5IWAM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5iwaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5iwaM02
4NXMM 1L2CA 1PM5A 4X65M 1IBMM 2F5SA 1FJGM 1Z5CA 1XC8A 2F5PA 1HNZM 3TWLA 4DV2M 1XNRM 4JI4M 1IBKM 1L2BA 4X66M 1K3XA 2UUCM 1N33M 5ITXA 5A2QS 5ITRA 2EA0A 3GPXA 4X62M 4B3SM 4G4RA 5ITQA 4PD2A 3J81S 4JI0M 1KFVA 4DUZM 2HHHM 4JYAM 3SBJA 4DUYM 4JI6M 1J5EM 3VK8A 4DV3M 4NRWA 4LF5M 4KHPM 3VK7A 3GQ5A 3U6LA 5LMUM 4YY3M 3A46A 4DV4M 1PJJA 3GQ3A 4DR2M 1L1ZA 4JI1M 2XZFA 3JR4A 3A45A 1R2YA 4JI5M 5ITUA 5ITXE 4K0KM 4DR5M 2UUAM 4PDIA 3C58A 3GPPA 2OQ4A 3OTOM 4B3TM 4LFBM 3DOAA 2XZUA 2UUBM 2VQFM 4DV0M 4DV1M 2UXDM 1MX0A 2OPFA 4DV5M 3SATA 4LFCM 5LMNM 4JI7M 1XNQM 4G4NA 4DV7M 3GPUA 3T1HM 4CISA 3U6DA 4JI2M 2Q2EB 2UXBM 1Q3CA 1Z5AA 4PDGA 5IWAM 3TWKA 4JI3M 3A42A 5FLXS 5ITTA 4DR7M 3U6PA 4ITQA 3SARA 1Z5BA 4DV6M 3T1YM 1HNWM 3U6OA 3W0FA 4DR6M 1IBLM 1XMQM 2F4VM 1HR0M 5BR8M 4NXNM 3U6SA 4GKKM 1EE8A 1L2DA 4G4QA 1R2ZA 4B3MM 3U6EA 3SAUA 1N32M 1I94M 4LF7M 1MU5A 2ZBKB 3GP1A 4NRVA 2F5QA 1N36M 1Z59A 3U6QA 4G4OA 1N34M 1Q39A 3J80S 3JR5A 1K82A 2HKJA 3GPYA 5ITYA 4LF8M 1TDHA 3SAVA 1PJIA 3GO8A 3J7AS 3U6MA 1XMOM 4B3RM 4JV5M 4X64M 4DR1M 1Q3BA 3GQ4A 2E5LM 2F5NA 1K3WA 4OX9M 2UU9M 2F5OA 4LF9M 3SASA 4MB7A 1L1TA 4LFAM 2UXCM 1NNJA 4JI8M 3TWMA 2ZM6M 4YHHM 3JAMS 4GKJM 4PCZA 1TDZA 4LF4M 4LF6M 5IT9S 2VQEM 4DR4M 4AQYM 4DR3M 3SAWA 1HNXM 3U6CA
chains in the Genus database with same CATH superfamily
1G4AE 3VLFB 2ZTCA 1IBMM 2F5SA 3K1JA 2JY8A 2YFQA 1YSYA 2RRUA 1TH4A 2ERCA 2CV2A 1GL6A 1QUTA 2BWBA 1IBKM 2JA2A 3FYDA 1L2BA 4QNMA 2JWSA 3FUVA 1JB0F 2RGOA 3BXWA 4FD2A 4M9XA 1WJ7A 3ZH9B 3SFZA 1NVMA 2DAIA 4KT0F 3K2LA 3MK6A 1D2NA 1NO1A 5A2QS 1NHWC 4KODA 2Z4SA 4IBEA 1RU3A 2XSZD 2DAEA 3FUTA 5FTJA 2I7NA 1DGBA 2KNVA 1IXSA 4II7A 4JN6A 1W5SA 2EUCA 1QQWA 2K9DA 3GRUA 3RE8A 1DGHB 3ZQJA 4DUZM 3FUXA 4NSRA 4DUYM 4DV3M 4NSOB 1SXJC 1Y8GA 1XWIA 3CF6E 3GRVA 4XBOA 1DGGA 4LJAA 1JR3E 4ANRA 4YY3M 5DNYA 5LMUM 4AI6A 3PVSA 1JR3A 1GVNA 2JZ1A 4WW0A 1IN5A 4HEOA 4JI1M 2XZFA 3R9XB 4GEWA 3A45A 4JI5M 3MJ5A 1HT1E 3M7GA 4K0KM 4P16A 1GJSA 4DR5M 2FNAA 4OU7A 2Z3XA 2UUAM 1ZMUA 5GKNA 4GHLA 4PDIA 2CEAA 3W0LB 2MR9A 2KA6B 4IBDA 3ILKA 1BVSA 2R45A 1JQJC 2DHYA 1DV0A 2XZUA 4Z6YA 3D8BA 3PNYA 4IBJA 2UXDM 1WGLA 3SATA 4LFCM 4RF1A 4B3RM 3B7ZA 4Q7JA 1NHGC 1QUSA 3SC3A 5KO3A 1OFIA 2JZ0A 2K6BA 3K9OA 2X49A 3I01M 2J5YA 4GC5A 3GPUA 1N75A 4JI2M 2LH0A 3D8LA 3U6DA 1OTRA 1IXRC 2Y21A 2OOBA 4MGYE 3BOSA 4PDGA 1GKIA 4BBAA 1N77A 3LQRA 3U60B 1GL7A 1SXJA 3GLGA 1HNWM 1PRBA 2LVOC 3W0FA 3GLIE 3MMPA 4LGMA 1R7RA 2F4VM 1OAOC 2DNAA 1HR0M 1I4WA 4GKKM 3KDSE 4IJFA 3AL0C 2R4JA 1IN7A 1KYIA 2QSFX 1TF0B 2DWMA 1E9RA 1J7KA 4GRIA 2KEBA 4KO8A 2QBYB 5FTLA 3GP1A 2JY7A 2F5QA 2G8LA 3DZDA 4M0DA 1N36M 1R4GA 4I8OA 3I04M 2DXIA 4GHAA 2FH0A 3WHLA 1K82A 3VFDA 2FOIC 3SAVA 4FVMA 3HJSA 3VKHA 1SG9A 3J27B 4JV5M 1W5TA 2DWLA 1Q3BA 1Q02A 1WXQA 3HHZA 2F5NA 2MH8A 3B89A 1K3WA 2UU9M 1T6OA 1EIJA 4LF9M 2ZAMA 3L28A 1ZMWA 3A98B 2UXCM 3FD9A 4REZA 4MGKE 1NNJA 2DAKA 2QZ4A 2ZM6M 4GKJM 2KXEA 3FKEA 1TDZA 4JXJA 4LF4M 2VQEM 1NY5A 4DR4M 4AQYM 3SAWA 4L15A 3H4JA 2R65A 2DZLA 1QVRA 2Y20A 1PM5A 4X65M 3Q8GA 1IXZA 2CHGA 3QYEA 1FJGM 5DYGA 1Z5CA 2R6FA 4LG2A 2KRKA 1XC8A 2C5RA 2F5PA 4L16A 4DV2M 2DHRA 3Q8XA 2R44A 1TGUA 4KLNA 5EXXA 4GC9A 2C9CA 5KPRA 2QPAA 1UM8A 4I81A 4LZJA 1E94E 3DA1A 2LNHC 3IG8A 2X4AA 3HX3A 3HZJA 1IY1A 1AIPC 1V33A 5ITRA 3GPXA 2WSCF 3M0EA 2L7HA 3BBZA 4I4LA 4B08A 2FFJA 4PD2A 2DAMA 3I4VA 5L8RF 3J81S 3RFWA 1PJTA 1TTEA 3VDPA 4NOOB 3SBJA 3LVWA 5BPVA 3VK8A 1J5EM 3AFHA 3HJ8A 3ZCBB 1XHBA 1OIPA 5DYIA 2KNZA 1HT2E 1QYRA 5KQ8A 3U6LA 2VDBB 3HU1A 3A46A 1IN8A 2H1RA 2QP9X 1PJJA 3L27A 3QAUA 2BNKA 3ZC7B 3GQ3A 4AKGA 1G59A 4DR2M 3U60A 2DENA 3KP1E 1GJTA 2JY5A 2O5RA 2YNMD 3GLGB 3GRYA 2VF8A 1IM2A 4GH9A 5ITUA 4LRSA 1VEJA 2LHCA 2CHQA 2DAGA 2O01F 5E6JA 2XFTA 1QZMA 2VIIA 3GPPA 1D0KA 4D81A 5H37D 2A5YB 3LW5F 5FSWA 3LQQA 3HHYA 1WGNA 1NJFA 4R7GA 