5IWAM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5iwaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5iwaM02
4DV6M 1MU5A 5BR8M 1PJIA 4DR7M 3U6PA 2UU9M 4MB7A 1HNZM 4JI4M 4DR3M 1XMQM 2F5OA 5LMNM 1XNRM 2VQFM 4G4QA 3TWKA 2F4VM 4DV7M 3GQ4A 2XZFA 2F5SA 3GPUA 3J7AS 2VQEM 4G4OA 1IBLM 4PCZA 3A42A 2OQ4A 4JYAM 4LFAM 4PDGA 4AQYM 4X66M 3T1YM 1MX0A 2UUBM 3GP1A 4NRWA 4DR4M 4B3RM 4DUYM 5ITTA 4DV4M 5ITXA 4JI8M 1L2CA 4DR6M 2UXCM 4G4NA 3W0FA 4JI2M 3A46A 1PM5A 3U6SA 4NXNM 4DR2M 4LF9M 4YY3M 4JI7M 5ITXE 2ZM6M 3U6LA 4B3SM 1XMOM 3U6MA 3SASA 1Q39A 2ZBKB 1Q3BA 4JI1M 4LF5M 3TWMA 4OX9M 3JR5A 3C58A 3DOAA 4DR1M 5IT9S 4DV3M 4LF7M 3U6OA 1R2ZA 1N34M 4DV5M 3GPXA 3U6QA 3U6CA 1N33M 3JR4A 5ITRA 2F5QA 3J80S 3GPYA 2E5LM 3JAMS 4LF8M 3OTOM 2F5NA 4K0KM 3SBJA 4JV5M 3J81S 3SAVA 3SAWA 1K3WA 1KFVA 4LF4M 4JI5M 4LF6M 5IWAM 4DV2M 1Z5AA 1J5EM 4PDIA 1IBMM 1FJGM 1XNQM 3VK8A 4DV0M 3T1HM 4JI0M 2EA0A 3U6DA 5A2QS 1TDZA 3GPPA 5LMUM 3GQ3A 4NRVA 1EE8A 2Q2EB 3SARA 1HR0M 1L2BA 5ITUA 3SATA 3U6EA 4DR5M 4JI3M 2F5PA 3TWLA 1Z59A 1Z5BA 4X64M 1N32M 4PD2A 5FLXS 3A45A 1L2DA 2HKJA 1K82A 4CISA 1TDHA 4JI6M 3GO8A 4GKJM 1XC8A 1PJJA 1N36M 1Q3CA 1HNXM 4DV1M 1Z5CA 2HHHM 4X62M 4DUZM 3SAUA 4GKKM 4NXMM 1L1ZA 4G4RA 4B3TM 1HNWM 4X65M 1NNJA 2UXBM 4LFBM 1K3XA 1I94M 4KHPM 3GQ5A 1IBKM 2UUAM 1R2YA 4LFCM 5ITYA 1L1TA 4B3MM 4ITQA 2UXDM 2OPFA 5ITQA 4YHHM 2XZUA 2UUCM 3VK7A
chains in the Genus database with same CATH superfamily
4DV6M 4LZZA 1MU5A 2W82A 2JY7A 4KT0F 2XH9A 3QYBA 2DNAA 2DZNB 3B7QA 5FTMA 1V33A 2QBYA 3RE8A 5C18A 2ZTDA 1UFZA 2LVNC 3AOEC 3C3EA 2KZUA 3FTCA 3MK6A 4M0WA 1XMQM 1G59A 2F5OA 4JI4M 3K92A 4G4QA 4LJ9A 2XZFA 2F5SA 3VKGA 1VQ1A 1IN8A 4L16A 2VQEM 4PCZA 3VFDA 3L25A 2DZOB 2L4FA 2WZJA 5EQTA 5E6JA 1OTRA 3K8ZA 1IM2A 4DUYM 1TR8A 3ZCBB 4CGYB 4JI8M 5ITXA 3TQSA 2UXCM 3CGWA 1W5TA 3C9PA 4Y28F 1NNUC 3U6SA 3DFZA 4P16A 4IBIA 3GLGE 4AZFA 2ZM6M 3SMPA 4B3SM 2KEBA 2QCUA 2R4EA 3U6MA 1XMOM 4LF5M 2BWEA 2X49A 1WJ7A 4RF1A 2Z8YM 1D0KA 3JR5A 3RGSA 3IG5A 1QZMA 2V1CA 2I7PA 2JWSA 2XFSA 3VDUA 4DV3M 4AW4A 1R2ZA 3FTEA 4AKHA 3R8FA 1SXJC 2KNAA 1N33M 5ITRA 2F5QA 2E5LM 4LF8M 4IBBA 3KOWE 3JAMS 2V1UA 2K0BX 2R18A 5DFLA 3CF2A 4WURA 3H4MA 2EKFA 2CHQA 4Z6YA 4LGMA 3HJ8A 1IY2A 4JN6A 1JR3A 1HJPA 3PNVA 4JV5M 3L29A 2JA2A 3VLFB 2HL7A 4LF4M 4JI5M 1TF0B 2KA6B 1Z5AA 2KXEA 3NBIA 3GLFA 2XSZA 3VK8A 2NQ8C 3DA1A 3T15A 2CFOA 4JI0M 2EA0A 4FWDA 2OOAA 2QHOB 3LVWA 1D0LA 2J7OA 3QYEA 4IJEA 3GQ3A 4NRVA 1EE8A 2BNKA 2O5RA 3CTWB 1ZAEA 4GRIA 4II7A 1SG9A 2BJVA 2KNZA 5BPVA 3SARA 1ORYB 2R4JA 2XGNA 5ITUA 2RKOA 4B08A 4QNRA 1IQPA 1OIPA 1TTEA 1Z5BA 4KODA 4PD2A 2H5XA 3RFWA 4PT5A 2MJ5B 1GL7A 2HKJA 4R7GA 4GHLA 1JQJC 3PNYA 1IN4A 4LZJA 3M6AA 1G41A 2K9DA 7CATA 2LVPC 3HU2A 3FKEA 2VIIA 1N36M 2XFTA 2HAKA 2C9CA 1Z5CA 4AG5A 5KQ8A 1PJSA 5GKNA 2ZANA 4GKKM 3FE3A 4D80A 4NXMM 1E94E 4REZA 3H4JA 2ZTCA 2H1RA 4R71A 3VK7A 2OO9A 2Z4RA 3QAUA 3L28A 1P3QQ 2UXBM 2R6FA 3FUWA 4IBDA 1K3XA 3B89A 4HLQA 1Q02A 1C7YA 1R4GA 2MR9A 1DV0A 4FCTA 1ZMWA 2YFQA 3U61A 1YUBA 4B7FA 4NC6A 4CHTB 3AOGA 4F1IA 2QPAA 1XNRM 2XZUA 2XEPA 1VEKA 5BR8M 3R9XB 2YNMD 2LVQD 2QQ8A 3FYDA 5EP3A 3GLHA 3ILKA 4LJAA 1EFUB 5EXXA 3U6PA 2UU9M 3DZDA 1C1KA 1GJTA 1IY1A 4DR3M 4IBJA 2KZSA 3B9PA 3MMPA 5EXPA 1VEJA 2KNVA 5KPTA 2DWNA 3J7AS 2K47A 2R0IA 4G4OA 3UGJA 1IBLM 2OQ4A 3I4VA 3GLGB 1N77A 5JI3E 4PDGA 3KP1E 4X66M 3T1YM 4NSOB 4NRWA 2R46A 2JP7A 5ITTA 1R6BX 2R65A 3QWLA 4DR6M 2LHGA 2QZ4A 1IXSB 3BOSA 3LCVB 4MH0E 1NV8A 2EUCA 2R44A 3KS8A 3J27B 4NXNM 4IJFA 4DR2M 1T6OA 4YY3M 4P17A 1RU3A 3KW6A 2DWZB 3SASA 3GLIE 1Q39A 3AFHA 4LRSA 2R62A 2J7NA 2GQFA 1OAIA 1MN3A 3DOAA 5IT9S 4LF7M 5KPZA 4FW9A 3PFIA 3U6QA 1DGHB 2L09A 2LXEA 1QAOA 4L8RC 1SXJD 3WHKA 2WSCF 3D8BA 4HEOA 4IIWA 2Y21A 1WIVA 4LJ4A 4RKUF 3B74A 3OTOM 2AHMA 1T3TA 3E9SA 3SMSA 2DI0A 5FTKA 2L7HA 1PGYA 3GRYA 4K0KM 3SBJA 1G8PA 2CHGA 2CP8A 2LVAA 4I81A 2X8AA 2JXNA 2C98A 1K3WA 4LCBA 3U5ZB 4IBCA 3PVSA 4DV2M 1J5EM 1D2NA 2LNHC 