5IWAM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5iwaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5iwaM02
2HHHM 4X65M 1N34M 4B3MM 4LF4M 2F5PA 4LF7M 5IT9S 2ZBKB 4DV4M 1Q3BA 3SBJA 3GPUA 1KFVA 4NXNM 4NRWA 2UU9M 4DR5M 4LFAM 2EA0A 3VK7A 2UUBM 1IBMM 3SATA 3GPXA 4LF6M 1Z5AA 4DV1M 1K3XA 1IBLM 2F5NA 1NNJA 4AQYM 3U6MA 1XNRM 4JI1M 4PDGA 4JI5M 1L1TA 5LMUM 4JI4M 4JV5M 4DV3M 3TWLA 3J81S 4JYAM 5FLXS 4JI2M 2Q2EB 4LF9M 4X64M 5ITRA 2F4VM 4B3TM 4GKJM 2UXBM 2HKJA 3U6DA 3U6PA 3A45A 1R2ZA 1I94M 1TDZA 3U6QA 1R2YA 3A46A 1N36M 3GO8A 1XNQM 5ITXA 4G4NA 4LFBM 1Q3CA 1XMQM 4DUZM 3SAUA 2OPFA 4NRVA 4DR2M 3W0FA 5ITTA 4K0KM 3A42A 1PJIA 3SARA 3DOAA 1TDHA 2UUAM 3GPYA 2OQ4A 1HR0M 3TWMA 4G4OA 2UUCM 1PJJA 4DV6M 1IBKM 4DUYM 5A2QS 5ITUA 3TWKA 2F5QA 4CISA 2ZM6M 1HNZM 4DV7M 5IWAM 3U6CA 3SAWA 4G4QA 4G4RA 1L1ZA 3OTOM 2VQEM 3T1YM 4DR4M 4KHPM 1Q39A 4PD2A 5ITXE 4DV2M 4PDIA 1MU5A 4JI3M 3U6LA 4LF5M 4LF8M 1PM5A 3J80S 4X62M 5ITYA 1L2DA 1L2CA 1HNXM 2UXDM 2F5SA 1N33M 1Z59A 4DV0M 4MB7A 2XZFA 4JI0M 3J7AS 3VK8A 4YHHM 3JR4A 4PCZA 1EE8A 1K3WA 4YY3M 4OX9M 5BR8M 4JI7M 3U6OA 4JI6M 4B3SM 3GPPA 1N32M 4X66M 2VQFM 2XZUA 2E5LM 2F5OA 4NXMM 3GQ3A 4DR6M 1J5EM 3T1HM 3SAVA 3C58A 3U6EA 4B3RM 1XMOM 4LFCM 1HNWM 4DR3M 3GQ5A 4DR7M 1L2BA 1Z5CA 4JI8M 3GQ4A 2UXCM 3JAMS 4ITQA 3JR5A 4DV5M 1Z5BA 1FJGM 5LMNM 1K82A 1XC8A 3U6SA 3GP1A 3SASA 5ITQA 1MX0A 4GKKM 4DR1M
chains in the Genus database with same CATH superfamily
4FWDA 4KO8A 2J5YA 4L16A 4M0DA 2F5PA 3AV0A 2XSZD 4B7GA 3VFDA 3L2AA 3LVVA 4JXJA 4LG2A 3MJ5A 1Q3BA 1JQJC 5DYGA 3VDUA 2G3QA 1NY5A 4LGYA 4NXNM 2FH0A 3C3DA 4DR5M 4LFAM 2UU9M 4OVZB 3SATA 3CGWA 3HU3A 3FUTA 2V6ZM 2F5NA 2JY6B 1NNJA 1KYIA 2DI0A 2O5RA 3WHLA 4AQYM 1T43A 3KFUG 4LZJA 4JI4M 5DNYA 4DV3M 4W5WA 1SXJD 4LZZA 4QHTA 2Z7JA 1VQ1A 3CTWB 2CRUA 2WSEF 5FLXS 2J7NA 4II7A 4ZPXA 3RE8A 3K8ZA 4JI2M 4OW0A 3HY5A 4IBEA 2ZAMA 2XGNA 3QYBA 5ITRA 4B3TM 2JP7A 2UXBM 3LCVB 1NNUC 3HGIA 4MH0E 3HHYA 3FTEA 1IXSA 1IXZA 1JB0F 2CP8A 4KLNA 1GKIA 2D7GA 4IBGA 3GLIA 3E9SA 8CATA 1GO5A 4HL4A 3J27B 4AKHA 2I7PA 1KSFX 2C9CA 2NQ8C 3KOXE 2EJSA 5GKNA 2HL7A 5ITXA 4LJ8A 4BBAA 5KPTA 3WHKA 1UM8A 1TTEA 2L09A 2JZ1A 3B7NA 2AHMA 5BPVA 5ITTA 1WXQA 2Y21A 5EP3A 3A42A 2FFJA 1IY1A 2QP9X 2JY5A 4LRTA 2CV2A 2DWZB 3PNYA 3A98B 3AFHA 4AZFA 2XF3A 1DGHB 3GPYA 1HR0M 3QAUA 1NVMA 3Q8XA 1DO0A 4FWGA 4G4OA 1PJJA 2UUCM 1ZV1A 4HEOA 4D80A 5FTLA 5F3WA 2LXEA 3HJSA 5C1BA 1YSYA 2KRKA 3AOEA 3FTCA 3KP0E 1OFHA 3FUUA 4IBKA 4G4RA 1GJSA 4KHPM 5IREB 4G6ZA 3GRUA 4PD2A 4GMQA 5ITXE 4LY6A 3TQSA 2O25A 4F1IA 3MMPA 1QUTA 3L29A 4PDIA 1A5TA 1IN8A 3KDSE 2KEBA 4LJ6A 3KS8A 1QUSA 2UXDM 1Z59A 2R4JA 3CF0A 2XZFA 2YNMD 4XK8F 5EXTA 2LVOC 1FNNA 3J7AS 3VK8A 3JR4A 2EKFA 1K3WA 2APLA 4IIWA 2DZNB 1RU3A 4YY3M 1EFUB 4NSRA 1GL6A 4IJFA 5KQ8A 3GLGA 2YQZA 4B08A 4JI6M 2J7OA 1G71A 3KOYE 2R46A 2H5XA 3NBXX 3GLFA 4DR6M 3RFWA 4KODA 3HU1A 4B3RM 3ZCBB 1XMOM 4QHSA 3LQRA 2R65A 1JR3E 1HNWM 2XSZA 3U61A 2VIIA 1Z5CA 3FUXA 1TH2A 1XXHA 4GC5A 3HZJA 3IHPA 3L25A 1WGLA 4DV5M 1N77A 5H37D 2FS1A 5LMNM 1LV7A 4GKKM 3KSJA 4FCVA 1V92A 4NL4H 1IN4A 1SXJB 2CHGA 4AW4A 4B7FA 3GLGE 2RGHA 1JR3D 1SXJA 3FRHA 2CV1A 3K9PA 3GPUA 5EP2A 2DHRA 1IY2A 3E46A 4BB9A 1G4AE 2XEPA 1Z5AA 3I01M 4QOSA 3IG5A 4DV1M 3VKGA 3Q8GA 3UJNA 1IXRC 1L1TA 4RKUF 3HJQA 1PJTA 3TWLA 4AKIA 3KS4A 3J81S 3TE6A 4GHAA 1QAQA 3FD9A 2LWXA 4XBOA 1OJLA 3THGA 3BBZA 3HX3A 2XFSA 2L7HA 2R4EA 5EXSA 4M0WA 2W82A 2WZJA 1AIPC 4GIPA 1SXJE 3GRRA 1I94M 2X8AA 2KRUA 3U6QA 2VDBB 2DWMA 4LCBA 3W67A 2LH0A 2Y0QA 4L78A 1XNQM 2DAKA 1DO2A 2BWBA 3LQQA 3T15A 1G41A 2K47A 3H4MA 2EO2A 2XFTA 4QNRA 3SHFA 1VEGA 1ZMUA 4OVZA 1ZMWA 1NY6A 1XMQM 1WR1B 2BJWA 1NJFA 2KXEA 2LVPC 2QZ4A 2R6FA 2D7EA 3I04M 2BWEA 3KSXA 4NRVA 2OPFA 4ANRA 1DV0A 3SARA 3DOAA 4FCTA 4AG6A 1NV8A 2UUAM 4S12A 5EXPA 2KNZA 4MGYE 1BVSA 1IN6A 2DZLA 4MGKE 2RKOA 1QDTA 3TWKA 1D0KA 1PRBA 5DYIA 1E94E 2ZM6M 2HCBA 1EIJA 4M9SA 2CHVA 4KT0F 2MR9A 3SHGB 1MJGM 3EIHA 2OOAA 