2MGWA

Solution structure of the uba domain of human nbr1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Next to BRCA1 gene 1 protein
publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mgwA00
1OKSA 1AIPC 1JR3E 2OO9A 2QSFX 3FRIA 1CUKA 1WIVA 1NV8A 1ZMVA 3K9OA 1GO5A 1WHCA 1E94E 2JZ1A 1T43A 2JY6B 2LVAA 2MGWA 1WJ7A 5DFLA 1OAIA 3IHPA 1DO0A 2LTUA 1V92A 1G3IA 4WP2A 2HAKA 2JY5A 2LVNC 4DBGB 1NV9A 1WGNA 1EFUB 2CWBA 3GLGE 1G4AE 1IXSA 1C7YA 2OOBA 3IECA 2DHYA 4UN2B 2LVOC 2MR9A 3FE3A 3B89A 1OTRA 1DV0A 2DI0A 1T6OA 2LVQD 3LCUA 1QZEA 1VDLA 2JY7A 2R0IA 3E21A 2G3QA 1WR1B 1G41A 2DAMA 2LVPC 1UFZA 2L2DA 1IFYA 4GEWA 1XB2B 1VEKA 2CP8A 2B3TA 2DAEA 2DKLA 2JNHA 3H4JA 1ZV1A 1VEGA 1HT1E 2JUJA 2QHOB 1SG9A 2JZ0A 2DAKA 3LCVB 2DAGA 3T6PA 1R4GA 1F4IA 3BBZA 2MROB 2WZJA 3MMPA 2BWBA 2JP7A 2RRUA 1OQYA 2H5XA 3FRHA 2EJSA 1HJPA 2L4FA 1XXHE 2OOAA 2O25A 3F92A 2KNZA 2HWJA 1BVSA 3GLIE 2DZLA 2ZTDA 3GLHE 3K9PA 2DAIA 2KNVA 2QNJA 4G3OA 2DNAA 1A5TA 1VEJA 2K9DA 2EKFA 1Y8GA 2DENA 1TTEA 1KYIA 1P3QQ 1DO2A 1TR8A 2K0BX 2JY8A 1HT2E 2ZTCA 4F2LA 2EKKA 1MN3A 3GLFE 1WGLA 3E46A 4Q7JA 5JI2E 1ZMWA 1PGYA 2KNAA 4R71A 2L4EA 1HQYE 4HEOA 1VG5A 1ZMUA 2MJ5B 1YLAA 4F1IA 1IM2A 2LBCA 1VQ1A 1Q02A 2BWEA 2KHHA
chains in the Genus database with same CATH superfamily
3GPYA 1OKSA 1AIPC 1NO1A 1IY0A 2XGNA 4LJAA 4DR7M 1JR3A 1NV8A 4KHPM 4MH0E 1GO5A 3QYBA 2C98A 3GRVA 4LRTA 1WHCA 4KT0F 3M7GA 1G59A 5IREB 3WHKA 4PCZA 4Z8XA 4JI6M 1IXSB 3B9PA 1MX0A 2FH0A 2N35A 3IG5A 4FCWA 2HHHM 4W5WA 4NRWA 4AKIA 4YY3M 4LFAM 1IBLM 5EXSA 1IN7A 4LG2A 1Z6TA 3FD9A 3VLFB 1NV9A 4X66M 2Y21A 2HL7A 4M9XA 4QHSA 3D8BA 1NJGA 4JI0M 1OIZA 3U6PA 2V1UA 4L6V6 4RNAA 4FVMA 2FS1A 1G4AE 1IXSA 1C7YA 2UXDM 3B7QA 4UN2B 3FE3A 1IXRC 1FNNA 4KO8A 4LJ7A 1GLNA 1FJGM 3A46A 3KDSE 3U6LA 1K3XA 4PT5A 2H1RA 5ITUA 4KODA 3R8FA 4G4NA 3HWSA 5ITXA 3E21A 1G41A 4IJFA 3J7BA 4AW4A 4B3SM 2C9CA 3EIEA 4QOZC 4D80A 4YHHM 1N77A 4LJ4A 3AJIB 3HJQA 3ZQJA 4GEWA 4GC9A 4FCVA 1VEKA 1SXJE 4NXMM 1J5EM 1GJSA 4JXJA 1ZV1A 2XH9A 3U6SA 1SXJD 4DR3M 3KFUG 1LTMA 5E26A 4D82A 2QHOB 4LF8M 4MGHA 2L7IA 4QNRA 5FTMA 8CATA 3M0EA 2Z4RA 3GPPA 3LCVB 3KS8A 3T6PA 1R4GA 4LF9M 3BBZA 2MROB 5FTKA 5A2QS 3VK7A 1OQYA 3L28A 4NL4H 1KSFX 5IT9S 2LNHC 3CGWA 3FRHA 4GC5A 2EJSA 1N34M 4LFBM 3KOZE 4Y28F 1KFVA 3I4YA 2L4FA 4IBFA 2LWXA 1XXHE 2LHGA 1HNZM 2O25A 3L2AA 3TL4X 2KEBA 2HWJA 4L4UA 1N78A 4P17A 1IN4A 2V6ZM 3GLIE 5BPVA 1GJTA 2HKJA 4JI8M 1HNWM 2BJVA 3GLHE 1PJTA 3KSXA 2DAIA 2KNVA 3CF2A 3UMMA 2QP9X 1PJJA 4G3OA 1ORYB 1A5TA 1VEJA 2J5YA 1NY5A 2DWZB 2QQ8A 3U60A 1EE8A 2WSCF 1Y8GA 1TTEA 3HJSA 2KZSA 4NOOB 4M0WA 3SAVA 2CEAA 4MB7A 4B08A 3HU3A 4X65M 1L8QA 3Q8XA 4LJ8A 4GHAA 1DGHB 2ZTCA 