2MGWA

Solution structure of the uba domain of human nbr1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
b'GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Next to BRCA1 gene 1 protein
publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mgwA00
1PGYA 3LCUA 2BWEA 3LCVB 2LTUA 1WGNA 2DAGA 2JNHA 2OOAA 1V92A 3BBZA 2LBCA 1C7YA 2BWBA 1F4IA 3IECA 1XXHE 5JI2E 1HT1E 2LVQD 1G41A 3FRHA 1OQYA 2K0BX 2ZTDA 1VEJA 2B3TA 1VEGA 2MJ5B 4WP2A 2MR9A 1HT2E 2QHOB 1DO0A 1XB2B 1WIVA 2LVOC 2RRUA 2QNJA 1CUKA 5DFLA 1WJ7A 3IHPA 1DO2A 1R4GA 3FRIA 2DAMA 4UN2B 1VEKA 2G3QA 1IFYA 2JP7A 3K9OA 1WR1B 2JZ1A 2KNVA 2DAKA 1MN3A 1ZV1A 4R71A 1NV9A 1QZEA 1YLAA 2DZLA 1GO5A 2L4EA 1UFZA 4DBGB 3E46A 1IXSA 3GLFE 1KYIA 2EJSA 1OTRA 1P3QQ 2MROB 1OKSA 3GLHE 2ZTCA 1Q02A 2KNAA 1AIPC 1TR8A 4HEOA 1ZMVA 4F1IA 2KNZA 3B89A 4G3OA 3FE3A 2DENA 2DNAA 1ZMUA 1VG5A 3H4JA 1HQYE 2KHHA 1VDLA 2LVNC 4Q7JA 1A5TA 1NV8A 2QSFX 2JY7A 2DAIA 2O25A 2WZJA 2K9DA 4F2LA 2CP8A 1EFUB 1HJPA 2JZ0A 3K9PA 2CWBA 1WHCA 2LVPC 1WGLA 2L2DA 1T43A 2JY5A 1IM2A 1OAIA 2DHYA 2L4FA 2HWJA 1SG9A 2MGWA 2HAKA 4GEWA 1G3IA 2DI0A 2EKFA 1DV0A 2JUJA 2JY8A 3GLGE 2OOBA 2R0IA 3T6PA 1E94E 1JR3E 3GLIE 2DKLA 1G4AE 1T6OA 3MMPA 1BVSA 1ZMWA 2JY6B 2LVAA 3E21A 2DAEA 1VQ1A 2H5XA 2OO9A 1Y8GA 3F92A 2EKKA 1TTEA
chains in the Genus database with same CATH superfamily
1N32M 3A45A 4B3SM 1QUSA 4MB7A 1E9RA 1WGNA 4NRWA 2JNHA 2OOAA 3CTWB 3AOEA 2RGHA 3TWMA 2UXCM 2BWBA 3GPUA 1AUAA 4LRTA 1IN8A 3FRHA 1DGHB 1G41A 3KOZE 1OJLA 1S3SA 2UU9M 3FTDA 1VDDA 1R2ZA 2V1CA 3KOYE 2G5GX 2R18A 2QBYA 4GC5A 2DXIA 3U6QA 1IN7A 1G71A 2MR9A 3SMPA 2D7HA 1GLNA 1XB2B 1TDHA 1GJTA 1WIVA 3GLGA 1NJFA 4MGHA 1CUKA 5DFLA 4DR4M 3IHPA 3FRIA 3HHZA 4JI8M 1JR3D 1JB0F 1JR3A 3U5ZB 1VEKA 2R65A 3L27A 4BLCA 4JI7M 2G8LA 2R45A 4WW0A 2KNVA 5C1BA 3JR5A 1Q39A 3V76A 3C3EA 2J7NA 3GO8A 2KRUA 3U6CA 1K3WA 2DZLA 1GABA 2L4EA 3SMSA 5EXSA 5KQDA 3KVWA 4DBGB 2C9OA 1IXSA 3TWKA 5H37D 1WXQA 1KYIA 5ITRA 3ZQJA 3GLFE 1XXHA 2CFOA 5EQTA 1N78A 3AL0C 3DFZA 3HHYA 4GKKM 2JXNA 1Q02A 2KNAA 2HKJA 5DYGA 3T1YM 8CATA 3VK7A 4HEOA 1V34A 3K2LA 3FTFA 1XNRM 1QUTA 3SASA 2CEAA 4IBDA 4DUYM 1D0LA 1HNWM 3FE3A 1L1ZA 2DENA 3FD9A 1J09A 4RF0A 1ZMUA 4DV4M 2F4VM 2LVNC 4IBFA 3U60B 1A5TA 3J80S 3B7NA 2R62A 1IXZA 2DAIA 2Y0TA 3FUUA 4WURA 2XZFA 1PRBA 4FD2A 5KPRA 3LW5F 3DOAA 3MJ5A 4F2LA 3AKZA 1HJPA 1IBMM 1IY0A 2CWBA 2D7EA 1K3XA 3QYEA 3U6OA 4LFCM 4AKIA 3BXWA 2AHMA 3B74A 3GPXA 2EO2A 2I7PA 2KZUA 1NY6A 2APLA 2DHYA 2DHRA 5ITYA 3SATA 1OFHA 3ZCBB 3GP1A 1EE8A 2VF7A 3Q8XA 2V1UA 1QVRA 3E9SA 3IG8A 5GKNA 1NJGA 5KQ8A 3R9XB 2F5OA 3L26A 1G3IA 2DVWB 2EKFA 4JXJA 5EP4A 1YE9A 3GRYA 4CGYB 1DV0A 1QYRA 2JUJA 2RGOA 4NL4H 3GQ5A 1PJJA 