2CEAA 5DFLA 1TF0B 1WGNA 4LJ7A 2VQEM 1Q39A 4NSOB 1R7RA 2L7IA 1QAOA 4MGHA 2DAMA 3HJ8A 4DV2M 3B74A 3U6LA 4JI3M 2JZ0A 2CWBA 1NV9A 3J80S 2YR0A 3UZUA 1T3TA 2C99A 3LVWA 1L2DA 1V33A 1TR8A 2GNOA 3CF2A 1W5TA 2FOIC 4REZA 1ZAEA 3PXGA 5E6JA 4QOZC 1VEKA 2JY8A 2K0BX 1NO1A 2N35A 4JI7M 4NC6A 1DGBA 1DGHA 2CUZA 3LCUA 4B3SM 5EP4A 3GLHB 4LJ5A 1T6OA 3V76A 2DKLA 4X66M 4A3VB 2E5LM 2F5OA 5JI2E 4NXMM 1J5EM 3T1HM 2LBCA 4Y28F 4CJ6A 3SAVA 1TH3A 4LFCM 1TH4A 2MGWA 3GQ5A 1JR3A 3VDPA 2EKKA 3D8BA 2QENA 1C1KA 3VLFB 1J7KA 3EIEA 2LVNC 1XB2B 1XC8A 2V1UA 4TUWA 1GABA 4M9ZA 1QAMA 2L2DA 3FUVA 2KZUA 2JUJA 3SASA 1QQWA 2FNAA 4X65M 1N34M 5EP1A 4LF4M 2KA6B 3FTDA 1NSFA 5IT9S 3E4RA 3KOWE 4DV4M 3U60B 2CE7A 5FSWA 3IECA 2QPAA 2JY7A 4IBBA 2ZANA 2BJVA 4P17A 3HHZA 3HHXA 1P3QQ 2WSCF 2XH9A 2V1CA 2EA0A 3U60A 1HQCA 3GPXA 5KQDA 1QZMA 3KP1E 1OKSA 3K9OA 2DZOB 2X49A 1K3XA 3KOZE 3U6MA 1XNRM 4GHLA 4PDGA 4DBGB 4JI5M 4RF0A 1OIZA 1WJ7A 1PGYA 1V34A 3W0LB 2ZAOA 5KO3A 2R18A 2Y20A 3T38A 1R6BX 2G8LA 1HQYE 4G3OA 4LJ9A 1S3SA 4D82A 1N78A 3HKPA 2CHQA 3FRIA 3C9PA 4GKJM 2ZTCA 4IJEA 5L8RF 4LGMA 3U6DA 3A45A 3U6PA 1R2ZA 2CV0A 1TDZA 1Y8GA 2LTUA 3GO8A 3TL4X 2MROB 1IN7A 2HAKA 3CF6E 1ZMVA 4WURA 1G59A 3B89A 3ZH9B 3I4VA 1D0LA 1HT2E 2LVAA 2Y0TA 4IBCA 1ZQ9A 4P16A 4G4NA 1GVNA 1IFYA 4LFBM 4DUZM 3PVSA 2HWJA 3BXWA 1F4IA 3W0FA 4K0KM 3ILKA 3QYEA 2ZTDA 4EIWA 1E9RA 4R71A 2OQ4A 3BOSA 2OOBA 1IY0A 2OO9A 4CHTB 3TWMA 4DV6M 1PJSA 5A2QS 4DUYM 2F5QA 4CISA 4D81A 2D7HA 4DV7M 3AOGA 3MK6A 5FTMA 1PJQA 5IWAM 4G4QA 3PFIA 3SAWA 1L1ZA 3OTOM 5FTKA 4QNMA 3R9XB 4L8RC 3SYKA 1MU5A 4LF8M 3SC3A 1PM5A 3DA1A 1W5SA 4LRSA 4X62M 2QBYB 5ITYA 5IZ7D 2KNVA 1LTMA 3E21A 2X4AA 2QBYA 2VF7A 1N33M 4MB7A 1VDLA 4I4LA 2I7NA 2H1RA 2O01F 1XHBA 3FE3A 4MGZE 3GRYA 3HU2A 4IBDA 4JI0M 2DNAA 4I5SA 2JWSA 1VG5A 2LHCA 3MHVC 3R8FA 1D0MA 3NBIA 2M60A 3U6OA 1GLNA 1N32M 3KVWA 2VQFM 1Z6TA 3FKEA 3GQ3A 3I51A 1VEJA 3ZC7B 4AKGA 1L8QA 3B7QA 5EXXA 1IM2A 4CGYB 4FVMA 3C58A 2RGOA 3QWLA 4DR3M 2JXNA 3IG8A 7CATA 4WW0A 4DR7M 3LMMA 3ZQJA 1G3IA 2DAIA 2Z8YM 4B7HA 2UXCM 1HJPA 3FYDA 1N75A 3F92A 3L27A 3I4YA 4FW9A 3DZDA 1ORYB 3M7GA 1IQPA 3PNVA 3SFZA 3RGSA 1OIPA 1R4GA 3AOEC 5C18A 4GEWA 1IXSB 4DR1M 3KW6A 3GLIB 5FTJA 2HHHM 4B3MM 2YFQA 4AI6A 3HWSA 2L6OA 2QNJA 3NWLA 2JA2A 4LF7M 2ZBKB 2JNHA 5EJCA 1OQYA 4FD2A 3SBJA 1OAOC 1KFVA 1J09A 2KHHA 2Z3XA 1G8PA 1CUKA 1XWIA 2MJ5B 3SMSA 3VK7A 4NRWA 2CFOA 5JI3E 2QSFX 2UUBM 1IBMM 4MM3B 3FTFA 2C9OA 2K9DA 4LF6M 5EQTA 3GLHA 1Q02A 1IBLM 4PT5A 4FWHA 1TGUA 1X37A 4Q7JA 4L15A 4JI1M 1E9SA 4JN6A 2M5ZA 2A5YB 4L6V6 5LMUM 4JV5M 2Z4RA 3L28A 3L26A 5KPZA 4NOOB 4R3DA 4GRIA 4MGIE 4JYAM 2L4FA 3AL0C 2Q2EB 1GJTA 2RRUA 4LF9M 1QDRA 4X64M 1VDDA 4OU7A 2F4VM 3C3EA 2R0IA 2R44A 4WP2A 2HKJA 3J2PB 3GLIE 2B3TA 1HT1E 2DAGA 3GRVA 2LVQD 4AG5A 3RGPA 1YUBA 2DENA 3UMMA 3A46A 2WSFF 1R2YA 1DGFA 1N36M 2ERCA 3SYLA 4BLCA 2LHGA 2KNAA 3GLHE 2DWNA 1OTRA 2DXIA 4HLQA 1D2NA 3VKHA 3K92A 2R62A 4GH9A 1Q3CA 3FYCA 2DVWB 3T6PA 3SAUA 3K1JA 3UGJA 4DR2M 1QZEA 1OAIA 4IBJA 4L4UA 3J7BA 1SXJC 1E32A 1PJIA 2DWLA 1SG9A 4UN2B 3GLGB 1C7YA 1DGGA 2MH8A 1TDHA 1QYRA 2R45A 2QHOB 3M6AA 1IN5A 5E26A 2K6BA 2Z4SA 1IBKM 5ITUA 3GLFB 1HNZM 3DFZA 1OFIA 4IBIA 3KXEC 2FE8A 3U6CA 4I81A 4RF1A 3T1YM 3U61B 4DR4M 4LJ4A 3TPZA 2L4EA 5FTNA 2XLJA 1XXHB 3AJIB 4Z6YA 3FUWA 1H6UA 2GQFA 4LF5M 3LW5F 3H4JA 4CIZA 2KW0A 3U5ZB 2KZSA 4GC9A 1L2CA 1HNXM 4GITA 1NHGC 2F5SA 1AUAA 1NJGA 4DV0M 3D8LA 1NHWC 3SMPA 3U5ZA 3AKZA 2DAEA 4PCZA 4YHHM 1EE8A 3M0EA 4RNAA 3B7ZA 4OX9M 1MN3A 5BR8M 4Z8XA 3UK6A 2C5RA 3GPPA 2C98A 3GLFE 1UFZA 2XZUA 1I4WA 2QQ8A 2DHYA 1R5LA 4XGIA 4IBFA 1WHCA 2LNHC 2BNKA 2KDLA 3U6EA 3K2LA 1WIVA 4M9XA 3HHWA 4F2LA 1XXHE 1L2BA 1YLAA 4LJAA 3GQ4A 4JI8M 1QANA 4I8OA 3JAMS 4ITQA 1GL7A 3JR5A 5KPRA 2P5TA 1Z5BA 2C96A 2QCUA 1K82A 1FJGM 2G5GX 3B9PA 4R7GA 3W68A 3U6SA 3GP1A 1YE9A 2EUCA 5ITQA 1MX0A 1QVRA 2VF8A 4FCWA
chains in the Genus database with same CATH topology
