3FYCA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
AAQCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAKEGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable dimethyladenosine transferase
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 90
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fycA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fycA01
4YV0A 5GWXA 5U4XA 4RTKA 1R18A 4X60A 3PFGA 5E1MA 1R6AA 2ZW9A 5CM2Z 3QOWA 5D1NA 1AQJA 2IH4A 3NDIA 2PXCA 1JSZA 3DH0A 3HCAA 3LCUA 4YV1A 2ONYA 3GXOA 1UFKA 1PJZA 4KVZA 4ZTBA 2ZTHA 4X1OA 1RJEA 3TPZA 3CCFA 4YV2A 3IYLW 5GM2A 2AS0A 4HTFB 2AOWA 3LX6A 1UIRA 3ANXA 4ER0A 1KHHA 4L7VA 3TOSA 3ELYA 3DMFA 2FRXA 3KQQA 5EEGA 4EVIA 5FHRA 4RTQA 5DWQA 2CMGA 3K0BA 1JG2A 4A6DA 2OKCA 3LPMA 3OU7A 4RVHA 3BWBA 4P7GA 1AF7A 3FZGA 3BWMA 1KR5A 3KQTA 3DUWA 3KQWA 3G2QA 1X1AA 2N47A 3DTNA 2O57A 3HVIA 5EMMA 2IP2A 3UA4A 4HTFA 3OU6A 5EZQA 5BP7A 3DMHA 3KHKA 3FUXA 3PTAA 5EG5A 5JUWA 1EQAA 2ZIGA 3KQMA 2BZGA 4QQNA 3WSTA 2I6GA 2PT9A 3LDFA 3KPWA 4C03A 2XBMA 1SQGA 2FPOA 2BR4A 2ZSUA 3V97A 3A7DA 3FTDA 2PV0A 1NBIA 2QM3A 3Q87B 4OA8A 2B2CA 4BLWA 2JG3A 2P1DA 2FK7A 3EGIA 4MQ4A 9MHTA 3B3JA 1I1NA 3MCZA 3BKWA 1KXZA 1VP3A 5FA5A 2G72A 2O07A 3HA7A 3LSTA 5DM2A 2PGXA 2NP6A 3CJQA 2CMHA 3M6WA 2WA1A 5EQJB 3UFBA 1YFJA 5K05A 1TW2A 2QY6A 3HA3A 5ICGA 2P3LA 1YZ3A 5E9JA 1F3LA 3TM4A 3SGLA 5EMJA 4DA4A 1P91A 3THSA 4FSDA 5DT2A 4R6WA 3NWBA 2I62A 3KQVA 1YUBA 1JTFA 5KQRA 3DXXA 2E5WA 3LBYA 5E2BA 3MHTA 4IWNA 4PYJA 1QYRA 5HIMA 3A27A 4YUVA 1AQIA 3LECA 2B25A 2IPXA 5CCXA 3K6RA 1ZHFA 5CVDA 5F2NA 2IBTA 4F84A 2IH5A 5EPEA 2PJDA 3KQYA 3QV2A 4ATNA 2ESRA 3TFWA 5GP1A 2PY6A 1XDZA 2ZLBA 4GOOD 4V0RA 5M5BA 1Q0SA 3KQOA 1Z3CA 5DLYA 5CVEA 2UYCA 2ZWVA 1PRYA 1EJ6A 1YZHA 2VP3A 4PYIA 1D2GA 1T43A 3A7EA 1P1BA 4FR0A 4PONA 2CKDA 2JHCA 1SKMA 1JQ3A 2AN5A 3TKAA 4P7FA 3CKKA 3GJYA 3SMQA 1R00A 4C4AA 4XUEA 4FSXA 2AZTA 5E9QA 5FA8A 2OBFA 5K0EA 4MIKA 5C1IA 2ZFUA 3TQSA 3DOUA 2PX2A 4KW7A 2P35A 5DTMA 3UJCA 2AOXA 1SG9A 1N2XA 5ICFA 3BUSA 1L9KA 1DCTA 2YXEA 1FBNA 2ADMA 2OB2A 2P40A 3D2LA 4H0NA 3MERA 4QTUB 4YMGA 4IV0A 4HGYA 5EGSA 1QAQA 5BXYA 5K0BA 3FUWA 2ZVJA 3HEMA 5FQNA 5LQUA 3E23A 4QQKA 4AUKA 1G55A 2Z6AA 1M6YA 4WXHA 2YX1A 5EKXA 4Y2HA 1SQFA 1SUSA 1UWVA 1VP9A 5HEKA 5C9ZA 1Q0TA 8MHTA 2UYOA 2PX8A 5DM4A 3LKDA 4CKBA 4A6EA 2Z6UA 3GRZA 4FP9A 2BR5A 3NMUF 1JG4A 4KDCA 4M37A 4Y30A 3LHDA 2PT6A 3HCFA 4DZRA 2GAFA 1QAOA 2P7IA 1DUSA 3U81A 3HCBA 3H2BA 5E1BA 5FHQA 1XDSA 2VZ9A 4ER7A 1VLMA 3C6MA 1KYWA 2AN4A 4E33A 2IIPA 1JG1A 5GIPE 3KR0A 2IBSA 3DLCA 5FUBA 3G89A 3EVCA 4QPNA 4XUDA 3DXYA 4YMHA 5KYGA 2OXTA 3DLIA 1I4WA 4E70A 1RI5A 1L3IA 2YVLA 3PVCA 4RTMA 3ER9A 4BP1A 4CWAA 3KPJA 3GRVA 2B78A 2PVCA 2PX4A 2WA2A 1O9GA 3A25A 3X0DA 2QRVB 4PNEA 5EHGA 5HIJA 3LKZA 5KQSA 5DRYA 3KU1A 3I5UA 5DXJA 3NDJA 3EVDA 5EIWA 4BLVA 2ONZA 3VC2A 2Y1XA 2GH1A 3DMGA 5FQOA 4EKGA 5LQRA 4RTSA 3PX2A 3NVKI 3HVKA 1FJXA 4POOA 3M33A 1EIZA 5H02A 3EGEA 1O54A 1XDUA 3OZSA 2ZBRA 4E31A 2PBFA 2HNKA 3HA5A 3GIWA 4OA5A 3JWHA 2IGTA 3SSOA 4XUCA 3SX0A 2P3QA 4FGZA 3O31A 3GRYA 4RVFA 3P9IA 2QRVA 2R6ZA 3G8BA 3B3FA 3MCTA 4P58A 1G38A 5LQCA 3EGVA 1RI2A 1EJ0A 3GCZA 4BY9E 2BH2A 1G8SA 1OR8A 3NW9A 5EMKA 3T7TA 4YUWA 5K03A 4C06A 4PCAA 3GWZA 1G8AA 2C7OA 3A26A 1RJFA 2OY0A 3UWPA 2LD4A 4E32A 4EMSA 1ZQ9A 5DX1A 5K0LA 1QAMA 4FS8A 2FYTA 1O9HA 3OZTA 5GOZA 3BT7A 3P9CA 3BXOA 4PYQA 4DCMA 4B17A 4YUXA 3TMAA 3CJRA 3KQSA 3CJTA 4XCXA 5LQJA 4JXJA 5MHTA 5E8RA 1VL5A 4ER6A 2EJTA 4F86A 2PKWA 5K01A 3MAGA 2KW5A 3JWGA 5FADA 3PB3A 1X1BA 5IH3A 3P97A 3A4TA 3G2PA 5T6BA 1VE3A 3O7WA 4RTLA 4RTJA 2G1PA 3LBFA 4OBWA 3HCEA 3IEIA 2K4MA 3LGAA 1R8XA 2GB4A 2PWPA 3GNLA 5DSXA 3KPUA 3TRKA 4DCGA 10MHA 3IV6A 4ER5A 2P3OA 2VDVE 1ORHA 2OPBA 1Y8CA 1IXKA 4KWCA 4PGGA 5EHIA 2H00A 4WVLA 4R8RA 4P7JA 5FTWA 2UYHA 3AWIA 1NV9A 4GC5A 1WXXA 4HG2A 3PT9A 5T64A 4RTNA 3EVZA 3MB5A 2B3TA 3KPVA 1EG2A 3I53A 3VC1A 1NW8A 1KPIA 2O0LA 3HM2A 4HGZA 4R8SA 3SSMA 3EVAA 5GIOE 2UZ4A 4RSRA 3G5TA 1NW5A 1D2HA 3EMDA 3UZUA 3REOA 3THRA 3HP7A 1BC5A 3R3HA 2OB1A 1G6Q1 3R24A 3FPGA 5EVJA 1BKYA 2JJQA 3EVBA 3R6TA 4M7RA 4BLUA 5T67A 5BW4A 5CD1A 3B7PA 2NP7A 4FZVA 3ELUA 3FRIA 3MTEA 3PFHA 1L3BA 3AXSA 1QANA 3CGGA 2ZIEA 4LG1A 5FULA 5HOQA 3G5LA 4P7KA 4RV9A 3KR2A 2NXEA 3HTXA 3Q7EA 2P41A 4PWYA 3UJ9A 2Z6QA 2YTZA 1ORIA 3ER8A 1R8YA 1RJDA 2AOVA 3L8DA 2CL5A 4OQDA 3BGDA 3BGVA 1N7IA 2VS1A 3CVOA 4QDJA 5D1HA 1H1DA 3FPHA 3T7SA 4R05A 1D2CA 1JQEA 2NXNA 2YQZA 3B5IA 2ERCA 2PLWA 3FPEA 1V39A 5GINE 4RTPA 3BKXA 2NXCA 3FRHA 1WG8A 3B89A 3RIEA 4C08A 2PXAA 2PXXA 3M6VA 3LDUA 3S68A 2ZIFA 4G56A 4GOND 4RYLA 3ORHA 4GEKA 1XCLA 4LWOA 4PYNA 3FYDA 3EEYA 5LQKA 3LDGA 2ZCJA 1RI3A 4GF5A 3EEOA 4U7TB 3M6UA 2XYVA 3R0QA 5CUQA 5K8VA 5E1OA 1XXLA 2HTEA 2H11A 1KIAA 4X63A 2YUIA 5HILA 4EKIA 4ER3A 3PS9A 3QOXA 1NW3A 3EMBA 5C0OE 2O06A 3SR4A 1X1DA 2O05A 2PWYA 3UJ6A 3FUUA 2EJUA 5EC8A 2UYQA 1HMYA 2DPMA 2HMYB 3BWCA 3OCJA 5GM1A 1VPTA 3T7RA 1WY7A 4AZSA 5LQAA 1DL5A 1U2ZA 3HCDA 3ELDA 1AV6A 3KKZA 2BR3A 2I9KA 4PIMA 1ZKDA 3BZBA 2FK8A 3UJAA 1FP1D 4C04A 4C07A 1M0EA 1BOOA 5HIKA 4KIGA 5FWDA 4DKJA 4GC9A 1VIDA 