5LMNM 1YSYA 3HHXA 4XGIA 4B7HA 3HU2A 1E94E 4AQYM 2FNAA 3U6LA 2C96A 2XF3A 2ZM6M 1Z5CA 1G4AE 1T6OA 2L7IA 5LMUM 1TH4A 2LVAA 2X8AA 1G59A 3QAUA 4PD2A 1IN4A 2VF8A 4L78A 4YY3M 2DWMA 3GPPA 1PGYA 2CHGA 5EP3A 3LCVB 3A42A 2LTUA 4L15A 4DR5M 2DAGA 5KPZA 1IY1A 1V92A 1YUBA 3LQQA 4B7FA 1F4IA 1R5LA 1XMOM 3L25A 5ITTA 2ZANA 1LTMA 1OQYA 4JN6A 5EP2A 2CV1A 1E32A 3AFHA 1NO1A 2Y20A 2XLJA 2VQFM 4M9XA 4Z8XA 4DUZM 3HGIA 3K92A 2B3TA 1VEGA 2MH8A 1SXJD 2Z3XA 4DV6M 1SXJA 2O01F 1PJTA 4WP2A 3B9PA 3FYDA 1D0MA 2D7GA 5KPTA 4AKGA 2KA6B 3FUVA 2Q2EB 2C9CA 1DO0A 4JI1M 4G4QA 2LVOC 4D80A 4CJ6A 5FTNA 4FWGA 1WJ7A 1R4GA 3PVSA 4PDIA 3UMMA 1Z6TA 1IY2A 1IFYA 3SHGB 3K9OA 1WR1B 2JZ1A 3VDPA 4KT0F 1TF0B 1XMQM 4Y28F 1YLAA 4CISA 1L1TA 1QQWA 2CV0A 1NHGC 2FOIC 3E46A 1ORYB 2L6OA 1RU3A 4ZPXA 5L8RF 2EJSA 2DWZB 1NSFA 5IZ7D 3SYLA 4DV5M 1QZMA 1MX0A 1OKSA 3M0EA 2QQ8A 4L8RC 2YFQA 2KEBA 4AKHA 2KXEA 3GRUA 1TH3A 1J5EM 4QNMA 2ZAOA 3VLFB 4B3RM 1I94M 2FFJA 2KNZA 5FSWA 3B89A 3FTCA 2XGNA 4IBJA 4DR7M 4RNAA 2HHHM 5ITUA 3B7QA 4OVZB 2HCBA 4QHSA 2L7HA 1HQYE 3HU3A 1MU5A 1VDLA 4D81A 4MGKE 2KW0A 1NV8A 3GQ4A 2YR0A 3R8FA 2O25A 4JI3M 3PXGA 2EA0A 4IBIA 5JI3E 1GVNA 4MGZE 4R3DA 1DGFA 1V33A 3SAVA 1KFVA 3FTEA 5FTJA 1WHCA 5EXTA 3D8BA 1OIPA 1ZAEA 2CHVA 2UXBM 4PDGA 3U61A 2XZUA 2JY5A 1IM2A 1OIZA 3KOXE 3SFZA 1OAOC 2W82A 3H4MA 2L4FA 3W0LB 1GKIA 2RKOA 2YQZA 1QAOA 1SG9A 4LF6M 4XBOA 3GLFA 3DA1A 4OW0A 2R44A 3AJIB 3GQ3A 5BPVA 1EIJA 4DV2M 2ERCA 4JI0M 2UUCM 1R6BX 1N77A 2F5QA 4I5SA 3KP1E 3JAMS 2OOBA 2JWSA 4DR3M 2UUBM 2Y21A 2QBYB 3LVWA 4B3TM 3AOEC 4OU7A 4TUWA 4LFAM 4NC6A 1PJQA 2X49A 4JI2M 4MGIE 2FH0A 2F5SA 3HJ8A 5A2QS 2DKLA 1N75A 3GLGB 1BVSA 4G6ZA 2JY6B 4QOSA 2Z4RA 3KW6A 1VQ1A 2H5XA 4P16A 1Y8GA 4LJ4A 3DZDA 2EKKA 3AOGA 2N35A 4LF9M 1TTEA 3LCUA 4X66M 1NHWC 4AZFA 1XWIA 2Z7JA 3B7ZA 4IIWA 4S12A 4LGYA 4L4UA 3SHFA 1ZQ9A 1TDZA 4D82A 3KDSE 4KHPM 3U6EA 4NSRA 3TWLA 3VK8A 1C7YA 3C58A 1HNXM 4LF4M 1HR0M 3PNVA 3GLHA 1HT1E 2LVQD 4GC9A 3L28A 4GIPA 3HZJA 5JI2E 4JI6M 4LF8M 3J81S 2QPAA 1QDTA 1QDRA 1IXSB 1XNQM 3VKHA 4YHHM 1JQJC 4L16A 2ZTDA 1NVMA 4FCWA 3SC3A 3KSXA 5ITXA 1XXHB 1R7RA 3ILKA 4LJ6A 4X64M 3U61B 3QWLA 3CF2A 3THGA 2CHQA 1R2YA 4IJFA 2QHOB 3TL4X 3D8LA 4NXMM 2X4AA 2CV2A 4LG2A 4FCTA 4II7A 3WHLA 4GKJM 2H1RA 3KSJA 4KLNA 2RRUA 1H6UA 4NRVA 4NSOB 3ZH9B 3NBXX 4JYAM 2DAMA 3A98B 3VDUA 2BJVA 2NQ8C 1QAMA 3C9PA 3CF6E 4UN2B 1J7KA 4LRSA 2LNHC 2KZSA 2QP9X 1N33M 5FTMA 4B08A 4OX9M 1W5TA 1ZV1A 3I01M 4HL4A 4BB9A 1IBLM 4M9ZA 3U6PA 2FS1A 4QNRA 4DR1M 4K0KM 4PT5A 1GO5A 4GHLA 4Z6YA 1GL6A 2EUCA 4DR2M 2JA2A 2CE7A 2XH9A 4NOOB 4CHTB 2OPFA 1OTRA 3L29A 3JR4A 4IBEA 3SYKA 4GH9A 2ZAMA 4I4LA 3FUXA 4QHTA 3RFWA 1TR8A 2I7NA 1L2DA 3VKGA 2P5TA 