5IWAM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5iwaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5iwaM02
3GPPA 2F5QA 1TDZA 1Z5BA 4DR6M 4PDGA 4B3MM 1I94M 4GKKM 3GP1A 3U6SA 2F5PA 2EA0A 1K3XA 3GQ4A 3JR5A 4DV7M 3SAWA 2F5OA 5A2QS 5LMUM 4NRVA 4MB7A 3A45A 2E5LM 3U6LA 2VQFM 3VK8A 1XC8A 1J5EM 1L1TA 3JAMS 4JI4M 4NRWA 1EE8A 5ITQA 3T1HM 3J81S 3W0FA 4KHPM 1MU5A 4GKJM 4K0KM 1N34M 4JI0M 1IBKM 1IBMM 4OX9M 1R2ZA 4G4OA 2F5NA 4JI2M 5FLXS 4YY3M 3GO8A 3U6PA 2UUBM 2UUAM 4X65M 1KFVA 1TDHA 2ZM6M 2HKJA 4X64M 4DV2M 4LFAM 4PDIA 3SATA 1HNXM 4JYAM 2UXCM 4LF5M 5LMNM 4X66M 2XZFA 1Z59A 1XMOM 4LF7M 4LF9M 4DR7M 1PJIA 3GPYA 4JI8M 1N32M 3TWMA 4PCZA 3GQ5A 5IWAM 4LF8M 2XZUA 1PJJA 4JI1M 1K3WA 3GQ3A 1Q3CA 4JI5M 4LF4M 1Z5CA 4DV6M 3OTOM 2HHHM 2UUCM 1R2YA 4YHHM 2VQEM 2OQ4A 1N33M 5BR8M 1FJGM 4G4RA 2OPFA 4LF6M 4LFBM 3U6QA 3DOAA 5ITUA 4CISA 3SASA 3U6OA 3T1YM 3JR4A 2ZBKB 3A42A 4DV1M 5ITRA 4X62M 3SARA 4B3SM 5IT9S 3SAVA 4JV5M 1L2BA 1Q3BA 2UU9M 4DV5M 1Q39A 4NXNM 4G4QA 4PD2A 2UXBM 1PM5A 3U6EA 4JI6M 1IBLM 2Q2EB 4DR3M 3GPXA 4DR2M 3SAUA 5ITXA 1XNRM 3GPUA 4DUYM 3J80S 3A46A 3TWLA 4DUZM 4G4NA 3TWKA 4DR5M 4DV3M 4B3TM 5ITTA 3J7AS 4DR4M 1L1ZA 2UXDM 4DV0M 1K82A 3C58A 1MX0A 1XNQM 4B3RM 1HNWM 3U6DA 1HR0M 4JI3M 1XMQM 1Z5AA 4DR1M 5ITXE 1L2DA 1HNZM 4JI7M 4ITQA 3U6CA 3SBJA 4AQYM 3U6MA 1NNJA 2F4VM 1N36M 1L2CA 4LFCM 4DV4M 3VK7A 5ITYA 4NXMM 2F5SA
chains in the Genus database with same CATH superfamily
1W5SA 3C3EA 3FRHA 2XSZA 2OOAA 3GRYA 3NWLA 4KODA 4PDGA 1QUSA 4W5WA 3GP1A 1MJGM 5EP3A 4R71A 2D7HA 4DV7M 2ZTCA 5EP4A 3SAWA 3KS8A 4OW0A 1G3IA 1HQCA 2CEAA 3ZC7B 2XFTA 3K8ZA 5EXXA 3E4RA 4MB7A 1T6OA 2E5LM 1IQPA 3U6LA 5DNYA 1AUAA 2QBYB 1SXJA 2CE7A 2C96A 5DYIA 1E94E 1VG5A 4AZFA 4NRWA 1TR8A 5H37D 1DO2A 4IBCA 4B7FA 3W0FA 4KHPM 1MU5A 3GLFE 3U60B 1N34M 4JI0M 4BBAA 1HT1E 2BWEA 2LHGA 3L28A 2KZSA 1IN7A 3LCUA 2XGNA 3B89A 1X37A 4JI2M 3WHKA 1R7RA 5FLXS 4LZJA 2J7NA 4II7A 1YE9A 2LTUA 2HKJA 4PDIA 4JYAM 1HNXM 5DYGA 2UXCM 3HX3A 1BVSA 2R65A 4P17A 4X66M 3IHPA 1PJIA 1VDDA 3FTDA 2O25A 1GJTA 4D81A 4JI8M 4M0WA 4B7HA 3TWMA 4QHSA 1J09A 1R4GA 3TE6A 7CATA 5IWAM 2BJWA 4QNMA 2YFQA 3GLHB 1QYRA 4JI1M 1K3WA 3KSXA 2LNHC 3MHVC 3DFZA 2Z8YM 3E21A 3OTOM 4AI6A 4XBOA 4MM3B 2OOBA 1ZMWA 4Z8XA 4LCBA 1OIPA 2GNOA 3ZH9B 4GC5A 3GLGB 3QYEA 2HAKA 2LVQD 3FUTA 3SYKA 2OPFA 4LF6M 3CTWB 4LFBM 2DKLA 3CF6E 4AW4A 3U6QA 3IG5A 4AKHA 3U5ZB 3T1YM 5GKNA 2K9DA 2ZBKB 2ZTDA 3UK6A 5ITRA 4B3SM 2A5YB 4CJ6A 2R44A 1QAOA 2HCBA 4R3DA 8CATA 5F3WA 1Q3BA 5FTNA 3CGWA 2HL7A 1FNNA 4PD2A 4GH9A 4JI6M 2QQ8A 1PGYA 3FTEA 4DR2M 3FD9A 2XEPA 1TH2A 2MROB 3GLHE 2AHMA 3L26A 1C7YA 3GPUA 2JUJA 4L16A 3J80S 1SG9A 2QP9X 3TWLA 5KPZA 2Y20A 2FOIC 3I04M 5ITTA 2BWBA 2KNVA 4KLNA 3GLFA 1XXHB 4LGYA 4NC6A 3TQSA 1V92A 3AOEC 1K82A 2MJ5B 3GLGE 3UJNA 3HJSA 1HT2E 3W0LB 1OIZA 3TPZA 2L6OA 3FTCA 1HR0M 1Z5AA 4NSOB 4S12A 1YUBA 4F1IA 1RU3A 2C9OA 4I8OA 3M7GA 3U6CA 1E32A 3TL4X 4NOOB 3SBJA 2XF3A 3U6MA 1NNJA 2QPAA 2DAIA 1QAMA 1A5TA 3BOSA 1N36M 5E6JA 3VK7A 1G59A 1L8QA 1XB2B 1V34A 5ITYA 1VQ1A 1OFIA 5EXPA 2FS1A 2F5SA 3GPPA 1WGLA 3KOXE 3W67A 4RNAA 2QBYA 1I94M 3HJQA 5EP1A 2K47A 1NVMA 2WSCF 5FTKA 4A3VB 3U6SA 2RRUA 1IY0A 2QHOB 3JR5A 4AG6A 4M9SA 3B9PA 1QQWA 1IXRC 1XXHE 1IM2A 4NRVA 3RGSA 3SMPA 2QZ4A 3A45A 2VQFM 1J7KA 2JA2A 1H6UA 1XC8A 1MN3A 4JXJA 3EIEA 1OAIA 4L4UA 4AKIA 3UMMA 1L1TA 2J7OA 4RKUF 4JI4M 1Q02A 1NV8A 4ZPXA 3J81S 1QZEA 3KOYE 3VDPA 3MJ5A 3THGA 4K0KM 3J7BA 4I4LA 5EP2A 2Y0TA 1IBMM 2X4AA 3J2PB 4D82A 4OX9M 4WURA 2F5NA 3GLIE 1G71A 2L2DA 3U6PA 2UUAM 3FRIA 4GMQA 5IZ7D 1IN5A 4EIWA 3RGPA 3U61B 1KFVA 3L2AA 1I4WA 1WJ7A 1TDHA 3LQRA 3PFIA 5KPRA 2ZM6M 4LJ6A 3R9XB 3SATA 3K2LA 1NJGA 4LF5M 3NBIA 4LF7M 4G6ZA 1VEJA 4AKGA 2LH0A 3LVVA 3GPYA 1PJTA 2JP7A 5EJCA 1EFUB 2BNKA 1NNUC 3GQ5A 3VKGA 5C18A 3GLGA 2JZ0A 2XZUA 1T3TA 3CF2A 4JI5M 3AOEA 4M9ZA 4CGYB 2D7GA 2Z3XA 2W82A 4IBKA 2L09A 4DBGB 4DV6M 4GHLA 2RGOA 3LW5F 1R2YA 3W68A 3AKZA 2KA6B 4OU7A 