4M38A 1IM8A 2ZBQA 2ZZMA 2HWKA 3LL7A 4AZVA 4OX9Y 2GLUA 5KVAA 1ZG3A 3E8SA 5EKUA 2AVDA 3GO4A 3ERCA 4FT4A 3E05A 1ZGAA 4O29A 2ZULA 1TPYA 5F2OA 3I9FA 3GRRA 2AN3A 3NJRA 3C6KA 5DSTA 4CXMA 4DF3A 2GS9A 1XCJA 3VYWA 3LCVB 3JWJA 4YUZA 4CTJA 1YF3A 1B42A 3EVGA 5DTQA 3SXJA 3T0IA 1KP9A 3HVJA 5CCBA 1WXWA 2C7RA 2BM9A 3FTFA 4PYKA 5LQNA 4M36A 2IDKA 5LSAA 3P2KA 3KR9A 2DULA 1MJFA 2AOUB 1JSXA 4RWZA 3SVZA 2WK1A 3I64A 1FP2A 3FUVA 2HV9A 1SUIA 4PYLA 3UJBA 2P8JA 1RJGA 2G70A 2AVNA 4QTTB 3C3PA 4FT2A 3G2MA 1X1CA 4DQ0A 1TW3A 3KPYA 2R3SA 2CWWA 2P7HA 5ERGB 5ICCA 2YXLA 3DP7A 4MWZA 1KPGA 4MTLA 3P9NA 5DM1A 4AZWA 5CVVA 2AOUA 2V74B 1G60A 4KRGA 4AZTA 4RVDA 3AJDA 2C7QA 3PX3A 3M70A 4K6MA 4U7PB 3TM5A 1L1EA 1NKVA 2ZBPA 3E7PA 3LCCA 3OZRA 5HIIA 4HSGA 2PSSA 1BHJA 1X19A 2ZZKA 5K0JA 3DULA 3NVMB 4IV8A 5K0NA 4MHTA 3SM3A 1KPHA 4DM3A 4QDKA 1RI1A 3R9XB 5EZSA 1M6EX 5IKMA 5LR6A 1XTPA 1XJ5A 2OO3A 3P9KA 5DX8A 3G8AA 1YB2A 4PYOA 1FPQA 5CIYA 3IHTA 4R6XA 4IKPA 2F8LA 2YXDA 3CC8A 3UJDA 5E2AA 4EK9A 5K09A 3MTIA 1MHTA 3PLAE 3SSNA 4RTRA 1EAMA 3ELWA 1L3CA 3RW9A 2FHPA 2PX5A 2IDJA 5DRTA 5DXAA 5EOVA 3RODA 4PYMA 3TKYA 3HCCA 4QVKA 1NBHA 3KQPA 1NT2A 5P8WA 3AY0A 4RTOA 4PCLA 5DTRA 1HNNA 1F38A 1NW7A 3ME5A 4GOLD 2ZZNA 4X41A 2GPYA 4NECA 5E9WA 3UJ8A 4QPPA 3M6XA 2FCAA 2VDUE 4GUAA 4UOEA 3F4KA 3VSEA 5EIFA 5FWAA 1P39A 3GU3A 4KDRA 2IFTA 2NYUA 1XVAA 3CBGA 3G2OA 3FTCA 2JHAA 4QVGA 2NNWB 3BWYA 4ISCA 2ORED 3HVHA 3OU2A 3B3GA 4AX8A 4HH4A 1ZGJA 5BW5A 3OFJA 4F85A 3FUTA 3FYCA 4DMGA 3DXZA 4OQEA 1JTEA 2AOTB 4YUYA 3O4FA 2VDWA 4GQBA 2XVMA 3KR1A 2YR0A 5E8JA 5CVUA 4E2XA 2EFJA 5KS2A 3UJ7A 2XVAA 3V8VA 3JWIA 5K0GA 7MHTA 1WZNA 1SVUA 2JH9A 2OYRA 3P2EA 4LECA 4C05A 2QE6A 5JR3A 1P1CA 3UA3A 5K0FA 3EVEA 5F2KA 2Q41A 4EQZA 3G7UA 4E2WA 3P8ZA 4E2YA 3NWEA 4X61A 1JG3A 3C0KA 1N7JA 5EEHA 5EMLA 3TR6A 2AOTA 5FCDA 3UBTA 4CKEA 1NW6A 3BGIA 2C7PA 3DR5A 1QZZA 3NTVA 1JQDA 5K0CA 4HRAA 5DM0A 3P2IA 1NV8A 5DPMA 5HFJA 3TLJA 2EG5A 1R74A 2AR0A 3GRUA 3M4XA 3MQ2A 4KIFA 2HR1A 2XYRA 1INLA 5G02A 3HNRA 3EVFA 5B1SA 3OPNA 4PINA 2G8NA 2V7EA 3ID6C 1KYZA 2B9EA 3GDHA 3FTEA 2JHPA 2G71A 1I9GA 1IY9A 2A14A 2OZVA 3G88A 4PIPA 1JR4A 1VQ1A 2Y1WA 3AXTA 2JH8A 2XYQA 3GGDA 3MGGA 4PGHA 4RX1A 5ICEA 3P71T 4RVGA 2QYOA 4Z2YA 4CTKA 3I58A 1RI4A 2GA9A 4GOMD 4CKCA 3EPPA 5HZMA 3OE5A 4HC4A 5CVJA 2I7CA 1VBFA 2EX4A 4V0QA 4BP3A 4E2ZA 2H1RA 3OE4A 4GBED 4E30A 5E1DA 4LWPA 5DX0A 2ZWAA 1WS6A 2BM8A 4OBXA 3C3YA 3FPJA 2IH2A 1NE2A 3FPFA 2NXJA 3OFKA 1YFLA
chains in the Genus database with same CATH superfamily
4XWKA 2PUBA 2IA5A 4IMPA 3R74A 4TLEA 5IYZF 4B47A 4OLAA 1UXKA 3RK0A 2WG1A 3B36A 4HEOA 221PA 2YQ4A 3W90A 2EGGA 3N5CA 3KXPA 4UARA 1QGED 2OEPA 2ERYA 2QY9A 2QJWA 4MUBA 1E3IA 1W6RA 2FRVA 1LX6A 4GVPA 2PT9A 4LJ7A 4H0FA 1ZK2A 2XBMA 3JVIA 1D0LA 3DW1X 4GZ6A 4M8KA 4M6WB 3EZNA 2B99A 5TLSA 4B7XA 3FLBA 4D42A 4Z6KA 4I4IA 1ZAEA 4OKIA 1N0UA 3VYRB 1NN1A 3VX3A 1PNQA 3WY9A 1CBUA 1Z08A 1T43A 2FGKA 1P1BA 1VLVA 4FHFA 1FLAA 3T4EA 4LFCB 3MD0A 1VMEA 4LNUB 2QE7D 1AGYA 3QU7A 4OB7A 2GM3A 5LLTA 4JLWA 1BJTA 5AKXA 4Y2UA 2YMLA 4NH4A 3IOEA 2H2IA 1GJRA 3BSSA 1U7OA 4UOZA 3LUDA 4ZQEA 2YIMA 4J16C 2R4QA 5J5VA 3H5IA 1QX4A 1J39A 2XMSA 2XD4A 3UMBA 2W9XA 3VPXA 3VKFA 4DV7B 4TRMA 2P91A 1E9SA 3N0XA 3OHMA 1FFXA 2BIFA 3X1ZA 5C2JB 4H7IA 4QG7A 4AUNA 1XG5A 4Y1FA 2EEZA 4YUWA 2VIIA 2G7MC 4G23A 2D7DA 4CL2A 3HRKA 4PO3X 4B6EA 3E3MA 2EJTA 4O08A 3MWDB 4MULA 1K5PA 3ZYZA 3MWYW 2ECOA 5DSXA 1G7CA 4LBYA 1GYRA 5DE3A 4G26A 2R751 5AI0A 3K0FB 3SJCA 4NH0A 1I2CA 4TTSA 1ZN7A 5JDCA 5IK2A 3IT3A 3JU3A 5JAHA 4N8DA 5BRJA 2ZXEA 4NG5A 2BFEA 4BFXA 5EN4A 2B35A 4QNMA 4YCLA 5TQVA 1HY3A 1V1RB 3T7SA 2CP8A 3CUKA 5I01A 3ABZA 1ZONA 2JLUA 3THGA 3DR3A 2BE7A 1RM3A 4NPCA 4ZQFA 1TM4E 1YZTA 3AI7A 3CURA 1G3QA 3EMBA 4P4SA 3KOYE 5B3JA 3KLOA 1D1QA 5KJCA 1WDWB 1PZNA 4IDCA 4B7GA 1LPPA 4HOYA 4MIOA 2OKGA 2QLNA 4I3GA 2JZOA 4LMBA 2WZDA 1JR3D 2WM8A 2DH6A 2WD8A 3SXJA 1G8FA 3CUWA 4DLVA 2AK3A 1K1EA 4AMVA 1BVUA 4WV3A 2TMDA 3QA9A 3DP7A 4AO6A 4OHUA 3R41A 3EXHB 2J3EA 1V4VA 5KTSA 4KN5A 4BQPA 2DWLA 3VZDA 5LQDA 5BN5A 2RGYA 4AY2A 3Q41A 2GDJA 3LYUA 3ZK7A 4ZGWA 1BWPA 1HEYA 1E6LA 5KX5F 5ITYA 3SZGA 3E7FA 2F8LA 2PK3A 2PV7A 1H65A 3JAMS 1E1DA 6ADHA 5I8ZA 1L7BA 2DQKA 1F38A 2X7XA 1A7KA 4P6VF 3ZLUA 1YUMA 3JQRA 4JLSA 1I3LA 3R0XA 1ZRMA 1CZUA 4ITRC 1JHPA 2XVAA 4YP5A 4GM0A 4P82A 2QTRA 4F5ZA 4LHEA 4MZDA 3RVRA 4LRTA 2IYXA 4RKYA 5DNCA 4L5IA 5ALTA 5JY6A 4AC9A 3QPDA 1I7SB 3HBMA 2HMWA 3ZC7B 2O3TA 3DZGA 3STUA 2XMGA 4JNKA 4CL3A 1I9GA 3A70A 4IJEA 2GLTA 3L49A 1UBMS 3U3XA 5JJ5A 1E1QD 2JFZA 1I0IA 4B87A 2FZVA 5BN4A 1A7JA 2NUTB 4E5KA 1OU0A 1TM1E 1VKRA 2RHHA 2WVJA 2ONYA 2XFSA 4KO2S 1A8HA 4LCEA 2GI4A 3CRVA 3VR6A 4PCUA 4JI8B 2PCJA 4HDCA 4U9IS 1BDBA 4FZJA 3N2NA 3G2QA 4BEVA 3UA4A 4PAOA 1RWOA 3FUXA 2QZJA 3AQ4A 3BX1A 1ENYA 4OH7A 4O4IF 4YJHB 1PJCA 2VT2A 3N39C 1BFDA 1YFJA 2NOAA 1Z2EA 1P3QQ 2AFHA 5T4EA 3HBJA 4QAJA 3K0SA 4R6WA 2I9PA 1NC3A 1E9RA 4PG8A 3BN3A 5EXPA 4MVYA 2BZ0A 3H6HA 3K5IA 3GLGE 1JAZA 1DXQA 1BE8A 1U65A 4X90A 2IOHA 1HPLA 3QRWA 2EJCA 1YA4A 4CKBB 4EIWA 1KKMA 1YVPA 4H16A 4GO1A 1P31A 2DE0X 1I4TD 1SC9A 1U3CA 3ROMA 1CDDA 6YASA 