1J5EM

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1j5eM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1j5eM02
1K3XA 4DV5M 3U6MA 1XMOM 5FLXS 4DV6M 4K0KM 2F4VM 5A2QS 3VK8A 4LF9M 5ITRA 3JR4A 4B3RM 4PDIA 3T1YM 1K3WA 3JAMS 3J81S 1L2CA 4X62M 3GP1A 4LF8M 3JR5A 3U6QA 4DUZM 1TDZA 1N33M 4DR2M 4JI6M 1MU5A 1XC8A 1N32M 3SATA 4OX9M 2HKJA 2UXBM 3GPYA 4JI3M 3GQ3A 4DV1M 5IWAM 5ITUA 3GPPA 1KFVA 1HNWM 5BR8M 1XNQM 4B3MM 1J5EM 2F5SA 4G4RA 4DR3M 2UXDM 5LMNM 4DR4M 2ZM6M 4ITQA 4JI0M 2F5OA 3OTOM 3TWMA 2UUCM 4YHHM 3U6LA 4JI4M 4KHPM 1HNXM 3J80S 5LMUM 4G4OA 4JV5M 3GQ4A 2UUBM 4DR6M 3C58A 2ZBKB 1L1TA 1N36M 3J7AS 4YY3M 4X64M 4AQYM 1Q3CA 1HR0M 4B3TM 4PDGA 1R2ZA 1FJGM 3U6EA 1EE8A 3DOAA 4CISA 1XMQM 5IT9S 1MX0A 4JI1M 2UXCM 4JI8M 1PM5A 4PCZA 4DV2M 4G4NA 2OQ4A 1IBLM 4DV7M 3A45A 4DV0M 2UU9M 2VQFM 2EA0A 4B3SM 3TWKA 4GKJM 4LFBM 2XZFA 1TDHA 3VK7A 4JI7M 3SAUA 4X66M 3GO8A 2VQEM 4DV4M 1I94M 1Z5BA 4LF6M 2HHHM 5ITXA 5ITQA 1K82A 3TWLA 3U6OA 1Z5CA 1PJJA 4LF5M 1R2YA 1PJIA 1Q39A 5ITTA 4JI2M 4JI5M 4DR1M 1XNRM 4LF7M 3SAVA 1Z59A 4DR5M 3GPXA 3SASA 3SBJA 2F5NA 3A42A 1IBMM 4LFAM 3GQ5A 1L1ZA 2UUAM 5ITYA 1L2DA 1HNZM 4GKKM 4DR7M 1Z5AA 3U6SA 2E5LM 4PD2A 3W0FA 3SARA 3GPUA 3T1HM 2Q2EB 4X65M 2OPFA 2XZUA 4LF4M 3SAWA 3A46A 4DUYM 4JYAM 2F5QA 4NRVA 5ITXE 1IBKM 4NXMM 1Q3BA 3U6CA 4NXNM 4DV3M 3U6DA 3U6PA 1NNJA 4NRWA 4MB7A 4LFCM 1L2BA 1N34M 4G4QA 2F5PA
chains in the Genus database with same CATH superfamily
3CF0A 2Y21A 2LXEA 4NOOB 1TF0B 4NSRA 4FVMA 1K3XA 4LJ9A 2BJWA 3TQSA 5L8RF 3U61A 3T15A 3KP0E 4L8RC 3SMPA 1X37A 4LF9M 2F4VM 3L2AA 1AUAA 4B3RM 5C1BA 2GQFA 2XH9A 4XK8F 3UGJA 3T1YM 5EXXA 1C7YA 4AI6A 2M5ZA 3FUUA 3SFZA 3C9PA 1GJSA 2EKKA 1L2CA 1WR1B 2L2DA 1HJPA 4X62M 2KW0A 2MH8A 2CFOA 1LV7A 1DGGA 5EJCA 1QUSA 1JR3D 3SATA 2DAIA 3LCVB 3AFHA 1D0MA 2QNJA 3KXEC 3GPYA 1NVMA 3GPPA 1XNQM 3W68A 2G5GX 1VG5A 4GC5A 5JI2E 3PNVA 3GLHB 5EXPA 1W5TA 3LW5F 1IY2A 3FTDA 1H6UA 3GLFE 4YHHM 1IN4A 1W5SA 2K0BX 2KNZA 2L4FA 1BVSA 3HU2A 2UUBM 1NO1A 1VDDA 3UMMA 4LG2A 3C58A 3I01M 4YY3M 4LY6A 3KW6A 1Q3CA 2FE8A 1IY0A 4RKUF 3VKHA 1G71A 1R6BX 3IG8A 5C18A 3ZC7B 3DOAA 3K9PA 5KO3A 2LBCA 4OVZB 1MX0A 4R7GA 2UXCM 3HHWA 4QNRA 4JI8M 5IT9S 3B7NA 2XFSA 4LJ6A 5FSWA 2QBYA 2BWEA 4DV2M 2OQ4A 1IBLM 4DV7M 3HJ8A 4AW4A 2UU9M 2GNOA 3IECA 2XZFA 1TDHA 4IBBA 5EQTA 2EO2A 2BJVA 2FH0A 2LVQD 4P17A 1DGHA 4B7HA 3HHZA 1KYIA 3DZDA 2KRKA 3UK6A 4AG6A 2R6FA 2XSZA 3GLGB 1A5TA 1PJTA 5FTLA 4GH9A 3J27B 2QQ8A 4L78A 1GL7A 3TPZA 3VDPA 1NV8A 2CWBA 2LVPC 4NC6A 3TWLA 4AG5A 3NBIA 2CHGA 1QDRA 4FCTA 2R44A 2Y0QA 2LTUA 3L28A 1Q39A 2G3QA 4I5SA 5DFLA 4JI5M 2R62A 1G41A 2MROB 2MJ5B 4DR1M 3KFUG 3R9XB 3HJSA 1IM2A 3CF2A 4MH0E 1OIPA 3SASA 1G59A 1D0LA 3BXWA 2JNHA 3RFWA 3M7GA 1SXJC 1HT1E 4GKKM 2ERCA 1EIJA 4CIZA 5F3WA 1OAOC 4OW0A 2DZNB 1NSFA 2L6OA 3E21A 3W0FA 3K2LA 2JZ1A 3SARA 3BBZA 3PXGA 3SYKA 3SAWA 3AKZA 4L4UA 4NL4H 2N35A 3KOZE 5ITXE 2DWMA 2APLA 1QUTA 3FTFA 4NXMM 3SHFA 1T43A 1TGUA 3U6PA 4MB7A 2L4EA 3K1JA 3L26A 3GLIA 1IY1A 4L15A 3GLGE 2B3TA 3HHXA 2FFJA 2KNVA 3FYCA 3L25A 1E9RA 2QSFX 4LJAA 5A2QS 1OQYA 1OFHA 5ITRA 3VK8A 4PDIA 1DO2A 1K3WA 3JAMS 3GLHA 4QHSA 3VKGA 1JR3E 3HZJA 2K6BA 3JR5A 4FW9A 3HJQA 3R8FA 2CV1A 1MU5A 2LH0A 2V6ZM 3I51A 3RE8A 1XC8A 1ZMWA 3DA1A 1T6OA 3GLFB 4OX9M 2CRUA 2HWJA 3KOYE 2XEPA 5ITUA 7CATA 1OJLA 1NV9A 1N77A 4IBKA 4B3MM 2R45A 2LVOC 2Z4RA 3L27A 4G4RA 1Q02A 2UXDM 1TTEA 1GABA 5LMNM 2YNMD 4MGZE 4DR4M 2ZM6M 1OAIA 4BLCA 2DWLA 2L7IA 3OTOM 2UUCM 4ITQA 1ZAEA 3U6LA 3PNYA 1HNXM 3B89A 5LMUM 3VDUA 4G4OA 1I4WA 2JA2A 3VLFB 4BB9A 4QHTA 3MMPA 2ZBKB 1N36M 4KODA 4FWHA 4AQYM 3U60B 2CP8A 3RGPA 2O01F 4D82A 1R2ZA 1EE8A 1IXSA 4RNAA 5FTKA 1XMQM 1ZMUA 3QYEA 2LNHC 3Q8XA 4JI1M 4I4LA 2Z4SA 1NJFA 1WGLA 3T6PA 2O25A 3PVSA 2G8LA 1WJ7A 3LVWA 3A45A 4M9SA 4DV0M 1YSYA 5EP3A 2EA0A 3TWKA 2MGWA 1HQYE 2R4JA 2FOIC 2BWBA 2I7PA 1PJSA 1VEGA 3SAUA 5EP1A 1SXJA 3ZCBB 1UM8A 1VEJA 3E4RA 2DHRA 2MR9A 2RKOA 3C3EA 1I94M 2EUCA 3KP1E 