2OQ4A 3KDSE 2V1CA 5FTMA 1N33M 2P5TA 3AV0A 4G4RA 4FWDA 3UZUA 2XH9A 3I4YA 2CHVA 3ILKA 1QDRA 4CISA 3SASA 4GITA 3U6OA 3AL0C 1P3QQ 4X62M 3I4VA 1D0MA 1S3SA 3FUVA 3SAVA 3T38A 1L2BA 1IXSB 3F92A 3HU2A 1DGHA 2R18A 4DV5M 3E9SA 4L78A 1ZMVA 1NY5A 1GL6A 2WSFF 1GL7A 2UXBM 1NV9A 3FUUA 3U6EA 2X49A 1QAQA 3SMSA 2D7EA 2DZNB 1WHCA 3L29A 4FWGA 3UGJA 3GPXA 3SAUA 1QUTA 2BJVA 1VEGA 2DHYA 5ITXA 2KDLA 1PJQA 3HHZA 1E9SA 3A46A 4UN2B 1CUKA 2MH8A 3VLFB 3J7AS 3NBXX 1ZMUA 2Z4RA 2LWXA 1L1ZA 3K9OA 4MGHA 3VDUA 4HL4A 4DV0M 2O01F 2KEBA 2R4EA 4B7GA 3J27B 1G8PA 2HWJA 5EXTA 5KPTA 3D8LA 3KOWE 3U6DA 3QYBA 5JI2E 1JR3E 1XMQM 2R45A 3CF0A 3BXWA 3E46A 2Y0QA 1HNZM 1KYIA 4IBGA 2FFJA 2CWBA 3I51A 4ITQA 3M6AA 1QDTA 3LQQA 1XWIA 4NXMM 1HQYE 2LVAA 3T6PA 2K0BX 1N77A 1SXJB 2DWMA 2DWNA 2G8LA 3Q8XA 5KQDA 1Z5BA 1TDZA 2DAKA 3KFUG 2JY5A 1WGNA 4LRTA 2EA0A 3GQ4A 2YR0A 1PRBA 2QENA 3KVWA 2KXEA 5A2QS 5LMUM 4IJFA 1D0KA 1OKSA 4NL4H 4KO8A 3VK8A 4GIPA 4WW0A 1DO0A 2DENA 1V33A 2DAMA 2ZAMA 3H4MA 4XK8F 2EKKA 2XFSA 1N78A 1AIPC 2I7PA 1EE8A 5ITQA 3T1HM 2Y21A 5FTJA 1DV0A 1IXZA 3ZQJA 4GKJM 4KT0F 2JZ1A 1IBKM 4QHTA 2LVPC 2CFOA 3GLIB 3K92A 1GO5A 3QAUA 2O5RA 1R2ZA 4QOZC 1YLAA 1XHBA 5L8RF 4YY3M 3GO8A 3HZJA 3HWSA 2B3TA 1SXJE 3GRUA 3HGIA 4IBBA 1C1KA 2MR9A 2DVWB 1UM8A 2QSFX 4DV2M 4LFAM 4TUWA 2G3QA 4HEOA 4IIWA 2KZUA 1NHWC 1DGBA 1NSFA 3U60A 3MMPA 1Z59A 3B7NA 2XZFA 3HU3A 4HLQA 4LGMA 4D80A 4M9XA 4GHAA 1TF0B 3SYLA 3KW6A 4CIZA 4PCZA 1OTRA 3V76A 3H4JA 1E9RA 4LF8M 3AJIB 4GC9A 4FW9A 2JY8A 2R4JA 2DHRA 1Q3CA 2Z4SA 4REZA 4Q7JA 2CRUA 3B7QA 2R0IA 3PNVA 2UUCM 3HHWA 2R46A 3HHYA 3QWLA 2X8AA 3AFHA 2YNMD 4PT5A 4L8RC 4BB9A 3DOAA 5ITUA 3R8FA 3GLHA 2JY6B 3KOZE 4IBEA 2H5XA 2M5ZA 3A42A 2FH0A 3C3DA 2CHGA 4FCVA 3K9PA 4ANRA 2R62A 4JV5M 1DGGA 2KNZA 4FD2A 3HKPA 4BLCA 2UU9M 3SFZA 3C9PA 2L4EA 1NHGC 1Q39A 4LJAA 2VDBB 3KP0E 1GVNA 1JB0F 1NY6A 3KP1E 3FYCA 4FCWA 1HJPA 5IREB 1N75A 2VF8A 3U5ZA 5FSWA 4QNRA 2DAEA 3HHXA 4FWHA 3IG8A 3Q8GA 4G4NA 4DR5M 1PJSA 1UFZA 2V1UA 3HJ8A 3FKEA 3FUXA 3I01M 4IBJA 3C58A 1GABA 4B3RM 2ZANA 2V6ZM 4L6V6 1GLNA 1HNWM 1D0LA 2NQ8C 4JI3M 4DR1M 2M60A 4LRSA 1GKIA 4JN6A 1IN8A 2N35A 3T15A 1EIJA 3VFDA 5KQ8A 1XXHA 3PVSA 2F4VM 1Y8GA 2KRKA 4Y28F 4DV4M 2DXIA 4AG5A 3HU1A 2VIIA 1QZMA 4Z6YA 1OQYA 4WP2A 2DZLA 2F5QA 4DR6M 3MK6A 5DFLA 4B3MM 4GKKM 3L27A 4G3OA 4OVZB 4CHTB 4LJ4A 2F5PA 3IECA 3SHFA 1K3XA 3KXEC 3AOGA 2DWLA 3LCVB 2F5OA 2CP8A 4IJEA 3EIHA 3DZDA 1JQJC 4RF0A 2EUCA 2CV0A 1ZAEA 2LBCA 2EJSA 4LZZA 3GLIA 1J5EM 1GJSA 2G5GX 3JAMS 2DNAA 1OAOC 2CV2A 1G41A 5JI3E 4F2LA 2FE8A 2JWSA 3M0EA 4MH0E 4P16A 1G4AE 1OJLA 2L4FA 2LVNC 1DGFA 4IBIA 2YQZA 5C1BA 1TH4A 2C9CA 4G4OA 1IFYA 3ZCBB 2UUBM 3SHGB 1KSFX 4X65M 1JR3D 1IY1A 2FNAA 1QVRA 2KW0A 4X64M 2GQFA 1NJFA 2J5YA 4LJ9A 5LMNM 1XMOM 4L15A 4MGZE 4M0DA 4LF9M 4DR7M 2LVOC 2JY7A 3L25A 4MGYE 1N32M 1F4IA 5KO3A 2I7NA 2R6FA 1ZQ9A 3RFWA 3KS4A 1D2NA 3U61A 1PJJA 4LJ7A 2RKOA 3PNYA 1YSYA 3GQ3A 4LF4M 2LXEA 3D8BA 4QOSA 1Z5CA 3SC3A 2HHHM 2DAGA 4YHHM 1SXJC 1DGHB 2VQEM 4GEWA 1ORYB 5BR8M 2KHHA 1LTMA 2EO2A 1FJGM 1Z6TA 1VEKA 3K1JA 2KRUA 2WZJA 2XSZD 2Z7JA 4B08A 1R5LA 5EQTA 1IY2A 2QCUA 4I81A 4IBDA 3JR4A 2WSEF 1IN4A 3BBZA 3DA1A 2OO9A 2C98A 4FVMA 4DV1M 3SARA 3VKHA 5IT9S 4LJ5A 4LG2A 2L7HA 1TTEA 4RF1A 3WHLA 4G4QA 4NXNM 2CV1A 3RE8A 2DZOB 3LMMA 5E26A 2CHQA 1SXJD 3A98B 1PM5A 1IBLM 2Q2EB 4DR3M 3PXGA 4XGIA 4MGKE 3GRRA 1JR3A 3KSJA 2VF7A 3LVWA 4IBFA 4NSRA 1TGUA 3GRVA 1T43A 2QNJA 4GRIA 4DUYM 1XNRM 5EXSA 1TH3A 2JXNA 4DUZM 3FTFA 3TWKA 4B3TM 4DV3M 2LHCA 1WIVA 4DR4M 1WXQA 5FTLA 4MGIE 1IXSA 1ZV1A 2APLA 2UXDM 2H1RA 5BPVA 4LY6A 4R7GA 2EKFA 2K6BA 4FCTA 1MX0A 2JNHA 1XNQM 3B7ZA 2RGHA 3HY5A 1WR1B 1QANA 5ITXE 1L2DA 1OFHA 2MGWA 3FE3A 3FUWA 4OVZA 3FYDA 2L7IA 3GLFB 4JI7M 2KNAA 1R6BX 2C99A 4I5SA 4AQYM 1IN6A 2DI0A 2ERCA 2C5RA 2XLJA 1LV7A 2DWZB 1L2CA 2CUZA 4LFCM 3B74A 2ZAOA 1VDLA 1W5TA 4LJ8A 1NO1A
chains in the Genus database with same CATH topology
