2L7HA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 20
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7hA00
4I5SA 2L7IA 2L7HA 2Y20A 2Y0QA 2Y0TA 2Y21A
chains in the Genus database with same CATH superfamily
4IBKA 2ZTDA 3KW6A 1K3XA 4GHLA 4DV7M 2UXDM 3AKZA 2LNHC 3J80S 5IWAM 2A5YB 4DUZM 5JI3E 4FCWA 3SMPA 1XHBA 2HCBA 3KOWE 3U60A 2EUCA 4P17A 3FD9A 1PJIA 2MJ5B 3AOEC 2RGHA 3GLHE 1Z5BA 1WR1B 4FWGA 3SYKA 2HHHM 1L1TA 3L29A 1FNNA 2WSCF 4IBBA 3BXWA 4GMQA 3GLIB 2YFQA 4LF7M 4CJ6A 5A2QS 3GRUA 4IJEA 3GPUA 2D7GA 4DBGB 2BJWA 2XSZD 3MK6A 2KEBA 2Q2EB 3SBJA 3VK7A 3K8ZA 4DV6M 1R2ZA 4AKGA 7CATA 2OQ4A 2KNZA 3C3DA 3SARA 1NVMA 2Z4SA 1VDLA 1A5TA 5BPVA 5KPZA 2LWXA 1XXHB 3U6QA 1YLAA 4PT5A 3PNVA 3W0FA 4DR4M 2DAMA 2L7HA 3QYBA 3W67A 1I94M 1G8PA 4NC6A 4DR5M 2VDBB 3DFZA 4PDIA 4M9ZA 4AKIA 2B3TA 4DR7M 2MR9A 4B7HA 2Y0QA 3LW5F 2F5SA 2L4EA 2XFTA 2XZFA 4KT0F 1HQYE 2XZUA 4G4RA 1N78A 2FFJA 3KS4A 3GLFA 1T43A 3GLGA 1NV8A 3KOXE 4LF6M 2H1RA 2DAGA 1CUKA 4GC5A 4LF8M 2KXEA 1T3TA 2EKKA 1MU5A 3M7GA 3GPYA 4LF9M 1GKIA 2W82A 3HJQA 3JAMS 2KW0A 2XFSA 4GIPA 3VDPA 4ANRA 4DV3M 2CEAA 4Q7JA 4AZFA 3SAUA 4JI0M 2FE8A 3M6AA 2LVPC 2DKLA 1L8QA 4IJFA 4Z6YA 1WXQA 4LZZA 2I7NA 3TWKA 1E32A 3KP0E 2KRUA 1MJGM 2DENA 2CHQA 2C9OA 3CGWA 1YE9A 3HU2A 3GPXA 4JI5M 4OX9M 3AV0A 2DWNA 3IHPA 4I8OA 3U6SA 1TH2A 3LMMA 3K9PA 5FLXS 1IY0A 4JYAM 3CF0A 2DWLA 3T15A 4CGYB 2VF7A 1Z5AA 4NSOB 3SHFA 1Y8GA 3VKGA 1VEGA 5IT9S 2BJVA 2WSFF 3L27A 1HT2E 5EXTA 3W68A 3A46A 3GRVA 3VK8A 3SMSA 1HNXM 1NO1A 3FTFA 1GLNA 1HR0M 1PJTA 1H6UA 1PJSA 3M0EA 1EFUB 4MH0E 4AQYM 2I7PA 3ILKA 3RGSA 4G3OA 4NXMM 5EXSA 4LFCM 1DV0A 1NJFA 3H4MA 3UJNA 1L2DA 1V92A 3HJSA 3B7QA 2UUCM 3AL0C 3LVWA 4XGIA 1GJSA 4X65M 1IN6A 4B3TM 4LY6A 4QHSA 2XH9A 2LVQD 4M9XA 1G3IA 1NNJA 1R5LA 3JR5A 4LJ7A 3B9PA 2R0IA 2LXEA 2F5NA 3L26A 4FCTA 2UUBM 2ZBKB 1TDHA 2M60A 2Y20A 1XWIA 4B3SM 4DR1M 2K47A 1HT1E 2KA6B 4FVMA 3UGJA 4M9SA 3FE3A 3HX3A 4NRVA 4OVZB 4QNMA 3BBZA 5FTNA 3ZQJA 1KYIA 2J5YA 2R65A 3AJIB 5EXPA 1D2NA 3FUWA 2R4JA 3U61B 2CRUA 2DXIA 3LQRA 2DZNB 2KZUA 1QANA 4MGKE 1EIJA 1Z6TA 3HGIA 4IIWA 2K0BX 3FTEA 1J09A 1XC8A 1IXSA 4GRIA 1RU3A 4IBEA 1QAOA 2APLA 1SXJD 4FD2A 4I4LA 2D7HA 2CE7A 2QSFX 3J27B 1AUAA 3U6DA 2DWZB 4I5SA 2O01F 3I4YA 4CISA 1TH3A 1PJJA 8CATA 1VQ1A 1D0LA 3HU1A 5KQ8A 3T1HM 2F5QA 2QBYB 3ZH9B 1KFVA 2DZOB 4L4UA 2QBYA 4GKJM 2BWEA 2LHCA 4LF5M 2VF8A 3IG8A 1W5SA 2KNAA 2DAKA 2MGWA 4JI3M 1W5TA 1MN3A 1IBLM 4NOOB 3AOEA 3H4JA 5EP4A 3TPZA 3U5ZB 1LV7A 1PJQA 3KSJA 5ITXA 1VEJA 4M0WA 2BWBA 4AG5A 4D81A 2H5XA 4YHHM 4RF1A 3THGA 4B7FA 2R18A 3GLFE 3B7NA 2ZANA 1GVNA 1IN7A 1OAOC 3GLGE 5DYIA 1DGBA 3GLIA 4X64M 2MH8A 3TL4X 2JZ1A 3BOSA 3U6PA 1YSYA 2HAKA 3IECA 1FJGM 1NHGC 1VEKA 4JI6M 1IBKM 3E21A 3AFHA 1QZMA 1XXHA 1X37A 1ORYB 1OIZA 2L09A 1Z5CA 3T6PA 4NXNM 3U6OA 2V6ZM 4F1IA 2OOAA 3A42A 2HWJA 1QYRA 1DO2A 3ZC7B 1L2CA 4UN2B 1IFYA 5E26A 1I4WA 1C7YA 3HHWA 1QDTA 4LF4M 4S12A 3EIHA 2DNAA 1V33A 3I04M 4LJ4A 4LFBM 2Z8YM 2F5PA 3K9OA 5KO3A 2XEPA 3K92A 3TWMA 2WZJA 4B7GA 3SC3A 2CV0A 3HHYA 4I81A 2RKOA 3J2PB 2JNHA 5ITQA 2DVWB 3HKPA 1Q02A 4QOSA 2KZSA 5FTJA 3ZCBB 3C9PA 4DV1M 1N34M 2UUAM 1V34A 2ZTCA 1K3WA 3E9SA 1SXJB 4DV0M 1F4IA 1TGUA 3GRRA 1QAQA 4LJAA 1TF0B 2MROB 1SXJC 1PRBA 3RFWA 4OU7A 3KVWA 2WSEF 2LVNC 3GRYA 2KNVA 3HJ8A 1HNZM 1L1ZA 1IN5A 1GJTA 3FRIA 4B08A 1OFIA 3PXGA 3LCVB 2UXBM 3C3EA 4P16A 1LTMA 1DGHB 1OIPA 4TUWA 1JR3D 3GLHB 4JI2M 5ITUA 1R4GA 1QVRA 4R71A 1XMQM 3Q8XA 2V1CA 1NY6A 1JR3E 1IXZA 3U6MA 3SHGB 2J7NA 2G8LA 5DNYA 3T1YM 1K82A 4HLQA 2C9CA 4JV5M 4L16A 1R7RA 4NL4H 3KOYE 