2P5TA 1FJGM 2R45A 2QSFX 3AKZA 3K9OA 2FOIC 3U6DA 2DKLA 1IN5A 4IBFA 2Y0QA 1TDZA 3I4YA 1NHGC 4KO8A 3HJSA 3HHYA 5H37D 2MH8A 3C3DA 1XXHE 4FVMA 2L4EA 1L2BA 1BVSA 1NHWC 4JI3M 3W68A 1DGGA 1QDRA 4GHAA 3AJIB 4X64M 4MGKE 2CUZA 3J7BA 3HJQA 1CUKA 3L2AA 2A5YB 2DAKA 1F4IA 1K82A 1J09A 2HCBA 3BXWA 2D7EA 3ZC7B 5FSWA 4LJ7A 1XC8A 3GRVA 5DYGA 1OJLA 4GC9A 1EIJA 3TL4X 4LJ6A 4DV1M 1HNXM 4LG2A 2Z4SA 4DUZM 3LW5F 5KPRA 1GLNA 1UM8A 1GABA 2MGWA 3GLHE 3I51A 2KRUA 4XGIA 1VDDA 4G4RA 1GJSA 1W5SA 1SXJE 1NNJA 3FRIA 3HGIA 3FYCA 2LVOC 4HL4A 2C9OA 4FD2A 3HX3A 4ITQA 4M9XA 1E32A 2M60A 4BBAA 2ERCA 3HHWA 5KO3A 2FE8A 3KOYE 1XB2B 4WP2A 2G5GX 2CV0A 2CE7A 4YHHM 2OOBA 3KSJA 4DR4M 1A5TA 2ZAOA 4G6ZA 2Z7JA 3B7ZA 2LHCA 4DR7M 3IG8A 1OAOC 3U60B 1D0MA 3MHVC 1NY5A 1E9SA 1HT1E 2Y20A 5DNYA 2YQZA 1NV9A 1QDTA 5EP2A 3W0LB 1OFHA 3Q8XA 1JR3D 1QYRA 4OVZA 4D82A 2EO2A 2F4VM 4DV7M 1TGUA 1GL6A 3K2LA 2G3QA 3GPUA 1HT2E 4M0DA 2APLA 3F92A 3A42A 4IBKA 3SFZA 5JI2E 2XSZD 4AQYM 2HWJA 2JY6B 2UUBM 1N75A 2LTUA 3E4RA 3GLIB 4B3RM 3Q8GA 2QENA 2C96A 2DXIA 1IY0A 3SHGB 3GLGA 4DV4M 4B7HA 1GVNA 1X37A 1G71A 1WXQA 4JI2M 1NO1A 3EIEA 1NY6A 3LVVA 1KSFX 2JNHA 1ZV1A 4M9SA 4S12A 1HQYE 5ITXE 3L26A 3KSXA 2JUJA 4OVZB 2LWXA 1IXSA 4QOSA 1NVMA 3V76A 4W5WA 3UJNA 1VDLA 1Q3BA 2DAIA 3KP0E 3PXGA 1H6UA 3TWMA 3FD9A 3A98B 3C58A 2JY5A 4L6V6 4DR1M 3U6OA 1N34M 3GPXA 3U6CA 2DZLA 3NWLA 4RF0A 3ZH9B 1T43A 3KDSE 2M5ZA 2QNJA 3E46A 3J80S 2EKKA 3I01M 2Z3XA 2L7IA 3KOZE 3LMMA 4QOZC 1DGHA 3SHFA 2DWLA 4GMQA 1QAMA 2DAEA 4MM3B 4LJ8A 2BJWA 1TH2A 2VF8A 3J2PB 1XXHB 3MJ5A 4QHTA 3VKHA 2CRUA 1R7RA 4MGIE 1XHBA 3L27A 1KFVA 3W67A 4A3VB 5IWAM 4PDIA 1OKSA 2CEAA 1JR3E 1HQCA 4DV0M 4BLCA 3T1HM 1IN6A 2DENA 4QHSA 2FS1A 3M7GA 4GIPA 1E9RA 4I8OA 5LMUM 5EP4A 3U5ZA 2I7NA 3D8LA 4RNAA 3GLFE 2Q2EB 2QP9X 4F2LA 3E21A 4XK8F 3U6EA 4WW0A 4DR5M 2F5PA 3TWLA 1N32M 2DVWB 2CV1A 3HKPA 3A45A 1NJGA 1KYIA 3WHLA 1L2DA 4AI6A 3HU3A 4L4UA 4LJ5A 4CISA 2FNAA 1R5LA 5F3WA 4JI6M 1OQYA 1SXJB 2XF3A 1XWIA 1V34A 1QUTA 1JB0F 1Q3CA 3HZJA 4BB9A 3SAUA 3AL0C 5C1BA 3TE6A 2JZ1A 1AIPC 3BBZA 4L78A 4GEWA 5EP1A 5IREB 1PJTA 2CHVA 1IXRC 4NOOB 3HWSA 4IBEA 2DWMA 1NJFA 2CV2A 2JZ0A 3HHXA 3KFUG 3HY5A 3ZQJA 1WHCA 2FFJA 4KHPM 4LFCM 1R2YA 2DHRA 3LCUA 1QAQA 3LQRA 4FWHA 5ITYA 1L1TA 2L6OA 2C99A 4LY6A 3IECA 4AKGA 2QBYB 5ITQA 1Y8GA 2UUCM 3B7NA 1PJIA 2DAGA 4OU7A 5E26A 4KLNA 1QQWA 2XLJA 4MB7A 1HNZM 1DGBA 3CF0A 2RRUA 4Q7JA 1DGFA 3KXEC 3K9PA 5LMNM 2VQFM 2D7HA 4FWGA 4GC5A 3TWKA 1IN7A 3U60A 3GQ4A 2ZAMA 3FUTA 4QNMA 1LV7A 4JXJA 4CIZA 4JYAM 4LFAM 1DO2A 1YLAA 1MX0A 1QVRA 4LGYA 3GP1A 2KHHA 3GRRA 5FTNA 2D7GA 5EXTA 1LTMA 3SYKA 1N78A 1L2CA 3IHPA 4G4NA 3W0FA 4CJ6A 3KS4A 3GLIA 3A46A 1PM5A 1NSFA 3LQQA 4LF9M 4JI7M 2CWBA 2LH0A 3U6LA 4NSRA 2ZBKB 2K6BA 1PJQA 2EJSA 2KDLA 3HU1A 4LRTA 5EXSA 1ZQ9A 4JI1M 2BWBA 5EJCA 4OX9M 2WSEF 2VDBB 1J7KA 8CATA 4DV5M 3AV0A 3T38A 2RGOA 5FTLA 3M0EA 4OW0A 1QUSA 3KOXE 1GO5A 2B3TA 2KW0A 3JR4A 2Y0TA 3GPYA 5L8RF 1AUAA 1S3SA 1V92A 4MGHA 4ANRA 2GNOA 5IZ7D 3RGPA 4MGYE 4ZPXA 1YE9A 2YR0A 3AOEA 2N35A 3GLFB 2F5NA 2DHYA 5KQDA 3J81S 3SAVA 1IFYA 2O01F 2VF7A 4IBGA 3SAWA 1L8QA 1OFIA 4LF6M 4TUWA 4MGZE 1XNQM 4FCVA 1IBMM 1XXHA 3FUUA 3T6PA 3EIHA 1GKIA 3UMMA 3UZUA 5A2QS 1WGNA 3VDPA 3GPPA 1WR1B 2KRKA 1VEGA 2C5RA 1HR0M 2V6ZM 1ZMVA 5DYIA 2O25A 4FCWA 2G8LA 3UK6A 2FH0A 2J5YA 3SATA 3NBXX 4AKIA 1DO0A 1PRBA 1Z59A 3FTFA 4Z8XA 1QANA 5FLXS 3K1JA 1WGLA 2DAMA 4UN2B 4G3OA 2JY8A 3FUXA 1TDHA 1VG5A 3GO8A 3I04M 4GKJM 1PJJA 2L2DA 1IXZA 4NL4H 4GH9A 1TH3A 3HHZA 3GRUA 4DBGB 3SYLA 4B7GA 4XBOA 2HHHM 4X62M 1FNNA 3CF6E 3TPZA 1SXJA 4GITA 1YSYA 2WSFF 5FTJA 3SC3A 2RGHA 4AG6A 1TH4A 2LBCA 3KVWA 1L1ZA 2X4AA 4B3TM 2MROB 1Z6TA 4R3DA 1ZMUA 1HNWM 3U61B 4EIWA 1MJGM 4X65M 1I4WA 4LFBM 3FRHA 1I94M 4M9ZA 4I4LA 4L15A 3GQ5A 1IBKM 2UUAM 1OIZA 2UXDM 4B3MM 1QZEA 1G3IA 2OPFA 3FTDA 4I5SA 3FUVA 3GLHB 3THGA 4D81A 1G4AE
chains in the Genus database with same CATH topology
