2MGWA

Solution structure of the uba domain of human nbr1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Next to BRCA1 gene 1 protein
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mgwA00
2JY8A 1F4IA 5JI2E 3H4JA 1TR8A 2L4EA 2KNZA 1IM2A 2OOBA 3K9OA 1A5TA 1OAIA 1WJ7A 3GLGE 1OKSA 1R4GA 1G41A 1T43A 1ZMUA 1IXSA 2KNAA 2MGWA 2JZ1A 3GLHE 2MROB 1G3IA 1ZMWA 1C7YA 1CUKA 3E21A 1TTEA 2LVQD 2JY6B 2LBCA 2EKKA 1E94E 1GO5A 1WIVA 1DO0A 1Q02A 4GEWA 1HT1E 3FRIA 1ZMVA 1SG9A 2DNAA 2OOAA 4Q7JA 1XB2B 2DKLA 2JUJA 3FE3A 2JNHA 2L4FA 1HT2E 2LVNC 3BBZA 1T6OA 2BWEA 3B89A 4HEOA 2JZ0A 2QNJA 1WGNA 3T6PA 2DENA 4DBGB 3IECA 2ZTCA 1VEKA 4R71A 1ZV1A 2DHYA 3F92A 4UN2B 5DFLA 2MJ5B 1KYIA 2WZJA 2QSFX 2ZTDA 2LTUA 2DAEA 2DI0A 2CP8A 1DO2A 1P3QQ 2KNVA 2B3TA 2K0BX 2KHHA 2R0IA 1HQYE 1G4AE 2EKFA 2CWBA 2OO9A 1V92A 1VEGA 3K9PA 1YLAA 1UFZA 2L2DA 3E46A 1MN3A 1Y8GA 2LVAA 2JP7A 1DV0A 1AIPC 1IFYA 1WGLA 2DAIA 4F2LA 3LCUA 1BVSA 2JY5A 2JY7A 2LVPC 1VQ1A 1WHCA 3FRHA 2BWBA 3GLIE 2HAKA 1OQYA 1VG5A 1VEJA 2EJSA 2H5XA 1QZEA 3LCVB 3MMPA 1NV9A 1OTRA 2O25A 1NV8A 3GLFE 1EFUB 1PGYA 2K9DA 4F1IA 2DZLA 2DAKA 1JR3E 1HJPA 2HWJA 4WP2A 2DAMA 3IHPA 2G3QA 2DAGA 2LVOC 2QHOB 1WR1B 1XXHE 1VDLA 2RRUA 4G3OA 2MR9A
chains in the Genus database with same CATH superfamily
3QYBA 5KQDA 3M0EA 1XWIA 3H4JA 1TR8A 2L4EA 2KNZA 2DXIA 1IM2A 1TH2A 4LZZA 4LGMA 4B7FA 4LFAM 4YY3M 3KW6A 1WJ7A 1R4GA 1IY0A 1G41A 2R4JA 3VFDA 3DZDA 3FTEA 1IXSA 1TH3A 3FUTA 3ZQJA 3OTOM 4G4OA 2MGWA 2JZ1A 1SXJE 2CHVA 3HZJA 3J81S 3SBJA 3AL0C 1ZMWA 4IBGA 2C98A 3I4YA 1N77A 1LV7A 4ITQA 1D2NA 4KODA 3E21A 1X37A 4PDIA 4R3DA 2LVQD 5IT9S 4IJEA 1Q3CA 1Q02A 4LZJA 2KRKA 1XNRM 1HT1E 4AW4A 1ZMVA 2QPAA 3PNVA 4JI0M 5KO3A 4I8OA 4R7GA 2CUZA 1HNZM 3GRRA 3T15A 4CJ6A 4Q7JA 2OOAA 2O5RA 3SARA 2CHGA 3AV0A 3QWLA 2F5NA 3J7BA 4LF8M 2KEBA 2LWXA 1T6OA 4TUWA 2BWEA 3A45A 2ZM6M 2JZ0A 4GKKM 1LTMA 2J5YA 3HKPA 3T6PA 1IN6A 4AI6A 3U6MA 1Q3BA 4AG5A 4D82A 4LJ7A 4FWHA 4IJFA 1HR0M 2ZTCA 3CF6E 3ILKA 4DR3M 3HU2A 4W5WA 2ZBKB 4UN2B 4X66M 4FCVA 4IBDA 1KYIA 1QVRA 2ZTDA 2LTUA 2XEPA 1YE9A 2Y0TA 4M0DA 4IBKA 4MB7A 5EXXA 4JV5M 1IQPA 4QHTA 4DV7M 2KNVA 1Z5BA 3B74A 3C9PA 3UZUA 4NXMM 2ZAOA 4M9XA 1HQYE 3A98B 4LJ4A 4CHTB 3HGIA 3KOWE 1QZMA 2C9CA 1R2YA 1UFZA 3B9PA 2JXNA 3Q8GA 2LVAA 5EQTA 5EXSA 3GLIB 2JP7A 5IREB 3TQSA 3C3DA 3SHGB 1AIPC 1IFYA 2UUCM 2KDLA 3J7AS 1GL6A 1NSFA 3GQ5A 4NSRA 3VKGA 1SXJD 3KDSE 4QNRA 4NSOB 4FCWA 3GRUA 1GLNA 3L25A 2EA0A 4L4UA 4DR1M 3GLFA 2LHCA 1VG5A 2C9OA 5GKNA 1KSFX 3FTDA 5JI3E 2BJWA 2H5XA 3KOYE 1G8PA 3MMPA 1OFIA 3GPUA 3A46A 4GH9A 1QUTA 1MX0A 3U6CA 2K9DA 2JA2A 2WSFF 3J80S 2CFOA 3LVWA 2V1UA 4IBBA 1JQJC 3VK8A 1FJGM 3U5ZB 1Z59A 1OIZA 2V6ZM 