3FUWA 1TGUA 2EKKA 5KO3A 1MN3A 3GLFE 1WGLA 1GKIA 3RFWA 2V1CA 5JI2E 1L2CA 1PGYA 2KNAA 2R44A 3KW6A 1HR0M 2DWLA 4HLQA 2KRKA 1Q3BA 3GQ4A 1ZMUA 3DA1A 3GO8A 1DGHA 1IM2A 2APLA 2J7OA 4QNMA 3SBJA 1R2YA 3KOWE 2BWEA 4RKUF 4IBGA 4GRIA 3SATA 2OO9A 2L09A 3HX3A 3AKZA 2L6OA 2I7PA 1PJQA 3FRIA 4MGZE 1CUKA 3AOEA 1NNUC 1H6UA 1ZMVA 2DHRA 4DV6M 2Z7JA 4LGMA 4LF4M 3T1HM 5DYIA 3T1YM 1XMOM 1IN8A 2LVAA 2MGWA 4QOSA 1SXJB 1OFHA 2YR0A 3CF6E 1V92A 1Z5BA 1HNXM 2EA0A 1G3IA 1TH3A 4JI3M 1RU3A 4WP2A 2HAKA 2CRUA 2VF7A 1TDZA 1QAQA 3R9XB 1EFUB 2X4AA 2XLJA 4GHLA 4G4QA 2F4VM 4JI1M 3T38A 3TWLA 3GLGE 2E5LM 3ZCBB 4CIZA 1NVMA 4X64M 3IECA 1Q3CA 2DHYA 1TDHA 4DV1M 2MR9A 3HY5A 3B74A 4AI6A 2WSFF 4L16A 3MJ5A 1XXHB 1OTRA 1DV0A 1IY1A 5EXTA 2CHQA 1PJIA 3SASA 4RF1A 1QZMA 4A3VB 5EQTA 1T6OA 4DR2M 4JI4M 3LCUA 4NC6A 1L2BA 1VDLA 1DGFA 2GNOA 1JQJC 3FUTA 3FYDA 2DWMA 1IY2A 2JY7A 3GLIB 3U6OA 4JYAM 2I7NA 3U61B 4LGYA 3GLHB 2DZNB 2ZAOA 4LCBA 2L2DA 2F5OA 1XXHA 1L1ZA 3LW5F 3HHZA 2G8LA 3UGJA 2XF3A 4LJ9A 2OQ4A 4II7A 3LMMA 4CHTB 3L26A 2B3TA 3GLIA 2Z3XA 2JUJA 3U61A 5C18A 3GLHA 3LQRA 1Z5AA 1I94M 1W5TA 1IN5A 4OVZB 2DAGA 1XHBA 3FUUA 1F4IA 3GLFB 4OW0A 5ITTA 2VQEM 1QQWA 2R4JA 4G4RA 4IBDA 1C1KA 5KPZA 4M9SA 4B3MM 3I4VA 5ITRA 2HCBA 3K1JA 2XSZA 2D7HA 5H37D 5FLXS 2KDLA 3GQ5A 3DZDA 3FTEA 4DV3M 1I4WA 4GMQA 5KPTA 4IJEA 5BR8M 1K3WA 3HGIA 2DZLA 4HL4A 3K9PA 3GRUA 4FW9A 2LHCA 3HHYA 4DV4M 1G71A 5F3WA 3QAUA 2DNAA 4GITA 2YNMD 2RKOA 3BXWA 1GL7A 2AHMA 2EKFA 1R2ZA 2DENA 5EXXA 1KYIA 3AOGA 1P3QQ 5C1BA 1DO2A 2X8AA 2Y0QA 3PNYA 3U6DA 4LF5M 2K0BX 1J09A 1HT2E 1NSFA 3L29A 1NHWC 1QANA 1QUSA 1OIPA 4Q7JA 5FSWA 4TUWA 1ZMWA 2QENA 2FFJA 5EP3A 4CJ6A 1HQYE 4HEOA 1VG5A 1DGGA 4GKJM 2CUZA 4XGIA 3NBIA 4F1IA 1QVRA 5DNYA 2VF8A 3SMPA 5KQ8A 3GPUA 5LMNM 2LBCA 2K47A 1Q02A 1MJGM 2RGHA 4RF0A 3J81S 3NWLA 1XMQM 4NSOB 4B7FA 1JR3E 4JN6A 4L15A 1K82A 2ZM6M 3A98B 1JR3D 1WIVA 1Z5CA 3CTWB 2Y0TA 3K9OA 5EXPA 2CV2A 4X62M 2XFSA 3RGSA 3B7ZA 3I04M 2JZ1A 4AKHA 3VKGA 2JY6B 1S3SA 5EP2A 1WJ7A 2XEPA 5ITQA 1OAIA 2R4EA 1DO0A 4QHTA 3E4RA 1D0KA 4AG6A 3KVWA 3VKHA 2C99A 3I01M 4LZZA 1ZAEA 1XNRM 4IBBA 4M0DA 2JY5A 2LVNC 1QUTA 3TWKA 1WGNA 4ITQA 4IBEA 1R7RA 2CWBA 1TH4A 2BJWA 5FTLA 2NQ8C 5IZ7D 2G5GX 3HU2A 3LVWA 2FOIC 1OJLA 2ERCA 1NJFA 3VDUA 1GL6A 4I8OA 3B89A 2RGOA 5DYGA 4LFCM 5E6JA 5JI3E 2DI0A 5ITXE 4S12A 3RE8A 2CHGA 1VDDA 3AFHA 3TWMA 3U5ZB 3AL0C 2EO2A 3FYCA 4KLNA 2R0IA 3JR4A 1YSYA 1N33M 3JR5A 1IBMM 3W68A 3SAUA 2DAMA 2F5PA 2LVPC 5FTJA 1UFZA 3KOYE 2KA6B 2ZANA 1XC8A 3I51A 1TF0B 2XZFA 3B7NA 4G6ZA 3MHVC 2O01F 3GQ3A 4FWGA 2CP8A 1N75A 2DKLA 2JNHA 3C3EA 3H4JA 2F5NA 3U5ZA 1VEGA 2QPAA 1MU5A 1SXJA 1NHGC 4PDGA 2R45A 2CHVA 3UZUA 1SG9A 3VK8A 4XK8F 