1CZOA 4NZPA 3F2VA 1IBKB 4UHFA 5TB5A 4BC1A 3ANYB 3HKCB 4EAQA 1DB3A 1XZQA 4YMHA 5AI8A 2GM9A 2H2WA 4EYKA 3EH2A 1H2FA 4BO2A 4JL8A 3T54A 4EEZA 1NYQA 2LRHA 1PJRA 3WP0A 4PX5A 2QRNA 1ZJYA 1TCAA 4L9WA 3RNLA 4TRRA 5A9SA 1TECE 1GA1A 2V6ZM 5AW2A 3MHPA 4XEUA 1Y89A 4BB0A 1A76A 4JDUA 4KX5A 5CGQB 1OC4A 4JT4A 2BT4A 4H1TA 3W9YA 2CCGA 4EFLA 3PB3A 1JQLB 3JVUA 2DBVO 3DT6A 4M83A 2HMVA 1Z37A 4LRUA 2BDEA 1ZV1A 3PQ2A 2KNZA 1BKSB 5TY0A 3CNLA 1MMFB 5A4DA 1IONA 2EJVA 4EFDA 3EVAA 4TQUS 4Z2AA 3ROQA 2CUKA 3BD7A 3L7DA 2VEDA 4KR7A 3A6PC 4BZXA 3GEIA 4OP2A 5B3JC 1BD3A 2OO9A 2W82A 4MPRA 2WMOB 1YV9A 1XQWA 4M0DA 1UBNA 1HR0M 5EJCA 3G79A 3VV2A 4J2HA 1C7JA 3C85A 1PM5A 4UAJA 3BWCA 2D1TA 4IJUA 1F0PA 1D6JA 4G5XA 2AGVA 3IULA 3K6JA 1H9CA 2QL9A 3H6GA 1NOKA 4L1KA 3O1HB 4B3GA 5ALWA 2J9ZB 1R5LA 2DRIA 1TQ2A 3QA3E 4C4OA 2PPVA 1SZJG 2FLVA 4CV0A 4KE8A 3BWXA 1UKYA 2D7JA 3KBBA 4E7OA 1VJ5A 3RS0A 2IPMA 4Q9NA 3W2GA 3CZ9A 1A1SA 2J31A 2GJSA 3AJDA 3H11A 4W1PA 2RH8A 3C58A 4Q3EA 3GCWA 4HWKA 2W43A 4UC0A 5LQMA 2HYIC 1NU6A 2CLDX 3TQFA 3QBVA 1FPQA 4XW2A 3OZGA 5EVCA 1G6KA 3LRPA 2VKQA 2JZ0A 3SS8A 4XM2A 2F3TA 5P8WA 2C2OA 1H3EA 5A3SA 2HEIA 2HMUA 3JQPA 3LUCA 1XVAA 2GUGA 4H1VA 4A0FA 1L1TA 4PGFA 3AONB 4Z0HO 5IAJA 1JFTA 4D25A 4DJJA 4NCHA 2X4DA 1PHPA 2C4VA 1VMIA 3ANNA 3HR8A 2BJHA 3MIZA 4NS4A 4NSNA 1WZNA 3UA3A 2NM0A 2JGJA 4NZZA 4TSKA 4UUAA 4OL0A 4ZQGA 2AOTA 3WFZA 1Z29A 3ROGA 1W0JA 1YH3A 4ZK6A 4HRAA 3STWA 4KAAA 1R4MA 4PINA 2PX0A 1M83A 1X94A 3LW5F 1EVKA 4PNZA 1CF4A 2KRKA 3WTBA 3ZQ6A 2R85A 4RE6A 1XPUA 1D07A 4KXXA 4AULA 3NYIA 3OFNA 2AYZA 4ZD6A 3QAUA 2A9VA 3NOVA 3EZ6A 1NI4B 1S4QA 2DAGA 4PLYA 3CPSA 2QTAA 3RYFA 1ONOA 2B8JA 4MPPA 1ZUWA 1UAGA 2PUHA 3U40A 3Q0IA 3KQUA 1OXUA 3RANA 2RGRA 3KVVA 3DL0A 4OXKA 1SKYB 1Z17A 1FUKA 4TTJA 4L08A 4UTVA 1NI3A 5D3MB 5EP3A 2FRDA 1R6UA 3HA3A 5B4UA 2RONA 2IYAA 1E7MA 2ZYDA 3S7TA 2I2CA 5FR2A 1R3DA 4YJDA 1PKXA 3RS3A 1J20A 3OC0A 1DZ3A 2E2WA 4P3XA 1R64A 1Z2DA 2YUTA 3HP1A 1RBMA 2ZBUA 4DA7A 3OLYA 5LU8A 2O8VA 4DQDA 1B23P 4CMBA 4NZNA 3RADC 2VNAA 1WZUA 2PX2A 5I9BA 5FD8A 3PQ4A 1G5FA 1FBNA 2C7VA 5AW6A 1JPUA 1USGA 4G5QA 3ZXXA 2X76A 4KSCA 1Z38A 2V0NA 2FSHA 4PSAA 4DTIA 2JEYA 2RBEA 4UN2B 3VQTA 4NMLA 2IRWA 2L7HA 2NZ2A 3KR0A 4RABA 1WEKA 2M6KA 4I81A 1I4WA 4E70A 1O7JA 1TOAA 4INOA 1ML3A 3LGXA 1E9VA 3V7WA 1P7VA 4D80A 1AMOA 1R9MA 1WCIB 4TSFA 1E58A 4GKJB 5GZ6A 4MUXA 4M21A 3INTA 5D87A 1P19A 1OI7A 5KWJA 1J09A 3OZSA 3VX4A 1R66A 1BEUB 3G8BA 3EGVA 3R7AA 3T7TA 2R1TA 1Q22A 4FD2A 5DWDA 4DCPA 1QZMA 1BYIA 4D9IA 2X2PA 2R1ZA 2VF8A 1BMFA 3R6WA 2ORYA 3GY0A 4EF4A 2VDPB 4P98A 1WD5A 3ANMA 3K9QO 3LS2A 4C3VA 4N54A 1MEJA 2WF8A 4LKOA 2TMGA 3DOOA 3CLRC 1G21E 1N0IA 1XZDA 5K6TA 1XRRA 3ZH2A 2J4DA 3CNEA 1DC5A 2D2IA 4TLBA 1IATA 3ML1A 1L5RA 2OUKA 3ZGOA 2I6FA 4XQ9A 1N3YA 1NJSA 2ZB7A 3OWHA 2R8OA 521PA 1KOJA 1J0CA 1Y63A 3SFZA 3HYTA 3GQ3A 5G3YA 1XZAA 2G88A 4PR0A 3N8IA 2XUZA 1SUCA 2XAAA 4RGVA 1KMIY 3ILHA 3NX4A 2B37A 2BKVA 5FOTA 2Y1OA 1U4NA 1IH8A 1WEHA 3KEQA 1CE8B 1CHNA 5A6VA 1D0IA 3ZJYA 2RGNA 3ENNA 5KB3A 4YP6A 4DF3A 3U3KA 1H2EA 1KZ7B 2QN7A 3SICE 3ZGVA 2JAOA 3FHOA 2RG7A 4G1MB 2ADOA 5IZCA 5FPSA 1DC6A 5ERGB 4PPQA 1TCBA 5BMVF 4RPJA 4UE6A 3PGLA 1CKEA 1UQUA 1UEJA 1ACJA 1VGQA 1L7QA 3MWGA 4LE1A 1FTQA 5DGCA 4DSAA 5EOVA 2EP7A 1QTIA 5AKIA 4GP9A 4MR7A 1CEYA 4HH4A 1U3VA 4B08A 3ESAA 5FTKA 4I0WB 3KR1A 3CB2A 3VR3A 2AXPA 4YAFA 2LNHC 1QORA 2WIAA 3UAVA 1TEVA 4H77A 5B58C 1DRUA 4MUNA 5AVRA 1QZZA 3GQ5A 4L02A 3MWFA 1SH7A 3HHWA 1LDMA 3U4QB 1FSZA 2G71A 4L4UA 3J7AS 4H7HA 3KL4A 3HNPA 2A0YA 2JATA 4YLEA 4L3OA 1KAMA 3ICPA 4BFSA 1SCQA 5EKDA 4KO1S 4KH0A 5JYBA 1OA0A 1TLTA 3DL7A 4W6ZA 1A4UA 3ZLBA 1KHHA 1RLMA 3MS4A 2JL1A 2FRDC 2JDID 3C3WA 3UCFA 2FZKA 1LBIA 3KQTA 2I4TA 1C9MA 1KI9A 2A94A 2R1VB 3GMSA 5BV0A 3OEHD 4JBWA 4ENQA 3ZR4B 4PT5A 3MTAA 1UEIA 3Q8MA 3EQ9A 2IW3A 2GZMA 3N7TA 3HNOA 1K6JA 5AKHA 2J9GA 4UZEA 3FNQA 1Z06A 4RQTA 4AY6A 1SQ0A 1G1AA 2G9VA 5IT9A 5HDQA 1ZCFA 2LCIA 1QIFA 4ZJYA 2GJAA 1QIEA 4L6CA 1Y4ZA 3E9NA 2ZT5A 4NCBA 2KM1A 1E0KA 5BUZA 4FMBB 3L77A 1IBSA 2EYQA 4P3YA 1MJGA 1ZMXA 4ALLA 4B4DA 4LHWA 5GIPE 1NIPA 2QV0A 1DV1A 3FOFC 3LX8A 2ZQYA 4JC4A 3A1NA 1YR2A 2DYKA 2HCRA 2DFDA 2ONZA 2Z2KA 4LJRA 2NPIA 2J08A 4Z4HA 3M33A 2VZ8A 2EKDA 4BECA 1BS9A 1BMTA 4JI6M 4CKWB 3RREA 1NUUA 4JB8A 2BISA 3OLVA 1VSTA 4MQBA 2XV1A 2P9ZA 5BYBA 1KJYA 5CJJA 3OLCX 3A0UA 4KUHA 2ZCVA 1Q2XA 1D0SA 3CJRA 4FJ2A 1TT7A 2Q7DA 1X1BA 4FIZA 3W2EA 4BWVA 3F6SA 3L8EA 3IQZA 4BFUA 4YJ2F 4JV5B 2QP3A 2W0SA 4I36A 1WXXA 3A6HA 4TWZA 2GPAA 3HADA 4M89A 3G82C 4K40A 2HAKA 1G6Q1 2QENA 1LLFA 2F1HA 4NV1A 3ZVMA 3O8CA 3PYLA 3I45A 1IMOA 2JFVA 3KDSE 4LV8B 4Q93A 2J41A 1ABEA 1S02A 1VLZA 4CLHA 4GT1A 3KP0E 5HGJA 2BGLA 4PZCA 4S1WA 1UM9B 4J29A 3B5IA 2H7XA 4LOKA 4JP1A 2Y0CA 1BN6A 4R0NA 2XQVA 3Q3CA 1VL0A 5E6SA 4DIBA 5E1OA 1XXLA 4YFVA 5AJUA 4HAUA 1N77A 4OYLA 5EERA 1EP1B 4LG2A 1FFXB 2DLNA 2JNHA 5F35A 5IZCC 2BJWA 1KDYA 4JQSA 4MKRA 1TNDA 3OOSA 4OX9B 4GECA 2RI1A 3MHVC 4HUQA 3PA8A 2VJYA 5SY9A 2X3YA 2B7LA 5CAEB 3NB0A 3R6LA 4OXNA 1P5ZB 2R3SA 5TQ0B 1UC4B 3PSAA 2YWGA 3ZU4A 4MSUA 4TSRA 3O95A 3COWA 2E1RA 3F1LA 4DLLA 4TXJA 3SBJA 2I0FA 