4LJ8A 1T6OA 3KDSE 2XSZA 3GQ5A 4W5WA 2DWMA 2GNOA 1IY2A 2YR0A 4G4NA 4JI1M 1E9SA 1DGFA 1QAMA 2Y21A 5JI2E 4JI8M 4II7A 1G71A 2C99A 2Z4RA 4XK8F 2M5ZA 4WW0A 3UZUA 2O5RA 4LGYA 1QUTA 1N32M 1JQJC 3HY5A 5FTMA 2XGNA 2Y0TA 1NJGA 3FYDA 4JXJA 4X62M 5EXXA 1TH4A 1XB2B 1Q3CA 4M0DA 1OJLA 2FH0A 1P3QQ 2J7OA 4NSRA 4CIZA 3LCUA 4DR3M 1VDDA 3AOGA 4OVZA 1TR8A 1WJ7A 5KQDA 4WP2A 1OTRA 3WHLA 3F92A 5ITXE 3EIEA 4JI7M 1SG9A 3U61A 2BNKA 3HHZA 2C5RA 1IY1A 2JY8A 4QNRA 3NBXX 4LG2A 2F4VM 1PGYA 1G41A 3E4RA 3FKEA 3I4VA 4EIWA 3VKHA 4LFAM 2AHMA 1R6BX 4CHTB 1NV9A 2OPFA 4GKKM 1G59A 2G5GX 2L4FA 4F2LA 4L15A 2CV2A 2LVAA 4GHAA 2UU9M 4R7GA 3L2AA 2DI0A 2JY7A 3PFIA 4LJ5A 2DHYA 2KHHA 3L25A 1QDRA 2QHOB 4GITA 4NRWA 4QHTA 2HL7A 2L2DA 3QAUA 4BB9A 5FSWA 3K2LA 2EA0A 4AW4A 2P5TA 4RKUF 4G6ZA 4R3DA 4RNAA 3SAVA 2UXCM 4AI6A 1GL6A 2JP7A 2CFOA 4FW9A 5EJCA 3RE8A 4MM3B 2R44A 2O25A 4G4QA 3U5ZA 3FRHA 2L6OA 1IN8A 1EE8A 2CUZA 5E6JA 5KPRA 3DA1A 1IM2A 1JB0F 1MX0A 1WIVA 3GPPA 2DAEA 2LH0A 1HNWM 4X66M 1DGGA 2JWSA 1OAIA 1IQPA 3VLFB 4Y28F 2HKJA 4A3VB 3PVSA 4K0KM 2FOIC 2ZAMA 3I01M 2L7IA 5IREB 2NQ8C 3UMMA 1XNQM 1WGLA 1L2BA 2R4EA 1AIPC 2K6BA 4AG6A 4DUYM 1J5EM 1ZMUA 2LTUA 5ITRA 3V76A 2E5LM 2CHGA 5IZ7D 3WHKA 2X8AA 3U60B 4LCBA 2EKFA 4JN6A 3JR4A 2VQEM 1DO0A 1TDZA 1PM5A 3FTDA 3PNYA 2DAIA 1NSFA 4MGHA 1NNUC 4FWHA 5ITTA 3FUVA 2QP9X 5EP3A 5BR8M 3MHVC 3I51A 4L78A 2N35A 3HWSA 4KODA 4FCVA 2QENA 3FUUA 3FYCA 3HZJA 4KLNA 1SXJA 2ERCA 2YNMD 4LZJA 3TQSA 2C98A 2R45A 4B3RM 1D0KA 1ZMWA 2JA2A 3DZDA 3UK6A 2LHGA 4JI4M 3KS8A 2YQZA 3SFZA 3R8FA 2EO2A 1GABA 4IBJA 3QWLA 5EP2A 3GQ3A 1GO5A 3D8LA 3CF2A 2GQFA 3GO8A 3TWLA 1DGHA 3NWLA 3GLHA 5EQTA 3FTCA 3KXEC 3OTOM 3GLFB 2OOBA 1NY5A 4IBFA 4PDGA 2RGOA 5C18A 3GLGB 3HHXA 2D7EA 3GQ4A 4XBOA 3L28A 3IG5A 2ZAOA 1BVSA 3KOZE 2FS1A 3E46A 2JUJA 5F3WA 2QPAA 3U6LA 4ITQA 3KSXA 4GH9A 4HEOA 4RF0A 3SASA 3FUXA 3KFUG 4LJ9A 2X4AA 4MGYE 2LBCA 2DHRA 2VQFM 2LVOC 3A45A 5H37D 2OO9A 1UM8A 4BLCA 5LMUM 4L8RC 4AKHA 4GEWA 2QCUA 4OW0A 2Z3XA 1G4AE 3VDUA 2ZM6M 1GL7A 3C58A 3CTWB 3R9XB 3U6CA 2JY5A 2X49A 5DFLA 2CV1A 2EJSA 1NHWC 1E9RA 1HJPA 2K9DA 1ZAEA 1Q39A 2R46A 4MGZE 4IBIA 4LRSA 1YUBA 1C1KA 1WGNA 4Z8XA 1N33M 3LQQA 3SAWA 1IN4A 2R6FA 4DR6M 2QQ8A 3NBIA 2FNAA 4DV5M 3U6EA 1S3SA 3Q8GA 1J7KA 5EP1A 1QZEA 5FTKA 3MMPA 3T38A 1XNRM 1ZQ9A 4LJ6A 2JZ0A 3RGPA 4D82A 1QQWA 5C1BA 3J7BA 1N36M 1Z59A 1ZMVA 1TTEA 1XMOM 3B7ZA 2XLJA 3W0LB 3GLIE 3SYLA 4DV4M 2F5OA 4KO8A 1IXRC 2QNJA 3D8BA 1IBMM 3J7AS 1R2YA 2C96A 3MJ5A 5ITYA 2VIIA 2KDLA 2R62A 1XXHE 2XF3A 3QYEA 2CP8A 4WURA 2CWBA 5DYGA 3K1JA 3HU3A 3DOAA 2RRUA 4PCZA 1E94E 4G4OA 4BBAA 1N77A 2V1UA 2JY6B 3FUTA 4IBDA 4PD2A 1OQYA 1JR3A 1OKSA 2Z7JA 4HL4A 4GC9A 2CHVA 1ZV1A 3B74A 4FWDA 1Q3BA 2KRKA 2G3QA 4MGIE 3VFDA 4YY3M 4DR2M 4B3MM 1KSFX 2QZ4A 1IXSB 4L6V6 4LRTA 1D0MA 5GKNA 5FTLA 5KPTA 1VG5A 5LMNM 5L8RF 1QUSA 2JXNA 4ZPXA 3TE6A 1HQCA 4REZA 4KHPM 3KP1E 3LVVA 1UFZA 3J81S 4DV2M 1N75A 4MB7A 1SXJE 3CF6E 3A98B 1OFHA 4IBCA 4IBGA 4LGMA 4QOZC 1WHCA 2DZLA 4D80A 3SATA 3GP1A 3B89A
chains in the Genus database with same CATH topology
