  2GQF A;  5ITY A;  5FTM A;  1JR3 D;  1PJT A;  8CAT A;  4IJF A;  3GLI A;  2E5L M;  4QNM A;  1VEJ A;  5A2Q S;  2CHQ A;  1GJT A;  2OQ4 A;  3SAW A;  3J80 S;  4AQY M;  1K82 A;  2UXC M;  5KPR A;  2CRU A;  2KNV A;  4NXN M;  1R5L A;  2Z8Y M;  3U60 B;  5E6J A;  1DGH A;  4P16 A;  4LF7 M;  3CGW A;  3K1J A;  1TH2 A;  3KP1 E;  4IBF A;  4S12 A;  4FD2 A;  2DAG A;  4LF9 M;  5DFL A;  1N33 M;  2EKF A;  4LCB A;  2QP9 X;  2R44 A;  4W5W A;  2JY6 B;  1G8P A;  5FTN A;  1VQ1 A;  2XZU A;  1BVS A;  1R2Y A;  3TPZ A;  3HJS A;  1DGH B;  4AI6 A;  2FOI C;  2JP7 A;  1UFZ A;  2R45 A;  4I81 A;  1XMO M;  1TR8 A;  5DNY A;  3TWM A;  4DV6 M;  2JWS A;  1NHG C;  4UN2 B;  3MJ5 A;  1IXZ A;  2N35 A;  4LJ4 A;  1E94 E;  2RKO A;  4B7G A;  3E9S A;  4XK8 F;  2Z7J A;  4GIP A;  4JI2 M;  3I4V A;  2DNA A;  1NNU C;  4M9S A;  5JI3 E;  3FRH A;  4ZPX A;  1NY6 A;  2XZF A;  3SAT A;  3TQS A;  2DHR A;  3UMM A;  3GLG B;  1V92 A;  2VII A;  4RF0 A;  5ITQ A;  2L4E A;  3GLH A;  3FUT A;  3A45 A;  3SAR A;  3K2L A;  1NJF A;  4WUR A;  3SAS A;  3VLF B;  3C3E A;  1LV7 A;  3D8L A;  4OX9 M;  2HCB A;  3QYE A;  4IBE A;  3WHL A;  2OPF A;  4X62 M;  3B9P A;  2OOB A;  3E4R A;  1SXJ E;  4P17 A;  1XXH E;  3GP1 A;  4DR2 M;  4OVZ A;  3IG5 A;  2F5S A;  4QOS A;  4YY3 M;  2MGW A;  4LF6 M;  2RRU A;  4G3O A;  4KO8 A;  4LZZ A;  3OTO M;  3L26 A;  2FE8 A;  3GPU A;  4LFA M;  1QAQ A;  2UU9 M;  1ZV1 A;  1S3S A;  1IXS A;  1WGL A;  3SFZ A;  5FSW A;  4IJE A;  3TE6 A;  5ITU A;  4BBA A;  3GPY A;  4OW0 A;  2LWX A;  3KOY E;  3Q8G A;  2LH0 A;  4F1I A;  4QOZ C;  3FTC A;  2K6B A;  1PJI A;  4GKK M;  1HJP A;  1G4A E;  4Z8X A;  7CAT A;  4OVZ B;  2DAK A;  2O01 F;  2XH9 A;  3F92 A;  3GRR A;  1EE8 A;  3L29 A;  2BWE A;  3DOA A;  3SBJ A;  1MU5 A;  3ZH9 B;  5ITR A;  3GRU A;  3VK7 A;  3FKE A;  4KOD A;  3I01 M;  2JA2 A;  3HHY A;  3FE3 A;  3TWL A;  1H6U A;  1Q39 A;  4HL4 A;  1XMQ M;  1HNX M;  2JZ1 A;  4L78 A;  2WSE F;  3M6A A;  2F5Q A;  4LJ9 A;  3SAU A;  2F5P A;  3KW6 A;  2Z3X A;  1OAO C;  1R2Z A;  3ZCB B;  2NQ8 C;  1N32 M;  4MB7 A;  4QNR A;  3W0F A;  1G41 A;  1ZMW A;  4YHH M;  1HT2 E;  1GL6 A;  3AJI B;  3DA1 A;  2FS1 A;  1DGB A;  2L2D A;  2XEP A;  3RE8 A;  4DV7 M;  