1Z5BA 4GHAA 4F1IA 2A5YB 3KOXE 1C1KA 1GJTA 1SXJD 2RGHA 3IHPA 3L29A 4R3DA 5ITQA 1K82A 1JQJC 4Z8XA 2ZANA 3KDSE 3KVWA 1WHCA 1PJJA 3LVVA 1R2YA 1XXHB 2DHYA 1IN8A 5E6JA 4JI2M 4M0WA 5KPZA 2DAKA 4RF1A 3EIHA 3GRRA 2R4EA 4MGHA 4BBAA 4MGYE 2DAGA 2XLJA 3GPXA 1ZV1A 3FRHA 2F5NA 3B74A 4LFAM 1L1ZA 2QP9X 4EIWA 3LCUA 1TH4A 2H5XA 2DNAA 1HT2E 2CUZA 2JUJA 4GMQA 3GRVA 1NJGA 2WSEF 4FCVA 3U6SA 1HQCA 3CF6E 4XGIA 5KQDA 2DWNA 1MN3A 2JY6B 4WP2A 1N78A 4M0DA 5BPVA 1QDTA 4CGYB 1E32A 4JXJA 4D80A 4JYAM 2F5QA 1EFUB 2QZ4A 2JY8A 2QCUA 2XSZD 3KS8A 1R7RA 1NY5A 3CTWB 1IXRC 3M6AA 4L6V6 3MK6A 4DV3M 2YR0A 3U6CA 3U61B 4NRWA 3QAUA 3EIEA 2KNAA 1S3SA 2J7OA 2ZAMA 1IXZA 4MM3B 4IBEA 2EKFA 4MGIE 1DV0A 5IREB 3U6MA 3GLFA 2YQZA 2VF8A 3T38A 4I8OA 2L09A 1LTMA 2C99A 4Z6YA 2DI0A 1NHGC 2H1RA 3JR4A 1E94E 1IN6A 1XXHE 3U5ZA 2XGNA 3KS4A 4B7FA 4S12A 2FNAA 2KA6B 2HCBA 3H4MA 3H4JA 4R71A 3UJNA 3J81S 2CHQA 3HY5A 5IZ7D 5DYGA 1KSFX 4HEOA 1F4IA 2M60A 4LF8M 3U6QA 5FTNA 1PJQA 2C96A 3FYDA 4DUZM 3MJ5A 1N33M 3MHVC 2K9DA 4IBJA 1MJGM 3D8LA 3SHGB 4JI6M 2LVAA 2C98A 1QQWA 3PFIA 5FTJA 2UXBM 5KPTA 4JI3M 2ZTDA 1G3IA 1HNWM 5BR8M 1IFYA 2DVWB 2F5SA 2Y0TA 2JXNA 3FE3A 1XB2B 4G6ZA 4JI0M 4OU7A 3TWMA 4QOSA 2F5OA 1YLAA 4AKHA 2X4AA 3E9SA 1NNUC 4KO8A 4JI4M 3J80S 4KHPM 1OFIA 5E26A 1QZMA 5FTMA 4LZZA 3GQ4A 1QYRA 2R0IA 2QBYB 4DR6M 1QVRA 1L1TA 2FS1A 1L8QA 4FWDA 4W5WA 4FD2A 1FJGM 3U6EA 5EXSA 4CISA 1JB0F 3THGA 1AIPC 1GO5A 3FTEA 1GKIA 4G4NA 2D7HA 4LZJA 2Z3XA 3GRUA 1DGHB 4FCWA 2QENA 2V1UA 4LRSA 2OOBA 4B3SM 2CEAA 4GKJM 3D8BA 4JN6A 4QNMA 4KLNA 4OVZA 1DGFA 3VK7A 2LHCA 1D2NA 4IIWA 2EJSA 2DAMA 3E46A 4X66M 1GLNA 2KEBA 4DV4M 2CV0A 1G4AE 2DENA 1V33A 2JP7A 4G3OA 4I81A 1N75A 4HL4A 4UN2B 1QAOA 5ITXA 3U6OA 4IBDA 1Z5CA 2DAEA 1J09A 4A3VB 4LF5M 1PJIA 1OTRA 4ZPXA 1P3QQ 2D7EA 3GLGA 3FUVA 4IBFA 1XNRM 1PGYA 3A98B 1WIVA 2AHMA 3SAVA 4QOZC 3KSJA 4HLQA 3K9OA 4L16A 4M9ZA 1R4GA 1IBMM 3GQ5A 1RU3A 2KDLA 1IN7A 2UUAM 1HNZM 2CHVA 1TH3A 1UFZA 3RGSA 2KRUA 2DZLA 1QAQA 2C9OA 4DR7M 1V92A 1YE9A 2JZ0A 1Z5AA 3FTCA 5KPRA 3F92A 1JR3A 1DO0A 4PD2A 3VFDA 2E5LM 3GPUA 2V1CA 3GLIB 2Q2EB 3HWSA 2OPFA 2XZUA 3M0EA 2OO9A 3LMMA 1E9SA 1QAMA 1VQ1A 3I4VA 4Q7JA 4WW0A 3HU1A 4PT5A 3WHLA 5EP2A 2W82A 3GRYA 2I7NA 1IBKM 4LCBA 4XBOA 3TL4X 4IBIA 1NHWC 4LFCM 2D7GA 2KZSA 2R65A 2WSFF 1L2BA 4DBGB 4G4QA 1N34M 3CGWA 4DV5M 2LVNC 3IG5A 4GHLA 4IJFA 4REZA 4LGMA 3BOSA 5FLXS 1XMOM 4DV6M 4K0KM 4NSOB 4B08A 1DGBA 1SG9A 5JI3E 4FWGA 3B9PA 2RGOA 1OIZA 4WURA 2DXIA 1CUKA 1OKSA 2C9CA 2JWSA 2DKLA 5DNYA 3LQQA 3GP1A 2X49A 3FUTA 2HAKA 3FKEA 4IJEA 1TDZA 2RRUA 3AOEC 3FUXA 4DR2M 5KQ8A 2DZOB 4KT0F 2NQ8C 1N32M 4GIPA 1YUBA 3J2PB 2HKJA 2X8AA 5GKNA 3AJIB 3QYBA 3GQ3A 5EP4A 4DV1M 2CE7A 2OOAA 5IWAM 1KFVA 2DWZB 4F2LA 1Z6TA 3HGIA 1J5EM 1VDLA 4LJ5A 3GLIE 3LQRA 4DR3M 2KHHA 1TR8A 1V34A 2VIIA 4LGYA 4GEWA 3AV0A 3WHKA 2JY5A 2Z8YM 1IXSB 1G8PA 3UZUA 1ZQ9A 4JV5M 3HX3A 3ILKA 4LJ7A 4AKGA 1ZMVA 1IQPA 3AOGA 1VEKA 3DFZA 3J7AS 2WZJA 4X64M 3HKPA 3GLHE 1HR0M 4B3TM 1R5LA 1T3TA 3C3DA 4AZFA 4PDGA 2L7HA 2WSCF 3KOWE 2VF7A 4ANRA 2C5RA 3B7ZA 1PM5A 3SC3A 4Y28F 3Q8GA 4PCZA 4AKIA 5DYIA 3FUWA 1NY6A 3K8ZA 1SXJB 3U60A 1J7KA 2VQFM 2O5RA 4GITA 1TH2A 2VDBB 3B7QA 4MGKE 2LHGA 4LRTA 4LFBM 3V76A 4B7GA 4JI7M 3FRIA 1ORYB 3W0LB 2HL7A 3GO8A 2VQEM 1FNNA 2XFTA 2R18A 5H37D 8CATA 4LF6M 3AL0C 4RF0A 4CJ6A 2KZUA 2HHHM 1QZEA 4D81A 3W67A 3SYLA 2KXEA 3ZQJA 1IN5A 1WGNA 5ITTA 2QPAA 3ZH9B 2YFQA 3QWLA 2P5TA 3HU3A 4LF7M 2Y20A 2ZAOA 1Z59A 4M9XA 3FD9A 4GC9A 4GRIA 4DR5M 3SBJA 2K47A 2ZTCA 3A42A 1XXHA 2QHOB 3NBXX 5ITYA 1L2DA 4IBCA 3TE6A 2J7NA 1GL6A 3SMSA 2R46A 4CHTB 1SXJE 2BNKA 2J5YA 2LWXA 1WXQA 4IBGA 3T1HM 4P16A 4X65M 3J7BA 4LF4M 2JY7A 3K92A 3A46A 4DUYM 3KSXA 5EXTA 1PRBA 4NRVA 1D0KA 1GVNA 3AOEA 4LJ8A 4LJ4A 4TUWA 4II7A 1Q3BA 3I4YA 4NXNM 3U6DA 1XHBA 1NNJA 3I04M 3U5ZB 1QANA 1XWIA 2Z7JA 2CV2A 3HHYA 2XF3A 1Y8GA 3NWLA 2F5PA
chains in the Genus database with same CATH topology