1W5SA 4KODA 3GRYA 2XSZA 3NWLA 4PDGA 3GP1A 4W5WA 5EP3A 2D7HA 4DV7M 5EP4A 3SAWA 3KS8A 4OW0A 1G3IA 1HQCA 2CEAA 3ZC7B 2XFTA 3K8ZA 5EXXA 3E4RA 4MB7A 2E5LM 1IQPA 3U6LA 5DNYA 2QBYB 1SXJA 2CE7A 2C96A 5DYIA 1E94E 4AZFA 4NRWA 5H37D 1DO2A 4IBCA 4B7FA 3W0FA 4KHPM 1MU5A 3U60B 1N34M 4JI0M 4BBAA 1HT1E 3L28A 2KZSA 1IN7A 2XGNA 1X37A 4JI2M 3WHKA 1R7RA 5FLXS 4LZJA 2J7NA 4II7A 1YE9A 2HKJA 4PDIA 4JYAM 1HNXM 5DYGA 2UXCM 2R65A 4X66M 1PJIA 1VDDA 3FTDA 4D81A 4JI8M 4M0WA 4B7HA 3TWMA 4QHSA 1J09A 3TE6A 5IWAM 7CATA 2BJWA 4QNMA 2YFQA 3GLHB 1QYRA 4JI1M 1K3WA 3KSXA 2LNHC 3MHVC 3DFZA 3OTOM 4AI6A 4XBOA 4MM3B 4Z8XA 4LCBA 3ZH9B 4GC5A 3GLGB 3SYKA 3FUTA 2OPFA 4LF6M 3CTWB 4LFBM 3CF6E 3U6QA 4AW4A 3IG5A 4AKHA 3U5ZB 3T1YM 5GKNA 2ZBKB 3UK6A 5ITRA 4B3SM 2A5YB 8CATA 1QAOA 2HCBA 4R3DA 5F3WA 1Q3BA 5FTNA 2HL7A 1FNNA 4PD2A 4GH9A 4JI6M 3FTEA 4DR2M 3FD9A 2XEPA 1TH2A 2AHMA 3L26A 3GPUA 4L16A 3J80S 2QP9X 3TWLA 5KPZA 2Y20A 2FOIC 5ITTA 4KLNA 3GLFA 1XXHB 4LGYA 3TQSA 3AOEC 1K82A 3UJNA 3HJSA 1HT2E 3W0LB 3TPZA 2L6OA 3FTCA 1HR0M 1Z5AA 4NSOB 4S12A 1YUBA 2C9OA 4I8OA 3M7GA 3U6CA 1E32A 3TL4X 4NOOB 3SBJA 2XF3A 3U6MA 1NNJA 2QPAA 1QAMA 3BOSA 1N36M 5E6JA 3VK7A 1G59A 1L8QA 5ITYA 1OFIA 5EXPA 2F5SA 3GPPA 3KOXE 4RNAA 2QBYA 1I94M 3HJQA 5EP1A 2K47A 1NVMA 5FTKA 4A3VB 3U6SA 1IY0A 3JR5A 4AG6A 4M9SA 3B9PA 1QQWA 1IXRC 1IM2A 4NRVA 3RGSA 3SMPA 2QZ4A 3A45A 2VQFM 1J7KA 2JA2A 1H6UA 1XC8A 4JXJA 4L4UA 3EIEA 4AKIA 3UMMA 1L1TA 2J7OA 4JI4M 4ZPXA 3J81S 3KOYE 3VDPA 3MJ5A 3THGA 4K0KM 3J7BA 4I4LA 5EP2A 2Y0TA 1IBMM 2X4AA 3J2PB 4D82A 4OX9M 4WURA 2F5NA 3U6PA 2UUAM 4GMQA 5IZ7D 1IN5A 4EIWA 3RGPA 3U61B 1KFVA 3L2AA 1I4WA 1TDHA 3LQRA 3PFIA 5KPRA 2ZM6M 4LJ6A 3R9XB 3SATA 3K2LA 1NJGA 4LF5M 3NBIA 4LF7M 4G6ZA 4AKGA 2LH0A 3LVVA 3GPYA 5EJCA 2BNKA 1NNUC 3GQ5A 3VKGA 5C18A 3GLGA 2XZUA 1T3TA 3CF2A 4JI5M 3AOEA 4M9ZA 4CGYB 2D7GA 2Z3XA 2W82A 4IBKA 2L09A 4DV6M 4GHLA 2RGOA 1R2YA 3AKZA 2KA6B 4OU7A 2OQ4A 3KDSE 2V1CA 5FTMA 1N33M 2P5TA 3AV0A 4G4RA 4FWDA 3UZUA 2XH9A 3I4YA 2CHVA 3ILKA 4CISA 3SASA 4GITA 3U6OA 3AL0C 4X62M 3I4VA 1S3SA 3FUVA 3SAVA 3T38A 1L2BA 1IXSB 3HU2A 1DGHA 2R18A 4DV5M 3E9SA 4L78A 1NY5A 1GL6A 1GL7A 2UXBM 3FUUA 3U6EA 2X49A 1QAQA 3SMSA 2D7EA 2DZNB 3L29A 3UGJA 4FWGA 3GPXA 3SAUA 2BJVA 5ITXA 3HHZA 1E9SA 3A46A 3VLFB 3J7AS 2Z4RA 2LWXA 1L1ZA 4MGHA 3VDUA 4HL4A 4DV0M 2KEBA 2R4EA 4B7GA 3J27B 1G8PA 5EXTA 5KPTA 3D8LA 3KOWE 3U6DA 5JI2E 1XMQM 2R45A 3CF0A 2Y0QA 1HNZM 1KYIA 4IBGA 2FFJA 3I51A 4ITQA 3M6AA 3LQQA 1XWIA 1HQYE 1N77A 1SXJB 2DWMA 2DWNA 2G8LA 3Q8XA 5KQDA 1Z5BA 1TDZA 3KFUG 2EA0A 4LRTA 3GQ4A 2YR0A 2QENA 3KVWA 2KXEA 5A2QS 5LMUM 4IJFA 4NL4H 4KO8A 3VK8A 4GIPA 4WW0A 1DO0A 2ZAMA 3H4MA 2XFSA 1N78A 2I7PA 1EE8A 5ITQA 3T1HM 2Y21A 5FTJA 1IXZA 4GKJM 1IBKM 4QHTA 2CFOA 3GLIB 3K92A 3QAUA 2O5RA 1R2ZA 4QOZC 1XHBA 4YY3M 3GO8A 3HWSA 1SXJE 3GRUA 3HGIA 4IBBA 1C1KA 2DVWB 1UM8A 4DV2M 4LFAM 4TUWA 4IIWA 2KZUA 1NHWC 1DGBA 1NSFA 3U60A 2XZFA 1Z59A 3HU3A 4HLQA 4LGMA 4D80A 4M9XA 4GHAA 3SYLA 3KW6A 4PCZA 1E9RA 4LF8M 3AJIB 4GC9A 4FW9A 2R4JA 2Z4SA 2DHRA 1Q3CA 4REZA 3PNVA 2UUCM 3HHWA 2R46A 3HHYA 3QWLA 2X8AA 3AFHA 2YNMD 4PT5A 4L8RC 4BB9A 3DOAA 5ITUA 3R8FA 3GLHA 3KOZE 4IBEA 3A42A 2M5ZA 2CHGA 4FCVA 2R62A 4JV5M 1DGGA 4FD2A 3HKPA 4BLCA 2UU9M 3SFZA 1NHGC 1Q39A 4LJAA 3KP0E 1GVNA 1NY6A 3KP1E 3FYCA 4FCWA 5IREB 1N75A 3U5ZA 5FSWA 4QNRA 3HHXA 4FWHA 3IG8A 4G4NA 4DR5M 2V1UA 3HJ8A 3FKEA 3FUXA 3C58A 4IBJA 4B3RM 2ZANA 2V6ZM 1HNWM 1GLNA 2NQ8C 4JI3M 4DR1M 2M60A 4LRSA 1GKIA 4JN6A 1IN8A 3T15A 3VFDA 5KQ8A 1XXHA 3PVSA 2F4VM 2KRKA 4DV4M 2DXIA 4AG5A 3HU1A 2VIIA 1QZMA 4Z6YA 2F5QA 4DR6M 3MK6A 4B3MM 4GKKM 3L27A 4OVZB 4CHTB 4LJ4A 2F5PA 3SHFA 1K3XA 2DWLA 3KXEC 3AOGA 2F5OA 4IJEA 3EIHA 3DZDA 1JQJC 4RF0A 2EUCA 2CV0A 1ZAEA 4LZZA 3GLIA 1J5EM 2G5GX 3JAMS 2CV2A 1G41A 5JI3E 2FE8A 3M0EA 4MH0E 4P16A 1OJLA 1G4AE 1DGFA 4IBIA 2YQZA 5C1BA 1TH4A 2C9CA 4G4OA 3ZCBB 2UUBM 3SHGB 1KSFX 4X65M 1JR3D 1IY1A 2FNAA 1QVRA 2KW0A 4X64M 1NJFA 4LJ9A 5LMNM 1XMOM 4L15A 4MGZE 4M0DA 