3FYCA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
AAQCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAKEGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable dimethyladenosine transferase
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 90
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fycA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fycA01
4AUKA 3HM2A 3GO4A 1Z3CA 2GPYA 2HMYB 3OPNA 5E8JA 1N7IA 4DKJA 2V74B 2GB4A 5ICEA 2YVLA 3ID6C 4U7PB 2P3QA 1FP2A 3UJ7A 1XDSA 4V0QA 4ER3A 4RTPA 1SUSA 2QY6A 2C7PA 1NV8A 1KYZA 5BP7A 3EVFA 3G5TA 2OO3A 4IV8A 3LDUA 2CKDA 4MHTA 3C3PA 2I7CA 4X63A 1QAOA 5E9JA 1FJXA 1EG2A 3HCAA 3FUUA 3HTXA 3GXOA 1N2XA 2YXDA 3FPHA 4IWNA 5DX0A 1G6Q1 3NJRA 5EKUA 1I1NA 1B42A 1YUBA 3HNRA 4DA4A 1EAMA 2EG5A 2FHPA 4M7RA 3GJYA 2UYCA 3FYCA 3T0IA 1UFKA 1I9GA 1Y8CA 2VDVE 3KPJA 5D1HA 5JUWA 1MJFA 4FZVA 4F84A 1I4WA 4Z2YA 2CMHA 4RVFA 1ZHFA 3LX6A 4CXMA 3LBFA 1WY7A 5EOVA 2OY0A 4RVGA 3DTNA 3CJTA 3I9FA 5EC8A 5HIJA 1NKVA 2JH9A 3TMAA 5BW5A 7MHTA 3LKZA 4PYNA 5CVJA 4AZSA 2NP7A 1XCLA 1KP9A 1XXLA 3MB5A 3OU2A 3FUXA 3AXSA 3B3GA 1RJGA 2BR5A 5GP1A 4CTJA 3FUTA 2HV9A 1KIAA 2G72A 2NNWB 3MTEA 2AOUA 1JG1A 3HCDA 5T64A 2Z6QA 1YFLA 3AJDA 4GC9A 1P91A 4HH4A 4V0RA 3SSOA 2AOTB 2A14A 2P1DA 3HEMA 3T7SA 2ZWAA 1NW3A 5E2BA 4E2WA 3I5UA 4E2XA 3GIWA 3I53A 2JJQA 1M6EX 3P9KA 3EVGA 1SVUA 2DPMA 2PX4A 4HTFB 3CJRA 5EQJB 4NECA 5EZQA 3C6KA 4R05A 4RTSA 3M70A 2KW5A 2GS9A 3TLJA 3EMDA 1INLA 5ICGA 3KQVA 3HCFA 2YR0A 3MCTA 2YUIA 4QTTB 5E1DA 5DX8A 2IGTA 2K4MA 4P7GA 4ZTBA 1QYRA 4RTMA 2F8LA 3DLIA 3DXZA 1P39A 3EGEA 3M6VA 3P97A 1JSXA 4RVDA 4C06A 4OX9Y 3U81A 5K09A 3CKKA 5E1BA 3Q87B 4FT2A 5T67A 3E8SA 1JTFA 4HRAA 1X1DA 1RI2A 3SMQA 2PLWA 4YUXA 2H1RA 1JG4A 2AZTA 3HVJA 1F3LA 1WZNA 1V39A 3HP7A 1AQIA 3PVCA 2NYUA 4HC4A 4OBWA 3PLAE 1TPYA 3MTIA 1P1CA 3TKYA 3BWBA 4CKCA 3C6MA 3G8BA 3KR0A 5DSXA 5E1MA 3DOUA 4BLUA 4X61A 2P7IA 1WXXA 5ICCA 2AN5A 3CVOA 3LSTA 3EMBA 5FULA 3KPUA 5D1NA 3UFBA 3B3JA 4K6MA 2ZIFA 4GQBA 1P1BA 5DM4A 1RI3A 5DLYA 4B17A 3LKDA 5E1OA 1VPTA 2ZFUA 4PWYA 3EVEA 3BGIA 3P9CA 3A7EA 5EVJA 5LQUA 2C7OA 5FUBA 1R8YA 1VLMA 5ICFA 3OZSA 4PYOA 4X1OA 2G8NA 3EVDA 5HZMA 3DR5A 5K0LA 4QPPA 5KQSA 4LG1A 3G8AA 3A27A 5CUQA 5KS2A 2R3SA 4KDCA 3TRKA 3GWZA 3OZRA 4XUEA 4EKGA 2E5WA 3B7PA 5DM2A 1F38A 3ELUA 2XBMA 3PX3A 3OCJA 5KQRA 5CM2Z 2PV0A 2G1PA 1JG2A 2PX8A 2ZWVA 5DX1A 2XVAA 3R24A 3NMUF 4CKEA 2IH4A 2P8JA 1O9HA 4C07A 1G55A 2EFJA 4PYKA 5DM0A 5C1IA 3T7RA 1EIZA 4AX8A 5EMJA 5MHTA 4RTOA 2O57A 3G2QA 4DCGA 3G89A 2NXNA 2PXAA 2I62A 3FUWA 2BH2A 1AQJA 2YX1A 3LCVB 2ZZMA 3CBGA 3MHTA 5EPEA 2GAFA 2JHCA 4E33A 3FTDA 4YV1A 2IPXA 3CCFA 5K0EA 5LQNA 1QZZA 3GGDA 3EEOA 3ELDA 3JWJA 3SGLA 2G70A 5EHIA 1O9GA 1JSZA 3GU3A 3VSEA 5DXJA 1R6AA 3DP7A 3Q7EA 4PONA 2VZ9A 3A4TA 2GA9A 2PSSA 2Y1XA 2Q41A 3OU6A 4BP3A 2HNKA 3M4XA 2UZ4A 3AY0A 4JXJA 1NE2A 1QAQA 4KVZA 3X0DA 5K0FA 5JR3A 3NW9A 5KYGA 4EMSA 1NW5A 5HILA 4WVLA 3P8ZA 4R6XA 2C7QA 1X1CA 2FK7A 3V97A 1G60A 1HNNA 1X19A 3KQTA 4PCAA 1EJ6A 4CTKA 4RTLA 3LECA 4MQ4A 2H11A 4C03A 1SG9A 2PXCA 5FWDA 5EIWA 1ORHA 2IP2A 2JH8A 3EVAA 3G88A 1VP9A 3PFHA 1UIRA 4EVIA 4RTRA 3ELYA 5GIPE 4PGGA 3NDJA 3G5LA 4DCMA 3FYDA 4KIFA 5FWAA 2QRVA 1NW6A 2EJTA 2B9EA 1O54A 2YQZA 3AXTA 3LCCA 4FSDA 2HR1A 1WXWA 1L3IA 1L3CA 5IH3A 5FHQA 3SR4A 3SXJA 3KR9A 4PYQA 5K0CA 1G8AA 2BR4A 4CKBA 5LQRA 5K0GA 4P58A 2ZIEA 3R0QA 3GRRA 4R8SA 4E30A 1MHTA 2ZZNA 2EX4A 1FPQA 3KR1A 3TQSA 3S68A 2Z6AA 4GOOD 3F4KA 10MHA 4XUDA 3PTAA 3O31A 3R6TA 3TM5A 3UA4A 4DZRA 4GOLD 3GRZA 2BM9A 5HIMA 2JHPA 5CVEA 5CCXA 3RW9A 3E05A 2ZZKA 2IBTA 3NTVA 3B89A 3DMGA 3NVMB 2AOXA 4G56A 1SUIA 3C3YA 3DULA 2ZBQA 3M6WA 3K6RA 1EQAA 3KKZA 1R00A 2AS0A 3I58A 5EEHA 2ZLBA 1RJEA 5GM2A 5DRYA 3P2KA 2DULA 2O06A 4PIMA 2PT9A 3HA3A 4BP1A 3EVCA 3I64A 3JWIA 3SX0A 2P3LA 5FQOA 4P7KA 3BZBA 1BC5A 5KVAA 