4L6V6 2M60A 2BJVA 3U5ZA 3KOWE 4DV7M 3U61B 3IECA 2JUJA 8CATA 2LTUA 3GLHE 2YQZA 1XXHE 3TWKA 5EP4A 1YE9A 4EIWA 2CE7A 5FLXS 4DR7M 2CWBA 3TE6A 4ITQA 3J2PB 1SXJE 3E46A 3AKZA 3GLHB 3GLFB 2HL7A 3E4RA 3U6SA 2FS1A 3UJNA 1L2DA 5KPZA 4G4QA 1QANA 2DZNB 1R2ZA 5FTMA 2V1UA 1T43A 3SAUA 4LRTA 4LY6A 1MJGM 1I94M 2DKLA 4LF7M 4MGHA 4IBFA 4LJ8A 1Z6TA 1NV9A 4FWHA 4NC6A 1Q39A 3JR5A 3AOEC 1VDDA 2G3QA 4MGZE 4LF8M 2BJWA 3HHWA 4IJEA 3NBIA 3U6MA 1XMOM 4X64M 1X37A 4M0WA 3KSJA 3VDUA 2Y0QA 2D7HA 5IZ7D 3J7BA 4UN2B 4JI8M 2QENA 3CTWB 2NQ8C 2N35A 1MN3A 1JR3D 3LMMA 3B7QA 3NBXX 2L2DA 2D7GA 1ZV1A 5EXSA 1PJQA 4DR3M 1P3QQ 2L7IA 5KPTA 3K9PA 4CGYB 3U6CA 4NXMM 1IN4A 3B9PA 1R6BX 4A3VB 2B3TA 2XLJA 4F1IA 1HNZM 3TWLA 5C1BA 4IBBA 4AG6A 1IN6A 3KXEC 4L4UA 1VG5A 4OVZB 2H5XA 1OIZA 1ZAEA 3I51A 2DI0A 3B74A 2XEPA 3FRHA 4IBKA 4LZZA 3FE3A 4DBGB 3SHFA 1FNNA 1IQPA 5EJCA 2EA0A 2LVAA 2DWZB 4LJ6A 1C7YA 1D0MA 2APLA 2C9OA 3GLFE 5ITQA 2XH9A 1KFVA 3SMPA 1R5LA 2K0BX 1DO2A 2HHHM 4JYAM 3KW6A 4CJ6A 4QHSA 1YLAA 4Z8XA 4D82A 1XXHB 2XGNA 3KOZE 4M9SA 3GLIB 4JI6M 4LF5M 1VDLA 3U61A 3VK7A 3GQ5A 2CV0A 3LVVA 1QDRA 5FTNA 4DV4M 3LCUA 2RKOA 3T6PA 5DFLA 3HKPA 2QNJA 1L1ZA 5FTKA 1QAMA 5EQTA 5KQDA 4I5SA 3HHXA 4G3OA 4RKUF 5ITXE 2JXNA 3AOGA 2QBYA 2LVQD 4QNRA 3SYKA 2KW0A 3C58A 2Z8YM 2XFSA 3E9SA 4F2LA 1HNXM 3OTOM 3KS8A 4B3TM 4IBIA 3DOAA 4MH0E 3T15A 3FTEA 5C18A 1IXSB 1PJSA 4L78A 4DV0M 1SXJD 2KNAA 1DGHA 5LMNM 2GNOA 4JI7M 4G4NA 1IY0A 1WR1B 2DZOB 1LTMA 4AG5A 2CRUA 1PGYA 3T1HM 1ORYB 1QDTA 2R18A 3W67A 1NNUC 4CISA 1OJLA 4M9ZA 1Q3CA 2XF3A 5IWAM 2KDLA 3K92A 3SHGB 3IG5A 1NV8A 3U6PA 5IREB 4DV6M 1TH2A 3M6AA 3SARA 3NWLA 4FWDA 3HWSA 1XMQM 2WSFF 2D7EA 3THGA 3GRRA 2I7PA 2R0IA 2OO9A 4IBGA 5BR8M 3KFUG 2C98A 1IFYA 4AKIA 3C9PA 1C1KA 2P5TA 3KOXE 5EP2A 2KRUA 2R62A 5JI2E 4B3MM 2X8AA 4BB9A 1F4IA 2HAKA 2LVPC 3AJIB 1IY2A 4XGIA 1MU5A 4AW4A 4NRVA 3UK6A 4MGIE 3U6QA 1N34M 1VEGA 4CIZA 4LGYA 3J80S 2ZAOA 4GMQA 1OQYA 1PJIA 4TUWA 5EP3A 3W68A 3RGPA 3HY5A 2HWJA 4DR1M 3TPZA 3GQ4A 2E5LM 3F92A 4PT5A 1V34A 3IHPA 2Y0TA 4LJ9A 2LBCA 3SMSA 1L1TA 2GQFA 1S3SA 2LVNC 1G41A 2O25A 1WIVA 2XSZA 1N78A 1EFUB 4YHHM 1NY6A 4AKHA 3CF2A 3JAMS 1D0LA 4LJ5A 4LF6M 5IT9S 1WHCA 4S12A 1SXJB 4LCBA 2DWNA 3L2AA 3FTFA 3UZUA 3EIEA 5EXPA 4XK8F 3GLFA 2FE8A 4QOSA 1L2CA 4LJ7A 1E32A 3SYLA 4D80A 3FUWA 2JY6B 2L6OA 2EKFA 2MROB 2HCBA 2KZSA 1G71A 4RF0A 2DVWB 1V92A 1XNRM 4JI4M 2W82A 3FYCA 1G3IA 4X66M 1VEKA 1K3XA 1NJGA 3FRIA 4W5WA 3I4YA 2ZANA 4RNAA 2UUCM 1OAIA 5ITXA 4L8RC 1N33M 4HLQA 2EO2A 2AHMA 2R46A 4X62M 4B3SM 4GITA 4G4RA 4QOZC 1VQ1A 3DFZA 3K8ZA 4JI0M 3TQSA 1J09A 1AUAA 4CHTB 4NRWA 4FCTA 7CATA 5EXTA 4KHPM 2C99A 2JNHA 2LHGA 1YUBA 1GABA 3HGIA 1QAOA 2Z4RA 5JI3E 3L29A 1TR8A 3QWLA 4MM3B 1L8QA 2LWXA 3QYBA 3HJQA 3JR4A 3HU3A 4B7FA 1R2YA 3WHKA 1UFZA 3GLHA 2CUZA 2ZTDA 3UGJA 2V1CA 3R8FA 4P17A 1TH3A 3KP0E 3GLGE 2OQ4A 2EKKA 2L4FA 3FUUA 4LFBM 2J7NA 3E21A 2UUBM 2L4EA 4FWGA 3UMMA 4Y28F 4B7HA 2VQFM 4DV1M 1MX0A 3RGSA 3CF0A 1E9SA 4OW0A 2OPFA 4DV5M 1XNQM 3KSXA 2MJ5B 4ZPXA 1QAQA 3PNVA 2WZJA 3V76A 2CHVA 5E26A 2Q2EB 4FW9A 2UXBM 3KVWA 4R71A 2KZUA 1HQCA 1Z5AA 4WURA 4JI3M 3C3DA 3A42A 3HU2A 5ITTA 1XXHA 1XB2B 3GLIA 1Z5BA 3KS4A 2YR0A 4WP2A 3U6OA 4G6ZA 3T1YM 1QZEA 2QQ8A 3L26A 1H6UA 5F3WA 1IBLM 4DR6M 3EIHA 3FTCA 1GO5A 4NXNM 3B7NA 3PXGA 1EE8A 1KSFX 4FCWA 1T3TA 3MHVC 3LCVB 2JP7A 1ZQ9A 2LXEA 1G8PA 3TL4X 3U6EA 3AV0A 1N32M 3FTDA 2MGWA 3PFIA 1DGFA 2BWEA 5EP1A 2CV1A 2ZBKB 1HQYE 1Z59A 2C96A 1OKSA 2L09A 4G4OA 4R3DA 4LJ4A 2HKJA 2R4EA 3GPYA 5ITYA 2Z7JA 1TDHA 1OFHA 2WSEF 4IIWA 1LV7A 4B7GA 3GO8A 3J7AS 2K47A 2J7OA 2OOAA 2VF7A 2RGHA 1CUKA 2KHHA 4OVZA 4GIPA 2CP8A 4BLCA 4OX9M 4QHTA 3U5ZB 3KOYE 2F5OA 1GLNA 3SASA 3C3EA 4FCVA 2G5GX 4MB7A 4LFAM 2EJSA 1DO0A 3TWMA 1ZMVA 3CGWA 4HL4A 1HJPA 2QHOB 1NSFA 3T38A 2CFOA 3AOEA 4PCZA 3L25A 3VKGA 2V6ZM 2QCUA 3H4MA 4NL4H 1A5TA 4IBCA 2M5ZA 4AZFA
chains in the Genus database with same CATH topology