3CF0A 2Y21A 2LXEA 4NOOB 4NSRA 1K3XA 4FVMA 4LJ9A 2BJWA 3TQSA 3U61A 3T15A 3KP0E 4L8RC 3SMPA 1X37A 4LF9M 2F4VM 3L2AA 4B3RM 5C1BA 2XH9A 3UGJA 4AI6A 3T1YM 5EXXA 2M5ZA 3FUUA 1L2CA 4X62M 2KW0A 2CFOA 1LV7A 1DGGA 5EJCA 1JR3D 3SATA 3AFHA 3KXEC 3GPYA 1NVMA 3GPPA 1XNQM 2G5GX 4GC5A 5JI2E 3PNVA 3GLHB 5EXPA 1W5TA 1IY2A 3FTDA 1H6UA 4YHHM 1IN4A 1W5SA 3HU2A 2UUBM 1VDDA 3UMMA 4LG2A 3C58A 4YY3M 4LY6A 3KW6A 1Q3CA 2FE8A 1IY0A 3VKHA 1R6BX 3IG8A 5C18A 3ZC7B 3DOAA 5KO3A 4OVZB 1MX0A 4R7GA 2UXCM 3HHWA 4QNRA 4JI8M 5IT9S 2XFSA 4LJ6A 5FSWA 2QBYA 4DV2M 2OQ4A 1IBLM 4DV7M 3HJ8A 4AW4A 2UU9M 2XZFA 1TDHA 4IBBA 5EQTA 2EO2A 2BJVA 1DGHA 4B7HA 3HHZA 1KYIA 3DZDA 2KRKA 3UK6A 4AG6A 3GLGB 2XSZA 5FTLA 4GH9A 3J27B 4L78A 3TPZA 1GL7A 3VDPA 3TWLA 4AG5A 3NBIA 2CHGA 4FCTA 2Y0QA 3L28A 1Q39A 4I5SA 4JI5M 2R62A 1G41A 4DR1M 3KFUG 3R9XB 3HJSA 1IM2A 3CF2A 4MH0E 3SASA 1G59A 3RFWA 3M7GA 1SXJC 1HT1E 4GKKM 2ERCA 5F3WA 4OW0A 2DZNB 1NSFA 2L6OA 3W0FA 3SARA 3K2LA 3PXGA 3SYKA 3SAWA 3AKZA 4L4UA 4NL4H 3KOZE 5ITXE 2DWMA 3FTFA 4NXMM 3SHFA 1TGUA 3U6PA 4MB7A 3GLIA 3K1JA 3L26A 1IY1A 4L15A 3HHXA 2FFJA 3FYCA 3L25A 1E9RA 4LJAA 5A2QS 3VK8A 1OFHA 5ITRA 4PDIA 1DO2A 1K3WA 3JAMS 3GLHA 4QHSA 3VKGA 3JR5A 4FW9A 3HJQA 3R8FA 2CV1A 1MU5A 2LH0A 2V6ZM 3I51A 3RE8A 1XC8A 4JI6M 3DA1A 3GLFB 4OX9M 3KOYE 2XEPA 5ITUA 7CATA 1OJLA 1N77A 4IBKA 4B3MM 2R45A 2Z4RA 3L27A 4G4RA 2UXDM 5LMNM 2YNMD 4MGZE 4DR4M 2ZM6M 4BLCA 2DWLA 2L7IA 3OTOM 2UUCM 4ITQA 1ZAEA 3U6LA 3PNYA 1HNXM 5LMUM 3VDUA 4G4OA 1I4WA 2JA2A 3VLFB 4BB9A 4QHTA 2ZBKB 1N36M 4KODA 4FWHA 4AQYM 3U60B 3RGPA 4D82A 1R2ZA 1EE8A 4RNAA 5FTKA 1XMQM 2LNHC 3Q8XA 4JI1M 4I4LA 2Z4SA 1NJFA 3PVSA 2G8LA 3LVWA 3A45A 4M9SA 4DV0M 1YSYA 5EP3A 2EA0A 3TWKA 1HQYE 2R4JA 2FOIC 2I7PA 3SAUA 5EP1A 1SXJA 3ZCBB 1UM8A 3E4RA 2DHRA 2RKOA 1I94M 2EUCA 3KP1E 1Z5BA 4GHAA 2A5YB 3KOXE 1C1KA 1SXJD 2RGHA 3L29A 5ITQA 1K82A 4R3DA 1JQJC 4Z8XA 2ZANA 3KDSE 3KVWA 1PJJA 1R2YA 3LVVA 1XXHB 1IN8A 5E6JA 4JI2M 4M0WA 5KPZA 4RF1A 3EIHA 3GRRA 2R4EA 4MGHA 4BBAA 4MGYE 2XLJA 3GPXA 2F5NA 4LFAM 1L1ZA 2QP9X 4EIWA 1TH4A 4GMQA 1HT2E 2CUZA 3GRVA 1NJGA 3U6SA 4FCVA 1HQCA 3CF6E 4XGIA 5KQDA 2DWNA 1N78A 4M0DA 5BPVA 4CGYB 4D80A 1E32A 4JXJA 4JYAM 2F5QA 2QZ4A 2QCUA 2XSZD 3KS8A 1R7RA 1NY5A 3CTWB 1IXRC 3M6AA 4DV3M 3MK6A 3U6CA 2YR0A 3U61B 4NRWA 3QAUA 3EIEA 1S3SA 2J7OA 2ZAMA 1IXZA 4MM3B 4IBEA 4MGIE 5IREB 3U6MA 3GLFA 2YQZA 3T38A 4I8OA 2L09A 2C99A 4Z6YA 2H1RA 1NHGC 3JR4A 1E94E 1IN6A 3U5ZA 2XGNA 3KS4A 4B7FA 4S12A 2FNAA 2KA6B 2HCBA 3H4MA 3UJNA 3J81S 2CHQA 5IZ7D 5DYGA 1KSFX 2M60A 4LF8M 3U6QA 5FTNA 2C96A 3FYDA 4DUZM 3MJ5A 1N33M 3MHVC 4IBJA 3D8LA 3SHGB 2C98A 1QQWA 3PFIA 5FTJA 2UXBM 5KPTA 4JI3M 1G3IA 1HNWM 5BR8M 2DVWB 2F5SA 2Y0TA 4G6ZA 4JI0M 4OU7A 3TWMA 4QOSA 2F5OA 4AKHA 2X4AA 3E9SA 1NNUC 4KO8A 4JI4M 3J80S 4KHPM 1OFIA 5E26A 1QZMA 5FTMA 4LZZA 3GQ4A 1QYRA 2QBYB 4DR6M 1QVRA 1L1TA 1L8QA 4FWDA 4W5WA 4FD2A 1FJGM 3U6EA 5EXSA 4CISA 3THGA 3FTEA 1GKIA 4G4NA 2D7HA 4LZJA 2Z3XA 3GRUA 1DGHB 4FCWA 2QENA 2V1UA 4LRSA 4B3SM 2CEAA 4GKJM 3D8BA 4JN6A 4QNMA 4KLNA 4OVZA 1DGFA 3VK7A 1D2NA 4IIWA 4X66M 1GLNA 2KEBA 4DV4M 2CV0A 1G4AE 4I81A 1N75A 4HL4A 1QAOA 5ITXA 3U6OA 4IBDA 1Z5CA 1J09A 4A3VB 4LF5M 1PJIA 4ZPXA 2D7EA 3GLGA 3FUVA 4IBFA 1XNRM 3A98B 3SAVA 2AHMA 4QOZC 3KSJA 4HLQA 4L16A 4M9ZA 1IBMM 3GQ5A 2UUAM 1IN7A 1HNZM 2CHVA 1TH3A 3RGSA 2KRUA 4DR7M 1QAQA 2C9OA 1YE9A 1Z5AA 3FTCA 5KPRA 1JR3A 1DO0A 4PD2A 3VFDA 2E5LM 3GPUA 2V1CA 3GLIB 2Q2EB 3HWSA 2OPFA 2XZUA 3M0EA 3LMMA 1E9SA 1QAMA 3I4VA 4WW0A 3HU1A 4PT5A 3WHLA 5EP2A 2W82A 3GRYA 2I7NA 1IBKM 4LCBA 4XBOA 3TL4X 4IBIA 1NHWC 4LFCM 2D7GA 2KZSA 2R65A 1L2BA 1N34M 4G4QA 4DV5M 4GHLA 3IG5A 4IJFA 4REZA 4LGMA 3BOSA 5FLXS 1XMOM 4DV6M 4K0KM 4NSOB 4B08A 1DGBA 5JI3E 4FWGA 3B9PA 2RGOA 4WURA 2DXIA 2C9CA 3GP1A 5DNYA 3LQQA 2X49A 3FUTA 3FKEA 4IJEA 1TDZA 3AOEC 3FUXA 4DR2M 5KQ8A 2DZOB 2NQ8C 1N32M 4GIPA 1YUBA 3J2PB 2HKJA 2X8AA 5GKNA 3AJIB 3GQ3A 5EP4A 4DV1M 2CE7A 5IWAM 1KFVA 2DWZB 1Z6TA 3HGIA 1J5EM 4LJ5A 4DR3M 