4IBKA 3KW6A 1K3XA 4GHLA 4DV7M 2UXDM 3AKZA 2LNHC 3J80S 5IWAM 2A5YB 4DUZM 5JI3E 4FCWA 3SMPA 1XHBA 2HCBA 3KOWE 3U60A 2EUCA 3FD9A 1PJIA 3AOEC 2RGHA 1Z5BA 4FWGA 3SYKA 2HHHM 1L1TA 3L29A 1FNNA 4IBBA 4GMQA 3GLIB 2YFQA 5A2QS 3GRUA 4IJEA 3GPUA 2D7GA 2BJWA 2XSZD 3MK6A 2KEBA 2Q2EB 3SBJA 3VK7A 3K8ZA 4DV6M 1R2ZA 4AKGA 7CATA 2OQ4A 3SARA 1NVMA 2Z4SA 5BPVA 5KPZA 2LWXA 1XXHB 3U6QA 4PT5A 3PNVA 3W0FA 4DR4M 2L7HA 1I94M 1G8PA 4DR5M 3DFZA 4PDIA 4M9ZA 4AKIA 4DR7M 4B7HA 2Y0QA 2F5SA 2XFTA 2XZFA 1HQYE 2XZUA 4G4RA 1N78A 2FFJA 3KS4A 3GLFA 3GLGA 4LF6M 3KOXE 2H1RA 4GC5A 4LF8M 2KXEA 1T3TA 3M7GA 1MU5A 3GPYA 4LF9M 1GKIA 2W82A 3HJQA 3JAMS 2KW0A 2XFSA 4GIPA 3VDPA 4DV3M 2CEAA 4AZFA 3SAUA 4JI0M 2FE8A 3M6AA 4Z6YA 1L8QA 4IJFA 1WXQA 4LZZA 2I7NA 3TWKA 1E32A 3KP0E 2KRUA 2CHQA 2C9OA 1YE9A 3HU2A 3GPXA 4JI5M 4OX9M 3AV0A 2DWNA 4I8OA 3U6SA 1TH2A 3LMMA 5FLXS 1IY0A 4JYAM 3CF0A 2DWLA 3T15A 4CGYB 1Z5AA 4NSOB 3SHFA 3VKGA 5IT9S 2BJVA 3L27A 1HT2E 5EXTA 3A46A 3GRVA 3VK8A 3SMSA 1HNXM 3FTFA 1GLNA 1HR0M 1H6UA 3M0EA 4MH0E 4AQYM 2I7PA 3ILKA 3RGSA 4NXMM 5EXSA 4LFCM 1NJFA 3H4MA 3UJNA 1L2DA 3HJSA 2UUCM 3AL0C 3LVWA 4XGIA 4X65M 1IN6A 4B3TM 4LY6A 4QHSA 2XH9A 4M9XA 1NNJA 1G3IA 3JR5A 4LJ7A 3B9PA 2LXEA 2F5NA 3L26A 4FCTA 2UUBM 2ZBKB 1TDHA 2M60A 2Y20A 1XWIA 4B3SM 4DR1M 2K47A 1HT1E 2KA6B 4FVMA 3UGJA 4M9SA 4NRVA 4OVZB 4QNMA 5FTNA 1KYIA 3AJIB 2R65A 5EXPA 1D2NA 3FUWA 2R4JA 3U61B 2DXIA 3LQRA 2DZNB 2KZUA 1QANA 4MGKE 1Z6TA 3HGIA 4IIWA 3FTEA 1J09A 1XC8A 4GRIA 4IBEA 1QAOA 1SXJD 4FD2A 4I4LA 2D7HA 2CE7A 3J27B 3U6DA 2DWZB 4I5SA 3I4YA 4CISA 1TH3A 1PJJA 8CATA 5KQ8A 3HU1A 3T1HM 2F5QA 2QBYB 3ZH9B 1KFVA 2DZOB 4L4UA 2QBYA 4GKJM 4LF5M 3IG8A 1W5SA 4JI3M 1W5TA 1IBLM 4NOOB 3AOEA 5EP4A 3TPZA 3U5ZB 1LV7A 3KSJA 5ITXA 4M0WA 4D81A 4YHHM 4AG5A 4RF1A 4B7FA 2R18A 2ZANA 1GVNA 1IN7A 5DYIA 1DGBA 3GLIA 4X64M 3TL4X 3U6PA 3BOSA 1YSYA 1FJGM 1NHGC 4JI6M 1IBKM 3AFHA 1QZMA 1XXHA 1X37A 1ORYB 2L09A 1Z5CA 4NXNM 3U6OA 2V6ZM 3A42A 1L2CA 1QYRA 1DO2A 3ZC7B 5E26A 1I4WA 3HHWA 4LF4M 4S12A 3EIHA 4LJ4A 4LFBM 2F5PA 5KO3A 2XEPA 3K92A 3TWMA 4B7GA 3SC3A 2CV0A 3HHYA 4I81A 2RKOA 3J2PB 5ITQA 2DVWB 3HKPA 4QOSA 5FTJA 2KZSA 1N34M 3ZCBB 4DV1M 2UUAM 1K3WA 3E9SA 1SXJB 4DV0M 1TGUA 3GRRA 1QAQA 4LJAA 1SXJC 3RFWA 4OU7A 3KVWA 3GRYA 3HJ8A 1HNZM 1L1ZA 1IN5A 4B08A 1OFIA 3PXGA 2UXBM 4P16A 1DGHB 4TUWA 1JR3D 3GLHB 4JI2M 5ITUA 1QVRA 1XMQM 3Q8XA 2V1CA 1NY6A 1IXZA 3U6MA 3SHGB 2J7NA 2G8LA 5DNYA 3T1YM 1K82A 4HLQA 2C9CA 4JV5M 4L16A 1R7RA 4NL4H 3KOYE 4LJ8A 3KDSE 2XSZA 3GQ5A 4W5WA 2DWMA 1IY2A 2YR0A 4G4NA 4JI1M 1E9SA 1DGFA 1QAMA 2Y21A 5JI2E 4JI8M 4II7A 2C99A 2Z4RA 2M5ZA 4WW0A 3UZUA 2O5RA 4LGYA 1N32M 1JQJC 5FTMA 2XGNA 2Y0TA 1NJGA 3FYDA 4JXJA 4X62M 5EXXA 1TH4A 4M0DA 1Q3CA 1OJLA 2J7OA 4NSRA 4DR3M 1VDDA 3AOGA 4OVZA 5KQDA 3WHLA 5ITXE 3EIEA 4JI7M 3U61A 2BNKA 3HHZA 2C5RA 1IY1A 4QNRA 4LG2A 2F4VM 3FKEA 1G41A 3E4RA 3I4VA 4EIWA 3VKHA 4LFAM 2AHMA 1R6BX 4CHTB 2OPFA 4GKKM 1G59A 2G5GX 4GHAA 4L15A 2CV2A 2UU9M 4R7GA 3L2AA 4LJ5A 3PFIA 3L25A 4GITA 4NRWA 4QHTA 2HL7A 3QAUA 4BB9A 5FSWA 3K2LA 2EA0A 4AW4A 2P5TA 4G6ZA 4R3DA 4RNAA 3SAVA 2UXCM 4AI6A 1GL6A 3RE8A 2CFOA 4FW9A 5EJCA 4MM3B 4G4QA 3U5ZA 2L6OA 1IN8A 1EE8A 2CUZA 5E6JA 5KPRA 3DA1A 1IM2A 1MX0A 3GPPA 2LH0A 1HNWM 4X66M 1DGGA 1IQPA 3VLFB 2HKJA 4A3VB 3PVSA 4K0KM 2FOIC 2ZAMA 2L7IA 5IREB 2NQ8C 3UMMA 1XNQM 1L2BA 2R4EA 4AG6A 4DUYM 1J5EM 5ITRA 2E5LM 2CHGA 5IZ7D 3WHKA 2X8AA 3U60B 4LCBA 3JR4A 4JN6A 2VQEM 1TDZA 1DO0A 1PM5A 3FTDA 3PNYA 1NSFA 4MGHA 1NNUC 4FWHA 5ITTA 3FUVA 2QP9X 5EP3A 5BR8M 3MHVC 3I51A 4L78A 3HWSA 4KODA 4FCVA 2QENA 3FUUA 3FYCA 4KLNA 1SXJA 2ERCA 2YNMD 4LZJA 3TQSA 2C98A 2R45A 4B3RM 4JI4M 2JA2A 3DZDA 3UK6A 3KS8A 2YQZA 3SFZA 3R8FA 2EO2A 4IBJA 3QWLA 5EP2A 3GQ3A 3D8LA 3CF2A 3GO8A 3TWLA 1DGHA 3NWLA 3GLHA 5EQTA 3FTCA 3KXEC 3OTOM 3GLFB 1NY5A 4IBFA 4PDGA 2RGOA 5C18A 3GLGB 3HHXA 2D7EA 3GQ4A 4XBOA 3L28A 3IG5A 2ZAOA 3KOZE 5F3WA 2QPAA 3U6LA 4ITQA 3KSXA 4GH9A 4RF0A 3SASA 3FUXA 3KFUG 4LJ9A 2X4AA 4MGYE 2DHRA 2VQFM 3A45A 5H37D 1UM8A 4BLCA 5LMUM 4L8RC 4AKHA 2QCUA 4OW0A 2Z3XA 1G4AE 