4DV6M 4LZZA 1MU5A 2W82A 2XH9A 2DZNB 5FTMA 2QBYA 3RE8A 5C18A 3AOEC 3FTCA 3MK6A 2KZUA 4M0WA 1XMQM 2F5OA 4JI4M 1G59A 3K92A 4G4QA 4LJ9A 2XZFA 2F5SA 3VKGA 1IN8A 4L16A 2VQEM 4PCZA 3VFDA 3L25A 2DZOB 5EQTA 5E6JA 3K8ZA 1IM2A 4DUYM 3ZCBB 4CGYB 4JI8M 5ITXA 3TQSA 2UXCM 1W5TA 1NNUC 3U6SA 3DFZA 4P16A 4IBIA 4AZFA 2ZM6M 3SMPA 4B3SM 2KEBA 2QCUA 2R4EA 3U6MA 1XMOM 4LF5M 2X49A 4RF1A 3JR5A 3RGSA 3IG5A 1QZMA 2V1CA 2I7PA 2XFSA 3VDUA 4DV3M 1R2ZA 4AW4A 3FTEA 4AKHA 3R8FA 1SXJC 1N33M 5ITRA 2F5QA 2E5LM 4LF8M 4IBBA 3KOWE 3JAMS 2V1UA 2R18A 3CF2A 4WURA 3H4MA 2CHQA 4Z6YA 4LGMA 3HJ8A 1IY2A 4JN6A 1JR3A 3PNVA 4JV5M 3L29A 2JA2A 3VLFB 2HL7A 4LF4M 4JI5M 2KA6B 1Z5AA 2KXEA 3NBIA 3GLFA 2XSZA 3VK8A 2NQ8C 3DA1A 3T15A 2CFOA 4JI0M 2EA0A 4FWDA 3LVWA 2J7OA 4IJEA 3GQ3A 4NRVA 1EE8A 2BNKA 2O5RA 3CTWB 1ZAEA 4GRIA 4II7A 5BPVA 2BJVA 3SARA 4GHAA 1ORYB 2R4JA 2XGNA 5ITUA 2RKOA 4B08A 4QNRA 1IQPA 1Z5BA 4KODA 4PD2A 3RFWA 4PT5A 4GHLA 1GL7A 2HKJA 4R7GA 1JQJC 3PNYA 1IN4A 4LZJA 3M6AA 1G41A 7CATA 3HU2A 3FKEA 2VIIA 1N36M 2XFTA 4AG5A 2C9CA 1Z5CA 5KQ8A 5GKNA 2ZANA 4GKKM 4D80A 4NXMM 1E94E 4REZA 2H1RA 3VK7A 2Z4RA 3QAUA 3L28A 2UXBM 3FUWA 4IBDA 1K3XA 4HLQA 4FCTA 2YFQA 3U61A 1YUBA 4B7FA 4CHTB 3AOGA 2QPAA 1XNRM 2XZUA 2XEPA 5BR8M 3R9XB 2YNMD 3FYDA 5EP3A 3GLHA 3ILKA 4LJAA 5EXXA 3U6PA 2UU9M 3DZDA 1C1KA 4DR3M 1IY1A 4IBJA 2KZSA 3B9PA 5EXPA 5KPTA 2DWNA 3J7AS 2K47A 4G4OA 3UGJA 1IBLM 2OQ4A 3I4VA 3GLGB 1N77A 5JI3E 4PDGA 3KP1E 4X66M 3T1YM 4NSOB 4NRWA 2R46A 5ITTA 1R6BX 2R65A 3QWLA 4DR6M 2QZ4A 3BOSA 1IXSB 4MH0E 2EUCA 3KS8A 3J27B 4NXNM 4IJFA 4DR2M 4YY3M 3KW6A 2DWZB 3SASA 1Q39A 3AFHA 4LRSA 2R62A 2J7NA 3DOAA 5IT9S 4LF7M 5KPZA 4FW9A 3PFIA 3U6QA 1DGHB 2L09A 2LXEA 1QAOA 4L8RC 1SXJD 3WHKA 3D8BA 4IIWA 2Y21A 4LJ4A 3OTOM 2AHMA 1T3TA 3E9SA 3SMSA 5FTKA 2L7HA 3GRYA 4K0KM 3SBJA 1G8PA 2CHGA 4I81A 2X8AA 2C98A 1K3WA 4LCBA 3U5ZB 4IBCA 3PVSA 4DV2M 1J5EM 1D2NA 2LNHC 2P5TA 1FJGM 2R45A 3AKZA 2FOIC 3U6DA 1IN5A 4IBFA 2Y0QA 1TDZA 3I4YA 1NHGC 4KO8A 3HJSA 3HHYA 5H37D 4FVMA 1L2BA 1NHWC 4JI3M 1DGGA 3AJIB 4X64M 4MGKE 2CUZA 3J7BA 3HJQA 3L2AA 2A5YB 1K82A 1J09A 2HCBA 2D7EA 3ZC7B 5FSWA 4LJ7A 1XC8A 3GRVA 5DYGA 1OJLA 4GC9A 3TL4X 4LJ6A 4DV1M 1HNXM 4LG2A 2Z4SA 4DUZM 5KPRA 1GLNA 1UM8A 3I51A 2KRUA 4XGIA 1VDDA 4G4RA 1W5SA 1SXJE 1NNJA 3HGIA 3FYCA 4HL4A 2C9OA 4FD2A 4ITQA 4M9XA 1E32A 2M60A 4BBAA 2ERCA 3HHWA 5KO3A 2FE8A 3KOYE 2G5GX 2CV0A 2CE7A 4YHHM 4DR4M 3KSJA 2ZAOA 4G6ZA 2Z7JA 4DR7M 3IG8A 3U60B 3MHVC 1NY5A 1E9SA 1HT1E 2Y20A 5DNYA 2YQZA 5EP2A 3W0LB 1OFHA 3Q8XA 1JR3D 1QYRA 4OVZA 4D82A 2EO2A 2F4VM 4DV7M 1TGUA 1GL6A 3K2LA 3GPUA 1HT2E 4M0DA 3A42A 4IBKA 3SFZA 5JI2E 2XSZD 4AQYM 2UUBM 1N75A 3E4RA 3GLIB 4B3RM 2QENA 2C96A 2DXIA 1IY0A 3SHGB 3GLGA 4DV4M 4B7HA 1GVNA 1X37A 1WXQA 4JI2M 3EIEA 1NY6A 3LVVA 1KSFX 4M9SA 4S12A 1HQYE 5ITXE 3L26A 3KSXA 4OVZB 2LWXA 4QOSA 1NVMA 4W5WA 3UJNA 1Q3BA 3KP0E 3PXGA 1H6UA 3TWMA 3FD9A 3A98B 3C58A 4DR1M 3U6OA 1N34M 3GPXA 3U6CA 4RF0A 3NWLA 3ZH9B 3KDSE 2M5ZA 3J80S 2Z3XA 2L7IA 3KOZE 3LMMA 4QOZC 1DGHA 3SHFA 2DWLA 4GMQA 1QAMA 4MM3B 4LJ8A 2BJWA 1TH2A 3J2PB 3MJ5A 1XXHB 3VKHA 4QHTA 1R7RA 4MGIE 1XHBA 3L27A 1KFVA 4A3VB 5IWAM 4PDIA 2CEAA 1HQCA 4DV0M 4BLCA 3T1HM 1IN6A 4QHSA 4GIPA 3M7GA 1E9RA 4I8OA 5LMUM 5EP4A 3U5ZA 2I7NA 3D8LA 4RNAA 2Q2EB 2QP9X 3U6EA 4WW0A 4DR5M 2F5PA 3TWLA 1N32M 2DVWB 2CV1A 3HKPA 3A45A 1NJGA 1KYIA 3WHLA 1L2DA 4AI6A 3HU3A 4L4UA 4LJ5A 4CISA 2FNAA 5F3WA 4JI6M 1SXJB 2XF3A 1XWIA 1Q3CA 4BB9A 3SAUA 3AL0C 5C1BA 3TE6A 4L78A 5EP1A 5IREB 2CHVA 1IXRC 4NOOB 3HWSA 4IBEA 2DWMA 1NJFA 2CV2A 3HHXA 3KFUG 2FFJA 4KHPM 4LFCM 1R2YA 2DHRA 3LQRA 1QAQA 4FWHA 5ITYA 1L1TA 2L6OA 2C99A 4LY6A 4AKGA 2QBYB 5ITQA 2UUCM 1PJIA 4OU7A 5E26A 4KLNA 1QQWA 2XLJA 4MB7A 1HNZM 1DGBA 3CF0A 1DGFA 3KXEC 5LMNM 2VQFM 2D7HA 4FWGA 4GC5A 3TWKA 1IN7A 3U60A 3GQ4A 2ZAMA 3FUTA 4QNMA 1LV7A 4JXJA 4JYAM 4LFAM 1DO2A 1MX0A 1QVRA 4LGYA 3GP1A 3GRRA 5FTNA 2D7GA 5EXTA 3SYKA 1N78A 1L2CA 4G4NA 3W0FA 3KS4A 3GLIA 3A46A 1PM5A 1NSFA 3LQQA 4LF9M 