4LF9M 4DR7M 3L25A 4MGYE 1N32M 5KO3A 2I7NA 1ZQ9A 3RFWA 3KS4A 1D2NA 3U61A 1PJJA 4LJ7A 2RKOA 3PNYA 1YSYA 3GQ3A 4LF4M 2LXEA 3D8BA 4QOSA 1Z5CA 3SC3A 2HHHM 4YHHM 1SXJC 1DGHB 2VQEM 1ORYB 5BR8M 2EO2A 1FJGM 1Z6TA 4B08A 3K1JA 2KRUA 2XSZD 2Z7JA 5EQTA 1IY2A 2QCUA 4I81A 4IBDA 3JR4A 4DV1M 1IN4A 3DA1A 4FVMA 3SARA 2C98A 3VKHA 5IT9S 4LJ5A 4LG2A 2L7HA 4RF1A 3WHLA 4G4QA 4NXNM 2CV1A 3RE8A 2DZOB 3LMMA 5E26A 2CHQA 1SXJD 3A98B 1PM5A 1IBLM 2Q2EB 4DR3M 3PXGA 4XGIA 4MGKE 3GRRA 1JR3A 3KSJA 3LVWA 4IBFA 4NSRA 1TGUA 3GRVA 1XNRM 4GRIA 4DUYM 3FTFA 5EXSA 1TH3A 4DUZM 3TWKA 4B3TM 4DV3M 4DR4M 1WXQA 5FTLA 4MGIE 2UXDM 2H1RA 5BPVA 4LY6A 4R7GA 4FCTA 1MX0A 1XNQM 2RGHA 1QANA 5ITXE 1L2DA 1OFHA 3FUWA 3GLFB 4JI7M 4OVZA 3FYDA 2L7IA 1R6BX 2C99A 4I5SA 4AQYM 1IN6A 2ERCA 2C5RA 2XLJA 1LV7A 2DWZB 1L2CA 2CUZA 4LFCM 2ZAOA 4NXMM 1W5TA 4LJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPP A;  2F5Q A;  1TDZ A;  1Z5B A;  4DR6 M;  4PDG A;  4B3M M;  1I94 M;  4GKK M;  3GP1 A;  3U6S A;  2F5P A;  2EA0 A;  1K3X A;  3GQ4 A;  3JR5 A;  4DV7 M;  3SAW A;  2F5O A;  5A2Q S;  5LMU M;  4NRV A;  4MB7 A;  3A45 A;  2E5L M;  3U6L A;  2VQF M;  3VK8 A;  1XC8 A;  1J5E M;  1L1T A;  3JAM S;  4JI4 M;  4NRW A;  1EE8 A;  5ITQ A;  3T1H M;  3J81 S;  3W0F A;  4KHP M;  1MU5 A;  4GKJ M;  4K0K M;  1N34 M;  4JI0 M;  1IBK M;  1IBM M;  4OX9 M;  1R2Z A;  4G4O A;  2F5N A;  4JI2 M;  5FLX S;  4YY3 M;  3GO8 A;  3U6P A;  2UUB M;  2UUA M;  4X65 M;  1KFV A;  1TDH A;  2ZM6 M;  2HKJ A;  4X64 M;  4DV2 M;  4LFA M;  4PDI A;  3SAT A;  1HNX M;  4JYA M;  2UXC M;  4LF5 M;  5LMN M;  4X66 M;  2XZF A;  1Z59 A;  1XMO M;  4LF7 M;  4LF9 M;  4DR7 M;  1PJI A;  3GPY A;  4JI8 M;  1N32 M;  3TWM A;  4PCZ A;  3GQ5 A;  5IWA M;  4LF8 M;  2XZU A;  1PJJ A;  4JI1 M;  1K3W A;  3GQ3 A;  1Q3C A;  4JI5 M;  4LF4 M;  1Z5C A;  4DV6 M;  3OTO M;  2HHH M;  2UUC M;  1R2Y A;  4YHH M;  2VQE M;  2OQ4 A;  1N33 M;  5BR8 M;  1FJG M;  4G4R A;  2OPF A;  4LF6 M;  4LFB M;  3U6Q A;  3DOA A;  5ITU A;  4CIS A;  3SAS A;  3U6O A;  3T1Y M;  3JR4 A;  2ZBK B;  3A42 A;  4DV1 M;  5ITR A;  4X62 M;  3SAR A;  4B3S M;  5IT9 S;  3SAV A;  4JV5 M;  1L2B A;  1Q3B A;  2UU9 M;  4DV5 M;  1Q39 A;  4NXN M;  4G4Q A;  4PD2 A;  2UXB M;  1PM5 A;  3U6E A;  4JI6 M;  1IBL M;  2Q2E B;  4DR3 M;  3GPX A;  4DR2 M;  3SAU A;  5ITX A;  1XNR M;  3GPU A;  4DUY M;  3J80 S;  3A46 A;  3TWL A;  4DUZ M;  4G4N A;  3TWK A;  4DR5 M;  4DV3 M;  4B3T M;  5ITT A;  3J7A S;  4DR4 M;  1L1Z A;  2UXD M;  4DV0 M;  1K82 A;  3C58 A;  1MX0 A;  1XNQ M;  4B3R M;  1HNW M;  3U6D A;  1HR0 M;  4JI3 M;  1XMQ M;  1Z5A A;  4DR1 M;  5ITX E;  1L2D A;  1HNZ M;  4JI7 M;  4ITQ A;  3U6C A;  3SBJ A;  4AQY M;  3U6M A;  1NNJ A;  2F4V M;  1N36 M;  1L2C A;  4LFC M;  4DV4 M;  3VK7 A;  5ITY A;  4NXM M;  2F5S A; 
#chains in the Genus database with same CATH topology
 1W5S A;  3C3E A;  3FRH A;  2XSZ A;  2OOA A;  3GRY A;  3NWL A;  4KOD A;  4PDG A;  1QUS A;  4W5W A;  3GP1 A;  1MJG M;  5EP3 A;  4R71 A;  2D7H A;  4DV7 M;  2ZTC A;  5EP4 A;  3SAW A;  3KS8 A;  4OW0 A;  1G3I A;  1HQC A;  2CEA A;  3ZC7 B;  2XFT A;  3K8Z A;  5EXX A;  3E4R A;  4MB7 A;  1T6O A;  2E5L M;  1IQP A;  3U6L A;  5DNY A;  1AUA A;  2QBY B;  1SXJ A;  2CE7 A;  2C96 A;  5DYI A;  1E94 E;  1VG5 A;  4AZF A;  4NRW A;  1TR8 A;  5H37 D;  1DO2 A;  4IBC A;  4B7F A;  3W0F A;  4KHP M;  1MU5 A;  3GLF E;  3U60 B;  1N34 M;  4JI0 M;  4BBA A;  1HT1 E;  2BWE A;  2LHG A;  3L28 A;  2KZS A;  1IN7 A;  3LCU A;  2XGN A;  3B89 A;  1X37 A;  4JI2 M;  3WHK A;  1R7R A;  5FLX S;  4LZJ A;  2J7N A;  4II7 A;  1YE9 A;  2LTU A;  2HKJ A;  4PDI A;  4JYA M;  1HNX M;  5DYG A;  2UXC M;  3HX3 A;  1BVS A;  2R65 A;  4P17 A;  4X66 M;  3IHP A;  1PJI A;  1VDD A;  3FTD A;  2O25 A;  1GJT A;  4D81 A;  4JI8 M;  4M0W A;  4B7H A;  3TWM A;  4QHS A;  1J09 A;  1R4G A;  3TE6 A;  7CAT A;  5IWA M;  2BJW A;  4QNM A;  2YFQ A;  3GLH B;  1QYR A;  4JI1 M;  1K3W A;  