3VDUA 2ZM6M 1GL7A 3C58A 3CTWB 3R9XB 3U6CA 2X49A 2CV1A 1NHWC 1E9RA 1ZAEA 1Q39A 2R46A 4MGZE 4IBIA 4LRSA 1YUBA 1C1KA 4Z8XA 1N33M 3LQQA 3SAWA 1IN4A 4DR6M 3NBIA 2FNAA 4DV5M 3U6EA 1S3SA 1J7KA 5EP1A 5FTKA 3T38A 1XNRM 1ZQ9A 4LJ6A 3RGPA 4D82A 1QQWA 5C1BA 3J7BA 1N36M 1Z59A 1XMOM 2XLJA 3W0LB 3SYLA 4DV4M 2F5OA 4KO8A 1IXRC 3D8BA 1IBMM 3J7AS 1R2YA 2C96A 3MJ5A 5ITYA 2VIIA 2R62A 2XF3A 4WURA 5DYGA 3K1JA 3HU3A 3DOAA 4PCZA 1E94E 4G4OA 4BBAA 1N77A 2V1UA 3FUTA 4IBDA 4PD2A 1JR3A 2Z7JA 4HL4A 4GC9A 2CHVA 4FWDA 4YY3M 1Q3BA 2KRKA 4MGIE 3VFDA 4DR2M 4B3MM 1KSFX 2QZ4A 1IXSB 4LRTA 5GKNA 5FTLA 5KPTA 5LMNM 4LF7M 4ZPXA 4KHPM 3TE6A 1HQCA 4REZA 3KP1E 3LVVA 3J81S 4DV2M 1N75A 4MB7A 1SXJE 3CF6E 3A98B 1OFHA 4IBCA 4IBGA 4LGMA 4QOZC 3SATA 4D80A 3GP1A 3THGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  2L7I A;  2L7H A;  2Y20 A;  2Y0Q A;  2Y0T A;  2Y21 A; 
#chains in the Genus database with same CATH topology
 4IBK A;  2ZTD A;  3KW6 A;  1K3X A;  4GHL A;  4DV7 M;  2UXD M;  3AKZ A;  2LNH C;  3J80 S;  5IWA M;  2A5Y B;  4DUZ M;  5JI3 E;  4FCW A;  3SMP A;  1XHB A;  2HCB A;  3KOW E;  3U60 A;  2EUC A;  4P17 A;  3FD9 A;  1PJI A;  2MJ5 B;  3AOE C;  2RGH A;  3GLH E;  1Z5B A;  1WR1 B;  4FWG A;  3SYK A;  2HHH M;  1L1T A;  3L29 A;  1FNN A;  2WSC F;  4IBB A;  3BXW A;  4GMQ A;  3GLI B;  2YFQ A;  4LF7 M;  4CJ6 A;  5A2Q S;  3GRU A;  4IJE A;  3GPU A;  2D7G A;  4DBG B;  2BJW A;  2XSZ D;  3MK6 A;  2KEB A;  2Q2E B;  3SBJ A;  3VK7 A;  3K8Z A;  4DV6 M;  1R2Z A;  4AKG A;  7CAT A;  2OQ4 A;  2KNZ A;  3C3D A;  3SAR A;  1NVM A;  2Z4S A;  1VDL A;  1A5T A;  5BPV A;  5KPZ A;  2LWX A;  1XXH B;  3U6Q A;  1YLA A;  4PT5 A;  3PNV A;  3W0F A;  4DR4 M;  2DAM A;  2L7H A;  3QYB A;  3W67 A;  1I94 M;  1G8P A;  4NC6 A;  4DR5 M;  2VDB B;  3DFZ A;  4PDI A;  4M9Z A;  4AKI A;  2B3T A;  4DR7 M;  2MR9 A;  4B7H A;  2Y0Q A;  3LW5 F;  2F5S A;  2L4E A;  2XFT A;  2XZF A;  4KT0 F;  1HQY E;  2XZU A;  4G4R A;  1N78 A;  2FFJ A;  3KS4 A;  3GLF A;  1T43 A;  3GLG A;  1NV8 A;  3KOX E;  4LF6 M;  2H1R A;  2DAG A;  1CUK A;  4GC5 A;  4LF8 M;  2KXE A;  1T3T A;  2EKK A;  1MU5 A;  3M7G A;  3GPY A;  4LF9 M;  1GKI A;  2W82 A;  3HJQ A;  3JAM S;  2KW0 A;  2XFS A;  4GIP A;  3VDP A;  4ANR A;  4DV3 M;  2CEA A;  4Q7J A;  4AZF A;  3SAU A;  4JI0 M;  2FE8 A;  3M6A A;  2LVP C;  2DKL A;  1L8Q A;  4IJF A;  4Z6Y A;  1WXQ A;  4LZZ A;  2I7N A;  3TWK A;  1E32 A;  3KP0 E;  2KRU A;  1MJG M;  2DEN A;  2CHQ A;  2C9O A;  3CGW A;  1YE9 A;  3HU2 A;  3GPX A;  4JI5 M;  4OX9 M;  3AV0 A;  2DWN A;  3IHP A;  4I8O A;  3U6S A;  1TH2 A;  3LMM A;  3K9P A;  5FLX S;  1IY0 A;  4JYA M;  3CF0 A;  2DWL A;  3T15 A;  4CGY B;  2VF7 A;  1Z5A A;  4NSO B;  3SHF A;  1Y8G A;  3VKG A;  1VEG A;  5IT9 S;  2BJV A;  2WSF F;  3L27 A;  1HT2 E;  5EXT A;  3W68 A;  3A46 A;  3GRV A;  3VK8 A;  3SMS A;  1HNX M;  1NO1 A;  3FTF A;  1GLN A;  1HR0 M;  1PJT A;  1H6U A;  1PJS A;  3M0E A;  1EFU B;  4MH0 E;  4AQY M;  2I7P A;  3ILK A;  3RGS A;  4G3O A;  4NXM M;  5EXS A;  4LFC M;  1DV0 A;  1NJF A;  3H4M A;  3UJN A;  1L2D A;  1V92 A;  3HJS A;  3B7Q A;  2UUC M;  3AL0 C;  3LVW A;  4XGI A;  1GJS A;  4X65 M;  1IN6 A;  4B3T M;  4LY6 A;  4QHS A;  2XH9 A;  2LVQ D;  4M9X A;  1G3I A;  1NNJ A;  1R5L A;  3JR5 A;  4LJ7 A;  3B9P A;  2R0I A;  2LXE A;  2F5N A;  3L26 A;  4FCT A;  2UUB M;  2ZBK B;  1TDH A;  2M60 A;  2Y20 A;  1XWI A;  4B3S M;  4DR1 M;  2K47 A;  1HT1 E;  2KA6 B;  4FVM A;  3UGJ A;  4M9S A;  3FE3 A;  3HX3 A;  4NRV A;  4OVZ B;  4QNM A;  3BBZ A;  5FTN A;  3ZQJ A;  