3FUTA 2K6BA 3UJNA 2XFTA 1ZMVA 5IWAM 1Z59A 4IBGA 4DV7M 2K47A 1D0KA 1SXJE 4G3OA 5KO3A 3GLIA 4DV3M 2LHCA 3W0FA 2WSFF 4B7GA 4RKUF 3U5ZA 1PM5A 2DNAA 3H4JA 2A5YB 3T1HM 2CUZA 4A3VB 4Q7JA 2QSFX 2YNMD 4G4RA 2JY7A 3T15A 4M9SA 3J7AS 2CP8A 1EFUB 3LQRA 3U6MA 1NNJA 3LMMA 1TH2A 3K9PA 1FJGM 5C18A 4QOZC 3TPZA 3VFDA 4HLQA 2DZNB 2Z4SA 1Q3CA 3HY5A 4GITA 2UXDM 1T43A 2ZBKB 4IBKA 1Z5BA 2GNOA 2KDLA 4B3MM 3KXEC 5FTLA 3BOSA 2MGWA 4JV5M 2HAKA 4LCBA 4LJ7A 4GEWA 3UGJA 3WHKA 1GJSA 2R4EA 1XC8A 2DWLA 5DYIA 3I51A 5FLXS 4FVMA 4AW4A 2JY8A 5EXPA 2OQ4A 4KO8A 3GLGE 3NWLA 2R0IA 1IN6A 1SXJB 3Q8GA 2M5ZA 4LJAA 4CIZA 3U60A 1L2CA 4G4NA 1HNZM 1JR3E 2UUAM 1FNNA 3MMPA 3KS8A 2L09A 2DAEA 2OO9A 5EJCA 2LHGA 4LJ5A 3F92A 4REZA 1SXJC 2Z8YM 1DGBA 3GLIB 2BWEA 2KRKA 1IXRC 3LVVA 4EIWA 4PCZA 4IBBA 3BBZA 2LBCA 5E26A 3EIHA 4LGMA 4LZJA 3K8ZA 4AI6A 3IECA 1XXHE 3HU1A 4NXNM 4LZZA 1N34M 4GRIA 5IREB 3KP0E 1IBKM 1MJGM 2QENA 3MHVC 2BNKA 1HQCA 2K0BX 3KOWE 3KFUG 5FTKA 1VEJA 2J7OA 2QCUA 5F3WA 4FWDA 4MM3B 4DR6M 2MJ5B 4X62M 1TGUA 1G8PA 3HKPA 2DZOB 3OTOM 4LFBM 1HT2E 3J27B 3I04M 4L6V6 5EXXA 3SAUA 4AG5A 3AV0A 1PJSA 2QNJA 4KODA 4G4OA 4GMQA 1DO2A 2QZ4A 2XEPA 4FCVA 3HWSA 3TQSA 1OFIA 3I4VA 3C3DA 1D2NA 3CF0A 1C1KA 1XHBA 2G3QA 2F5PA 3RGSA 3PNYA 2JP7A 2DWNA 5IT9S 2Y0QA 3W67A 2V6ZM 2DAKA 3GRVA 4LY6A 1MN3A 5E6JA 3TE6A 2VIIA 4M0WA 4AG6A 3UK6A 4R71A 1NV9A 1QZEA 3K1JA 2LWXA 1UFZA 3E4RA 1I4WA 4I81A 3W68A 3L2AA 3RE8A 1GL7A 4ANRA 1P3QQ 2MROB 2R46A 3GLHE 2HL7A 2ZTCA 2J5YA 2VDBB 1DGGA 4IJEA 2LH0A 3J2PB 1AIPC 3HJSA 3KS4A 4M0DA 3GLFB 3J7BA 3IG5A 1Q3BA 5ITXE 2FE8A 3GRRA 4F1IA 3EIEA 3A46A 3U6DA 1NY5A 4IBCA 1L8QA 4JI5M 2XSZD 4LF7M 2O5RA 1VG5A 1T3TA 2KHHA 2XSZA 3FKEA 3I4YA 2LXEA 2GQFA 2CRUA 3SAWA 2WZJA 2K9DA 1DGHA 1IN5A 3CGWA 2C5RA 1QAQA 2C99A 2JZ0A 2VQEM 3HJQA 4XK8F 4ITQA 1N36M 3FYCA 4X65M 3GPYA 2LVPC 1WGLA 2L2DA 4LJ8A 1IQPA 4W5WA 1OAIA 2WSEF 4MH0E 1Z5AA 2HWJA 3FUWA 5EP1A 4GHAA 1E9SA 3HX3A 2E5LM 3GLHB 3PFIA 2BJWA 7CATA 3M7GA 1W5SA 2DI0A 3HHWA 2C98A 3NBIA 4LJ9A 5DNYA 1LV7A 3QYBA 1NNUC 1QANA 1L2BA 2R4JA 3SARA 1X37A 4OVZA 3T38A 1KSFX 4RF1A 3T6PA 3ZC7B 4I8OA 4DV0M 5ITQA 5BR8M 2XFSA 1UM8A 4MGYE 3U6SA 1PJIA 2F5NA 3RGPA 3GLIE 4R7GA 2WSCF 3UZUA 4JI4M 4FW9A 1K82A 2M60A 1ZMWA 2R6FA 3E21A 4FWHA 4BBAA 3SBJA 4P17A 3M6AA 4LF5M 4DV1M 3MK6A
chains in the Genus database with same CATH topology