3KQWA 4C4AA 4RTJA 3UJ6A 5FTWA 2ZCJA 3B5IA 3RIEA 4GOND 4XUCA 3WSTA 4OA5A 1WG8A 3P2IA 1N7JA 5T6BA 1VBFA 3DLCA 1RI5A 4KW7A 3FTCA 3ER9A 3FRIA 3GCZA 3KPWA 1NV9A 4QDKA 8MHTA 4LWOA 3A25A 4KWCA 5DTRA 4YUZA 1KHHA 4E31A 5BW4A 1KPIA 4YMGA 5EZSA 1RI1A 2N47A 3UA3A 1HMYA 1TW2A 4R6WA 4Y30A 1KR5A 2OBFA 1ZGAA 3BKXA 2B3TA 3HVHA 3VC1A 2UYHA 2JG3A 1XTPA 1M6YA 3PB3A 4PNEA 3D2LA 1VL5A 3PT9A 4GEKA 4WXHA 1EJ0A 3UJAA 3LCUA 4QVKA 1NW8A 2HTEA 5GOZA 5EMMA 1NW7A 2ZW9A 3EVBA 3CC8A 3MCZA 3KQPA 3NVKI 3EEYA 4RV9A 5IKMA 4HGZA 5EGSA 2ZIGA 4O29A 3KQQA 1XDZA 1BOOA 3LDGA 1PJZA 1H1DA 4KRGA 4L7VA 2VS1A 2PWYA 4AZVA 1L1EA 4YV2A 4E32A 2IFTA 3KR2A 4FSXA 4PYLA 3GRYA 3ORHA 5GM1A 5U4XA 3BXOA 5HIIA 4RTNA 5GIOE 2ZBPA 5FADA 3QOWA 4GOMD 2IIPA 2AOTA 2P35A 1DL5A 5EIFA 5FA5A 3UWPA 2ONYA 4ISCA 4PIPA 4OQDA 3BUSA 1RJFA 3NWBA 2AOWA 4P7FA 5P8WA 2QYOA 3TKAA 2AVDA 3OE4A 4LWPA 5ERGB 4YUWA 3E7PA 4HTFA 1X1BA 2PJDA 2ESRA 1PRYA 2ZVJA 5DM1A 5DRTA 4YUVA 2Z6UA 3RODA 3G2MA 4RX1A 2VP3A 3SVZA 3FUVA 3GDHA 4RVHA 4X60A 1VQ1A 2R6ZA 2O05A 3ME5A 3QV2A 5C9ZA 2FYTA 2ONZA 1TW3A 1R74A 2OKCA 3JWGA 3KU1A 1XJ5A 5EMKA 5GWXA 3VC2A 4F85A 1D2CA 5K05A 3JWHA 3LHDA 4RTKA 3G2PA 5FQNA 1XCJA 2AN3A 3EGVA 2JHAA 4P7JA 2IH5A 5EKXA 3BWMA 4CWAA 5LQCA 3AWIA 3V8VA 3IV6A 5DT2A 1VE3A 2NXCA 4FGZA 3HA5A 4QPNA 4ER0A 4ATNA 4PGHA 5HIKA 1IM8A 3CGGA 4PYMA 3T7TA 1M0EA 2G71A 2FPOA 3A7DA 2HWKA 3HVKA 1VIDA 1BHJA 2UYQA 3FPJA 3OE5A 3PFGA 3PS9A 1YZHA 3QOXA 2IBSA 3KQSA 3M33A 4DM3A 4ER6A 2Y1WA 3DMFA 4KIGA 1FP1D 4FS8A 1D2HA 4X41A 1YZ3A 2P7HA 4Y2HA 3ELWA 5EHGA 5EMLA 4QVGA 3BGVA 1NT2A 5CVDA 1JQEA 3NWEA 4BLWA 3SSNA 5CCBA 4M36A 4F86A 4FP9A 3UJ9A 3DH0A 3OZTA 2ZULA 4YV0A 1KYWA 3G2OA 4MTLA 1ORIA 1SKMA 1XDUA 3NDIA 5E9WA 2XVMA 4ER7A 3P71T 3O7WA 1AV6A 4M38A 5LSAA 4PYIA 5M5BA 4GBED 3LPMA 2C7RA 3FPEA 2VDUE 2WA2A 1Q0TA 3HCBA 3HCEA 4GF5A 4E2ZA 2WA1A 2PX2A 1FBNA 3R9XB 2QM3A 3LGAA 4RWZA 2ORED 4DF3A 2IH2A 4C05A 1U2ZA 3UBTA 2LD4A 4A6DA 3KQYA 2QE6A 2YTZA 1ZKDA 5K0NA 3IYLW 2FK8A 3SM3A 4UOEA 3TPZA 4PINA 3BWYA 3DUWA 2AN4A 5CVVA 4A6EA 5K8VA 1YF3A 3DXYA 4R8RA 2OXTA 5DWQA 1Q0SA 3DXXA 2PY6A 4OA8A 5LQAA 3TR6A 1KPHA 4AZWA 5LQKA 2P40A 5HFJA 1R8XA 2CWWA 4YUYA 3EVZA 4DMGA 4C04A 3M6XA 5K0JA 1KPGA 4GC5A 2PXXA 4U7TB 5DSTA 1VP3A 4OBXA 1L9KA 3H2BA 1JG3A 2EJUA 3IEIA 3THRA 1OR8A 3LDFA 5H02A 5K01A 2OZVA 4PYJA 1WS6A 3P9NA 3FPGA 5EG5A 1RI4A 5HOQA 3BKWA 2PBFA 3MAGA 5DXAA 4IKPA 5DPMA 4RSRA 3P2EA 5E2AA 5FA8A 4RYLA 2PGXA 4RTQA 2CL5A 2B78A 2VDWA 4KDRA 3EPPA 4QDJA 5C0OE 5K0BA 3R3HA 1DUSA 2IDJA 3M6UA 1QAMA 3ERCA 5CD1A 2PT6A 1IXKA 2NP6A 3REOA 2GLUA 1R18A 5FHRA 4EKIA 4E2YA 1L3BA 3HVIA 1UWVA 3L8DA 3FTFA 3TM4A 2P3OA 2V7EA 5DTMA 5FCDA 1JQ3A 2BZGA 2XYVA 3KQOA 5E9QA 3OFJA 2XYRA 5GINE 4HGYA 2P41A 1ZGJA 2YXEA 5K03A 1D2GA 3GNLA 3OU7A 3TOSA 2I9KA 4IV0A 5E8RA 5HEKA 1JTEA 2PVCA 3HA7A 3BT7A 4FT4A 4H0NA 1JQDA 3LL7A 3OFKA 1IY9A 2OPBA 2ZBRA 2ERCA 3PX2A 3BWCA 3KQMA 5F2OA 4C08A 4MIKA 5CIYA 4HSGA 3ER8A 2NXJA 3ANXA 3CJQA 3GRUA 4E70A 3UZUA 3EGIA 1KXZA 1RJDA 3THSA 5BXYA 2OB1A 3KHKA 4QQKA 3UJ8A 2WK1A 4MWZA 3MGGA 2B2CA 5DTQA 3SSMA 2AVNA 2FRXA 2AR0A 3MERA 4PCLA 3TFWA 2PX5A 4OQEA 4BLVA 9MHTA 3C0KA 3LBYA 1YB2A 3E23A 4EQZA 2I6GA 1XVAA 2B25A 2FCAA 3UJCA 4M37A 4DQ0A 2QRVB 1BKYA 2UYOA 3A26A 1G8SA 2YXLA 3FPFA 2BM8A 3IHTA 3UJDA 4GUAA 4BY9E 2AOUB 4LECA 1JR4A 2NXEA 3DMHA 5F2KA 4YMHA 5LR6A 1ZQ9A 1AF7A 4POOA 1SQGA 1YFJA 2GH1A 3FRHA 1NBHA 2OB2A 3P9IA 5CVUA 3VYWA 2AOVA 4FR0A 2ADMA 3FZGA 3FTEA 4ER5A 5F2NA 4QQNA 2BR3A 3GRVA 4HG2A 1DCTA 3KPYA 4AZTA 3HCCA 2ZTHA 1ZG3A 4QTUB 2O0LA 3O4FA 2O07A 3MQ2A 3G7UA 2OYRA 5G02A 2PKWA 1NBIA 2ZSUA 3BGDA 4EK9A 2CMGA 2H00A 3KPVA 5B1SA 1SQFA 5EEGA 4XCXA 1X1AA 2XYQA 3B3FA 1T43A 5LQJA 3K0BA 2IDKA 1G38A 2PWPA 3UJBA 1QANA
chains in the Genus database with same CATH superfamily