1KYI A;  2J5Y A;  2R65 A;  3AJI B;  5EXP A;  1D2N A;  3FUW A;  2R4J A;  3U61 B;  2CRU A;  2DXI A;  3LQR A;  2DZN B;  2KZU A;  1QAN A;  4MGK E;  1EIJ A;  1Z6T A;  3HGI A;  4IIW A;  2K0B X;  3FTE A;  1J09 A;  1XC8 A;  1IXS A;  4GRI A;  1RU3 A;  4IBE A;  1QAO A;  2APL A;  1SXJ D;  4FD2 A;  4I4L A;  2D7H A;  2CE7 A;  2QSF X;  3J27 B;  1AUA A;  3U6D A;  2DWZ B;  4I5S A;  2O01 F;  3I4Y A;  4CIS A;  1TH3 A;  1PJJ A;  8CAT A;  1VQ1 A;  1D0L A;  3HU1 A;  5KQ8 A;  3T1H M;  2F5Q A;  2QBY B;  3ZH9 B;  1KFV A;  2DZO B;  4L4U A;  2QBY A;  4GKJ M;  2BWE A;  2LHC A;  4LF5 M;  2VF8 A;  3IG8 A;  1W5S A;  2KNA A;  2DAK A;  2MGW A;  4JI3 M;  1W5T A;  1MN3 A;  1IBL M;  4NOO B;  3AOE A;  3H4J A;  5EP4 A;  3TPZ A;  3U5Z B;  1LV7 A;  1PJQ A;  3KSJ A;  5ITX A;  1VEJ A;  4M0W A;  2BWB A;  4AG5 A;  4D81 A;  2H5X A;  4YHH M;  4RF1 A;  3THG A;  4B7F A;  2R18 A;  3GLF E;  3B7N A;  2ZAN A;  1GVN A;  1IN7 A;  1OAO C;  3GLG E;  5DYI A;  1DGB A;  3GLI A;  4X64 M;  2MH8 A;  3TL4 X;  2JZ1 A;  3BOS A;  3U6P A;  1YSY A;  2HAK A;  3IEC A;  1FJG M;  1NHG C;  1VEK A;  4JI6 M;  1IBK M;  3E21 A;  3AFH A;  1QZM A;  1XXH A;  1X37 A;  1ORY B;  1OIZ A;  2L09 A;  1Z5C A;  3T6P A;  4NXN M;  3U6O A;  2V6Z M;  4F1I A;  2OOA A;  3A42 A;  2HWJ A;  1QYR A;  1DO2 A;  3ZC7 B;  1L2C A;  4UN2 B;  1IFY A;  5E26 A;  1I4W A;  1C7Y A;  3HHW A;  1QDT A;  4LF4 M;  4S12 A;  3EIH A;  2DNA A;  1V33 A;  3I04 M;  4LJ4 A;  4LFB M;  2Z8Y M;  2F5P A;  3K9O A;  5KO3 A;  2XEP A;  3K92 A;  3TWM A;  2WZJ A;  4B7G A;  3SC3 A;  2CV0 A;  3HHY A;  4I81 A;  2RKO A;  3J2P B;  2JNH A;  5ITQ A;  2DVW B;  3HKP A;  1Q02 A;  4QOS A;  2KZS A;  5FTJ A;  3ZCB B;  3C9P A;  4DV1 M;  1N34 M;  2UUA M;  1V34 A;  2ZTC A;  1K3W A;  3E9S A;  1SXJ B;  4DV0 M;  1F4I A;  1TGU A;  3GRR A;  1QAQ A;  4LJA A;  1TF0 B;  2MRO B;  1SXJ C;  1PRB A;  3RFW A;  4OU7 A;  3KVW A;  2WSE F;  2LVN C;  3GRY A;  2KNV A;  3HJ8 A;  1HNZ M;  1L1Z A;  1IN5 A;  1GJT A;  3FRI A;  4B08 A;  1OFI A;  3PXG A;  3LCV B;  2UXB M;  3C3E A;  4P16 A;  1LTM A;  1DGH B;  1OIP A;  4TUW A;  1JR3 D;  3GLH B;  4JI2 M;  5ITU A;  1R4G A;  1QVR A;  4R71 A;  1XMQ M;  3Q8X A;  2V1C A;  1NY6 A;  1JR3 E;  1IXZ A;  3U6M A;  3SHG B;  2J7N A;  2G8L A;  5DNY A;  3T1Y M;  1K82 A;  4HLQ A;  2C9C A;  4JV5 M;  4L16 A;  1R7R A;  4NL4 H;  3KOY E;  4LJ8 A;  1T6O A;  3KDS E;  2XSZ A;  3GQ5 A;  4W5W A;  2DWM A;  2GNO A;  1IY2 A;  2YR0 A;  4G4N A;  4JI1 M;  1E9S A;  1DGF A;  1QAM A;  2Y21 A;  5JI2 E;  4JI8 M;  4II7 A;  1G71 A;  2C99 A;  2Z4R A;  4XK8 F;  2M5Z A;  4WW0 A;  3UZU A;  2O5R A;  4LGY A;  1QUT A;  1N32 M;  1JQJ C;  3HY5 A;  5FTM A;  2XGN A;  2Y0T A;  1NJG A;  3FYD A;  4JXJ A;  4X62 M;  5EXX A;  1TH4 A;  1XB2 B;  1Q3C A;  4M0D A;  1OJL A;  2FH0 A;  1P3Q Q;  2J7O A;  4NSR A;  4CIZ A;  3LCU A;  4DR3 M;  1VDD A;  3AOG A;  4OVZ A;  1TR8 A;  1WJ7 A;  5KQD A;  4WP2 A;  1OTR A;  3WHL A;  3F92 A;  5ITX E;  3EIE A;  4JI7 M;  1SG9 A;  3U61 A;  2BNK A;  3HHZ A;  2C5R A;  1IY1 A;  2JY8 A;  4QNR A;  3NBX X;  4LG2 A;  2F4V M;  1PGY A;  1G41 A;  3E4R A;  3FKE A;  3I4V A;  4EIW A;  3VKH A;  4LFA M;  2AHM A;  1R6B X;  4CHT B;  1NV9 A;  2OPF A;  4GKK M;  1G59 A;  2G5G X;  2L4F A;  4F2L A;  4L15 A;  2CV2 A;  2LVA A;  4GHA A;  2UU9 M;  4R7G A;  3L2A A;  2DI0 A;  2JY7 A;  3PFI A;  4LJ5 A;  2DHY A;  2KHH A;  3L25 A;  1QDR A;  2QHO B;  4GIT A;  4NRW A;  4QHT A;  2HL7 A;  2L2D A;  3QAU A;  4BB9 A;  5FSW A;  3K2L A;  2EA0 A;  4AW4 A;  2P5T A;  4RKU F;  4G6Z A;  