2W82A 1X37A 4FD2A 1NY6A 2WZJA 1XWIA 3DFZA 4ZPXA 3MMPA 3GP1A 3AOEC 2YQZA 3KXEC 2CV1A 4L8RC 4MGKE 3SAWA 1IBKM 5KPRA 1HJPA 2UU9M 3T15A 4AZFA 3TPZA 3PXGA 3FUVA 2OOAA 3GRRA 4WURA 2J7NA 4IBJA 3F92A 1R6BX 2UUAM 3PFIA 3DOAA 3UJNA 4OX9M 2OPFA 4WW0A 4P16A 4DV5M 1QDRA 2ZTDA 2KZUA 2QZ4A 1SXJC 3J7AS 1J7KA 3SHFA 4M9ZA 5LMUM 2K9DA 3VDPA 4I81A 3EIHA 2R62A 4DR1M 3FTDA 2CFOA 1L2DA 2LH0A 4R7GA 4I5SA 4JI7M 1TR8A 3NBXX 1D0LA 5EP1A 3PNVA 2R18A 2CE7A 4F2LA 4L78A 2VQFM 2P5TA 3A45A 3QWLA 4DR6M 3CF0A 1OAOC 4PD2A 2K6BA 3E46A 4PDIA 2KRUA 4FCTA 2UUCM 3J27B 3KOXE 3ZC7B 4OVZA 4R71A 2C96A 4JI2M 2GQFA 2Z4SA 2R6FA 3W67A 3GLFA 3FKEA 3FUXA 2XZUA 4IBCA 3K2LA 7CATA 3U6CA 3HZJA 4DR4M 2MJ5B 4IBKA 1E32A 1NNJA 4IIWA 2Q2EB 3BOSA 4AG5A 3U6MA 2F5QA 4BBAA 1VQ1A 2M5ZA 2JA2A 1N32M 3SYLA 4B3TM 2QSFX 2KXEA 4B7GA 4EIWA 3V76A 1D2NA 4JV5M 3KS4A 1PRBA 2JWSA 4MM3B 3SMSA 4Z6YA 1IXZA 3C9PA 3ZH9B 2ZBKB 1E94E 1T43A 4DUZM 4GKKM 5DFLA 5GKNA 1OFIA 2D7EA 3IHPA 2LTUA 4FWDA 3RGPA 3C58A 1G8PA 1JB0F 2Y20A 3SFZA 4D81A 3HJ8A 3GLGB 4DBGB 1QAMA 1AUAA 1W5SA 4NXNM 2L7HA 4DV7M 2DVWB 3KP0E 2CV0A 2VDBB 4LRSA 2OOBA 1XNQM 2LVOC 3GLGA 4GH9A 4MGIE 2QCUA 3MK6A 2JXNA 2UXBM 1YE9A 5ITYA 5KQDA 1ZQ9A 3C3DA 2LVQD 2QBYB 3E9SA 3HKPA 1QZEA 1L1TA 4BB9A 2UXCM 1QDTA 5EJCA 5L8RF 2G3QA 1WR1B 2UUBM 2DXIA 3SYKA 4LF7M 3U60B 3GRYA 1LV7A 1IFYA 4DR5M 1DGBA 1XB2B 4NRVA 2EUCA 4REZA 4DV2M 4B3RM 2QBYA 4ANRA 2DAEA 3LVVA 1UM8A 3J2PB 1T3TA 4LZJA 1HT1E 2XFTA 2VIIA 3J80S 3SC3A 3FTFA 2JZ0A 4GIPA 3Q8GA 2DAKA 4I4LA 4XBOA 3HHWA 4LY6A 3QYEA 3K8ZA 3A42A 3LQQA 2BWBA 2JP7A 2RRUA 1PM5A 2H5XA 4R3DA 3M6AA 5IWAM 3OTOM 4K0KM 1WXQA 5EP4A 4B7HA 3K92A 3IG8A 1R5LA 2XSZD 1EIJA 1D0MA 4CGYB 4AQYM 2KW0A 2ZAMA 3U6EA 3JAMS 4JI5M 2KNZA 2C5RA 3SHGB 2MH8A 3KSJA 2DZOB 1PJSA 4NSRA 1BVSA 2FE8A 1QAOA 2M60A 4DV0M 4DUYM 1E9SA 3VFDA 2BNKA 2LXEA 4BLCA 4G4OA 2QNJA 3TQSA 5FTNA 2R65A 2WSEF 4IBIA 2YFQA 3AV0A 1YUBA 2R46A 1HQCA 1Q39A 2FNAA 1IQPA 3H4MA 2A5YB 3U6QA 2JY8A 2Z8YM 3L27A 2C9OA 3HHXA 1V34A 3W0LB 3FTCA 3L25A 4LF6M 1E9RA 2DWNA 1V33A 4CISA 3TE6A 3THGA 3GPXA 1GABA 2F5SA 1QYRA 3D8LA 2L4EA 3HU1A 4FWHA 3KP1E 4AKGA 4LJ6A 1Z59A 3ILKA 1IN6A 3W0FA 3UK6A 4MGYE 2X49A 1GVNA 3WHLA 1YLAA 2D7GA 1N36M 3PVSA 4OU7A 3SARA 2O5RA 4LJ5A 1TH2A 2KHHA
chains in the Genus database with same CATH topology