3ITNA 4TMTA 5ALSA 3T5MA 3E1GA 1W5SA 4D26A 1Z22A 1VHDA 2ACWA 1L5OA 5BWNA 3P20A 5HRAA 5ALLA 5I7OA 3BIWA 5BSVA 2XXAB 1IZ9A 5J1TB 3COWA 3BA1A 2VPYA 3ILVA 1H65A 5K0SA 4AJIA 4DCVA 4G4NA 3MRXA 4PPNA 2MYTA 1H1TA 3CNLA 3B3GA 3JX9A 1Y6FA 5JSHA 3PEWA 4OUKX 5DBFA 3ZTYA 1QGOA 3HEMA 3GZNB 2FB9A 3ADOA 4J7CA 1EVIA 1QH9A 3WL4A 5JMWA 1MAAA 5A5GA 2Z95A 3IOCA 5JSUA 1PWHA 2AXQA 3LW7A 3OTIA 2F5QA 3TB4A 2ACVA 5EA2A 3K16A 5EIAA 4KPFC 3W77A 4LRSA 1KEUA 3CEPB 2MTBA 3FOCA 3R5KA 5DM4A 4F92B 5DFLA 3GCXA 2G8NA 3L8CA 3T5GA 1T6XA 3DKKA 3O8DA 1EXVA 2AWNA 1OREA 5MN5A 4O8ZA 5ADWA 2IYNA 2OHIA 5TSDA 1NYRA 3ANTA 4FMDB 3H1PA 5SYAA 4WJZA 5KYYA 4IFTA 4QBIA 1X2EA 3MOIA 2PNJA 3FI9A 2NW6A 2AR9A 3Q7EA 1GQSA 4TQAA 4B6EA 3SZ3A 1CP3A 3FDIA 1TRHA 3HKEB 4M0CA 3PNKA 3IUJA 1ZSVA 2QLTA 4KR9A 5CYGA 2GASA 1GNTA 5LB4A 1L1QA 2CJWB 4LRTB 3VK8A 3JQ9A 5FIUA 4REMA 4EHKA 1SC4A 2ZLBA 4OSOA 3PXUA 2OC9A 4ZOCA 4PLZA 5G1NA 1T25A 5D6NA 1Y4UA 2VYND 3Q10A 1F0PA 3MRTA 2QYTA 3VR5A 2FMKA 2HRRA 3ZIDA 3HACA 2NUAB 2R11A 1XWFA 3EVBA 3QYFA 3LDGA 2UUAB 3LZ6A 2CJXA 2AC2A 1GN8A 4B3MB 3H3XA 2DP4E 3ZX5A 4NHEA 1KZGB 5U4QA 1GVHA 3RODA 3U13A 5DYTA 4IG4A 4J1QA 4PGFA 1AUPA 3TRFA 1FF9A 1P5JA 3LVRE 3BRSA 3WMGA 2XTMA 3B6ZA 3AI3A 1A98A 5BOVA 4G1MB 1UKCA 3P9ZA 2GARA 4DS3A 4YI5A 1MR3F 5LWHA 4P17A 1PFGA 1Z07A 1UEIA 1H8HA 2OQRA 4G5OA 1GNPA 1J8FA 3DH0A 2F5SA 4KXXA 3MAJA 2J5RA 4FX5A 4HGRA 5IDWA 1LPPA 3F74A 3G6KA 4ZO9A 1A2KC 2XB4A 2OZLA 3WYCA 4BNMA 2NZXA 3WJ1A 1UJCA 2ABWA 1ST3A 1TEZA 3B1YA 1G71A 4RV5A 1TEXA 5A4IS 1BYUA 3PDHA 4CGZA 4TXJA 2GFIA 1MHPA 5K6TA 2EFGA 2OSVA 1HE2A 3KWJA 4HXYA 1OPXA 4Y9DA 4Q21A 4WZAE 3QUSA 4S3MA 2HD4A 2IUYA 4KE7A 1X8JA 4G5YA 1JI0A 5COAA 4ZIRB 2GESA 1GUFA 5TVGA 3TNLA 4PCZA 3DMTC 1KFEB 5DOVA 5CCEA 1YONA 2C5LA 4D82A 5AMXA 4ZV4A 1DRWA 5CDUA 1U9JA 3V8MA 4O4LB 3JYNA 4J16A 4G1VA 5HA5A 3IJEB 3K96A 2QVGA 3C3JA 3HUEA 2C7VA 3AVOA 3RGGA 4MPJA 1SUSA 1Y1SA 4BLQA 5E9JA 1U2GA 4BU1A 4E94A 5I8PA 1PZHA 3W9SA 3R5TA 2BHSA 5DGHA 1DAEA 3KS4A 3D4LA 4HFNA 5IBCA 3GJYA 3A9WA 2CMKA 3RT9A 1EFPB 2FKNA 1LB1B 3OIFA 3NDBB 4ZA2A 2COEA 1XD2A 3E5RA 1C4KA 4MRMB 3OZWA 3HFGA 3I2KA 2VNAA 5E6JA 2NYRA 3AI2A 1FU8A 3CXUA 3S2YA 3UT5B 1UDCA 1DJPA 1N1GA 4FQ8A 3D0KA 1UPXA 2YR0A 4GYYA 4OP2A 2RI0A 4X71A 2OHOA 3W06A 2JEZA 2ODNA 1BDIA 1X86B 4DW8A 4BP9A 3DDCA 2IU3A 2LVNC 3EXHB 1DDOA 3M89A 1T0PA 4R69A 3WKCA 1Z4MA 1D07A 1TMYA 5ALDA 3THXB 4ZCLA 3OLQA 3QF7A 4MCIA 2Q5IA 1X3SA 4UBKA 5IC4A 4MMZB 3RYTC 1P5FA 1IEQA 3DDZX 2YV3A 1OJLA 1IHXA 3BK2A 3KL4A 3FHJA 4FBGA 2PX8A 3QOYA 1AK9A 3IVXA 5HQ3A 4CQMA 3UCFA 2YX1A 4YAKA 3K0EA 1OA1A 2RJNA 3AFGA 3FOWA 4EF5A 2WG1A 4C4YA 4P7BA 4GGMX 1K3UB 5KYWB 2H4ZA 2AJ8A 4PXYA 4MKFA 1NQTA 2JAPA 1ZWKA 5IASA 3KYJB 1OH8A 1GM5A 1FFSA 1CJUC 4RMIA 1YRYE 3H65A 1ZJZA 4D80A 2ZSBA 5C2JB 2ZSFA 4CKBA 2QZ9A 4FR2A 1PTJA 3RIYA 5CCXA 1HMPA 4YLYA 3EARA 4PZUA 2PGAA 2REBA 3WGIA 2HPVA 2OZEA 1J0BA 2NTJA 3EZFA 1WBDA 2AN1A 5CEJA 4TPKA 1EPUA 3UMBA 1D0IA 1QWOA 3OIWA 4XUCA 3GCZA 5FTMA 4YCBA 1KEEB 4YRQA 3BE4A 3QKSB 4KCGA 3ZWPA 3PPVA 4EUEA 1M5RA 3OM9A 4S1OA 4C76A 1N9GA 8ATCA 1HEUA 3SS8A 4N5MA 5EP4A 2VHZA 3N2NA 3F8TA 3EMVA 1NVVQ 3PVZA 2WR8A 2GFQA 1AE1A 1I8TA 4RU1A 4R6WA 3NBZC 2HMVA 3F9IA 3W5VA 1QTQA 2XQJA 2AFIA 3ZKWA 4KPYA 4MYTA 1P9NA 4YV0A 4W1QA 4YP6A 3E3NA 1OV6A 3NETA 4NZPA 1R0RE 2V54A 4Y7CA 3TR6A 1PE0A 1PV4A 2XB2A 1QCDA 3IA2A 4DZTA 3ZVKA 4UUPA 4RMGA 2HN9A 4MXDA 3S3TA 4I50F 5C32A 3NANA 2C9YA 3WK4A 3JD2A 2PT6A 5DW3A 5CFNA 2KS6A 1UWVA 3TM4A 4ERNA 1ADBA 2XDWA 1GVNB 5IJ0B 2CE2X 2HRBA 2RAFA 1XQ9A 5I3CA 2FRXA 2VP4A 3KOYE 3PA6A 1N0UA 1P1FA 1YFKA 4EZBA 3C1OA 2D0PB 4H2DA 2UUAM 1NYQA 1ZH8A 1ZOIA 3C48A 4D98A 2ORVA 4KE9A 5GJWC 4B3MM 1W4ZA 3MQ2A 1QOZA 5KIAA 1DOZA 2FR0A 2XE6A 1UF9A 2OCDA 2F9LA 3CKYA 2D5IA 2J5YA 2WFLA 2PDAA 3ZCRA 3KYCA 2VTKA 1WQ1R 3VR5D 5C8YF 3HCAA 3AYXB 3L6RA 3HNRA 3T0IA 5BO5A 3VR1A 1IBKB 3JARA 1W88B 4QOEA 4BNNA 4TT8A 