4FWDA 4KO8A 4L16A 4M0DA 2F5PA 3AV0A 2XSZD 4B7GA 3VFDA 3L2AA 3LVVA 4JXJA 4LG2A 3MJ5A 1Q3BA 1JQJC 5DYGA 3VDUA 1NY5A 4LGYA 4NXNM 2UU9M 4DR5M 4LFAM 4OVZB 3SATA 3HU3A 3FUTA 2V6ZM 2F5NA 1NNJA 1KYIA 2O5RA 3WHLA 4AQYM 3KFUG 4LZJA 4JI4M 5DNYA 4DV3M 4W5WA 1SXJD 4LZZA 4QHTA 2Z7JA 3CTWB 5FLXS 2J7NA 4II7A 4ZPXA 3RE8A 3K8ZA 4JI2M 4OW0A 4IBEA 2ZAMA 2XGNA 5ITRA 4B3TM 2UXBM 1NNUC 3HGIA 4MH0E 3HHYA 3FTEA 1IXZA 4KLNA 3GLIA 1GKIA 2D7GA 4IBGA 3E9SA 8CATA 4HL4A 3J27B 4AKHA 2I7PA 1KSFX 2C9CA 2NQ8C 3KOXE 5GKNA 2HL7A 5ITXA 4LJ8A 4BBAA 5KPTA 3WHKA 1UM8A 2L09A 2AHMA 5BPVA 5ITTA 1WXQA 2Y21A 5EP3A 3A42A 2FFJA 1IY1A 2QP9X 4LRTA 2CV2A 2DWZB 3PNYA 3A98B 3AFHA 4AZFA 2XF3A 1DGHB 3GPYA 1HR0M 3QAUA 1NVMA 3Q8XA 1DO0A 4FWGA 4G4OA 1PJJA 2UUCM 4D80A 5FTLA 5F3WA 2LXEA 3HJSA 5C1BA 1YSYA 2KRKA 3AOEA 3FTCA 3KP0E 1OFHA 3FUUA 4IBKA 4G4RA 4KHPM 5IREB 4G6ZA 3GRUA 4PD2A 4GMQA 5ITXE 4LY6A 3TQSA 4PDIA 3L29A 1IN8A 3KDSE 2KEBA 4LJ6A 3KS8A 2UXDM 1Z59A 2R4JA 3CF0A 2XZFA 2YNMD 5EXTA 1FNNA 3J7AS 3VK8A 3JR4A 1K3WA 4YY3M 4IIWA 2DZNB 4NSRA 1GL6A 4IJFA 5KQ8A 3GLGA 2YQZA 4B08A 4JI6M 2J7OA 3KOYE 2R46A 3GLFA 4DR6M 3RFWA 4KODA 3HU1A 4B3RM 3ZCBB 1XMOM 4QHSA 3LQRA 2R65A 1HNWM 2XSZA 3U61A 2VIIA 1Z5CA 3FUXA 1TH2A 1XXHA 4GC5A 3L25A 4DV5M 1N77A 5H37D 5LMNM 1LV7A 4GKKM 3KSJA 4FCVA 4NL4H 1IN4A 1SXJB 2CHGA 4AW4A 4B7FA 2RGHA 1JR3D 1SXJA 2CV1A 3GPUA 5EP2A 2DHRA 1IY2A 4BB9A 1G4AE 2XEPA 1Z5AA 4QOSA 3IG5A 4DV1M 3VKGA 3UJNA 1IXRC 1L1TA 3HJQA 3TWLA 4AKIA 3KS4A 3J81S 3TE6A 4GHAA 1QAQA 3FD9A 2LWXA 4XBOA 1OJLA 3THGA 2XFSA 2L7HA 2R4EA 5EXSA 4M0WA 2W82A 4GIPA 1SXJE 3GRRA 1I94M 2X8AA 2KRUA 3U6QA 2DWMA 4LCBA 2LH0A 2Y0QA 4L78A 1XNQM 1DO2A 3LQQA 3T15A 1G41A 2K47A 3H4MA 2EO2A 2XFTA 4QNRA 3SHFA 4OVZA 1NY6A 1XMQM 2BJWA 1NJFA 2KXEA 2QZ4A 2OPFA 3KSXA 2D7EA 4NRVA 3SARA 3DOAA 4FCTA 4AG6A 2UUAM 4S12A 5EXPA 4MGYE 1IN6A 3TWKA 4MGKE 2RKOA 5DYIA 1E94E 2ZM6M 2HCBA 4M9SA 2CHVA 3SHGB 3EIHA 2CEAA 2VQEM 4LJ7A 1Q39A 4NSOB 1R7RA 2L7IA 1QAOA 4MGHA 3HJ8A 4DV2M 3U6LA 4JI3M 3J80S 2YR0A 3UZUA 1T3TA 2C99A 3LVWA 1L2DA 3CF2A 1W5TA 2FOIC 4REZA 1ZAEA 3PXGA 5E6JA 4QOZC 4JI7M 1DGBA 1DGHA 2CUZA 4B3SM 5EP4A 3GLHB 4LJ5A 4X66M 4A3VB 2E5LM 2F5OA 4NXMM 5JI2E 1J5EM 3T1HM 3SAVA 1TH3A 4LFCM 1TH4A 3GQ5A 1JR3A 3VDPA 3D8BA 2QENA 1C1KA 3VLFB 1J7KA 3EIEA 1XC8A 2V1UA 4TUWA 4M9ZA 1QAMA 3FUVA 2KZUA 3SASA 1QQWA 2FNAA 4X65M 1N34M 5EP1A 4LF4M 2KA6B 3FTDA 1NSFA 5IT9S 3E4RA 3KOWE 4DV4M 3U60B 2CE7A 5FSWA 2QPAA 4IBBA 2ZANA 2BJVA 3HHZA 3HHXA 3U60A 2EA0A 2XH9A 2V1CA 1HQCA 3GPXA 5KQDA 1QZMA 3KP1E 1K3XA 2DZOB 2X49A 3KOZE 3U6MA 1XNRM 4GHLA 4PDGA 4JI5M 4RF0A 3W0LB 2ZAOA 5KO3A 2R18A 2Y20A 3T38A 1R6BX 2G8LA 1HQYE 4LJ9A 1S3SA 4D82A 1N78A 3HKPA 2CHQA 4GKJM 4IJEA 4LGMA 3U6DA 3A45A 3U6PA 1R2ZA 2CV0A 1TDZA 3GO8A 3TL4X 1IN7A 3CF6E 4WURA 1G59A 3ZH9B 3I4VA 1HT2E 4IBCA 2Y0TA 4P16A 1ZQ9A 4G4NA 1GVNA 4LFBM 4DUZM 3PVSA 3W0FA 4K0KM 3ILKA 4EIWA 1E9RA 2OQ4A 3BOSA 1IY0A 4CHTB 3TWMA 4DV6M 4DUYM 5A2QS 2F5QA 4CISA 4D81A 2D7HA 4DV7M 3AOGA 3MK6A 5FTMA 5IWAM 4G4QA 3SAWA 3PFIA 1L1ZA 3OTOM 5FTKA 4QNMA 3R9XB 4L8RC 3SYKA 1MU5A 4LF8M 3SC3A 1PM5A 3DA1A 1W5SA 4LRSA 4X62M 2QBYB 5ITYA 5IZ7D 2X4AA 2QBYA 1N33M 4MB7A 4I4LA 2I7NA 2H1RA 4MGZE 1XHBA 4JI0M 3GRYA 3HU2A 4IBDA 4I5SA 3MHVC 3R8FA 3NBIA 2M60A 3U6OA 1GLNA 1N32M 3KVWA 2VQFM 1Z6TA 3FKEA 3GQ3A 3I51A 3ZC7B 4AKGA 1L8QA 5EXXA 1IM2A 4CGYB 4FVMA 3C58A 2RGOA 3QWLA 4DR3M 3IG8A 7CATA 4WW0A 4DR7M 3LMMA 1G3IA 4B7HA 2UXCM 3FYDA 1N75A 3L27A 4FW9A 3I4YA 3DZDA 1ORYB 3M7GA 1IQPA 3PNVA 3SFZA 3RGSA 3AOEC 5C18A 1IXSB 4DR1M 3KW6A 3GLIB 5FTJA 2HHHM 4B3MM 2YFQA 4AI6A 3HWSA 2L6OA 3NWLA 2JA2A 4LF7M 2ZBKB 5EJCA 4FD2A 3SBJA 1KFVA 1J09A 2Z3XA 1G8PA 1XWIA 3SMSA 4NRWA 3VK7A 2CFOA 5JI3E 2UUBM 1IBMM 4MM3B 3FTFA 2C9OA 4LF6M 5EQTA 3GLHA 1IBLM 4PT5A 4FWHA 1TGUA 1X37A 4L15A 4JI1M 1E9SA 4JN6A 2M5ZA 2A5YB 4JV5M 5LMUM 2Z4RA 3L28A 3L26A 5KPZA 4NOOB 4R3DA 4GRIA 4MGIE 4JYAM 3AL0C 2Q2EB 4LF9M 4X64M 4OU7A 1VDDA 2F4VM 2HKJA 3J2PB 1HT1E 3GRVA 