1OKS A;  4JXJ A;  4WP2 A;  1D0L A;  4X65 M;  2WSC F;  1AUA A;  1HQC A;  4CJ6 A;  1Z5B A;  4M9Z A;  4B7F A;  4B3R M;  1V33 A;  2Y21 A;  3GLF A;  1N34 M;  4JI1 M;  4IBI A;  1F4I A;  1PRB A;  4JV5 M;  3FTF A;  1L2B A;  2W82 A;  4MGK E;  2XSZ A;  3U61 B;  2CV0 A;  4LFB M;  3VFD A;  3PVS A;  2CP8 A;  2DWZ B;  3VK8 A;  3B89 A;  3GQ5 A;  3SYK A;  5ITX E;  1K3X A;  4R7G A;  4DV0 M;  4GIT A;  3GLG E;  2QNJ A;  3UK6 A;  1N77 A;  1NO1 A;  3H4J A;  1IN4 A;  2C9O A;  5KQ8 A;  2OOA A;  1Z5A A;  1D0K A;  1Z6T A;  1NJG A;  3UZU A;  2CFO A;  1SXJ D;  3E46 A;  1IN6 A;  3A42 A;  1IBL M;  4GHL A;  2DZN B;  3DFZ A;  4BLC A;  3FRI A;  1P3Q Q;  1YLA A;  3M0E A;  1JR3 A;  1A5T A;  4CIZ A;  2G8L A;  3SMP A;  2H1R A;  3WHK A;  2Z4R A;  3UGJ A;  4LRT A;  2UUC M;  4JI6 M;  2J7O A;  4DR3 M;  1XNR M;  1TTE A;  1IN7 A;  3B7Q A;  2MJ5 B;  3K92 A;  1NV9 A;  2EJS A;  2QHO B;  2YR0 A;  3W67 A;  1DO2 A;  2L09 A;  2KA6 B;  3C9P A;  1OFH A;  2C99 A;  5IT9 S;  2F5N A;  4A3V B;  2JY8 A;  1WR1 B;  2M5Z A;  1NY5 A;  2QSF X;  3I51 A;  1HNW M;  2MH8 A;  4LF5 M;  3GLI B;  2CV1 A;  1J5E M;  5JI2 E;  2CE7 A;  3HU3 A;  3IG8 A;  4DV3 M;  4DV5 M;  2Y0T A;  3KVW A;  3LQR A;  3GPX A;  1TH3 A;  2C5R A;  1MJG M;  1T6O A;  2L7H A;  4NL4 H;  1GO5 A;  2DWL A;  2DZL A;  2DAI A;  4FVM A;  4WW0 A;  1Z5C A;  2MR9 A;  2XLJ A;  3J7A S;  2EO2 A;  2UXB M;  1ZQ9 A;  2DHY A;  3HU2 A;  2A5Y B;  1LTM A;  3M7G A;  1JB0 F;  3VDU A;  3VDP A;  4LGY A;  4GC5 A;  1QAN A;  1QDR A;  4CIS A;  1VEK A;  3FUV A;  2UUB M;  4REZ A;  3B7N A;  4G4O A;  3SHG B;  1IFY A;  4L16 A;  1G59 A;  2HHH M;  3R9X B;  2ZTD A;  3TWK A;  2V6Z M;  3FTD A;  3JAM S;  3FD9 A;  1NHW C;  4OU7 A;  3AKZ A;  3B74 A;  1MN3 A;  1NSF A;  4GC9 A;  4DV1 M;  2EA0 A;  4DR4 M;  1EFU B;  1GLN A;  4G6Z A;  4NSR A;  4PCZ A;  3KOZ E;  4D80 A;  5EXX A;  1AIP C;  1X37 A;  2WZJ A;  3AOE C;  1CUK A;  2I7P A;  2QCU A;  3PXG A;  3L25 A;  3T15 A;  1QVR A;  3FUU A;  4R71 A;  3A98 B;  2CHV A;  3W0L B;  2BWB A;  2X8A A;  5C18 A;  3GLH B;  1XHB A;  1PM5 A;  1FJG M;  1R7R A;  3KSX A;  4IBK A;  2R18 A;  2C96 A;  2YFQ A;  2FH0 A;  2LHG A;  1QYR A;  3J27 B;  4Q7J A;  2XF3 A;  3KSJ A;  