5IWAM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5iwaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5iwaM02
3C58A 1Z5AA 3GPUA 2UXCM 5ITQA 1IBMM 3SBJA 2F5NA 1N32M 5IWAM 2XZFA 4JI0M 4NRWA 3SASA 1L2CA 1L2DA 5ITYA 4PCZA 4DUZM 1HNXM 4JI5M 4B3RM 4AQYM 5ITXE 3GPYA 1PJJA 1Z5BA 1R2YA 3U6DA 4K0KM 2UXBM 3GP1A 4LF8M 2UUCM 4NRVA 3SARA 2UU9M 5ITUA 4JI2M 4JI7M 1PJIA 5A2QS 3JAMS 4LF7M 3A42A 4GKJM 3JR5A 4KHPM 4DUYM 1L1TA 2ZBKB 2UUAM 4DR7M 2EA0A 5LMUM 3J7AS 5LMNM 1PM5A 2E5LM 5ITRA 3U6SA 1Z59A 4DR4M 4PDIA 2UUBM 4B3MM 1XMQM 1NNJA 4X62M 1K3XA 3U6MA 4B3TM 5ITTA 4X66M 3W0FA 3U6QA 4JI6M 1MX0A 3GQ5A 1XNQM 4B3SM 3A45A 3GPPA 3VK7A 1L2BA 4PDGA 2VQFM 2Q2EB 2F5SA 5IT9S 4JI1M 4JYAM 4OX9M 4JI4M 2UXDM 1IBKM 3OTOM 4DR1M 3U6OA 2F5OA 4LF6M 3SAUA 3TWKA 1XMOM 1MU5A 4ITQA 4G4NA 4DV6M 3TWMA 1Q3BA 3SAVA 2XZUA 4NXNM 4DV3M 1TDZA 2F5QA 4LF5M 4DV0M 2OQ4A 5BR8M 1J5EM 3U6LA 3T1HM 4YHHM 4G4QA 3U6PA 4CISA 1K3WA 1N36M 4DR6M 3A46A 5FLXS 4DV7M 3JR4A 4G4RA 1N34M 1IBLM 1XC8A 1K82A 3GQ4A 4DV4M 4DR5M 1L1ZA 4X65M 3J81S 4PD2A 4G4OA 1I94M 4DR2M 5ITXA 2HKJA 4YY3M 1KFVA 1R2ZA 4MB7A 4DR3M 4JI8M 1HNZM 3TWLA 3J80S 3SAWA 1XNRM 1Z5CA 3GO8A 1Q3CA 2ZM6M 1HR0M 4JV5M 1FJGM 4DV5M 4LFBM 4LFCM 1N33M 3GQ3A 3U6CA 4LF9M 2F4VM 4LFAM 4X64M 1TDHA 1Q39A 4DV1M 2VQEM 4NXMM 3SATA 4DV2M 2F5PA 1EE8A 3GPXA 4JI3M 1HNWM 3DOAA 2OPFA 4GKKM 4LF4M 3U6EA 3T1YM 2HHHM 3VK8A
chains in the Genus database with same CATH superfamily
4GMQA 3C58A 3GPUA 1DGGA 1OIPA 2JZ1A 2R44A 2JXNA 1IBMM 2F5NA 5H37D 5DYIA 1N32M 3QAUA 2XZFA 3VDPA 2APLA 3BXWA 1L2CA 3CGWA 1DGHB 1HNXM 2R45A 4AQYM 5ITXE 3LQRA 3I4VA 3KS8A 3KDSE 2KA6B 2KW0A 4AG6A 4NRVA 2DWNA 4ANRA 2EO2A 2I7PA 4XGIA 2R62A 3B9PA 4LRSA 3SHFA 5ITUA 5FTNA 4JI2M 2OOBA 4HLQA 3E4RA 5C1BA 3VLFB 1GO5A 2XLJA 3B7QA 1QAOA 4REZA 2LVQD 1V33A 5FTMA 3H4JA 4XBOA 2BJVA 2DVWB 5LMUM 2WSCF 5LMNM 2E5LM 1HT2E 3KVWA 3UK6A 2MGWA 1W5SA 3U6SA 1E32A 1QZMA 5BPVA 3FUUA 2JY7A 1DGFA 2HAKA 4I8OA 2UUBM 2L4EA 2CE7A 4X62M 2BWBA 4B3MM 3H4MA 1IFYA 2R0IA 4X66M 3GQ5A 4GRIA 5EXSA 4B3SM 3B89A 3Q8XA 2P5TA 2DAKA 2JY5A 3RE8A 2L4FA 4MGKE 2VQFM 5IT9S 3GLGB 2R4JA 1OAOC 4I81A 1NNUC 4M9XA 3SMPA 4JI4M 2ZAMA 4G3OA 1IN5A 3TE6A 1V34A 5FSWA 3OTOM 3W0LB 2XSZA 1EFUB 3TL4X 3GLIA 2KNZA 4F2LA 4QHTA 5KPTA 3SAUA 2F5OA 1GLNA 4NOOB 1ZAEA 4DV6M 5KPZA 1Q3BA 3HZJA 2L6OA 1UM8A 1J5EM 1QYRA 2DWLA 3HHXA 1DO0A 3VDUA 4CISA 4M0DA 1T43A 4D82A 1K3WA 2VDBB 1TTEA 4RNAA 1G71A 2W82A 4DR6M 2R65A 5FLXS 1G4AE 3JR4A 4G4RA 1HQYE 2QZ4A 8CATA 1N34M 3LMMA 3RGSA 4QNMA 3ZQJA 4M0WA 4B7FA 4OVZA 2XGNA 4FWGA 2YR0A 3M0EA 4CIZA 3W68A 1D0MA 2EKFA 2ZAOA 4DR2M 3E21A 2O01F 4QOZC 3MHVC 3HWSA 2C9OA 4BBAA 1X37A 2ZANA 1OJLA 3AOEA 3FTDA 4LG2A 4DR3M 2V1CA 4IBFA 4PT5A 2XH9A 3HU2A 4LGMA 4M9ZA 3GO8A 2QPAA 2EJSA 2KZSA 1NSFA 1HJPA 2KEBA 2L7HA 5EP1A 1JB0F 3SHGB 2J7OA 2F4VM 3KSJA 1TDHA 3ZH9B 1GKIA 2JUJA 4DV1M 4L6V6 3R8FA 4GHAA 2CHVA 1Y8GA 4FW9A 4Y28F 4JI3M 3AKZA 2QP9X 4NL4H 1QZEA 2EUCA 3HJSA 4L4UA 1NV9A 4AW4A 3T1YM 3HHZA 3FTEA 5ITQA 3DA1A 3SBJA 3THGA 2KNAA 2HCBA 4KODA 4MM3B 2FH0A 2DHYA 4QOSA 1NHWC 2D7EA 3RGPA 4NRWA 4LJ8A 2LVPC 4QNRA 3VKHA 4B3RM 1A5TA 2L09A 3ZCBB 4R3DA 4XK8F 3U6DA 1PJJA 4K0KM 3HHYA 2FFJA 1QDTA 2DZLA 1DO2A 3C3DA 3GP1A 2UXBM 3PNYA 3TQSA 2WZJA 4AI6A 2K6BA 4LCBA 3L28A 3AFHA 5EJCA 1T3TA 1WHCA 4LF7M 4FCTA 3A42A 3FYCA 4GKJM 2KRKA 4KHPM 2R6FA 2QENA 3T6PA 1L1TA 2MJ5B 2Y21A 2QBYB 2K9DA 1OIZA 2VF7A 2EA0A 2R46A 1OFHA 2JWSA 4EIWA 1D2NA 1YLAA 1N78A 1SXJA 3NWLA 4DR4M 1XMQM 3IECA 1W5TA 3U60B 2YFQA 5EQTA 4Q7JA 4IBJA 3GPPA 1SXJE 2DWZB 1L2BA 4OU7A 1IXRC 2Q2EB 2Z7JA 3UMMA 2F5SA 2KZUA 4B08A 1NO1A 5KO3A 2Z4RA 2J5YA 1OQYA 1IBKM 1TH3A 1TR8A 3U6OA 4LF6M 2G8LA 4IBIA 2LVNC 2DI0A 2RGHA 3QYBA 2GQFA 2O5RA 1XMOM 3U61B 2HL7A 2LVAA 4ITQA 1HQCA 5C18A 2CHGA 2B3TA 1VEKA 3SAVA 1NY6A 4IBDA 4GHLA 1WGNA 2C99A 2N35A 3LQQA 2OQ4A 3PXGA 3U6LA 1SXJD 3MMPA 4YHHM 2R18A 1R7RA 3IHPA 3I01M 1JR3A 2KDLA 2Z3XA 2G5GX 2XFTA 1N36M 