3BOSA 4LRXA 3DZCA 3UJDA 4NJMB 4FYVA 5A5VA 2OOAA 4AY4A 5LPNA 3R3YA 2A6PA 3TWLA 3MXOA 3REQB 1S8AA 1SCIA 1WXIA 3FFBA 1PG5A 2GEFA 2FI1A 3O8DA 2QX8A 3I6YA 3NATA 1Q0QA 3EA5A 2J07A 4E2XA 1Z2AA 4HKTA 1FX1A 3D2BA 4G2NA 3WISA 3JYPA 5HF5A 5IREB 1YJXA 5F52A 3TL4X 3ECSA 4TROA 1IIRA 2EL7A 2PL9A 3CRW1 5HZMA 4S0XA 1E3WB 1GGEA 2CVFA 4JQYA 3Q3JB 4Q9JA 4CLOA 3WGKA 2WUWE 3RSHA 4ZOEA 1BX1A 4EYEA 4NEGA 3BDVA 3RQIA 5D1NA 3COJA 2GAOA 5FPYA 3EXEA 1UFKA 1ZN2A 1TT5B 1JFRA 1GFSA 4C5AA 1QG4A 4KPFC 3PCXA 2C3MA 3CVWA 2AC2A 4QICA 2IT1A 4F92B 2OQRA 4ZRMA 2QJRA 4HYQA 2BR4A 5ITSA 5G1NA 2EC5A 1ODLA 3TECE 1ZK4A 2UXBB 2BUAA 5EJIA 4ZVVA 4IIJF 2FFQA 2JWSA 4XQCA 4BO1A 5DWVA 2GCOA 1J8QA 3ZVKA 1ZJ4A 5FDFA 1ZVVA 3LBYA 1YZUA 4KQIA 4YP0A 3RRBA 2ZAGA 3HFJA 3VHXA 4II3A 4LRTB 4IKEA 4PAWA 2OZLA 5KKNB 4WZBE 4R8VA 4AKTA 4YWHA 1VA5A 3NHPA 1CLEA 2QAGA 1G2QA 5CT4A 3O4GA 4HGYA 2YWDA 3ZIAA 4G0WA 3F7MA 2JJ8A 1EJBA 4ZYTA 1AY0A 4IV5A 2CLOB 3CN7A 5ECGC 1NWHA 3HI4A 1L4NA 1X1QA 3L05A 4Y9UA 3QW2A 2R8RA 5A62A 1VFPA 4D6PA 5KQSA 1UC5B 3F7NA 3LPCA 3SPXA 2P4EA 1TO1E 1ODTC 1Y7HA 3ELBA 2JY5A 5A3JA 2QJOA 4JBYA 3N0RA 3CCBA 4XUCA 2I33A 4O4JF 2YY7A 2KB0A 5FTLA 4LC0A 4GHLA 1L5GB 2XDAA 3DO8A 1R9NA 2WHQA 2J3LA 4L27A 4ZTZB 1PVDA 2KSQA 4GSLA 2AFHB 4HEQA 1AMNA 2FYTA 1U5AA 4DDTA 3TTUA 3LJKA 3LQRA 2VBCA 1KBQA 2GPWA 1ZN9A 2ZSFA 1URPA 1D4AA 2Q5QA 2WG2A 3C7DB 4WERA 2I71A 3TAUA 3OF3A 3T4PA 2OAQ1 1TEZA 3I32A 1FFGA 5CXXA 1VDZA 1YWGO 2FOLA 5DCLA 4IX9A 4C29A 3B7GA 4TYPA 4WJLA 2G83A 2QR3A 3JS5A 1M34E 4CT4B 3DDOA 3ZN2A 3G1TA 3R7NA 5A9SB 2I8CA 4XWGA 5T57A 4UMDA 4MUAA 1LDGA 13PKA 3M5DA 3PL1A 2OCYC 4M9SA 1ZCBA 3THWA 2F90A 3G8DA 4P5DA 1ZG3A 3D31A 4GYKA 2HT1A 4UXIA 3UM9A 1V48A 2JI7A 3LCVB 3KW6A 1CRWG 3PJGA 2DULA 5JDIA 2AOUB 4L8FA 4FWIB 2ZM5A 3D5EA 4BX2A 1L7EA 3STVA 2EVWX 4YAJA 1UBFA 4OCZA 3JR4A 2C84A 2AMFA 1CUJA 1UOQA 3DULA 2YWCA 4RK1A 3I6QA 3EJ6A 3T1NA 3AF5A 4TVSA 5K0ZA 3HH8A 4IMIB 2EW8A 4W8OA 1RCTE 2DKLA 1UQTA 2MYNA 2QYSA 1T8RA 1K4MA 3FWNA 1FFYA 1VCIA 4CR6A 4H27A 1X86B 4Q47A 5IS2A 1P5FA 2PKQO 5KNBA 1NLYA 3KE9A 2BFBA 4IBOA 4NU6A 1Z4NA 5H9VA 3TMKA 2WJZB 5C1DA 2HMAA 1U80A 4MA5A 4LF9M 3P2EA 1ZIYA 4B79A 5E95A 2VPIA 3U4AA 4WFQA 4M88A 1NV8A 3F8SA 5B1SA 4B45A 4GI1A 4BGEA 1GRNA 1KYZA 1TD9A 2Z4RA 3AL0C 1CJSA 4RX1A 4YRDA 3N53A 3CRMA 2YMMA 3EEIA 2MTBA 1X2BA 3TTVA 5A6SB 4GWLA 4OOEA 4F3TA 4HAZA 4C4YA 2X8JB 4Y2JA 3ZGYA 1K5GA 3LRTA 4QYMA 3L29A 4O2RA 3SYRA 2GCNA 3AKDA 2JGEA 1NUAA 3L8GA 1J24A 3FJOA 4K6OA 2I87A 1E5VA 3K9CA 1AF7A 2ST1A 1KR5A 1PJ2A 4MHOA 2IP2A 4F6LA 2IHUA 1R6TA 1JHYA 3GQBB 2XHEA 4BL5A 3GB9A 3MELA 1GKKA 2GD1O 5IK2D 1A8IA 1UDXA 5EUQB 1WIWA 2QAGC 2AEJA 5IC4A 1VSQA 4MDFA 3FBTA 4Q4LA 1A7AA 4NZYA 2AXNA 1UPTA 4YAWA 4ZT6A 3UFXB 3H83A 3C3KA 3NBQA 3FFTA 1VYVA 1CDEA 1WHSB 4P3OA 5D3KA 3KCNA 3A58B 3UJCA 4MITA 3TLYA 4YRLA 2WSLA 2ZTCA 3IAM1 4EO7A 1U1FA 3CXUA 1ABBA 1JEQA 3R3UA 2IDMA 2C5GA 2W8ZA 3TNFA 2FPMA 3N9IA 4QPDA 1E89A 4RHXA 1NRJB 3LKVA 1N2JA 1CERA 2Q07A 2OXTA 5ISMA 3CX8A 4TKLA 1TZKA 4K2HA 3L79A 1NXTA 5FAKA 4B32A 2A9QA 3BHMA 3NBXX 2ZWOA 4F3NA 3GLFB 3RYFB 2NO6A 3EVDA 5EIWA 3DMGA 5DHFA 4BQOA 1K0FA 5DK4A 1N75A 4RETA 2OV8A 1YJBA 3ZX4A 1G8AA 3M3HA 4N5HX 3UWPA 4BNLA 3KLPX 4C43A 2J85A 2VTDA 2KBFA 4I1OA 4FFWA 4MS1A 5LYYA 2YCLA 4EW1A 2P2GA 4Z9AA 3UWMA 4NE9A 1L5FA 4I55B 4EYOA 2QUAA 2VJMB 4UXJA 3HM2A 1ORDA 2E85A 2ZYRA 5HX7A 4LOIA 1M3SA 3C43A 3T7KA 1VBNA 3M4NA 3H5WA 5AJWA 2QM0A 3EWSA 5JPCA 1WZCA 1H2BA 1KKUA 2HMTA 3NDRA 3CUTA 4WKOA 1QQ5A 1NJ2A 5KYUA 2QW0X 4ZEWA 1JHAA 3V8MA 4UEKA 3U6SA 1G20E 4FU0A 3ENWA 2CFOA 3NHBA 4R1OA 4LDAA 4C87A 1FDOA 4BB5A 4PTLA 5JS1A 1BA3A 2FWRA 1E0AA 3SSAA 4JDPA 4C0QC 1J7JA 1H05A 3RCBA 1AM4D 5HILA 4FVMA 5LLDA 1X1DA 4H17A 5JDIC 2JY8A 1MLDA 3ABSB 4IVPA 3C98A 3WSWA 1K88A 4O2BB 2HH9A 3OD5A 1WWKA 3IECA 1SM4A 4MA0A 1MTZA 1JJFA 3VR6D 3X2SA 4MVWA 4LQDA 1DARA 4B6SA 4ZMRA 1NJ8A 1XQXA 4IX1A 4LJSA 3GNQA 3W0FA 1N25A 1B4DA 2GFQA 4QUDA 3VVCA 4OY3A 3O26A 3OOEA 4LSZA 2L17A 3MRTA 5CPBA 1Y1SA 3NAGA 1OCEA 2CVQA 3QE0A 4Q4AB 3IUPA 3RWMB 4RPLA 2PMKA 3VVMA 3WOVA 1PLKA 1AKQA 1G8PA 4G1BA 2J1LA 4I2VA 1JVNA 1ZISA 2P9BA 2DWUA 3COSA 3PZBA 2G9NA 2NNLD 4N7JA 1FA9A 1U0GA 3T1YB 3SLGA 4WD3A 1TCUA 4UREA 1N4AA 2ALJA 3UATA 3BL8A 1HE5A 1OXVA 3WL6A 4XH9B 2G5GX 3SR3A 3ID6C 2B9EA 3KOZA 4QLBA 2J5YA 1VJRA 4RVGA 2QI9C 2QLLA 2J6BA 2Z08A 4G1FA 2Q3CA 3EIOA 1YFLA 1GU1A 4TUWA 4BO8A 2BCEA 1WXQA 4UHBA 1C1XB 1S89A 4M76B 3P0FA 4WEOA 2J5BA 5EIBC 4IIGA 3GUZA 2GJKA 1UPAA 3EGXA 3IDOA 4UXHA 1Y3CE 4Y2GA 2CMGA 3QKSA 2NVBA 1XKLA 4PN3A 5LOVB 5DASA 4DABA 3R0IA 2MSLA 4RKQA 4D0SA 1IG3A 1K9SA 2CLFB 2B82A 3FOCA 2HBRA 3LHKA 5BSKA 1C3OA 3BMCB 4Q0MA 4L4XA 4E07A 4JIMA 1KFKB 1XD8A 3EGCA 1MQ9A 4ZVPA 1ZJ5A 4YPFA 1F4PA 4YCBA 5FFFA 3CLRD 3TCXB 2ZVQX 4IZIA 3QVUA 3JD3A 2WSFF 1CZRA 1ZNXA 3E1KA 3EBPA 4MUJA 1R8QA 1JI0A 1Y4SA 5KNLA 2AA3A 2O8CA 5IM4A 3L0OA 3PBKA 5G40A 2FZ4A 1Q0UA 2XQIA 3ZEAA 4DR7M 1IXSB 4KQXA 1WZIA 3DA8A 1KKLA 1QO0A 1VSUA 2FS1A 5C5CA 1LLUA 3QTBA 1PD1A 1YFKA 1U3UA 3WMEA 1IXYA 4DJ5X 1GRVA 3NHRA 2B5WA 2B61A 3TSCA 2C0CA 2GHRA 1Z6ZA 2V7TA 1G3MA 1I7QB 1OR8A 1JJAA 4OMDA 2I3BA 3CNHA 