1IBK M;  2KRU A;  2LVP C;  3I04 M;  3W68 A;  2DEN A;  2KEB A;  3KOW E;  1G3I A;  4DR6 M;  2Q2E B;  4AKG A;  2DVW B;  1YUB A;  4DV2 M;  4XBO A;  1L8Q A;  2JY5 A;  4IBD A;  3JR4 A;  4XGI A;  2DI0 A;  1QQW A;  4AKI A;  3VKH A;  3KOX E;  3HGI A;  2BJV A;  2B3T A;  3PNY A;  4M0W A;  1IXS B;  2QBY A;  1OIP A;  1WXQ A;  1QDT A;  3T6P A;  3U5Z A;  1D2N A;  1SG9 A;  4LY6 A;  4I4L A;  1GJS A;  2BNK A;  2KNZ A;  5IRE B;  1JR3 E;  5C1B A;  1Z59 A;  3KFU G;  3J2P B;  4GRI A;  3QAU A;  2R46 A;  1ORY B;  5FTK A;  1TDZ A;  4B3T M;  3GLI E;  3LCU A;  4LG2 A;  5ITT A;  3GRV A;  3EIH A;  2QQ8 A;  3U6O A;  1MX0 A;  2DWN A;  3JR5 A;  4G4R A;  4HLQ A;  2KNA A;  4L4U A;  4NRW A;  2D7G A;  3KS4 A;  1I4W A;  3C58 A;  2R4J A;  1N78 A;  1RU3 A;  5KPZ A;  1OAI A;  4ITQ A;  2RGH A;  3RGP A;  2C98 A;  4MGI E;  1SXJ C;  1Y8G A;  3FUX A;  5EP2 A;  1HQY E;  2LTU A;  2R65 A;  3LCV B;  3RFW A;  1ZMU A;  1IY0 A;  2DAE A;  3IEC A;  3U6D A;  1L1Z A;  4JI8 M;  4X66 M;  1DGG A;  2I7N A;  4DUY M;  2LBC A;  2F4V M;  3I4Y A;  4AW4 A;  1XWI A;  1N75 A;  1KFV A;  2LXE A;  2JNH A;  3KS8 A;  4M0D A;  4IBG A;  3EIE A;  2D7H A;  3LMM A;  2FFJ A;  1E9S A;  3CF2 A;  4AG6 A;  4NRV A;  3GLF B;  2APL A;  3A46 A;  3SC3 A;  3T1Y M;  4B08 A;  1SXJ A;  5DYI A;  2J5Y A;  1IQP A;  1K3W A;  2BJW A;  3BOS A;  4NC6 A;  3U6M A;  1XB2 B;  3NBI A;  1WHC A;  1QZM A;  4GH9 A;  2XFT A;  4IBB A;  1JQJ C;  1J09 A;  2LNH C;  3LW5 F;  5EP3 A;  1GL7 A;  4RNA A;  5EP1 A;  3GO8 A;  3D8B A;  3K9O A; 
#chains in the Genus database with same CATH homology
 1KSF X;  2XSZ D;  5GKN A;  4I5S A;  2HL7 A;  3GRY A;  5KO3 A;  2QZ4 A;  3HHX A;  5FTL A;  2EUC A;  4B3M M;  1XNQ M;  3KXE C;  4MH0 E;  1T3T A;  5EJC A;  5LMN M;  4FWG A;  1Q3B A;  3AV0 A;  4FWD A;  4FWH A;  5IWA M;  4JI3 M;  3THG A;  3U6S A;  4FW9 A;  2C9C A;  4D82 A;  2KZS A;  4PDG A;  3U6E A;  3U6C A;  1IN5 A;  3TL4 X;  1N36 M;  3U6P A;  1HNZ M;  1DGF A;  4FCT A;  2ZM6 M;  4G4N A;  2DWM A;  3J81 S;  3FYC A;  4DR1 M;  4JI0 M;  3HJQ A;  2CHG A;  4PDI A;  2Y0Q A;  3K8Z A;  2VQF M;  3AL0 C;  2ZAM A;  2J7N A;  3GQ3 A;  3VKG A;  5KPT A;  5BPV A;  2D7E A;  5FLX S;  5EP4 A;  1TH4 A;  