4JI7M 2LH0A 3U6LA 4NSRA 2ZBKB 3HU1A 4LRTA 5EXSA 4JI1M 1ZQ9A 5EJCA 4OX9M 1J7KA 8CATA 4DV5M 3AV0A 3T38A 2RGOA 5FTLA 3M0EA 4OW0A 3KOXE 2KW0A 3JR4A 2Y0TA 3GPYA 1S3SA 4MGHA 3RGPA 5IZ7D 4MGYE 4ZPXA 1YE9A 2YR0A 3AOEA 3GLFB 2F5NA 5KQDA 3J81S 3SAVA 4IBGA 3SAWA 1L8QA 1OFIA 4LF6M 4TUWA 4MGZE 1XNQM 4FCVA 1IBMM 1XXHA 3FUUA 3EIHA 1GKIA 3UMMA 3UZUA 5A2QS 3VDPA 3GPPA 2KRKA 2C5RA 1HR0M 2V6ZM 5DYIA 4FCWA 2G8LA 3UK6A 3SATA 4AKIA 1DO0A 1Z59A 3FTFA 4Z8XA 1QANA 5FLXS 3K1JA 3FUXA 1TDHA 3GO8A 4GKJM 1PJJA 1IXZA 4NL4H 4GH9A 1TH3A 3HHZA 3GRUA 3SYLA 4B7GA 4XBOA 2HHHM 4X62M 1FNNA 3CF6E 3TPZA 1SXJA 4GITA 1YSYA 5FTJA 3SC3A 2RGHA 4AG6A 3KVWA 1TH4A 1L1ZA 2X4AA 4B3TM 4R3DA 1Z6TA 1HNWM 3U61B 4EIWA 4X65M 1I4WA 4LFBM 1I94M 4M9ZA 4I4LA 4L15A 3GQ5A 1IBKM 2UUAM 2UXDM 4B3MM 1G3IA 2OPFA 3FTDA 4I5SA 3FUVA 3GLHB 3THGA 4D81A 1G4AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 M;  1MU5 A;  5BR8 M;  1PJI A;  4DR7 M;  3U6P A;  2UU9 M;  4MB7 A;  1HNZ M;  4JI4 M;  4DR3 M;  1XMQ M;  2F5O A;  5LMN M;  1XNR M;  2VQF M;  4G4Q A;  3TWK A;  2F4V M;  4DV7 M;  3GQ4 A;  2XZF A;  2F5S A;  3GPU A;  3J7A S;  2VQE M;  4G4O A;  1IBL M;  4PCZ A;  3A42 A;  2OQ4 A;  4JYA M;  4LFA M;  4PDG A;  4AQY M;  4X66 M;  3T1Y M;  1MX0 A;  2UUB M;  3GP1 A;  4NRW A;  4DR4 M;  4B3R M;  4DUY M;  5ITT A;  4DV4 M;  5ITX A;  4JI8 M;  1L2C A;  4DR6 M;  2UXC M;  4G4N A;  3W0F A;  4JI2 M;  3A46 A;  1PM5 A;  3U6S A;  4NXN M;  4DR2 M;  4LF9 M;  4YY3 M;  4JI7 M;  5ITX E;  2ZM6 M;  3U6L A;  4B3S M;  1XMO M;  3U6M A;  3SAS A;  1Q39 A;  2ZBK B;  1Q3B A;  4JI1 M;  4LF5 M;  3TWM A;  4OX9 M;  3JR5 A;  3C58 A;  3DOA A;  4DR1 M;  5IT9 S;  4DV3 M;  4LF7 M;  3U6O A;  1R2Z A;  1N34 M;  4DV5 M;  3GPX A;  3U6Q A;  3U6C A;  1N33 M;  3JR4 A;  5ITR A;  2F5Q A;  3J80 S;  3GPY A;  2E5L M;  3JAM S;  4LF8 M;  3OTO M;  2F5N A;  4K0K M;  3SBJ A;  4JV5 M;  3J81 S;  3SAV A;  3SAW A;  1K3W A;  1KFV A;  4LF4 M;  4JI5 M;  4LF6 M;  5IWA M;  4DV2 M;  1Z5A A;  1J5E M;  4PDI A;  1IBM M;  1FJG M;  1XNQ M;  3VK8 A;  4DV0 M;  3T1H M;  4JI0 M;  2EA0 A;  3U6D A;  5A2Q S;  1TDZ A;  3GPP A;  5LMU M;  3GQ3 A;  4NRV A;  1EE8 A;  2Q2E B;  3SAR A;  1HR0 M;  1L2B A;  5ITU A;  3SAT A;  3U6E A;  4DR5 M;  4JI3 M;  2F5P A;  3TWL A;  1Z59 A;  1Z5B A;  4X64 M;  1N32 M;  4PD2 A;  5FLX S;  3A45 A;  1L2D A;  2HKJ A;  1K82 A;  4CIS A;  1TDH A;  4JI6 M;  3GO8 A;  4GKJ M;  1XC8 A;  1PJJ A;  1N36 M;  1Q3C A;  1HNX M;  4DV1 M;  1Z5C A;  2HHH M;  4X62 M;  4DUZ M;  3SAU A;  4GKK M;  4NXM M;  1L1Z A;  4G4R A;  4B3T M;  1HNW M;  4X65 M;  1NNJ A;  2UXB M;  4LFB M;  1K3X A;  1I94 M;  4KHP M;  3GQ5 A;  1IBK M;  2UUA M;  1R2Y A;  4LFC M;  5ITY A;  1L1T A;  4B3M M;  4ITQ A;  2UXD M;  2OPF A;  5ITQ A;  4YHH M;  2XZU A;  2UUC M;  3VK7 A; 
#chains in the Genus database with same CATH topology
 4DV6 M;  4LZZ A;  1MU5 A;  2W82 A;  2JY7 A;  4KT0 F;  2XH9 A;  3QYB A;  2DNA A;  2DZN B;  3B7Q A;  5FTM A;  1V33 A;  2QBY A;  3RE8 A;  5C18 A;  2ZTD A;  1UFZ A;  2LVN C;  3AOE C;  3C3E A;  2KZU A;  3FTC A;  3MK6 A;  4M0W A;  1XMQ M;  1G59 A;  2F5O A;  4JI4 M;  3K92 A;  4G4Q A;  4LJ9 A;  2XZF A;  2F5S A;  3VKG A;  1VQ1 A;  1IN8 A;  4L16 A;  2VQE M;  4PCZ A;  3VFD A;  3L25 A;  2DZO B;  2L4F A;  2WZJ A;  5EQT A;  5E6J A;  1OTR A;  3K8Z A;  1IM2 A;  4DUY M;  1TR8 A;  3ZCB B;  4CGY B;  4JI8 M;  5ITX A;  3TQS A;  2UXC M;  3CGW A;  1W5T A;  3C9P A;  4Y28 F;  1NNU C;  3U6S A;  3DFZ A;  4P16 A;  4IBI A;  3GLG E;  4AZF A;  2ZM6 M;  3SMP A;  4B3S M;  2KEB A;  2QCU A;  2R4E A;  3U6M A;  1XMO M;  4LF5 M;  2BWE A;  2X49 A;  1WJ7 A;  4RF1 A;  2Z8Y M;  1D0K A;  3JR5 A;  3RGS A;  3IG5 A;  1QZM A;  2V1C A;  2I7P A;  2JWS A;  2XFS A;  3VDU A;  4DV3 M;  4AW4 A;  1R2Z A;  3FTE A;  4AKH A;  3R8F A;  1SXJ C;  2KNA A;  1N33 M;  5ITR A;  2F5Q A;  2E5L M;  4LF8 M;  4IBB A;  3KOW E;  3JAM S;  2V1U A;  2K0B X;  2R18 A;  5DFL A;  