1XJQA 4Z3DA 3FI0A 3SQLA 5AXDA 3B13B 2TMDA 1G8HA 1F2VA 3L6BA 3KT3A 4JR0A 2PBZA 5AK6A 5EQFA 3DZIA 4C06A 2J4DA 4EARA 3V8PA 1I6MA 4R40A 5LP6F 1W8IA 2IHJA 5MDHA 1ICEA 3FFWA 1FUUA 4W7SA 3MRSA 2VAPA 4QXAA 4L8VA 3G8BA 3VMFA 4AMVA 1GKIA 2NTYC 1XQVA 4MW7A 3IMCA 2F3RA 4IHJA 3UAWA 4OXRA 5E4TA 3OURA 3WLFA 3L7DA 4ENQA 2F5OA 4P1ZA 3G8AA 3ANYB 4AXXA 1A7AA 3TRKA 3NHMA 4RFLA 2WG0A 5HVNA 1W5BA 1U0TA 2GPNA 3IMEA 1JL3A 1AQJA 4GIBA 1K97A 4Z49A 1C3VA 4H59A 5AQEA 1QDUA 2BLNA 2J0UB 4DR2B 2GA9A 5TIIA 2IXEA 3I6IA 3HPRA 1ULUA 2VWHA 5ITZB 2WAMA 5F9MA 2IWHA 3IO3A 5T6MA 1OMOA 1OKKA 2EBUA 4J8PA 2W4QA 4GOLD 1H2BA 2VHVA 4MH0E 2JLZA 3ZZNA 2VHYA 2VR1A 4DT1B 1M2JA 4ZD6A 1EDBA 1IDOA 1M7GA 2VCHA 1I4LD 3IR7A 1UBUS 1GUDA 4YJGB 4UDOA 3V33A 4JLUA 5GZ1A 5DCLA 4BTEA 1C30A 1KSHA 4JR1A 1T9CA 4U9HS 1TM4E 1U0SY 1I5OA 3SC2B 2D00A 2HADA 3H7AA 1ONBA 3WLOA 2BRUC 2QIPA 2JCVA 4ALIA 3DFUA 4RQAA 3E3LA 2JCSA 1XQWA 1BTOA 2I7XA 4C2BA 1ZPDA 1LW7A 1Y7LA 1MZPA 5ERGB 3OICA 2ZETA 3F3KA 3DHYA 3QMPA 4MW2A 2C61A 4X92A 1E0AA 3ABOB 4BO1A 4NE2A 4O0MA 3LHIA 3SKYA 3MG9A 5CR9A 1V96A 4MVYA 3CF4A 3TUIC 4F3RA 4KPUA 4MUHA 4BVLA 3HJRA 4K9QA 2Q4DA 4KO1S 5UKDA 1V9CA 4QIHA 4KYIB 4ZT4A 3OZTA 4QLBA 3QLJA 3ITEA 4TZKA 3VPGA 2WJWA 5L95A 4GMQA 4NZYA 1BJKA 3K1ZA 3RE8A 2KLBA 4H3SA 4A5OA 4QARA 1LLFA 1C3JA 1TH4A 4JT4A 2HK7A 2RFLA 1U7UA 3BZWA 2GUWA 2RCYA 3RGSA 4CKEB 4F4CA 2DPYA 2VOEA 5KC8A 1RQXA 3PSAA 3LPLA 3B70A 4BEJA 4OP1A 1B76A 4DA0A 3PK0A 4GG1A 3BSFA 1XU4A 2IXBA 4WDQA 2P62A 1E1QD 1MPTA 2W9XA 4MVJP 1KRWA 3ADCA 4FSHA 2H85A 3TSOA 3ET5A 3NC1C 1PFWA 2DUWA 1NLFA 4MV4A 4RZIA 3T61A 3U7JA 4YR9A 2NXEA 5KAMA 1MRSA 3ZCVA 3PVSA 4B0OA 1FDIA 1EUCA 1PZEA 3D0RA 3U5ZB 1CR6A 5EJ6A 4K40A 1F60A 5LUBA 3E84A 4HQOA 2WNHA 1F12A 1FFDA 3L6UA 4Q4AA 1E9EA 2ZE6A 4X63A 4N7JA 4KGXA 1KI3A 3KQHA 3U4MA 1Z6PA 1YB5A 1L4BA 4FVTA 4F9FA 3T35A 3I6BA 3NEJA 1Z5AA 2J0SA 1CQIA 3FUXA 1Q1EA 1EX9A 1TMOA 4LZZA 3CR7A 7REQB 1KNQA 2R8ZA 2FPXA 3T1TA 5ITWA 4EFNA 1J9ZA 2G6TA 1XLVA 4HTFB 4KLCA 4BX0A 5E7QA 1KYVA 2EIXA 3IB3A 3SEQA 4B6PA 2H4WA 5DWVA 5FYDA 1CNEA 1J0XO 5FKJA 3T1NA 1SAYA 1JTFA 1IN4A 1N2CB 4WT7A 3HVJA 3PVCA 4R2LA 3FYHA 1C81A 1UOOA 3PICA 4XWGA 4L6V6 5I9IA 3MXTA 4D9CA 1NR1A 2Y92A 3ICPA 4IJ5A 1F6BA 3BX1A 4RHFA 1UC5B 3R7WB 4M0KA 5EVJA 2ZU0C 1B14A 1UT6A 2KNVA 3UH0A 5BWCA 1G21A 4QJ5A 5L6MB 2H07A 5CM2Z 3PHBE 4Q18A 4E7PA 1SELA 1R4NA 3HVRA 1VG8A 5JAMA 2VP6A 1KI1A 4CRWB 1L7AA 3O6VA 2HSJA 2GVDC 2QOEA 2WKQA 1GNVA 4ZAWA 1JHDA 2QTMA 4ND5A 4GVXA 2ZTDA 1ESNA 5FLYA 1QPZA 3GGSA 3RSOA 1XF9A 4O2BA 3BC1A 1Z4JA 3E9YA 1FX0B 4J49A 4WNIA 1TYDE 1M1YA 1VYHA 4FU0A 5JC8A 1FS5A 1IBKM 1EH5A 2EHJA 5K4HA 3E9RA 3A4IA 5JLAA 4LJLA 3T38A 4BMZA 2W00A 3DZJA 4B6QA 1DG1G 4CNQA 4CG0A 5F9FA 4KX3A 1B93A 5INTA 1EESA 2AKEA 3K6RA 2WJ6A 3P9PA 1EQAA 1ULTA 1YVRA 5EJAA 5LBUA 4WERA 4HAXA 5HM8A 1KSGA 4DQUA 2ZCJA 2H7XA 2QPLA 4TRNA 3HUFA 3DLTA 4HQFA 2YV2A 1JEDA 2MYUA 3WQRA 1PEDA 3T15A 2CSUA 2UYHA 3R09A 1WXGA 3MCZA 3OFND 1OZHA 1K2WA 5JSZB 3KQQA 1JAXA 1DKPA 5L53A 3I61A 3CVJA 4MA5A 4YJ3B 3ZY2A 2IYOA 3WHPA 2P9JA 3A11A 4MLPA 4TVSA 2A0YA 2C00A 3T7KA 4HMPA 5IKXA 1PLJA 2AX4A 4JI0B 1BHSA 4DCSA 2QJOA 4OVKA 3KT8A 4X1YA 1WIVA 2JZ0A 1KY3A 5L4SA 2GJ9A 4H77A 4ITUA 5DHSA 1OT3A 4EKNB 4X64B 3O7MA 1YZ3A 4DR2M 1DBPA 5GAJA 4D8YA 2WFZA 2PH5A 1C7FA 1QLJA 2EYQA 3WVNA 5BORA 5LKRA 3ISVA 5E6RA 5LKAA 3I9MA 1UXKA 4Y8VA 4MQ6A 1MB9A 4Z1MD 2YV4A 3DXYA 1ISIA 1FDTA 2IWRA 4H6PA 2BFEA 1GJTA 1VP3A 4YRIA 1WB4A 2HCJB 4QU9A 1N6RA 1YHNA 3B1ZA 2QZZA 3LLMA 4U0JA 2O0KA 1RFGE 1BX1A 2PR2A 3ND6A 3GJSA 4EYKA 5TX7A 1D2GA 4ANRA 1LPBB 4TT3A 1VJ0A 5DJ5A 1ZD3A 3HSSA 4PCLA 4P0QB 2QAGA 1OKKD 1OTYA 3UPDA 1Z39A 3D02A 3VYRB 4HG2A 4KN6A 2XWJI 4XD2A 1EK0A 2ILTA 1DTSA 4WUTA 4L0QA 2W2VA 4DYHA 1T1RA 3MBIA 2B61A 2XYQA 2O2IA 3EGDB 3CZ4A 3O8QB 3L7YA 1T6NA 2QDXA 3OHSX 2RHRA 2CVFA 2O4CA 1YZLA 3AEZA 