4AG5A 3RGPA 1YUBA 3A46A 3UMMA 1R2YA 1N36M 1DGFA 2ERCA 3SYLA 4BLCA 2DWNA 2DXIA 4HLQA 1D2NA 3VKHA 3K92A 2R62A 4GH9A 1Q3CA 3FYCA 2DVWB 3SAUA 3K1JA 3UGJA 4DR2M 4L4UA 4IBJA 3J7BA 1SXJC 1E32A 1PJIA 2DWLA 3GLGB 1DGGA 1TDHA 1QYRA 2R45A 3M6AA 5E26A 1IN5A 2Z4SA 1IBKM 5ITUA 3GLFB 1HNZM 3DFZA 1OFIA 4IBIA 3KXEC 2FE8A 3U6CA 4I81A 4RF1A 3T1YM 3U61B 4DR4M 4LJ4A 3TPZA 5FTNA 2XLJA 1XXHB 3AJIB 4Z6YA 3FUWA 1H6UA 4LF5M 2KW0A 3U5ZB 2KZSA 4GC9A 1L2CA 1HNXM 4GITA 1NHGC 2F5SA 1NJGA 4DV0M 3D8LA 1NHWC 3SMPA 3U5ZA 3AKZA 4PCZA 4YHHM 1EE8A 3M0EA 4RNAA 4OX9M 5BR8M 4Z8XA 3UK6A 2C5RA 3GPPA 2C98A 2XZUA 1I4WA 4XGIA 4IBFA 2LNHC 2BNKA 3U6EA 3K2LA 4M9XA 3HHWA 1L2BA 4LJAA 3GQ4A 4JI8M 1QANA 4I8OA 3JAMS 4ITQA 1GL7A 3JR5A 5KPRA 2P5TA 1Z5BA 2C96A 2QCUA 1K82A 1FJGM 2G5GX 3B9PA 4R7GA 3U6SA 3GP1A 1YE9A 2EUCA 5ITQA 1MX0A 1QVRA 4FCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH M;  4X65 M;  1N34 M;  4B3M M;  4LF4 M;  2F5P A;  4LF7 M;  5IT9 S;  2ZBK B;  4DV4 M;  1Q3B A;  3SBJ A;  3GPU A;  1KFV A;  4NXN M;  4NRW A;  2UU9 M;  4DR5 M;  4LFA M;  2EA0 A;  3VK7 A;  2UUB M;  1IBM M;  3SAT A;  3GPX A;  4LF6 M;  1Z5A A;  4DV1 M;  1K3X A;  1IBL M;  2F5N A;  1NNJ A;  4AQY M;  3U6M A;  1XNR M;  4JI1 M;  4PDG A;  4JI5 M;  1L1T A;  5LMU M;  4JI4 M;  4JV5 M;  4DV3 M;  3TWL A;  3J81 S;  4JYA M;  5FLX S;  4JI2 M;  2Q2E B;  4LF9 M;  4X64 M;  5ITR A;  2F4V M;  4B3T M;  4GKJ M;  2UXB M;  2HKJ A;  3U6D A;  3U6P A;  3A45 A;  1R2Z A;  1I94 M;  1TDZ A;  3U6Q A;  1R2Y A;  3A46 A;  1N36 M;  3GO8 A;  1XNQ M;  5ITX A;  4G4N A;  4LFB M;  1Q3C A;  1XMQ M;  4DUZ M;  3SAU A;  2OPF A;  4NRV A;  4DR2 M;  3W0F A;  5ITT A;  4K0K M;  3A42 A;  1PJI A;  3SAR A;  3DOA A;  1TDH A;  2UUA M;  3GPY A;  2OQ4 A;  1HR0 M;  3TWM A;  4G4O A;  2UUC M;  1PJJ A;  4DV6 M;  1IBK M;  4DUY M;  5A2Q S;  5ITU A;  3TWK A;  2F5Q A;  4CIS A;  2ZM6 M;  1HNZ M;  4DV7 M;  5IWA M;  3U6C A;  3SAW A;  4G4Q A;  4G4R A;  1L1Z A;  3OTO M;  2VQE M;  3T1Y M;  4DR4 M;  4KHP M;  1Q39 A;  4PD2 A;  5ITX E;  4DV2 M;  4PDI A;  1MU5 A;  4JI3 M;  3U6L A;  4LF5 M;  4LF8 M;  1PM5 A;  3J80 S;  4X62 M;  5ITY A;  1L2D A;  1L2C A;  1HNX M;  2UXD M;  2F5S A;  1N33 M;  1Z59 A;  4DV0 M;  4MB7 A;  2XZF A;  4JI0 M;  3J7A S;  3VK8 A;  4YHH M;  3JR4 A;  4PCZ A;  1EE8 A;  1K3W A;  4YY3 M;  4OX9 M;  5BR8 M;  4JI7 M;  3U6O A;  4JI6 M;  4B3S M;  3GPP A;  1N32 M;  4X66 M;  2VQF M;  2XZU A;  2E5L M;  2F5O A;  4NXM M;  3GQ3 A;  4DR6 M;  1J5E M;  3T1H M;  3SAV A;  3C58 A;  3U6E A;  4B3R M;  1XMO M;  4LFC M;  1HNW M;  4DR3 M;  3GQ5 A;  4DR7 M;  1L2B A;  1Z5C A;  4JI8 M;  3GQ4 A;  2UXC M;  3JAM S;  4ITQ A;  3JR5 A;  4DV5 M;  1Z5B A;  1FJG M;  5LMN M;  1K82 A;  1XC8 A;  3U6S A;  3GP1 A;  3SAS A;  5ITQ A;  1MX0 A;  4GKK M;  4DR1 M; 
#chains in the Genus database with same CATH topology
 4FWD A;  4KO8 A;  2J5Y A;  4L16 A;  4M0D A;  2F5P A;  3AV0 A;  2XSZ D;  4B7G A;  3VFD A;  3L2A A;  3LVV A;  4JXJ A;  4LG2 A;  3MJ5 A;  1Q3B A;  1JQJ C;  5DYG A;  3VDU A;  2G3Q A;  1NY5 A;  4LGY A;  4NXN M;  2FH0 A;  3C3D A;  4DR5 M;  4LFA M;  2UU9 M;  4OVZ B;  3SAT A;  3CGW A;  3HU3 A;  3FUT A;  2V6Z M;  2F5N A;  2JY6 B;  1NNJ A;  1KYI A;  2DI0 A;  2O5R A;  3WHL A;  4AQY M;  1T43 A;  3KFU G;  4LZJ A;  4JI4 M;  5DNY A;  4DV3 M;  4W5W A;  1SXJ D;  4LZZ A;  4QHT A;  2Z7J A;  1VQ1 A;  3CTW B;  2CRU A;  2WSE F;  5FLX S;  2J7N A;  4II7 A;  4ZPX A;  3RE8 A;  3K8Z A;  4JI2 M;  4OW0 A;  3HY5 A;  4IBE A;  2ZAM A;  2XGN A;  3QYB A;  5ITR A;  4B3T M;  2JP7 A;  2UXB M;  3LCV B;  1NNU C;  3HGI A;  4MH0 E;  3HHY A;  3FTE A;  1IXS A;  1IXZ A;  1JB0 F;  2CP8 A;  4KLN A;  1GKI A;  2D7G A;  4IBG A;  3GLI A;  3E9S A;  8CAT A;  1GO5 A;  4HL4 A;  3J27 B;  4AKH A;  2I7P A;  1KSF X;  2C9C A;  2NQ8 C;  3KOX E;  2EJS A;  5GKN A;  2HL7 A;  5ITX A;  4LJ8 A;  4BBA A;  5KPT A;  3WHK A;  1UM8 A;  1TTE A;  2L09 A;  2JZ1 A;  3B7N A;  