2ZBK B;  2UXD M;  3CF6 E;  4KHP M;  4D81 A;  4GHA A;  2KRK A;  5ITX A;  3UJN A;  2X49 A;  1IY2 A;  3SYL A;  3GLG A;  1IBM M;  4K0K M;  4FCV A;  4LZJ A;  4AG5 A;  1W5T A;  2CUZ A;  3QWL A;  1L2C A;  3HKP A;  4B3S M;  5EXT A;  1XC8 A;  2Z4S A;  3CTW B;  1KYI A;  2V1C A;  4TUW A;  4AKH A;  3L28 A;  4DUZ M;  3SAV A;  5DYG A;  4NXM M;  3AOG A;  3FUW A;  3KDS E;  3L27 A;  3U6Q A;  2HKJ A;  3Q8X A;  2ZAN A;  2DZO B;  1L2D A;  2ERC A;  2XGN A;  4LJ5 A;  3ZC7 B;  4B7H A;  1E9R A;  3J7B A;  3HHZ A;  3KP0 E;  3GQ4 A;  3SMS A;  3AOE A;  1OFI A;  4Z6Y A;  4MM3 B;  5IZ7 D;  3RGS A;  4JYA M;  3T38 A;  3LVV A;  3LQQ A;  2DXI A;  2L7I A;  4LF8 M;  4M9X A;  1L1T A;  3DZD A;  3PFI A;  1I94 M;  1HT1 E;  1NVM A;  5H37 D;  3MHV C;  5KQD A;  1VDD A;  4CHT B;  5BR8 M;  4LFC M;  1QAO A;  2P5T A;  1GVN A;  4LRS A;  4QHS A;  1Q3C A;  4LJ8 A;  1QAM A;  1IN8 A;  2O5R A;  4NSO B;  1W5S A;  4IIW A;  3GPP A;  2G5G X;  4JI4 M;  3T1H M;  5EQT A;  1C1K A;  2QBY B;  2CEA A;  2AHM A;  1E32 A;  3U5Z B;  3NWL A;  3AFH A;  1PJJ A;  3HJ8 A;  2QPA A;  3R8F A;  4LF4 M;  4AKG A;  3H4M A;  4L8R C;  3ILK A;  3LVW A;  2XFS A;  2Y20 A;  1J7K A;  2M60 A;  4BB9 A;  2R62 A;  4PT5 A;  4AZF A;  3FTE A;  2YNM D;  4NOO B;  5FTJ A;  2CV2 A;  4GMQ A;  5EXS A;  3FYD A;  4DV4 M;  4GKJ M;  5F3W A;  1ZAE A;  4JI7 M;  2YQZ A;  4MGH A;  4L15 A;  3U6L A;  2V1U A;  4RF1 A;  2QEN A;  2VQE M;  4QHT A;  3HU1 A;  4II7 A;  3HHW A;  2X4A A;  3U61 A;  4LGM A;  2RGO A;  1IM2 A;  2KXE A;  2KZU A;  4EIW A;  1DO0 A;  4X64 M;  3CF0 A;  4IBC A;  5LMU M;  1XXH A;  1GKI A;  4LJA A;  1IXR C;  3PNV A;  4JI5 M;  1TGU A;  2L6O A;  1YSY A;  4LJ7 A;  4KLN A;  2UUA M;  2R4E A;  4LJ6 A;  4JN6 A;  2KW0 A;  1YE9 A;  1FNN A;  4PD2 A;  2ZAO A;  3L2A A;  1SXJ B;  5E26 A;  4CGY B;  2F5O A;  1R6B X;  1XXH B;  1TDH A;  1NNJ A;  2FNA A;  1OJL A;  4G4Q A;  5EXP A;  4DR7 M;  3HWS A;  4FCW A;  1IY1 A;  2K47 A;  1HR0 M;  4IBJ A;  4MGZ E;  4R3D A;  3SHF A;  4DR5 M;  4I8O A;  3U60 A;  3MK6 A;  1UM8 A;  4MGY E;  5ITY A;  5FTM A;  1JR3 D;  8CAT A;  4IJF A;  3GLI A;  2E5L M;  4QNM A;  5A2Q S;  2CHQ A;  2OQ4 A;  3SAW A;  3J80 S;  4AQY M;  1K82 A;  2UXC M;  