3KSX A;  2LNH C;  3MHV C;  3DFZ A;  2Z8Y M;  3E21 A;  3OTO M;  4AI6 A;  4XBO A;  4MM3 B;  2OOB A;  1ZMW A;  4Z8X A;  4LCB A;  1OIP A;  2GNO A;  3ZH9 B;  4GC5 A;  3GLG B;  3QYE A;  2HAK A;  2LVQ D;  3FUT A;  3SYK A;  2OPF A;  4LF6 M;  3CTW B;  4LFB M;  2DKL A;  3CF6 E;  4AW4 A;  3U6Q A;  3IG5 A;  4AKH A;  3U5Z B;  3T1Y M;  5GKN A;  2K9D A;  2ZBK B;  2ZTD A;  3UK6 A;  5ITR A;  4B3S M;  2A5Y B;  4CJ6 A;  2R44 A;  1QAO A;  2HCB A;  4R3D A;  8CAT A;  5F3W A;  1Q3B A;  5FTN A;  3CGW A;  2HL7 A;  1FNN A;  4PD2 A;  4GH9 A;  4JI6 M;  2QQ8 A;  1PGY A;  3FTE A;  4DR2 M;  3FD9 A;  2XEP A;  1TH2 A;  2MRO B;  3GLH E;  2AHM A;  3L26 A;  1C7Y A;  3GPU A;  2JUJ A;  4L16 A;  3J80 S;  1SG9 A;  2QP9 X;  3TWL A;  5KPZ A;  2Y20 A;  2FOI C;  3I04 M;  5ITT A;  2BWB A;  2KNV A;  4KLN A;  3GLF A;  1XXH B;  4LGY A;  4NC6 A;  3TQS A;  1V92 A;  3AOE C;  1K82 A;  2MJ5 B;  3GLG E;  3UJN A;  3HJS A;  1HT2 E;  3W0L B;  1OIZ A;  3TPZ A;  2L6O A;  3FTC A;  1HR0 M;  1Z5A A;  4NSO B;  4S12 A;  1YUB A;  4F1I A;  1RU3 A;  2C9O A;  4I8O A;  3M7G A;  3U6C A;  1E32 A;  3TL4 X;  4NOO B;  3SBJ A;  2XF3 A;  3U6M A;  1NNJ A;  2QPA A;  2DAI A;  1QAM A;  1A5T A;  3BOS A;  1N36 M;  5E6J A;  3VK7 A;  1G59 A;  1L8Q A;  1XB2 B;  1V34 A;  5ITY A;  1VQ1 A;  1OFI A;  5EXP A;  2FS1 A;  2F5S A;  3GPP A;  1WGL A;  3KOX E;  3W67 A;  4RNA A;  2QBY A;  1I94 M;  3HJQ A;  5EP1 A;  2K47 A;  1NVM A;  2WSC F;  5FTK A;  4A3V B;  3U6S A;  2RRU A;  1IY0 A;  2QHO B;  3JR5 A;  4AG6 A;  4M9S A;  3B9P A;  1QQW A;  1IXR C;  1XXH E;  1IM2 A;  4NRV A;  3RGS A;  3SMP A;  2QZ4 A;  3A45 A;  2VQF M;  1J7K A;  2JA2 A;  1H6U A;  1XC8 A;  1MN3 A;  4JXJ A;  3EIE A;  1OAI A;  4L4U A;  4AKI A;  3UMM A;  1L1T A;  2J7O A;  4RKU F;  4JI4 M;  1Q02 A;  1NV8 A;  4ZPX A;  3J81 S;  1QZE A;  3KOY E;  3VDP A;  3MJ5 A;  3THG A;  4K0K M;  3J7B A;  4I4L A;  5EP2 A;  2Y0T A;  1IBM M;  2X4A A;  3J2P B;  4D82 A;  4OX9 M;  4WUR A;  2F5N A;  3GLI E;  1G71 A;  2L2D A;  3U6P A;  2UUA M;  3FRI A;  4GMQ A;  5IZ7 D;  1IN5 A;  4EIW A;  3RGP A;  3U61 B;  1KFV A;  3L2A A;  1I4W A;  1WJ7 A;  1TDH A;  3LQR A;  3PFI A;  5KPR A;  2ZM6 M;  4LJ6 A;  3R9X B;  3SAT A;  3K2L A;  1NJG A;  4LF5 M;  3NBI A;  4LF7 M;  4G6Z A;  1VEJ A;  4AKG A;  2LH0 A;  3LVV A;  3GPY A;  1PJT A;  2JP7 A;  5EJC A;  1EFU B;  2BNK A;  1NNU C;  3GQ5 A;  3VKG A;  5C18 A;  3GLG A;  2JZ0 A;  2XZU A;  1T3T A;  3CF2 A;  4JI5 M;  3AOE A;  4M9Z A;  4CGY B;  2D7G A;  2Z3X A;  2W82 A;  4IBK A;  2L09 A;  4DBG B;  4DV6 M;  4GHL A;  2RGO A;  3LW5 F;  1R2Y A;  3W68 A;  3AKZ A;  2KA6 B;  4OU7 A;  2OQ4 A;  3KDS E;  2V1C A;  5FTM A;  1N33 M;  2P5T A;  3AV0 A;  4G4R A;  4FWD A;  3UZU A;  2XH9 A;  3I4Y A;  2CHV A;  3ILK A;  1QDR A;  4CIS A;  3SAS A;  4GIT A;  3U6O A;  3AL0 C;  1P3Q Q;  4X62 M;  3I4V A;  1D0M A;  1S3S A;  3FUV A;  3SAV A;  3T38 A;  1L2B A;  1IXS B;  3F92 A;  3HU2 A;  1DGH A;  2R18 A;  4DV5 M;  3E9S A;  4L78 A;  1ZMV A;  1NY5 A;  1GL6 A;  2WSF F;  1GL7 A;  2UXB M;  1NV9 A;  3FUU A;  3U6E A;  2X49 A;  1QAQ A;  3SMS A;  2D7E A;  2DZN B;  1WHC A;  3L29 A;  4FWG A;  3UGJ A;  3GPX A;  3SAU A;  1QUT A;  2BJV A;  1VEG A;  2DHY A;  5ITX A;  2KDL A;  1PJQ A;  3HHZ A;  1E9S A;  3A46 A;  4UN2 B;  1CUK A;  2MH8 A;  3VLF B;  3J7A S;  3NBX X;  1ZMU A;  2Z4R A;  2LWX A;  1L1Z A;  3K9O A;  4MGH A;  3VDU A;  4HL4 A;  4DV0 M;  2O01 F;  2KEB A;  2R4E A;  4B7G A;  3J27 B;  1G8P A;  2HWJ A;  5EXT A;  5KPT A;  3D8L A;  3KOW E;  3U6D A;  3QYB A;  5JI2 E;  1JR3 E;  1XMQ M;  2R45 A;  3CF0 A;  3BXW A;  3E46 A;  2Y0Q A;  1HNZ M;  1KYI A;  4IBG A;  2FFJ A;  2CWB A;  3I51 A;  4ITQ A;  3M6A A;  1QDT A;  3LQQ A;  1XWI A;  4NXM M;  1HQY E;  2LVA A;  3T6P A;  2K0B X;  1N77 A;  1SXJ B;  2DWM A;  2DWN A;  2G8L A;  3Q8X A;  5KQD A;  1Z5B A;  1TDZ A;  2DAK A;  3KFU G;  2JY5 A;  1WGN A;  4LRT A;  2EA0 A;  3GQ4 A;  2YR0 A;  