2GXQA 2EHDA 3NPAA 9LDTA 2TMKA 2K7ZA 3GPCA 4UHDA 1SULA 4JA2A 4JEIA 1IBLM 4IJKA 5KTNA 4U7DA 2JKZA 2VDQB 2FPXA 3GFQA 1PNRA 4OBWA 3EC2A 1R6XA 1DOAA 3LIPA 2FOIA 5CYGA 3GR6A 2WNIA 4CG3A 4YN3A 2JPDA 4QXRA 2GEVA 3RSCA 3SAJA 4DXDA 1C8BA 3ND9A 3JXEA 4OQQA 2E4UA 3LC7O 5EJ9A 1W0JD 3V80A 1A96A 1WG8A 3B89A 4DVGA 3CFYA 3DBLB 4MKGA 4MYUA 4Q3NA 1TJNA 3LLVA 2VYFA 1E3DA 1P80A 4N4AA 2W70A 4MNTA 4AZSA 4PPYA 4TYNA 1TM5E 4REZA 3L0BA 3OFND 4BVHA 1KU0A 2B20A 1IWBB 1WMEA 2ZULA 2O8DB 1CQXA 4WK2B 1CTQA 4JODA 5KYWB 1S2LA 1N2ZA 1T2DA 1CFJA 3OMXA 4PPFA 4FCTA 3U5ZA 1I9CA 4C0AC 1W48A 4LXYA 4YROA 3WYAA 1ZESA 2EZ8A 4PTZA 3SM3A 1U2TA 3C2QA 4QT0A 3AV0A 5A1TA 2BEWB 3OCWA 4NBVA 3CZQA 3LLMA 3V2GA 3O0DA 1AN0A 2ZZNA 3CRRA 4GS5A 3TSOA 3RUPA 2GXSA 2NNWB 1UBTS 3RJ9A 2O7QA 4Y2VA 5BSWA 4CKEB 1PN3A 2NO0A 1JBEA 3LPDA 5AICA 5IT0A 2WTEA 2WT9A 4TWRA 3RUDA 2W22A 5FPPA 3VGPA 3TL6A 2O2YA 1Z4OA 4I9GA 4NBKA 1KDTA 4IXNA 3CUUA 4FMDB 2FSPA 1FU8A 2RAFA 4ENRA 3X1JA 621PA 1OGYA 1L7XA 2CB0A 1HFKA 4WOBA 3R8CA 4TSFD 3FTEA 2IOYA 4KKVA 4CM1A 5LLSA 4CKCA 1UMKA 3PHJA 4D0NA 1JDVA 1NW4A 1FLDA 3U44B 1MIOA 3PXEA 1TMKA 2X6TA 4K9KA 3P4XA 3G1UA 3SAVA 3WRVA 4IG4A 1UT5A 4MQMA 3TRDA 5AW8A 1BMFD 4EA6A 3IE2A 1WDMA 4M7WA 4JFAA 5J4HA 1ZW1A 2FUG1 2ROQA 4QGAA 4BASA 3GHHA 2Q4DA 2XMPA 4LVOA 2OO5C 2ACKA 2F8SA 3AESB 4BLWA 3R7FA 1NVTA 1JBKA 2FPUA 5JCOA 2XZUA 2CMHA 4J2OA 1Z0JA 1LH0A 1BJRE 1T9ZA 4K9MA 4ITVA 3JZFA 4WTOA 3OTWA 4KXVA 2HF9A 4KLCA 3IIKA 4B1FA 4HDSB 5EIOA 3HDYA 4KQ6A 4PAQA 5F3DA 5JARA 1WMDA 4YT2A 2Z2YA 3HB5X 2B1JA 3K20A 2A3NA 2Z30A 4A15A 3EMVA 2HNBA 4B6JA 3L3BA 4XWAA 2CT8A 2W90A 2ABWA 3JQAA 1L3IA 5IVHA 4BP1A 3DWGA 1HJPA 4DCSA 1FQKA 2X1MA 5L3VA 1GL6A 3PPVA 5D7NA 3DEIA 3PI6A 3Q7QA 3ND5A 1NP3A 1P77A 2DVWB 3ABOB 3IG8A 2C2GA 4P58A 3WLSA 5F5XA 3WVNA 5BPHA 4II2A 5A9RA 1D6MA 1K6EA 2EDCA 5J63A 4GI2A 4JBXA 2FOIC 5I4BA 5YASA 2PAAA 2DHEA 3GPPA 3WK7A 3EUFA 3VHLB 1EX9A 2V7VA 1Y8CA 3ZV4A 3DMDA 4G0NA 4WOCA 1ESDA 1SRRA 3ZIDA 3QWIA 3JX9A 3NHFA 4EJFA 3VR3D 3G8YA 1U3DA 3S55A 1RWPA 4A92A 1A71A 1CJMA 1HX7A 2G7ZA 3O38A 3QVGA 1ICIA 4OQ4A 3HKDA 3FRHA 2ZAMA 3FBGA 4MQUA 3W6OA 2BD0A 7REQB 3JALB 4KOEC 4GF5A 2GQFA 1VDMA 3LUKA 4LFAB 3KQHA 2YUIA 4KMSA 5EE3A 1BHO1 5JC8A 3AIOA 4GNKA 4EZBA 3HDVA 3D81A 4NEHB 4Q01A 1SKAA 4A3SA 4N01A 2FWPA 2XWPA 2ISSD 2G1KA 3ET5A 5JQGA 2OK8A 3SLKA 1DCKA 2NO1A 3GPLA 1IY8A 1WB5A 4BKQA 1N6LA 2BJVA 1Z6PA 2AJCA 1PR1A 1DIRA 1Z4IA 3JQ8A 1VG0B 5IW8A 5C35A 4ABTA 5HIIA 2VYNA 3VR1A 1SC6A 4IMJB 2AJLI 3L7KA 4QDTA 1GZSA 3AERB 4UJ5A 1B6GA 1RPZA 1J5EM 1DFIA 3NBZC 3ETJA 3K31A 2VRCA 3ZHZA 1Z8DA 2D54A 4AU1A 1P4HA 2H5EA 2ZK7A 5F76A 2GN4A 3GMTA 4AF8A 5BSHA 3HN2A 4ZEXA 1GAEO 2IYYA 2GPYA 3GP1A 4MJXA 3WIEA 4IJVA 5JOQA 4D82A 2AX4A 1M0TA 2QGNA 3IP3A 1P0IA 2CXPA 1Z6YA 1H4VB 2FJ0A 1L4EA 2EW2A 2A1IA 1RWQA 3UMGA 4H4EA 2BGJA 2RMKA 4ZOAA 3HP4A 4MW0A 4C0WA 2P6OA 4ZZIA 4R9SA 4TM7A 1KSJA 2VRNA 4JROA 2RHCA 5AHKA 5BY2A 3FPBA 1U1EA 5K8JB 2XYQA 3GGDA 3L04A 3OE5A 1BU8A 1US8A 3I5MA 3PK0A 2PYDA 4HVCA 3SQWA 1TC2A 1CUBA 1K82A 3F6CA 2RRUA 1IOWA 4ZTBA 3TPZA 3KT8A 4JP3A 1F7UA 1ISMA 1O89A 1E4YA 3QMVA 3NC0C 5JCOC 3WLKX 1G3UA 4TM8A 3ENVA 3VHQA 1SZDA 4CQMA 5JXHA 2EIHA 4WW0A 2ATVA 5BP7A 4ZJZA 3AFOA 3RVOA 4HWOA 4YRGA 3A7DA 1AXRA 5JDCC 2J3MA 4IBCA 3LZ6A 2ZE6A 3G9UA 2RHLA 1J49A 3A45A 2UVDA 3KKQA 5A4AA 3PUVA 3K1AA 3MLEA 1GZUA 3GFVA 1J0XO 2ODNA 2IIBA 1XT6A 1V71A 2I62A 5KQRA 2BFBB 3BL5A 2FHSA 2GPSA 3DMYA 1F8UA 4JC8A 1HQKA 6NULA 1Z5NA 3UK1A 4P0QB 4E7PA 4QT4A 2IE0A 1BE1A 3D3NA 1U2GA 2FPGB 4C0XA 1EFTA 3D8BA 3AG5A 2XE6A 3W1VA 4BVJA 3HWSA 5B53A 3NORA 4FDTA 2HU8A 4WESA 2D2VA 5EMNA 3BGWA 5EP1A 4IIUA 2NWQA 2DWZB 4OW0A 2GN6A 1V35A 4X95A 1P8JA 4GLBA 4XUDA 4EB8A 5KYGA 4FHDA 1KAGA 1XC7A 3F6PA 3NBYC 4WH0A 4QBTA 4JUAA 4MWDA 4DEXA 1QF9A 5LQRA 2RJOA 5FH9A 4B2PA 4I4NA 3KL2A 2V3VA 3GIWA 3JWHA 4WKCA 5K8UA 4R2WA 1OILA 3QUCA 1TF0B 3BXOA 4J7UA 2HSDA 4N3NA 2DOKA 4BFTA 4FMCB 2F55A 2WIBA 4K1XA 3LUAA 4JK3A 4PX3A 3BWVA 3IV6A 2FN8A 4OHOA 4M87A 1JW9B 2ZJZA 2JLYA 4QJ4A 4EW6A 1V8PA 3KTOA 4TZTA 3BC1A 3OJXA 1WJ7A 1B2LA 5K99A 1Z63A 4QXOA 1M75A 4IQ0A 1UF9A 4BO5A 4A6XA 2ZDQA 2F6RA 1ZXBA 1C0PA 3KLMX 4WN3A 4GPEA 3BJRA 4V1CI 2IYOA 4OHVA 2VWHA 4FS3A 3FVTA 1V2HE 3OPYI 3SYMA 1QM5A 3AR8A 3LYLA 1EK6A 1MPTA 4LWOA 2VHJA 3PC6A 3QVTA 4FR5A 1EDEA 1U2DA 4I08A 1ST2A 1XHEA 3T1HB 4S1NA 2O9JA 3C8UA 1DEXA 5HKAA 3WAKA 2X14A 4KN8A 3H9CA 2R7NA 1XWFA 4BNFA 3UOAB 1GAWA 3K9WA 3E8SA 4NOJA 2GYWA 1JG7A 3NS7A 2WJYA 2WJGA 1I3MA 2ZUWA 5A5DA 1DBVO 1M1NB 3L25A 1KJWA 2NSJA 3SMVA 2ZSHA 3UJBA 2WJ6A 3CGWA 1HH4A 4ZXPA 3OTOB 2YHIB 5IG2A 4I50B 4U7FA 3QYEA 4A5SA 5JC1A 4A2PA 5K0NA 1J42A 3FTNA 4PLZA 3TUZC 3CIOA 1X7YB 3IPCA 1LB1B 1I6MA 3ZD6A 1GZ4A 4HHEA 2H08A 4H7KA 5KYUB 2FHPA 3PNVA 4CU5A 4R2JA 4EPRA 2VRBA 2G6BA 2XRFA 4KGVA 4QPJC 1X7ZA 3V2IA 4BLOA 3ZIAD 2Y27A 5AW9A 1NVMA 1FQOA 1DOZA 3OM0A 2PSFA 3LOUA 2OAEA 4E11A 4JJ4A 3VZBA 1HF3A 3AWDA 1KO5A 1HNXB 3DR5A 5K0CA 1AUAA 4G1VA 4KPYA 2L69A 4HQFA 2CL0X 4LOJA 2XXAA 3D6TB 4RJTA 1YDFA 4O3FA 4LHVA 4MS4A 4UU1A 2WWRA 2K6GA 4XIYA 1ZJZA 2W00A 3FIJA 2G40A 5TV2A 1J90A 4A0HA 3B6KA 1RKBA 5DH9A 