1PGYA 3LCUA 2BWEA 3LCVB 2LTUA 1WGNA 2DAGA 2JNHA 2OOAA 1V92A 3BBZA 2LBCA 1C7YA 2BWBA 1F4IA 3IECA 1XXHE 5JI2E 1HT1E 2LVQD 1G41A 3FRHA 1OQYA 2K0BX 2ZTDA 1VEJA 2B3TA 1VEGA 2MJ5B 4WP2A 2MR9A 1HT2E 2QHOB 1DO0A 1XB2B 1WIVA 2LVOC 2RRUA 2QNJA 1CUKA 5DFLA 1WJ7A 3IHPA 1DO2A 1R4GA 3FRIA 2DAMA 4UN2B 1VEKA 2G3QA 1IFYA 2JP7A 3K9OA 1WR1B 2JZ1A 2KNVA 2DAKA 1MN3A 1ZV1A 4R71A 1NV9A 1QZEA 1YLAA 2DZLA 1GO5A 2L4EA 1UFZA 4DBGB 3E46A 1IXSA 3GLFE 1KYIA 2EJSA 1OTRA 1P3QQ 2MROB 1OKSA 3GLHE 2ZTCA 1Q02A 2KNAA 1AIPC 1TR8A 4HEOA 1ZMVA 4F1IA 2KNZA 3B89A 4G3OA 3FE3A 2DENA 2DNAA 1ZMUA 1VG5A 3H4JA 1HQYE 2KHHA 1VDLA 2LVNC 4Q7JA 1A5TA 1NV8A 2QSFX 2JY7A 2DAIA 2O25A 2WZJA 2K9DA 4F2LA 2CP8A 1EFUB 1HJPA 2JZ0A 3K9PA 2CWBA 1WHCA 2LVPC 1WGLA 2L2DA 1T43A 2JY5A 1IM2A 1OAIA 2DHYA 2L4FA 2HWJA 1SG9A 2MGWA 2HAKA 4GEWA 1G3IA 2DI0A 2EKFA 1DV0A 2JUJA 2JY8A 3GLGE 2OOBA 2R0IA 3T6PA 1E94E 1JR3E 3GLIE 2DKLA 1G4AE 1T6OA 3MMPA 1BVSA 1ZMWA 2JY6B 2LVAA 3E21A 2DAEA 1VQ1A 2H5XA 2OO9A 1Y8GA 3F92A 2EKKA 1TTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGY A;  3LCU A;  2BWE A;  3LCV B;  2LTU A;  1WGN A;  2DAG A;  2JNH A;  2OOA A;  1V92 A;  3BBZ A;  2LBC A;  1C7Y A;  2BWB A;  1F4I A;  3IEC A;  1XXH E;  5JI2 E;  1HT1 E;  2LVQ D;  1G41 A;  3FRH A;  1OQY A;  2K0B X;  2ZTD A;  1VEJ A;  2B3T A;  1VEG A;  2MJ5 B;  4WP2 A;  2MR9 A;  1HT2 E;  2QHO B;  1DO0 A;  1XB2 B;  1WIV A;  2LVO C;  2RRU A;  2QNJ A;  1CUK A;  5DFL A;  1WJ7 A;  3IHP A;  1DO2 A;  1R4G A;  3FRI A;  2DAM A;  4UN2 B;  1VEK A;  2G3Q A;  1IFY A;  2JP7 A;  3K9O A;  1WR1 B;  2JZ1 A;  2KNV A;  2DAK A;  1MN3 A;  1ZV1 A;  4R71 A;  1NV9 A;  1QZE A;  1YLA A;  2DZL A;  1GO5 A;  2L4E A;  1UFZ A;  4DBG B;  3E46 A;  1IXS A;  3GLF E;  1KYI A;  2EJS A;  1OTR A;  1P3Q Q;  2MRO B;  1OKS A;  3GLH E;  2ZTC A;  1Q02 A;  2KNA A;  1AIP C;  1TR8 A;  4HEO A;  1ZMV A;  4F1I A;  2KNZ A;  3B89 A;  4G3O A;  3FE3 A;  2DEN A;  2DNA A;  1ZMU A;  1VG5 A;  3H4J A;  1HQY E;  2KHH A;  1VDL A;  2LVN C;  4Q7J A;  1A5T A;  1NV8 A;  2QSF X;  2JY7 A;  2DAI A;  2O25 A;  2WZJ A;  2K9D A;  4F2L A;  2CP8 A;  1EFU B;  1HJP A;  2JZ0 A;  3K9P A;  2CWB A;  1WHC A;  2LVP C;  1WGL A;  2L2D A;  1T43 A;  2JY5 A;  1IM2 A;  1OAI A;  2DHY A;  2L4F A;  2HWJ A;  1SG9 A;  2MGW A;  2HAK A;  4GEW A;  1G3I A;  2DI0 A;  2EKF A;  1DV0 A;  2JUJ A;  2JY8 A;  3GLG E;  2OOB A;  2R0I A;  3T6P A;  1E94 E;  1JR3 E;  3GLI E;  2DKL A;  1G4A E;  1T6O A;  3MMP A;  1BVS A;  1ZMW A;  2JY6 B;  2LVA A;  3E21 A;  2DAE A;  1VQ1 A;  2H5X A;  2OO9 A;  1Y8G A;  3F92 A;  2EKK A;  1TTE A; 
#chains in the Genus database with same CATH topology