3AOGA 2E5LM 4DV5M 3SYKA 3U6PA 4LF4M 2HCBA 2G3QA 1NVMA 2N35A 2DAGA 2RKOA 2VF7A 3K9PA 4NC6A 4AZFA 4PDGA 4DR2M 2BNKA 1F4IA 3KOXE 1L2CA 1TDHA 2OOBA 4AQYM 1A5TA 2XSZD 3SFZA 2XZUA 1OAIA 2R18A 1HNXM 4LF9M 3GLGE 3SHFA 1OKSA 1GJTA 2CEAA 1T43A 2XF3A 2QP9X 3GLIA 4RKUF 2KNAA 5EP3A 4LCBA 5F3WA 4IIWA 3KVWA 4G6ZA 1R7RA 3GPYA 1IXSB 4DV6M 1CUKA 3SATA 1IN4A 4G4NA 1TTEA 1PJQA 2RGHA 2JY6B 3LMMA 4NRVA 2XLJA 1GO5A 3GRYA 1V34A 2G5GX 2MH8A 2DZNB 3B7NA 4OW0A 1WIVA 1ORYB 1DO0A 4FW9A 3GLHA 5ITQA 1NJGA 3IG5A 5KPZA 2KXEA 3FRIA 3GQ4A 1NY6A 4NOOB 1QAMA 2I7NA 5EP1A 3J2PB 2FNAA 1Z6TA 1XB2B 4P16A 2OPFA 3L27A 2KZUA 1HNWM 2VQFM 4DR7M 2JNHA 2L4FA 5FTNA 3AJIB 5EXPA 3GPXA 1K82A 2QNJA 4MGZE 4S12A 1WGNA 2O01F 4CISA 2DENA 3BXWA 1N34M 2VIIA 3TWKA 2X8AA 2V1CA 4GC9A 1EIJA 1ZV1A 1TH4A 3U60B 2DWMA 5DFLA 5FTKA 2WZJA 3W0FA 1N36M 2GNOA 4QNMA 2DAEA 4GMQA 3JAMS 3U61A 3FUVA 2VF8A 1DO2A 3FD9A 4L78A 2R0IA 1XHBA 1S3SA 2QZ4A 1G4AE 3KS4A 4GITA 3T38A 2EKFA 4ZPXA 4LRSA 2HKJA 1PJTA 3TL4X 2CWBA 3GPPA 1XMQM 1VEGA 1C1KA 1YLAA 1E9RA 3I51A 1MN3A 1D0KA 4XK8F 1XMOM 2F5OA 2CE7A 2J7OA 2Z7JA 1J7KA 2D7EA 2Y20A 1GVNA 1NY5A 3PFIA 4MGYE 2Y21A 4X62M 3AKZA 3GLGA 4AKGA 1VQ1A 1I94M 4LFBM 3HY5A 3HHYA 5LMUM 4L8RC 2Z4RA 3LQRA 3GLIE 2BWBA 4FWDA 3HU3A 4FVMA 3C58A 4QHSA 4LF6M 1SXJA 1J09A 1OQYA 4EIWA 4JXJA 3IG8A 3FYCA 3K1JA 2WSEF 2EJSA 3PVSA 7CATA 3VK7A 2UUBM 3KFUG 3V76A 3B7ZA 1QZEA 4HL4A 4NL4H 1N32M 4LJ9A 4DV1M 4BB9A 2YFQA 1OTRA 2ZAMA 1NV8A 4REZA 4L6V6 1JB0F 2DHRA 3GLFB 1QANA 1R6BX 2H1RA 2W82A 3E9SA 1IBLM 1XXHA 5ITRA 2DZLA 2DAKA 4FD2A 3FYDA 1R2ZA 3R9XB 1HJPA 2XSZA 2CV2A 4WP2A 1W5TA 3T1HM 2J7NA 1OJLA 2LVOC 1IXRC 1WR1B 3HHXA 4BLCA 4OX9M 1QQWA 1NHGC 2JY8A 3DA1A 3EIHA 4DV4M 4MGKE 3D8BA 3HU1A 1OIPA 1IN5A 3QAUA 3UMMA 3U5ZA 4B3TM 3FUUA 3K9OA 3RGPA 4CGYB 3KP0E 2DWLA 4QOZC 4Z6YA 3B7QA 3RFWA 2XGNA 5IZ7D 4PD2A 3AFHA 4B3MM 4ANRA 5H37D 3MK6A 2KA6B 3Q8XA 3FUWA 1G3IA 3FKEA 2M5ZA 4KLNA 4Y28F 5DNYA 2WSCF 5IWAM 1C7YA 3SASA 4LJ8A 4X64M 2XZFA 5C18A 2L6OA 2R45A 2VQEM 4LFCM 2EKKA 1E94E 4I4LA 3J27B 4K0KM 2R62A 2P5TA 3KS8A 3NBXX 4JI7M 2C5RA 2K47A 4XGIA 3TWLA 1IY1A 2A5YB 5ITTA 8CATA 5ITYA 1SG9A 1JR3A 3L2AA 2DKLA 4JYAM 3K2LA 3HJSA 3L29A 3CTWB 1HT2E 3BBZA 3GP1A 5DYGA 5KQ8A 4HEOA 4DR5M 1NHWC 4MGIE 1IY2A 1E32A 3MJ5A 1DGHA 3VDUA 2UXDM 4A3VB 4B08A 4IBCA 3WHLA 4DBGB 1D0MA 3IECA 2F4VM 1VEKA 4R71A 5EXTA 2YQZA 4MGHA 1IN7A 4DR6M 3SMPA 2Y0QA 1IN8A 4RNAA 4JI5M 3U6SA 2QSFX 3SAVA 1AUAA 2DI0A 1YUBA 3GO8A 3W68A 2CRUA 3HHWA 3SMSA 2Q2EB 1L2DA 1Z5AA 1P3QQ 5E26A 1NJFA 4M0WA 2KHHA 2XH9A 1RU3A 3PXGA 3WHKA 3SAWA 4DR4M 4L16A 1L1ZA 4AKIA 4B7GA 3TWMA 2X4AA 3M7GA 3DFZA 4BBAA 4B3SM 1V92A 3TPZA 1Y8GA 4CIZA 2JWSA 3U61B 