4L4RA 2P3SA 1ONPA 1HNWM 5ABPA 2J0QA 1HORA 5BVGB 1VG8A 3WLNA 3IEKA 3UBMA 4LDZA 2BHSA 3ZHBA 5H7XA 3L0IB 1V4NA 3AHHA 3R7SA 3DUFA 3G85A 3UB2A 1NTRA 1RQLA 5A5EA 4J07A 5KOJB 2CWDA 1VP3A 2G72A 4DR2M 2PGXA 3JYHA 4H15A 1Q1ZA 1SCBA 3PGJA 2E3JA 1KI6B 1TQ4A 1U2GC 4GWKA 2PRSA 1ZS9A 5EE1A 3UXYA 4D41A 2CHFA 1NBEA 4GE0A 4DLTA 5JXGA 1JAYA 3BGSA 1XX6A 3U3ZA 2VDBB 1LXCA 1NYRA 1A8UA 3HN7A 4QGHA 1K27A 3WYFA 4ZV9A 1YA8A 4AZFA 2PT6A 2QQFA 2GHQA 3ZDEA 1JA9A 5FHQA 3H2BA 3PDUA 2FVYA 4EX6A 3GD7A 1MAWA 1NPTO 5CW1A 4UUQA 3QKSB 5A3VA 1PJIA 1R12A 3WBKA 1PK7A 3RT9A 5JFOA 4LTDA 1N0WA 1FCJA 2ENUA 3ESDA 3RB8A 3GVXA 1DQSA 4CLXA 4WKGA 3LM8A 3PENA 1MA3A 3CNBA 1TIKA 4PCAA 4IUCS 3FDJA 1C3OB 3P9XA 2ERXA 4Q34A 2BEKA 4A27A 2GM5A 3AKCA 3H1AA 3OCVA 4HGRA 4J0JA 3TUIC 2KXEA 4EO4A 3VSBA 2YFKA 1N32B 3INGA 1HWYA 3R4CA 5LMZA 3I23A 1PW7A 4HEJA 4Y2RA 3I53A 5KNBD 3FMOB 3DXFA 1GG2A 2PGNA 2MSKA 2ZIEA 5KOIA 1H93A 3T52A 3ZLTA 3LUFA 4BN4A 1G9TA 1MXFA 1SXIA 1U8FO 3GZNA 2QTWB 1U2DC 1QRAA 3QH4A 3R76A 1XFDA 2ONCA 4N47A 3TPCA 3RUHA 1VSBA 2C94A 3Q6IA 4N0EA 1R27A 1JDPA 1UJ4A 4HPXB 1XTSA 4PXYA 2F1RA 5JAIA 3T5AA 3DA1A 3HACA 2CV2A 1XUOA 3PE3A 3UMSA 3UW3A 2W93A 2V0GA 1CR6A 1ZYUA 3T7RA 3WYEA 5LQAA 3L8ZA 1H0SA 4UM9D 1DL5A 2UZIR 3HS3A 1EGQA 3PQDA 3DPUA 1M0EA 4RKFA 4FOLA 3SYLA 4ZVUA 4GC9A 3I2JA 3N0WA 1TDHA 4EW3A 3SBOA 5KTPA 2I3GA 3I1FA 1L1ZA 2V7GA 3S8YA 3WR5A 1SOVA 4MRAA 5LUAA 1Y8QA 3KPYA 4DBZA 4F4CA 1CLUA 4BNNA 5K4GA 5EIBD 5CXUA 4KXLA 4WKPA 2W6PA 3CZ4A 4TN1A 1Z5CA 3RVNA 1CY6A 1EGHA 4LYHA 4J94A 2I3ZA 1WUJS 1UP6A 2H4JA 1C7YA 3FBWA 4LOHA 2Y1GA 3NAMA 1P4JA 4G67A 4A7PA 4DEVA 2HQOA 4IQGA 1QIIA 3HBNA 2QLFA 1F0KA 1MABB 4Z7OB 3X1WA 2RGUA 1ZNYA 2NU8B 3STTA 4PLPA 1P39A 1PQ4A 2PA3A 1HE1C 2ATCA 5ALDA 5BW5A 3DZHA 4XYMA 2WSYB 1H2WA 2VDWA 3GLHA 4KTTE 2SNIE 5C80A 5K0GA 5FLXS 2VLBA 5AVKA 3EGOA 3FDXA 5JAMA 2UYGA 3IUSA 2WJ4A 1X74A 4UQOA 3S2ZA 3S2EA 2VUIB 2BFNA 3ZHRA 3WDSA 5BXQC 2QD3A 2F43A 5A7FA 4ETNA 3R75A 2ZUFA 3OQOA 1ILEA 5E7IA 4MVJA 2UYYA 3U5ZB 4K6FA 2Z1DA 4MHSA 5E1MA 4B09A 2C5HA 2AKAB 3DBOB 1NRXA 2F5NA 2PRZA 5FTMA 4V3BA 4YDSA 2FW9A 1NQ5A 4BOYA 4GKBA 4TLMB 1NLFA 1TF7A 1EI9A 4CTNA 4K46A 4NP6A 4RPKA 4U7GA 1HT3A 1I4LD 1GPKA 5AM4A 1T8SA 1GSIA 2HQ1A 1RYHA 4D9GA 1PJ4A 3A27A 1PJ3A 4PICA 2PZLA 3CX3A 2R5FA 1U8YA 3IQGX 2ZRGA 1OLUA 4Y98A 1GPUA 4M54A 1XMOM 2H17A 3I4CA 1WSBA 3VTFA 1BWQA 3FOEC 4JJ8A 3LWBA 1V33A 3AGQA 3RSSA 1ZM2A 1YR8A 1YI0A 2VQFM 4L72A 1L2DA 4HTAA 1XF1A 4UBIA 1U6JA 4M99A 1J4AA 2RGNC 1UADA 1MIOB 4Q48A 1UL1X 4B3SB 2JFXA 4RD0A 3G5AA 3PEUA 1RYMA 3CX6A 4MLZA 2HXSA 3KPJA 3OZ7A 1KA9H 2IPOA 4D4LA 3GDOA 3BORA 1XTZA 1CC1S 3LU1A 3NCTA 2KNAA 4P8RA 4R9NA 2XCUA 5EFZA 2ZBKB 5EQTA 5J3JA 3GX1A 1O5IA 3D7RA 2IHYA 2JUJA 4D3SA 2QRUA 3OOHA 3LC2O 3D59A 1QGYA 2ZSAA 4C06A 3VAZA 2Q6IA 1O94A 4N5DA 3EPRA 2BV3A 1T4BA 1EM6A 3IMKA 4QRDA 5FNVF 4MPDA 3IMFA 1JIJA 3HVRA 4KWCA 4IUDS 5FSWA 3MB5A 1MDFA 2HRRA 5CM9C 3CLUC 1AIPA 1W8DA 2BFEB 3O2NA 3W6NA 4KHPB 3RKSA 1PGNA 4LWQA 4KAJA 4CF4A 4GH5A 2IYFA 4KYVA 8GPBA 2V7BA 3FRIA 3IDZA 1U11A 2OCAA 3MMPA 4QRIA 3UENA 3EXIA 3USCS 2F2TA 3MBOA 1LI7A 1ILWA 1OFUA 4P4SB 1C4KA 4ZO8A 3KTDA 4G07A 2ZITA 4CV1A 1OVGA 4RIHA 2VT6A 1HTWA 3LQYA 2UVQA 5EP2A 3HR4A 1N3BA 3KJFA 2JLQA 1KHTA 4L6IA 1WOMA 1TU3A 3LUBA 4WZAE 4U7JA 5ITXE 3NT5A 2HC9A 2QQ0A 3PDHA 1AJEA 1PJBA 3ZCUA 1JHMA 3M3DA 2VTKA 2C9DA 5LMCA 3KR9A 2BE9A 3CNNA 2XTAA 3V4OA 1E1KA 2QN2A 3GLVA 2ZPAA 5BN5B 3FYUA 1MN3A 4CISA 3ZKAA 1DTSA 4U7HA 2CHGA 3D7NA 4KRGA 2CC2A 3KT0A 4K2AA 1TH3A 1GU7A 1GPBA 5H9WA 2ASVA 5AKGA 3R9WA 5ANRB 4AKIA 2ONJA 1A5AB 2PO7A 1V9LA 5G0WA 1JHUA 1E8MA 3UT0A 1CY4A 1GJTA 4FFLA 3I9V1 4GYYA 4UTXA 3ZWXA 1ZOPA 2I3AA 4M3NA 4DC9A 3FTPA 3HKDB 1Z0SA 2XDYA 1KS9A 4PRZA 2MHCA 4OMFG 1OXXK 3V4PB 1JL3A 2UKDA 4XWWA 4R1NA 2IJGX 4IG9A 2XPCA 2IZ7A 2OHHA 5EZYF 3U61A 2W6NA 1T1IA 1TZJA 2WMNB 4GSYA 1SVWA 4K9LA 1E3JA 2DTDA 2LBPA 2X0RA 3AEKA 3EVFA 3K9PA 3K94A 5BN4B 1QO0D 5EJFA 1XHFA 4V0SA 1U7DA 2ZYSA 4DWWA 3JQ8B 5EP4A 3LCJA 3IQDB 1EE8A 3ETCA 4F1WA 1ZH4A 1G8KA 4P53A 3QE3A 5I7SA 1NLMA 1DEAA 5DWQA 3K15A 3AHCA 4DGQA 5BR8M 2GK3A 2E48A 2CUNA 4FI3F 3EYAA 4NLLA 1C4WA 4EI9A 1OY1A 5BR4A 4G37A 2JS7A 4PSDA 1XZCA 5JSYA 2O6HA 3SMPA 2XCOA 3QLVA 5GJBA 1SXGA 5KSZA 2C1EA 2R00A 4KPEC 2YVUA 5C1BA 2A5GA 2G63A 4C20A 1M10A 4ZHQA 3EFEA 5HF6A 1IVSA 1T6BY 2RK4A 2QR2A 3QLUA 1FU4A 4K6HA 3JRWA 4LV6A 1KFJB 3Q15C 3TQRA 3MINA 4PF1A 3HYRA 2FH5B 4MZXA 4FSXA 4F11A 2VPYA 1PZMA 5JD3A 3LPNA 4OXRA 3ANTA 1D2RA 2EW1A 5BXYA 1NG9A 2KYRA 4HFNA 1US8B 2B4RO 4TMZA 2Y99A 5HCNA 4I5DA 4CF7A 1IN5A 3GRVA 2WABA 2JAXA 1SMKA 2R8BA 4BAUA 2GH1A 1P7PA 5HE8A 2QTTA 5BR7A 4MTCA 2OK7A 1J9GA 3NBUA 4FGZA 1Z13A 2IIVA 1GUDA 1G8SA 3OOWA 3FZYA 3N70A 3VPSA 5LMUB 4LXUA 1Q3HA 2PWBA 5G3ZA 1AIPC 5LCXA 1QAMA 3TMAA 2H1OA 2OA0A 2MH8A 2R7MA 3QPBA 2VZLA 4TV8F 2H29A 5T6BA 3G2PA 1Q0PA 3NHWA 3PRKE 1EXMA 1AUOA 1ZINA 5JMWA 1GPNA 5EHIA 3B20A 4ONEA 4J0HA 1IZZA 1YBMA 4MGEA 4LXXA 4DZZA 3KPVA 4AP5A 2BFFA 3TX2A 5KWVA 2HF8A 1IBMB 1TZ2A 5BW4A 1C81A 2HCJB 1V26A 3HFGA 1MQAA 3PX7A 3BWDD 7GPBA 4C7VA 1E60A 4M22A 3D64A 2QPLA 3A1EA 3WGMA 1W0CA 3RIXA 2E18A 2O1WA 