 1N32 M;  3A45 A;  4B3S M;  1QUS A;  4MB7 A;  1E9R A;  1WGN A;  4NRW A;  2JNH A;  2OOA A;  3CTW B;  3AOE A;  2RGH A;  3TWM A;  2UXC M;  2BWB A;  3GPU A;  1AUA A;  4LRT A;  1IN8 A;  3FRH A;  1DGH B;  1G41 A;  3KOZ E;  1OJL A;  1S3S A;  2UU9 M;  3FTD A;  1VDD A;  1R2Z A;  2V1C A;  3KOY E;  2G5G X;  2R18 A;  2QBY A;  4GC5 A;  2DXI A;  3U6Q A;  1IN7 A;  1G71 A;  2MR9 A;  3SMP A;  2D7H A;  1GLN A;  1XB2 B;  1TDH A;  1GJT A;  1WIV A;  3GLG A;  1NJF A;  4MGH A;  1CUK A;  5DFL A;  4DR4 M;  3IHP A;  3FRI A;  3HHZ A;  4JI8 M;  1JR3 D;  1JB0 F;  1JR3 A;  3U5Z B;  1VEK A;  2R65 A;  3L27 A;  4BLC A;  4JI7 M;  2G8L A;  2R45 A;  4WW0 A;  2KNV A;  5C1B A;  3JR5 A;  1Q39 A;  3V76 A;  3C3E A;  2J7N A;  3GO8 A;  2KRU A;  3U6C A;  1K3W A;  2DZL A;  1GAB A;  2L4E A;  3SMS A;  5EXS A;  5KQD A;  3KVW A;  4DBG B;  2C9O A;  1IXS A;  3TWK A;  5H37 D;  1WXQ A;  1KYI A;  5ITR A;  3ZQJ A;  3GLF E;  1XXH A;  2CFO A;  5EQT A;  1N78 A;  3AL0 C;  3DFZ A;  3HHY A;  4GKK M;  2JXN A;  1Q02 A;  2KNA A;  2HKJ A;  5DYG A;  3T1Y M;  8CAT A;  3VK7 A;  4HEO A;  1V34 A;  3K2L A;  3FTF A;  1XNR M;  1QUT A;  3SAS A;  2CEA A;  4IBD A;  4DUY M;  1D0L A;  1HNW M;  3FE3 A;  1L1Z A;  2DEN A;  3FD9 A;  1J09 A;  4RF0 A;  1ZMU A;  4DV4 M;  2F4V M;  2LVN C;  4IBF A;  3U60 B;  1A5T A;  3J80 S;  3B7N A;  2R62 A;  1IXZ A;  2DAI A;  2Y0T A;  3FUU A;  4WUR A;  2XZF A;  1PRB A;  4FD2 A;  5KPR A;  3LW5 F;  3DOA A;  3MJ5 A;  4F2L A;  3AKZ A;  1HJP A;  1IBM M;  1IY0 A;  2CWB A;  2D7E A;  1K3X A;  3QYE A;  3U6O A;  4LFC M;  4AKI A;  3BXW A;  2AHM A;  3B74 A;  3GPX A;  2EO2 A;  2I7P A;  2KZU A;  1NY6 A;  2APL A;  2DHY A;  2DHR A;  5ITY A;  3SAT A;  1OFH A;  3ZCB B;  3GP1 A;  1EE8 A;  2VF7 A;  3Q8X A;  2V1U A;  1QVR A;  3E9S A;  3IG8 A;  5GKN A;  1NJG A;  5KQ8 A;  3R9X B;  2F5O A;  3L26 A;  1G3I A;  2DVW B;  2EKF A;  4JXJ A;  5EP4 A;  1YE9 A;  3GRY A;  4CGY B;  1DV0 A;  1QYR A;  2JUJ A;  2RGO A;  4NL4 H;  3GQ5 A;  1PJJ A;  5LMN M;  1YSY A;  3HHX A;  4XGI A;  4B7H A;  3HU2 A;  1E94 E;  4AQY M;  2FNA A;  3U6L A;  2C96 A;  2XF3 A;  2ZM6 M;  1Z5C A;  1G4A E;  1T6O A;  2L7I A;  5LMU M;  1TH4 A;  2LVA A;  2X8A A;  1G59 A;  3QAU A;  4PD2 A;  1IN4 A;  2VF8 A;  4L78 A;  4YY3 M;  2DWM A;  3GPP A;  1PGY A;  2CHG A;  5EP3 A;  3LCV B;  3A42 A;  2LTU A;  4L15 A;  4DR5 M;  2DAG A;  5KPZ A;  1IY1 A;  1V92 A;  1YUB A;  3LQQ A;  4B7F A;  1F4I A;  1R5L A;  1XMO M;  3L25 A;  5ITT A;  2ZAN A;  1LTM A;  1OQY A;  4JN6 A;  5EP2 A;  2CV1 A;  1E32 A;  3AFH A;  1NO1 A;  2Y20 A;  2XLJ A;  2VQF M;  4M9X A;  4Z8X A;  4DUZ M;  3HGI A;  3K92 A;  2B3T A;  1VEG A;  2MH8 A;  1SXJ D;  2Z3X A;  4DV6 M;  1SXJ A;  2O01 F;  1PJT A;  4WP2 A;  3B9P A;  3FYD A;  1D0M A;  2D7G A;  5KPT A;  4AKG A;  2KA6 B;  3FUV A;  2Q2E B;  2C9C A;  1DO0 A;  4JI1 M;  4G4Q A;  2LVO C;  4D80 A;  4CJ6 A;  5FTN A;  4FWG A;  1WJ7 A;  1R4G A;  3PVS A;  4PDI A;  3UMM A;  1Z6T A;  1IY2 A;  1IFY A;  3SHG B;  3K9O A;  1WR1 B;  2JZ1 A;  3VDP A;  4KT0 F;  1TF0 B;  