3DEZA 4DHEA 4EYOA 4P4SB 1DFGA 1G6Q1 3QVLA 3R4CA 2D2XA 5L40A 5I5EA 5REQA 1DARA 1P2BA 1MFPA 3K9FC 2X1HA 4HAUA 1I2ZA 1KP9A 3VKWA 1XDBA 4C0SA 2C3YA 3A36A 4DRZA 5EIHA 3G8DA 3T7SA 4XTRA 7YASA 1FNSA 4DV4B 2R4UA 4PQRA 4JX9A 1R0SA 3BFKA 5E4FA 3SR3A 4O4IF 3MT0A 3DLIA 3LHSA 5L8RF 1WBJB 5JJIA 4FYYA 2NPIA 3C58A 1ZGHA 2NVWA 4B6OA 4C0WA 4XJTA 1V4NA 4I1PA 4KU4A 3BD7A 2PZKA 3HP7A 3VKHA 3ULKA 4CLRB 2YXPX 3C5CA 2J6IA 2MINA 2VH2A 4JD5A 5DHUA 2D6FA 1WHCA 4PO8A 2JGNA 1VL2A 3LQQA 1LCIA 2CWDA 4MDFA 2LVOC 2FHSA 5KS2A 1YCGA 4JQYA 4AD8A 2R7MA 2Y4NA 3WJAA 4NS4A 2A57A 1RPTA 1TT5B 3FWYA 4BGIA 2BEVB 3CLTC 1USGA 1N2CE 4KLRA 4QQRA 1TJ5A 5KO2A 3GC6A 3VA7A 4WNCA 5B64A 3H6KA 2GJKA 2Q0SA 2W71A 1AHHA 3AF1A 1HQCA 3VRHA 3JATA 1T5OA 5FI1B 3ZU6A 3CF0A 4TXLA 1ZNQO 5CDHA 4WXYB 2G4CA 2NTVA 2V0NA 4Z99A 5LQRA 4PG5A 3M6LA 4GOOD 2FZWA 1XZPA 3DDNA 1P6XA 3N2GA 3RW9A 1FTWA 3E05A 3ENNA 4QQ8A 4G56A 3I01A 1PZGA 2D5LA 2PT9A 4MB7A 4II3A 1PGNA 2B7LA 1SG0A 1XYGA 2VRCD 1JJFA 4L27A 4V1CI 1OROA 1NUPA 2BJHA 2XOXA 4QDKA 4UHDA 4D9MA 1UZLA 1TR8A 3PT9A 2ECOA 1BGVA 1CJSA 4ZTZB 4AI6A 2V65A 5KKAA 3HI4A 2ZBKB 2IJGX 5ALVA 1C1KA 4UOZA 1IBLB 3EG5A 3ZCQA 1RRKA 4IYRA 1VL1A 2I3AA 4DCOA 3PXBA 2WKRA 4B9EA 4D6PA 3K73O 5TNXA 4DVJA 1DAOA 3UJ3X 5EYPA 3NEAA 3D6HA 2AK3A 3WI7A 4WK0B 1ZW6A 3RYCA 4LYHA 4CLDA 4LF7B 2QW0X 5SICE 4O4JA 5DNWA 3EQ6A 3F5DA 5ESDA 4D81A 1LKZA 4IY1A 1WHSB 2XNSA 4INZA 4B33A 3DTVD 3IO5A 4KXMA 1MB3A 4FD3A 1PZMA 2HMUA 5I9TA 3VSAA 3DEFA 3GLKA 4Z3OA 3SX2A 2HREA 5DSTA 7CATA 5LXTF 2C1XA 3CFYA 2GTHA 1E2BA 3U5TA 3T3EA 4AKSA 5AW4A 2FG5A 4HNRA 4KVFA 1Q1GA 5HR5A 5IM4A 4MW5A 4IV0A 4QBTA 4Y1RB 2Y1LA 3C7KA 5K3OA 3I5MA 1U8FO 2CLSA 2PT7A 1JPNA 1P4RA 4C9BA 2NTNA 5KDDA 1G19A 3KJGA 2Q4RA 2LVQD 1KDRA 2XMCA 3TCNA 2QXUA 1J07A 3C6ZA 1V5WA 4ARAA 2CMGA 2DZNB 4OP3A 5AKZA 5GOTA 4JI0M 2O59A 1JS1X 4BDSA 3LNCA 2QTWB 4C6TA 1DB3A 1MVLA 1J7KA 1KI9A 4JLAA 4ARVA 3NC4A 3KFXA 3D8RA 4X64M 3W8RA 3V4ZA 2UYCA 2VDVE 5EOVA 4GLBA 3WGMA 5GY7A 1OFVA 2AT1A 5FWYA 5CVJA 3T3HA 4QEKA 1YRLA 4E2FA 2FW8A 5JCPA 2OHXA 2Z6QA 3HB9A 4N6GA 2A14A 1NW3A 2V4UA 2MYPA 1VLZA 3MPOA 4J3JA 4N7MA 4R05A 2FFBA 5DX8A 1QHYA 3DF7A 4QBKA 1ECBA 3DT9A 4MGKE 1YI1A 1XDDA 3U0VA 1IXRC 1B41A 1YR1A 5ICCA 3OCYA 5KKNB 4I4LA 1ZJJA 3A2MA 1ETUA 4NYMQ 1DCMA 4HAIA 4WFKA 3V1UA 1SU4A 5I9BA 3TWMA 4Q1VA 3UTCA 4RDCA 3J80A 3FHTA 2I1LA 2QF7A 3UNXA 1GV1A 4MS3B 3CCFA 3EEOA 1QZZA 3GGDA 4BCCA 5EHIA 3VV2A 1PLKA 3TX6A 3UV3A 3DR3A 2HRQA 3SDZA 4LXYA 3QBTA 1LK0A 1Z5OA 4C0AC 1I13A 3RUIA 1WULS 3NP9A 2IELA 5JPIA 3ONEA 1L2DA 3IBSA 4LY6A 4ZEXA 4OGGA 3D5EA 3HJHA 1GP2A 1YKSA 1NYLA 3DGEC 4UEJA 4WZBB 2BL4A 3U4CA 4BNLA 4UD6A 3BJMA 4BLTA 5AKXA 3GW8A 3GDWA 2P9QA 8CATA 5F76A 5J2UA 1OQYA 4BQPA 1T4CB 1E3QA 2FR1A 3DAPA 4DV4M 1ST2A 4NPHA 2PZEA 1BCRA 3RIEA 2B1QA 3WK5A 2L69A 4G0WA 3UA3A 2V6GA 1XTPA 1LNSA 2AFHB 3LXUX 2P4UA 1NVUQ 4QBFA 1ZMOA 3CA8A 2I0FA 3MWYW 2H65A 3SASA 1B7GO 1XB2B 4DRXA 8OHMA 1HTWA 3L0PA 4WAUA 1X7WA 3ONDA 3NTQA 4DJEC 3HYTA 4FZ5A 1T13A 1EFTA 1KTIA 4DBZA 3S2FA 4QC2A 1J6UA 2O05A 4F85A 2ZJ5A 3ENWA 4TM7A 3CWCA 2MSDB 4P7JA 4ID9A 3GLVA 3T3DA 3V8VA 4ER0A 4HWOA 1TM3E 2CSXA 1T8SA 1GOTA 2AGVA 3HVKA 4I46A 3VJRA 4N47A 1CRQA 4TVKA 1P9OA 1H2AS 2Q29A 4MW1A 2XZLA 3L05A 4IX1A 3AF5A 4K86A 3TZHA 4AECA 3JVIA 3AM1A 3PL5A 4ZYLA 2ZSAA 2OAEA 3OE7D 3D3KA 3KQYA 2MIIA 2Y4OA 4M8NE 3PHJA 1RXSA 4QEZA 3SZUA 2OXTA 2FWIA 4DLVA 4IMPA 4PLGA 4MCAA 3PPXA 1DOAA 1EJ2A 2P1ZA 4FE4A 1UMBA 3DV0A 2P4QA 1AURA 1NPYA 1IHOA 3D8TA 2F1RA 4LRWA 1NMEA 5HM6A 4P5EA 2IYZA 1TTTA 2QN1A 2XYRA 3RKSA 3ABIA 3TFOA 3TN7A 2UUBB 3OCCA 2ZBRA 2ERCA 4QFDA 4HSGA 1Y0BA 2P4EA 1EVZA 4AUEA 2QSJA 1UK7A 1UL1X 3H97A 4DQ0A 3A6KA 2RGXA 2BM8A 5C80A 3QXGA 4V38A 1IBLM 3S40A 4Y6LA 3ZQJA 2FH0A 1GPBA 4L1KA 4DLPA 3TTUA 1NI4A 1CCWA 1JVSA 3F9CA 1FQWA 1NMQA 3MAAC 4CTNA 1PG0A 1MB4A 3MVEA 5DWDA 4Q4HB 