4R3D A;  4RNA A;  3SAV A;  2UXC M;  4AI6 A;  1GL6 A;  2JP7 A;  2CFO A;  4FW9 A;  5EJC A;  3RE8 A;  4MM3 B;  2R44 A;  2O25 A;  4G4Q A;  3U5Z A;  3FRH A;  2L6O A;  1IN8 A;  1EE8 A;  2CUZ A;  5E6J A;  5KPR A;  3DA1 A;  1IM2 A;  1JB0 F;  1MX0 A;  1WIV A;  3GPP A;  2DAE A;  2LH0 A;  1HNW M;  4X66 M;  1DGG A;  2JWS A;  1OAI A;  1IQP A;  3VLF B;  4Y28 F;  2HKJ A;  4A3V B;  3PVS A;  4K0K M;  2FOI C;  2ZAM A;  3I01 M;  2L7I A;  5IRE B;  2NQ8 C;  3UMM A;  1XNQ M;  1WGL A;  1L2B A;  2R4E A;  1AIP C;  2K6B A;  4AG6 A;  4DUY M;  1J5E M;  1ZMU A;  2LTU A;  5ITR A;  3V76 A;  2E5L M;  2CHG A;  5IZ7 D;  3WHK A;  2X8A A;  3U60 B;  4LCB A;  2EKF A;  4JN6 A;  3JR4 A;  2VQE M;  1DO0 A;  1TDZ A;  1PM5 A;  3FTD A;  3PNY A;  2DAI A;  1NSF A;  4MGH A;  1NNU C;  4FWH A;  5ITT A;  3FUV A;  2QP9 X;  5EP3 A;  5BR8 M;  3MHV C;  3I51 A;  4L78 A;  2N35 A;  3HWS A;  4KOD A;  4FCV A;  2QEN A;  3FUU A;  3FYC A;  3HZJ A;  4KLN A;  1SXJ A;  2ERC A;  2YNM D;  4LZJ A;  3TQS A;  2C98 A;  2R45 A;  4B3R M;  1D0K A;  1ZMW A;  2JA2 A;  3DZD A;  3UK6 A;  2LHG A;  4JI4 M;  3KS8 A;  2YQZ A;  3SFZ A;  3R8F A;  2EO2 A;  1GAB A;  4IBJ A;  3QWL A;  5EP2 A;  3GQ3 A;  1GO5 A;  3D8L A;  3CF2 A;  2GQF A;  3GO8 A;  3TWL A;  1DGH A;  3NWL A;  3GLH A;  5EQT A;  3FTC A;  3KXE C;  3OTO M;  3GLF B;  2OOB A;  1NY5 A;  4IBF A;  4PDG A;  2RGO A;  5C18 A;  3GLG B;  3HHX A;  2D7E A;  3GQ4 A;  4XBO A;  3L28 A;  3IG5 A;  2ZAO A;  1BVS A;  3KOZ E;  2FS1 A;  3E46 A;  2JUJ A;  5F3W A;  2QPA A;  3U6L A;  4ITQ A;  3KSX A;  4GH9 A;  4HEO A;  4RF0 A;  3SAS A;  3FUX A;  3KFU G;  4LJ9 A;  2X4A A;  4MGY E;  2LBC A;  2DHR A;  2VQF M;  2LVO C;  3A45 A;  5H37 D;  2OO9 A;  1UM8 A;  4BLC A;  5LMU M;  4L8R C;  4AKH A;  4GEW A;  2QCU A;  4OW0 A;  2Z3X A;  1G4A E;  3VDU A;  2ZM6 M;  1GL7 A;  3C58 A;  3CTW B;  3R9X B;  3U6C A;  2JY5 A;  2X49 A;  5DFL A;  2CV1 A;  2EJS A;  1NHW C;  1E9R A;  1HJP A;  2K9D A;  1ZAE A;  1Q39 A;  2R46 A;  4MGZ E;  4IBI A;  4LRS A;  1YUB A;  1C1K A;  1WGN A;  4Z8X A;  1N33 M;  3LQQ A;  3SAW A;  1IN4 A;  2R6F A;  4DR6 M;  2QQ8 A;  3NBI A;  2FNA A;  4DV5 M;  3U6E A;  1S3S A;  3Q8G A;  1J7K A;  5EP1 A;  1QZE A;  5FTK A;  3MMP A;  3T38 A;  1XNR M;  1ZQ9 A;  4LJ6 A;  2JZ0 A;  3RGP A;  4D82 A;  1QQW A;  5C1B A;  3J7B A;  1N36 M;  1Z59 A;  1ZMV A;  1TTE A;  1XMO M;  3B7Z A;  2XLJ A;  3W0L B;  3GLI E;  3SYL A;  4DV4 M;  2F5O A;  4KO8 A;  1IXR C;  2QNJ A;  3D8B A;  1IBM M;  3J7A S;  1R2Y A;  2C96 A;  3MJ5 A;  5ITY A;  2VII A;  2KDL A;  2R62 A;  1XXH E;  2XF3 A;  3QYE A;  2CP8 A;  4WUR A;  2CWB A;  5DYG A;  3K1J A;  3HU3 A;  3DOA A;  2RRU A;  4PCZ A;  1E94 E;  4G4O A;  4BBA A;  1N77 A;  2V1U A;  2JY6 B;  3FUT A;  4IBD A;  4PD2 A;  1OQY A;  1JR3 A;  1OKS A;  2Z7J A;  4HL4 A;  4GC9 A;  2CHV A;  1ZV1 A;  3B74 A;  4FWD A;  1Q3B A;  2KRK A;  2G3Q A;  4MGI E;  3VFD A;  4YY3 M;  4DR2 M;  4B3M M;  1KSF X;  2QZ4 A;  1IXS B;  4L6V 6;  4LRT A;  1D0M A;  5GKN A;  5FTL A;  5KPT A;  1VG5 A;  5LMN M;  5L8R F;  1QUS A;  2JXN A;  4ZPX A;  3TE6 A;  1HQC A;  4REZ A;  4KHP M;  3KP1 E;  3LVV A;  1UFZ A;  3J81 S;  4DV2 M;  1N75 A;  4MB7 A;  1SXJ E;  3CF6 E;  3A98 B;  1OFH A;  4IBC A;  4IBG A;  4LGM A;  4QOZ C;  1WHC A;  2DZL A;  4D80 A;  3SAT A;  3GP1 A;  3B89 A; 
#chains in the Genus database with same CATH homology