1G4AE 3VLFB 1IBMM 2F5SA 3K1JA 2YFQA 1YSYA 1TH4A 2ERCA 2CV2A 1GL6A 1IBKM 2JA2A 3FYDA 1L2BA 4QNMA 3FUVA 2RGOA 4FD2A 4M9XA 3ZH9B 3SFZA 1NVMA 3K2LA 3MK6A 1D2NA 5A2QS 1NHWC 4KODA 2Z4SA 4IBEA 2XSZD 3FUTA 5FTJA 2I7NA 1DGBA 4II7A 4JN6A 1W5SA 2EUCA 1QQWA 3GRUA 3RE8A 4DUZM 1DGHB 3FUXA 4NSRA 4DUYM 4DV3M 4NSOB 1SXJC 1XWIA 3CF6E 3GRVA 4XBOA 1DGGA 4LJAA 5LMUM 4YY3M 5DNYA 4AI6A 3PVSA 1JR3A 1GVNA 4WW0A 1IN5A 3R9XB 4JI1M 2XZFA 3A45A 4JI5M 3MJ5A 1HT1E 3M7GA 4K0KM 4P16A 4DR5M 2FNAA 4OU7A 2Z3XA 2UUAM 5GKNA 4GHLA 4PDIA 2CEAA 3W0LB 2KA6B 4IBDA 3ILKA 2R45A 1JQJC 2XZUA 4Z6YA 3D8BA 3PNYA 4IBJA 2UXDM 3SATA 4LFCM 4RF1A 3SC3A 1NHGC 5KO3A 1OFIA 2X49A 4GC5A 3GPUA 1N75A 4JI2M 2LH0A 3D8LA 3U6DA 1IXRC 2Y21A 4MGYE 3BOSA 4PDGA 1GKIA 4BBAA 1N77A 3LQRA 3U60B 1GL7A 1SXJA 3GLGA 1HNWM 3W0FA 4LGMA 1R7RA 2F4VM 1HR0M 1I4WA 4GKKM 3KDSE 4IJFA 3AL0C 2R4JA 1IN7A 1KYIA 2DWMA 1E9RA 1J7KA 4GRIA 2KEBA 4KO8A 2QBYB 5FTLA 3GP1A 2F5QA 2G8LA 3DZDA 4M0DA 1N36M 4I8OA 2DXIA 4GHAA 3WHLA 1K82A 3VFDA 2FOIC 3SAVA 4FVMA 3HJSA 3VKHA 3J27B 4JV5M 1W5TA 2DWLA 1Q3BA 1WXQA 3HHZA 2F5NA 1K3WA 2UU9M 4LF9M 2ZAMA 3L28A 3A98B 2UXCM 3FD9A 4REZA 4MGKE 1NNJA 2QZ4A 2ZM6M 4GKJM 2KXEA 3FKEA 1TDZA 4JXJA 4LF4M 2VQEM 1NY5A 4DR4M 4AQYM 3SAWA 4L15A 2R65A 1QVRA 2Y20A 1PM5A 4X65M 1IXZA 2CHGA 1FJGM 5DYGA 1Z5CA 4LG2A 2KRKA 1XC8A 2C5RA 2F5PA 4L16A 4DV2M 2DHRA 3Q8XA 1TGUA 4KLNA 5EXXA 4GC9A 2C9CA 5KPRA 2QPAA 1UM8A 4I81A 4LZJA 1E94E 3DA1A 2LNHC 3IG8A 2X4AA 1IY1A 5ITRA 3GPXA 3M0EA 2L7HA 4B08A 4I4LA 4PD2A 2FFJA 3J81S 3I4VA 3RFWA 3VDPA 3SBJA 4NOOB 3LVWA 5BPVA 3VK8A 1J5EM 3AFHA 3HJ8A 3ZCBB 1XHBA 5DYIA 1HT2E 1QYRA 5KQ8A 3U6LA 3HU1A 3A46A 1IN8A 2H1RA 2QP9X 1PJJA 3L27A 3QAUA 2BNKA 3ZC7B 3GQ3A 4AKGA 1G59A 4DR2M 3U60A 3KP1E 3GLGB 2O5RA 2YNMD 3GRYA 5ITUA 1IM2A 4GH9A 4LRSA 2CHQA 5E6JA 2XFTA 1QZMA 2VIIA 3GPPA 4D81A 5H37D 2A5YB 5FSWA 3LQQA 3HHYA 1NJFA 4R7GA 2M60A 2BJVA 3U5ZA 3KOWE 4DV7M 3U61B 8CATA 2YQZA 3TWKA 5EP4A 1YE9A 4EIWA 2CE7A 5FLXS 4DR7M 3TE6A 4ITQA 3J2PB 1SXJE 3AKZA 3GLHB 3GLFB 2HL7A 3E4RA 3U6SA 3UJNA 1L2DA 5KPZA 4G4QA 1QANA 2DZNB 1R2ZA 5FTMA 2V1UA 3SAUA 4LRTA 4LY6A 1I94M 4LF7M 4MGHA 4IBFA 4LJ8A 1Z6TA 4FWHA 1Q39A 3JR5A 3AOEC 1VDDA 4MGZE 4LF8M 2BJWA 3HHWA 4IJEA 3NBIA 3U6MA 1XMOM 4X64M 1X37A 4M0WA 3KSJA 3VDUA 2Y0QA 2D7HA 5IZ7D 3J7BA 4JI8M 2QENA 3CTWB 2NQ8C 1JR3D 3LMMA 2D7GA 5EXSA 4DR3M 2L7IA 5KPTA 4CGYB 3U6CA 4NXMM 1IN4A 3B9PA 1R6BX 4A3VB 2XLJA 1HNZM 3TWLA 5C1BA 4IBBA 4AG6A 1IN6A 3KXEC 4L4UA 4OVZB 1ZAEA 3I51A 2XEPA 4IBKA 4LZZA 3SHFA 1FNNA 1IQPA 5EJCA 2EA0A 2DWZB 4LJ6A 2C9OA 5ITQA 2XH9A 1KFVA 3SMPA 2HHHM 1DO2A 4JYAM 3KW6A 4QHSA 4JI6M 4Z8XA 4D82A 1XXHB 2XGNA 3KOZE 4M9SA 3GLIB 4LF5M 3VK7A 3U61A 3GQ5A 2CV0A 3LVVA 5FTNA 4DV4M 2RKOA 3HKPA 1L1ZA 5FTKA 1QAMA 5EQTA 5KQDA 4I5SA 3HHXA 5ITXE 3AOGA 2QBYA 4QNRA 3SYKA 2KW0A 3C58A 3E9SA 2XFSA 3OTOM 3KS8A 4B3TM 4IBIA 3DOAA 4MH0E 3T15A 3FTEA 5C18A 1IXSB 4L78A 4DV0M 1SXJD 1DGHA 5LMNM 4JI7M 4G4NA 1IY0A 2DZOB 4AG5A 3T1HM 1ORYB 2R18A 4CISA 1NNUC 1OJLA 4M9ZA 1Q3CA 2XF3A 5IWAM 3K92A 3SHGB 3IG5A 3U6PA 5IREB 4DV6M 1TH2A 3M6AA 3SARA 3NWLA 4FWDA 3HWSA 1XMQM 2D7EA 3THGA 3GRRA 2I7PA 3KFUG 4IBGA 5BR8M 2C98A 4AKIA 1C1KA 2P5TA 3KOXE 5EP2A 2KRUA 2R62A 5JI2E 4B3MM 2X8AA 4BB9A 4XGIA 3AJIB 1IY2A 1MU5A 4AW4A 4NRVA 3UK6A 4MGIE 3U6QA 1N34M 4LGYA 3J80S 2ZAOA 4GMQA 1PJIA 4TUWA 5EP3A 3RGPA 4DR1M 3TPZA 3GQ4A 2E5LM 4PT5A 2Y0TA 4LJ9A 3SMSA 1L1TA 1S3SA 1G41A 2XSZA 1N78A 4YHHM 1NY6A 4AKHA 3CF2A 3JAMS 4LJ5A 4LF6M 5IT9S 4S12A 1SXJB 4LCBA 2DWNA 3L2AA 3FTFA 3UZUA 3EIEA 5EXPA 3GLFA 2FE8A 4QOSA 1L2CA 4LJ7A 1E32A 3SYLA 4D80A 3FUWA 2L6OA 2HCBA 2KZSA 4RF0A 2DVWB 1XNRM 4JI4M 2W82A 3FYCA 1G3IA 4X66M 1K3XA 1NJGA 4W5WA 3I4YA 2ZANA 4RNAA 2UUCM 1N33M 5ITXA 4L8RC 4HLQA 2EO2A 2AHMA 2R46A 4X62M 4B3SM 4GITA 4G4RA 4QOZC 3DFZA 3K8ZA 4JI0M 3TQSA 1J09A 4CHTB 4NRWA 4FCTA 7CATA 5EXTA 4KHPM 2C99A 1YUBA 3HGIA 1QAOA 2Z4RA 5JI3E 3L29A 3QWLA 4MM3B 1L8QA 2LWXA 3HJQA 3JR4A 3HU3A 4B7FA 1R2YA 3WHKA 