3R9XB 1ZMVA 3K92A 3LVWA 2LWXA 3FTCA 1TH2A 3HJQA 2C96A 4JN6A 1ORYB 4GC9A 2C98A 3KP1E 4DR5M 1N77A 1IXZA 2CP8A 3AL0C 5IREB 4X65M 3K1JA 4MGHA 3J81S 3U5ZB 4L15A 3CF2A 2DNAA 1PRBA 3HGIA 1G59A 4G6ZA 5EP3A 4A3VB 1SXJB 3GLIE 4JI8M 2CHQA 1NJGA 4L78A 1Z5CA 4HEOA 2RGOA 4MGYE 5FTKA 1FJGM 4DV5M 2CRUA 4LFBM 4MGIE 4LFCM 2X49A 3ILKA 3GQ3A 4LJ5A 1QUSA 3U6CA 4LF9M 4X64M 2M60A 5JI3E 2FNAA 3CF0A 5DYGA 3SATA 4LF4M 1IXSA 3I04M 2XFSA 3HU1A 2DZOB 1EE8A 3QYEA 3SC3A 2LH0A 1L8QA 3BBZA 3DOAA 2OPFA 4CHTB 4FCWA 4B7GA 2FOIC 1XXHA 4OX9M 1IN8A 2HHHM 3VK8A 7CATA 4D81A 1LTMA 2XSZD 2UXCM 2VF8A 4WW0A 5EXXA 2LXEA 4IIWA 5IWAM 1QVRA 3HJ8A 3PFIA 3D8LA 3RFWA 4D80A 3SASA 4RF1A 1CUKA 1R5LA 4DUZM 3GPYA 1Z5BA 2BWEA 3FUVA 3GLFA 4LF8M 3E9SA 3SARA 2UU9M 4JI7M 4TUWA 3T15A 3KOXE 2Y0TA 5A2QS 1C7YA 2M5ZA 3JAMS 2DWMA 4DUYM 1YSYA 1KYIA 1ZMWA 1GVNA 1MJGM 1S3SA 3K9PA 2UUAM 4DR7M 2D7GA 4LJAA 3GLHA 3GLIB 3J7AS 1PM5A 3KP0E 5ITRA 4P16A 3KOWE 3MJ5A 5DFLA 1Z59A 3L27A 2LVOC 4IJFA 2VIIA 3QWLA 1DGHA 4LZZA 2CV1A 1RU3A 3W67A 2DENA 2D7HA 2GNOA 3AJIB 2Z4SA 3FKEA 1D0KA 4HL4A 3U6MA 1N75A 3U6QA 4JI6M 3GLHE 1MX0A 2Y20A 1XNQM 4NSRA 4LRTA 1GJSA 5EXTA 4FD2A 3VK7A 2LTUA 4PDGA 3A98B 2R4EA 5EP4A 4R71A 4AKIA 2DZNB 1D0LA 3B7ZA 3SYKA 4JYAM 1GL6A 3CTWB 4R7GA 2UXDM 2DAIA 1WIVA 3LW5F 1Q02A 5FTJA 4I5SA 4IJEA 3M6AA 2QSFX 1MU5A 2CEAA 3GRVA 3J2PB 1IY1A 4OVZB 4MGZE 1VQ1A 1YE9A 2JY6B 3TWMA 3FE3A 4NXNM 5KQDA 3D8BA 2WSFF 3K2LA 4LJ7A 4DV3M 1TDZA 1R4GA 4Z6YA 1GJTA 1XB2B 4KO8A 3U6PA 1Z6TA 3GLGA 1R6BX 3L2AA 4DV7M 3GRUA 4LZJA 3HHWA 4LJ4A 3L25A 2FS1A 3BOSA 2DAEA 3FTFA 1J09A 4IBKA 3GQ4A 1QAQA 4DV4M 2JZ0A 1PGYA 5E26A 4CJ6A 2JP7A 3WHKA 1QQWA 4LJ9A 3FUXA 4G4OA 4Z8XA 1F4IA 1I94M 5DNYA 3VFDA 5ITXA 2HKJA 1T6OA 4YY3M 2A5YB 3GLHB 1G8PA 2MH8A 2I7NA 4NC6A 1R2ZA 4MB7A 1E9SA 2J7NA 3KS4A 5KPRA 3J80S 4BB9A 1TH4A 4GIPA 3ZC7B 2KXEA 4AKGA 3K9OA 2ZM6M 3IG8A 3J27B 3UZUA 1QUTA 3GRRA 1PJSA 2YQZA 1N33M 1VDLA 2XEPA 1ZQ9A 4ZPXA 1Q39A 2VQEM 4NXMM 5IZ7D 1E9RA 1XWIA 3HKPA 1JR3E 1QDRA 3F92A 2KHHA 3I4YA 1HNWM 4CGYB 1WR1B 1SXJC 2C9CA 3HU3A 3U6EA 3B7NA 4GKKM 3I51A 1NV8A 1Z5AA 2CWBA 5GKNA 4I4LA 2C5RA 4LGYA 1NJFA 4FCVA 2H1RA 4AG5A 1TF0B 3VKGA 4FVMA 4P17A 1OKSA 4JI0M 3TPZA 2KNVA 3KXEC 1VG5A 2DAGA 5KQ8A 3C9PA 1E94E 1L2DA 1GABA 5ITYA 4PCZA 4JI5M 1VDDA 3J7BA 3KSXA 3NBXX 3MK6A 1R2YA 1WJ7A 2OOAA 1PJQA 1VEJA 2LHCA 2UUCM 1UFZA 2X4AA 1PJIA 2CV0A 2RKOA 2DXIA 1JR3D 1WXQA 1J7KA 4RKUF 3UJNA 1NY5A 2JA2A 3JR5A 4L8RC 4IBGA 3LCVB 1OTRA 4QHSA 2ERCA 2ZBKB 3KW6A 2DHRA 4AKHA 2BJWA 3HX3A 1QAMA 1EIJA 2EKKA 3L29A 2JY8A 1MN3A 3PVSA 4PDIA 2X8AA 1YUBA 3LCUA 1NNJA 1K3XA 3KOZE 4FWDA 3KFUG 4B3TM 5ITTA 3E46A 3FUTA 3W0FA 2K0BX 2LHGA 1OAIA 3FUWA 3K8ZA 2RRUA 3SFZA 1LV7A 3EIEA 1XXHE 3A45A 3AV0A 3IG5A 2V1UA 2MROB 3EIHA 2ZTDA 3HY5A 2DAMA 3M7GA 4JI1M 2QCUA 4GH9A 4IBEA 4NSOB 2OO9A 2WSEF 1FNNA 1WGLA 2NQ8C 3GRYA 3T38A 3V76A 4DR1M 5L8RF 2QBYA 2O25A 3GLFE 3TWKA 1IY0A 2Y0QA 2CV2A 5JI2E 1BVSA 2CFOA 1AIPC 3PNVA 4G4NA 3U60A 4W5WA 1DV0A 1TGUA 2V6ZM 3DFZA 3L26A 2XZUA 3WHLA 4DBGB 2JNHA 2F5QA 2K47A 3FRIA 4DV0M 4LF5M 5BR8M 4S12A 3FYDA 3Q8GA 3T1HM 5EXPA 1IN6A 4G4QA 4GITA 3LVVA 3UGJA 4FWHA 1IY2A 3A46A 2L2DA 2QQ8A 1AUAA 1PJTA 2L7IA 2DKLA 2LNHC 4UN2B 4IBBA 1IBLM 1XC8A 1K82A 1OFIA 1L1ZA 4LJ6A 4L16A 3CF6E 1G3IA 3U61A 2YNMD 1H6UA 2H5XA 3AOGA 3SYLA 4GEWA 4RF0A 5E6JA 1C1KA 4PD2A 1IXSB 4LY6A 1KSFX 2G3QA 1V92A 3SMSA 1I4WA 2KRUA 2ZTCA 3C3EA 4GC5A 3KOYE 4II7A 4KLNA 3AOEC 1HT1E 1KFVA 1IN7A 1JQJC 1XXHB 2CUZA 4OW0A 5EP2A 1HNZM 1IQPA 3TWLA 3DZDA 4M9SA 3SAWA 2AHMA 2FE8A 1XNRM 4WURA 1ZMUA 1ZV1A 2BNKA 1Q3CA 1HR0M 2MR9A 2Z8YM 4JV5M 2QNJA 3NBIA 1P3QQ 4BLCA 4IBCA 4JXJA 1NVMA 4AZFA 2QHOB 4LFAM 1GL7A 3FRHA 2HWJA 3GLFB 1G41A 5FTLA 3U5ZA 2LBCA 5F3WA 1VEGA 1SG9A 1IN4A 2XF3A 4DV2M 4MH0E 1QANA 4KT0F 3GLGE 2F5PA 1IM2A 3GPXA 1DGBA 4WP2A 3B74A 4B7HA 1XHBA 3FD9A 4F1IA 1NHGC
chains in the Genus database with same CATH topology