1PRB A;  2QEN A;  3KVW A;  2KXE A;  5A2Q S;  5LMU M;  4IJF A;  1D0K A;  1OKS A;  4NL4 H;  4KO8 A;  3VK8 A;  4GIP A;  4WW0 A;  1DO0 A;  2DEN A;  1V33 A;  2DAM A;  2ZAM A;  3H4M A;  4XK8 F;  2EKK A;  2XFS A;  1N78 A;  1AIP C;  2I7P A;  1EE8 A;  5ITQ A;  3T1H M;  2Y21 A;  5FTJ A;  1DV0 A;  1IXZ A;  3ZQJ A;  4GKJ M;  4KT0 F;  2JZ1 A;  1IBK M;  4QHT A;  2LVP C;  2CFO A;  3GLI B;  3K92 A;  1GO5 A;  3QAU A;  2O5R A;  1R2Z A;  4QOZ C;  1YLA A;  1XHB A;  5L8R F;  4YY3 M;  3GO8 A;  3HZJ A;  3HWS A;  2B3T A;  1SXJ E;  3GRU A;  3HGI A;  4IBB A;  1C1K A;  2MR9 A;  2DVW B;  1UM8 A;  2QSF X;  4DV2 M;  4LFA M;  4TUW A;  2G3Q A;  4HEO A;  4IIW A;  2KZU A;  1NHW C;  1DGB A;  1NSF A;  3U60 A;  3MMP A;  1Z59 A;  3B7N A;  2XZF A;  3HU3 A;  4HLQ A;  4LGM A;  4D80 A;  4M9X A;  4GHA A;  1TF0 B;  3SYL A;  3KW6 A;  4CIZ A;  4PCZ A;  1OTR A;  3V76 A;  3H4J A;  1E9R A;  4LF8 M;  3AJI B;  4GC9 A;  4FW9 A;  2JY8 A;  2R4J A;  2DHR A;  1Q3C A;  2Z4S A;  4REZ A;  4Q7J A;  2CRU A;  3B7Q A;  2R0I A;  3PNV A;  2UUC M;  3HHW A;  2R46 A;  3HHY A;  3QWL A;  2X8A A;  3AFH A;  2YNM D;  4PT5 A;  4L8R C;  4BB9 A;  3DOA A;  5ITU A;  3R8F A;  3GLH A;  2JY6 B;  3KOZ E;  4IBE A;  2H5X A;  2M5Z A;  3A42 A;  2FH0 A;  3C3D A;  2CHG A;  4FCV A;  3K9P A;  4ANR A;  2R62 A;  4JV5 M;  1DGG A;  2KNZ A;  4FD2 A;  3HKP A;  4BLC A;  2UU9 M;  3SFZ A;  3C9P A;  2L4E A;  1NHG C;  1Q39 A;  4LJA A;  2VDB B;  3KP0 E;  1GVN A;  1JB0 F;  1NY6 A;  3KP1 E;  3FYC A;  4FCW A;  1HJP A;  5IRE B;  1N75 A;  2VF8 A;  3U5Z A;  5FSW A;  4QNR A;  2DAE A;  3HHX A;  4FWH A;  3IG8 A;  3Q8G A;  4G4N A;  4DR5 M;  1PJS A;  1UFZ A;  2V1U A;  3HJ8 A;  3FKE A;  3FUX A;  3I01 M;  4IBJ A;  3C58 A;  1GAB A;  4B3R M;  2ZAN A;  2V6Z M;  4L6V 6;  1GLN A;  1HNW M;  1D0L A;  2NQ8 C;  4JI3 M;  4DR1 M;  2M60 A;  4LRS A;  1GKI A;  4JN6 A;  1IN8 A;  2N35 A;  3T15 A;  1EIJ A;  3VFD A;  5KQ8 A;  1XXH A;  3PVS A;  2F4V M;  1Y8G A;  2KRK A;  4Y28 F;  4DV4 M;  2DXI A;  4AG5 A;  3HU1 A;  2VII A;  1QZM A;  4Z6Y A;  1OQY A;  4WP2 A;  2DZL A;  2F5Q A;  4DR6 M;  3MK6 A;  5DFL A;  4B3M M;  4GKK M;  3L27 A;  4G3O A;  4OVZ B;  4CHT B;  4LJ4 A;  2F5P A;  3IEC A;  3SHF A;  1K3X A;  3KXE C;  3AOG A;  2DWL A;  3LCV B;  2F5O A;  2CP8 A;  4IJE A;  3EIH A;  3DZD A;  1JQJ C;  4RF0 A;  2EUC A;  2CV0 A;  1ZAE A;  2LBC A;  2EJS A;  4LZZ A;  3GLI A;  1J5E M;  1GJS A;  2G5G X;  3JAM S;  2DNA A;  1OAO C;  2CV2 A;  1G41 A;  5JI3 E;  4F2L A;  2FE8 A;  2JWS A;  3M0E A;  4MH0 E;  4P16 A;  1G4A E;  1OJL A;  2L4F A;  2LVN C;  1DGF A;  4IBI A;  2YQZ A;  5C1B A;  1TH4 A;  2C9C A;  4G4O A;  1IFY A;  3ZCB B;  2UUB M;  3SHG B;  1KSF X;  4X65 M;  1JR3 D;  1IY1 A;  2FNA A;  1QVR A;  2KW0 A;  4X64 M;  2GQF A;  1NJF A;  2J5Y A;  4LJ9 A;  5LMN M;  1XMO M;  4L15 A;  4MGZ E;  4M0D A;  4LF9 M;  4DR7 M;  2LVO C;  2JY7 A;  3L25 A;  4MGY E;  1N32 M;  1F4I A;  5KO3 A;  2I7N A;  2R6F A;  1ZQ9 A;  3RFW A;  3KS4 A;  1D2N A;  3U61 A;  1PJJ A;  4LJ7 A;  2RKO A;  3PNY A;  1YSY A;  3GQ3 A;  4LF4 M;  2LXE A;  3D8B A;  4QOS A;  1Z5C A;  3SC3 A;  2HHH M;  2DAG A;  4YHH M;  1SXJ C;  1DGH B;  2VQE M;  4GEW A;  1ORY B;  5BR8 M;  2KHH A;  1LTM A;  2EO2 A;  1FJG M;  1Z6T A;  1VEK A;  3K1J A;  2KRU A;  2WZJ A;  2XSZ D;  2Z7J A;  4B08 A;  1R5L A;  5EQT A;  1IY2 A;  2QCU A;  4I81 A;  4IBD A;  3JR4 A;  2WSE F;  1IN4 A;  3BBZ A;  3DA1 A;  2OO9 A;  2C98 A;  4FVM A;  4DV1 M;  3SAR A;  3VKH A;  5IT9 S;  4LJ5 A;  4LG2 A;  2L7H A;  1TTE A;  4RF1 A;  3WHL A;  4G4Q A;  4NXN M;  2CV1 A;  3RE8 A;  2DZO B;  3LMM A;  5E26 A;  2CHQ A;  1SXJ D;  3A98 B;  1PM5 A;  1IBL M;  2Q2E B;  4DR3 M;  3PXG A;  4XGI A;  4MGK E;  3GRR A;  1JR3 A;  3KSJ A;  2VF7 A;  3LVW A;  4IBF A;  4NSR A;  1TGU A;  3GRV A;  1T43 A;  2QNJ A;  4GRI A;  4DUY M;  1XNR M;  5EXS A;  1TH3 A;  2JXN A;  4DUZ M;  3FTF A;  3TWK A;  4B3T M;  4DV3 M;  2LHC A;  1WIV A;  4DR4 M;  1WXQ A;  5FTL A;  4MGI E;  1IXS A;  1ZV1 A;  2APL A;  2UXD M;  2H1R A;  5BPV A;  4LY6 A;  4R7G A;  2EKF A;  2K6B A;  4FCT A;  1MX0 A;  2JNH A;  1XNQ M;  3B7Z A;  2RGH A;  3HY5 A;  1WR1 B;  1QAN A;  5ITX E;  1L2D A;  1OFH A;  2MGW A;  3FE3 A;  3FUW A;  4OVZ A;  3FYD A;  2L7I A;  3GLF B;  4JI7 M;  2KNA A;  1R6B X;  2C99 A;  4I5S A;  4AQY M;  1IN6 A;  2DI0 A;  2ERC A;  2C5R A;  2XLJ A;  1LV7 A;  2DWZ B;  1L2C A;  2CUZ A;  4LFC M;  3B74 A;  2ZAO A;  1VDL A;  1W5T A;  4LJ8 A;  1NO1 A; 