3GLHA 2CUZA 3UGJA 2V1CA 3R8FA 1TH3A 3KP0E 2OQ4A 3FUUA 4LFBM 2J7NA 2UUBM 4FWGA 3UMMA 2VQFM 4B7HA 4DV1M 1MX0A 3RGSA 3CF0A 1E9SA 4OW0A 2OPFA 4DV5M 1XNQM 3KSXA 4ZPXA 1QAQA 3PNVA 2CHVA 5E26A 2Q2EB 4FW9A 2UXBM 3KVWA 2KZUA 1HQCA 1Z5AA 4WURA 4JI3M 3HU2A 3A42A 5ITTA 1XXHA 3GLIA 1Z5BA 3KS4A 2YR0A 3T1YM 3U6OA 4G6ZA 5F3WA 4DR6M 3L26A 1H6UA 1IBLM 3EIHA 3FTCA 4NXNM 3PXGA 1EE8A 4FCWA 1KSFX 1T3TA 3MHVC 1ZQ9A 2LXEA 1G8PA 3TL4X 3U6EA 3AV0A 1N32M 3FTDA 5EP1A 3PFIA 1DGFA 2CV1A 2ZBKB 1HQYE 1Z59A 2C96A 2L09A 4G4OA 4R3DA 4LJ4A 2HKJA 2R4EA 3GPYA 5ITYA 2Z7JA 1TDHA 1OFHA 4IIWA 3GO8A 1LV7A 4B7GA 3J7AS 4B3RM 2K47A 2J7OA 2RGHA 4OVZA 4GIPA 4BLCA 4OX9M 4QHTA 3U5ZB 3KOYE 2F5OA 1GLNA 3SASA 4FCVA 2G5GX 4MB7A 4LFAM 1DO0A 3TWMA 3T38A 4HL4A 3L25A 1NSFA 4PCZA 2CFOA 3AOEA 3VKGA 2V6ZM 2QCUA 3H4MA 4NL4H 1HNXM 4IBCA 2M5ZA 4AZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM M;  1L2C A;  1PM5 A;  4X65 M;  1IBM M;  2F5S A;  1FJG M;  1Z5C A;  1XC8 A;  2F5P A;  1HNZ M;  3TWL A;  4DV2 M;  1XNR M;  4JI4 M;  1IBK M;  1L2B A;  4X66 M;  1K3X A;  2UUC M;  1N33 M;  5ITX A;  5A2Q S;  5ITR A;  2EA0 A;  3GPX A;  4X62 M;  4B3S M;  4G4R A;  5ITQ A;  4PD2 A;  3J81 S;  4JI0 M;  1KFV A;  4DUZ M;  2HHH M;  4JYA M;  3SBJ A;  4DUY M;  4JI6 M;  1J5E M;  3VK8 A;  4DV3 M;  4NRW A;  4LF5 M;  4KHP M;  3VK7 A;  3GQ5 A;  3U6L A;  5LMU M;  4YY3 M;  3A46 A;  4DV4 M;  1PJJ A;  3GQ3 A;  4DR2 M;  1L1Z A;  4JI1 M;  2XZF A;  3JR4 A;  3A45 A;  1R2Y A;  4JI5 M;  5ITU A;  5ITX E;  4K0K M;  4DR5 M;  2UUA M;  4PDI A;  3C58 A;  3GPP A;  2OQ4 A;  3OTO M;  4B3T M;  4LFB M;  3DOA A;  2XZU A;  2UUB M;  2VQF M;  4DV0 M;  4DV1 M;  2UXD M;  1MX0 A;  2OPF A;  4DV5 M;  3SAT A;  4LFC M;  5LMN M;  4JI7 M;  1XNQ M;  4G4N A;  4DV7 M;  3GPU A;  3T1H M;  4CIS A;  3U6D A;  4JI2 M;  2Q2E B;  2UXB M;  1Q3C A;  1Z5A A;  4PDG A;  5IWA M;  3TWK A;  4JI3 M;  3A42 A;  5FLX S;  5ITT A;  4DR7 M;  3U6P A;  4ITQ A;  3SAR A;  1Z5B A;  4DV6 M;  3T1Y M;  1HNW M;  3U6O A;  3W0F A;  4DR6 M;  1IBL M;  1XMQ M;  2F4V M;  1HR0 M;  5BR8 M;  4NXN M;  3U6S A;  4GKK M;  1EE8 A;  1L2D A;  4G4Q A;  1R2Z A;  4B3M M;  3U6E A;  3SAU A;  1N32 M;  1I94 M;  4LF7 M;  1MU5 A;  2ZBK B;  3GP1 A;  4NRV A;  2F5Q A;  1N36 M;  1Z59 A;  3U6Q A;  4G4O A;  1N34 M;  1Q39 A;  3J80 S;  3JR5 A;  1K82 A;  2HKJ A;  3GPY A;  5ITY A;  4LF8 M;  1TDH A;  3SAV A;  1PJI A;  3GO8 A;  3J7A S;  3U6M A;  1XMO M;  4B3R M;  4JV5 M;  4X64 M;  4DR1 M;  1Q3B A;  3GQ4 A;  2E5L M;  2F5N A;  1K3W A;  4OX9 M;  2UU9 M;  2F5O A;  4LF9 M;  3SAS A;  4MB7 A;  1L1T A;  4LFA M;  2UXC M;  1NNJ A;  4JI8 M;  3TWM A;  2ZM6 M;  4YHH M;  3JAM S;  4GKJ M;  4PCZ A;  1TDZ A;  4LF4 M;  4LF6 M;  5IT9 S;  2VQE M;  4DR4 M;  4AQY M;  4DR3 M;  3SAW A;  1HNX M;  3U6C A; 
#chains in the Genus database with same CATH topology
 1G4A E;  3VLF B;  2ZTC A;  1IBM M;  2F5S A;  3K1J A;  2JY8 A;  2YFQ A;  1YSY A;  2RRU A;  1TH4 A;  2ERC A;  2CV2 A;  1GL6 A;  1QUT A;  2BWB A;  1IBK M;  2JA2 A;  3FYD A;  1L2B A;  4QNM A;  2JWS A;  3FUV A;  1JB0 F;  2RGO A;  3BXW A;  4FD2 A;  4M9X A;  1WJ7 A;  3ZH9 B;  3SFZ A;  1NVM A;  2DAI A;  4KT0 F;  3K2L A;  3MK6 A;  1D2N A;  1NO1 A;  5A2Q S;  1NHW C;  4KOD A;  2Z4S A;  4IBE A;  1RU3 A;  2XSZ D;  2DAE A;  3FUT A;  5FTJ A;  2I7N A;  1DGB A;  2KNV A;  1IXS A;  4II7 A;  4JN6 A;  1W5S A;  2EUC A;  1QQW A;  2K9D A;  3GRU A;  3RE8 A;  1DGH B;  3ZQJ A;  4DUZ M;  3FUX A;  4NSR A;  4DUY M;  4DV3 M;  4NSO B;  1SXJ C;  1Y8G A;  1XWI A;  3CF6 E;  3GRV A;  4XBO A;  1DGG A;  4LJA A;  1JR3 E;  4ANR A;  4YY3 M;  5DNY A;  5LMU M;  4AI6 A;  3PVS A;  1JR3 A;  1GVN A;  2JZ1 A;  4WW0 A;  1IN5 A;  4HEO A;  4JI1 M;  2XZF A;  3R9X B;  4GEW A;  3A45 A;  4JI5 M;  3MJ5 A;  1HT1 E;  3M7G A;  4K0K M;  4P16 A;  1GJS A;  4DR5 M;  2FNA A;  4OU7 A;  2Z3X A;  2UUA M;  1ZMU A;  5GKN A;  4GHL A;  4PDI A;  2CEA A;  3W0L B;  2MR9 A;  