1D0LA 2CV0A 3MHVC 3U6EA 3SAUA 4GKJM 3A42A 3DOAA 2FH0A 3U6OA 1OAOC 2DAIA 2C99A 4JI6M 4F2LA 3LCUA 2F5PA 2I7PA 4OVZB 2JY5A 2DWNA 1G59A 2JY7A 2HHHM 2LVPC 2Z4SA 3KSJA 1KFVA 4B3RM 1EE8A 3D8LA 3R8FA 4LF5M 2L09A 1WHCA 4DUZM 2LNHC 1QYRA 2R6FA 3HJ8A 4MH0E 2DZOB 1VEJA 1I4WA 2QENA 3I4VA 2QBYA 4KHPM 2R46A 1L1TA 4OVZA 2D7HA 5LMNM 1SXJB 4LY6A 3U6DA 1PJIA 5ITUA 3W0LB 3FTCA 1QAOA 1XC8A 4JI8M 4GHAA 4IBIA 3K92A 4Z8XA 3U6LA 2Z3XA 3UK6A 3FTFA 5FSWA 1K3WA 1JR3E 2R65A 2YNMD 3TE6A 3LVVA 2CV1A 1QUSA 2APLA 5ITXA 4X65M 4GHLA 5EP2A 4GRIA 5EP4A 2DAMA 2UXCM 2LHGA 4I81A 1Q39A 5KPTA 1TF0B 1K3XA 2L7IA 1PRBA 2FOIC 2QHOB 1Z5CA 4AG6A 2RRUA 2R4EA 3C3EA 4G3OA 3UJNA 3KOZE 4G4QA 3QYEA 3ZCBB 4NXNM 5JI2E 1T3TA 1L2BA 2AHMA 4LJAA 2UUAM 4JI3M 1IBMM 4GC5A 4I5SA 1ZMUA 1GKIA 1GJSA 3AOEC 4OU7A 3GLGB 1OFHA 4JN6A 1H6UA 2KZSA 3GLHE 2MROB 3CF2A 4DUYM 3UGJA 1ZAEA 1E9SA 1TGUA 1TDZA 4GIPA 4RF1A 1DGBA 2RGOA 2LBCA 3SYLA 3HWSA 4WURA 3CGWA 1QDTA 1UM8A 2G8LA 3JR5A 1NNUC 2ZANA 3H4MA 1DGFA 4GEWA 4RF0A 3E4RA 4LJ6A 2QBYB 1PJSA 4AKHA 1SXJC 2DVWB 2DNAA 2F5SA 2F5QA 2JUJA 2VDBB 3ZC7B 4D80A 2M60A 3FE3A 1WXQA 3I04M 4IBFA 2ERCA 4LG2A 3PNYA 3LQQA 2LVNC 3HJQA 3B89A 3NWLA 2C96A 3U60A 5C1BA 2QQ8A 1R5LA 3GRVA 4FCTA 4PT5A 5EJCA 2K6BA 4QOSA 2UU9M 1PJJA 1V33A 2UXBM 1ZQ9A 2DHYA 2HL7A 2YR0A 3F92A 1DGHB 1FNNA 3FUXA 5BPVA 2MJ5B 4P17A 2OQ4A 1NNJA 3RE8A 2BJVA 4II7A 3ZH9B 2FS1A 2R44A 2XFTA 3JR4A 2CP8A 1G71A 1HQCA 3K8ZA 3LW5F 1DGGA 2B3TA 2K0BX 2KW0A 5ITXE 4NRWA 3W67A 1XXHB 1YSYA 2OO9A 4PCZA 2L7HA 3GLHB 4D81A 1PM5A 3VDPA 3HHZA 4JI4M 1XNQM 3E46A 2L2DA 4B7HA 4LJ5A 2EUCA 5KPRA 2DWZB 1GABA 3L26A 1NO1A 2FE8A 1DV0A 1WGLA 3U6QA 4G4RA 3EIEA 1BVSA 4IBJA 1L8QA 4DV2M 3THGA 4YHHM 2KRUA 5E6JA 2Z8YM 5FTMA 5FLXS 2FFJA 3VLFB 5A2QS 3KSXA 1QDRA 4WW0A 1IXZA 3BOSA 3FRHA 3HX3A 4M9SA 1GL7A 4FWGA 3SC3A 3CF0A 1MJGM 2HAKA 3M6AA 2XFSA 3T1YM 5DYIA 1W5SA 4JI1M 1MU5A 2X49A 3KXEC 3NBIA 3L28A 3GQ3A 2LXEA 2LH0A 3I01M 3LCVB 2QCUA 1IBKM 1NV9A 2O25A 2GQFA 5FTJA 3GLFE 1EFUB 4HLQA 4LGYA 1PGYA 1N75A 5L8RF 4KT0F 4KO8A 4XBOA 4F1IA 4DV0M 1J5EM 1JR3D 1N78A 4IBEA 1VDDA 4JI2M 3AOEA 4M9ZA 5BR8M 4LF7M 3RGSA 2HWJA 4MM3B 3VKHA 3KP1E 2NQ8C 1QAQA 4LRTA 5FTLA 4L15A 3IHPA 4DV3M 2EO2A 1N33M 2D7GA 2CHQA 1XXHE 1VDLA 2MR9A
chains in the Genus database with same CATH topology