2AHM A;  5BPV A;  5ITT A;  1WXQ A;  2Y21 A;  5EP3 A;  3A42 A;  2FFJ A;  1IY1 A;  2QP9 X;  2JY5 A;  4LRT A;  2CV2 A;  2DWZ B;  3PNY A;  3A98 B;  3AFH A;  4AZF A;  2XF3 A;  1DGH B;  3GPY A;  1HR0 M;  3QAU A;  1NVM A;  3Q8X A;  1DO0 A;  4FWG A;  4G4O A;  1PJJ A;  2UUC M;  1ZV1 A;  4HEO A;  4D80 A;  5FTL A;  5F3W A;  2LXE A;  3HJS A;  5C1B A;  1YSY A;  2KRK A;  3AOE A;  3FTC A;  3KP0 E;  1OFH A;  3FUU A;  4IBK A;  4G4R A;  1GJS A;  4KHP M;  5IRE B;  4G6Z A;  3GRU A;  4PD2 A;  4GMQ A;  5ITX E;  4LY6 A;  3TQS A;  2O25 A;  4F1I A;  3MMP A;  1QUT A;  3L29 A;  4PDI A;  1A5T A;  1IN8 A;  3KDS E;  2KEB A;  4LJ6 A;  3KS8 A;  1QUS A;  2UXD M;  1Z59 A;  2R4J A;  3CF0 A;  2XZF A;  2YNM D;  4XK8 F;  5EXT A;  2LVO C;  1FNN A;  3J7A S;  3VK8 A;  3JR4 A;  2EKF A;  1K3W A;  2APL A;  4IIW A;  2DZN B;  1RU3 A;  4YY3 M;  1EFU B;  4NSR A;  1GL6 A;  4IJF A;  5KQ8 A;  3GLG A;  2YQZ A;  4B08 A;  4JI6 M;  2J7O A;  1G71 A;  3KOY E;  2R46 A;  2H5X A;  3NBX X;  3GLF A;  4DR6 M;  3RFW A;  4KOD A;  3HU1 A;  4B3R M;  3ZCB B;  1XMO M;  4QHS A;  3LQR A;  2R65 A;  1JR3 E;  1HNW M;  2XSZ A;  3U61 A;  2VII A;  1Z5C A;  3FUX A;  1TH2 A;  1XXH A;  4GC5 A;  3HZJ A;  3IHP A;  3L25 A;  1WGL A;  4DV5 M;  1N77 A;  5H37 D;  2FS1 A;  5LMN M;  1LV7 A;  4GKK M;  3KSJ A;  4FCV A;  1V92 A;  4NL4 H;  1IN4 A;  1SXJ B;  2CHG A;  4AW4 A;  4B7F A;  3GLG E;  2RGH A;  1JR3 D;  1SXJ A;  3FRH A;  2CV1 A;  3K9P A;  3GPU A;  5EP2 A;  2DHR A;  1IY2 A;  3E46 A;  4BB9 A;  1G4A E;  2XEP A;  1Z5A A;  3I01 M;  4QOS A;  3IG5 A;  4DV1 M;  3VKG A;  3Q8G A;  3UJN A;  1IXR C;  1L1T A;  4RKU F;  3HJQ A;  1PJT A;  3TWL A;  4AKI A;  3KS4 A;  3J81 S;  3TE6 A;  4GHA A;  1QAQ A;  3FD9 A;  2LWX A;  4XBO A;  1OJL A;  3THG A;  3BBZ A;  3HX3 A;  2XFS A;  2L7H A;  2R4E A;  5EXS A;  4M0W A;  2W82 A;  2WZJ A;  1AIP C;  4GIP A;  1SXJ E;  3GRR A;  1I94 M;  2X8A A;  2KRU A;  3U6Q A;  2VDB B;  2DWM A;  4LCB A;  3W67 A;  2LH0 A;  2Y0Q A;  4L78 A;  1XNQ M;  2DAK A;  1DO2 A;  2BWB A;  3LQQ A;  3T15 A;  1G41 A;  2K47 A;  3H4M A;  2EO2 A;  2XFT A;  4QNR A;  3SHF A;  1VEG A;  1ZMU A;  4OVZ A;  1ZMW A;  1NY6 A;  1XMQ M;  1WR1 B;  2BJW A;  1NJF A;  2KXE A;  2LVP C;  2QZ4 A;  2R6F A;  2D7E A;  3I04 M;  2BWE A;  3KSX A;  4NRV A;  2OPF A;  4ANR A;  1DV0 A;  3SAR A;  3DOA A;  4FCT A;  4AG6 A;  1NV8 A;  2UUA M;  4S12 A;  5EXP A;  2KNZ A;  4MGY E;  1BVS A;  1IN6 A;  2DZL A;  4MGK E;  2RKO A;  1QDT A;  3TWK A;  1D0K A;  1PRB A;  5DYI A;  1E94 E;  2ZM6 M;  2HCB A;  1EIJ A;  4M9S A;  2CHV A;  4KT0 F;  2MR9 A;  3SHG B;  1MJG M;  3EIH A;  2OOA A;  2CEA A;  5DFL A;  1TF0 B;  1WGN A;  4LJ7 A;  2VQE M;  1Q39 A;  4NSO B;  1R7R A;  2L7I A;  1QAO A;  4MGH A;  2DAM A;  3HJ8 A;  4DV2 M;  3B74 A;  3U6L A;  4JI3 M;  2JZ0 A;  2CWB A;  1NV9 A;  3J80 S;  2YR0 A;  3UZU A;  1T3T A;  2C99 A;  3LVW A;  1L2D A;  1V33 A;  1TR8 A;  2GNO A;  3CF2 A;  1W5T A;  2FOI C;  4REZ A;  1ZAE A;  3PXG A;  5E6J A;  4QOZ C;  1VEK A;  2JY8 A;  2K0B X;  1NO1 A;  2N35 A;  4JI7 M;  4NC6 A;  1DGB A;  1DGH A;  2CUZ A;  3LCU A;  4B3S M;  5EP4 A;  3GLH B;  4LJ5 A;  1T6O A;  3V76 A;  2DKL A;  4X66 M;  4A3V B;  2E5L M;  2F5O A;  5JI2 E;  4NXM M;  1J5E M;  3T1H M;  2LBC A;  4Y28 F;  4CJ6 A;  3SAV A;  1TH3 A;  4LFC M;  1TH4 A;  2MGW A;  3GQ5 A;  1JR3 A;  3VDP A;  2EKK A;  3D8B A;  2QEN A;  1C1K A;  3VLF B;  1J7K A;  3EIE A;  2LVN C;  1XB2 B;  1XC8 A;  2V1U A;  4TUW A;  1GAB A;  4M9Z A;  1QAM A;  2L2D A;  3FUV A;  2KZU A;  2JUJ A;  3SAS A;  1QQW A;  2FNA A;  4X65 M;  1N34 M;  5EP1 A;  4LF4 M;  2KA6 B;  3FTD A;  1NSF A;  5IT9 S;  3E4R A;  3KOW E;  4DV4 M;  3U60 B;  2CE7 A;  5FSW A;  3IEC A;  2QPA A;  2JY7 A;  4IBB A;  2ZAN A;  2BJV A;  4P17 A;  3HHZ A;  3HHX A;  1P3Q Q;  2WSC F;  2XH9 A;  2V1C A;  2EA0 A;  3U60 A;  1HQC A;  3GPX A;  5KQD A;  1QZM A;  3KP1 E;  1OKS A;  3K9O A;  2DZO B;  2X49 A;  