1OKSA 1AIPC 1JR3E 2OO9A 2QSFX 3FRIA 1CUKA 1WIVA 1NV8A 1ZMVA 3K9OA 1GO5A 1WHCA 1E94E 2JZ1A 1T43A 2JY6B 2LVAA 2MGWA 1WJ7A 5DFLA 1OAIA 3IHPA 1DO0A 2LTUA 1V92A 1G3IA 4WP2A 2HAKA 2JY5A 2LVNC 4DBGB 1NV9A 1WGNA 1EFUB 2CWBA 3GLGE 1G4AE 1IXSA 1C7YA 2OOBA 3IECA 2DHYA 4UN2B 2LVOC 2MR9A 3FE3A 3B89A 1OTRA 1DV0A 2DI0A 1T6OA 2LVQD 3LCUA 1QZEA 1VDLA 2JY7A 2R0IA 3E21A 2G3QA 1WR1B 1G41A 2DAMA 2LVPC 1UFZA 2L2DA 1IFYA 4GEWA 1XB2B 1VEKA 2CP8A 2B3TA 2DAEA 2DKLA 2JNHA 3H4JA 1ZV1A 1VEGA 1HT1E 2JUJA 2QHOB 1SG9A 2JZ0A 2DAKA 3LCVB 2DAGA 3T6PA 1R4GA 1F4IA 3BBZA 2MROB 2WZJA 3MMPA 2BWBA 2JP7A 2RRUA 1OQYA 2H5XA 3FRHA 2EJSA 1HJPA 2L4FA 1XXHE 2OOAA 2O25A 3F92A 2KNZA 2HWJA 1BVSA 3GLIE 2DZLA 2ZTDA 3GLHE 3K9PA 2DAIA 2KNVA 2QNJA 4G3OA 2DNAA 1A5TA 1VEJA 2K9DA 2EKFA 1Y8GA 2DENA 1TTEA 1KYIA 1P3QQ 1DO2A 1TR8A 2K0BX 2JY8A 1HT2E 2ZTCA 4F2LA 2EKKA 1MN3A 3GLFE 1WGLA 3E46A 4Q7JA 5JI2E 1ZMWA 1PGYA 2KNAA 4R71A 2L4EA 1HQYE 4HEOA 1VG5A 1ZMUA 2MJ5B 1YLAA 4F1IA 1IM2A 2LBCA 1VQ1A 1Q02A 2BWEA 2KHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKS A;  1AIP C;  1JR3 E;  2OO9 A;  2QSF X;  3FRI A;  1CUK A;  1WIV A;  1NV8 A;  1ZMV A;  3K9O A;  1GO5 A;  1WHC A;  1E94 E;  2JZ1 A;  1T43 A;  2JY6 B;  2LVA A;  2MGW A;  1WJ7 A;  5DFL A;  1OAI A;  3IHP A;  1DO0 A;  2LTU A;  1V92 A;  1G3I A;  4WP2 A;  2HAK A;  2JY5 A;  2LVN C;  4DBG B;  1NV9 A;  1WGN A;  1EFU B;  2CWB A;  3GLG E;  1G4A E;  1IXS A;  1C7Y A;  2OOB A;  3IEC A;  2DHY A;  4UN2 B;  2LVO C;  2MR9 A;  3FE3 A;  3B89 A;  1OTR A;  1DV0 A;  2DI0 A;  1T6O A;  2LVQ D;  3LCU A;  1QZE A;  1VDL A;  2JY7 A;  2R0I A;  3E21 A;  2G3Q A;  1WR1 B;  1G41 A;  2DAM A;  2LVP C;  1UFZ A;  2L2D A;  1IFY A;  4GEW A;  1XB2 B;  1VEK A;  2CP8 A;  2B3T A;  2DAE A;  2DKL A;  2JNH A;  3H4J A;  1ZV1 A;  1VEG A;  1HT1 E;  2JUJ A;  2QHO B;  1SG9 A;  2JZ0 A;  2DAK A;  3LCV B;  2DAG A;  3T6P A;  1R4G A;  1F4I A;  3BBZ A;  2MRO B;  2WZJ A;  3MMP A;  2BWB A;  2JP7 A;  2RRU A;  1OQY A;  2H5X A;  3FRH A;  2EJS A;  1HJP A;  2L4F A;  1XXH E;  2OOA A;  2O25 A;  3F92 A;  2KNZ A;  2HWJ A;  1BVS A;  3GLI E;  2DZL A;  2ZTD A;  3GLH E;  3K9P A;  2DAI A;  2KNV A;  2QNJ A;  4G3O A;  2DNA A;  1A5T A;  1VEJ A;  2K9D A;  2EKF A;  1Y8G A;  2DEN A;  1TTE A;  1KYI A;  1P3Q Q;  1DO2 A;  1TR8 A;  2K0B X;  2JY8 A;  1HT2 E;  2ZTC A;  4F2L A;  2EKK A;  1MN3 A;  3GLF E;  1WGL A;  3E46 A;  4Q7J A;  5JI2 E;  1ZMW A;  1PGY A;  2KNA A;  4R71 A;  2L4E A;  1HQY E;  4HEO A;  1VG5 A;  1ZMU A;  2MJ5 B;  1YLA A;  4F1I A;  1IM2 A;  2LBC A;  1VQ1 A;  1Q02 A;  2BWE A;  2KHH A; 
#chains in the Genus database with same CATH topology