#chains in the Genus database with same CATH homology
 1W5S A;  4KOD A;  3GRY A;  2XSZ A;  3NWL A;  4PDG A;  3GP1 A;  4W5W A;  5EP3 A;  2D7H A;  4DV7 M;  5EP4 A;  3SAW A;  3KS8 A;  4OW0 A;  1G3I A;  1HQC A;  2CEA A;  3ZC7 B;  2XFT A;  3K8Z A;  5EXX A;  3E4R A;  4MB7 A;  2E5L M;  1IQP A;  3U6L A;  5DNY A;  2QBY B;  1SXJ A;  2CE7 A;  2C96 A;  5DYI A;  1E94 E;  4AZF A;  4NRW A;  5H37 D;  1DO2 A;  4IBC A;  4B7F A;  3W0F A;  4KHP M;  1MU5 A;  3U60 B;  1N34 M;  4JI0 M;  4BBA A;  1HT1 E;  3L28 A;  2KZS A;  1IN7 A;  2XGN A;  1X37 A;  4JI2 M;  3WHK A;  1R7R A;  5FLX S;  4LZJ A;  2J7N A;  4II7 A;  1YE9 A;  2HKJ A;  4PDI A;  4JYA M;  1HNX M;  5DYG A;  2UXC M;  2R65 A;  4X66 M;  1PJI A;  1VDD A;  3FTD A;  4D81 A;  4JI8 M;  4M0W A;  4B7H A;  3TWM A;  4QHS A;  1J09 A;  3TE6 A;  5IWA M;  7CAT A;  2BJW A;  4QNM A;  2YFQ A;  3GLH B;  1QYR A;  4JI1 M;  1K3W A;  3KSX A;  2LNH C;  3MHV C;  3DFZ A;  3OTO M;  4AI6 A;  4XBO A;  4MM3 B;  4Z8X A;  4LCB A;  3ZH9 B;  4GC5 A;  3GLG B;  3SYK A;  3FUT A;  2OPF A;  4LF6 M;  3CTW B;  4LFB M;  3CF6 E;  3U6Q A;  4AW4 A;  3IG5 A;  4AKH A;  3U5Z B;  3T1Y M;  5GKN A;  2ZBK B;  3UK6 A;  5ITR A;  4B3S M;  2A5Y B;  8CAT A;  1QAO A;  2HCB A;  4R3D A;  5F3W A;  1Q3B A;  5FTN A;  2HL7 A;  1FNN A;  4PD2 A;  4GH9 A;  4JI6 M;  3FTE A;  4DR2 M;  3FD9 A;  2XEP A;  1TH2 A;  2AHM A;  3L26 A;  3GPU A;  4L16 A;  3J80 S;  2QP9 X;  3TWL A;  5KPZ A;  2Y20 A;  2FOI C;  5ITT A;  4KLN A;  3GLF A;  1XXH B;  4LGY A;  3TQS A;  3AOE C;  1K82 A;  3UJN A;  3HJS A;  1HT2 E;  3W0L B;  3TPZ A;  2L6O A;  3FTC A;  1HR0 M;  1Z5A A;  4NSO B;  4S12 A;  1YUB A;  2C9O A;  4I8O A;  3M7G A;  3U6C A;  1E32 A;  3TL4 X;  4NOO B;  3SBJ A;  2XF3 A;  3U6M A;  1NNJ A;  2QPA A;  1QAM A;  3BOS A;  1N36 M;  5E6J A;  3VK7 A;  1G59 A;  1L8Q A;  5ITY A;  1OFI A;  5EXP A;  2F5S A;  3GPP A;  3KOX E;  4RNA A;  2QBY A;  1I94 M;  3HJQ A;  5EP1 A;  2K47 A;  1NVM A;  5FTK A;  4A3V B;  3U6S A;  1IY0 A;  3JR5 A;  4AG6 A;  4M9S A;  3B9P A;  1QQW A;  1IXR C;  1IM2 A;  4NRV A;  3RGS A;  3SMP A;  2QZ4 A;  3A45 A;  2VQF M;  1J7K A;  2JA2 A;  1H6U A;  1XC8 A;  4JXJ A;  4L4U A;  3EIE A;  4AKI A;  3UMM A;  1L1T A;  2J7O A;  4JI4 M;  4ZPX A;  3J81 S;  3KOY E;  3VDP A;  3MJ5 A;  3THG A;  4K0K M;  3J7B A;  4I4L A;  5EP2 A;  2Y0T A;  1IBM M;  2X4A A;  3J2P B;  4D82 A;  4OX9 M;  4WUR A;  2F5N A;  3U6P A;  2UUA M;  4GMQ A;  5IZ7 D;  1IN5 A;  4EIW A;  3RGP A;  3U61 B;  1KFV A;  3L2A A;  1I4W A;  1TDH A;  3LQR A;  3PFI A;  5KPR A;  2ZM6 M;  4LJ6 A;  3R9X B;  3SAT A;  3K2L A;  1NJG A;  4LF5 M;  3NBI A;  4LF7 M;  4G6Z A;  4AKG A;  2LH0 A;  3LVV A;  3GPY A;  5EJC A;  2BNK A;  1NNU C;  3GQ5 A;  3VKG A;  5C18 A;  3GLG A;  2XZU A;  1T3T A;  3CF2 A;  4JI5 M;  3AOE A;  4M9Z A;  4CGY B;  2D7G A;  2Z3X A;  2W82 A;  4IBK A;  2L09 A;  4DV6 M;  4GHL A;  2RGO A;  1R2Y A;  3AKZ A;  2KA6 B;  4OU7 A;  2OQ4 A;  3KDS E;  2V1C A;  5FTM A;  1N33 M;  2P5T A;  3AV0 A;  4G4R A;  4FWD A;  3UZU A;  2XH9 A;  3I4Y A;  2CHV A;  3ILK A;  4CIS A;  3SAS A;  4GIT A;  3U6O A;  3AL0 C;  4X62 M;  3I4V A;  1S3S A;  3FUV A;  3SAV A;  3T38 A;  1L2B A;  1IXS B;  3HU2 A;  1DGH A;  2R18 A;  4DV5 M;  3E9S A;  4L78 A;  1NY5 A;  1GL6 A;  1GL7 A;  2UXB M;  3FUU A;  3U6E A;  2X49 A;  1QAQ A;  3SMS A;  2D7E A;  2DZN B;  3L29 A;  3UGJ A;  4FWG A;  3GPX