2JY8A 1F4IA 5JI2E 3H4JA 1TR8A 2L4EA 2KNZA 1IM2A 2OOBA 3K9OA 1A5TA 1OAIA 1WJ7A 3GLGE 1OKSA 1R4GA 1G41A 1T43A 1ZMUA 1IXSA 2KNAA 2MGWA 2JZ1A 3GLHE 2MROB 1G3IA 1ZMWA 1C7YA 1CUKA 3E21A 1TTEA 2LVQD 2JY6B 2LBCA 2EKKA 1E94E 1GO5A 1WIVA 1DO0A 1Q02A 4GEWA 1HT1E 3FRIA 1ZMVA 1SG9A 2DNAA 2OOAA 4Q7JA 1XB2B 2DKLA 2JUJA 3FE3A 2JNHA 2L4FA 1HT2E 2LVNC 3BBZA 1T6OA 2BWEA 3B89A 4HEOA 2JZ0A 2QNJA 1WGNA 3T6PA 2DENA 4DBGB 3IECA 2ZTCA 1VEKA 4R71A 1ZV1A 2DHYA 3F92A 4UN2B 5DFLA 2MJ5B 1KYIA 2WZJA 2QSFX 2ZTDA 2LTUA 2DAEA 2DI0A 2CP8A 1DO2A 1P3QQ 2KNVA 2B3TA 2K0BX 2KHHA 2R0IA 1HQYE 1G4AE 2EKFA 2CWBA 2OO9A 1V92A 1VEGA 3K9PA 1YLAA 1UFZA 2L2DA 3E46A 1MN3A 1Y8GA 2LVAA 2JP7A 1DV0A 1AIPC 1IFYA 1WGLA 2DAIA 4F2LA 3LCUA 1BVSA 2JY5A 2JY7A 2LVPC 1VQ1A 1WHCA 3FRHA 2BWBA 3GLIE 2HAKA 1OQYA 1VG5A 1VEJA 2EJSA 2H5XA 1QZEA 3LCVB 3MMPA 1NV9A 1OTRA 2O25A 1NV8A 3GLFE 1EFUB 1PGYA 2K9DA 4F1IA 2DZLA 2DAKA 1JR3E 1HJPA 2HWJA 4WP2A 2DAMA 3IHPA 2G3QA 2DAGA 2LVOC 2QHOB 1WR1B 1XXHE 1VDLA 2RRUA 4G3OA 2MR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY8 A;  1F4I A;  5JI2 E;  3H4J A;  1TR8 A;  2L4E A;  2KNZ A;  1IM2 A;  2OOB A;  3K9O A;  1A5T A;  1OAI A;  1WJ7 A;  3GLG E;  1OKS A;  1R4G A;  1G41 A;  1T43 A;  1ZMU A;  1IXS A;  2KNA A;  2MGW A;  2JZ1 A;  3GLH E;  2MRO B;  1G3I A;  1ZMW A;  1C7Y A;  1CUK A;  3E21 A;  1TTE A;  2LVQ D;  2JY6 B;  2LBC A;  2EKK A;  1E94 E;  1GO5 A;  1WIV A;  1DO0 A;  1Q02 A;  4GEW A;  1HT1 E;  3FRI A;  1ZMV A;  1SG9 A;  2DNA A;  2OOA A;  4Q7J A;  1XB2 B;  2DKL A;  2JUJ A;  3FE3 A;  2JNH A;  2L4F A;  1HT2 E;  2LVN C;  3BBZ A;  1T6O A;  2BWE A;  3B89 A;  4HEO A;  2JZ0 A;  2QNJ A;  1WGN A;  3T6P A;  2DEN A;  4DBG B;  3IEC A;  2ZTC A;  1VEK A;  4R71 A;  1ZV1 A;  2DHY A;  3F92 A;  4UN2 B;  5DFL A;  2MJ5 B;  1KYI A;  2WZJ A;  2QSF X;  2ZTD A;  2LTU A;  2DAE A;  2DI0 A;  2CP8 A;  1DO2 A;  1P3Q Q;  2KNV A;  2B3T A;  2K0B X;  2KHH A;  2R0I A;  1HQY E;  1G4A E;  2EKF A;  2CWB A;  2OO9 A;  1V92 A;  1VEG A;  3K9P A;  1YLA A;  1UFZ A;  2L2D A;  3E46 A;  1MN3 A;  1Y8G A;  2LVA A;  2JP7 A;  1DV0 A;  1AIP C;  1IFY A;  1WGL A;  2DAI A;  4F2L A;  3LCU A;  1BVS A;  2JY5 A;  2JY7 A;  2LVP C;  1VQ1 A;  1WHC A;  3FRH A;  2BWB A;  3GLI E;  2HAK A;  1OQY A;  1VG5 A;  1VEJ A;  2EJS A;  2H5X A;  1QZE A;  3LCV B;  3MMP A;  1NV9 A;  1OTR A;  2O25 A;  1NV8 A;  3GLF E;  1EFU B;  1PGY A;  2K9D A;  4F1I A;  2DZL A;  2DAK A;  1JR3 E;  1HJP A;  2HWJ A;  4WP2 A;  2DAM A;  3IHP A;  2G3Q A;  2DAG A;  2LVO C;  2QHO B;  1WR1 B;  1XXH E;  1VDL A;  2RRU A;  4G3O A;  2MR9 A; 
#chains in the Genus database with same CATH topology