1XMQ M;  4Y28 F;  1YLA A;  4CIS A;  1L1T A;  1QQW A;  2CV0 A;  1NHG C;  2FOI C;  3E46 A;  1ORY B;  2L6O A;  1RU3 A;  4ZPX A;  5L8R F;  2EJS A;  2DWZ B;  1NSF A;  5IZ7 D;  3SYL A;  4DV5 M;  1QZM A;  1MX0 A;  1OKS A;  3M0E A;  2QQ8 A;  4L8R C;  2YFQ A;  2KEB A;  4AKH A;  2KXE A;  3GRU A;  1TH3 A;  1J5E M;  4QNM A;  2ZAO A;  3VLF B;  4B3R M;  1I94 M;  2FFJ A;  2KNZ A;  5FSW A;  3B89 A;  3FTC A;  2XGN A;  4IBJ A;  4DR7 M;  4RNA A;  2HHH M;  5ITU A;  3B7Q A;  4OVZ B;  2HCB A;  4QHS A;  2L7H A;  1HQY E;  3HU3 A;  1MU5 A;  1VDL A;  4D81 A;  4MGK E;  2KW0 A;  1NV8 A;  3GQ4 A;  2YR0 A;  3R8F A;  2O25 A;  4JI3 M;  3PXG A;  2EA0 A;  4IBI A;  5JI3 E;  1GVN A;  4MGZ E;  4R3D A;  1DGF A;  1V33 A;  3SAV A;  1KFV A;  3FTE A;  5FTJ A;  1WHC A;  5EXT A;  3D8B A;  1OIP A;  1ZAE A;  2CHV A;  2UXB M;  4PDG A;  3U61 A;  2XZU A;  2JY5 A;  1IM2 A;  1OIZ A;  3KOX E;  3SFZ A;  1OAO C;  2W82 A;  3H4M A;  2L4F A;  3W0L B;  1GKI A;  2RKO A;  2YQZ A;  1QAO A;  1SG9 A;  4LF6 M;  4XBO A;  3GLF A;  3DA1 A;  4OW0 A;  2R44 A;  3AJI B;  3GQ3 A;  5BPV A;  1EIJ A;  4DV2 M;  2ERC A;  4JI0 M;  2UUC M;  1R6B X;  1N77 A;  2F5Q A;  4I5S A;  3KP1 E;  3JAM S;  2OOB A;  2JWS A;  4DR3 M;  2UUB M;  2Y21 A;  2QBY B;  3LVW A;  4B3T M;  3AOE C;  4OU7 A;  4TUW A;  4LFA M;  4NC6 A;  1PJQ A;  2X49 A;  4JI2 M;  4MGI E;  2FH0 A;  2F5S A;  3HJ8 A;  5A2Q S;  2DKL A;  1N75 A;  3GLG B;  1BVS A;  4G6Z A;  2JY6 B;  4QOS A;  2Z4R A;  3KW6 A;  1VQ1 A;  2H5X A;  4P16 A;  1Y8G A;  4LJ4 A;  3DZD A;  2EKK A;  3AOG A;  2N35 A;  4LF9 M;  1TTE A;  3LCU A;  4X66 M;  1NHW C;  4AZF A;  1XWI A;  2Z7J A;  3B7Z A;  4IIW A;  4S12 A;  4LGY A;  4L4U A;  3SHF A;  1ZQ9 A;  1TDZ A;  4D82 A;  3KDS E;  4KHP M;  3U6E A;  4NSR A;  3TWL A;  3VK8 A;  1C7Y A;  3C58 A;  1HNX M;  4LF4 M;  1HR0 M;  3PNV A;  3GLH A;  1HT1 E;  2LVQ D;  4GC9 A;  3L28 A;  4GIP A;  3HZJ A;  5JI2 E;  4JI6 M;  4LF8 M;  3J81 S;  2QPA A;  1QDT A;  1QDR A;  1IXS B;  1XNQ M;  3VKH A;  4YHH M;  1JQJ C;  4L16 A;  2ZTD A;  1NVM A;  4FCW A;  3SC3 A;  3KSX A;  5ITX A;  1XXH B;  1R7R A;  3ILK A;  4LJ6 A;  4X64 M;  3U61 B;  3QWL A;  3CF2 A;  3THG A;  2CHQ A;  1R2Y A;  4IJF A;  2QHO B;  3TL4 X;  3D8L A;  4NXM M;  2X4A A;  2CV2 A;  4LG2 A;  4FCT A;  4II7 A;  3WHL A;  4GKJ M;  2H1R A;  3KSJ A;  4KLN A;  2RRU A;  1H6U A;  4NRV A;  4NSO B;  3ZH9 B;  3NBX X;  4JYA M;  2DAM A;  3A98 B;  3VDU A;  2BJV A;  2NQ8 C;  1QAM A;  3C9P A;  3CF6 E;  4UN2 B;  1J7K A;  4LRS A;  2LNH C;  2KZS A;  2QP9 X;  1N33 M;  5FTM A;  4B08 A;  4OX9 M;  1W5T A;  1ZV1 A;  3I01 M;  4HL4 A;  4BB9 A;  1IBL M;  4M9Z A;  3U6P A;  2FS1 A;  4QNR A;  4DR1 