4GMQA 3C58A 3GPUA 1DGGA 1IBMM 2F5NA 5DYIA 1N32M 3QAUA 2XZFA 3VDPA 1L2CA 1DGHB 1HNXM 2R45A 4AQYM 5ITXE 3LQRA 3I4VA 3KS8A 3KDSE 2KA6B 2KW0A 4AG6A 4NRVA 2DWNA 5ITUA 2EO2A 2I7PA 4XGIA 2R62A 3B9PA 4LRSA 3SHFA 4JI2M 5FTNA 4HLQA 3E4RA 5C1BA 3VLFB 2XLJA 1QAOA 4REZA 5FTMA 4XBOA 2BJVA 2DVWB 5LMUM 5LMNM 2E5LM 1HT2E 3KVWA 3UK6A 1W5SA 3U6SA 1E32A 1QZMA 5BPVA 3FUUA 1DGFA 4I8OA 2UUBM 4B3MM 2CE7A 4X62M 3H4MA 4X66M 3GQ5A 4GRIA 5EXSA 4B3SM 3Q8XA 2P5TA 3RE8A 4MGKE 2VQFM 5IT9S 3GLGB 2R4JA 4I81A 4M9XA 1NNUC 3SMPA 4JI4M 2ZAMA 1IN5A 3TE6A 5FSWA 3OTOM 3W0LB 2XSZA 3GLIA 3TL4X 2F5OA 5KPTA 4QHTA 3SAUA 1GLNA 4NOOB 1ZAEA 4DV6M 5KPZA 1Q3BA 2L6OA 1UM8A 1J5EM 1QYRA 2DWLA 3HHXA 1DO0A 3VDUA 4CISA 4M0DA 4D82A 1K3WA 4RNAA 2W82A 4DR6M 2R65A 5FLXS 1G4AE 3JR4A 4G4RA 1HQYE 2QZ4A 8CATA 1N34M 3LMMA 3RGSA 4QNMA 4M0WA 4B7FA 4OVZA 2XGNA 4FWGA 2YR0A 3M0EA 2ZAOA 4DR2M 4QOZC 3MHVC 3HWSA 2C9OA 4BBAA 1X37A 2ZANA 1OJLA 3AOEA 3FTDA 4LG2A 4DR3M 2V1CA 4IBFA 4PT5A 2XH9A 3HU2A 4LGMA 4M9ZA 3GO8A 2QPAA 2KZSA 1NSFA 2KEBA 2L7HA 5EP1A 3SHGB 2J7OA 2F4VM 3KSJA 1TDHA 3ZH9B 1GKIA 4DV1M 3R8FA 4GHAA 2CHVA 4FW9A 4JI3M 3AKZA 2QP9X 4NL4H 2EUCA 3HJSA 4L4UA 3T1YM 4AW4A 3HHZA 3FTEA 5ITQA 3DA1A 3SBJA 3THGA 2HCBA 4KODA 4MM3B 4QOSA 1NHWC 2D7EA 3RGPA 4NRWA 4LJ8A 4QNRA 3VKHA 4B3RM 2L09A 3ZCBB 4R3DA 1PJJA 3U6DA 4K0KM 3HHYA 2FFJA 2UXBM 1DO2A 3GP1A 3PNYA 3TQSA 4AI6A 4LCBA 3L28A 3AFHA 5EJCA 1T3TA 4LF7M 4FCTA 3A42A 3FYCA 4GKJM 2KRKA 4KHPM 2QENA 1L1TA 2QBYB 2Y21A 2EA0A 2R46A 1OFHA 4EIWA 1D2NA 1N78A 1SXJA 3NWLA 4DR4M 1XMQM 1W5TA 3U60B 2YFQA 5EQTA 4IBJA 3GPPA 1SXJE 2DWZB 1L2BA 4OU7A 1IXRC 2Q2EB 2Z7JA 3UMMA 2F5SA 2KZUA 4B08A 5KO3A 2Z4RA 1IBKM 1TH3A 3U6OA 4LF6M 2G8LA 4IBIA 2RGHA 2O5RA 1XMOM 3U61B 2HL7A 4ITQA 1HQCA 5C18A 2CHGA 3SAVA 1NY6A 4IBDA 4GHLA 2OQ4A 2C99A 3LQQA 3PXGA 3U6LA 1SXJD 4YHHM 2R18A 1R7RA 1JR3A 2Z3XA 2G5GX 2XFTA 1N36M 3R9XB 3K92A 3LVWA 2LWXA 3FTCA 1TH2A 3HJQA 2C96A 4JN6A 1ORYB 4GC9A 2C98A 3KP1E 4DR5M 1N77A 1IXZA 3AL0C 5IREB 4X65M 3K1JA 4MGHA 3J81S 3U5ZB 4L15A 3CF2A 3HGIA 1G59A 4G6ZA 5EP3A 4A3VB 1SXJB 4JI8M 2CHQA 1NJGA 4L78A 1Z5CA 2RGOA 4MGYE 5FTKA 1FJGM 4DV5M 4LFBM 4MGIE 4LFCM 2X49A 3ILKA 3GQ3A 4LJ5A 3U6CA 4LF9M 4X64M 2M60A 5JI3E 2FNAA 3CF0A 5DYGA 3SATA 2XFSA 3HU1A 2DZOB 1EE8A 3SC3A 2LH0A 1L8QA 3DOAA 2OPFA 4CHTB 4FCWA 4B7GA 2FOIC 1XXHA 4OX9M 1IN8A 2HHHM 3VK8A 7CATA 4D81A 2XSZD 2UXCM 4WW0A 5EXXA 2LXEA 4IIWA 5IWAM 1QVRA 3HJ8A 3PFIA 3D8LA 3RFWA 4D80A 3SASA 4RF1A 4DUZM 3GPYA 1Z5BA 3FUVA 3GLFA 4LF8M 3E9SA 3SARA 2UU9M 4JI7M 4TUWA 3T15A 3KOXE 2Y0TA 5A2QS 2M5ZA 3JAMS 2DWMA 4DUYM 1YSYA 1KYIA 2UUAM 1GVNA 1S3SA 4DR7M 2D7GA 4LJAA 3GLHA 3GLIB 3J7AS 1PM5A 3KP0E 5ITRA 4P16A 3KOWE 3MJ5A 1Z59A 3L27A 2CV1A 4IJFA 2VIIA 3QWLA 1DGHA 4LZZA 4HL4A 2D7HA 3AJIB 3FKEA 2Z4SA 3U6MA 1N75A 3U6QA 4JI6M 1MX0A 2Y20A 1XNQM 4NSRA 4LRTA 5EXTA 4FD2A 3VK7A 4PDGA 3A98B 2R4EA 5EP4A 4AKIA 2DZNB 3SYKA 4JYAM 1GL6A 3CTWB 4R7GA 2UXDM 5FTJA 4I5SA 4IJEA 3M6AA 3GRVA 1MU5A 2CEAA 3J2PB 1IY1A 4OVZB 4MGZE 1YE9A 3TWMA 4NXNM 5KQDA 3D8BA 4LJ7A 3K2LA 4DV3M 1TDZA 4Z6YA 4KO8A 3U6PA 1Z6TA 3GLGA 1R6BX 3L2AA 4DV7M 3GRUA 4LZJA 3HHWA 4LJ4A 3L25A 3BOSA 3FTFA 1J09A 4IBKA 3GQ4A 1QAQA 4DV4M 5E26A 3WHKA 1QQWA 4LJ9A 3FUXA 4G4OA 4Z8XA 1I94M 5DNYA 3VFDA 5ITXA 2HKJA 4YY3M 2A5YB 3GLHB 1G8PA 2I7NA 1R2ZA 4MB7A 1E9SA 2J7NA 3KS4A 5KPRA 3J80S 4BB9A 1TH4A 4GIPA 3ZC7B 2KXEA 4AKGA 2ZM6M 3IG8A 3J27B 3UZUA 3GRRA 2YQZA 1N33M 2XEPA 1ZQ9A 4ZPXA 1Q39A 2VQEM 4NXMM 5IZ7D 1E9RA 1XWIA 3HKPA 3I4YA 1HNWM 4CGYB 1SXJC 2C9CA 3HU3A 3U6EA 4GKKM 3I51A 1Z5AA 5GKNA 4I4LA 2C5RA 4LGYA 1NJFA 4FCVA 2H1RA 4AG5A 3VKGA 4FVMA 3TPZA 4JI0M 3KXEC 5KQ8A 1E94E 1L2DA 5ITYA 4PCZA 4JI5M 1VDDA 3J7BA 3KSXA 1R2YA 3MK6A 2UUCM 2X4AA 1PJIA 2CV0A 2RKOA 2DXIA 1JR3D 1WXQA 1J7KA 3UJNA 1NY5A 2JA2A 3JR5A 4L8RC 4IBGA 4QHSA 2ERCA 2ZBKB 3KW6A 2DHRA 4AKHA 2BJWA 1QAMA 3L29A 3PVSA 4PDIA 2X8AA 1YUBA 1NNJA 1K3XA 3KOZE 4FWDA 3KFUG 4B3TM 5ITTA 3FUTA 3W0FA 3FUWA 3K8ZA 3SFZA 1LV7A 