1K3X A;  3KOZ E;  3U6M A;  1XNR M;  4GHL A;  4PDG A;  4DBG B;  4JI5 M;  4RF0 A;  1OIZ A;  1WJ7 A;  1PGY A;  1V34 A;  3W0L B;  2ZAO A;  5KO3 A;  2R18 A;  2Y20 A;  3T38 A;  1R6B X;  2G8L A;  1HQY E;  4G3O A;  4LJ9 A;  1S3S A;  4D82 A;  1N78 A;  3HKP A;  2CHQ A;  3FRI A;  3C9P A;  4GKJ M;  2ZTC A;  4IJE A;  5L8R F;  4LGM A;  3U6D A;  3A45 A;  3U6P A;  1R2Z A;  2CV0 A;  1TDZ A;  1Y8G A;  2LTU A;  3GO8 A;  3TL4 X;  2MRO B;  1IN7 A;  2HAK A;  3CF6 E;  1ZMV A;  4WUR A;  1G59 A;  3B89 A;  3ZH9 B;  3I4V A;  1D0L A;  1HT2 E;  2LVA A;  2Y0T A;  4IBC A;  1ZQ9 A;  4P16 A;  4G4N A;  1GVN A;  1IFY A;  4LFB M;  4DUZ M;  3PVS A;  2HWJ A;  3BXW A;  1F4I A;  3W0F A;  4K0K M;  3ILK A;  3QYE A;  2ZTD A;  4EIW A;  1E9R A;  4R71 A;  2OQ4 A;  3BOS A;  2OOB A;  1IY0 A;  2OO9 A;  4CHT B;  3TWM A;  4DV6 M;  1PJS A;  5A2Q S;  4DUY M;  2F5Q A;  4CIS A;  4D81 A;  2D7H A;  4DV7 M;  3AOG A;  3MK6 A;  5FTM A;  1PJQ A;  5IWA M;  4G4Q A;  3PFI A;  3SAW A;  1L1Z A;  3OTO M;  5FTK A;  4QNM A;  3R9X B;  4L8R C;  3SYK A;  1MU5 A;  4LF8 M;  3SC3 A;  1PM5 A;  3DA1 A;  1W5S A;  4LRS A;  4X62 M;  2QBY B;  5ITY A;  5IZ7 D;  2KNV A;  1LTM A;  3E21 A;  2X4A A;  2QBY A;  2VF7 A;  1N33 M;  4MB7 A;  1VDL A;  4I4L A;  2I7N A;  2H1R A;  2O01 F;  1XHB A;  3FE3 A;  4MGZ E;  3GRY A;  3HU2 A;  4IBD A;  4JI0 M;  2DNA A;  4I5S A;  2JWS A;  1VG5 A;  2LHC A;  3MHV C;  3R8F A;  1D0M A;  3NBI A;  2M60 A;  3U6O A;  1GLN A;  1N32 M;  3KVW A;  2VQF M;  1Z6T A;  3FKE A;  3GQ3 A;  3I51 A;  1VEJ A;  3ZC7 B;  4AKG A;  1L8Q A;  3B7Q A;  5EXX A;  1IM2 A;  4CGY B;  4FVM A;  3C58 A;  2RGO A;  3QWL A;  4DR3 M;  2JXN A;  3IG8 A;  7CAT A;  4WW0 A;  4DR7 M;  3LMM A;  3ZQJ A;  1G3I A;  2DAI A;  2Z8Y M;  4B7H A;  2UXC M;  1HJP A;  3FYD A;  1N75 A;  3F92 A;  3L27 A;  3I4Y A;  4FW9 A;  3DZD A;  1ORY B;  3M7G A;  1IQP A;  3PNV A;  3SFZ A;  3RGS A;  1OIP A;  1R4G A;  3AOE C;  5C18 A;  4GEW A;  1IXS B;  4DR1 M;  3KW6 A;  3GLI B;  5FTJ A;  2HHH M;  4B3M M;  2YFQ A;  4AI6 A;  3HWS A;  2L6O A;  2QNJ A;  3NWL A;  2JA2 A;  4LF7 M;  2ZBK B;  2JNH A;  5EJC A;  1OQY A;  4FD2 A;  3SBJ A;  1OAO C;  1KFV A;  1J09 A;  2KHH A;  2Z3X A;  1G8P A;  1CUK A;  1XWI A;  2MJ5 B;  3SMS A;  3VK7 A;  4NRW A;  2CFO A;  5JI3 E;  2QSF X;  2UUB M;  1IBM M;  4MM3 B;  3FTF A;  2C9O A;  2K9D A;  4LF6 M;  5EQT A;  3GLH A;  1Q02 A;  1IBL M;  4PT5 A;  4FWH A;  1TGU A;  1X37 A;  4Q7J A;  4L15 A;  4JI1 M;  1E9S A;  4JN6 A;  2M5Z A;  2A5Y B;  4L6V 6;  5LMU M;  4JV5 M;  2Z4R A;  3L28 A;  3L26 A;  5KPZ A;  4NOO B;  4R3D A;  4GRI A;  4MGI E;  4JYA M;  2L4F A;  3AL0 C;  2Q2E B;  1GJT A;  2RRU A;  4LF9 M;  1QDR A;  4X64 M;  1VDD A;  4OU7 A;  2F4V M;  3C3E A;  2R0I A;  2R44 A;  4WP2 A;  2HKJ A;  3J2P B;  3GLI E;  2B3T A;  1HT1 E;  2DAG A;  3GRV A;  2LVQ D;  4AG5 A;  3RGP A;  1YUB A;  2DEN A;  3UMM A;  3A46 A;  2WSF F;  1R2Y A;  1DGF A;  1N36 M;  2ERC A;  3SYL A;  4BLC A;  2LHG A;  2KNA A;  3GLH E;  2DWN A;  1OTR A;  2DXI A;  4HLQ A;  1D2N A;  3VKH A;  3K92 A;  2R62 A;  4GH9 A;  1Q3C A;  3FYC A;  2DVW B;  3T6P A;  3SAU A;  3K1J A;  3UGJ A;  4DR2 M;  1QZE A;  1OAI A;  4IBJ A;  4L4U A;  3J7B A;  1SXJ C;  1E32 A;  1PJI A;  2DWL A;  1SG9 A;  4UN2 B;  3GLG B;  1C7Y A;  1DGG A;  2MH8 A;  1TDH A;  1QYR A;  2R45 A;  2QHO B;  3M6A A;  1IN5 A;  5E26 A;  2K6B A;  2Z4S A;  1IBK M;  5ITU A;  3GLF B;  1HNZ M;  3DFZ A;  1OFI A;  4IBI A;  3KXE C;  2FE8 A;  3U6C A;  4I81 A;  4RF1 A;  3T1Y M;  3U61 B;  4DR4 M;  4LJ4 A;  3TPZ A;  2L4E A;  5FTN A;  2XLJ A;  1XXH B;  3AJI B;  4Z6Y A;  3FUW A;  1H6U A;  2GQF A;  4LF5 M;  3LW5 F;  3H4J A;  4CIZ A;  2KW0 A;  3U5Z B;  2KZS A;  4GC9 A;  1L2C A;  1HNX M;  4GIT A;  1NHG C;  2F5S A;  1AUA A;  1NJG A;  4DV0 M;  3D8L A;  1NHW C;  3SMP A;  3U5Z A;  3AKZ A;  2DAE A;  4PCZ A;  4YHH M;  1EE8 A;  3M0E A;  4RNA A;  3B7Z A;  4OX9 M;  1MN3 A;  5BR8 M;  4Z8X A;  3UK6 A;  2C5R A;  3GPP A;  2C98 A;  3GLF E;  1UFZ A;  2XZU A;  1I4W A;  2QQ8 A;  2DHY A;  1R5L A;  4XGI A;  4IBF A;  1WHC A;  2LNH C;  2BNK A;  2KDL A;  3U6E A;  3K2L A;  1WIV A;  4M9X A;  3HHW A;  4F2L A;  1XXH E;  1L2B A;  1YLA A;  4LJA A;  3GQ4 A;  4JI8 M;  1QAN A;  4I8O A;  3JAM S;  4ITQ A;  1GL7 A;  3JR5 A;  5KPR A;  2P5T A;  1Z5B A;  2C96 A;  2QCU A;  1K82 A;  1FJG M;  2G5G X;  3B9P A;  4R7G A;  3W68 A;  3U6S A;  3GP1 A;  1YE9 A;  2EUC A;  5ITQ A;  1MX0 A;  1QVR A;  2VF8 A;  4FCW A; 