5KPR A;  4NXN M;  3U60 B;  5E6J A;  1DGH A;  4P16 A;  4LF7 M;  3K1J A;  1TH2 A;  3KP1 E;  4IBF A;  4S12 A;  4FD2 A;  4LF9 M;  1N33 M;  4LCB A;  2QP9 X;  4W5W A;  1G8P A;  5FTN A;  2XZU A;  1R2Y A;  3TPZ A;  3HJS A;  1DGH B;  4AI6 A;  2FOI C;  2R45 A;  4I81 A;  1XMO M;  5DNY A;  3TWM A;  4DV6 M;  1NHG C;  3MJ5 A;  1IXZ A;  4LJ4 A;  1E94 E;  2RKO A;  4B7G A;  3E9S A;  2Z7J A;  4GIP A;  4JI2 M;  3I4V A;  1NNU C;  4M9S A;  5JI3 E;  4ZPX A;  2XZF A;  1NY6 A;  3SAT A;  3TQS A;  2DHR A;  3UMM A;  3GLG B;  2VII A;  4RF0 A;  5ITQ A;  3GLH A;  3FUT A;  3A45 A;  3SAR A;  3K2L A;  1NJF A;  4WUR A;  3SAS A;  3VLF B;  3D8L A;  1LV7 A;  4OX9 M;  2HCB A;  4IBE A;  3WHL A;  2OPF A;  4X62 M;  3B9P A;  3E4R A;  1SXJ E;  3GP1 A;  4DR2 M;  4OVZ A;  3IG5 A;  2F5S A;  4QOS A;  4YY3 M;  4LF6 M;  4KO8 A;  4LZZ A;  3OTO M;  3L26 A;  3GPU A;  2FE8 A;  4LFA M;  1QAQ A;  2UU9 M;  1S3S A;  5FSW A;  3SFZ A;  4IJE A;  3TE6 A;  5ITU A;  4BBA A;  3GPY A;  4OW0 A;  2LWX A;  3KOY E;  4QOZ C;  2LH0 A;  3FTC A;  1PJI A;  4GKK M;  1G4A E;  4Z8X A;  7CAT A;  4OVZ B;  2XH9 A;  3GRR A;  1EE8 A;  3L29 A;  3SBJ A;  3DOA A;  1MU5 A;  3ZH9 B;  5ITR A;  3GRU A;  3VK7 A;  3FKE A;  4KOD A;  2JA2 A;  3HHY A;  3TWL A;  1XMQ M;  1H6U A;  1Q39 A;  4HL4 A;  2F5Q A;  1HNX M;  4L78 A;  3M6A A;  4LJ9 A;  3SAU A;  2F5P A;  3KW6 A;  2Z3X A;  1R2Z A;  3ZCB B;  2NQ8 C;  1N32 M;  4MB7 A;  4QNR A;  3W0F A;  1G41 A;  4YHH M;  1HT2 E;  1GL6 A;  3AJI B;  3DA1 A;  1DGB A;  2XEP A;  3RE8 A;  4DV7 M;  4JXJ A;  4X65 M;  1HQC A;  1Z5B A;  4M9Z A;  4B7F A;  4B3R M;  2Y21 A;  3GLF A;  1N34 M;  4JI1 M;  4IBI A;  4JV5 M;  3FTF A;  1L2B A;  2W82 A;  4MGK E;  2XSZ A;  3U61 B;  2CV0 A;  4LFB M;  3VFD A;  3PVS A;  2DWZ B;  3VK8 A;  3GQ5 A;  3SYK A;  5ITX E;  1K3X A;  4R7G A;  4DV0 M;  4GIT A;  3UK6 A;  1N77 A;  1IN4 A;  2C9O A;  5KQ8 A;  1Z5A A;  1Z6T A;  1NJG A;  3UZU A;  2CFO A;  1SXJ D;  1IN6 A;  3A42 A;  1IBL M;  4GHL A;  2DZN B;  3DFZ A;  4BLC A;  3M0E A;  1JR3 A;  2G8L A;  3SMP A;  2H1R A;  3WHK A;  2Z4R A;  3UGJ A;  4LRT A;  2UUC M;  4JI6 M;  2J7O A;  4DR3 M;  1XNR M;  1IN7 A;  3K92 A;  2YR0 A;  1DO2 A;  2L09 A;  2KA6 B;  1OFH