3EIEA 3AV0A 3A45A 3IG5A 2V1UA 3EIHA 3M7GA 4JI1M 2QCUA 4GH9A 4IBEA 4NSOB 1FNNA 2NQ8C 2QBYA 3GRYA 3T38A 4DR1M 3TWKA 1IY0A 2Y0QA 2CV2A 5JI2E 2CFOA 3PNVA 4G4NA 3U60A 4W5WA 1TGUA 2V6ZM 3DFZA 3L26A 2XZUA 3WHLA 2F5QA 2K47A 4LF5M 4DV0M 5BR8M 4S12A 3FYDA 3T1HM 5EXPA 1IN6A 4G4QA 4GITA 3LVVA 3UGJA 4FWHA 1IY2A 3A46A 2L7IA 2LNHC 1IBLM 4IBBA 1XC8A 1K82A 1OFIA 1L1ZA 4LJ6A 4L16A 3CF6E 1G3IA 3U61A 2YNMD 1H6UA 3AOGA 3SYLA 5H37D 4RF0A 5E6JA 1C1KA 4PD2A 1IXSB 4LY6A 1KSFX 3SMSA 1I4WA 2KRUA 4GC5A 3KOYE 4II7A 4KLNA 3AOEC 1HT1E 1KFVA 1IN7A 1JQJC 1XXHB 2CUZA 4OW0A 5EP2A 1HNZM 1IQPA 3TWLA 3DZDA 4M9SA 3SAWA 2AHMA 2FE8A 1XNRM 4WURA 2BNKA 1Q3CA 1HR0M 4JV5M 3NBIA 4BLCA 4IBCA 4JXJA 1NVMA 4AZFA 4LFAM 1GL7A 3GLFB 1G41A 5FTLA 3U5ZA 5F3WA 1IN4A 2XF3A 4DV2M 4MH0E 1QANA 2F5PA 1IM2A 3GPXA 1DGBA 4B7HA 1XHBA 3FD9A 4LF4M 1NHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C58 A;  1Z5A A;  3GPU A;  2UXC M;  5ITQ A;  1IBM M;  3SBJ A;  2F5N A;  1N32 M;  5IWA M;  2XZF A;  4JI0 M;  4NRW A;  3SAS A;  1L2C A;  1L2D A;  5ITY A;  4PCZ A;  4DUZ M;  1HNX M;  4JI5 M;  4B3R M;  4AQY M;  5ITX E;  3GPY A;  1PJJ A;  1Z5B A;  1R2Y A;  3U6D A;  4K0K M;  2UXB M;  3GP1 A;  4LF8 M;  2UUC M;  4NRV A;  3SAR A;  2UU9 M;  5ITU A;  4JI2 M;  4JI7 M;  1PJI A;  5A2Q S;  3JAM S;  4LF7 M;  3A42 A;  4GKJ M;  3JR5 A;  4KHP M;  4DUY M;  1L1T A;  2ZBK B;  2UUA M;  4DR7 M;  2EA0 A;  5LMU M;  3J7A S;  5LMN M;  1PM5 A;  2E5L M;  5ITR A;  3U6S A;  1Z59 A;  4DR4 M;  4PDI A;  2UUB M;  4B3M M;  1XMQ M;  1NNJ A;  4X62 M;  1K3X A;  3U6M A;  4B3T M;  5ITT A;  4X66 M;  3W0F A;  3U6Q A;  4JI6 M;  1MX0 A;  3GQ5 A;  1XNQ M;  4B3S M;  3A45 A;  3GPP A;  3VK7 A;  1L2B A;  4PDG A;  2VQF M;  2Q2E B;  2F5S A;  5IT9 S;  4JI1 M;  4JYA M;  4OX9 M;  4JI4 M;  2UXD M;  1IBK M;  3OTO M;  4DR1 M;  3U6O A;  2F5O A;  4LF6 M;  3SAU A;  3TWK A;  1XMO M;  1MU5 A;  4ITQ A;  4G4N A;  4DV6 M;  3TWM A;  1Q3B A;  3SAV A;  2XZU A;  4NXN M;  4DV3 M;  1TDZ A;  2F5Q A;  4LF5 M;  4DV0 M;  2OQ4 A;  5BR8 M;  1J5E M;  3U6L A;  3T1H M;  4YHH M;  4G4Q A;  3U6P A;  4CIS A;  1K3W A;  1N36 M;  4DR6 M;  3A46 A;  5FLX S;  4DV7 M;  3JR4 A;  4G4R A;  1N34 M;  1IBL M;  1XC8 A;  1K82 A;  3GQ4 A;  4DV4 M;  4DR5 M;  1L1Z A;  4X65 M;  3J81 S;  4PD2 A;  4G4O A;  1I94 M;  4DR2 M;  5ITX A;  2HKJ A;  4YY3 M;  1KFV A;  1R2Z A;  4MB7 A;  4DR3 M;  4JI8 M;  1HNZ M;  3TWL A;  3J80 S;  3SAW A;  1XNR M;  1Z5C A;  3GO8 A;  1Q3C A;  2ZM6 M;  1HR0 M;  4JV5 M;  1FJG M;  4DV5 M;  4LFB M;  4LFC M;  1N33 M;  3GQ3 A;  3U6C A;  4LF9 M;  2F4V M;  4LFA M;  4X64 M;  1TDH A;  1Q39 A;  4DV1 M;  2VQE M;  4NXM M;  3SAT A;  4DV2 M;  2F5P A;  1EE8 A;  3GPX A;  4JI3 M;  1HNW M;  3DOA A;  2OPF A;  4GKK M;  4LF4 M;  3U6E A;  3T1Y M;  2HHH M;  3VK8 A; 
#chains in the Genus database with same CATH topology
 4GMQ A;  3C58 A;  3GPU A;  1DGG A;  1OIP A;  2JZ1 A;  2R44 A;  2JXN A;  1IBM M;  2F5N A;  5H37 D;  5DYI A;  1N32 M;  3QAU A;  2XZF A;  3VDP A;  2APL A;  3BXW A;  1L2C A;  3CGW A;  1DGH B;  1HNX M;  2R45 A;  4AQY M;  5ITX E;  3LQR A;  3I4V A;  3KS8 A;  3KDS E;  2KA6 B;  2KW0 A;  4AG6 A;  4NRV A;  2DWN A;  4ANR A;  2EO2 A;  2I7P A;  4XGI A;  2R62 A;  3B9P A;  4LRS A;  3SHF A;  5ITU A;  5FTN A;  4JI2 M;  2OOB A;  4HLQ A;  3E4R A;  5C1B A;  3VLF B;  1GO5 A;  2XLJ A;  3B7Q A;  1QAO A;  4REZ A;  2LVQ D;  1V33 A;  5FTM A;  3H4J A;  4XBO A;  2BJV A;  2DVW B;  5LMU M;  2WSC F;  5LMN M;  2E5L M;  1HT2 E;  3KVW A;  3UK6 A;  2MGW A;  1W5S A;  3U6S A;  1E32 A;  1QZM A;  5BPV A;  3FUU A;  2JY7 A;  1DGF A;  2HAK A;  4I8O A;  2UUB M;  2L4E A;  2CE7 A;  4X62 M;  2BWB A;  4B3M M;  3H4M A;  1IFY A;  2R0I A;  4X66 M;  3GQ5 A;  4GRI A;  5EXS A;  4B3S M;  3B89 A;  3Q8X A;  2P5T A;  2DAK A;  2JY5 A;  3RE8 A;  2L4F A;  4MGK E;  2VQF M;  5IT9 S;  3GLG B;  2R4J A;  1OAO C;  4I81 A;  1NNU C;  4M9X A;  3SMP A;  4JI4 M;  2ZAM A;  