2KA6 B;  4IBD A;  3ILK A;  1BVS A;  2R45 A;  1JQJ C;  2DHY A;  1DV0 A;  2XZU A;  4Z6Y A;  3D8B A;  3PNY A;  4IBJ A;  2UXD M;  1WGL A;  3SAT A;  4LFC M;  4RF1 A;  4B3R M;  3B7Z A;  4Q7J A;  1NHG C;  1QUS A;  3SC3 A;  5KO3 A;  1OFI A;  2JZ0 A;  2K6B A;  3K9O A;  2X49 A;  3I01 M;  2J5Y A;  4GC5 A;  3GPU A;  1N75 A;  4JI2 M;  2LH0 A;  3D8L A;  3U6D A;  1OTR A;  1IXR C;  2Y21 A;  2OOB A;  4MGY E;  3BOS A;  4PDG A;  1GKI A;  4BBA A;  1N77 A;  3LQR A;  3U60 B;  1GL7 A;  1SXJ A;  3GLG A;  1HNW M;  1PRB A;  2LVO C;  3W0F A;  3GLI E;  3MMP A;  4LGM A;  1R7R A;  2F4V M;  1OAO C;  2DNA A;  1HR0 M;  1I4W A;  4GKK M;  3KDS E;  4IJF A;  3AL0 C;  2R4J A;  1IN7 A;  1KYI A;  2QSF X;  1TF0 B;  2DWM A;  1E9R A;  1J7K A;  4GRI A;  2KEB A;  4KO8 A;  2QBY B;  5FTL A;  3GP1 A;  2JY7 A;  2F5Q A;  2G8L A;  3DZD A;  4M0D A;  1N36 M;  1R4G A;  4I8O A;  3I04 M;  2DXI A;  4GHA A;  2FH0 A;  3WHL A;  1K82 A;  3VFD A;  2FOI C;  3SAV A;  4FVM A;  3HJS A;  3VKH A;  1SG9 A;  3J27 B;  4JV5 M;  1W5T A;  2DWL A;  1Q3B A;  1Q02 A;  1WXQ A;  3HHZ A;  2F5N A;  2MH8 A;  3B89 A;  1K3W A;  2UU9 M;  1T6O A;  1EIJ A;  4LF9 M;  2ZAM A;  3L28 A;  1ZMW A;  3A98 B;  2UXC M;  3FD9 A;  4REZ A;  4MGK E;  1NNJ A;  2DAK A;  2QZ4 A;  2ZM6 M;  4GKJ M;  2KXE A;  3FKE A;  1TDZ A;  4JXJ A;  4LF4 M;  2VQE M;  1NY5 A;  4DR4 M;  4AQY M;  3SAW A;  4L15 A;  3H4J A;  2R65 A;  2DZL A;  1QVR A;  2Y20 A;  1PM5 A;  4X65 M;  3Q8G A;  1IXZ A;  2CHG A;  3QYE A;  1FJG M;  5DYG A;  1Z5C A;  2R6F A;  4LG2 A;  2KRK A;  1XC8 A;  2C5R A;  2F5P A;  4L16 A;  4DV2 M;  2DHR A;  3Q8X A;  2R44 A;  1TGU A;  4KLN A;  5EXX A;  4GC9 A;  2C9C A;  5KPR A;  2QPA A;  1UM8 A;  4I81 A;  4LZJ A;  1E94 E;  3DA1 A;  2LNH C;  3IG8 A;  2X4A A;  3HX3 A;  3HZJ A;  1IY1 A;  1AIP C;  1V33 A;  5ITR A;  3GPX A;  2WSC F;  3M0E A;  2L7H A;  3BBZ A;  4I4L A;  4B08 A;  2FFJ A;  4PD2 A;  2DAM A;  3I4V A;  5L8R F;  3J81 S;  3RFW A;  1PJT A;  1TTE A;  3VDP A;  4NOO B;  3SBJ A;  3LVW A;  5BPV A;  3VK8 A;  1J5E M;  3AFH A;  3HJ8 A;  3ZCB B;  1XHB A;  1OIP A;  5DYI A;  2KNZ A;  1HT2 E;  1QYR A;  5KQ8 A;  3U6L A;  2VDB B;  3HU1 A;  3A46 A;  1IN8 A;  2H1R A;  2QP9 X;  1PJJ A;  3L27 A;  3QAU A;  2BNK A;  3ZC7 B;  3GQ3 A;  4AKG A;  1G59 A;  4DR2 M;  3U60 A;  2DEN A;  3KP1 E;  1GJT A;  2JY5 A;  2O5R A;  2YNM D;  3GLG B;  3GRY A;  2VF8 A;  1IM2 A;  4GH9 A;  5ITU A;  4LRS A;  1VEJ A;  2LHC A;  2CHQ A;  2DAG A;  2O01 F;  5E6J A;  2XFT A;  1QZM A;  2VII A;  3GPP A;  1D0K A;  4D81 A;  5H37 D;  2A5Y B;  3LW5 F;  5FSW A;  3LQQ A;  3HHY A;  1WGN A;  1NJF A;  4R7G A;  4L6V 6;  2M60 A;  2BJV A;  3U5Z A;  3KOW E;  4DV7 M;  3U61 B;  3IEC A;  2JUJ A;  8CAT A;  2LTU A;  3GLH E;  2YQZ A;  1XXH E;  3TWK A;  5EP4 A;  1YE9 A;  4EIW A;  2CE7 A;  5FLX S;  4DR7 M;  2CWB A;  3TE6 A;  4ITQ A;  3J2P B;  1SXJ E;  3E46 A;  3AKZ A;  3GLH B;  3GLF B;  2HL7 A;  3E4R A;  3U6S A;  2FS1 A;  3UJN A;  1L2D A;  5KPZ A;  4G4Q A;  1QAN A;  2DZN B;  1R2Z A;  5FTM A;  2V1U A;  1T43 A;  3SAU A;  4LRT A;  4LY6 A;  1MJG M;  1I94 M;  2DKL A;  4LF7 M;  4MGH A;  4IBF A;  4LJ8 A;  1Z6T A;  1NV9 A;  4FWH A;  4NC6 A;  1Q39 A;  3JR5 A;  3AOE C;  1VDD A;  2G3Q A;  4MGZ E;  4LF8 M;  2BJW A;  3HHW A;  4IJE A;  3NBI A;  3U6M A;  1XMO M;  4X64 M;  1X37 A;  4M0W A;  3KSJ A;  3VDU A;  2Y0Q A;  2D7H A;  5IZ7 D;  3J7B A;  4UN2 B;  4JI8 M;  2QEN A;  3CTW B;  2NQ8 C;  2N35 A;  1MN3 A;  1JR3 D;  3LMM A;  3B7Q A;  3NBX X;  2L2D A;  2D7G A;  1ZV1 A;  5EXS A;  1PJQ A;  4DR3 M;  1P3Q Q;  2L7I A;  5KPT A;  3K9P A;  4CGY B;  3U6C A;  4NXM M;  1IN4 A;  3B9P A;  1R6B X;  4A3V B;  2B3T A;  2XLJ A;  4F1I A;  1HNZ M;  3TWL A;  5C1B A;  4IBB A;  4AG6 A;  1IN6 A;  3KXE C;  4L4U A;  1VG5 A;  4OVZ B;  2H5X A;  1OIZ A;  1ZAE A;  3I51 A;  2DI0 A;  3B74 A;  2XEP A;  3FRH A;  4IBK A;  4LZZ A;  3FE3 A;  4DBG B;  3SHF A;  1FNN A;  1IQP A;  