3LQRA 2VIIA 4LGYA 3AV0A 3WHKA 1IXSB 1G8PA 3UZUA 1ZQ9A 4JV5M 3ILKA 4LJ7A 4AKGA 1IQPA 3AOGA 3DFZA 3J7AS 4X64M 3HKPA 1HR0M 4B3TM 1T3TA 4AZFA 4PDGA 2L7HA 3KOWE 2C5RA 1PM5A 3SC3A 4PCZA 4AKIA 5DYIA 3FUWA 1NY6A 3K8ZA 1SXJB 3U60A 1J7KA 2VQFM 2O5RA 4GITA 1TH2A 4MGKE 4LFBM 4LRTA 4B7GA 4JI7M 1ORYB 3W0LB 2HL7A 3GO8A 2VQEM 1FNNA 2XFTA 2R18A 5H37D 8CATA 4LF6M 3AL0C 4RF0A 2KZUA 2HHHM 4D81A 3SYLA 2KXEA 1IN5A 5ITTA 2QPAA 3ZH9B 2YFQA 3QWLA 2P5TA 3HU3A 4LF7M 2Y20A 2ZAOA 1Z59A 4M9XA 3FD9A 4GC9A 4GRIA 4DR5M 3SBJA 2K47A 3A42A 1XXHA 5ITYA 1L2DA 4IBCA 3TE6A 2J7NA 1GL6A 3SMSA 2R46A 4CHTB 1SXJE 2BNKA 4IBGA 2LWXA 1WXQA 3T1HM 4P16A 4X65M 3J7BA 4LF4M 3K92A 3A46A 4DUYM 3KSXA 5EXTA 4NRVA 1GVNA 3AOEA 4LJ8A 4LJ4A 4TUWA 4II7A 1Q3BA 3I4YA 4NXNM 3U6DA 1XHBA 1NNJA 3U5ZB 1QANA 1XWIA 2Z7JA 2CV2A 3HHYA 2XF3A 3SFZA 3NWLA 2F5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3X A;  4DV5 M;  3U6M A;  1XMO M;  5FLX S;  4DV6 M;  4K0K M;  2F4V M;  5A2Q S;  3VK8 A;  4LF9 M;  5ITR A;  3JR4 A;  4B3R M;  4PDI A;  3T1Y M;  1K3W A;  3JAM S;  3J81 S;  1L2C A;  4X62 M;  3GP1 A;  4LF8 M;  3JR5 A;  3U6Q A;  4DUZ M;  1TDZ A;  1N33 M;  4DR2 M;  4JI6 M;  1MU5 A;  1XC8 A;  1N32 M;  3SAT A;  4OX9 M;  2HKJ A;  2UXB M;  3GPY A;  4JI3 M;  3GQ3 A;  4DV1 M;  5IWA M;  5ITU A;  3GPP A;  1KFV A;  1HNW M;  5BR8 M;  1XNQ M;  4B3M M;  1J5E M;  2F5S A;  4G4R A;  4DR3 M;  2UXD M;  5LMN M;  4DR4 M;  2ZM6 M;  4ITQ A;  4JI0 M;  2F5O A;  3OTO M;  3TWM A;  2UUC M;  4YHH M;  3U6L A;  4JI4 M;  4KHP M;  1HNX M;  3J80 S;  5LMU M;  4G4O A;  4JV5 M;  3GQ4 A;  2UUB M;  4DR6 M;  3C58 A;  2ZBK B;  1L1T A;  1N36 M;  3J7A S;  4YY3 M;  4X64 M;  4AQY M;  1Q3C A;  1HR0 M;  4B3T M;  4PDG A;  1R2Z A;  1FJG M;  3U6E A;  1EE8 A;  3DOA A;  4CIS A;  1XMQ M;  5IT9 S;  1MX0 A;  4JI1 M;  2UXC M;  4JI8 M;  1PM5 A;  4PCZ A;  4DV2 M;  4G4N A;  2OQ4 A;  1IBL M;  4DV7 M;  3A45 A;  4DV0 M;  2UU9 M;  2VQF M;  2EA0 A;  4B3S M;  3TWK A;  4GKJ M;  4LFB M;  2XZF A;  1TDH A;  3VK7 A;  4JI7 M;  3SAU A;  4X66 M;  3GO8 A;  2VQE M;  4DV4 M;  1I94 M;  1Z5B A;  4LF6 M;  2HHH M;  5ITX A;  5ITQ A;  1K82 A;  3TWL A;  3U6O A;  1Z5C A;  1PJJ A;  4LF5 M;  1R2Y A;  1PJI A;  1Q39 A;  5ITT A;  4JI2 M;  4JI5 M;  4DR1 M;  1XNR M;  4LF7 M;  3SAV A;  1Z59 A;  4DR5 M;  3GPX A;  3SAS A;  3SBJ A;  2F5N A;  3A42 A;  1IBM M;  4LFA M;  3GQ5 A;  1L1Z A;  2UUA M;  5ITY A;  1L2D A;  1HNZ M;  4GKK M;  4DR7 M;  1Z5A A;  3U6S A;  2E5L M;  4PD2 A;  3W0F A;  3SAR A;  3GPU A;  3T1H M;  2Q2E B;  4X65 M;  2OPF A;  2XZU A;  4LF4 M;  3SAW A;  3A46 A;  4DUY M;  4JYA M;  2F5Q A;  4NRV A;  5ITX E;  1IBK M;  4NXM M;  1Q3B A;  3U6C A;  4NXN M;  4DV3 M;  3U6D A;  3U6P A;  1NNJ A;  4NRW A;  4MB7 A;  4LFC M;  1L2B A;  1N34 M;  4G4Q A;  2F5P A; 
#chains in the Genus database with same CATH topology
 3CF0 A;  2Y21 A;  2LXE A;  4NOO B;  1TF0 B;  4NSR A;  4FVM A;  1K3X A;  4LJ9 A;  2BJW A;  3TQS A;  5L8R F;  3U61 A;  3T15 A;  3KP0 E;  4L8R C;  3SMP A;  1X37 A;  4LF9 M;  2F4V M;  3L2A A;  1AUA A;  4B3R M;  5C1B A;  2GQF A;  2XH9 A;  4XK8 F;  3UGJ A;  3T1Y M;  5EXX A;  1C7Y A;  4AI6 A;  2M5Z A;  3FUU A;  3SFZ A;  3C9P A;  1GJS A;  2EKK A;  1L2C A;  1WR1 B;  2L2D A;  1HJP A;  4X62 M;  2KW0 A;  2MH8 A;  2CFO A;  1LV7 A;  1DGG A;  5EJC A;  1QUS A;  1JR3 D;  3SAT A;  2DAI A;  3LCV B;  3AFH A;  1D0M A;  2QNJ A;  3KXE C;  3GPY A;  1NVM A;  3GPP A;  1XNQ M;  3W68 A;  2G5G X;  1VG5 A;  4GC5 A;  5JI2 E;  3PNV A;  3GLH B;  5EXP A;  1W5T A;  3LW5 F;  1IY2 A;  3FTD A;  1H6U A;  3GLF E;  4YHH M;  1IN4 A;  1W5S A;  2K0B X;  2KNZ A;  2L4F A;  1BVS A;  3HU2 A;  2UUB M;  1NO1 A;  1VDD A;  3UMM A;  4LG2 A;  3C58 A;  3I01 M;  4YY3 M;  4LY6 A;  3KW6 A;  1Q3C A;  2FE8 A;  1IY0 A;  4RKU F;  3VKH A;  1G71 A;  1R6B X;  3IG8 A;  5C18 A;  3ZC7 B;  3DOA A;  3K9P A;  5KO3 A;  2LBC A;  4OVZ B;  1MX0 A;  4R7G A;  2UXC M;  3HHW