4G3O A;  1IN5 A;  3TE6 A;  1V34 A;  5FSW A;  3OTO M;  3W0L B;  2XSZ A;  1EFU B;  3TL4 X;  3GLI A;  2KNZ A;  4F2L A;  4QHT A;  5KPT A;  3SAU A;  2F5O A;  1GLN A;  4NOO B;  1ZAE A;  4DV6 M;  5KPZ A;  1Q3B A;  3HZJ A;  2L6O A;  1UM8 A;  1J5E M;  1QYR A;  2DWL A;  3HHX A;  1DO0 A;  3VDU A;  4CIS A;  4M0D A;  1T43 A;  4D82 A;  1K3W A;  2VDB B;  1TTE A;  4RNA A;  1G71 A;  2W82 A;  4DR6 M;  2R65 A;  5FLX S;  1G4A E;  3JR4 A;  4G4R A;  1HQY E;  2QZ4 A;  8CAT A;  1N34 M;  3LMM A;  3RGS A;  4QNM A;  3ZQJ A;  4M0W A;  4B7F A;  4OVZ A;  2XGN A;  4FWG A;  2YR0 A;  3M0E A;  4CIZ A;  3W68 A;  1D0M A;  2EKF A;  2ZAO A;  4DR2 M;  3E21 A;  2O01 F;  4QOZ C;  3MHV C;  3HWS A;  2C9O A;  4BBA A;  1X37 A;  2ZAN A;  1OJL A;  3AOE A;  3FTD A;  4LG2 A;  4DR3 M;  2V1C A;  4IBF A;  4PT5 A;  2XH9 A;  3HU2 A;  4LGM A;  4M9Z A;  3GO8 A;  2QPA A;  2EJS A;  2KZS A;  1NSF A;  1HJP A;  2KEB A;  2L7H A;  5EP1 A;  1JB0 F;  3SHG B;  2J7O A;  2F4V M;  3KSJ A;  1TDH A;  3ZH9 B;  1GKI A;  2JUJ A;  4DV1 M;  4L6V 6;  3R8F A;  4GHA A;  2CHV A;  1Y8G A;  4FW9 A;  4Y28 F;  4JI3 M;  3AKZ A;  2QP9 X;  4NL4 H;  1QZE A;  2EUC A;  3HJS A;  4L4U A;  1NV9 A;  4AW4 A;  3T1Y M;  3HHZ A;  3FTE A;  5ITQ A;  3DA1 A;  3SBJ A;  3THG A;  2KNA A;  2HCB A;  4KOD A;  4MM3 B;  2FH0 A;  2DHY A;  4QOS A;  1NHW C;  2D7E A;  3RGP A;  4NRW A;  4LJ8 A;  2LVP C;  4QNR A;  3VKH A;  4B3R M;  1A5T A;  2L09 A;  3ZCB B;  4R3D A;  4XK8 F;  3U6D A;  1PJJ A;  4K0K M;  3HHY A;  2FFJ A;  1QDT A;  2DZL A;  1DO2 A;  3C3D A;  3GP1 A;  2UXB M;  3PNY A;  3TQS A;  2WZJ A;  4AI6 A;  2K6B A;  4LCB A;  3L28 A;  3AFH A;  5EJC A;  1T3T A;  1WHC A;  4LF7 M;  4FCT A;  3A42 A;  3FYC A;  4GKJ M;  2KRK A;  4KHP M;  2R6F A;  2QEN A;  3T6P A;  1L1T A;  2MJ5 B;  2Y21 A;  2QBY B;  2K9D A;  1OIZ A;  2VF7 A;  2EA0 A;  2R46 A;  1OFH A;  2JWS A;  4EIW A;  1D2N A;  1YLA A;  1N78 A;  1SXJ A;  3NWL A;  4DR4 M;  1XMQ M;  3IEC A;  1W5T A;  3U60 B;  2YFQ A;  5EQT A;  4Q7J A;  4IBJ A;  3GPP A;  1SXJ E;  2DWZ B;  1L2B A;  4OU7 A;  1IXR C;  2Q2E B;  2Z7J A;  3UMM A;  2F5S A;  2KZU A;  4B08 A;  1NO1 A;  5KO3 A;  2Z4R A;  2J5Y A;  1OQY A;  1IBK M;  1TH3 A;  1TR8 A;  3U6O A;  4LF6 M;  2G8L A;  4IBI A;  2LVN C;  2DI0 A;  2RGH A;  3QYB A;  2GQF A;  2O5R A;  1XMO M;  3U61 B;  2HL7 A;  2LVA A;  4ITQ A;  1HQC A;  5C18 A;  2CHG A;  2B3T A;  1VEK A;  3SAV A;  1NY6 A;  4IBD A;  4GHL A;  1WGN A;  2C99 A;  2N35 A;  3LQQ A;  2OQ4 A;  3PXG A;  3U6L A;  1SXJ D;  3MMP A;  4YHH M;  2R18 A;  1R7R A;  3IHP A;  3I01 M;  1JR3 A;  2KDL A;  2Z3X A;  2G5G X;  2XFT A;  1N36 M;  3R9X B;  1ZMV A;  3K92 A;  3LVW A;  2LWX A;  3FTC A;  1TH2 A;  3HJQ A;  2C96 A;  4JN6 A;  1ORY B;  4GC9 A;  2C98 A;  3KP1 E;  4DR5 M;  1N77 A;  1IXZ A;  2CP8 A;  3AL0 C;  5IRE B;  4X65 M;  3K1J A;  4MGH A;  3J81 S;  3U5Z B;  4L15 A;  3CF2 A;  2DNA A;  1PRB A;  3HGI A;  1G59 A;  4G6Z A;  5EP3 A;  4A3V B;  1SXJ B;  3GLI E;  4JI8 M;  2CHQ A;  1NJG A;  4L78 A;  1Z5C A;  4HEO A;  2RGO A;  4MGY E;  5FTK A;  1FJG M;  4DV5 M;  2CRU A;  4LFB M;  4MGI E;  4LFC M;  2X49 A;  3ILK A;  3GQ3 A;  4LJ5 A;  1QUS A;  3U6C A;  4LF9 M;  4X64 M;  2M60 A;  5JI3 E;  2FNA A;  3CF0 A;  5DYG A;  3SAT A;  4LF4 M;  1IXS A;  3I04 M;  2XFS A;  3HU1 A;  2DZO B;  1EE8 A;  3QYE A;  3SC3 A;  2LH0 A;  1L8Q A;  3BBZ A;  3DOA A;  2OPF A;  4CHT B;  4FCW A;  4B7G A;  2FOI C;  1XXH A;  4OX9 M;  1IN8 A;  2HHH M;  3VK8 A;  7CAT A;  4D81 A;  1LTM A;  2XSZ D;  2UXC M;  2VF8 A;  4WW0 A;  5EXX A;  2LXE A;  4IIW A;  5IWA M;  1QVR A;  3HJ8 A;  3PFI A;  3D8L A;  3RFW A;  4D80 A;  3SAS A;  4RF1 A;  1CUK A;  1R5L A;  4DUZ M;  3GPY A;  1Z5B A;  2BWE A;  3FUV A;  3GLF A;  4LF8 M;  3E9S A;  3SAR A;  2UU9 M;  4JI7 M;  4TUW A;  3T15 A;  3KOX E;  2Y0T A;  5A2Q S;  1C7Y A;  2M5Z A;  3JAM S;  2DWM A;  4DUY M;  1YSY A;  1KYI A;  1ZMW A;  1GVN A;  1MJG M;  1S3S A;  