#chains in the Genus database with same CATH homology
 4FWD A;  4KO8 A;  4L16 A;  4M0D A;  2F5P A;  3AV0 A;  2XSZ D;  4B7G A;  3VFD A;  3L2A A;  3LVV A;  4JXJ A;  4LG2 A;  3MJ5 A;  1Q3B A;  1JQJ C;  5DYG A;  3VDU A;  1NY5 A;  4LGY A;  4NXN M;  2UU9 M;  4DR5 M;  4LFA M;  4OVZ B;  3SAT A;  3HU3 A;  3FUT A;  2V6Z M;  2F5N A;  1NNJ A;  1KYI A;  2O5R A;  3WHL A;  4AQY M;  3KFU G;  4LZJ A;  4JI4 M;  5DNY A;  4DV3 M;  4W5W A;  1SXJ D;  4LZZ A;  4QHT A;  2Z7J A;  3CTW B;  5FLX S;  2J7N A;  4II7 A;  4ZPX A;  3RE8 A;  3K8Z A;  4JI2 M;  4OW0 A;  4IBE A;  2ZAM A;  2XGN A;  5ITR A;  4B3T M;  2UXB M;  1NNU C;  3HGI A;  4MH0 E;  3HHY A;  3FTE A;  1IXZ A;  4KLN A;  3GLI A;  1GKI A;  2D7G A;  4IBG A;  3E9S A;  8CAT A;  4HL4 A;  3J27 B;  4AKH A;  2I7P A;  1KSF X;  2C9C A;  2NQ8 C;  3KOX E;  5GKN A;  2HL7 A;  5ITX A;  4LJ8 A;  4BBA A;  5KPT A;  3WHK A;  1UM8 A;  2L09 A;  2AHM A;  5BPV A;  5ITT A;  1WXQ A;  2Y21 A;  5EP3 A;  3A42 A;  2FFJ A;  1IY1 A;  2QP9 X;  4LRT A;  2CV2 A;  2DWZ B;  3PNY A;  3A98 B;  3AFH A;  4AZF A;  2XF3 A;  1DGH B;  3GPY A;  1HR0 M;  3QAU A;  1NVM A;  3Q8X A;  1DO0 A;  4FWG A;  4G4O A;  1PJJ A;  2UUC M;  4D80 A;  5FTL A;  5F3W A;  2LXE A;  3HJS A;  5C1B A;  1YSY A;  2KRK A;  3AOE A;  3FTC A;  3KP0 E;  1OFH A;  3FUU A;  4IBK A;  4G4R A;  4KHP M;  5IRE B;  4G6Z A;  3GRU A;  4PD2 A;  4GMQ A;  5ITX E;  4LY6 A;  3TQS A;  4PDI A;  3L29 A;  1IN8 A;  3KDS E;  2KEB A;  4LJ6 A;  3KS8 A;  2UXD M;  1Z59 A;  2R4J A;  3CF0 A;  2XZF A;  2YNM D;  5EXT A;  1FNN A;  3J7A S;  3VK8 A;  3JR4 A;  1K3W A;  4YY3 M;  4IIW A;  2DZN B;  4NSR A;  1GL6 A;  4IJF A;  5KQ8 A;  3GLG A;  2YQZ A;  4B08 A;  4JI6 M;  2J7O A;  3KOY E;  2R46 A;  3GLF A;  4DR6 M;  3RFW A;  4KOD A;  3HU1 A;  4B3R M;  3ZCB B;  1XMO M;  4QHS A;  3LQR A;  2R65 A;  1HNW M;  2XSZ A;  3U61 A;  2VII A;  1Z5C A;  3FUX A;  1TH2 A;  1XXH A;  4GC5 A;  3L25 A;  4DV5 M;  1N77 A;  5H37 D;  5LMN M;  1LV7 A;  4GKK M;  3KSJ A;  4FCV A;  4NL4 H;  1IN4 A;  1SXJ B;  2CHG A;  4AW4 A;  4B7F A;  2RGH A;  1JR3 D;  1SXJ A;  2CV1 A;  3GPU A;  5EP2 A;  2DHR A;  1IY2 A;  4BB9 A;  1G4A E;  2XEP A;  1Z5A A;  4QOS A;  3IG5 A;  4DV1 M;  3VKG A;  3UJN A;  1IXR C;  1L1T A;  3HJQ A;  3TWL A;  4AKI A;  3KS4 A;  3J81 S;  3TE6 A;  4GHA A;  1QAQ A;  3FD9 A;  2LWX A;  4XBO A;  1OJL A;  3THG A;  2XFS A;  2L7H A;  2R4E A;  5EXS A;  4M0W A;  2W82 A;  4GIP A;  1SXJ E;  3GRR A;  1I94 M;  2X8A A;  2KRU A;  3U6Q A;  2DWM A;  4LCB A;  2LH0 A;  2Y0Q A;  4L78 A;  1XNQ M;  1DO2 A;  3LQQ A;  3T15 A;  1G41 A;  2K47 A;  3H4M A;  2EO2 A;  2XFT A;  4QNR A;  3SHF A;  4OVZ A;  1NY6 A;  1XMQ M;  2BJW A;  1NJF A;  2KXE A;  2QZ4 A;  2OPF A;  3KSX A;  2D7E A;  4NRV A;  3SAR A;  3DOA A;  4FCT A;  4AG6 A;  2UUA M;  4S12 A;  5EXP A;  4MGY E;  1IN6 A;  3TWK A;  4MGK E;  2RKO A;  5DYI A;  1E94 E;  2ZM6 M;  2HCB A;  4M9S A;  2CHV A;  3SHG B;  3EIH A;  2CEA A;  2VQE M;  4LJ7 A;  1Q39 A;  4NSO B;  1R7R A;  2L7I A;  1QAO A;  4MGH A;  3HJ8 A;  4DV2 M;  3U6L A;  4JI3 M;  3J80 S;  2YR0 A;  3UZU A;  1T3T A;  2C99 A;  3LVW A;  1L2D A;  3CF2 A;  1W5T A;  2FOI C;  4REZ A;  1ZAE A;  3PXG A;  5E6J A;  4QOZ C;  4JI7 M;  1DGB A;  1DGH A;  2CUZ A;  4B3S M;  5EP4 A;  3GLH B;  4LJ5 A;  4X66 M;  4A3V B;  2E5L M;  2F5O A;  4NXM M;  5JI2 E;  1J5E M;  3T1H M;  3SAV A;  1TH3 A;  4LFC