A;  4QNR A;  4JI8 M;  5IT9 S;  3B7N A;  2XFS A;  4LJ6 A;  5FSW A;  2QBY A;  2BWE A;  4DV2 M;  2OQ4 A;  1IBL M;  4DV7 M;  3HJ8 A;  4AW4 A;  2UU9 M;  2GNO A;  3IEC A;  2XZF A;  1TDH A;  4IBB A;  5EQT A;  2EO2 A;  2BJV A;  2FH0 A;  2LVQ D;  4P17 A;  1DGH A;  4B7H A;  3HHZ A;  1KYI A;  3DZD A;  2KRK A;  3UK6 A;  4AG6 A;  2R6F A;  2XSZ A;  3GLG B;  1A5T A;  1PJT A;  5FTL A;  4GH9 A;  3J27 B;  2QQ8 A;  4L78 A;  1GL7 A;  3TPZ A;  3VDP A;  1NV8 A;  2CWB A;  2LVP C;  4NC6 A;  3TWL A;  4AG5 A;  3NBI A;  2CHG A;  1QDR A;  4FCT A;  2R44 A;  2Y0Q A;  2LTU A;  3L28 A;  1Q39 A;  2G3Q A;  4I5S A;  5DFL A;  4JI5 M;  2R62 A;  1G41 A;  2MRO B;  2MJ5 B;  4DR1 M;  3KFU G;  3R9X B;  3HJS A;  1IM2 A;  3CF2 A;  4MH0 E;  1OIP A;  3SAS A;  1G59 A;  1D0L A;  3BXW A;  2JNH A;  3RFW A;  3M7G A;  1SXJ C;  1HT1 E;  4GKK M;  2ERC A;  1EIJ A;  4CIZ A;  5F3W A;  1OAO C;  4OW0 A;  2DZN B;  1NSF A;  2L6O A;  3E21 A;  3W0F A;  3K2L A;  2JZ1 A;  3SAR A;  3BBZ A;  3PXG A;  3SYK A;  3SAW A;  3AKZ A;  4L4U A;  4NL4 H;  2N35 A;  3KOZ E;  5ITX E;  2DWM A;  2APL A;  1QUT A;  3FTF A;  4NXM M;  3SHF A;  1T43 A;  1TGU A;  3U6P A;  4MB7 A;  2L4E A;  3K1J A;  3L26 A;  3GLI A;  1IY1 A;  4L15 A;  3GLG E;  2B3T A;  3HHX A;  2FFJ A;  2KNV A;  3FYC A;  3L25 A;  1E9R A;  2QSF X;  4LJA A;  5A2Q S;  1OQY A;  1OFH A;  5ITR A;  3VK8 A;  4PDI A;  1DO2 A;  1K3W A;  3JAM S;  3GLH A;  4QHS A;  3VKG A;  1JR3 E;  3HZJ A;  2K6B A;  3JR5 A;  4FW9 A;  3HJQ A;  3R8F A;  2CV1 A;  1MU5 A;  2LH0 A;  2V6Z M;  3I51 A;  3RE8 A;  1XC8 A;  1ZMW A;  3DA1 A;  1T6O A;  3GLF B;  4OX9 M;  2CRU A;  2HWJ A;  3KOY E;  2XEP A;  5ITU A;  7CAT A;  1OJL A;  1NV9 A;  1N77 A;  4IBK A;  4B3M M;  2R45 A;  2LVO C;  2Z4R A;  3L27 A;  4G4R A;  1Q02 A;  2UXD M;  1TTE A;  1GAB A;  5LMN M;  2YNM D;  4MGZ E;  4DR4 M;  2ZM6 M;  1OAI A;  4BLC A;  2DWL A;  2L7I A;  3OTO M;  2UUC M;  4ITQ A;  1ZAE A;  3U6L A;  3PNY A;  1HNX M;  3B89 A;  5LMU M;  3VDU A;  4G4O A;  1I4W A;  2JA2 A;  3VLF B;  4BB9 A;  4QHT A;  3MMP A;  2ZBK B;  1N36 M;  4KOD A;  4FWH A;  4AQY M;  3U60 B;  2CP8 A;  3RGP A;  2O01 F;  4D82 A;  1R2Z A;  1EE8 A;  1IXS A;  4RNA A;  5FTK A;  1XMQ M;  1ZMU A;  3QYE A;  2LNH C;  3Q8X A;  4JI1 M;  4I4L A;  2Z4S A;  1NJF A;  1WGL A;  3T6P A;  2O25 A;  3PVS A;  2G8L A;  1WJ7 A;  3LVW A;  3A45 A;  4M9S A;  4DV0 M;  1YSY A;  5EP3 A;  2EA0 A;  3TWK A;  2MGW A;  1HQY E;  2R4J A;  2FOI C;  2BWB A;  2I7P A;  1PJS A;  1VEG A;  3SAU A;  5EP1 A;  1SXJ A;  3ZCB B;  1UM8 A;  1VEJ A;  3E4R A;  2DHR A;  2MR9 A;  2RKO A;  3C3E A;  1I94 M;  2EUC A;  3KP1 E;  1Z5B A;  4GHA A;  4F1I A;  2A5Y B;  3KOX E;  1C1K A;  1GJT A;  1SXJ D;  2RGH A;  3IHP A;  3L29 A;  4R3D A;  5ITQ A;  1K82 A;  1JQJ C;  4Z8X A;  2ZAN A;  3KDS E;  3KVW A;  1WHC A;  1PJJ A;  3LVV A;  1R2Y A;  1XXH B;  2DHY A;  1IN8 A;  5E6J A;  4JI2 M;  4M0W A;  5KPZ A;  2DAK A;  4RF1 A;  3EIH A;  3GRR A;  2R4E A;  4MGH A;  4BBA A;  4MGY E;  2DAG A;  2XLJ A;  3GPX A;  1ZV1 A;  3FRH A;  2F5N A;  3B74 A;  4LFA M;  1L1Z A;  2QP9 X;  4EIW A;  3LCU A;  1TH4 A;  2H5X A;  2DNA A;  1HT2 E;  2CUZ A;  2JUJ A;  4GMQ A;  3GRV A;  1NJG A;  2WSE F;  4FCV A;  3U6S A;  1HQC A;  3CF6 E;  4XGI A;  5KQD A;  2DWN A;  1MN3 A;  2JY6 B;  4WP2 A;  1N78 A;  4M0D A;  5BPV A;  1QDT A;  4CGY B;  1E32 A;  4JXJ A;  4D80 A;  4JYA M;  2F5Q A;  1EFU B;  2QZ4 A;  2JY8 A;  2QCU A;  2XSZ D;  3KS8 A;  1R7R A;  1NY5 A;  3CTW B;  1IXR C;  3M6A A;  4L6V 6;  3MK6 A;  4DV3 M;  2YR0 A;  3U6C A;  3U61 B;  4NRW A;  3QAU A;  3EIE A;  2KNA A;  1S3S A;  2J7O A;  2ZAM A;  1IXZ A;  4MM3 B;  4IBE A;  2EKF A;  4MGI E;  1DV0 A;  5IRE B;  3U6M A;  3GLF A;  2YQZ A;  2VF8 A;  3T38 A;  4I8O A;  2L09 A;  1LTM A;  2C99 A;  4Z6Y A;  2DI0 A;  1NHG C;  2H1R A;  3JR4 A;  1E94 E;  1IN6 A;  1XXH E;  3U5Z A;  2XGN A;  3KS4 A;  4B7F A;  4S12 A;  2FNA A;  2KA6 B;  2HCB