 3QYB A;  5KQD A;  3M0E A;  1XWI A;  3H4J A;  1TR8 A;  2L4E A;  2KNZ A;  2DXI A;  1IM2 A;  1TH2 A;  4LZZ A;  4LGM A;  4B7F A;  4LFA M;  4YY3 M;  3KW6 A;  1WJ7 A;  1R4G A;  1IY0 A;  1G41 A;  2R4J A;  3VFD A;  3DZD A;  3FTE A;  1IXS A;  1TH3 A;  3FUT A;  3ZQJ A;  3OTO M;  4G4O A;  2MGW A;  2JZ1 A;  1SXJ E;  2CHV A;  3HZJ A;  3J81 S;  3SBJ A;  3AL0 C;  1ZMW A;  4IBG A;  2C98 A;  3I4Y A;  1N77 A;  1LV7 A;  4ITQ A;  1D2N A;  4KOD A;  3E21 A;  1X37 A;  4PDI A;  4R3D A;  2LVQ D;  5IT9 S;  4IJE A;  1Q3C A;  1Q02 A;  4LZJ A;  2KRK A;  1XNR M;  1HT1 E;  4AW4 A;  1ZMV A;  2QPA A;  3PNV A;  4JI0 M;  5KO3 A;  4I8O A;  4R7G A;  2CUZ A;  1HNZ M;  3GRR A;  3T15 A;  4CJ6 A;  4Q7J A;  2OOA A;  2O5R A;  3SAR A;  2CHG A;  3AV0 A;  3QWL A;  2F5N A;  3J7B A;  4LF8 M;  2KEB A;  2LWX A;  1T6O A;  4TUW A;  2BWE A;  3A45 A;  2ZM6 M;  2JZ0 A;  4GKK M;  1LTM A;  2J5Y A;  3HKP A;  3T6P A;  1IN6 A;  4AI6 A;  3U6M A;  1Q3B A;  4AG5 A;  4D82 A;  4LJ7 A;  4FWH A;  4IJF A;  1HR0 M;  2ZTC A;  3CF6 E;  3ILK A;  4DR3 M;  3HU2 A;  4W5W A;  2ZBK B;  4UN2 B;  4X66 M;  4FCV A;  4IBD A;  1KYI A;  1QVR A;  2ZTD A;  2LTU A;  2XEP A;  1YE9 A;  2Y0T A;  4M0D A;  4IBK A;  4MB7 A;  5EXX A;  4JV5 M;  1IQP A;  4QHT A;  4DV7 M;  2KNV A;  1Z5B A;  3B74 A;  3C9P A;  3UZU A;  4NXM M;  2ZAO A;  4M9X A;  1HQY E;  3A98 B;  4LJ4 A;  4CHT B;  3HGI A;  3KOW E;  1QZM A;  2C9C A;  1R2Y A;  1UFZ A;  3B9P A;  2JXN A;  3Q8G A;  2LVA A;  5EQT A;  5EXS A;  3GLI B;  2JP7 A;  5IRE B;  3TQS A;  3C3D A;  3SHG B;  1AIP C;  1IFY A;  2UUC M;  2KDL A;  3J7A S;  1GL6 A;  1NSF A;  3GQ5 A;  4NSR A;  3VKG A;  1SXJ D;  3KDS E;  4QNR A;  4NSO B;  4FCW A;  3GRU A;  1GLN A;  3L25 A;  2EA0 A;  4L4U A;  4DR1 M;  3GLF A;  2LHC A;  1VG5 A;  2C9O A;  5GKN A;  1KSF X;  3FTD A;  5JI3 E;  2BJW A;  2H5X A;  3KOY E;  1G8P A;  3MMP A;  1OFI A;  3GPU A;  3A46 A;  4GH9 A;  1QUT A;  1MX0 A;  3U6C A;  2K9D A;  2JA2 A;  2WSF F;  3J80 S;  2CFO A;  3LVW A;  2V1U A;  4IBB A;  1JQJ C;  3VK8 A;  1FJG M;  3U5Z B;  1Z59 A;  1OIZ A;  2V6Z M;  3AOG A;  2E5L M;  4DV5 M;  3SYK A;  3U6P A;  4LF4 M;  2HCB A;  2G3Q A;  1NVM A;  2N35 A;  2DAG A;  2RKO A;  2VF7 A;  3K9P A;  4NC6 A;  4AZF A;  4PDG A;  4DR2 M;  2BNK A;  1F4I A;  3KOX E;  1L2C A;  1TDH A;  2OOB A;  4AQY M;  1A5T A;  2XSZ D;  3SFZ A;  2XZU A;  1OAI A;  2R18 A;  1HNX M;  4LF9 M;  3GLG E;  3SHF A;  1OKS A;  1GJT A;  2CEA A;  1T43 A;  2XF3 A;  2QP9 X;  3GLI A;  4RKU F;  2KNA A;  5EP3 A;  4LCB A;  5F3W A;  4IIW A;  3KVW A;  4G6Z A;  1R7R A;  3GPY A;  1IXS B;  4DV6 M;  1CUK A;  3SAT A;  1IN4 A;  4G4N A;  1TTE A;  1PJQ A;  2RGH A;  2JY6 B;  3LMM A;  4NRV A;  2XLJ A;  1GO5 A;  3GRY A;  1V34 A;  2G5G X;  2MH8 A;  2DZN B;  3B7N A;  4OW0 A;  1WIV A;  1ORY B;  1DO0 A;  4FW9 A;  3GLH A;  5ITQ A;  1NJG A;  3IG5 A;  5KPZ A;  2KXE A;  3FRI A;  3GQ4 A;  1NY6 A;  4NOO B;  1QAM A;  2I7N A;  5EP1 A;  3J2P B;  2FNA A;  1Z6T A;  1XB2 B;  4P16 A;  2OPF A;  3L27 A;  2KZU A;  1HNW M;  2VQF M;  4DR7 M;  2JNH A;  2L4F A;  5FTN