3CF2 A;  4WUR A;  3H4M A;  2EKF A;  2CHQ A;  4Z6Y A;  4LGM A;  3HJ8 A;  1IY2 A;  4JN6 A;  1JR3 A;  1HJP A;  3PNV A;  4JV5 M;  3L29 A;  2JA2 A;  3VLF B;  2HL7 A;  4LF4 M;  4JI5 M;  1TF0 B;  2KA6 B;  1Z5A A;  2KXE A;  3NBI A;  3GLF A;  2XSZ A;  3VK8 A;  2NQ8 C;  3DA1 A;  3T15 A;  2CFO A;  4JI0 M;  2EA0 A;  4FWD A;  2OOA A;  2QHO B;  3LVW A;  1D0L A;  2J7O A;  3QYE A;  4IJE A;  3GQ3 A;  4NRV A;  1EE8 A;  2BNK A;  2O5R A;  3CTW B;  1ZAE A;  4GRI A;  4II7 A;  1SG9 A;  2BJV A;  2KNZ A;  5BPV A;  3SAR A;  1ORY B;  2R4J A;  2XGN A;  5ITU A;  2RKO A;  4B08 A;  4QNR A;  1IQP A;  1OIP A;  1TTE A;  1Z5B A;  4KOD A;  4PD2 A;  2H5X A;  3RFW A;  4PT5 A;  2MJ5 B;  1GL7 A;  2HKJ A;  4R7G A;  4GHL A;  1JQJ C;  3PNY A;  1IN4 A;  4LZJ A;  3M6A A;  1G41 A;  2K9D A;  7CAT A;  2LVP C;  3HU2 A;  3FKE A;  2VII A;  1N36 M;  2XFT A;  2HAK A;  2C9C A;  1Z5C A;  4AG5 A;  5KQ8 A;  1PJS A;  5GKN A;  2ZAN A;  4GKK M;  3FE3 A;  4D80 A;  4NXM M;  1E94 E;  4REZ A;  3H4J A;  2ZTC A;  2H1R A;  4R71 A;  3VK7 A;  2OO9 A;  2Z4R A;  3QAU A;  3L28 A;  1P3Q Q;  2UXB M;  2R6F A;  3FUW A;  4IBD A;  1K3X A;  3B89 A;  4HLQ A;  1Q02 A;  1C7Y A;  1R4G A;  2MR9 A;  1DV0 A;  4FCT A;  1ZMW A;  2YFQ A;  3U61 A;  1YUB A;  4B7F A;  4NC6 A;  4CHT B;  3AOG A;  4F1I A;  2QPA A;  1XNR M;  2XZU A;  2XEP A;  1VEK A;  5BR8 M;  3R9X B;  2YNM D;  2LVQ D;  2QQ8 A;  3FYD A;  5EP3 A;  3GLH A;  3ILK A;  4LJA A;  1EFU B;  5EXX A;  3U6P A;  2UU9 M;  3DZD A;  1C1K A;  1GJT A;  1IY1 A;  4DR3 M;  4IBJ A;  2KZS A;  3B9P A;  3MMP A;  5EXP A;  1VEJ A;  2KNV A;  5KPT A;  2DWN A;  3J7A S;  2K47 A;  2R0I A;  4G4O A;  3UGJ A;  1IBL M;  2OQ4 A;  3I4V A;  3GLG B;  1N77 A;  5JI3 E;  4PDG A;  3KP1 E;  4X66 M;  3T1Y M;  4NSO B;  4NRW A;  2R46 A;  2JP7 A;  5ITT A;  1R6B X;  2R65 A;  3QWL A;  4DR6 M;  2LHG A;  2QZ4 A;  1IXS B;  3BOS A;  3LCV B;  4MH0 E;  1NV8 A;  2EUC A;  2R44 A;  3KS8 A;  3J27 B;  4NXN M;  4IJF A;  4DR2 M;  1T6O A;  4YY3 M;  4P17 A;  1RU3 A;  3KW6 A;  2DWZ B;  3SAS A;  3GLI E;  1Q39 A;  3AFH A;  4LRS A;  2R62 A;  2J7N A;  2GQF A;  1OAI A;  1MN3 A;  3DOA A;  5IT9 S;  4LF7 M;  5KPZ A;  4FW9 A;  3PFI A;  3U6Q A;  1DGH B;  2L09 A;  2LXE A;  1QAO A;  4L8R C;  1SXJ D;  3WHK A;  2WSC F;  3D8B A;  4HEO A;  4IIW A;  2Y21 A;  1WIV A;  4LJ4 A;  4RKU F;  3B74 A;  3OTO M;  2AHM A;  1T3T A;  3E9S A;  3SMS A;  2DI0 A;  5FTK A;  2L7H A;  1PGY A;  3GRY A;  4K0K M;  3SBJ A;  1G8P A;  2CHG A;  2CP8 A;  2LVA A;  4I81 A;  2X8A A;  2JXN A;  2C98 A;  1K3W A;  4LCB A;  3U5Z B;  4IBC A;  3PVS A;  4DV2 M;  1J5E M;  1D2N A;  2LNH C;  2P5T A;  1FJG M;  2R45 A;  2QSF X;  3AKZ A;  3K9O A;  2FOI C;  3U6D A;  2DKL A;  1IN5 A;  4IBF A;  2Y0Q A;  1TDZ A;  3I4Y A;  1NHG C;  4KO8 A;  3HJS A;  3HHY A;  5H37 D;  2MH8 A;  3C3D A;  1XXH E;  4FVM A;  2L4E A;  1L2B A;  1BVS A;  1NHW C;  4JI3 M;  3W68 A;  1DGG A;  1QDR A;  4GHA A;  3AJI B;  4X64 M;  4MGK E;  2CUZ A;  3J7B A;  3HJQ A;  1CUK A;  3L2A A;  2A5Y B;  2DAK A;  1F4I A;  1K82 A;  1J09 A;  2HCB A;  3BXW A;  2D7E A;  3ZC7 B;  5FSW A;  4LJ7 A;  1XC8 A;  3GRV A;  5DYG A;  1OJL A;  4GC9 A;  1EIJ A;  3TL4 X;  4LJ6 A;  4DV1 M;  1HNX M;  4LG2 A;  2Z4S A;  4DUZ M;  3LW5 F;  5KPR A;  1GLN A;  1UM8 A;  1GAB A;  2MGW A;  3GLH E;  3I51 A;  2KRU A;  4XGI A;  1VDD A;  4G4R A;  1GJS A;  1W5S A;  1SXJ E;  1NNJ A;  3FRI A;  3HGI A;  3FYC A;  2LVO C;  4HL4 A;  2C9O A;  4FD2 A;  3HX3 A;  4ITQ A;  4M9X A;  1E32 A;  2M60 A;  4BBA A;  2ERC A;  3HHW A;  5KO3 A;  2FE8 A;  3KOY E;  1XB2 B;  4WP2 A;  2G5G X;  2CV0 A;  2CE7 A;  4YHH M;  2OOB A;  3KSJ A;  4DR4 M;  1A5T A;  2ZAO A;  4G6Z A;  2Z7J A;  3B7Z A;  2LHC A;  4DR7 M;  3IG8 A;  1OAO C;  3U60 B;  1D0M A;  3MHV C;  1NY5 A;  1E9S A;  1HT1 E;  2Y20 A;  5DNY A;  2YQZ A;  1NV9 A;  1QDT A;  5EP2 A;  3W0L B;  1OFH A;  3Q8X A;  1JR3 D;  1QYR A;  4OVZ A;  4D82 A;  2EO2 A;  