A;  3H4M A;  3H4J A;  4R71 A;  3UJN A;  3J81 S;  2CHQ A;  3HY5 A;  5IZ7 D;  5DYG A;  1KSF X;  4HEO A;  1F4I A;  2M60 A;  4LF8 M;  3U6Q A;  5FTN A;  1PJQ A;  2C96 A;  3FYD A;  4DUZ M;  3MJ5 A;  1N33 M;  3MHV C;  2K9D A;  4IBJ A;  1MJG M;  3D8L A;  3SHG B;  4JI6 M;  2LVA A;  2C98 A;  1QQW A;  3PFI A;  5FTJ A;  2UXB M;  5KPT A;  4JI3 M;  2ZTD A;  1G3I A;  1HNW M;  5BR8 M;  1IFY A;  2DVW B;  2F5S A;  2Y0T A;  2JXN A;  3FE3 A;  1XB2 B;  4G6Z A;  4JI0 M;  4OU7 A;  3TWM A;  4QOS A;  2F5O A;  1YLA A;  4AKH A;  2X4A A;  3E9S A;  1NNU C;  4KO8 A;  4JI4 M;  3J80 S;  4KHP M;  1OFI A;  5E26 A;  1QZM A;  5FTM A;  4LZZ A;  3GQ4 A;  1QYR A;  2R0I A;  2QBY B;  4DR6 M;  1QVR A;  1L1T A;  2FS1 A;  1L8Q A;  4FWD A;  4W5W A;  4FD2 A;  1FJG M;  3U6E A;  5EXS A;  4CIS A;  1JB0 F;  3THG A;  1AIP C;  1GO5 A;  3FTE A;  1GKI A;  4G4N A;  2D7H A;  4LZJ A;  2Z3X A;  3GRU A;  1DGH B;  4FCW A;  2QEN A;  2V1U A;  4LRS A;  2OOB A;  4B3S M;  2CEA A;  4GKJ M;  3D8B A;  4JN6 A;  4QNM A;  4KLN A;  4OVZ A;  1DGF A;  3VK7 A;  2LHC A;  1D2N A;  4IIW A;  2EJS A;  2DAM A;  3E46 A;  4X66 M;  1GLN A;  2KEB A;  4DV4 M;  2CV0 A;  1G4A E;  2DEN A;  1V33 A;  2JP7 A;  4G3O A;  4I81 A;  1N75 A;  4HL4 A;  4UN2 B;  1QAO A;  5ITX A;  3U6O A;  4IBD A;  1Z5C A;  2DAE A;  1J09 A;  4A3V B;  4LF5 M;  1PJI A;  1OTR A;  4ZPX A;  1P3Q Q;  2D7E A;  3GLG A;  3FUV A;  4IBF A;  1XNR M;  1PGY A;  3A98 B;  1WIV A;  2AHM A;  3SAV A;  4QOZ C;  3KSJ A;  4HLQ A;  3K9O A;  4L16 A;  4M9Z A;  1R4G A;  1IBM M;  3GQ5 A;  1RU3 A;  2KDL A;  1IN7 A;  2UUA M;  1HNZ M;  2CHV A;  1TH3 A;  1UFZ A;  3RGS A;  2KRU A;  2DZL A;  1QAQ A;  2C9O A;  4DR7 M;  1V92 A;  1YE9 A;  2JZ0 A;  1Z5A A;  3FTC A;  5KPR A;  3F92 A;  1JR3 A;  1DO0 A;  4PD2 A;  3VFD A;  2E5L M;  3GPU A;  2V1C A;  3GLI B;  2Q2E B;  3HWS A;  2OPF A;  2XZU A;  3M0E A;  2OO9 A;  3LMM A;  1E9S A;  1QAM A;  1VQ1 A;  3I4V A;  4Q7J A;  4WW0 A;  3HU1 A;  4PT5 A;  3WHL A;  5EP2 A;  2W82 A;  3GRY A;  2I7N A;  1IBK M;  4LCB A;  4XBO A;  3TL4 X;  4IBI A;  1NHW C;  4LFC M;  2D7G A;  2KZS A;  2R65 A;  2WSF F;  1L2B A;  4DBG B;  4G4Q A;  1N34 M;  3CGW A;  4DV5 M;  2LVN C;  3IG5 A;  4GHL A;  4IJF A;  4REZ A;  4LGM A;  3BOS A;  5FLX S;  1XMO M;  4DV6 M;  4K0K M;  4NSO B;  4B08 A;  1DGB A;  1SG9 A;  5JI3 E;  4FWG A;  3B9P A;  2RGO A;  1OIZ A;  4WUR A;  2DXI A;  1CUK A;  1OKS A;  2C9C A;  2JWS A;  2DKL A;  5DNY A;  3LQQ A;  3GP1 A;  2X49 A;  3FUT A;  2HAK A;  3FKE A;  4IJE A;  1TDZ A;  2RRU A;  3AOE C;  3FUX A;  4DR2 M;  5KQ8 A;  2DZO B;  4KT0 F;  2NQ8 C;  1N32 M;  4GIP A;  1YUB A;  3J2P B;  2HKJ A;  2X8A A;  5GKN A;  3AJI B;  3QYB A;  3GQ3 A;  5EP4 A;  4DV1 M;  2CE7 A;  2OOA A;  5IWA M;  1KFV A;  2DWZ B;  4F2L A;  1Z6T A;  3HGI A;  1J5E M;  1VDL A;  4LJ5 A;  3GLI E;  3LQR A;  4DR3 M;  2KHH A;  1TR8 A;  1V34 A;  2VII A;  4LGY A;  4GEW A;  3AV0 A;  3WHK A;  2JY5 A;  2Z8Y M;  1IXS B;  1G8P A;  3UZU A;  1ZQ9 A;  4JV5 M;  3HX3 A;  3ILK A;  4LJ7 A;  4AKG A;  1ZMV A;  1IQP A;  3AOG A;  1VEK A;  3DFZ A;  3J7A S;  2WZJ A;  4X64 M;  3HKP A;  3GLH E;  1HR0 M;  4B3T M;  1R5L A;  1T3T A;  3C3D A;  4AZF A;  4PDG A;  2L7H A;  2WSC F;  3KOW E;  2VF7 A;  4ANR A;  2C5R A;  3B7Z A;  1PM5 A;  3SC3 A;  4Y28 F;  3Q8G A;  4PCZ A;  4AKI A;  5DYI A;  3FUW A;  1NY6 A;  3K8Z A;  1SXJ B;  3U60 A;  1J7K A;  2VQF M;  2O5R A;  4GIT A;  1TH2 A;  2VDB B;  3B7Q A;  4MGK E;  2LHG A;  4LRT A;  4LFB M;  3V76 A;  4B7G A;  4JI7 M;  3FRI A;  1ORY B;  3W0L B;  2HL7 A;  3GO8 A;  2VQE M;  1FNN A;  2XFT A;  2R18 A;  5H37 D;  8CAT A;  4LF6 M;  3AL0 C;  4RF0 A;  4CJ6 A;  2KZU A;  2HHH M;  1QZE A;  4D81 A;  3W67 A;  3SYL A;  2KXE A;  3ZQJ A;  1IN5 A;  1WGN A;  5ITT A;  2QPA A;  3ZH9 B;  2YFQ A;  3QWL A;  2P5T A;  3HU3 A;  4LF7 M;  2Y20 A;  2ZAO A;  1Z59 A;  4M9X A;  3FD9 A;  4GC9 A;  4GRI A;  4DR5 M;  3SBJ A;  2K47 A;  2ZTC A;  3A42 A;  1XXH A;  2QHO B;  3NBX X;  5ITY A;  1L2D A;  4IBC A;  3TE6 A;  2J7N A;  1GL6 A;  3SMS A;  2R46 A;  4CHT B;  1SXJ E;  2BNK A;  2J5Y A;  2LWX A;  1WXQ A;  4IBG A;  3T1H M;  4P16 A;  4X65 M;  3J7B A;  4LF4 M;  2JY7 A;  3K92 A;  3A46 A;  4DUY M;  3KSX A;  5EXT A;  1PRB A;  4NRV A;  1D0K A;  1GVN A;  3AOE A;  4LJ8 A;  4LJ4 A;  4TUW A;  4II7 A;  1Q3B A;  3I4Y A;  4NXN M;  3U6D A;  1XHB A;  1NNJ A;  3I04 M;  3U5Z B;  1QAN A;  1XWI A;  2Z7J A;  2CV2 A;  3HHY A;  2XF3 A;  1Y8G A;  3NWL A;  2F5P A; 