 4IBK A;  3KW6 A;  1K3X A;  4GHL A;  4DV7 M;  2UXD M;  3AKZ A;  2LNH C;  3J80 S;  5IWA M;  2A5Y B;  4DUZ M;  5JI3 E;  4FCW A;  3SMP A;  1XHB A;  2HCB A;  3KOW E;  3U60 A;  2EUC A;  3FD9 A;  1PJI A;  3AOE C;  2RGH A;  1Z5B A;  4FWG A;  3SYK A;  2HHH M;  1L1T A;  3L29 A;  1FNN A;  4IBB A;  4GMQ A;  3GLI B;  2YFQ A;  5A2Q S;  3GRU A;  4IJE A;  3GPU A;  2D7G A;  2BJW A;  2XSZ D;  3MK6 A;  2KEB A;  2Q2E B;  3SBJ A;  3VK7 A;  3K8Z A;  4DV6 M;  1R2Z A;  4AKG A;  7CAT A;  2OQ4 A;  3SAR A;  1NVM A;  2Z4S A;  5BPV A;  5KPZ A;  2LWX A;  1XXH B;  3U6Q A;  4PT5 A;  3PNV A;  3W0F A;  4DR4 M;  2L7H A;  1I94 M;  1G8P A;  4DR5 M;  3DFZ A;  4PDI A;  4M9Z A;  4AKI A;  4DR7 M;  4B7H A;  2Y0Q A;  2F5S A;  2XFT A;  2XZF A;  1HQY E;  2XZU A;  4G4R A;  1N78 A;  2FFJ A;  3KS4 A;  3GLF A;  3GLG A;  4LF6 M;  3KOX E;  2H1R A;  4GC5 A;  4LF8 M;  2KXE A;  1T3T A;  3M7G A;  1MU5 A;  3GPY A;  4LF9 M;  1GKI A;  2W82 A;  3HJQ A;  3JAM S;  2KW0 A;  2XFS A;  4GIP A;  3VDP A;  4DV3 M;  2CEA A;  4AZF A;  3SAU A;  4JI0 M;  2FE8 A;  3M6A A;  4Z6Y A;  1L8Q A;  4IJF A;  1WXQ A;  4LZZ A;  2I7N A;  3TWK A;  1E32 A;  3KP0 E;  2KRU A;  2CHQ A;  2C9O A;  1YE9 A;  3HU2 A;  3GPX A;  4JI5 M;  4OX9 M;  3AV0 A;  2DWN A;  4I8O A;  3U6S A;  1TH2 A;  3LMM A;  5FLX S;  1IY0 A;  4JYA M;  3CF0 A;  2DWL A;  3T15 A;  4CGY B;  1Z5A A;  4NSO B;  3SHF A;  3VKG A;  5IT9 S;  2BJV A;  3L27 A;  1HT2 E;  5EXT A;  3A46 A;  3GRV A;  3VK8 A;  3SMS A;  1HNX M;  3FTF A;  1GLN A;  1HR0 M;  1H6U A;  3M0E A;  4MH0 E;  4AQY M;  2I7P A;  3ILK A;  3RGS A;  4NXM M;  5EXS A;  4LFC M;  1NJF A;  3H4M A;  3UJN A;  1L2D A;  3HJS A;  2UUC M;  3AL0 C;  3LVW A;  4XGI A;  4X65 M;  1IN6 A;  4B3T M;  4LY6 A;  4QHS A;  2XH9 A;  4M9X A;  1NNJ A;  1G3I A;  3JR5 A;  4LJ7 A;  3B9P A;  2LXE A;  2F5N A;  3L26 A;  4FCT A;  2UUB M;  2ZBK B;  1TDH A;  2M60 A;  2Y20 A;  1XWI A;  4B3S M;  4DR1 M;  2K47 A;  1HT1 E;  2KA6 B;  4FVM A;  3UGJ A;  4M9S A;  4NRV A;  4OVZ B;  4QNM A;  5FTN A;  1KYI A;  3AJI B;  2R65 A;  5EXP A;  1D2N A;  3FUW A;  2R4J A;  3U61 B;  2DXI A;  3LQR A;  2DZN B;  2KZU A;  1QAN A;  4MGK E;  1Z6T A;  3HGI A;  4IIW A;  3FTE A;  1J09 A;  1XC8 A;  4GRI A;  4IBE A;  1QAO A;  1SXJ D;  4FD2 A;  4I4L A;  2D7H A;  2CE7 A;  3J27 B;  3U6D A;  2DWZ B;  4I5S A;  3I4Y A;  4CIS A;  1TH3 A;  1PJJ A;  8CAT A;  5KQ8 A;  3HU1 A;  3T1H M;  2F5Q A;  2QBY B;  3ZH9 B;  1KFV A;  2DZO B;  4L4U A;  2QBY A;  4GKJ M;  4LF5 M;  3IG8 A;  1W5S A;  4JI3 M;  1W5T A;  1IBL M;  4NOO B;  3AOE A;  5EP4 A;  3TPZ A;  3U5Z B;  1LV7 A;  3KSJ A;  5ITX A;  4M0W A;  4D81 A;  4YHH M;  4AG5 A;  4RF1 A;  4B7F A;  2R18 A;  2ZAN A;  1GVN A;  1IN7 A;  5DYI A;  1DGB A;  3GLI A;  4X64 M;  3TL4 X;  3U6P A;  3BOS A;  1YSY A;  1FJG M;  1NHG C;  4JI6 M;  1IBK M;  3AFH A;  1QZM A;  1XXH A;  1X37 A;  1ORY B;  2L09 A;  1Z5C A;  4NXN M;  3U6O A;  2V6Z M;  3A42 A;  1L2C A;  1QYR A;  1DO2 A;  3ZC7 B;  5E26 A;  1I4W A;  3HHW A;  4LF4 M;  4S12 A;  3EIH A;  4LJ4 A;  4LFB M;  2F5P A;  5KO3 A;  2XEP A;  3K92 A;  3TWM A;  4B7G A;  3SC3 A;  2CV0 A;  3HHY A;  4I81 A;  2RKO A;  3J2P B;  5ITQ A;  2DVW B;  3HKP A;  4QOS A;  5FTJ A;  2KZS A;  1N34 M;  3ZCB B;  4DV1 M;  2UUA M;  1K3W A;  3E9S A;  1SXJ B;  4DV0 M;  1TGU A;  3GRR A;  1QAQ A;  4LJA A;  1SXJ C;  3RFW A;  4OU7 A;  3KVW A;  3GRY A;  3HJ8 A;  1HNZ M;  1L1Z A;  1IN5 A;  4B08 A;  1OFI A;  3PXG A;  2UXB M;  4P16 A;  1DGH B;  4TUW A;  1JR3 D;  3GLH B;  4JI2 M;  5ITU A;  1QVR A;  1XMQ M;  3Q8X A;  2V1C A;  1NY6 A;  1IXZ A;  3U6M A;  3SHG B;  2J7N A;  2G8L A;  5DNY A;  3T1Y M;  1K82 A;  4HLQ A;  2C9C A;  4JV5 M;  4L16 A;  1R7R A;  4NL4 H;  3KOY E;  