A;  2C99 A;  5IT9 S;  2F5N A;  4A3V B;  1HNW M;  2M5Z A;  1NY5 A;  3I51 A;  4LF5 M;  3GLI B;  2CV1 A;  1J5E M;  5JI2 E;  2CE7 A;  3HU3 A;  3IG8 A;  4DV3 M;  4DV5 M;  2Y0T A;  3KVW A;  3LQR A;  3GPX A;  1TH3 A;  2C5R A;  2L7H A;  4NL4 H;  2DWL A;  4FVM A;  4WW0 A;  1Z5C A;  2XLJ A;  3J7A S;  2EO2 A;  2UXB M;  1ZQ9 A;  3HU2 A;  2A5Y B;  3M7G A;  3VDU A;  3VDP A;  4LGY A;  4GC5 A;  1QAN A;  4CIS A;  3FUV A;  2UUB M;  4REZ A;  4G4O A;  3SHG B;  4L16 A;  1G59 A;  2HHH M;  3R9X B;  3TWK A;  2V6Z M;  3FTD A;  3JAM S;  3FD9 A;  1NHW C;  4OU7 A;  3AKZ A;  1NSF A;  4GC9 A;  4DV1 M;  2EA0 A;  4DR4 M;  1GLN A;  4G6Z A;  4NSR A;  4PCZ A;  3KOZ E;  4D80 A;  5EXX A;  1X37 A;  3AOE C;  3PXG A;  2I7P A;  2QCU A;  3L25 A;  3T15 A;  1QVR A;  3FUU A;  3A98 B;  2CHV A;  3W0L B;  2X8A A;  5C18 A;  3GLH B;  1XHB A;  1PM5 A;  1FJG M;  1R7R A;  3KSX A;  4IBK A;  2R18 A;  2C96 A;  2YFQ A;  1QYR A;  3J27 B;  2XF3 A;  3KSJ A;  1IBK M;  2KRU A;  2KEB A;  3KOW E;  4DR6 M;  1G3I A;  2Q2E B;  2DVW B;  1YUB A;  4DV2 M;  4XBO A;  1L8Q A;  4IBD A;  3JR4 A;  4XGI A;  4AKI A;  1QQW A;  3VKH A;  3KOX E;  3HGI A;  2BJV A;  3PNY A;  4M0W A;  1IXS B;  2QBY A;  1WXQ A;  3U5Z A;  1D2N A;  4LY6 A;  4I4L A;  2BNK A;  5IRE B;  5C1B A;  1Z59 A;  3KFU G;  3J2P B;  4GRI A;  3QAU A;  2R46 A;  1ORY B;  5FTK A;  1TDZ A;  4B3T M;  4LG2 A;  5ITT A;  3GRV A;  3EIH A;  3U6O A;  1MX0 A;  2DWN A;  3JR5 A;  4G4R A;  4HLQ A;  4L4U A;  4NRW A;  2D7G A;  3KS4 A;  1I4W A;  3C58 A;  2R4J A;  1N78 A;  5KPZ A;  4ITQ A;  2RGH A;  3RGP A;  2C98 A;  4MGI E;  1SXJ C;  3FUX A;  5EP2 A;  1HQY E;  2R65 A;  3RFW A;  1IY0 A;  3U6D A;  1L1Z A;  4JI8 M;  4X66 M;  1DGG A;  2I7N A;  4DUY M;  2F4V M;  3I4Y A;  4AW4 A;  1XWI A;  1N75 A;  1KFV A;  2LXE A;  3KS8 A;  4M0D A;  4IBG A;  3EIE A;  2D7H A;  3LMM A;  2FFJ A;  1E9S A;  3CF2 A;  4AG6 A;  4NRV A;  3GLF B;  3A46 A;  3SC3 A;  3T1Y M;  4B08 A;  1SXJ A;  5DYI A;  1IQP A;  1K3W A;  2BJW A;  3BOS A;  3U6M A;  3NBI A;  1QZM A;  4GH9 A;  2XFT A;  4IBB A;  1JQJ C;  1J09 A;  2LNH C;  5EP3 A;  5EP1 A;  1GL7 A;  4RNA A;  3GO8 A;  3D8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...