2DWMA 2ZJ0A 4EUSA 2WLTA 1XHLA 4LQ4A 2JA2A 4RSGA 1KIAA 3H75A 1GNRA 2QAIA 3MT9A 3IJPA 2F48A 3LXXA 3IEXA 4C3UA 1M9NA 1OIWA 4LGVA 3FYUC 2JLCA 1T24A 1RWXA 4DIMA 1NTOA 3HLYA 3OX2A 3UMVA 3DDHA 4P4GA 1WXWA 1AHNA 2FAXA 5BQ5A 2WYIA 2HDOA 5JW6A 4N5IX 3H11B 1QGDA 4OUDA 4GEWA 1ABFA 1V8FA 3RVPA 3A3PA 3A4VA 1L1EA 2LTAA 1P9LA 3KQNA 5LKAA 5FO1A 3ZY3A 3GK3A 4ZCPA 2YZNA 6REQA 3RGPA 4RMNA 3HHZA 2CW5A 2NMVA 3FNIA 1T2CA 4L74A 1UPUA 2BGTA 4G4QA 1IK6A 2NTEA 3VZQA 3DZBA 4EW2A 1LSSA 4AWXA 2AOTB 2WF7A 4GQBA 4F2DA 5JNTA 5K4AA 3TTYA 3GT0A 1R4MB 2XB2A 3HU2A 4MWOA 4L3VA 4R5HA 3ZLVA 4C6TA 3HB4X 5B7GA 1UDRA 5LJIA 2WM9B 5IDYA 2AHRA 3JQAD 3OUUA 3PFBA 2YY5A 2NSYA 1UCFA 3T15A 2FW1A 3LPLA 1TADA 3TG8A 1KQ3A 1OC2A 1YS1X 3E5MA 3TL3A 1C2TA 1RHQA 3MCWA 1NBOA 4CF6A 3HCAA 1H4QA 4GX2A 3C1AA 2AI3A 5CEJA 4IKOA 3FAZA 3QYAA 2GBLA 5FLKA 3TOSA 1IWOA 4M0FA 3RIHA 4US2R 3QLVC 1H6BA 5JRZA 4J0EA 3RT1A 2R00C 1ZIOA 3KQWA 2B2NA 3ZWYA 5CX4A 3ZJ4A 2JGFA 2BWJA 4KPUA 2ZSUA 3FE3A 1NVBA 1FMJA 2X8BA 1DXOA 2P4UA 2IYTA 1K3TA 4MQ4A 4DA9A 3QLUC 2ZYAA 1X7ZB 4ZARA 4YB8A 1CUCA 3WIBA 2CLCX 1Q16A 4EGQA 4HH3C 1XGKA 1MVOA 3LVBA 3HY4A 5AXDA 3QXHA 3TFWA 2FP3A 1IY1A 3IKTA 3ODGA 3KD2A 4HZUA 5DIZA 3U80A 1D2GA 5EWJA 2BFAA 4DV4M 3ZJVA 3C6XA 1K08A 4AO7A 4P9NA 1Y5MA 3KP1E 3AP1A 3W4KA 3NDBB 3B78A 4NOKA 5FI0B 1WMBA 4IXTA 1X8XA 2MR6A 4TWIA 2ZTDA 2DFNA 4IBIA 1E9AA 3B48A 5J2UA 2QSUA 4MIEA 4PFKA 4LHSA 3GFBA 3D8LA 1ETUA 2D00A 4YMVA 2R1TB 4RHUA 3SATA 3G0BA 5FO0A 4D1YA 1H3NA 3JAKA 2WDZA 2W2QA 1TTEA 3QWFA 3P9PA 4A26A 1KP2A 2QDKA 2VYND 4GKAA 1P9NA 2D1YA 2XE7A 4GKKB 1JSLA 2IWHA 1POXA 3AL3A 1VXOA 2VRCD 2WE7A 2IOFK 3ROZA 1Y9JA 1ZD4A 4ENTA 2GB4A 3TRKA 1EFDN 1CUGA 1JH8A 3A6DA 2E4ZA 4GI7A 3U7HB 2XMDA 1D2HA 4Q1VA 1JRLA 4V0OA 3ZQ4A 3C3CA 3RTEA 1IY0A 4A03A 5HUJA 2E5LB 4PIVA 3D4PA 2FJPA 4C7JA 3FKJA 3MK6A 3CRNA 4XGRA 2QNBA 1U2SA 3PXXA 3EJWA 2HREA 1NX9A 1F5NA 2Y0EA 4DSTA 3ZU6A 4OJKA 4F4JA 4BZZA 3KFLA 3FHJA 4EHNA 4UAVA 2E4AA 5FBWB 3E2PA 4B3MM 4F2GA 5KINB 3NH9A 2F5PA 3BG5A 4DB4A 4W99A 4GBMA 4U7WA 1T2EA 3VSAA 2NSHA 5DT9A 2R46A 4JEUA 1HLDA 1FYWA 3VZCA 3ZZNA 3EPKA 3PQ8A 1DJOA 3Q5EA 2C88A 1E5QA 4CIBA 2Q3BA 4Y6GB 4CQMD 5KJEA 4ZWNA 2OZEA 3OZCA 1O58A 2UUCB 2TMYA 5BVHA 4S04A 1J0DA 4CL8A 1GRQA 3TZ6A 4F96A 2IZZA 1QKJA 5IKMA 1E5DA 4DCNA 1IN4A 2PXHA 4MR7B 4QBIA 2I4IA 5F1KA 1K92A 2ZAIA 3V9AA 1Q1AA 3CX4A 5DTRA 3RI3A 3ISVA 3O74A 3P9QA 5JEDA 4IIYA 4ABYA 3DDZX 5I4KA 1ZXXA 2B8EA 1WW8A 1HTBA 1Y4UA 2B8NA 3LLSA 3NFYA 5LBTA 4R41A 4DMGA 4Z3KA 3M1IA 1DWPA 4NICA 3UJ7A 4IIDA 3FSJX 3HGQA 3H9UA 4E2YA 4EP1A 2J7KA 3EPHA 1J97A 5DM0A 3P2IA 1DKQA 1G98A 2FR8A 1EM8A 2WWYA 5JZOA 3EIXA 5ITQA 3BILA 2GBLC 5BORA 4BO7A 1WLYA 2YN4A 1NVVQ 2CL7X 5ITTA 3QMWA 4DPLA 5JJBA 4L0MA 1SOUA 1F8XA 2Q45A 4LVUA 2C9ZA 5F77A 4DUYM 4MYRA 4BKUA 4YRMA 3JZMA 5BO5A 5T4HA 2KZUA 4PLVA 1SXJE 1A3CA 3K5PA 2Z1MA 1DGGA 3H05A 1QRSA 1MP0A 4DCTA 1QO9A 5LBUA 3ENQA 3A04A 1IRXA 3TD9A 5HSGA 3DKPA 4QGSA 3H2YA 3PQFA 4G9EA 1IN7A 3OE7A 1NXOA 3FPSA 5JCZA 1N9GA 3G9QA 2QUBA 4B75A 3VA7A 4WKBA 3X2FA 3CG4A 2H5IA 3IAFA 5GP1A 4GOOD 2VRWA 5DBGA 4PONA 4BO6A 1A69A 3BREA 1EVQA 1VHWA 4OFBA 2FWJA 4Y1GA 1Z5BA 3BTSA 4YBRA 5EJ8A 2F43B 5JY1A 5CIQA 4XWYA 4EY5A 1QP0A 5I3CA 2HWJA 1H8HA 3IJ5A 1QAOA 3ZNNA 2NAPA 3U81A 4GITA 1LJUA 2BGUA 3HKBA 3K8YA 3H0KA 2JJ2A 1RI5A 1VA4A 1HL3A 4A82A 5HE9A 2C03A 4X7RA 3IXMA 1F9AA 4O59O 4J3NA 3NVKI 4XR4A 1Y5LA 3GPIA 3AR3A 3HA5A 3DLTA 1QGOA 1DOHA 3GP8A 4DIFA 4FNMA 3AOEA 4R31A 3DV2A 4UHJA 3TNLA 2KBEA 4YAGA 5CP8A 3P20A 1C2YA 3HCEA 2NPFA 4Z7QB 1OLUB 2VWQA 1D1PA 1Z2OX 2RGGA 3PT9A 2JGIA 3DMRA 3RRMA 4OBEA 5TT1A 2HK9A 4Z4EA 2VQ3A 1JKFA 5DZSA 1KIMA 4GPIB 1QKKA 4UDNA 4P38A 4XIIA 4G0PA 3I3SR 1NG1A 3AH8A 2VHEA 5E6SB 3O1IC 4L95C 4GX5A 1FS4A 3B1VA 2XX3A 2GDZA 3NIDB 3A6GA 1Y1PA 4LXTA 1XCOA 2POCA 2I8LA 4X63A 5CA1F 2VKTA 2ZB8A 4BQRA 1F4LA 3D02A 3CEPB 2YL2A 3ZGZA 2P4SA 1TJ4A 4L7QA 5DN6A 1KZ9A 4LY3A 1X1EA 1T1JA 2I9KA 1MOPA 3Q7PA 2AK2A 4Z0TA 1PL0A 2D1FA 4HUQB 5DLEA 1AGNA 4FR2A 1OI3A 2VCHA 4N9QA 3LE8A 3TRHA 4CXMA 3KV1A 3ETDA 4V24A 2DKNA 4LRYA 1U8AA 1J5PA 4QOZC 3I64A 2QROA 2ZTLA 3I2KA 5TPWA 3DE7X 4JLUA 2CWWA 1SKBA 4IVRA 2JD0A 5CVVA 2O01F 1REQA 2JC3A 4WHMA 5BUCA 2A5JA 3GT7A 4DMHA 1TQHA 1FSPA 1EBUA 4QFBA 1NVXQ 3LOPA 4X84A 1EVYA 2IVFA 1Y8AA 1JMYA 2B7CA 5KJ6A 2XECA 1JP7A 1G7TA 4TLCA 3EXIB 2YWBA 2OP1A 4QXMA 2R7KA 1H1TA 2J3DA 4TT8A 3OPQA 3OKCA 2VBFA 2P69A 2C4UA 1KY4A 4OXIA 5KI6A 1LKZA 1ORWA 2FR8C 2M60A 5DNVA 2B34A 3UKJA 3OQNA 1O08A 4YRTA 4RK5A 4CV2A 4NFHA 1XVUA 4XDYA 7MHTA 4RVCA 4QTYA 5CFNA 3IQXA 4PX2A 4LF6B 3BGIA 2HR1A 4CLOB 2XYRA 3KAJA 4ZEOA 2H65A 3KYJB 5T7BA 1WUHS 5KC9A 2OXFA 2ZDGA 3LT1A 3E4RA 2WJIA 3EXEB 4CUZA 4XASA 5JNLA 2AE1A 2MDTA 3SHFA 1WF3A 1OKKA 1AN9A 1MO5A 4JSTA 4DNQA 1DAGA 4UDYX 2DBRA 1Y6QA 1W19A 2VQSA 1GT91 1SR8A 4UM7A 3LPMA 4NAUA 1K8RA 1CEEA 4F5YA 1P1RA 4DQVA 2D7HA 2GCOB 4LGMA 4KEAA 4KK4A 3U31A 3H8VA 5JNWA 4C4SA 3K72B 2XWQA 4DSOA 1U0RA 3VHXB 3C4QA 3THSA 1CRLA 2OZLB 3NWBA 3RSOA 3L41A 4II7A 2D1QA 2ZRPA 2QLJA 3EXAA 2QMZA 4OYYA 1XWIA 5MGBA 3D3EA 2QAGB 4DSNA 3U61B 3PE4A 3HCNA 4RCVA 4N3AA 3CLUD 4JLOA 2CHEA 