5EJC A;  2EA0 A;  2LVA A;  2DWZ B;  4LJ6 A;  1C7Y A;  1D0M A;  2APL A;  2C9O A;  3GLF E;  5ITQ A;  2XH9 A;  1KFV A;  3SMP A;  1R5L A;  2K0B X;  1DO2 A;  2HHH M;  4JYA M;  3KW6 A;  4CJ6 A;  4QHS A;  1YLA A;  4Z8X A;  4D82 A;  1XXH B;  2XGN A;  3KOZ E;  4M9S A;  3GLI B;  4JI6 M;  4LF5 M;  1VDL A;  3U61 A;  3VK7 A;  3GQ5 A;  2CV0 A;  3LVV A;  1QDR A;  5FTN A;  4DV4 M;  3LCU A;  2RKO A;  3T6P A;  5DFL A;  3HKP A;  2QNJ A;  1L1Z A;  5FTK A;  1QAM A;  5EQT A;  5KQD A;  4I5S A;  3HHX A;  4G3O A;  4RKU F;  5ITX E;  2JXN A;  3AOG A;  2QBY A;  2LVQ D;  4QNR A;  3SYK A;  2KW0 A;  3C58 A;  2Z8Y M;  2XFS A;  3E9S A;  4F2L A;  1HNX M;  3OTO M;  3KS8 A;  4B3T M;  4IBI A;  3DOA A;  4MH0 E;  3T15 A;  3FTE A;  5C18 A;  1IXS B;  1PJS A;  4L78 A;  4DV0 M;  1SXJ D;  2KNA A;  1DGH A;  5LMN M;  2GNO A;  4JI7 M;  4G4N A;  1IY0 A;  1WR1 B;  2DZO B;  1LTM A;  4AG5 A;  2CRU A;  1PGY A;  3T1H M;  1ORY B;  1QDT A;  2R18 A;  3W67 A;  1NNU C;  4CIS A;  1OJL A;  4M9Z A;  1Q3C A;  2XF3 A;  5IWA M;  2KDL A;  3K92 A;  3SHG B;  3IG5 A;  1NV8 A;  3U6P A;  5IRE B;  4DV6 M;  1TH2 A;  3M6A A;  3SAR A;  3NWL A;  4FWD A;  3HWS A;  1XMQ M;  2WSF F;  2D7E A;  3THG A;  3GRR A;  2I7P A;  2R0I A;  2OO9 A;  4IBG A;  5BR8 M;  3KFU G;  2C98 A;  1IFY A;  4AKI A;  3C9P A;  1C1K A;  2P5T A;  3KOX E;  5EP2 A;  2KRU A;  2R62 A;  5JI2 E;  4B3M M;  2X8A A;  4BB9 A;  1F4I A;  2HAK A;  2LVP C;  3AJI B;  1IY2 A;  4XGI A;  1MU5 A;  4AW4 A;  4NRV A;  3UK6 A;  4MGI E;  3U6Q A;  1N34 M;  1VEG A;  4CIZ A;  4LGY A;  3J80 S;  2ZAO A;  4GMQ A;  1OQY A;  1PJI A;  4TUW A;  5EP3 A;  3W68 A;  3RGP A;  3HY5 A;  2HWJ A;  4DR1 M;  3TPZ A;  3GQ4 A;  2E5L M;  3F92 A;  4PT5 A;  1V34 A;  3IHP A;  2Y0T A;  4LJ9 A;  2LBC A;  3SMS A;  1L1T A;  2GQF A;  1S3S A;  2LVN C;  1G41 A;  2O25 A;  1WIV A;  2XSZ A;  1N78 A;  1EFU B;  4YHH M;  1NY6 A;  4AKH A;  3CF2 A;  3JAM S;  1D0L A;  4LJ5 A;  4LF6 M;  5IT9 S;  1WHC A;  4S12 A;  1SXJ B;  4LCB A;  2DWN A;  3L2A A;  3FTF A;  3UZU A;  3EIE A;  5EXP A;  4XK8 F;  3GLF A;  2FE8 A;  4QOS A;  1L2C A;  4LJ7 A;  1E32 A;  3SYL A;  4D80 A;  3FUW A;  2JY6 B;  2L6O A;  2EKF A;  2MRO B;  2HCB A;  2KZS A;  1G71 A;  4RF0 A;  2DVW B;  1V92 A;  1XNR M;  4JI4 M;  2W82 A;  3FYC A;  1G3I A;  4X66 M;  1VEK A;  1K3X A;  1NJG A;  3FRI A;  4W5W A;  3I4Y A;  2ZAN A;  4RNA A;  2UUC M;  1OAI A;  5ITX A;  4L8R C;  1N33 M;  4HLQ A;  2EO2 A;  2AHM A;  2R46 A;  4X62 M;  4B3S M;  4GIT A;  4G4R A;  4QOZ C;  1VQ1 A;  3DFZ A;  3K8Z A;  4JI0 M;  3TQS A;  1J09 A;  1AUA A;  4CHT B;  4NRW A;  4FCT A;  7CAT A;  5EXT A;  4KHP M;  2C99 A;  2JNH A;  2LHG A;  1YUB A;  1GAB A;  3HGI A;  1QAO A;  2Z4R A;  5JI3 E;  3L29 A;  1TR8 A;  3QWL A;  4MM3 B;  1L8Q A;  2LWX A;  3QYB A;  3HJQ A;  3JR4 A;  3HU3 A;  4B7F A;  1R2Y A;  3WHK A;  1UFZ A;  3GLH A;  2CUZ A;  2ZTD A;  3UGJ A;  2V1C A;  3R8F A;  4P17 A;  1TH3 A;  3KP0 E;  3GLG E;  2OQ4 A;  2EKK A;  2L4F A;  3FUU A;  4LFB M;  2J7N A;  3E21 A;  2UUB M;  2L4E A;  4FWG A;  3UMM A;  4Y28 F;  4B7H A;  2VQF M;  4DV1 M;  1MX0 A;  3RGS A;  3CF0 A;  1E9S A;  4OW0 A;  2OPF A;  4DV5 M;  1XNQ M;  3KSX A;  2MJ5 B;  4ZPX A;  1QAQ A;  3PNV A;  2WZJ A;  3V76 A;  2CHV A;  5E26 A;  2Q2E B;  4FW9 A;  2UXB M;  3KVW A;  4R71 A;  2KZU A;  1HQC A;  1Z5A A;  4WUR A;  4JI3 M;  3C3D A;  3A42 A;  3HU2 A;  5ITT A;  1XXH A;  1XB2 B;  3GLI A;  1Z5B A;  3KS4 A;  2YR0 A;  4WP2 A;  3U6O A;  4G6Z A;  3T1Y M;  1QZE A;  2QQ8 A;  3L26 A;  1H6U A;  5F3W A;  1IBL M;  4DR6 M;  3EIH A;  3FTC A;  1GO5 A;  4NXN M;  3B7N A;  3PXG A;  1EE8 A;  1KSF X;  4FCW A;  1T3T A;  3MHV C;  3LCV B;  2JP7 A;  1ZQ9 A;  2LXE A;  1G8P A;  3TL4 X;  3U6E A;  3AV0 A;  1N32 M;  3FTD A;  2MGW A;  3PFI A;  1DGF A;  2BWE A;  5EP1 A;  2CV1 A;  2ZBK B;  1HQY E;  1Z59 A;  2C96 A;  1OKS A;  2L09 A;  4G4O A;  4R3D A;  4LJ4 A;  2HKJ A;  2R4E A;  3GPY A;  5ITY A;  2Z7J A;  1TDH A;  1OFH A;  2WSE F;  4IIW A;  1LV7 A;  4B7G A;  3GO8 A;  3J7A S;  2K47 A;  2J7O A;  2OOA A;  2VF7 A;  2RGH A;  1CUK A;  2KHH A;  4OVZ A;  4GIP A;  2CP8 A;  4BLC A;  4OX9 M;  4QHT A;  3U5Z B;  3KOY E;  2F5O A;  1GLN A;  3SAS A;  3C3E A;  4FCV A;  2G5G X;  4MB7 A;  4LFA M;  2EJS A;  1DO0 A;  3TWM A;  1ZMV A;  3CGW A;  4HL4 A;  1HJP A;  2QHO B;  1NSF A;  3T38 A;  2CFO A;  3AOE A;  4PCZ A;  3L25 A;  3VKG A;  2V6Z M;  2QCU A;  3H4M A;  4NL4 H;  1A5T A;  4IBC A;  2M5Z A;  4AZF A; 