A;  3AJI B;  5EXP A;  3GPX A;  1K82 A;  2QNJ A;  4MGZ E;  4S12 A;  1WGN A;  2O01 F;  4CIS A;  2DEN A;  3BXW A;  1N34 M;  2VII A;  3TWK A;  2X8A A;  2V1C A;  4GC9 A;  1EIJ A;  1ZV1 A;  1TH4 A;  3U60 B;  2DWM A;  5DFL A;  5FTK A;  2WZJ A;  3W0F A;  1N36 M;  2GNO A;  4QNM A;  2DAE A;  4GMQ A;  3JAM S;  3U61 A;  3FUV A;  2VF8 A;  1DO2 A;  3FD9 A;  4L78 A;  2R0I A;  1XHB A;  1S3S A;  2QZ4 A;  1G4A E;  3KS4 A;  4GIT A;  3T38 A;  2EKF A;  4ZPX A;  4LRS A;  2HKJ A;  1PJT A;  3TL4 X;  2CWB A;  3GPP A;  1XMQ M;  1VEG A;  1C1K A;  1YLA A;  1E9R A;  3I51 A;  1MN3 A;  1D0K A;  4XK8 F;  1XMO M;  2F5O A;  2CE7 A;  2J7O A;  2Z7J A;  1J7K A;  2D7E A;  2Y20 A;  1GVN A;  1NY5 A;  3PFI A;  4MGY E;  2Y21 A;  4X62 M;  3AKZ A;  3GLG A;  4AKG A;  1VQ1 A;  1I94 M;  4LFB M;  3HY5 A;  3HHY A;  5LMU M;  4L8R C;  2Z4R A;  3LQR A;  3GLI E;  2BWB A;  4FWD A;  3HU3 A;  4FVM A;  3C58 A;  4QHS A;  4LF6 M;  1SXJ A;  1J09 A;  1OQY A;  4EIW A;  4JXJ A;  3IG8 A;  3FYC A;  3K1J A;  2WSE F;  2EJS A;  3PVS A;  7CAT A;  3VK7 A;  2UUB M;  3KFU G;  3V76 A;  3B7Z A;  1QZE A;  4HL4 A;  4NL4 H;  1N32 M;  4LJ9 A;  4DV1 M;  4BB9 A;  2YFQ A;  1OTR A;  2ZAM A;  1NV8 A;  4REZ A;  4L6V 6;  1JB0 F;  2DHR A;  3GLF B;  1QAN A;  1R6B X;  2H1R A;  2W82 A;  3E9S A;  1IBL M;  1XXH A;  5ITR A;  2DZL A;  2DAK A;  4FD2 A;  3FYD A;  1R2Z A;  3R9X B;  1HJP A;  2XSZ A;  2CV2 A;  4WP2 A;  1W5T A;  3T1H M;  2J7N A;  1OJL A;  2LVO C;  1IXR C;  1WR1 B;  3HHX A;  4BLC A;  4OX9 M;  1QQW A;  1NHG C;  2JY8 A;  3DA1 A;  3EIH A;  4DV4 M;  4MGK E;  3D8B A;  3HU1 A;  1OIP A;  1IN5 A;  3QAU A;  3UMM A;  3U5Z A;  4B3T M;  3FUU A;  3K9O A;  3RGP A;  4CGY B;  3KP0 E;  2DWL A;  4QOZ C;  4Z6Y A;  3B7Q A;  3RFW A;  2XGN A;  5IZ7 D;  4PD2 A;  3AFH A;  4B3M M;  4ANR A;  5H37 D;  3MK6 A;  2KA6 B;  3Q8X A;  3FUW A;  1G3I A;  3FKE A;  2M5Z A;  4KLN A;  4Y28 F;  5DNY A;  2WSC F;  5IWA M;  1C7Y A;  3SAS A;  4LJ8 A;  4X64 M;  2XZF A;  5C18 A;  2L6O A;  2R45 A;  2VQE M;  4LFC M;  2EKK A;  1E94 E;  4I4L A;  3J27 B;  4K0K M;  2R62 A;  2P5T A;  3KS8 A;  3NBX X;  4JI7 M;  2C5R A;  2K47 A;  4XGI A;  3TWL A;  1IY1 A;  2A5Y B;  5ITT A;  8CAT A;  5ITY A;  1SG9 A;  1JR3 A;  3L2A A;  2DKL A;  4JYA M;  3K2L A;  3HJS A;  3L29 A;  3CTW B;  1HT2 E;  3BBZ A;  3GP1 A;  5DYG A;  5KQ8 A;  4HEO A;  4DR5 M;  1NHW C;  4MGI E;  1IY2 A;  1E32 A;  3MJ5 A;  1DGH A;  3VDU A;  2UXD M;  4A3V B;  4B08 A;  4IBC A;  3WHL A;  4DBG B;  1D0M A;  3IEC A;  2F4V M;  1VEK A;  4R71 A;  5EXT A;  2YQZ A;  4MGH A;  1IN7 A;  4DR6 M;  3SMP A;  2Y0Q A;  1IN8 A;  4RNA A;  4JI5 M;  3U6S A;  2QSF X;  3SAV A;  1AUA A;  