2F4V M;  4DV7 M;  1TGU A;  1GL6 A;  3K2L A;  2G3Q A;  3GPU A;  1HT2 E;  4M0D A;  2APL A;  3F92 A;  3A42 A;  4IBK A;  3SFZ A;  5JI2 E;  2XSZ D;  4AQY M;  2HWJ A;  2JY6 B;  2UUB M;  1N75 A;  2LTU A;  3E4R A;  3GLI B;  4B3R M;  3Q8G A;  2QEN A;  2C96 A;  2DXI A;  1IY0 A;  3SHG B;  3GLG A;  4DV4 M;  4B7H A;  1GVN A;  1X37 A;  1G71 A;  1WXQ A;  4JI2 M;  1NO1 A;  3EIE A;  1NY6 A;  3LVV A;  1KSF X;  2JNH A;  1ZV1 A;  4M9S A;  4S12 A;  1HQY E;  5ITX E;  3L26 A;  3KSX A;  2JUJ A;  4OVZ B;  2LWX A;  1IXS A;  4QOS A;  1NVM A;  3V76 A;  4W5W A;  3UJN A;  1VDL A;  1Q3B A;  2DAI A;  3KP0 E;  3PXG A;  1H6U A;  3TWM A;  3FD9 A;  3A98 B;  3C58 A;  2JY5 A;  4L6V 6;  4DR1 M;  3U6O A;  1N34 M;  3GPX A;  3U6C A;  2DZL A;  3NWL A;  4RF0 A;  3ZH9 B;  1T43 A;  3KDS E;  2M5Z A;  2QNJ A;  3E46 A;  3J80 S;  2EKK A;  3I01 M;  2Z3X A;  2L7I A;  3KOZ E;  3LMM A;  4QOZ C;  1DGH A;  3SHF A;  2DWL A;  4GMQ A;  1QAM A;  2DAE A;  4MM3 B;  4LJ8 A;  2BJW A;  1TH2 A;  2VF8 A;  3J2P B;  1XXH B;  3MJ5 A;  4QHT A;  3VKH A;  2CRU A;  1R7R A;  4MGI E;  1XHB A;  3L27 A;  1KFV A;  3W67 A;  4A3V B;  5IWA M;  4PDI A;  1OKS A;  2CEA A;  1JR3 E;  1HQC A;  4DV0 M;  4BLC A;  3T1H M;  1IN6 A;  2DEN A;  4QHS A;  2FS1 A;  3M7G A;  4GIP A;  1E9R A;  4I8O A;  5LMU M;  5EP4 A;  3U5Z A;  2I7N A;  3D8L A;  4RNA A;  3GLF E;  2Q2E B;  2QP9 X;  4F2L A;  3E21 A;  4XK8 F;  3U6E A;  4WW0 A;  4DR5 M;  2F5P A;  3TWL A;  1N32 M;  2DVW B;  2CV1 A;  3HKP A;  3A45 A;  1NJG A;  1KYI A;  3WHL A;  1L2D A;  4AI6 A;  3HU3 A;  4L4U A;  4LJ5 A;  4CIS A;  2FNA A;  1R5L A;  5F3W A;  4JI6 M;  1OQY A;  1SXJ B;  2XF3 A;  1XWI A;  1V34 A;  1QUT A;  1JB0 F;  1Q3C A;  3HZJ A;  4BB9 A;  3SAU A;  3AL0 C;  5C1B A;  3TE6 A;  2JZ1 A;  1AIP C;  3BBZ A;  4L78 A;  4GEW A;  5EP1 A;  5IRE B;  1PJT A;  2CHV A;  1IXR C;  4NOO B;  3HWS A;  4IBE A;  2DWM A;  1NJF A;  2CV2 A;  2JZ0 A;  3HHX A;  3KFU G;  3HY5 A;  3ZQJ A;  1WHC A;  2FFJ A;  4KHP M;  4LFC M;  1R2Y A;  2DHR A;  3LCU A;  1QAQ A;  3LQR A;  4FWH A;  5ITY A;  1L1T A;  2L6O A;  2C99 A;  4LY6 A;  3IEC A;  4AKG A;  2QBY B;  5ITQ A;  1Y8G A;  2UUC M;  3B7N A;  1PJI A;  2DAG A;  4OU7 A;  5E26 A;  4KLN A;  1QQW A;  2XLJ A;  4MB7 A;  1HNZ M;  1DGB A;  3CF0 A;  2RRU A;  4Q7J A;  1DGF A;  3KXE C;  3K9P A;  5LMN M;  2VQF M;  2D7H A;  4FWG A;  4GC5 A;  3TWK A;  1IN7 A;  3U60 A;  3GQ4 A;  2ZAM A;  3FUT A;  4QNM A;  1LV7 A;  4JXJ A;  4CIZ A;  4JYA M;  4LFA M;  1DO2 A;  1YLA A;  1MX0 A;  1QVR A;  4LGY A;  3GP1 A;  2KHH A;  3GRR A;  5FTN A;  2D7G A;  5EXT A;  1LTM A;  3SYK A;  1N78 A;  1L2C A;  3IHP A;  4G4N A;  3W0F A;  4CJ6 A;  3KS4 A;  3GLI A;  3A46 A;  1PM5 A;  1NSF A;  3LQQ A;  4LF9 M;  4JI7 M;  2CWB A;  2LH0 A;  3U6L A;  4NSR A;  2ZBK B;  2K6B A;  1PJQ A;  2EJS A;  2KDL A;  3HU1 A;  4LRT A;  5EXS A;  1ZQ9 A;  4JI1 M;  2BWB A;  5EJC A;  4OX9 M;  2WSE F;  2VDB B;  1J7K A;  8CAT A;  4DV5 M;  3AV0 A;  3T38 A;  2RGO A;  5FTL A;  3M0E A;  4OW0 A;  1QUS A;  3KOX E;  1GO5 A;  2B3T A;  2KW0 A;  3JR4 A;  2Y0T A;  3GPY A;  5L8R F;  1AUA A;  1S3S A;  1V92 A;  4MGH A;  4ANR A;  2GNO A;  5IZ7 D;  3RGP A;  4MGY E;  4ZPX A;  1YE9 A;  2YR0 A;  3AOE A;  2N35 A;  3GLF B;  2F5N A;  2DHY A;  5KQD A;  3J81 S;  3SAV A;  1IFY A;  2O01 F;  2VF7 A;  4IBG A;  3SAW A;  1L8Q A;  1OFI A;  4LF6 M;  4TUW A;  4MGZ E;  1XNQ M;  4FCV A;  1IBM M;  1XXH A;  3FUU A;  3T6P A;  3EIH A;  1GKI A;  3UMM A;  3UZU A;  5A2Q S;  1WGN A;  3VDP A;  3GPP A;  1WR1 B;  2KRK A;  1VEG A;  2C5R A;  1HR0 M;  2V6Z M;  1ZMV A;  5DYI A;  2O25 A;  4FCW A;  2G8L A;  3UK6 A;  2FH0 A;  2J5Y A;  3SAT A;  3NBX X;  4AKI A;  1DO0 A;  1PRB A;  1Z59 A;  3FTF A;  4Z8X A;  1QAN A;  5FLX S;  3K1J A;  1WGL A;  2DAM A;  4UN2 B;  4G3O A;  2JY8 A;  3FUX A;  1TDH A;  1VG5 A;  3GO8 A;  3I04 M;  4GKJ M;  1PJJ A;  2L2D A;  1IXZ A;  4NL4 H;  4GH9 A;  1TH3 A;  3HHZ A;  3GRU A;  4DBG B;  3SYL A;  4B7G A;  4XBO A;  2HHH M;  4X62 M;  1FNN A;  3CF6 E;  3TPZ A;  1SXJ A;  4GIT A;  1YSY A;  2WSF F;  5FTJ A;  3SC3 A;  2RGH A;  4AG6 A;  1TH4 A;  2LBC A;  3KVW A;  1L1Z A;  2X4A A;  4B3T M;  2MRO B;  1Z6T A;  4R3D A;  1ZMU A;  1HNW M;  3U61 B;  4EIW A;  1MJG M;  4X65 M;  1I4W A;  4LFB M;  3FRH A;  1I94 M;  4M9Z A;  4I4L A;  4L15 A;  3GQ5 A;  1IBK M;  2UUA M;  1OIZ A;  2UXD M;  4B3M M;  1QZE A;  1G3I A;  2OPF A;  3FTD A;  4I5S A;  3FUV A;  3GLH B;  3THG A;  4D81 A;  1G4A E; 