#chains in the Genus database with same CATH homology
 1G4A E;  3VLF B;  1IBM M;  2F5S A;  3K1J A;  2YFQ A;  1YSY A;  1TH4 A;  2ERC A;  2CV2 A;  1GL6 A;  1IBK M;  2JA2 A;  3FYD A;  1L2B A;  4QNM A;  3FUV A;  2RGO A;  4FD2 A;  4M9X A;  3ZH9 B;  3SFZ A;  1NVM A;  3K2L A;  3MK6 A;  1D2N A;  5A2Q S;  1NHW C;  4KOD A;  2Z4S A;  4IBE A;  2XSZ D;  3FUT A;  5FTJ A;  2I7N A;  1DGB A;  4II7 A;  4JN6 A;  1W5S A;  2EUC A;  1QQW A;  3GRU A;  3RE8 A;  4DUZ M;  1DGH B;  3FUX A;  4NSR A;  4DUY M;  4DV3 M;  4NSO B;  1SXJ C;  1XWI A;  3CF6 E;  3GRV A;  4XBO A;  1DGG A;  4LJA A;  5LMU M;  4YY3 M;  5DNY A;  4AI6 A;  3PVS A;  1JR3 A;  1GVN A;  4WW0 A;  1IN5 A;  3R9X B;  4JI1 M;  2XZF A;  3A45 A;  4JI5 M;  3MJ5 A;  1HT1 E;  3M7G A;  4K0K M;  4P16 A;  4DR5 M;  2FNA A;  4OU7 A;  2Z3X A;  2UUA M;  5GKN A;  4GHL A;  4PDI A;  2CEA A;  3W0L B;  2KA6 B;  4IBD A;  3ILK A;  2R45 A;  1JQJ C;  2XZU A;  4Z6Y A;  3D8B A;  3PNY A;  4IBJ A;  2UXD M;  3SAT A;  4LFC M;  4RF1 A;  3SC3 A;  1NHG C;  5KO3 A;  1OFI A;  2X49 A;  4GC5 A;  3GPU A;  1N75 A;  4JI2 M;  2LH0 A;  3D8L A;  3U6D A;  1IXR C;  2Y21 A;  4MGY E;  3BOS A;  4PDG A;  1GKI A;  4BBA A;  1N77 A;  3LQR A;  3U60 B;  1GL7 A;  1SXJ A;  3GLG A;  1HNW M;  3W0F A;  4LGM A;  1R7R A;  2F4V M;  1HR0 M;  1I4W A;  4GKK M;  3KDS E;  4IJF A;  3AL0 C;  2R4J A;  1IN7 A;  1KYI A;  2DWM A;  1E9R A;  1J7K A;  4GRI A;  2KEB A;  4KO8 A;  2QBY B;  5FTL A;  3GP1 A;  2F5Q A;  2G8L A;  3DZD A;  4M0D A;  1N36 M;  4I8O A;  2DXI A;  4GHA A;  3WHL A;  1K82 A;  3VFD A;  2FOI C;  3SAV A;  4FVM A;  3HJS A;  3VKH A;  3J27 B;  4JV5 M;  1W5T A;  2DWL A;  1Q3B A;  1WXQ A;  3HHZ A;  2F5N A;  1K3W A;  2UU9 M;  4LF9 M;  2ZAM A;  3L28 A;  3A98 B;  2UXC M;  3FD9 A;  4REZ A;  4MGK E;  1NNJ A;  2QZ4 A;  2ZM6 M;  4GKJ M;  2KXE A;  3FKE A;  1TDZ A;  4JXJ A;  4LF4 M;  2VQE M;  1NY5 A;  4DR4 M;  4AQY M;  3SAW A;  4L15 A;  2R65 A;  1QVR A;  2Y20 A;  1PM5 A;  4X65 M;  1IXZ A;  2CHG A;  1FJG M;  5DYG A;  1Z5C A;  4LG2 A;  2KRK A;  1XC8 A;  2C5R A;  2F5P A;  4L16 A;  4DV2 M;  2DHR A;  3Q8X A;  1TGU A;  4KLN A;  5EXX A;  4GC9 A;  2C9C A;  5KPR A;  2QPA A;  1UM8 A;  4I81 A;  4LZJ A;  1E94 E;  3DA1 A;  2LNH C;  3IG8 A;  2X4A A;  1IY1 A;  5ITR A;  3GPX A;  3M0E A;  2L7H A;  4B08 A;  4I4L A;  4PD2 A;  2FFJ A;  3J81 S;  3I4V A;  3RFW A;  3VDP A;  3SBJ A;  4NOO B;  3LVW A;  5BPV A;  3VK8 A;  1J5E M;  3AFH A;  3HJ8 A;  3ZCB B;  1XHB A;  5DYI A;  1HT2 E;  1QYR A;  5KQ8 A;  3U6L A;  3HU1 A;  3A46 A;  1IN8 A;  2H1R A;  2QP9 X;  1PJJ A;  3L27 A;  3QAU A;  2BNK A;  3ZC7 B;  3GQ3 A;  4AKG A;  1G59 A;  4DR2 M;  3U60 A;  3KP1 E;  3GLG B;  2O5R A;  2YNM D;  3GRY A;  5ITU A;  1IM2 A;  4GH9 A;  4LRS A;  2CHQ A;  5E6J A;  2XFT A;  1QZM A;  2VII A;  3GPP A;  4D81 A;  5H37 D;  2A5Y B;  5FSW A;  3LQQ A;  3HHY A;  1NJF A;  4R7G A;  2M60 A;  2BJV A;  3U5Z A;  3KOW E;  4DV7 M;  3U61 B;  8CAT A;  2YQZ A;  3TWK A;  5EP4 A;  1YE9 A;  4EIW A;  2CE7 A;  5FLX S;  4DR7 M;  3TE6 A;  4ITQ A;  3J2P B;  1SXJ E;  3AKZ A;  3GLH B;  3GLF B;  2HL7 A;  3E4R A;  3U6S A;  3UJN A;  1L2D A;  5KPZ A;  4G4Q A;  1QAN A;  2DZN B;  1R2Z A;  5FTM A;  2V1U A;  3SAU A;  4LRT A;  4LY6 A;  1I94 M;  4LF7 M;  4MGH A;  4IBF A;  4LJ8 A;  1Z6T A;  4FWH A;  1Q39 A;  3JR5 A;  3AOE C;  1VDD A;  4MGZ E;  4LF8 M;  2BJW A;  3HHW A;  4IJE