3K9P A;  2UUA M;  4DR7 M;  2D7G A;  4LJA A;  3GLH A;  3GLI B;  3J7A S;  1PM5 A;  3KP0 E;  5ITR A;  4P16 A;  3KOW E;  3MJ5 A;  5DFL A;  1Z59 A;  3L27 A;  2LVO C;  4IJF A;  2VII A;  3QWL A;  1DGH A;  4LZZ A;  2CV1 A;  1RU3 A;  3W67 A;  2DEN A;  2D7H A;  2GNO A;  3AJI B;  2Z4S A;  3FKE A;  1D0K A;  4HL4 A;  3U6M A;  1N75 A;  3U6Q A;  4JI6 M;  3GLH E;  1MX0 A;  2Y20 A;  1XNQ M;  4NSR A;  4LRT A;  1GJS A;  5EXT A;  4FD2 A;  3VK7 A;  2LTU A;  4PDG A;  3A98 B;  2R4E A;  5EP4 A;  4R71 A;  4AKI A;  2DZN B;  1D0L A;  3B7Z A;  3SYK A;  4JYA M;  1GL6 A;  3CTW B;  4R7G A;  2UXD M;  2DAI A;  1WIV A;  3LW5 F;  1Q02 A;  5FTJ A;  4I5S A;  4IJE A;  3M6A A;  2QSF X;  1MU5 A;  2CEA A;  3GRV A;  3J2P B;  1IY1 A;  4OVZ B;  4MGZ E;  1VQ1 A;  1YE9 A;  2JY6 B;  3TWM A;  3FE3 A;  4NXN M;  5KQD A;  3D8B A;  2WSF F;  3K2L A;  4LJ7 A;  4DV3 M;  1TDZ A;  1R4G A;  4Z6Y A;  1GJT A;  1XB2 B;  4KO8 A;  3U6P A;  1Z6T A;  3GLG A;  1R6B X;  3L2A A;  4DV7 M;  3GRU A;  4LZJ A;  3HHW A;  4LJ4 A;  3L25 A;  2FS1 A;  3BOS A;  2DAE A;  3FTF A;  1J09 A;  4IBK A;  3GQ4 A;  1QAQ A;  4DV4 M;  2JZ0 A;  1PGY A;  5E26 A;  4CJ6 A;  2JP7 A;  3WHK A;  1QQW A;  4LJ9 A;  3FUX A;  4G4O A;  4Z8X A;  1F4I A;  1I94 M;  5DNY A;  3VFD A;  5ITX A;  2HKJ A;  1T6O A;  4YY3 M;  2A5Y B;  3GLH B;  1G8P A;  2MH8 A;  2I7N A;  4NC6 A;  1R2Z A;  4MB7 A;  1E9S A;  2J7N A;  3KS4 A;  5KPR A;  3J80 S;  4BB9 A;  1TH4 A;  4GIP A;  3ZC7 B;  2KXE A;  4AKG A;  3K9O A;  2ZM6 M;  3IG8 A;  3J27 B;  3UZU A;  1QUT A;  3GRR A;  1PJS A;  2YQZ A;  1N33 M;  1VDL A;  2XEP A;  1ZQ9 A;  4ZPX A;  1Q39 A;  2VQE M;  4NXM M;  5IZ7 D;  1E9R A;  1XWI A;  3HKP A;  1JR3 E;  1QDR A;  3F92 A;  2KHH A;  3I4Y A;  1HNW M;  4CGY B;  1WR1 B;  1SXJ C;  2C9C A;  3HU3 A;  3U6E A;  3B7N A;  4GKK M;  3I51 A;  1NV8 A;  1Z5A A;  2CWB A;  5GKN A;  4I4L A;  2C5R A;  4LGY A;  1NJF A;  4FCV A;  2H1R A;  4AG5 A;  1TF0 B;  3VKG A;  4FVM A;  4P17 A;  1OKS A;  4JI0 M;  3TPZ A;  2KNV A;  3KXE C;  1VG5 A;  2DAG A;  5KQ8 A;  3C9P A;  1E94 E;  1L2D A;  1GAB A;  5ITY A;  4PCZ A;  4JI5 M;  1VDD A;  3J7B A;  3KSX A;  3NBX X;  3MK6 A;  1R2Y A;  1WJ7 A;  2OOA A;  1PJQ A;  1VEJ A;  2LHC A;  2UUC M;  1UFZ A;  2X4A A;  1PJI A;  2CV0 A;  2RKO A;  2DXI A;  1JR3 D;  1WXQ A;  1J7K A;  4RKU F;  3UJN A;  1NY5 A;  2JA2 A;  3JR5 A;  4L8R C;  4IBG A;  3LCV B;  1OTR A;  4QHS A;  2ERC A;  2ZBK B;  3KW6 A;  2DHR A;  4AKH A;  2BJW A;  3HX3 A;  1QAM A;  1EIJ A;  2EKK A;  3L29 A;  2JY8 A;  1MN3 A;  3PVS A;  4PDI A;  2X8A A;  1YUB A;  3LCU A;  1NNJ A;  1K3X A;  3KOZ E;  4FWD A;  3KFU G;  4B3T M;  5ITT A;  3E46 A;  3FUT A;  3W0F A;  2K0B X;  2LHG A;  1OAI A;  3FUW A;  3K8Z A;  2RRU A;  3SFZ A;  1LV7 A;  3EIE A;  1XXH E;  3A45 A;  3AV0 A;  3IG5 A;  2V1U A;  2MRO B;  3EIH A;  2ZTD A;  3HY5 A;  2DAM A;  3M7G A;  4JI1 M;  2QCU A;  4GH9 A;  4IBE A;  4NSO B;  2OO9 A;  2WSE F;  1FNN A;  1WGL A;  2NQ8 C;  3GRY A;  3T38 A;  3V76 A;  4DR1 M;  5L8R F;  2QBY A;  2O25 A;  3GLF E;  3TWK A;  1IY0 A;  2Y0Q A;  2CV2 A;  5JI2 E;  1BVS A;  2CFO A;  1AIP C;  3PNV A;  4G4N A;  3U60 A;  4W5W A;  1DV0 A;  1TGU A;  2V6Z M;  3DFZ A;  3L26 A;  2XZU A;  3WHL A;  4DBG B;  2JNH A;  2F5Q A;  2K47 A;  3FRI A;  4DV0 M;  4LF5 M;  5BR8 M;  4S12 A;  3FYD A;  3Q8G A;  3T1H M;  5EXP A;  1IN6 A;  4G4Q A;  4GIT A;  3LVV A;  3UGJ A;  4FWH A;  1IY2 A;  3A46 A;  2L2D A;  2QQ8 A;  1AUA A;  1PJT A;  2L7I A;  2DKL A;  2LNH C;  4UN2 B;  4IBB A;  1IBL M;  1XC8 A;  1K82 A;  1OFI A;  1L1Z A;  4LJ6 A;  4L16 A;  3CF6 E;  1G3I A;  3U61 A;  2YNM D;  1H6U A;  2H5X A;  3AOG A;  3SYL A;  4GEW A;  4RF0 A;  5E6J A;  1C1K A;  4PD2 A;  1IXS B;  4LY6 A;  1KSF X;  2G3Q A;  1V92 A;  3SMS A;  1I4W A;  2KRU A;  2ZTC A;  3C3E A;  4GC5 A;  3KOY E;  4II7 A;  4KLN A;  3AOE C;  1HT1 E;  1KFV A;  1IN7 A;  1JQJ C;  1XXH B;  2CUZ A;  4OW0 A;  5EP2 A;  1HNZ M;  1IQP A;  3TWL A;  3DZD A;  4M9S A;  3SAW A;  2AHM A;  2FE8 A;  1XNR M;  4WUR A;  1ZMU A;  1ZV1 A;  2BNK A;  1Q3C A;  1HR0 M;  2MR9 A;  2Z8Y M;  4JV5 M;  2QNJ A;  3NBI A;  1P3Q Q;  4BLC A;  4IBC A;  4JXJ A;  1NVM A;  4AZF A;  2QHO B;  4LFA M;  1GL7 A;  3FRH A;  2HWJ A;  3GLF B;  1G41 A;  5FTL A;  3U5Z A;  2LBC A;  5F3W A;  1VEG A;  1SG9 A;  1IN4 A;  2XF3 A;  4DV2 M;  4MH0 E;  1QAN A;  4KT0 F;  3GLG E;  2F5P A;  1IM2 A;  3GPX A;  1DGB A;  4WP2 A;  3B74 A;  4B7H A;  1XHB A;  3FD9 A;  4F1I A;  1NHG C; 