#chains in the Genus database with same CATH homology
 3CF0 A;  2Y21 A;  2LXE A;  4NOO B;  4NSR A;  1K3X A;  4FVM A;  4LJ9 A;  2BJW A;  3TQS A;  3U61 A;  3T15 A;  3KP0 E;  4L8R C;  3SMP A;  1X37 A;  4LF9 M;  2F4V M;  3L2A A;  4B3R M;  5C1B A;  2XH9 A;  3UGJ A;  4AI6 A;  3T1Y M;  5EXX A;  2M5Z A;  3FUU A;  1L2C A;  4X62 M;  2KW0 A;  2CFO A;  1LV7 A;  1DGG A;  5EJC A;  1JR3 D;  3SAT A;  3AFH A;  3KXE C;  3GPY A;  1NVM A;  3GPP A;  1XNQ M;  2G5G X;  4GC5 A;  5JI2 E;  3PNV A;  3GLH B;  5EXP A;  1W5T A;  1IY2 A;  3FTD A;  1H6U A;  4YHH M;  1IN4 A;  1W5S A;  3HU2 A;  2UUB M;  1VDD A;  3UMM A;  4LG2 A;  3C58 A;  4YY3 M;  4LY6 A;  3KW6 A;  1Q3C A;  2FE8 A;  1IY0 A;  3VKH A;  1R6B X;  3IG8 A;  5C18 A;  3ZC7 B;  3DOA A;  5KO3 A;  4OVZ B;  1MX0 A;  4R7G A;  2UXC M;  3HHW A;  4QNR A;  4JI8 M;  5IT9 S;  2XFS A;  4LJ6 A;  5FSW A;  2QBY A;  4DV2 M;  2OQ4 A;  1IBL M;  4DV7 M;  3HJ8 A;  4AW4 A;  2UU9 M;  2XZF A;  1TDH A;  4IBB A;  5EQT A;  2EO2 A;  2BJV A;  1DGH A;  4B7H A;  3HHZ A;  1KYI A;  3DZD A;  2KRK A;  3UK6 A;  4AG6 A;  3GLG B;  2XSZ A;  5FTL A;  4GH9 A;  3J27 B;  4L78 A;  3TPZ A;  1GL7 A;  3VDP A;  3TWL A;  4AG5 A;  3NBI A;  2CHG A;  4FCT A;  2Y0Q A;  3L28 A;  1Q39 A;  4I5S A;  4JI5 M;  2R62 A;  1G41 A;  4DR1 M;  3KFU G;  3R9X B;  3HJS A;  1IM2 A;  3CF2 A;  4MH0 E;  3SAS A;  1G59 A;  3RFW A;  3M7G A;  1SXJ C;  1HT1 E;  4GKK M;  2ERC A;  5F3W A;  4OW0 A;  2DZN B;  1NSF A;  2L6O A;  3W0F A;  3SAR A;  3K2L A;  3PXG A;  3SYK A;  3SAW A;  3AKZ A;  4L4U A;  4NL4 H;  3KOZ E;  5ITX E;  2DWM A;  3FTF A;  4NXM M;  3SHF A;  1TGU A;  3U6P A;  4MB7 A;  3GLI A;  3K1J A;  3L26 A;  1IY1 A;  4L15 A;  3HHX A;  2FFJ A;  3FYC A;  3L25 A;  1E9R A;  4LJA A;  5A2Q S;  3VK8 A;  1OFH A;  5ITR A;  4PDI A;  1DO2 A;  1K3W A;  3JAM S;  3GLH A;  4QHS A;  3VKG A;  3JR5 A;  4FW9 A;  3HJQ A;  3R8F A;  2CV1 A;  1MU5 A;  2LH0 A;  2V6Z M;  3I51 A;  3RE8 A;  1XC8 A;  4JI6 M;  3DA1 A;  3GLF B;  4OX9 M;  3KOY E;  2XEP A;  5ITU A;  7CAT A;  1OJL A;  1N77 A;  4IBK A;  4B3M M;  2R45 A;  2Z4R A;  3L27 A;  4G4R A;  2UXD M;  5LMN M;  2YNM D;  4MGZ E;  4DR4 M;  2ZM6 M;  4BLC A;  2DWL A;  2L7I A;  3OTO M;  2UUC M;  4ITQ A;  1ZAE A;  3U6L A;  3PNY A;  1HNX M;  5LMU M;  3VDU A;  4G4O A;  1I4W A;  2JA2 A;  3VLF B;  4BB9 A;  4QHT A;  2ZBK B;  1N36 M;  4KOD A;  4FWH A;  4AQY M;  3U60 B;  3RGP A;  4D82 A;  1R2Z A;  1EE8 A;  4RNA A;  5FTK A;  1XMQ M;  2LNH C;  3Q8X A;  4JI1 M;  4I4L A;  2Z4S A;  1NJF A;  3PVS A;  2G8L A;  3LVW A;  3A45 A;  4M9S A;  4DV0 M;  1YSY A;  5EP3 A;  2EA0 A;  3TWK A;  1HQY E;  2R4J A;  2FOI C;  2I7P A;  3SAU A;  5EP1 A;  1SXJ A;  3ZCB B;  1UM8 A;  3E4R A;  2DHR A;  2RKO A;  1I94 M;  2EUC A;  3KP1 E;  1Z5B A;  4GHA A;  2A5Y B;  3KOX E;  1C1K A;  1SXJ D;  2RGH A;  3L29 A;  5ITQ A;  1K82 A;  4R3D A;  1JQJ C;  4Z8X A;  2ZAN A;  3KDS E;  3KVW A;  1PJJ A;  1R2Y A;  3LVV A;  1XXH B;  1IN8 A;  5E6J A;  4JI2 M;  4M0W A;  5KPZ A;  4RF1 A;  3EIH A;  3GRR A;  2R4E A;  4MGH A;  4BBA A;  4MGY E;  2XLJ A;  3GPX A;  2F5N A;  4LFA M;  1L1Z A;  2QP9 X;  4EIW A;  1TH4 A;  4GMQ A;  1HT2 E;  2CUZ A;  3GRV A;  1NJG A;  3U6S A;  4FCV A;  1HQC A;  3CF6 E;  4XGI A;  5KQD A;  2DWN A;  1N78 A;  4M0D A;  5BPV A;  4CGY B;  4D80 A;  1E32 A;  4JXJ A;  4JYA M;  2F5Q A;  2QZ4 A;  2QCU A;  2XSZ D;  3KS8 A;  1R7R