A;  3SAU A;  2BJV A;  5ITX A;  3HHZ A;  1E9S A;  3A46 A;  3VLF B;  3J7A S;  2Z4R A;  2LWX A;  1L1Z A;  4MGH A;  3VDU A;  4HL4 A;  4DV0 M;  2KEB A;  2R4E A;  4B7G A;  3J27 B;  1G8P A;  5EXT A;  5KPT A;  3D8L A;  3KOW E;  3U6D A;  5JI2 E;  1XMQ M;  2R45 A;  3CF0 A;  2Y0Q A;  1HNZ M;  1KYI A;  4IBG A;  2FFJ A;  3I51 A;  4ITQ A;  3M6A A;  3LQQ A;  1XWI A;  1HQY E;  1N77 A;  1SXJ B;  2DWM A;  2DWN A;  2G8L A;  3Q8X A;  5KQD A;  1Z5B A;  1TDZ A;  3KFU G;  2EA0 A;  4LRT A;  3GQ4 A;  2YR0 A;  2QEN A;  3KVW A;  2KXE A;  5A2Q S;  5LMU M;  4IJF A;  4NL4 H;  4KO8 A;  3VK8 A;  4GIP A;  4WW0 A;  1DO0 A;  2ZAM A;  3H4M A;  2XFS A;  1N78 A;  2I7P A;  1EE8 A;  5ITQ A;  3T1H M;  2Y21 A;  5FTJ A;  1IXZ A;  4GKJ M;  1IBK M;  4QHT A;  2CFO A;  3GLI B;  3K92 A;  3QAU A;  2O5R A;  1R2Z A;  4QOZ C;  1XHB A;  4YY3 M;  3GO8 A;  3HWS A;  1SXJ E;  3GRU A;  3HGI A;  4IBB A;  1C1K A;  2DVW B;  1UM8 A;  4DV2 M;  4LFA M;  4TUW A;  4IIW A;  2KZU A;  1NHW C;  1DGB A;  1NSF A;  3U60 A;  2XZF A;  1Z59 A;  3HU3 A;  4HLQ A;  4LGM A;  4D80 A;  4M9X A;  4GHA A;  3SYL A;  3KW6 A;  4PCZ A;  1E9R A;  4LF8 M;  3AJI B;  4GC9 A;  4FW9 A;  2R4J A;  2Z4S A;  2DHR A;  1Q3C A;  4REZ A;  3PNV A;  2UUC M;  3HHW A;  2R46 A;  3HHY A;  3QWL A;  2X8A A;  3AFH A;  2YNM D;  4PT5 A;  4L8R C;  4BB9 A;  3DOA A;  5ITU A;  3R8F A;  3GLH A;  3KOZ E;  4IBE A;  3A42 A;  2M5Z A;  2CHG A;  4FCV A;  2R62 A;  4JV5 M;  1DGG A;  4FD2 A;  3HKP A;  4BLC A;  2UU9 M;  3SFZ A;  1NHG C;  1Q39 A;  4LJA A;  3KP0 E;  1GVN A;  1NY6 A;  3KP1 E;  3FYC A;  4FCW A;  5IRE B;  1N75 A;  3U5Z A;  5FSW A;  4QNR A;  3HHX A;  4FWH A;  3IG8 A;  4G4N A;  4DR5 M;  2V1U A;  3HJ8 A;  3FKE A;  3FUX A;  3C58 A;  4IBJ A;  4B3R M;  2ZAN A;  2V6Z M;  1HNW M;  1GLN A;  2NQ8 C;  4JI3 M;  4DR1 M;  2M60 A;  4LRS A;  1GKI A;  4JN6 A;  1IN8 A;  3T15 A;  3VFD A;  5KQ8 A;  1XXH A;  3PVS A;  2F4V M;  2KRK A;  4DV4 M;  2DXI A;  4AG5 A;  3HU1 A;  2VII A;  1QZM A;  4Z6Y A;  2F5Q A;  4DR6 M;  3MK6 A;  4B3M M;  4GKK M;  3L27 A;  4OVZ B;  4CHT B;  4LJ4 A;  2F5P A;  3SHF A;  1K3X A;  2DWL A;  3KXE C;  3AOG A;  2F5O A;  4IJE A;  3EIH A;  3DZD A;  1JQJ C;  4RF0 A;  2EUC A;  2CV0 A;  1ZAE A;  4LZZ A;  3GLI A;  1J5E M;  2G5G X;  3JAM S;  2CV2 A;  1G41 A;  5JI3 E;  2FE8 A;  3M0E A;  4MH0 E;  4P16 A;  1OJL A;  1G4A E;  1DGF A;  4IBI A;  2YQZ A;  5C1B A;  1TH4 A;  2C9C A;  4G4O A;  3ZCB B;  2UUB M;  3SHG B;  1KSF X;  4X65 M;  1JR3 D;  1IY1 A;  2FNA A;  1QVR A;  2KW0 A;  4X64 M;  1NJF A;  4LJ9 A;  5LMN M;  1XMO M;  4L15 A;  4MGZ E;  4M0D A;  4LF9 M;  4DR7 M;  3L25 A;  4MGY E;  1N32 M;  5KO3 A;  2I7N A;  1ZQ9 A;  3RFW A;  3KS4 A;  1D2N A;  3U61 A;  1PJJ A;  4LJ7 A;  2RKO A;  3PNY A;  1YSY A;  3GQ3 A;  4LF4 M;  2LXE A;  3D8B A;  4QOS A;  1Z5C A;  3SC3 A;  2HHH M;  4YHH M;  1SXJ C;  1DGH B;  2VQE M;  1ORY B;  5BR8 M;  2EO2 A;  1FJG M;  1Z6T A;  4B08 A;  3K1J A;  2KRU A;  2XSZ D;  2Z7J A;  5EQT A;  1IY2 A;  2QCU A;  4I81 A;  4IBD A;  3JR4 A;  4DV1 M;  1IN4 A;  3DA1 A;  4FVM A;  3SAR A;  2C98 A;  3VKH A;  5IT9 S;  4LJ5 A;  4LG2 A;  2L7H A;  4RF1 A;  3WHL A;  4G4Q A;  4NXN M;  2CV1 A;  3RE8 A;  2DZO B;  3LMM A;  5E26 A;  2CHQ A;  1SXJ D;  3A98 B;  1PM5 A;  1IBL M;  2Q2E B;  4DR3 M;  3PXG A;  4XGI A;  4MGK E;  3GRR A;  1JR3 A;  3KSJ A;  3LVW A;  4IBF A;  4NSR A;  1TGU A;  3GRV A;  1XNR M;  4GRI A;  4DUY M;  3FTF A;  5EXS A;  1TH3 A;  4DUZ M;  3TWK A;  4B3T M;  4DV3 M;  4DR4 M;  1WXQ A;  5FTL A;  4MGI E;  2UXD M;  2H1R A;  5BPV A;  4LY6 A;  4R7G A;  4FCT A;  1MX0 A;  1XNQ M;  2RGH A;  1QAN A;  5ITX E;  1L2D A;  1OFH A;  3FUW A;  3GLF B;  4JI7 M;  4OVZ A;  3FYD A;  2L7I A;  1R6B X;  2C99 A;  4I5S A;  4AQY M;  1IN6 A;  2ERC A;  2C5R A;  2XLJ A;  1LV7 A;  2DWZ B;  1L2C A;  2CUZ A;  4LFC M;  2ZAO A;  4NXM M;  1W5T A;  4LJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...