#chains in the Genus database with same CATH homology
 4GMQ A;  3C58 A;  3GPU A;  1DGG A;  1IBM M;  2F5N A;  5DYI A;  1N32 M;  3QAU A;  2XZF A;  3VDP A;  1L2C A;  1DGH B;  1HNX M;  2R45 A;  4AQY M;  5ITX E;  3LQR A;  3I4V A;  3KS8 A;  3KDS E;  2KA6 B;  2KW0 A;  4AG6 A;  4NRV A;  2DWN A;  5ITU A;  2EO2 A;  2I7P A;  4XGI A;  2R62 A;  3B9P A;  4LRS A;  3SHF A;  4JI2 M;  5FTN A;  4HLQ A;  3E4R A;  5C1B A;  3VLF B;  2XLJ A;  1QAO A;  4REZ A;  5FTM A;  4XBO A;  2BJV A;  2DVW B;  5LMU M;  5LMN M;  2E5L M;  1HT2 E;  3KVW A;  3UK6 A;  1W5S A;  3U6S A;  1E32 A;  1QZM A;  5BPV A;  3FUU A;  1DGF A;  4I8O A;  2UUB M;  4B3M M;  2CE7 A;  4X62 M;  3H4M A;  4X66 M;  3GQ5 A;  4GRI A;  5EXS A;  4B3S M;  3Q8X A;  2P5T A;  3RE8 A;  4MGK E;  2VQF M;  5IT9 S;  3GLG B;  2R4J A;  4I81 A;  4M9X A;  1NNU C;  3SMP A;  4JI4 M;  2ZAM A;  1IN5 A;  3TE6 A;  5FSW A;  3OTO M;  3W0L B;  2XSZ A;  3GLI A;  3TL4 X;  2F5O A;  5KPT A;  4QHT A;  3SAU A;  1GLN A;  4NOO B;  1ZAE A;  4DV6 M;  5KPZ A;  1Q3B A;  2L6O A;  1UM8 A;  1J5E M;  1QYR A;  2DWL A;  3HHX A;  1DO0 A;  3VDU A;  4CIS A;  4M0D A;  4D82 A;  1K3W A;  4RNA A;  2W82 A;  4DR6 M;  2R65 A;  5FLX S;  1G4A E;  3JR4 A;  4G4R A;  1HQY E;  2QZ4 A;  8CAT A;  1N34 M;  3LMM A;  3RGS A;  4QNM A;  4M0W A;  4B7F A;  4OVZ A;  2XGN A;  4FWG A;  2YR0 A;  3M0E A;  2ZAO A;  4DR2 M;  4QOZ C;  3MHV C;  3HWS A;  2C9O A;  4BBA A;  1X37 A;  2ZAN A;  1OJL A;  3AOE A;  3FTD A;  4LG2 A;  4DR3 M;  2V1C A;  4IBF A;  4PT5 A;  2XH9 A;  3HU2 A;  4LGM A;  4M9Z A;  3GO8 A;  2QPA A;  2KZS A;  1NSF A;  2KEB A;  2L7H A;  5EP1 A;  3SHG B;  2J7O A;  2F4V M;  3KSJ A;  1TDH A;  3ZH9 B;  1GKI A;  4DV1 M;  3R8F A;  4GHA A;  2CHV A;  4FW9 A;  4JI3 M;  3AKZ A;  2QP9 X;  4NL4 H;  2EUC A;  3HJS A;  4L4U A;  3T1Y M;  4AW4 A;  3HHZ A;  3FTE A;  5ITQ A;  3DA1 A;  3SBJ A;  3THG A;  2HCB A;  4KOD A;  4MM3 B;  4QOS A;  1NHW C;  2D7E A;  3RGP A;  4NRW A;  4LJ8 A;  4QNR A;  3VKH A;  4B3R M;  2L09 A;  3ZCB B;  4R3D A;  1PJJ A;  3U6D A;  4K0K M;  3HHY A;  2FFJ A;  2UXB M;  1DO2 A;  3GP1 A;  3PNY A;  3TQS A;  4AI6 A;  4LCB A;  3L28 A;  3AFH A;  5EJC A;  1T3T A;  4LF7 M;  4FCT A;  3A42 A;  3FYC A;  4GKJ M;  2KRK A;  4KHP M;  2QEN A;  1L1T A;  2QBY B;  2Y21 A;  2EA0 A;  2R46 A;  1OFH A;  4EIW A;  1D2N A;  1N78 A;  1SXJ A;  3NWL A;  4DR4 M;  1XMQ M;  1W5T A;  3U60 B;  2YFQ A;  5EQT A;  4IBJ A;  3GPP A;  1SXJ E;  2DWZ B;  1L2B A;  4OU7 A;  1IXR C;  2Q2E B;  2Z7J A;  3UMM A;  2F5S A;  2KZU A;  4B08 A;  5KO3 A;  2Z4R A;  1IBK M;  1TH3 A;  3U6O A;  4LF6 M;  2G8L A;  4IBI A;  2RGH A;  2O5R A;  1XMO M;  3U61 B;  2HL7 A;  4ITQ A;  1HQC A;  5C18 A;  2CHG A;  3SAV A;  1NY6 A;  4IBD A;  4GHL A;  2OQ4 A;  2C99 A;  3LQQ A;  3PXG A;  3U6L A;  1SXJ D;  4YHH M;  2R18 A;  1R7R A;  1JR3 A;  2Z3X A;  2G5G X;  2XFT A;  1N36 M;  3R9X B;  3K92 A;  3LVW A;  2LWX A;  3FTC A;  1TH2 A;  3HJQ A;  2C96 A;  4JN6 A;  1ORY B;  4GC9 A;  2C98 A;  3KP1 E;  4DR5 M;  1N77 A;  1IXZ A;  3AL0 C;  5IRE B;  4X65 M;  3K1J A;  4MGH A;  3J81 S;  3U5Z B;  4L15 A;  3CF2 A;  3HGI A;  1G59 A;  4G6Z A;  5EP3 A;  4A3V B;  1SXJ B;  4JI8 M;  2CHQ A;  1NJG A;  4L78 A;  1Z5C A;  2RGO A;  4MGY E;  5FTK A;  1FJG M;  4DV5 M;  4LFB M;  4MGI E;  4LFC M;  2X49 A;  3ILK A;  3GQ3 A;  4LJ5 A;  3U6C A;  4LF9 M;  4X64 M;  2M60 A;  5JI3 E;  2FNA