3BG5A 5EJGA 1ZAYA 5H3LA 2P9EA 4IWNA 1E2NA 4LF7M 2JVJA 3BL6A 2I78A 4K7JA 1V1MB 3ZR4B 2FEPA 4OI4A 5J59A 1D7AA 2VDOB 2H5XA 3W3AH 1UBEA 3K72B 2H06A 4UTPA 3LQFA 3MTEA 4KB5A 2JNHA 4D43A 1OLUA 1LV7A 1Z62A 4L5CA 3CSSA 4ZVMA 2WV9A 5TQ0A 3ZY6A 3H5NA 2BGUA 1Q12A 1YVDA 5JXGA 4HWKA 5CT4A 3S2UA 3FWKA 1MMFB 4NJMB 1DKQA 3WSWA 2CMDA 3DMDA 3SYNA 2HBYA 4IZHA 2VUIB 2PLWA 3BHIA 2BFPA 4KC0A 5CITA 1ZZEA 4WZAA 1XK7A 4IGAA 3FUCA 4YDHB 1WMAA 2GM9A 2XMSA 4JSRA 1CS4C 3QFTA 1V6SA 1VDZA 4Q93A 2PVPA 1OYVA 2C4WA 3X1JA 1KBQA 1PSZA 1TH3A 4XQCA 4KR3A 1TVMA 4EMTA 4D92A 5CG2A 2C1EA 3A4TA 4XX0A 5JD6A 5D51S 3E9QA 1MEOA 1GPUA 3PFHA 4PZ9A 2WHPA 3V7WA 5IX8A 1LD3A 4YMWA 1EYZA 1DKMA 4JWTA 2X9VA 4QOIA 1R2QA 4U02A 4RGBA 1NDHA 1PG5A 2B5OA 5M34A 1IJEA 4PIMA 2HL6A 1FIUA 4HDAA 3W6OA 3DMNA 2QL9A 4XQEA 2OBYA 1JHMA 2PS0A 4DMCA 5LMNB 4JT9A 2XXAA 4F3NA 2MSCB 3GNTA 1AT1A 1QV7A 3U7EB 4OQMA 3ZCXA 4CEHB 2OGTA 2ZR0A 1GFSA 4FPXA 3FB4A 4FDVA 3BF7A 2D4HA 3AVWA 1ZUNB 4F5EA 3HRKA 3D6JA 2C94A 4WZBE 3L07A 5H4GA 1Y89A 4S04A 4D9IA 2WAYA 3DOAA 1SUFA 2H1WA 3K1TA 3KOZE 3L7LA 3WTCA 1N4DA 4GM1A 3MJHA 4AAYA 4RY8A 5TF4A 1JLSA 3KELA 2V7QD 4YCSA 1B16A 3A6JA 3IUMA 4NAVA 1J00A 3FDZB 4YONB 3LTNC 4DLWA 4JSTA 4E51A 5J43A 2AFHE 3JVDA 1D3AA 3HS3A 2JRCA 1NX9A 4MYRA 3PGKA 3H42B 3UIEA 3RG2A 3R9WA 4ZI3A 1R12A 2V7VA 3WAGA 1G291 3IDZA 2BI8A 3NHKA 1Q5PA 4M8IA 2P9GA 1T8YA 2CBZA 3M5PA 1OXBB 4D8UA 1DUSA 4EOGA 1U9CA 1XAIA 2V9ZA 5HTOA 4PR0A 2B37A 4KV7A 3P0IA 1CDOA 1CY2A 1KA9H 5I45A 6ADHA 1TTHA 1D0SA 1REQB 3T4EA 3HKEA 2YJNA 1N36B 4PQYA 1JT9A 5BSMA 1L4NA 3GPLA 3F1KA 1DE0A 4OHKA 2CJWA 4LRTA 2JVIA 3ROZA 2A9RA 1EEXB 5BV8A 2YNMD 2QUKA 4EZIA 2OGZA 5A5EA 1GZHB 4DQDA 4GR9A 1EE8A 2JLUA 2I99A 4N5HX 3P0RA 3WXBA 2GB4A 4TYYA 2HEGA 1DTWA 4NFSA 2NUAA 3O3CA 3ZYCA 1QV9A 1S1MA 1WW3A 5KNDA 4RDIA 3Q2KA 1XE3A 3OTGA 1YMUA 2XCOA 1WD7A 1M2WA 1Z8FA 2O7RA 1GKKA 1C5KA 4KJXA 4GC9A 3IP9A 5AVKA 3INYA 5IM5A 1RAFA 1A96A 1KJ9A 3P2OA 3KSDO 1S4QA 3MUOA 4FNMA 3KOUA 3MWLA 2IGTA 2ZBDA 4ZRNA 1O0BA 2VUHB 1ACMA 4DBLE 4UU8A 4YHBA 2K6GA 1E9AA 3ICOA 4L2IB 2PX6A 4D3DA 2JIOA 2RSLA 4PZYA 1MC1A 1Y33E 3C70A 2UUBM 3JRNA 1HFWA 5D1NA 2LKDA 1Z5PA 3A6HA 4NYJR 4P08A 1ZH4A 2M5ZA 2VNKA 4CLEA 2Y0BA 2BTQB 3OEHD 1GCUA 4DQXA 1E0KA 2OD9A 4FFWA 4US2R 1HUQA 2QQFA 5TPZA 1OBHA 4PPYA 5I51A 1Q1QA 4FYIA 1JSZA 1RT9A 1IOLA 1UM8A 4B09A 3IDAA 4LC1A 2JPDA 3FNQA 2H4HA 4AS2A 3N2IA 2LNDA 4J0QA 1IWOA 4DMKA 4KT0F 5I3ZA 4ZIRA 5LU9A 1U1EA 3D2AA 1ZQ1A 4I36A 3I76A 1EX1A 1F6DA 3MA0A 1QG0A 5IDQA 3SQDA 2RGUA 1KKUA 3C7DB 4G2TA 1RLUA 1M1ZA 2FXIA 4UULA 4O4LA 3MWGA 3GMDA 1V8FA 4ALJA 4J3NA 1K82A 2W93A 1DCKA 4C4AA 1CVIA 3RC1A 4PQGA 2H18A 1ODIA 3L4SO 4YMGA 1X1SA 1X74A 1EFPA 5LJIA 5IYZF 2A0WA 4AY5A 4MO2A 3O83A 4WWHA 4EYGA 3NAGA 1EXMA 1NR7A 5ENZA 4UEOA 1K27A 3I6QA 3QOWA 5EIFA 1QIMA 2XITA 2EKFA 5AK5A 3UT5A 1M83A 1JX6A 2R0IA 1SCDA 4MGHA 4WBSA 1JB1A 4EBFA 5FBWB 3USCS 3P4YA 1Z56C 3ZLVA 4WD3A 4YTEA 4ON9A 2C0QA 1VE3A 2XBLA 3DJYA 3UUEA 5CDFE 3PSHA 4KR6A 3EXHA 2O50A 2J9RA 1C0PA 3DMFA 3KLMX 4HP8A 1ZR2A 4J1NA 5AESA 3FX2A 3THXA 3VO1A 4X00A 3W2TA 4CVNA 1Q92A 5E9WA 2KHHA 3HJQA 3EZ2A 2WP0A 3M1LA 1AF4A 5BR1A 3TTXA 4P4UA 2Z8YM 3O2SB 4S1VA 2YIMA 3TS1A 1U28A 1NLUA 4U00A 1DBVO 4NBUA 1ZYUA 1FB5A 3IR6A 2HBRA 5KPJA 5AKKA 1QV6A 4FCWA 1OR8A 5LM3A 2VPXA 2BGLA 3P9NA 4HEHA 1JALA 2Z8ZA 3V4VB 3ENQA 1F8YA 3U3RA 2EP5A 5KYWA 1D04A 1BDJA 5LMNM 2A9FA 3EIOA 5BNWA 2O8EB 3CZCA 4L9SA 4I8OA 1JQDA 1DLIA 2QENA 3FJYA 1TFUA 4GD3Q 1S6YA 3ZH2A 4B3XA 2WJ4A 4OHMA 4QYMA 4M37A 4BCBA 4BE4A 3KD2A 3N5CA 4ZDIA 2JFPA 3GQ5A 1U2RA 4P36A 4CDRA 1E6MA 4F2WA 2A5YB 2LIVA 3ENVA 1GQOA 3IFSA 1QVVA 1G64A 2XXBA 1RVV1 4B5LA 1JKXA 3MBOA 2N75A 3D7NA 4KH1A 4IUYA 1R4MB 1WDLA 5ALOA 3QKSA 3KWLA 4MGZR 1Q0LA 2DHQA 1VGQA 3JQBC 4PZAA 4BNWA 1AKEA 3U3MA 5JZ9A 1H23A 3FD9A 1A9YA 1ADJA 2JH9A 2GBCA 4WBNB 1Y3AA 