#chains in the Genus database with same CATH homology
 4DV6 M;  4LZZ A;  1MU5 A;  2W82 A;  2XH9 A;  2DZN B;  5FTM A;  2QBY A;  3RE8 A;  5C18 A;  3AOE C;  3FTC A;  3MK6 A;  2KZU A;  4M0W A;  1XMQ M;  2F5O A;  4JI4 M;  1G59 A;  3K92 A;  4G4Q A;  4LJ9 A;  2XZF A;  2F5S A;  3VKG A;  1IN8 A;  4L16 A;  2VQE M;  4PCZ A;  3VFD A;  3L25 A;  2DZO B;  5EQT A;  5E6J A;  3K8Z A;  1IM2 A;  4DUY M;  3ZCB B;  4CGY B;  4JI8 M;  5ITX A;  3TQS A;  2UXC M;  1W5T A;  1NNU C;  3U6S A;  3DFZ A;  4P16 A;  4IBI A;  4AZF A;  2ZM6 M;  3SMP A;  4B3S M;  2KEB A;  2QCU A;  2R4E A;  3U6M A;  1XMO M;  4LF5 M;  2X49 A;  4RF1 A;  3JR5 A;  3RGS A;  3IG5 A;  1QZM A;  2V1C A;  2I7P A;  2XFS A;  3VDU A;  4DV3 M;  1R2Z A;  4AW4 A;  3FTE A;  4AKH A;  3R8F A;  1SXJ C;  1N33 M;  5ITR A;  2F5Q A;  2E5L M;  4LF8 M;  4IBB A;  3KOW E;  3JAM S;  2V1U A;  2R18 A;  3CF2 A;  4WUR A;  3H4M A;  2CHQ A;  4Z6Y A;  4LGM A;  3HJ8 A;  1IY2 A;  4JN6 A;  1JR3 A;  3PNV A;  4JV5 M;  3L29 A;  2JA2 A;  3VLF B;  2HL7 A;  4LF4 M;  4JI5 M;  2KA6 B;  1Z5A A;  2KXE A;  3NBI A;  3GLF A;  2XSZ A;  3VK8 A;  2NQ8 C;  3DA1 A;  3T15 A;  2CFO A;  4JI0 M;  2EA0 A;  4FWD A;  3LVW A;  2J7O A;  4IJE A;  3GQ3 A;  4NRV A;  1EE8 A;  2BNK A;  2O5R A;  3CTW B;  1ZAE A;  4GRI A;  4II7 A;  5BPV A;  2BJV A;  3SAR A;  4GHA A;  1ORY B;  2R4J A;  2XGN A;  5ITU A;  2RKO A;  4B08 A;  4QNR A;  1IQP A;  1Z5B A;  4KOD A;  4PD2 A;  3RFW A;  4PT5 A;  4GHL A;  1GL7 A;  2HKJ A;  4R7G A;  1JQJ C;  3PNY A;  1IN4 A;  4LZJ A;  3M6A A;  1G41 A;  7CAT A;  3HU2 A;  3FKE A;  2VII A;  1N36 M;  2XFT A;  4AG5 A;  2C9C A;  1Z5C A;  5KQ8 A;  5GKN A;  2ZAN A;  4GKK M;  4D80 A;  4NXM M;  1E94 E;  4REZ A;  2H1R A;  3VK7 A;  2Z4R A;  3QAU A;  3L28 A;  2UXB M;  3FUW A;  4IBD A;  1K3X A;  4HLQ A;  4FCT A;  2YFQ A;  3U61 A;  1YUB A;  4B7F A;  4CHT B;  3AOG A;  2QPA A;  1XNR M;  2XZU A;  2XEP A;  5BR8 M;  3R9X B;  2YNM D;  3FYD A;  5EP3 A;  3GLH A;  3ILK A;  4LJA A;  5EXX A;  3U6P A;  2UU9 M;  3DZD A;  1C1K A;  4DR3 M;  1IY1 A;  4IBJ A;  2KZS A;  3B9P A;  5EXP A;  5KPT A;  2DWN A;  3J7A S;  2K47 A;  4G4O A;  3UGJ A;  1IBL M;  2OQ4 A;  3I4V A;  3GLG B;  1N77 A;  5JI3 E;  4PDG A;  3KP1 E;  4X66 M;  3T1Y M;  4NSO B;  4NRW A;  2R46 A;  5ITT A;  1R6B X;  2R65 A;  3QWL A;  4DR6 M;  2QZ4 A;  3BOS A;  1IXS B;  4MH0 E;  2EUC A;  3KS8 A;  3J27 B;  4NXN M;  4IJF A;  4DR2 M;  4YY3 M;  3KW6 A;  2DWZ B;  3SAS A;  1Q39 A;  3AFH A;  4LRS A;  2R62 A;  2J7N A;  3DOA A;  5IT9 S;  4LF7 M;  5KPZ A;  4FW9 A;  3PFI A;  3U6Q A;  1DGH B;  2L09 A;  2LXE A;  1QAO A;  4L8R C;  1SXJ D;  3WHK A;  3D8B A;  4IIW A;  2Y21 A;  4LJ4 A;  3OTO M;  2AHM A;  1T3T A;  3E9S A;  3SMS A;  5FTK A;  2L7H A;  3GRY A;  4K0K M;  3SBJ A;  1G8P A;  2CHG A;  4I81 A;  2X8A A;  2C98 A;  1K3W A;  4LCB A;  3U5Z B;  4IBC A;  3PVS A;  4DV2 M;  1J5E M;  1D2N A;  2LNH C;  2P5T A;  1FJG M;  2R45 A;  3AKZ A;  2FOI C;  3U6D A;  1IN5 A;  4IBF A;  2Y0Q A;  1TDZ A;  3I4Y A;  1NHG C;  4KO8 A;  3HJS A;  3HHY A;  5H37 D;  4FVM A;  1L2B A;  1NHW C;  4JI3 M;  1DGG A;  3AJI B;  4X64 M;  4MGK E;  2CUZ A;  3J7B A;  3HJQ A;  3L2A A;  2A5Y B;  1K82 A;  1J09 A;  2HCB A;  2D7E A;  3ZC7 B;  5FSW A;  4LJ7 A;  1XC8 A;  3GRV A;  5DYG A;  1OJL A;  4GC9 A;  3TL4 X;  4LJ6 A;  4DV1 M;  1HNX M;  4LG2 A;  2Z4S A;  4DUZ M;  5KPR A;  1GLN A;  1UM8 