4LJ8 A;  3KDS E;  2XSZ A;  3GQ5 A;  4W5W A;  2DWM A;  1IY2 A;  2YR0 A;  4G4N A;  4JI1 M;  1E9S A;  1DGF A;  1QAM A;  2Y21 A;  5JI2 E;  4JI8 M;  4II7 A;  2C99 A;  2Z4R A;  2M5Z A;  4WW0 A;  3UZU A;  2O5R A;  4LGY A;  1N32 M;  1JQJ C;  5FTM A;  2XGN A;  2Y0T A;  1NJG A;  3FYD A;  4JXJ A;  4X62 M;  5EXX A;  1TH4 A;  4M0D A;  1Q3C A;  1OJL A;  2J7O A;  4NSR A;  4DR3 M;  1VDD A;  3AOG A;  4OVZ A;  5KQD A;  3WHL A;  5ITX E;  3EIE A;  4JI7 M;  3U61 A;  2BNK A;  3HHZ A;  2C5R A;  1IY1 A;  4QNR A;  4LG2 A;  2F4V M;  3FKE A;  1G41 A;  3E4R A;  3I4V A;  4EIW A;  3VKH A;  4LFA M;  2AHM A;  1R6B X;  4CHT B;  2OPF A;  4GKK M;  1G59 A;  2G5G X;  4GHA A;  4L15 A;  2CV2 A;  2UU9 M;  4R7G A;  3L2A A;  4LJ5 A;  3PFI A;  3L25 A;  4GIT A;  4NRW A;  4QHT A;  2HL7 A;  3QAU A;  4BB9 A;  5FSW A;  3K2L A;  2EA0 A;  4AW4 A;  2P5T A;  4G6Z A;  4R3D A;  4RNA A;  3SAV A;  2UXC M;  4AI6 A;  1GL6 A;  3RE8 A;  2CFO A;  4FW9 A;  5EJC A;  4MM3 B;  4G4Q A;  3U5Z A;  2L6O A;  1IN8 A;  1EE8 A;  2CUZ A;  5E6J A;  5KPR A;  3DA1 A;  1IM2 A;  1MX0 A;  3GPP A;  2LH0 A;  1HNW M;  4X66 M;  1DGG A;  1IQP A;  3VLF B;  2HKJ A;  4A3V B;  3PVS A;  4K0K M;  2FOI C;  2ZAM A;  2L7I A;  5IRE B;  2NQ8 C;  3UMM A;  1XNQ M;  1L2B A;  2R4E A;  4AG6 A;  4DUY M;  1J5E M;  5ITR A;  2E5L M;  2CHG A;  5IZ7 D;  3WHK A;  2X8A A;  3U60 B;  4LCB A;  3JR4 A;  4JN6 A;  2VQE M;  1TDZ A;  1DO0 A;  1PM5 A;  3FTD A;  3PNY A;  1NSF A;  4MGH A;  1NNU C;  4FWH A;  5ITT A;  3FUV A;  2QP9 X;  5EP3 A;  5BR8 M;  3MHV C;  3I51 A;  4L78 A;  3HWS A;  4KOD A;  4FCV A;  2QEN A;  3FUU A;  3FYC A;  4KLN A;  1SXJ A;  2ERC A;  2YNM D;  4LZJ A;  3TQS A;  2C98 A;  2R45 A;  4B3R M;  4JI4 M;  2JA2 A;  3DZD A;  3UK6 A;  3KS8 A;  2YQZ A;  3SFZ A;  3R8F A;  2EO2 A;  4IBJ A;  3QWL A;  5EP2 A;  3GQ3 A;  3D8L A;  3CF2 A;  3GO8 A;  3TWL A;  1DGH A;  3NWL A;  3GLH A;  5EQT A;  3FTC A;  3KXE C;  3OTO M;  3GLF B;  1NY5 A;  4IBF A;  4PDG A;  2RGO A;  5C18 A;  3GLG B;  3HHX A;  2D7E A;  3GQ4 A;  4XBO A;  3L28 A;  3IG5 A;  2ZAO A;  3KOZ E;  5F3W A;  2QPA A;  3U6L A;  4ITQ A;  3KSX A;  4GH9 A;  4RF0 A;  3SAS A;  3FUX A;  3KFU G;  4LJ9 A;  2X4A A;  4MGY E;  2DHR A;  2VQF M;  3A45 A;  5H37 D;  1UM8 A;  4BLC A;  5LMU M;  4L8R C;  4AKH A;  2QCU A;  4OW0 A;  2Z3X A;  1G4A E;  3VDU A;  2ZM6 M;  1GL7 A;  3C58 A;  3CTW B;  3R9X B;  3U6C A;  2X49 A;  2CV1 A;  1NHW C;  1E9R A;  1ZAE A;  1Q39 A;  2R46 A;  4MGZ E;  4IBI A;  4LRS A;  1YUB A;  1C1K A;  4Z8X A;  1N33 M;  3LQQ A;  3SAW A;  1IN4 A;  4DR6 M;  3NBI A;  2FNA A;  4DV5 M;  3U6E A;  1S3S A;  1J7K A;  5EP1 A;  5FTK A;  3T38 A;  1XNR M;  1ZQ9 A;  4LJ6 A;  3RGP A;  4D82 A;  1QQW A;  5C1B A;  3J7B A;  1N36 M;  1Z59 A;  1XMO M;  2XLJ A;  3W0L B;  3SYL A;  4DV4 M;  2F5O A;  4KO8 A;  1IXR C;  3D8B A;  1IBM M;  3J7A S;  1R2Y A;  2C96 A;  3MJ5 A;  5ITY A;  2VII A;  2R62 A;  2XF3 A;  4WUR A;  5DYG A;  3K1J A;  3HU3 A;  3DOA A;  4PCZ A;  1E94 E;  4G4O A;  4BBA A;  1N77 A;  2V1U A;  3FUT A;  4IBD A;  4PD2 A;  1JR3 A;  2Z7J A;  4HL4 A;  4GC9 A;  2CHV A;  4FWD A;  4YY3 M;  1Q3B A;  2KRK A;  4MGI E;  3VFD A;  4DR2 M;  4B3M M;  1KSF X;  2QZ4 A;  1IXS B;  4LRT A;  5GKN A;  5FTL A;  5KPT A;  5LMN M;  4LF7 M;  4ZPX A;  4KHP M;  3TE6 A;  1HQC A;  4REZ A;  3KP1 E;  3LVV A;  3J81 S;  4DV2 M;  1N75 A;  4MB7 A;  1SXJ E;  3CF6 E;  3A98 B;  1OFH A;  4IBC A;  4IBG A;  4LGM A;  4QOZ C;  3SAT A;  4D80 A;  3GP1 A;  3THG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...