A;  3NBI A;  3U6M A;  1XMO M;  4X64 M;  1X37 A;  4M0W A;  3KSJ A;  3VDU A;  2Y0Q A;  2D7H A;  5IZ7 D;  3J7B A;  4JI8 M;  2QEN A;  3CTW B;  2NQ8 C;  1JR3 D;  3LMM A;  2D7G A;  5EXS A;  4DR3 M;  2L7I A;  5KPT A;  4CGY B;  3U6C A;  4NXM M;  1IN4 A;  3B9P A;  1R6B X;  4A3V B;  2XLJ A;  1HNZ M;  3TWL A;  5C1B A;  4IBB A;  4AG6 A;  1IN6 A;  3KXE C;  4L4U A;  4OVZ B;  1ZAE A;  3I51 A;  2XEP A;  4IBK A;  4LZZ A;  3SHF A;  1FNN A;  1IQP A;  5EJC A;  2EA0 A;  2DWZ B;  4LJ6 A;  2C9O A;  5ITQ A;  2XH9 A;  1KFV A;  3SMP A;  2HHH M;  1DO2 A;  4JYA M;  3KW6 A;  4QHS A;  4JI6 M;  4Z8X A;  4D82 A;  1XXH B;  2XGN A;  3KOZ E;  4M9S A;  3GLI B;  4LF5 M;  3VK7 A;  3U61 A;  3GQ5 A;  2CV0 A;  3LVV A;  5FTN A;  4DV4 M;  2RKO A;  3HKP A;  1L1Z A;  5FTK A;  1QAM A;  5EQT A;  5KQD A;  4I5S A;  3HHX A;  5ITX E;  3AOG A;  2QBY A;  4QNR A;  3SYK A;  2KW0 A;  3C58 A;  3E9S A;  2XFS A;  3OTO M;  3KS8 A;  4B3T M;  4IBI A;  3DOA A;  4MH0 E;  3T15 A;  3FTE A;  5C18 A;  1IXS B;  4L78 A;  4DV0 M;  1SXJ D;  1DGH A;  5LMN M;  4JI7 M;  4G4N A;  1IY0 A;  2DZO B;  4AG5 A;  3T1H M;  1ORY B;  2R18 A;  4CIS A;  1NNU C;  1OJL A;  4M9Z A;  1Q3C A;  2XF3 A;  5IWA M;  3K92 A;  3SHG B;  3IG5 A;  3U6P A;  5IRE B;  4DV6 M;  1TH2 A;  3M6A A;  3SAR A;  3NWL A;  4FWD A;  3HWS A;  1XMQ M;  2D7E A;  3THG A;  3GRR A;  2I7P A;  3KFU G;  4IBG A;  5BR8 M;  2C98 A;  4AKI A;  1C1K A;  2P5T A;  3KOX E;  5EP2 A;  2KRU A;  2R62 A;  5JI2 E;  4B3M M;  2X8A A;  4BB9 A;  4XGI A;  3AJI B;  1IY2 A;  1MU5 A;  4AW4 A;  4NRV A;  3UK6 A;  4MGI E;  3U6Q A;  1N34 M;  4LGY A;  3J80 S;  2ZAO A;  4GMQ A;  1PJI A;  4TUW A;  5EP3 A;  3RGP A;  4DR1 M;  3TPZ A;  3GQ4 A;  2E5L M;  4PT5 A;  2Y0T A;  4LJ9 A;  3SMS A;  1L1T A;  1S3S A;  1G41 A;  2XSZ A;  1N78 A;  4YHH M;  1NY6 A;  4AKH A;  3CF2 A;  3JAM S;  4LJ5 A;  4LF6 M;  5IT9 S;  4S12 A;  1SXJ B;  4LCB A;  2DWN A;  3L2A A;  3FTF A;  3UZU A;  3EIE A;  5EXP A;  3GLF A;  2FE8 A;  4QOS A;  1L2C A;  4LJ7 A;  1E32 A;  3SYL A;  4D80 A;  3FUW A;  2L6O A;  2HCB A;  2KZS A;  4RF0 A;  2DVW B;  1XNR M;  4JI4 M;  2W82 A;  3FYC A;  1G3I A;  4X66 M;  1K3X A;  1NJG A;  4W5W A;  3I4Y A;  2ZAN A;  4RNA A;  2UUC M;  1N33 M;  5ITX A;  4L8R C;  4HLQ A;  2EO2 A;  2AHM A;  2R46 A;  4X62 M;  4B3S M;  4GIT A;  4G4R A;  4QOZ C;  3DFZ A;  3K8Z A;  4JI0 M;  3TQS A;  1J09 A;  4CHT B;  4NRW A;  4FCT A;  7CAT A;  5EXT A;  4KHP M;  2C99 A;  1YUB A;  3HGI A;  1QAO A;  2Z4R A;  5JI3 E;  3L29 A;  3QWL A;  4MM3 B;  1L8Q A;  2LWX A;  3HJQ A;  3JR4 A;  3HU3 A;  4B7F A;  1R2Y A;  3WHK A;  3GLH A;  2CUZ A;  3UGJ A;  2V1C A;  3R8F A;  1TH3 A;  3KP0 E;  2OQ4 A;  3FUU A;  4LFB M;  2J7N A;  2UUB M;  4FWG A;  3UMM A;  2VQF M;  4B7H A;  4DV1 M;  1MX0 A;  3RGS A;  3CF0 A;  1E9S A;  4OW0 A;  2OPF A;  4DV5 M;  1XNQ M;  3KSX A;  4ZPX A;  1QAQ A;  3PNV A;  2CHV A;  5E26 A;  2Q2E B;  4FW9 A;  2UXB M;  3KVW A;  2KZU A;  1HQC A;  1Z5A A;  4WUR A;  4JI3 M;  3HU2 A;  3A42 A;  5ITT A;  1XXH A;  3GLI A;  1Z5B A;  3KS4 A;  2YR0 A;  3T1Y M;  3U6O A;  4G6Z A;  5F3W A;  4DR6 M;  3L26 A;  1H6U A;  1IBL M;  3EIH A;  3FTC A;  4NXN M;  3PXG A;  1EE8 A;  4FCW A;  1KSF X;  1T3T A;  3MHV C;  1ZQ9 A;  2LXE A;  1G8P A;  3TL4 X;  3U6E A;  3AV0 A;  1N32 M;  3FTD A;  5EP1 A;  3PFI A;  1DGF A;  2CV1 A;  2ZBK B;  1HQY E;  1Z59 A;  2C96 A;  2L09 A;  4G4O A;  4R3D A;  4LJ4 A;  2HKJ A;  2R4E A;  3GPY A;  5ITY A;  2Z7J A;  1TDH A;  1OFH A;  4IIW A;  3GO8 A;  1LV7 A;  4B7G A;  3J7A S;  4B3R M;  2K47 A;  2J7O A;  2RGH A;  4OVZ A;  4GIP A;  4BLC A;  4OX9 M;  4QHT A;  3U5Z B;  3KOY E;  2F5O A;  1GLN A;  3SAS A;  4FCV A;  2G5G X;  4MB7 A;  4LFA M;  1DO0 A;  3TWM A;  3T38 A;  4HL4 A;  3L25 A;  1NSF A;  4PCZ A;  2CFO A;  3AOE A;  3VKG A;  2V6Z M;  2QCU A;  3H4M A;  4NL4 H;  1HNX M;  4IBC A;  2M5Z A;  4AZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...