A;  3I51 A;  2KRU A;  4XGI A;  1VDD A;  4G4R A;  1W5S A;  1SXJ E;  1NNJ A;  3HGI A;  3FYC A;  4HL4 A;  2C9O A;  4FD2 A;  4ITQ A;  4M9X A;  1E32 A;  2M60 A;  4BBA A;  2ERC A;  3HHW A;  5KO3 A;  2FE8 A;  3KOY E;  2G5G X;  2CV0 A;  2CE7 A;  4YHH M;  4DR4 M;  3KSJ A;  2ZAO A;  4G6Z A;  2Z7J A;  4DR7 M;  3IG8 A;  3U60 B;  3MHV C;  1NY5 A;  1E9S A;  1HT1 E;  2Y20 A;  5DNY A;  2YQZ A;  5EP2 A;  3W0L B;  1OFH A;  3Q8X A;  1JR3 D;  1QYR A;  4OVZ A;  4D82 A;  2EO2 A;  2F4V M;  4DV7 M;  1TGU A;  1GL6 A;  3K2L A;  3GPU A;  1HT2 E;  4M0D A;  3A42 A;  4IBK A;  3SFZ A;  5JI2 E;  2XSZ D;  4AQY M;  2UUB M;  1N75 A;  3E4R A;  3GLI B;  4B3R M;  2QEN A;  2C96 A;  2DXI A;  1IY0 A;  3SHG B;  3GLG A;  4DV4 M;  4B7H A;  1GVN A;  1X37 A;  1WXQ A;  4JI2 M;  3EIE A;  1NY6 A;  3LVV A;  1KSF X;  4M9S A;  4S12 A;  1HQY E;  5ITX E;  3L26 A;  3KSX A;  4OVZ B;  2LWX A;  4QOS A;  1NVM A;  4W5W A;  3UJN A;  1Q3B A;  3KP0 E;  3PXG A;  1H6U A;  3TWM A;  3FD9 A;  3A98 B;  3C58 A;  4DR1 M;  3U6O A;  1N34 M;  3GPX A;  3U6C A;  4RF0 A;  3NWL A;  3ZH9 B;  3KDS E;  2M5Z A;  3J80 S;  2Z3X A;  2L7I A;  3KOZ E;  3LMM A;  4QOZ C;  1DGH A;  3SHF A;  2DWL A;  4GMQ A;  1QAM A;  4MM3 B;  4LJ8 A;  2BJW A;  1TH2 A;  3J2P B;  3MJ5 A;  1XXH B;  3VKH A;  4QHT A;  1R7R A;  4MGI E;  1XHB A;  3L27 A;  1KFV A;  4A3V B;  5IWA M;  4PDI A;  2CEA A;  1HQC A;  4DV0 M;  4BLC A;  3T1H M;  1IN6 A;  4QHS A;  4GIP A;  3M7G A;  1E9R A;  4I8O A;  5LMU M;  5EP4 A;  3U5Z A;  2I7N A;  3D8L A;  4RNA A;  2Q2E B;  2QP9 X;  3U6E A;  4WW0 A;  4DR5 M;  2F5P A;  3TWL A;  1N32 M;  2DVW B;  2CV1 A;  3HKP A;  3A45 A;  1NJG A;  1KYI A;  3WHL A;  1L2D A;  4AI6 A;  3HU3 A;  4L4U A;  4LJ5 A;  4CIS A;  2FNA A;  5F3W A;  4JI6 M;  1SXJ B;  2XF3 A;  1XWI A;  1Q3C A;  4BB9 A;  3SAU A;  3AL0 C;  5C1B A;  3TE6 A;  4L78 A;  5EP1 A;  5IRE B;  2CHV A;  1IXR C;  4NOO B;  3HWS A;  4IBE A;  2DWM A;  1NJF A;  2CV2 A;  3HHX A;  3KFU G;  2FFJ A;  4KHP M;  4LFC M;  1R2Y A;  2DHR A;  3LQR A;  1QAQ A;  4FWH A;  5ITY A;  1L1T A;  2L6O A;  2C99 A;  4LY6 A;  4AKG A;  2QBY B;  5ITQ A;  2UUC M;  1PJI A;  4OU7 A;  5E26 A;  4KLN A;  1QQW A;  2XLJ A;  4MB7 A;  1HNZ M;  1DGB A;  3CF0 A;  1DGF A;  3KXE C;  5LMN M;  2VQF M;  2D7H A;  4FWG A;  4GC5 A;  3TWK A;  1IN7 A;  3U60 A;  3GQ4 A;  2ZAM A;  3FUT A;  4QNM A;  1LV7 A;  4JXJ A;  4JYA M;  4LFA M;  1DO2 A;  1MX0 A;  1QVR A;  4LGY A;  3GP1 A;  3GRR A;  5FTN A;  2D7G A;  5EXT A;  3SYK A;  1N78 A;  1L2C A;  4G4N A;  3W0F A;  3KS4 A;  3GLI A;  3A46 A;  1PM5 A;  1NSF A;  3LQQ A;  4LF9 M;  4JI7 M;  2LH0 A;  3U6L A;  4NSR A;  2ZBK B;  3HU1 A;  4LRT A;  5EXS A;  4JI1 M;  1ZQ9 A;  5EJC A;  4OX9 M;  1J7K A;  8CAT A;  4DV5 M;  3AV0 A;  3T38 A;  2RGO A;  5FTL A;  3M0E A;  4OW0 A;  3KOX E;  2KW0 A;  3JR4 A;  2Y0T A;  3GPY A;  1S3S A;  4MGH A;  3RGP A;  5IZ7 D;  4MGY E;  4ZPX A;  1YE9 A;  2YR0 A;  3AOE A;  3GLF B;  2F5N A;  5KQD A;  3J81 S;  3SAV A;  4IBG A;  3SAW A;  1L8Q A;  1OFI A;  4LF6 M;  4TUW A;  4MGZ E;  1XNQ M;  4FCV A;  1IBM M;  1XXH A;  3FUU A;  3EIH A;  1GKI A;  3UMM A;  3UZU A;  5A2Q S;  3VDP A;  3GPP A;  2KRK A;  2C5R A;  1HR0 M;  2V6Z M;  5DYI A;  4FCW A;  2G8L A;  3UK6 A;  3SAT A;  4AKI A;  1DO0 A;  1Z59 A;  3FTF A;  4Z8X A;  1QAN A;  5FLX S;  3K1J A;  3FUX A;  1TDH A;  3GO8 A;  4GKJ M;  1PJJ A;  1IXZ A;  4NL4 H;  4GH9 A;  1TH3 A;  3HHZ A;  3GRU A;  3SYL A;  4B7G A;  4XBO A;  2HHH M;  4X62 M;  1FNN A;  3CF6 E;  3TPZ A;  1SXJ A;  4GIT A;  1YSY A;  5FTJ A;  3SC3 A;  2RGH A;  4AG6 A;  3KVW A;  1TH4 A;  1L1Z A;  2X4A A;  4B3T M;  4R3D A;  1Z6T A;  1HNW M;  3U61 B;  4EIW A;  4X65 M;  1I4W A;  4LFB M;  1I94 M;  4M9Z A;  4I4L A;  4L15 A;  3GQ5 A;  1IBK M;  2UUA M;  2UXD M;  4B3M M;  1G3I A;  2OPF A;  3FTD A;  4I5S A;  3FUV A;  3GLH B;  3THG A;  4D81 A;  1G4A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...