 3GPY A;  1OKS A;  1AIP C;  1NO1 A;  1IY0 A;  2XGN A;  4LJA A;  4DR7 M;  1JR3 A;  1NV8 A;  4KHP M;  4MH0 E;  1GO5 A;  3QYB A;  2C98 A;  3GRV A;  4LRT A;  1WHC A;  4KT0 F;  3M7G A;  1G59 A;  5IRE B;  3WHK A;  4PCZ A;  4Z8X A;  4JI6 M;  1IXS B;  3B9P A;  1MX0 A;  2FH0 A;  2N35 A;  3IG5 A;  4FCW A;  2HHH M;  4W5W A;  4NRW A;  4AKI A;  4YY3 M;  4LFA M;  1IBL M;  5EXS A;  1IN7 A;  4LG2 A;  1Z6T A;  3FD9 A;  3VLF B;  1NV9 A;  4X66 M;  2Y21 A;  2HL7 A;  4M9X A;  4QHS A;  3D8B A;  1NJG A;  4JI0 M;  1OIZ A;  3U6P A;  2V1U A;  4L6V 6;  4RNA A;  4FVM A;  2FS1 A;  1G4A E;  1IXS A;  1C7Y A;  2UXD M;  3B7Q A;  4UN2 B;  3FE3 A;  1IXR C;  1FNN A;  4KO8 A;  4LJ7 A;  1GLN A;  1FJG M;  3A46 A;  3KDS E;  3U6L A;  1K3X A;  4PT5 A;  2H1R A;  5ITU A;  4KOD A;  3R8F A;  4G4N A;  3HWS A;  5ITX A;  3E21 A;  1G41 A;  4IJF A;  3J7B A;  4AW4 A;  4B3S M;  2C9C A;  3EIE A;  4QOZ C;  4D80 A;  4YHH M;  1N77 A;  4LJ4 A;  3AJI B;  3HJQ A;  3ZQJ A;  4GEW A;  4GC9 A;  4FCV A;  1VEK A;  1SXJ E;  4NXM M;  1J5E M;  1GJS A;  4JXJ A;  1ZV1 A;  2XH9 A;  3U6S A;  1SXJ D;  4DR3 M;  3KFU G;  1LTM A;  5E26 A;  4D82 A;  2QHO B;  4LF8 M;  4MGH A;  2L7I A;  4QNR A;  5FTM A;  8CAT A;  3M0E A;  2Z4R A;  3GPP A;  3LCV B;  3KS8 A;  3T6P A;  1R4G A;  4LF9 M;  3BBZ A;  2MRO B;  5FTK A;  5A2Q S;  3VK7 A;  1OQY A;  3L28 A;  4NL4 H;  1KSF X;  5IT9 S;  2LNH C;  3CGW A;  3FRH A;  4GC5 A;  2EJS A;  1N34 M;  4LFB M;  3KOZ E;  4Y28 F;  1KFV A;  3I4Y A;  2L4F A;  4IBF A;  2LWX A;  1XXH E;  2LHG A;  1HNZ M;  2O25 A;  3L2A A;  3TL4 X;  2KEB A;  2HWJ A;  4L4U A;  1N78 A;  4P17 A;  1IN4 A;  2V6Z M;  3GLI E;  5BPV A;  1GJT A;  2HKJ A;  4JI8 M;  1HNW M;  2BJV A;  3GLH E;  1PJT A;  3KSX A;  2DAI A;  2KNV A;  3CF2 A;  3UMM A;  2QP9 X;  1PJJ A;  4G3O A;  1ORY B;  1A5T A;  1VEJ A;  2J5Y A;  1NY5 A;  2DWZ B;  2QQ8 A;  3U60 A;  1EE8 A;  2WSC F;  1Y8G A;  1TTE A;  3HJS A;  2KZS A;  4NOO B;  4M0W A;  3SAV A;  2CEA A;  4MB7 A;  4B08 A;  3HU3 A;  4X65 M;  1L8Q A;  3Q8X A;  4LJ8 A;  4GHA A;  1DGH B;  2ZTC A;  3FUW A;  1TGU A;  2EKK A;  5KO3 A;  1MN3 A;  3GLF E;  1WGL A;  1GKI A;  3RFW A;  2V1C A;  5JI2 E;  1L2C A;  1PGY A;  2KNA A;  2R44 A;  3KW6 A;  1HR0 M;  2DWL A;  4HLQ A;  2KRK A;  1Q3B A;  3GQ4 A;  1ZMU A;  3DA1 A;  3GO8 A;  1DGH A;  1IM2 A;  2APL A;  2J7O A;  4QNM A;  3SBJ A;  1R2Y A;  3KOW E;  2BWE A;  4RKU F;  4IBG A;  4GRI A;  3SAT A;  2OO9 A;  2L09 A;  3HX3 A;  3AKZ A;  2L6O A;  2I7P A;  1PJQ A;  3FRI A;  4MGZ E;  1CUK A;  3AOE A;  1NNU C;  1H6U A;  1ZMV A;  2DHR A;  4DV6 M;  2Z7J A;  4LGM A;  4LF4 M;  3T1H M;  5DYI A;  3T1Y M;  1XMO M;  1IN8 A;  2LVA A;  2MGW A;  4QOS A;  1SXJ B;  1OFH A;  2YR0 A;  3CF6 E;  1V92 A;  1Z5B A;  1HNX M;  2EA0 A;  1G3I A;  1TH3 A;  4JI3 M;  1RU3 A;  4WP2 A;  2HAK A;  2CRU A;  2VF7 A;  1TDZ A;  1QAQ A;  3R9X B;  1EFU B;  2X4A A;  2XLJ A;  4GHL A;  4G4Q A;  2F4V M;  4JI1 M;  3T38 A;  3TWL A;  3GLG E;  2E5L M;  3ZCB B;  4CIZ A;  1NVM A;  4X64 M;  3IEC A;  1Q3C A;  2DHY A;  1TDH A;  4DV1 M;  2MR9 