4AN1A 1O5OA 2BR5A 2R46A 2A5GA 3AYZB 1PU2A 1J49A 2D1QA 1C2YA 4Y2PA 3FFBA 4HUTA 3FJ1A 4PZZA 4JHLA 4AO6A 4ZK6A 3QU9A 4JU9A 1G3MA 3M70A 4G36A 3SSAA 2ZJYA 3ST7A 3OQIB 3IMKA 5L9AA 2JGDA 5IFLA 2EX1A 2R60A 3RS3A 1ZRNA 2Y2VA 4UVHA 1P1HA 5HBRA 1HDRA 3H87A 1NBEA 4DPKA 4TLLB 4UREA 2RAVA 1Z75A 3FFAA 3KR0A 3WYFA 4AQYB 1XTBA 1XEWX 4I2NA 4DUZB 4E11A 1W0JA 1QZ3A 4JP5A 2JBHA 4PWYA 1ZM9A 3ZZTA 3JQAB 3EAQA 4W1PA 1N36M 4JT2A 1DXOA 2FKAA 1G17A 2FR8A 5C31A 2H1LA 4F4HA 3LUAA 2PV0A 1P7CA 3HDHA 3QY0A 1ICIA 2PH1A 3NJ4A 1Z6XA 1MQSA 1N0WA 4PC3A 1E3WB 2WUWE 5JROA 3JALB 3H8VA 4BNVA 2XODA 1L5GB 3FCOA 4XGIA 4IIJB 2ATCA 4OFWA 2CVPA 1GVNA 3G2IA 2QX7A 1XNQB 4JEUA 3I9KA 4OM8A 5IC5A 5FLKA 1FP4B 5A1TA 4DR7B 4UJ5A 3HEBA 1G8KA 4PHTA 1NUTA 1ADFA 2Z1NA 2XFSA 2V5VA 2Y0QA 4H7JA 4FQ7A 2AW3A 2ZJZA 3G2LA 2QVZX 3GMTA 2YS6A 1GGEA 1SPXA 3DMGA 4MPDA 5DHPA 2XGNA 3SEFA 1LNQA 2OKGA 5KMGB 4OK3A 4IWYA 4BVGA 1Q14A 1IAQA 1QDLB 2QGNA 2FPGB 5KNDD 3TAHA 3WYAA 5CM8B 3W90A 2PFSA 2BKXA 3WMXA 3SAJA 1D0KA 3V2IA 4KGZA 4EHLA 1JB0F 5F5NA 5U4XA 3K2QA 1TZCA 5JZMA 5EUBA 1Z6QA 3SQMA 3U26A 1LLCA 4Q66C 4M98A 3ILYA 3QV2A 2DSTA 5DB4A 3VC2A 4IHKA 5TJHA 3CCBA 3CU5A 2X49A 2H4JA 2R18A 3DEYX 4XQGA 2LCIA 2ZYDA 4CISA 4XI9A 4GGPA 4KIGA 3VZDA 3EUWA 2FWJA 3AJ8A 3IEXA 3JQ7B 5LFAA 4JQZA 5DGTA 4HDOB 1HDCA 3IYLW 4IRMA 2GR9A 1MQ9A 2IHUA 2IHKA 2XNHA 4CFYA 2P2GA 1KVUA 4QU5A 3K0SA 1ZJ5A 5TPZD 1KH2A 2PS3A 4NC9A 1T6YA 4XPIB 2PYIA 2IA5A 3NKVA 4DIFA 2XT0A 3BQMB 1EHCA 1KJNA 2OZKA 4U2FA 4DCNA 2VQFB 3QLTA 2PRSA 3T4XA 1H8HD 1TXGA 5L7YA 2PUFA 3Q0EA 4QYIB 3ANXA 4K6OA 2BSQA 4D74A 2Z30A 1BVRA 5C3MA 2UDPA 1EBBA 1OFUX 1RTTA 3ODGA 4JVNA 4MIOA 1XI2A 4DT1A 1V5EA 2I3BA 3UKDA 1TAGA 2FAXA 3WLEA 1RRMA 5G02A 1K0UA 4YJGA 4KNYA 2ALJA 2CE7A 3OQPA 4HVCA 4XW2A 1KNXA 3INTA 3K8YA 2P2LA 1KKMA 4TQUS 5B7QA 3NTOA 3SC2A 2N0SA 2I2WA 4W1RA 1C4XA 3NAQA 1TL7C 1U8TA 4CM4B 3LX6A 1MV5A 1SA0B 1XWIA 1K4YA 2BBOA 2NVBA 1GNRA 2I80A 1UQRA 2V7PA 2PMBA 2BCGY 3EPJA 4MB6A 2VPPA 4PLFA 2X7XA 1S8OA 3DNPA 4S35A 5DNCA 2XLBA 3RU3A 2GS9A 3EMDA 4P7GA 2QA5A 5CYFA 5HF8A 3RAJA 5FPSA 3B6MA 2JWSA 2Q49A 2V7BA 1TM7E 4C4PA 1BDMA 3FWHA 4UE6A 1G3QA 1SUDA 1AK1A 4YQFA 3C6MA 2V7GA 4MYHA 4Z8XA 3S81A 4W7HA 2EZTA 1UWLA 2FPPB 5DHFA 1CF2O 4HEQA 3HABA 1ODSA 1XVLA 2PUAA 2A1TR 3AVQA 1B1AA 3CT6A 2XZUA 5DN9A 4V39A 3I04M 3ILXA 1JTVA 4CKEA 2NUTB 1H0KA 3RWOA 3PR3A 3PHCA 4U9IS 2DR0A 3UCXA 3A4LA 5JS8A 3VSEA 1JGTA 5JH7F 1I14A 1NVTA 2H48A 5F12A 1G3IA 1NXTA 3WNQA 3GJ3A 5KYGA 5AUNB 3C3WA 2ONKA 1CUAA 1PL7A 3V97A 4PCAA 1T9BA 4BLRA 1XUOA 1V3TA 2CD9A 2Z1DA 5A9RA 1PG2A 3OOHA 4B6SA 3NDRA 4B4OA 3GAZA 4NXNB 3IR5A 2W8BB 4AKIA 1JIJA 1VHTA 3U5ZA 1R64A 3GLFB 1ZUHA 4IZOA 1Z63A 2FQYA 4CQMD 1P5HA 3GG2A 4YRBA 1JDVA 3BZBA 3A58B 2YYYA 1J2JA 1LEHA 5T4EA 1KDPA 1TMGE 1PCXA 1HFKA 2FCRA 5KWVA 4OYYA 2DCUA 4RVNA 1NNJA 1YU9A 4IGEA 2ZW9A 1B0UA 5AKJA 2XQGA 3CC8A 3PPYA 3AESB 4NWIA 4AQYM 1MO5A 4PLYA 4DUZM 1ES9A 1HEYA 3VSDA 1IG0A 3ESZA 4HTFA 2AJLI 1HZZA 1J8DA 4PVDA 3IKTA 3SNKA 1JDUA 5FSWA 2Y1FA 2VF8A 1BH6A 1E69A 4PAMA 2XTJA 4EY4A 4MO9A 3VUEA 4O6VA 3QE2A 4EUFA 4X65B 4D4JA 3DJFA 4DCTA 3CGGA 2IQ5A 4EUHA 1HNWB 1M2OA 1LS1A 2P7HA 2JI6A 4QAJA 5C5CA 4X3OA 3R7WA 1SBZA 1XNQM 4M38A 1N2BA 3HCBA 4E1VA 4DR7M 4KQ2A 4FK8A 1ENPA 1Z0AA 5KTPA 2FX5A 3L29A 9GPBA 4NU6A 4BV8A 4JAVC 1GPLA 4DIDA 3V1NA 3QPBA 1O4VA 4Z0NA 1V8BA 1ZMVA 1UPAA 4X8LA 3MIIA 4BVKA 1QS0B 4WECA 2ZG6A 3Q7SA 1K86A 1P2FA 5B12A 4B0PA 1EM8A 3ZWYA 3JYPA 3P0FA 1FX0A 2Q07A 5JY6A 4XX1A 5HNKA 1U99A 1A8QA 3CONA 2XVXA 5E26A 3MUFA 1KC3A 2OORC 3F78A 3OQMA 1LQTA 4WNAB 3L6OO 2XOKA 3HWWA 4RKRA 1DJMA 1NJ1A 1XC7A 2LZ0A 2YRWA 4M6WB 4A8JB 3ESQA 4P2GA 4D3YA 4MVXA 2HHAA 2JY7A 3DMHA 2PKQO 4IXTA 2DBRA 4C3VA 3IPYA 2X0KA 4NONA 4BQQA 1U1FA 1ZOLA 1LJUA 3GT0A 1K89A 2PZGA 3H2KA 4DLUA 1LDMA 5B1SA 2XJ4A 3L18A 1KS2A 2IUSA 2VNHA 3A6GA 2BDUA 3RV4A 