A;  1NY5 A;  3CTW B;  1IXR C;  3M6A A;  4DV3 M;  3MK6 A;  3U6C A;  2YR0 A;  3U61 B;  4NRW A;  3QAU A;  3EIE A;  1S3S A;  2J7O A;  2ZAM A;  1IXZ A;  4MM3 B;  4IBE A;  4MGI E;  5IRE B;  3U6M A;  3GLF A;  2YQZ A;  3T38 A;  4I8O A;  2L09 A;  2C99 A;  4Z6Y A;  2H1R A;  1NHG C;  3JR4 A;  1E94 E;  1IN6 A;  3U5Z A;  2XGN A;  3KS4 A;  4B7F A;  4S12 A;  2FNA A;  2KA6 B;  2HCB A;  3H4M A;  3UJN A;  3J81 S;  2CHQ A;  5IZ7 D;  5DYG A;  1KSF X;  2M60 A;  4LF8 M;  3U6Q A;  5FTN A;  2C96 A;  3FYD A;  4DUZ M;  3MJ5 A;  1N33 M;  3MHV C;  4IBJ A;  3D8L A;  3SHG B;  2C98 A;  1QQW A;  3PFI A;  5FTJ A;  2UXB M;  5KPT A;  4JI3 M;  1G3I A;  1HNW M;  5BR8 M;  2DVW B;  2F5S A;  2Y0T A;  4G6Z A;  4JI0 M;  4OU7 A;  3TWM A;  4QOS A;  2F5O A;  4AKH A;  2X4A A;  3E9S A;  1NNU C;  4KO8 A;  4JI4 M;  3J80 S;  4KHP M;  1OFI A;  5E26 A;  1QZM A;  5FTM A;  4LZZ A;  3GQ4 A;  1QYR A;  2QBY B;  4DR6 M;  1QVR A;  1L1T A;  1L8Q A;  4FWD A;  4W5W A;  4FD2 A;  1FJG M;  3U6E A;  5EXS A;  4CIS A;  3THG A;  3FTE A;  1GKI A;  4G4N A;  2D7H A;  4LZJ A;  2Z3X A;  3GRU A;  1DGH B;  4FCW A;  2QEN A;  2V1U A;  4LRS A;  4B3S M;  2CEA A;  4GKJ M;  3D8B A;  4JN6 A;  4QNM A;  4KLN A;  4OVZ A;  1DGF A;  3VK7 A;  1D2N A;  4IIW A;  4X66 M;  1GLN A;  2KEB A;  4DV4 M;  2CV0 A;  1G4A E;  4I81 A;  1N75 A;  4HL4 A;  1QAO A;  5ITX A;  3U6O A;  4IBD A;  1Z5C A;  1J09 A;  4A3V B;  4LF5 M;  1PJI A;  4ZPX A;  2D7E A;  3GLG A;  3FUV A;  4IBF A;  1XNR M;  3A98 B;  3SAV A;  2AHM A;  4QOZ C;  3KSJ A;  4HLQ A;  4L16 A;  4M9Z A;  1IBM M;  3GQ5 A;  2UUA M;  1IN7 A;  1HNZ M;  2CHV A;  1TH3 A;  3RGS A;  2KRU A;  4DR7 M;  1QAQ A;  2C9O A;  1YE9 A;  1Z5A A;  3FTC A;  5KPR A;  1JR3 A;  1DO0 A;  4PD2 A;  3VFD A;  2E5L M;  3GPU A;  2V1C A;  3GLI B;  2Q2E B;  3HWS A;  2OPF A;  2XZU A;  3M0E A;  3LMM A;  1E9S A;  1QAM A;  3I4V A;  4WW0 A;  3HU1 A;  4PT5 A;  3WHL A;  5EP2 A;  2W82 A;  3GRY A;  2I7N A;  1IBK M;  4LCB A;  4XBO A;  3TL4 X;  4IBI A;  1NHW C;  4LFC M;  2D7G A;  2KZS A;  2R65 A;  1L2B A;  1N34 M;  4G4Q A;  4DV5 M;  4GHL A;  3IG5 A;  4IJF A;  4REZ A;  4LGM A;  3BOS A;  5FLX S;  1XMO M;  4DV6 M;  4K0K M;  4NSO B;  4B08 A;  1DGB A;  5JI3 E;  4FWG A;  3B9P A;  2RGO A;  4WUR A;  2DXI A;  2C9C A;  3GP1 A;  5DNY A;  3LQQ A;  2X49 A;  3FUT A;  3FKE A;  4IJE A;  1TDZ A;  3AOE C;  3FUX A;  4DR2 M;  5KQ8 A;  2DZO B;  2NQ8 C;  1N32 M;  4GIP A;  1YUB A;  3J2P B;  2HKJ A;  2X8A A;  5GKN A;  3AJI B;  3GQ3 A;  5EP4 A;  4DV1 M;  2CE7 A;  5IWA M;  1KFV A;  2DWZ B;  1Z6T A;  3HGI A;  1J5E M;  4LJ5 A;  4DR3 M;  3LQR A;  2VII A;  4LGY A;  3AV0 A;  3WHK A;  1IXS B;  1G8P A;  3UZU A;  1ZQ9 A;  4JV5 M;  3ILK A;  4LJ7 A;  4AKG A;  1IQP A;  3AOG A;  3DFZ A;  3J7A S;  4X64 M;  3HKP A;  1HR0 M;  4B3T M;  1T3T A;  4AZF A;  4PDG A;  2L7H A;  3KOW E;  2C5R A;  1PM5 A;  3SC3 A;  4PCZ A;  4AKI A;  5DYI A;  3FUW A;  1NY6 A;  3K8Z A;  1SXJ B;  3U60 A;  1J7K A;  2VQF M;  2O5R A;  4GIT A;  1TH2 A;  4MGK E;  4LFB M;  4LRT A;  4B7G A;  4JI7 M;  1ORY B;  3W0L B;  2HL7 A;  3GO8 A;  2VQE M;  1FNN A;  2XFT A;  2R18 A;  5H37 D;  8CAT A;  4LF6 M;  3AL0 C;  4RF0 A;  2KZU A;  2HHH M;  4D81 A;  3SYL A;  2KXE A;  1IN5 A;  5ITT A;  2QPA A;  3ZH9 B;  2YFQ A;  3QWL A;  2P5T A;  3HU3 A;  4LF7 M;  2Y20 A;  2ZAO A;  1Z59 A;  4M9X A;  3FD9 A;  4GC9 A;  4GRI A;  4DR5 M;  3SBJ A;  2K47 A;  3A42 A;  1XXH A;  5ITY A;  1L2D A;  4IBC A;  3TE6 A;  2J7N A;  1GL6 A;  3SMS A;  2R46 A;  4CHT B;  1SXJ E;  2BNK A;  4IBG A;  2LWX A;  1WXQ A;  3T1H M;  4P16 A;  4X65 M;  3J7B A;  4LF4 M;  3K92 A;  3A46 A;  4DUY M;  3KSX A;  5EXT A;  4NRV A;  1GVN A;  3AOE A;  4LJ8 A;  4LJ4 A;  4TUW A;  4II7 A;  1Q3B A;  3I4Y A;  4NXN M;  3U6D A;  1XHB A;  1NNJ A;  3U5Z B;  1QAN A;  1XWI A;  2Z7J A;  2CV2 A;  3HHY A;  2XF3 A;  3SFZ A;  3NWL A;  2F5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...