A;  3HY5 A;  3B74 A;  4AI6 A;  2WSF F;  4L16 A;  3MJ5 A;  1XXH B;  1OTR A;  1DV0 A;  1IY1 A;  5EXT A;  2CHQ A;  1PJI A;  3SAS A;  4RF1 A;  1QZM A;  4A3V B;  5EQT A;  1T6O A;  4DR2 M;  4JI4 M;  3LCU A;  4NC6 A;  1L2B A;  1VDL A;  1DGF A;  2GNO A;  1JQJ C;  3FUT A;  3FYD A;  2DWM A;  1IY2 A;  2JY7 A;  3GLI B;  3U6O A;  4JYA M;  2I7N A;  3U61 B;  4LGY A;  3GLH B;  2DZN B;  2ZAO A;  4LCB A;  2L2D A;  2F5O A;  1XXH A;  1L1Z A;  3LW5 F;  3HHZ A;  2G8L A;  3UGJ A;  2XF3 A;  4LJ9 A;  2OQ4 A;  4II7 A;  3LMM A;  4CHT B;  3L26 A;  2B3T A;  3GLI A;  2Z3X A;  2JUJ A;  3U61 A;  5C18 A;  3GLH A;  3LQR A;  1Z5A A;  1I94 M;  1W5T A;  1IN5 A;  4OVZ B;  2DAG A;  1XHB A;  3FUU A;  1F4I A;  3GLF B;  4OW0 A;  5ITT A;  2VQE M;  1QQW A;  2R4J A;  4G4R A;  4IBD A;  1C1K A;  5KPZ A;  4M9S A;  4B3M M;  3I4V A;  5ITR A;  2HCB A;  3K1J A;  2XSZ A;  2D7H A;  5H37 D;  5FLX S;  2KDL A;  3GQ5 A;  3DZD A;  3FTE A;  4DV3 M;  1I4W A;  4GMQ A;  5KPT A;  4IJE A;  5BR8 M;  1K3W A;  3HGI A;  2DZL A;  4HL4 A;  3K9P A;  3GRU A;  4FW9 A;  2LHC A;  3HHY A;  4DV4 M;  1G71 A;  5F3W A;  3QAU A;  2DNA A;  4GIT A;  2YNM D;  2RKO A;  3BXW A;  1GL7 A;  2AHM A;  2EKF A;  1R2Z A;  2DEN A;  5EXX A;  1KYI A;  3AOG A;  1P3Q Q;  5C1B A;  1DO2 A;  2X8A A;  2Y0Q A;  3PNY A;  3U6D A;  4LF5 M;  2K0B X;  1J09 A;  1HT2 E;  1NSF A;  3L29 A;  1NHW C;  1QAN A;  1QUS A;  1OIP A;  4Q7J A;  5FSW A;  4TUW A;  1ZMW A;  2QEN A;  2FFJ A;  5EP3 A;  4CJ6 A;  1HQY E;  4HEO A;  1VG5 A;  1DGG A;  4GKJ M;  2CUZ A;  4XGI A;  3NBI A;  4F1I A;  1QVR A;  5DNY A;  2VF8 A;  3SMP A;  5KQ8 A;  3GPU A;  5LMN M;  2LBC A;  2K47 A;  1Q02 A;  1MJG M;  2RGH A;  4RF0 A;  3J81 S;  3NWL A;  1XMQ M;  4NSO B;  4B7F A;  1JR3 E;  4JN6 A;  4L15 A;  1K82 A;  2ZM6 M;  3A98 B;  1JR3 D;  1WIV A;  1Z5C A;  3CTW B;  2Y0T A;  3K9O A;  5EXP A;  2CV2 A;  4X62 M;  2XFS A;  3RGS A;  3B7Z A;  3I04 M;  2JZ1 A;  4AKH A;  3VKG A;  2JY6 B;  1S3S A;  5EP2 A;  1WJ7 A;  2XEP A;  5ITQ A;  1OAI A;  2R4E A;  1DO0 A;  4QHT A;  3E4R A;  1D0K A;  4AG6 A;  3KVW A;  3VKH A;  2C99 A;  3I01 M;  4LZZ A;  1ZAE A;  1XNR M;  4IBB A;  4M0D A;  2JY5 A;  2LVN C;  1QUT A;  3TWK A;  1WGN A;  4ITQ A;  4IBE A;  1R7R A;  2CWB A;  1TH4 A;  2BJW A;  5FTL A;  2NQ8 C;  5IZ7 D;  2G5G X;  3HU2 A;  3LVW A;  2FOI C;  1OJL A;  2ERC A;  1NJF A;  3VDU A;  1GL6 A;  4I8O A;  3B89 A;  2RGO A;  5DYG A;  4LFC M;  5E6J A;  5JI3 E;  2DI0 A;  5ITX E;  4S12 A;  3RE8 A;  2CHG A;  1VDD A;  3AFH A;  3TWM A;  3U5Z B;  3AL0 C;  2EO2 A;  3FYC A;  4KLN A;  2R0I A;  3JR4 A;  1YSY A;  1N33 M;  3JR5 A;  1IBM M;  3W68 A;  3SAU A;  2DAM A;  2F5P A;  