M;  4K0K M;  4PT5 A;  1GO5 A;  4GHL A;  4Z6Y A;  1GL6 A;  2EUC A;  4DR2 M;  2JA2 A;  2CE7 A;  2XH9 A;  4NOO B;  4CHT B;  2OPF A;  1OTR A;  3L29 A;  3JR4 A;  4IBE A;  3SYK A;  4GH9 A;  2ZAM A;  4I4L A;  3FUX A;  4QHT A;  3RFW A;  1TR8 A;  2I7N A;  1L2D A;  3VKG A;  2P5T A;  3FUT A;  2K6B A;  3UJN A;  2XFT A;  1ZMV A;  5IWA M;  1Z59 A;  4IBG A;  4DV7 M;  2K47 A;  1D0K A;  1SXJ E;  4G3O A;  5KO3 A;  3GLI A;  4DV3 M;  2LHC A;  3W0F A;  2WSF F;  4B7G A;  4RKU F;  3U5Z A;  1PM5 A;  2DNA A;  3H4J A;  2A5Y B;  3T1H M;  2CUZ A;  4A3V B;  4Q7J A;  2QSF X;  2YNM D;  4G4R A;  2JY7 A;  3T15 A;  4M9S A;  3J7A S;  2CP8 A;  1EFU B;  3LQR A;  3U6M A;  1NNJ A;  3LMM A;  1TH2 A;  3K9P A;  1FJG M;  5C18 A;  4QOZ C;  3TPZ A;  3VFD A;  4HLQ A;  2DZN B;  2Z4S A;  1Q3C A;  3HY5 A;  4GIT A;  2UXD M;  1T43 A;  2ZBK B;  4IBK A;  1Z5B A;  2GNO A;  2KDL A;  4B3M M;  3KXE C;  5FTL A;  3BOS A;  2MGW A;  4JV5 M;  2HAK A;  4LCB A;  4LJ7 A;  4GEW A;  3UGJ A;  3WHK A;  1GJS A;  2R4E A;  1XC8 A;  2DWL A;  5DYI A;  3I51 A;  5FLX S;  4FVM A;  4AW4 A;  2JY8 A;  5EXP A;  2OQ4 A;  4KO8 A;  3GLG E;  3NWL A;  2R0I A;  1IN6 A;  1SXJ B;  3Q8G A;  2M5Z A;  4LJA A;  4CIZ A;  3U60 A;  1L2C A;  4G4N A;  1HNZ M;  1JR3 E;  2UUA M;  1FNN A;  3MMP A;  3KS8 A;  2L09 A;  2DAE A;  2OO9 A;  5EJC A;  2LHG A;  4LJ5 A;  3F92 A;  4REZ A;  1SXJ C;  2Z8Y M;  1DGB A;  3GLI B;  2BWE A;  2KRK A;  1IXR C;  3LVV A;  4EIW A;  4PCZ A;  4IBB A;  3BBZ A;  2LBC A;  5E26 A;  3EIH A;  4LGM A;  4LZJ A;  3K8Z A;  4AI6 A;  3IEC A;  1XXH E;  3HU1 A;  4NXN M;  4LZZ A;  1N34 M;  4GRI A;  5IRE B;  3KP0 E;  1IBK M;  1MJG M;  2QEN A;  3MHV C;  2BNK A;  1HQC A;  2K0B X;  3KOW E;  3KFU G;  5FTK A;  1VEJ A;  2J7O A;  2QCU A;  5F3W A;  4FWD A;  4MM3 B;  4DR6 M;  2MJ5 B;  4X62 M;  1TGU A;  1G8P A;  3HKP A;  2DZO B;  3OTO M;  4LFB M;  1HT2 E;  3J27 B;  3I04 M;  4L6V 6;  5EXX A;  3SAU A;  4AG5 A;  3AV0 A;  1PJS A;  2QNJ A;  4KOD A;  4G4O A;  4GMQ A;  1DO2 A;  2QZ4 A;  2XEP A;  4FCV A;  3HWS A;  3TQS A;  1OFI A;  3I4V A;  3C3D A;  1D2N A;  3CF0 A;  1C1K A;  1XHB A;  2G3Q A;  2F5P A;  3RGS A;  3PNY A;  2JP7 A;  2DWN A;  5IT9 S;  2Y0Q A;  3W67 A;  2V6Z M;  2DAK A;  3GRV A;  4LY6 A;  1MN3 A;  5E6J A;  3TE6 A;  2VII A;  4M0W A;  4AG6 A;  3UK6 A;  4R71 A;  1NV9 A;  1QZE A;  3K1J A;  2LWX A;  1UFZ A;  3E4R A;  1I4W A;  4I81 A;  3W68 A;  3L2A A;  3RE8 A;  1GL7 A;  4ANR A;  1P3Q Q;  2MRO B;  2R46 A;  3GLH E;  2HL7 A;  2ZTC A;  2J5Y A;  2VDB B;  1DGG A;  4IJE A;  2LH0 A;  3J2P B;  1AIP C;  3HJS A;  3KS4 A;  4M0D A;  3GLF B;  3J7B A;  3IG5 A;  1Q3B A;  5ITX E;  2FE8 A;  3GRR A;  4F1I A;  