2DI0 A;  1YUB A;  3GO8 A;  3W68 A;  2CRU A;  3HHW A;  3SMS A;  2Q2E B;  1L2D A;  1Z5A A;  1P3Q Q;  5E26 A;  1NJF A;  4M0W A;  2KHH A;  2XH9 A;  1RU3 A;  3PXG A;  3WHK A;  3SAW A;  4DR4 M;  4L16 A;  1L1Z A;  4AKI A;  4B7G A;  3TWM A;  2X4A A;  3M7G A;  3DFZ A;  4BBA A;  4B3S M;  1V92 A;  3TPZ A;  1Y8G A;  4CIZ A;  2JWS A;  3U61 B;  1D0L A;  2CV0 A;  3MHV C;  3U6E A;  3SAU A;  4GKJ M;  3A42 A;  3DOA A;  2FH0 A;  3U6O A;  1OAO C;  2DAI A;  2C99 A;  4JI6 M;  4F2L A;  3LCU A;  2F5P A;  2I7P A;  4OVZ B;  2JY5 A;  2DWN A;  1G59 A;  2JY7 A;  2HHH M;  2LVP C;  2Z4S A;  3KSJ A;  1KFV A;  4B3R M;  1EE8 A;  3D8L A;  3R8F A;  4LF5 M;  2L09 A;  1WHC A;  4DUZ M;  2LNH C;  1QYR A;  2R6F A;  3HJ8 A;  4MH0 E;  2DZO B;  1VEJ A;  1I4W A;  2QEN A;  3I4V A;  2QBY A;  4KHP M;  2R46 A;  1L1T A;  4OVZ A;  2D7H A;  5LMN M;  1SXJ B;  4LY6 A;  3U6D A;  1PJI A;  5ITU A;  3W0L B;  3FTC A;  1QAO A;  1XC8 A;  4JI8 M;  4GHA A;  4IBI A;  3K92 A;  4Z8X A;  3U6L A;  2Z3X A;  3UK6 A;  3FTF A;  5FSW A;  1K3W A;  1JR3 E;  2R65 A;  2YNM D;  3TE6 A;  3LVV A;  2CV1 A;  1QUS A;  2APL A;  5ITX A;  4X65 M;  4GHL A;  5EP2 A;  4GRI A;  5EP4 A;  2DAM A;  2UXC M;  2LHG A;  4I81 A;  1Q39 A;  5KPT A;  1TF0 B;  1K3X A;  2L7I A;  1PRB A;  2FOI C;  2QHO B;  1Z5C A;  4AG6 A;  2RRU A;  2R4E A;  3C3E A;  4G3O A;  3UJN A;  3KOZ E;  4G4Q A;  3QYE A;  3ZCB B;  4NXN M;  5JI2 E;  1T3T A;  1L2B A;  2AHM A;  4LJA A;  2UUA M;  4JI3 M;  1IBM M;  4GC5 A;  4I5S A;  1ZMU A;  1GKI A;  1GJS A;  3AOE C;  4OU7 A;  3GLG B;  1OFH A;  4JN6 A;  1H6U A;  2KZS A;  3GLH E;  2MRO B;  3CF2 A;  4DUY M;  3UGJ A;  1ZAE A;  1E9S A;  1TGU A;  1TDZ A;  4GIP A;  4RF1 A;  1DGB A;  2RGO A;  2LBC A;  3SYL A;  3HWS A;  4WUR A;  3CGW A;  1QDT A;  1UM8 A;  2G8L A;  3JR5 A;  1NNU C;  2ZAN A;  3H4M A;  1DGF A;  4GEW A;  4RF0 A;  3E4R A;  4LJ6 A;  2QBY B;  1PJS A;  4AKH A;  1SXJ C;  2DVW B;  2DNA A;  2F5S A;  2F5Q A;  2JUJ A;  2VDB B;  3ZC7 B;  4D80 A;  2M60 A;  3FE3 A;  1WXQ A;  3I04 M;  4IBF A;  2ERC A;  4LG2 A;  3PNY A;  3LQQ A;  2LVN C;  3HJQ A;  3B89 A;  3NWL A;  2C96 A;  3U60 A;  5C1B A;  2QQ8 A;  1R5L A;  3GRV A;  4FCT A;  4PT5 A;  5EJC A;  2K6B A;  4QOS A;  2UU9 M;  1PJJ A;  1V33 A;  2UXB M;  1ZQ9 A;  2DHY A;  2HL7 A;  2YR0 A;  3F92 A;  1DGH B;  1FNN A;  3FUX A;  5BPV A;  2MJ5 B;  4P17 A;  2OQ4 A;  1NNJ A;  3RE8 A;  2BJV A;  4II7 A;  3ZH9 B;  2FS1 A;  2R44 A;  2XFT A;  3JR4 A;  2CP8 A;  1G71 A;  1HQC A;  3K8Z A;  3LW5 F;  1DGG A;  2B3T A;  2K0B X;  2KW0 A;  5ITX E;  4NRW A;  3W67 A;  1XXH B;  1YSY A;  2OO9 A;  4PCZ A;  2L7H A;  3GLH B;  4D81 A;  1PM5 A;  3VDP A;  3HHZ A;  