2LVP C;  5FTJ A;  1UFZ A;  3KOY E;  2KA6 B;  2ZAN A;  1XC8 A;  3I51 A;  1TF0 B;  2XZF A;  3B7N A;  4G6Z A;  3MHV C;  2O01 F;  3GQ3 A;  4FWG A;  2CP8 A;  1N75 A;  2DKL A;  2JNH A;  3C3E A;  3H4J A;  2F5N A;  3U5Z A;  1VEG A;  2QPA A;  1MU5 A;  1SXJ A;  1NHG C;  4PDG A;  2R45 A;  2CHV A;  3UZU A;  1SG9 A;  3VK8 A;  4XK8 F;  2W82 A;  1X37 A;  4FD2 A;  1NY6 A;  2WZJ A;  1XWI A;  3DFZ A;  4ZPX A;  3MMP A;  3GP1 A;  3AOE C;  2YQZ A;  3KXE C;  2CV1 A;  4L8R C;  4MGK E;  3SAW A;  1IBK M;  5KPR A;  1HJP A;  2UU9 M;  3T15 A;  4AZF A;  3TPZ A;  3PXG A;  3FUV A;  2OOA A;  3GRR A;  4WUR A;  2J7N A;  4IBJ A;  3F92 A;  1R6B X;  2UUA M;  3PFI A;  3DOA A;  3UJN A;  4OX9 M;  2OPF A;  4WW0 A;  4P16 A;  4DV5 M;  1QDR A;  2ZTD A;  2KZU A;  2QZ4 A;  1SXJ C;  3J7A S;  1J7K A;  3SHF A;  4M9Z A;  5LMU M;  2K9D A;  3VDP A;  4I81 A;  3EIH A;  2R62 A;  4DR1 M;  3FTD A;  2CFO A;  1L2D A;  2LH0 A;  4R7G A;  4I5S A;  4JI7 M;  1TR8 A;  3NBX X;  1D0L A;  5EP1 A;  3PNV A;  2R18 A;  2CE7 A;  4F2L A;  4L78 A;  2VQF M;  2P5T A;  3A45 A;  3QWL A;  4DR6 M;  3CF0 A;  1OAO C;  4PD2 A;  2K6B A;  3E46 A;  4PDI A;  2KRU A;  4FCT A;  2UUC M;  3J27 B;  3KOX E;  3ZC7 B;  4OVZ A;  4R71 A;  2C96 A;  4JI2 M;  2GQF A;  2Z4S A;  2R6F A;  3W67 A;  3GLF A;  3FKE A;  3FUX A;  2XZU A;  4IBC A;  3K2L A;  7CAT A;  3U6C A;  3HZJ A;  4DR4 M;  2MJ5 B;  4IBK A;  1E32 A;  1NNJ A;  4IIW A;  2Q2E B;  3BOS A;  4AG5 A;  3U6M A;  2F5Q A;  4BBA A;  1VQ1 A;  2M5Z A;  2JA2 A;  1N32 M;  3SYL A;  4B3T M;  2QSF X;  2KXE A;  4B7G A;  4EIW A;  3V76 A;  1D2N A;  4JV5 M;  3KS4 A;  1PRB A;  2JWS A;  4MM3 B;  3SMS A;  4Z6Y A;  1IXZ A;  3C9P A;  3ZH9 B;  2ZBK B;  1E94 E;  1T43 A;  4DUZ M;  4GKK M;  5DFL A;  5GKN A;  1OFI A;  2D7E A;  3IHP A;  2LTU A;  4FWD A;  3RGP A;  3C58 A;  1G8P A;  1JB0 F;  2Y20 A;  3SFZ A;  4D81 A;  3HJ8 A;  3GLG B;  4DBG B;  1QAM A;  1AUA A;  1W5S A;  4NXN M;  2L7H A;  4DV7 M;  2DVW B;  3KP0 E;  2CV0 A;  2VDB B;  4LRS A;  2OOB A;  1XNQ M;  2LVO C;  3GLG A;  4GH9 A;  4MGI E;  2QCU A;  3MK6 A;  2JXN A;  2UXB M;  1YE9 A;  5ITY A;  5KQD A;  1ZQ9 A;  3C3D A;  2LVQ D;  2QBY B;  3E9S A;  3HKP A;  1QZE A;  1L1T A;  4BB9 A;  2UXC M;  1QDT A;  5EJC A;  5L8R F;  2G3Q A;  1WR1 B;  2UUB M;  2DXI A;  3SYK A;  4LF7 M;  3U60 B;  3GRY A;  1LV7 A;  1IFY A;  4DR5 M;  1DGB A;  1XB2 B;  4NRV A;  2EUC A;  4REZ A;  4DV2 M;  4B3R M;  2QBY A;  4ANR A;  2DAE A;  3LVV A;  1UM8 A;  3J2P B;  1T3T A;  4LZJ A;  1HT1 E;  2XFT A;  2VII A;  3J80 S;  3SC3 A;  3FTF A;  2JZ0 A;  4GIP A;  3Q8G A;  2DAK A;  4I4L A;  4XBO A;  3HHW A;  4LY6 A;  3QYE A;  3K8Z A;  3A42 A;  3LQQ A;  