3EIE A;  3A46 A;  3U6D A;  1NY5 A;  4IBC A;  1L8Q A;  4JI5 M;  2XSZ D;  4LF7 M;  2O5R A;  1VG5 A;  1T3T A;  2KHH A;  2XSZ A;  3FKE A;  3I4Y A;  2LXE A;  2GQF A;  2CRU A;  3SAW A;  2WZJ A;  2K9D A;  1DGH A;  1IN5 A;  3CGW A;  2C5R A;  1QAQ A;  2C99 A;  2JZ0 A;  2VQE M;  3HJQ A;  4XK8 F;  4ITQ A;  1N36 M;  3FYC A;  4X65 M;  3GPY A;  2LVP C;  1WGL A;  2L2D A;  4LJ8 A;  1IQP A;  4W5W A;  1OAI A;  2WSE F;  4MH0 E;  1Z5A A;  2HWJ A;  3FUW A;  5EP1 A;  4GHA A;  1E9S A;  3HX3 A;  2E5L M;  3GLH B;  3PFI A;  2BJW A;  7CAT A;  3M7G A;  1W5S A;  2DI0 A;  3HHW A;  2C98 A;  3NBI A;  4LJ9 A;  5DNY A;  1LV7 A;  3QYB A;  1NNU C;  1QAN A;  1L2B A;  2R4J A;  3SAR A;  1X37 A;  4OVZ A;  3T38 A;  1KSF X;  4RF1 A;  3T6P A;  3ZC7 B;  4I8O A;  4DV0 M;  5ITQ A;  5BR8 M;  2XFS A;  1UM8 A;  4MGY E;  3U6S A;  1PJI A;  2F5N A;  3RGP A;  3GLI E;  4R7G A;  2WSC F;  3UZU A;  4JI4 M;  4FW9 A;  1K82 A;  2M60 A;  1ZMW A;  2R6F A;  3E21 A;  4FWH A;  4BBA A;  3SBJ A;  4P17 A;  3M6A A;  4LF5 M;  4DV1 M;  3MK6 A; 
#chains in the Genus database with same CATH homology
 1PGY A;  3LCU A;  2BWE A;  3LCV B;  2LTU A;  1WGN A;  2DAG A;  2JNH A;  2OOA A;  1V92 A;  3BBZ A;  2LBC A;  1C7Y A;  2BWB A;  1F4I A;  3IEC A;  1XXH E;  5JI2 E;  1HT1 E;  2LVQ D;  1G41 A;  3FRH A;  1OQY A;  2K0B X;  2ZTD A;  1VEJ A;  2B3T A;  1VEG A;  2MJ5 B;  4WP2 A;  2MR9 A;  1HT2 E;  2QHO B;  1DO0 A;  1XB2 B;  1WIV A;  2LVO C;  2RRU A;  2QNJ A;  1CUK A;  5DFL A;  1WJ7 A;  3IHP A;  1DO2 A;  1R4G A;  3FRI A;  2DAM A;  4UN2 B;  1VEK A;  2G3Q A;  1IFY A;  2JP7 A;  3K9O A;  1WR1 B;  2JZ1 A;  2KNV A;  2DAK A;  1MN3 A;  1ZV1 A;  4R71 A;  1NV9 A;  1QZE A;  1YLA A;  2DZL A;  1GO5 A;  2L4E A;  1UFZ A;  4DBG B;  3E46 A;  1IXS A;  3GLF E;  1KYI A;  2EJS A;  1OTR A;  1P3Q Q;  2MRO B;  1OKS A;  3GLH E;  2ZTC A;  1Q02 A;  2KNA A;  1AIP C;  1TR8 A;  4HEO A;  1ZMV A;  4F1I A;  2KNZ A;  3B89 A;  4G3O A;  3FE3 A;  2DEN A;  2DNA A;  1ZMU A;  1VG5 A;  3H4J A;  1HQY E;  2KHH A;  1VDL A;  2LVN C;  4Q7J A;  1A5T A;  1NV8 A;  2QSF X;  2JY7 A;  2DAI A;  2O25 A;  2WZJ A;  2K9D A;  4F2L A;  2CP8 A;  1EFU B;  1HJP A;  2JZ0 A;  3K9P A;  2CWB A;  1WHC A;  2LVP C;  1WGL A;  2L2D A;  1T43 A;  2JY5 A;  1IM2 A;  1OAI A;  2DHY A;  2L4F A;  2HWJ A;  1SG9 A;  2MGW A;  2HAK A;  4GEW A;  1G3I A;  2DI0 A;  2EKF A;  1DV0 A;  2JUJ A;  2JY8 A;  3GLG E;  2OOB A;  2R0I A;  3T6P A;  1E94 E;  1JR3 E;  3GLI E;  2DKL A;  1G4A E;  1T6O A;  3MMP A;  1BVS A;  1ZMW A;  2JY6 B;  2LVA A;  3E21 A;  2DAE A;  1VQ1 A;  2H5X A;  2OO9 A;  1Y8G A;  3F92 A;  2EKK A;  1TTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...