A;  3CF0 A;  5DYG A;  3SAT A;  2XFS A;  3HU1 A;  2DZO B;  1EE8 A;  3SC3 A;  2LH0 A;  1L8Q A;  3DOA A;  2OPF A;  4CHT B;  4FCW A;  4B7G A;  2FOI C;  1XXH A;  4OX9 M;  1IN8 A;  2HHH M;  3VK8 A;  7CAT A;  4D81 A;  2XSZ D;  2UXC M;  4WW0 A;  5EXX A;  2LXE A;  4IIW A;  5IWA M;  1QVR A;  3HJ8 A;  3PFI A;  3D8L A;  3RFW A;  4D80 A;  3SAS A;  4RF1 A;  4DUZ M;  3GPY A;  1Z5B A;  3FUV A;  3GLF A;  4LF8 M;  3E9S A;  3SAR A;  2UU9 M;  4JI7 M;  4TUW A;  3T15 A;  3KOX E;  2Y0T A;  5A2Q S;  2M5Z A;  3JAM S;  2DWM A;  4DUY M;  1YSY A;  1KYI A;  2UUA M;  1GVN A;  1S3S A;  4DR7 M;  2D7G A;  4LJA A;  3GLH A;  3GLI B;  3J7A S;  1PM5 A;  3KP0 E;  5ITR A;  4P16 A;  3KOW E;  3MJ5 A;  1Z59 A;  3L27 A;  2CV1 A;  4IJF A;  2VII A;  3QWL A;  1DGH A;  4LZZ A;  4HL4 A;  2D7H A;  3AJI B;  3FKE A;  2Z4S A;  3U6M A;  1N75 A;  3U6Q A;  4JI6 M;  1MX0 A;  2Y20 A;  1XNQ M;  4NSR A;  4LRT A;  5EXT A;  4FD2 A;  3VK7 A;  4PDG A;  3A98 B;  2R4E A;  5EP4 A;  4AKI A;  2DZN B;  3SYK A;  4JYA M;  1GL6 A;  3CTW B;  4R7G A;  2UXD M;  5FTJ A;  4I5S A;  4IJE A;  3M6A A;  3GRV A;  1MU5 A;  2CEA A;  3J2P B;  1IY1 A;  4OVZ B;  4MGZ E;  1YE9 A;  3TWM A;  4NXN M;  5KQD A;  3D8B A;  4LJ7 A;  3K2L A;  4DV3 M;  1TDZ A;  4Z6Y A;  4KO8 A;  3U6P A;  1Z6T A;  3GLG A;  1R6B X;  3L2A A;  4DV7 M;  3GRU A;  4LZJ A;  3HHW A;  4LJ4 A;  3L25 A;  3BOS A;  3FTF A;  1J09 A;  4IBK A;  3GQ4 A;  1QAQ A;  4DV4 M;  5E26 A;  3WHK A;  1QQW A;  4LJ9 A;  3FUX A;  4G4O A;  4Z8X A;  1I94 M;  5DNY A;  3VFD A;  5ITX A;  2HKJ A;  4YY3 M;  2A5Y B;  3GLH B;  1G8P A;  2I7N A;  1R2Z A;  4MB7 A;  1E9S A;  2J7N A;  3KS4 A;  5KPR A;  3J80 S;  4BB9 A;  1TH4 A;  4GIP A;  3ZC7 B;  2KXE A;  4AKG A;  2ZM6 M;  3IG8 A;  3J27 B;  3UZU A;  3GRR A;  2YQZ A;  1N33 M;  2XEP A;  1ZQ9 A;  4ZPX A;  1Q39 A;  2VQE M;  4NXM M;  5IZ7 D;  1E9R A;  1XWI A;  3HKP A;  3I4Y A;  1HNW M;  4CGY B;  1SXJ C;  2C9C A;  3HU3 A;  3U6E A;  4GKK M;  3I51 A;  1Z5A A;  5GKN A;  4I4L A;  2C5R A;  4LGY A;  1NJF A;  4FCV A;  2H1R A;  4AG5 A;  3VKG A;  4FVM A;  3TPZ A;  4JI0 M;  3KXE C;  5KQ8 A;  1E94 E;  1L2D A;  5ITY A;  4PCZ A;  4JI5 M;  1VDD A;  3J7B A;  3KSX A;  1R2Y A;  3MK6 A;  2UUC M;  2X4A A;  1PJI A;  2CV0 A;  2RKO A;  2DXI A;  1JR3 D;  1WXQ A;  1J7K A;  3UJN A;  1NY5 A;  2JA2 A;  3JR5 A;  4L8R C;  4IBG A;  4QHS A;  2ERC A;  2ZBK B;  3KW6 A;  2DHR A;  4AKH A;  2BJW A;  1QAM A;  3L29 A;  3PVS A;  4PDI A;  2X8A A;  1YUB A;  1NNJ A;  1K3X A;  3KOZ E;  4FWD A;  3KFU G;  4B3T M;  5ITT A;  3FUT A;  3W0F A;  3FUW A;  3K8Z A;  3SFZ A;  1LV7 A;  3EIE A;  3AV0 A;  3A45 A;  3IG5 A;  2V1U A;  3EIH A;  3M7G A;  4JI1 M;  2QCU A;  4GH9 A;  4IBE A;  4NSO B;  1FNN A;  2NQ8 C;  2QBY A;  3GRY A;  3T38 A;  4DR1 M;  3TWK A;  1IY0 A;  2Y0Q A;  2CV2 A;  5JI2 E;  2CFO A;  3PNV A;  4G4N A;  3U60 A;  4W5W A;  1TGU A;  2V6Z M;  3DFZ A;  3L26 A;  2XZU A;  3WHL A;  2F5Q A;  2K47 A;  4LF5 M;  4DV0 M;  5BR8 M;  4S12 A;  3FYD A;  3T1H M;  5EXP A;  1IN6 A;  4G4Q A;  4GIT A;  3LVV A;  3UGJ A;  4FWH A;  1IY2 A;  3A46 A;  2L7I A;  2LNH C;  1IBL M;  4IBB A;  1XC8 A;  1K82 A;  1OFI A;  1L1Z A;  4LJ6 A;  4L16 A;  3CF6 E;  1G3I A;  3U61 A;  2YNM D;  1H6U A;  3AOG A;  3SYL A;  5H37 D;  4RF0 A;  5E6J A;  1C1K A;  4PD2 A;  1IXS B;  4LY6 A;  1KSF X;  3SMS A;  1I4W A;  2KRU A;  4GC5 A;  3KOY E;  4II7 A;  4KLN A;  3AOE C;  1HT1 E;  1KFV A;  1IN7 A;  1JQJ C;  1XXH B;  2CUZ A;  4OW0 A;  5EP2 A;  1HNZ M;  1IQP A;  3TWL A;  3DZD A;  4M9S A;  3SAW A;  2AHM A;  2FE8 A;  1XNR M;  4WUR A;  2BNK A;  1Q3C A;  1HR0 M;  4JV5 M;  3NBI A;  4BLC A;  4IBC A;  4JXJ A;  1NVM A;  4AZF A;  4LFA M;  1GL7 A;  3GLF B;  1G41 A;  5FTL A;  3U5Z A;  5F3W A;  1IN4 A;  2XF3 A;  4DV2 M;  4MH0 E;  1QAN A;  2F5P A;  1IM2 A;  3GPX A;  1DGB A;  4B7H A;  1XHB A;  3FD9 A;  4LF4 M;  1NHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...