4JI4 M;  1XNQ M;  3E46 A;  2L2D A;  4B7H A;  4LJ5 A;  2EUC A;  5KPR A;  2DWZ B;  1GAB A;  3L26 A;  1NO1 A;  2FE8 A;  1DV0 A;  1WGL A;  3U6Q A;  4G4R A;  3EIE A;  1BVS A;  4IBJ A;  1L8Q A;  4DV2 M;  3THG A;  4YHH M;  2KRU A;  5E6J A;  2Z8Y M;  5FTM A;  5FLX S;  2FFJ A;  3VLF B;  5A2Q S;  3KSX A;  1QDR A;  4WW0 A;  1IXZ A;  3BOS A;  3FRH A;  3HX3 A;  4M9S A;  1GL7 A;  4FWG A;  3SC3 A;  3CF0 A;  1MJG M;  2HAK A;  3M6A A;  2XFS A;  3T1Y M;  5DYI A;  1W5S A;  4JI1 M;  1MU5 A;  2X49 A;  3KXE C;  3NBI A;  3L28 A;  3GQ3 A;  2LXE A;  2LH0 A;  3I01 M;  3LCV B;  2QCU A;  1IBK M;  1NV9 A;  2O25 A;  2GQF A;  5FTJ A;  3GLF E;  1EFU B;  4HLQ A;  4LGY A;  1PGY A;  1N75 A;  5L8R F;  4KT0 F;  4KO8 A;  4XBO A;  4F1I A;  4DV0 M;  1J5E M;  1JR3 D;  1N78 A;  4IBE A;  1VDD A;  4JI2 M;  3AOE A;  4M9Z A;  5BR8 M;  4LF7 M;  3RGS A;  2HWJ A;  4MM3 B;  3VKH A;  3KP1 E;  2NQ8 C;  1QAQ A;  4LRT A;  5FTL A;  4L15 A;  3IHP A;  4DV3 M;  2EO2 A;  1N33 M;  2D7G A;  2CHQ A;  1XXH E;  1VDL A;  2MR9 A; 
#chains in the Genus database with same CATH homology
 2JY8 A;  1F4I A;  5JI2 E;  3H4J A;  1TR8 A;  2L4E A;  2KNZ A;  1IM2 A;  2OOB A;  3K9O A;  1A5T A;  1OAI A;  1WJ7 A;  3GLG E;  1OKS A;  1R4G A;  1G41 A;  1T43 A;  1ZMU A;  1IXS A;  2KNA A;  2MGW A;  2JZ1 A;  3GLH E;  2MRO B;  1G3I A;  1ZMW A;  1C7Y A;  1CUK A;  3E21 A;  1TTE A;  2LVQ D;  2JY6 B;  2LBC A;  2EKK A;  1E94 E;  1GO5 A;  1WIV A;  1DO0 A;  1Q02 A;  4GEW A;  1HT1 E;  3FRI A;  1ZMV A;  1SG9 A;  2DNA A;  2OOA A;  4Q7J A;  1XB2 B;  2DKL A;  2JUJ A;  3FE3 A;  2JNH A;  2L4F A;  1HT2 E;  2LVN C;  3BBZ A;  1T6O A;  2BWE A;  3B89 A;  4HEO A;  2JZ0 A;  2QNJ A;  1WGN A;  3T6P A;  2DEN A;  4DBG B;  3IEC A;  2ZTC A;  1VEK A;  4R71 A;  1ZV1 A;  2DHY A;  3F92 A;  4UN2 B;  5DFL A;  2MJ5 B;  1KYI A;  2WZJ A;  2QSF X;  2ZTD A;  2LTU A;  2DAE A;  2DI0 A;  2CP8 A;  1DO2 A;  1P3Q Q;  2KNV A;  2B3T A;  2K0B X;  2KHH A;  2R0I A;  1HQY E;  1G4A E;  2EKF A;  2CWB A;  2OO9 A;  1V92 A;  1VEG A;  3K9P A;  1YLA A;  1UFZ A;  2L2D A;  3E46 A;  1MN3 A;  1Y8G A;  2LVA A;  2JP7 A;  1DV0 A;  1AIP C;  1IFY A;  1WGL A;  2DAI A;  4F2L A;  3LCU A;  1BVS A;  2JY5 A;  2JY7 A;  2LVP C;  1VQ1 A;  1WHC A;  3FRH A;  2BWB A;  3GLI E;  2HAK A;  1OQY A;  1VG5 A;  1VEJ A;  2EJS A;  2H5X A;  1QZE A;  3LCV B;  3MMP A;  1NV9 A;  1OTR A;  2O25 A;  1NV8 A;  3GLF E;  1EFU B;  1PGY A;  2K9D A;  4F1I A;  2DZL A;  2DAK A;  1JR3 E;  1HJP A;  2HWJ A;  4WP2 A;  2DAM A;  3IHP A;  2G3Q A;  2DAG A;  2LVO C;  2QHO B;  1WR1 B;  1XXH E;  1VDL A;  2RRU A;  4G3O A;  2MR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...