2BWB A;  2JP7 A;  2RRU A;  1PM5 A;  2H5X A;  4R3D A;  3M6A A;  5IWA M;  3OTO M;  4K0K M;  1WXQ A;  5EP4 A;  4B7H A;  3K92 A;  3IG8 A;  1R5L A;  2XSZ D;  1EIJ A;  1D0M A;  4CGY B;  4AQY M;  2KW0 A;  2ZAM A;  3U6E A;  3JAM S;  4JI5 M;  2KNZ A;  2C5R A;  3SHG B;  2MH8 A;  3KSJ A;  2DZO B;  1PJS A;  4NSR A;  1BVS A;  2FE8 A;  1QAO A;  2M60 A;  4DV0 M;  4DUY M;  1E9S A;  3VFD A;  2BNK A;  2LXE A;  4BLC A;  4G4O A;  2QNJ A;  3TQS A;  5FTN A;  2R65 A;  2WSE F;  4IBI A;  2YFQ A;  3AV0 A;  1YUB A;  2R46 A;  1HQC A;  1Q39 A;  2FNA A;  1IQP A;  3H4M A;  2A5Y B;  3U6Q A;  2JY8 A;  2Z8Y M;  3L27 A;  2C9O A;  3HHX A;  1V34 A;  3W0L B;  3FTC A;  3L25 A;  4LF6 M;  1E9R A;  2DWN A;  1V33 A;  4CIS A;  3TE6 A;  3THG A;  3GPX A;  1GAB A;  2F5S A;  1QYR A;  3D8L A;  2L4E A;  3HU1 A;  4FWH A;  3KP1 E;  4AKG A;  4LJ6 A;  1Z59 A;  3ILK A;  1IN6 A;  3W0F A;  3UK6 A;  4MGY E;  2X49 A;  1GVN A;  3WHL A;  1YLA A;  2D7G A;  1N36 M;  3PVS A;  4OU7 A;  3SAR A;  2O5R A;  4LJ5 A;  1TH2 A;  2KHH A; 
#chains in the Genus database with same CATH homology
 1OKS A;  1AIP C;  1JR3 E;  2OO9 A;  2QSF X;  3FRI A;  1CUK A;  1WIV A;  1NV8 A;  1ZMV A;  3K9O A;  1GO5 A;  1WHC A;  1E94 E;  2JZ1 A;  1T43 A;  2JY6 B;  2LVA A;  2MGW A;  1WJ7 A;  5DFL A;  1OAI A;  3IHP A;  1DO0 A;  2LTU A;  1V92 A;  1G3I A;  4WP2 A;  2HAK A;  2JY5 A;  2LVN C;  4DBG B;  1NV9 A;  1WGN A;  1EFU B;  2CWB A;  3GLG E;  1G4A E;  1IXS A;  1C7Y A;  2OOB A;  3IEC A;  2DHY A;  4UN2 B;  2LVO C;  2MR9 A;  3FE3 A;  3B89 A;  1OTR A;  1DV0 A;  2DI0 A;  1T6O A;  2LVQ D;  3LCU A;  1QZE A;  1VDL A;  2JY7 A;  2R0I A;  3E21 A;  2G3Q A;  1WR1 B;  1G41 A;  2DAM A;  2LVP C;  1UFZ A;  2L2D A;  1IFY A;  4GEW A;  1XB2 B;  1VEK A;  2CP8 A;  2B3T A;  2DAE A;  2DKL A;  2JNH A;  3H4J A;  1ZV1 A;  1VEG A;  1HT1 E;  2JUJ A;  2QHO B;  1SG9 A;  2JZ0 A;  2DAK A;  3LCV B;  2DAG A;  3T6P A;  1R4G A;  1F4I A;  3BBZ A;  2MRO B;  2WZJ A;  3MMP A;  2BWB A;  2JP7 A;  2RRU A;  1OQY A;  2H5X A;  3FRH A;  2EJS A;  1HJP A;  2L4F A;  1XXH E;  2OOA A;  2O25 A;  3F92 A;  2KNZ A;  2HWJ A;  1BVS A;  3GLI E;  2DZL A;  2ZTD A;  3GLH E;  3K9P A;  2DAI A;  2KNV A;  2QNJ A;  4G3O A;  2DNA A;  1A5T A;  1VEJ A;  2K9D A;  2EKF A;  1Y8G A;  2DEN A;  1TTE A;  1KYI A;  1P3Q Q;  1DO2 A;  1TR8 A;  2K0B X;  2JY8 A;  1HT2 E;  2ZTC A;  4F2L A;  2EKK A;  1MN3 A;  3GLF E;  1WGL A;  3E46 A;  4Q7J A;  5JI2 E;  1ZMW A;  1PGY A;  2KNA A;  4R71 A;  2L4E A;  1HQY E;  4HEO A;  1VG5 A;  1ZMU A;  2MJ5 B;  1YLA A;  4F1I A;  1IM2 A;  2LBC A;  1VQ1 A;  1Q02 A;  2BWE A;  2KHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...