M;  1TH4 A;  3GQ5 A;  1JR3 A;  3VDP A;  3D8B A;  2QEN A;  1C1K A;  3VLF B;  1J7K A;  3EIE A;  1XC8 A;  2V1U A;  4TUW A;  4M9Z A;  1QAM A;  3FUV A;  2KZU A;  3SAS A;  1QQW A;  2FNA A;  4X65 M;  1N34 M;  5EP1 A;  4LF4 M;  2KA6 B;  3FTD A;  1NSF A;  5IT9 S;  3E4R A;  3KOW E;  4DV4 M;  3U60 B;  2CE7 A;  5FSW A;  2QPA A;  4IBB A;  2ZAN A;  2BJV A;  3HHZ A;  3HHX A;  3U60 A;  2EA0 A;  2XH9 A;  2V1C A;  1HQC A;  3GPX A;  5KQD A;  1QZM A;  3KP1 E;  1K3X A;  2DZO B;  2X49 A;  3KOZ E;  3U6M A;  1XNR M;  4GHL A;  4PDG A;  4JI5 M;  4RF0 A;  3W0L B;  2ZAO A;  5KO3 A;  2R18 A;  2Y20 A;  3T38 A;  1R6B X;  2G8L A;  1HQY E;  4LJ9 A;  1S3S A;  4D82 A;  1N78 A;  3HKP A;  2CHQ A;  4GKJ M;  4IJE A;  4LGM A;  3U6D A;  3A45 A;  3U6P A;  1R2Z A;  2CV0 A;  1TDZ A;  3GO8 A;  3TL4 X;  1IN7 A;  3CF6 E;  4WUR A;  1G59 A;  3ZH9 B;  3I4V A;  1HT2 E;  4IBC A;  2Y0T A;  4P16 A;  1ZQ9 A;  4G4N A;  1GVN A;  4LFB M;  4DUZ M;  3PVS A;  3W0F A;  4K0K M;  3ILK A;  4EIW A;  1E9R A;  2OQ4 A;  3BOS A;  1IY0 A;  4CHT B;  3TWM A;  4DV6 M;  4DUY M;  5A2Q S;  2F5Q A;  4CIS A;  4D81 A;  2D7H A;  4DV7 M;  3AOG A;  3MK6 A;  5FTM A;  5IWA M;  4G4Q A;  3SAW A;  3PFI A;  1L1Z A;  3OTO M;  5FTK A;  4QNM A;  3R9X B;  4L8R C;  3SYK A;  1MU5 A;  4LF8 M;  3SC3 A;  1PM5 A;  3DA1 A;  1W5S A;  4LRS A;  4X62 M;  2QBY B;  5ITY A;  5IZ7 D;  2X4A A;  2QBY A;  1N33 M;  4MB7 A;  4I4L A;  2I7N A;  2H1R A;  4MGZ E;  1XHB A;  4JI0 M;  3GRY A;  3HU2 A;  4IBD A;  4I5S A;  3MHV C;  3R8F A;  3NBI A;  2M60 A;  3U6O A;  1GLN A;  1N32 M;  3KVW A;  2VQF M;  1Z6T A;  3FKE A;  3GQ3 A;  3I51 A;  3ZC7 B;  4AKG A;  1L8Q A;  5EXX A;  1IM2 A;  4CGY B;  4FVM A;  3C58 A;  2RGO A;  3QWL A;  4DR3 M;  3IG8 A;  7CAT A;  4WW0 A;  4DR7 M;  3LMM A;  1G3I A;  4B7H A;  2UXC M;  3FYD A;  1N75 A;  3L27 A;  4FW9 A;  3I4Y A;  3DZD A;  1ORY B;  3M7G A;  1IQP A;  3PNV A;  3SFZ A;  3RGS A;  3AOE C;  5C18 A;  1IXS B;  4DR1 M;  3KW6 A;  3GLI B;  5FTJ A;  2HHH M;  4B3M M;  2YFQ A;  4AI6 A;  3HWS A;  2L6O A;  3NWL A;  2JA2 A;  4LF7 M;  2ZBK B;  5EJC A;  4FD2 A;  3SBJ A;  1KFV A;  1J09 A;  2Z3X A;  1G8P A;  1XWI A;  3SMS A;  4NRW A;  3VK7 A;  2CFO A;  5JI3 E;  2UUB M;  1IBM M;  4MM3 B;  3FTF A;  2C9O A;  4LF6 M;  5EQT A;  3GLH A;  1IBL M;  4PT5 A;  4FWH A;  1TGU A;  1X37 A;  4L15 A;  4JI1 M;  1E9S A;  4JN6 A;  2M5Z A;  2A5Y B;  4JV5 M;  5LMU M;  2Z4R A;  3L28 A;  3L26 A;  5KPZ A;  4NOO B;  4R3D A;  4GRI A;  4MGI E;  4JYA M;  3AL0 C;  2Q2E B;  4LF9 M;  4X64 M;  4OU7 A;  1VDD A;  2F4V M;  2HKJ A;  3J2P B;  1HT1 E;  3GRV A;  4AG5 A;  3RGP A;  1YUB A;  3A46 A;  3UMM A;  1R2Y A;  1N36 M;  1DGF A;  2ERC A;  3SYL A;  4BLC A;  2DWN A;  2DXI A;  4HLQ A;  1D2N A;  3VKH A;  3K92 A;  2R62 A;  4GH9 A;  1Q3C A;  3FYC A;  2DVW B;  3SAU A;  3K1J A;  3UGJ A;  4DR2 M;  4L4U A;  4IBJ A;  3J7B A;  1SXJ C;  1E32 A;  1PJI A;  2DWL A;  3GLG B;  1DGG A;  1TDH A;  1QYR A;  2R45 A;  3M6A A;  5E26 A;  1IN5 A;  2Z4S A;  1IBK M;  5ITU A;  3GLF B;  1HNZ M;  3DFZ A;  1OFI A;  4IBI A;  3KXE C;  2FE8 A;  3U6C A;  4I81 A;  4RF1 A;  3T1Y M;  3U61 B;  4DR4 M;  4LJ4 A;  3TPZ A;  5FTN A;  2XLJ A;  1XXH B;  3AJI B;  4Z6Y A;  3FUW A;  1H6U A;  4LF5 M;  2KW0 A;  3U5Z B;  2KZS A;  4GC9 A;  1L2C A;  1HNX M;  4GIT A;  1NHG C;  2F5S A;  1NJG A;  4DV0 M;  3D8L A;  1NHW C;  3SMP A;  3U5Z A;  3AKZ A;  4PCZ A;  4YHH M;  1EE8 A;  3M0E A;  4RNA A;  4OX9 M;  5BR8 M;  4Z8X A;  3UK6 A;  2C5R A;  3GPP A;  2C98 A;  2XZU A;  1I4W A;  4XGI A;  4IBF A;  2LNH C;  2BNK A;  3U6E A;  3K2L A;  4M9X A;  3HHW A;  1L2B A;  4LJA A;  3GQ4 A;  4JI8 M;  1QAN A;  4I8O A;  3JAM S;  4ITQ A;  1GL7 A;  3JR5 A;  5KPR A;  2P5T A;  1Z5B A;  2C96 A;  2QCU A;  1K82 A;  1FJG M;  2G5G X;  3B9P A;  4R7G A;  3U6S A;  3GP1 A;  1YE9 A;  2EUC A;  5ITQ A;  1MX0 A;  1QVR A;  4FCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...