3BD9A 1OROA 3UC5A 3U16A 3ASVA 4JLBA 4ZN6A 5JBQA 2HRDA 3MLBA 1JECA 3D2LA 4FWHA 2H16A 5DW3A 2YX1A 3VYTB 3ORYA 4JLNA 2Z6UA 1GQQA 3LHDA 2I4MA 2JARA 3QHAA 4WKNA 4GXRA 4OXXA 1I94B 3AOEC 2M9MA 2C1XA 1L5VA 1ORYB 3KU1A 4C4XA 1CV2A 1WQ3A 1P2UA 2LH0A 1W73A 3NYQA 3KDAA 2C96A 3MTGA 4KAFA 4RF5A 4DR3M 1YS2X 1STOA 4NONA 3N58A 1IBRA 4BY9E 4MCAA 5GOTA 5ALRA 1GPWB 2UUAB 5ELMA 1QRRA 2CJWA 5LB4A 3GEPA 1Q6ZA 5A4JA 4ZHQB 4RTLA 2UUBB 4IJMA 3I9JA 3HJUA 1OREA 5CK4A 3UUFA 3D4NA 3JPYA 5FTWA 4HY3A 5B5SA 2B3DA 3E70C 4WURA 3MINB 5LYJA 2FH0A 2OB1A 2BM1A 2WC1A 3C7TA 1GTJ1 1TA0A 3DAPA 2VN8A 1TMGE 2GEBA 2GBCA 3CGGA 4AYWA 1FDWA 3HUFA 3VTAA 2JFHA 2DFTA 2XH9A 3UMRA 3D3JA 2PZEA 3WDLA 3BGDA 4KQ9A 1KZ6A 1OFUX 2RGXA 3KHUA 1EUYA 4DDVA 2IYEA 5C5DA 3O8NA 2OGWA 4CKZA 4TV9A 4GP7A 2H11A 2FWIA 3THWB 5FJIA 4B3HA 3NNNA 5EC8A 4MVJD 2BZSA 3VPHA 3TRJA 1I2MA 4UMFA 2NYRA 1A9YA 5SZIA 2HLNA 5ECYA 2VLIA 2V55B 3R0JA 3QFCA 2KQUA 3GL9A 3RFUA 2V1XA 5HF8A 4FDVA 1P62B 1IYZA 2P4HX 3ZK9A 5FP0A 2VZEA 4LW8A 3BTUA 4L6V6 3L82B 3MUFA 1OASA 3LXUX 1GFWA 3J81k 4RVDA 2MSCB 5JD5A 3LCCA 3UKOA 2D74A 1SCUA 4QL3A 2FE4A 1RI1A 4G0ZA 2FEWB 1XJ5A 1RLTA 1F5SA 3HCOA 3R0VA 2YJ3A 4PAGA 1Z0KA 4PFSA 1ODIA 4RTRA 3OY7A 2KDLA 1F6DA 3U56A 4JXKA 2JZ1A 4NYIQ 2P65A 3VO8A 5B6PA 1Z7WA 4BVGA 4RLSA 4EJ6A 6CHYA 1QHYA 2PR2A 3WK8A 1KP3A 3GBPA 3KJNA 1N7GA 1W5EA 2NYUA 5H70A 4DDKA 1BWRA 3UN1A 3OIYA 4AS1A 1ADCA 4ZJUA 1NURA 1PS0A 4Q24A 1JTEA 4CU2A 3T61A 3AU9A 3WQQA 4RK6A 4EG7A 3WLMA 5FCDA 1Y3HA 2C7PA 3BB4A 2O52A 4ARCA 1ISGA 1DRJA 3GA7A 4UM9B 2P11A 2RGWA 4XVRA 4ZVQA 5FRDA 4RVNA 3QGMA 2PD4A 3OPMA 2PKRA 2X4IA 3A2NA 1NE2A 1YUNA 4ZDKA 3R6GA 4REOA 1R16A 4CV3A 1O94D 3AVPA 4HN4B 1FEZA 3K0EA 1KNQA 4TMVA 2G36A 5IANA 4DYHA 3U7GA 3A9UA 3CVXA 4BS9A 1IQUA 3U1BA 4ZI5A 3B5EA 2C95A 3HWX1 3MD9A 3I30X 4BRSA 1JXQA 1Q0RA 1R37A 3GLQA 3ZHSA 2IYUA 5TVKA 3CW2A 4QOIA 2AD5A 4LPSA 1H3FA 4YTEA 2Q5LA 2E4VA 4JXZA 4B8YA 1TJ5A 3JD1A 3ND6A 2ESRA 4C6TB 1ZOLA 1L0BA 4KPGA 1MOZA 3W79A 1PL6A 1KK1A 2Y9MB 3GUUA 4L4ZA 1JEQB 2KZSA 2HMSA 4OHYA 3KOYA 3Q6NA 1R0BA 1NZFA 3RVQA 3AJRA 1RXSA 2ZQZA 1IHOA 3AZQA 3MBIA 1TC1A 5AJZA 3QVMA 3V6MA 1O2DA 1JE0A 1J2EA 3RRYA 4LZAA 1BVHA 4F9TA 3HZRA 2PMBA 4CWAA 1QQBA 1QLWA 4AJHA 3Q7SA 1GLNA 3UGJA 4E4TA 3DFFA 4FCVA 1QSGA 1SHTX 1MPXA 5DB4A 4PZZA 3WA7A 4KPUB 1E4EA 3UY4A 1RLJA 1Z35A 2X0JA 2QV7A 4EX7A 3ZEIA 4MS1B 2OVBA 4EI8A 2QPAA 3RRJA 1FTNA 4MCJA 1EESA 3CH4B 3WX0A 3AOGA 3UMMA 5J4LA 5CTJA 5BWNA 1QYXA 2FUNB 3FMGA 2RHJA 2VH5R 4ZQHA 2P3OA 3IQHX 4WXEA 4FVTA 3T12A 3K2BA 2IPLA 4E12A 1IUPA 3CUSA 2OZKA 1BXRA 5JZBA 5DNAA 2ADFA 1BKYA 2JY6B 1U0EA 2H1FA 4WZZA 4UU7A 5GGXA 2JGDA 4WXRA 2AQ8A 2RHRA 1WZ2A 2GJ4A 2O3RA 3PDJA 2QPTA 2XZOA 3S68A 3TLZA 1ISFA 3ZV5A 4WLVA 3EIEA 2ECQA 4JC5A 2ZUTA 1SZPA 1Z5PA 1IEQA 3JAKB 1ZD5A 5K2MA 1I2ZA 3PTLA 2GLUA 1TPYA 3KVWA 4R83A 2P0EA 3RIYA 2E0IA 3SYNA 3CO0S 3T0IA 1OBHA 2P6NA 4YR7A 1SUIA 1Y82A 1XPOA 2AB0A 2Q1WA 4YDHB 4IHKA 2H1SA 5B1IA 1YR6A 4LJ8A 1CWUA 2P2ZA 4AZTA 3IDAA 1M6WA 1PAUA 4LYFA 4I1IA 3ZGXA 3ST7A 2AQHA 1SHZA 3GLGA 1K2WA 5JS6A 3DT9A 4EK9A 5K09A 4KR9A 1S1MA 4AL4A 1N6KA 2IS6A 2GVDC 3JQCA 4LV5B 5L3RA 1LNZA 3D8TA 1GSHA 4TS9A 4XYEA 2CRUA 1NLZA 1IY2A 5JJIA 2CEAA 3LC0A 1OHHA 3GOHA 4L9AA 1QUTA 2R6GA 1Z0UA 2ZRFA 1PS8A 2PJRA 1AXEA 3P0JA 3TLJA 1KH2A 3DS8A 4NCXA 2HU5A 2XOKA 4IHJF 2ZR8A 2GBIA 2XYHA 1E4OA 1T5OA 1RYYA 4ROSA 3NETA 1N36B 4LVNA 4JQZA 2BM8A 2GKGA 1N34M 1G4UR 3EGXB 1WP9A 3K6KA 4LIPD 3P2OA 2LPMA 2VXOA 1OAKA 5B1HA 4J0DA 5BVHB 5EJ6A 4OU7A 1ZUIA 3E61A 1EFUA 3HY3A 4EHFA 1BMDA 4BLQA 2ZM6M 4OP3A 3RSFA 1JNXX 1R15A 5LN1A 4KIUA 4A1FA 4ZU6X 5IJ0A 3HMQA 5AW7A 3KB6A 2A88A 3SC6A 2WI8A 2GXUA 4C03A 1GG5A 2H51A 5C8YF 4OSEA 2O23A 2AZ4A 3E0XA 1TQ6A 5K05A 4JX8A 1JTVA 1BG6A 1SKQA 1PSWA 3FSEA 5THQA 2HZ7A 3DKKA 1LFAA 1YJ8A 4GH9A 1Q0SA 4CDNA 5EAIA 5BPVA 3RKUA 4NU5A 2O8CB 5T4BA 4MIKA 4OHBA 3M4ZA 1KDVA 3D6FA 1KVUA 3F2IA 5KWSA 1XMSA 5FQNA 3EZ7A 3L8MA 3RROA 4DG9A 1SUAA 4ZRNA 1LDNA 5BRAA 5FUXA 3AIKA 2F1KA 1MT3A 1AS3A 3G68A 1UZMA 2M1ZA 4Q4HA 3UW1A 2CSXA 1S3IA 3FDIA 1B6RA 2HZBA 1JB9A 2VDRB 2QVGA 2WKSA 3QKRA 3I5UA 1B1AA 4L4SA 1R7RA 3VU9A 3CZCA 3AR5A 3DOCA 2X8AA 4PLTA 2OLKA 4XA8A 4PXSA 1Z73A 4RJLA 3EXG2 1ZSNA 1SUEA 1TVEA 3PLNA 1KMCA 4LXHA 4KIWA 4UEWA 1JBQA 5KO2A 1PVVA 2PEZA 1FOEB 2H4YA 4GZ3A 3HBAA 1L4FA 4LBWA 5SY6A 1DQZA 5LWQA 2GTIA 2PWPA 3A6ZA 1T13A 1W47A 2Y20A 4Z7JA 2B3TA 1JJBA 4BNMA 4RVSA 3T38A 2BDTA 1CHDA 2FWMX 3AO0B 3K8OE 1P9RA 2F59A 4NAVA 4I1SA 4JUIA 1TVKA 4YRSA 1WX1A 1JVBA 4ML3A 2JLRA 4PXAA 4K9QA 4LN1A 5I7VA 2YYSA 4AYTA 2EFYA 1P44A 3WL7A 1Z5VA 4U2KA 3SAUA 4HCJA 3L8HA 2HMYB 4HYTA 2VAMA 3BA1A 1Q77A 4Y8VA 1DZIA 1VIDA 3GLIA 1L5QA 3R20A 1LFDB 1EDBA 5CMLA 3DZ8A 2VJDA 1XELA 3TWOA 3C6KA 3PJFA 1JFVA 1S2MA 2GWRA 2IUFA 2D2EA 4FYPA 1YIDA 2HRZA 1TW3A 1CF9A 1EVEA 3DMTA 1Y0BA 5DI9A 16PKA 3CLTC 2CNWA 5INTA 2HPZA 2Q3EA 1UQRA 3AV0B 1AB6A 1E3SA 4N8EA 4KLRA 2ET6A 2ZUBA 4LZOA 4ND1A 5HKKA 1AURA 1BXGA 3L1UA 3UAWA 3S7ZA 3JSXA 3J7BA 1GOTA 1E2LA 2VQDA 5AK6A 1A7UA 4PCVA 3JRXA 5CNIA 4QD3A 5U4QA 3PXBA 3AVTA 3E9DA 2P62A 1YQQA 3OX3A 4U5QA 2J3KA 1K7SN 1N5RA 3LH5A 3W5AA 2C9BA