2VJPA 4DDVA 3OLWA 2OHGA 1RKVA 2QN3A 1IN1A 2QJWA 1L5QA 1VZ3A 3USES 1CY8A 4XWKA 3TTVA 2WVJA 4YJ3A 4JL6A 1SKAA 5BW8A 4ZO6A 1SXHA 4GH9A 2OD2A 3AF3A 5DASA 3AXSA 1YS4A 2BSXA 3JQEA 2P5TB 4RJIA 4INAA 1QHGA 1SNYA 4QNNA 3NHUA 1OI4A 1UKYA 5GZ6A 1FLNA 3CGWA 1QP8A 1LBQA 4ZTBA 1W75A 3R5FA 4MSUA 5JAUA 3C3BA 4GPTA 1MC5A 2D1SA 3H83A 3TGLA 1U3FA 3TF5A 1ZA2A 2DHYA 5ED0A 4NMLA 4Z51A 1Y7TA 4PCUA 1A2QA 2QD1A 1BXGB 3ZDXB 2VQFM 4P4LA 4IJWA 3T9EA 1RWVA 4F38A 5JDIC 5CPFA 4BZWA 6REQB 2COKA 1AUVA 1S8AA 3LRPA 3C8MA 2VRBA 1N9ZA 2B1JA 1PR2A 3CX8A 4RW0A 3DPIA 4BNZA 4FW9A 1W2GA 5IN5A 3I51A 4BECA 4ENTA 2P8SA 2PU7A 3UOGA 1L4KA 2NSYA 1UPUA 1QRAA 4E14A 3V4PB 3BSWA 1NW4A 3K8ZA 4L8WB 5DXJA 1SVWA 5CP8A 1ZVQA 1CG6A 3G5MA 2EKLA 3NW9A 5HZGA 3HLTA 1JMKC 4EQ6B 3KZ1E 2WU1A 3U49A 4KE6A 3TNYA 2OCYC 4D8XA 2QRGA 4PBRA 3IC5A 2XT6A 2EX4A 3W2GA 3U31A 4ND3A 1KFCB 1EWRA 5LBIA 3NG1A 3EGDA 3Q9SA 3E70C 5BQ3A 3GFFA 3O8QA 1XRJA 3ORSA 1YZUA 3PC7A 5F35A 3SHVA 4YMSA 5EIXA 5ITUA 2Z83A 1H2WA 4P4SA 4UVGA 3CEMA 5J5VA 5SV2A 3AJAA 4KXUA 4FR5A 3A8TA 2V8OA 5FPYA 4CBVA 2VI5A 3ZI0A 1QYXA 4G8JA 4MJLA 4HRVA 3ZK7A 4GMDA 3RBAA 2MT9A 2W48A 4OB7A 3SYLA 4BBPA 3WWDA 1T9KA 4RD3A 3PWZA 4B8YA 3GLFE 4TKMA 1B0ZA 2BDTA 3I2IA 5GWXA 3ZCUA 3TNJA 3HDYA 2PTGA 1VE1A 2OCPA 4EJ6A 4ZZ3A 3SE0A 5FB3A 1XL0A 3UTDA 1J2EA 3EXAA 3KQSA 4CLRA 3MJSA 2O7VA 1W73A 4JLVA 4ZICA 4PSAA 3D31A 5LSAA 4GBED 3OIYA 2GBPA 5K0ZA 2J85A 2OYCA 2C8KA 1J7JA 4HPWA 3FWZA 1N6OA 4L9RA 2C9BA 1YIAA 5IVHA 4NXNM 3T9FA 2JA1A 1TAQA 1TT5A 4PYJA 3ZIAA 1J39A 3A32A 4UUAA 5DTIA 5E3IA 4CI9A 1N5OX 1DGFA 1NJGA 1G5HA 2O3SA 3C87A 3RUEA 2XTAA 3V8QA 3OZIA 1VCOA 2JFQA 2HL7A 2B30A 3ESDA 5TMEA 5HUQA 3HR7A 2WIBA 3Q1KA 1A9XA 4ARZB 1K2VN 2R85A 5DBIA 1C9JA 5AKYA 5JECA 3ONVA 2UYOA 5TT0A 3FRHA 2AG1A 3ETCA 3CE9A 1NSTA 2XMZA 4BNHA 2JGAA 2PU5A 2WDZA 3UWOA 4I19A 4Q01A 1Z0FA 3RRMA 1ZR4A 2GBGA 3OJFA 4P84A 1N7IA 1F2UB 3LUCA 2H92A 5L3VA 3AR7A 3BQNB 3ZNNA 1X6VA 3RU7A 2N1MA 3W9UA 5F3DA 1GGVA 3ACCA 4PHFA 4X65M 1T4DA 4E88A 2ID8A 4HLCA 1HNWM 3GJ6A 1WCYA 4CXMA 5KQDA 1H2FA 4RPLA 3PRKE 5AXBA 3TZLA 4XLZA 2ENUA 1LS6A 4O4HA 4AN0A 2WU0A 3CR8A 4GPIB 1NJSA 4Y9UA 5J2TB 3C8HA 4R41A 1YRQA 1M6EX 3HADA 4LIPD 3AVTA 1VE9A 2FPKA 4AO8A 4ZQBA 2OFOA 3SJ7A 4J91A 4BE9A 3O38A 3NFRA 5ALHA 3Q8XB 4XR4A 2WTUA 4AUMA 3KTDA 1M6VB 1EP2B 3DQPA 3UMVA 1WHSA 1QFJA 3BIJA 2WB4A 4M0PA 4EJ2A 1U7ZA 2P7IA 3L7OA 2BMJA 1PUXA 3NBUA 2CXTA 1SCKA 3KZKA 4MUXA 3IAM1 2A58A 3KSJA 3C6BA 1C9EA 3H16A 3OCJA 1EGVB 3NWPA 3WL6A 5H37D 4ITVA 3ZS9A 2RHOA 3CW2A 5ITVA 4HVLA 3FTDA 3FF1A 1KQPA 4BFYA 1WABA 2B0JA 3BD6A 4R7TA 2DM6A 4Z9XA 1W4CA 4WLOA 2HNKA 1XV5A 3LXMA 4Y1RA 2BZSA 3UPUA 2YJGA 5LBTA 3IBTA 3NQ41 3L4JA 5B6IA 2AN9A 4LBVA 4MHSA 3G88A 1A72A 2JIRA 4BO0A 1E3TA 4CM9A 4M9QA 2QX6A 3OJOA 4LBYA 5CTJA 4NRVA 2OWDA 5CK4A 1PR5A 2WNIA 4BMSA 1V35A 1U3TA 2JL1A 1K6IA 3SM9A 5AJTA 5JSQA 5JTUA 5KZMB 2R47A 1U0NA 4B73A 4II2A 2ZRLA 4AG5A 3MLBA 5D5HA 3OPYB 5HWSA 5DBHX 2ZBUA 2I71A 1PGJA 3DG9A 2OOKA 1DAPA 1QFSA 3OOJA 3A9RA 5IKOA 1WUTA 2QUJA 2NGRA 4XFJA 2FEMA 5IAKA 3I9OA 5B7NA 1JDNA 4QGSA 4F0JA 4MVCA 4WKPA 4XWOA 1PEKE 4QAQA 5A1JA 3D3NA 5J47A 5AICA 4O25A 1OFIA 2GHTA 2NQ8C 5JFOA 4KUEA 1DJNA 3OHPA 1R15A 1NVAA 1ZMUA 3CRVA 3RT1A 1FU7A 1DBRA 3Q2IA 3PUJA 3S2SA 4JENA 3ACDA 4W5NA 2FYTA 2G25A 1PR1A 3LM8A 3UF0A 1OI7A 2K7FA 3K09C 3MNFA 1IM8A 3R76A 2ZATA 3UKJA 5DEOA 4DPMA 4MP6A 1J9GA 1WGNA 4QJBA 1NQUA 1QCCA 5EZ5A 2KPOA 3QNUA 1M8KA 2QR2A 4ER7A 2LHGA 4O1HA 4OMCA 3L77A 3BVPA 3W4IA 4KXYA 2OXRA 1I7SB 1ZKDA 5JZVA 4GZMA 2LP4Y 3RREA 4FWTA 1GAXA 1PT9A 3ZJ4A 4FHCA 3FNHA 1GRVA 2H5IA 4R3UC 1PNTA 1ZCZA 3W3ZB 3THOA 4C4OA 2Y9MB 2QNIA 3T3IA 3QX8A 4E2YA 1TEHA 2H9YA 4P9NA 2XRYA 2VJOA 4I5DA 4GX2A 3A70A 1QG4A 1TPZA 4C6HA 3E22B 3PQ6A 4Y1EA 4DLRA 2DQZA 4ILEA 4YAUA 4TMZA 1Q50A 4IDOA 4WZBA 1WCWA 5A6VA 5BVGB 1RS0A 2OHJA 3DKVA 3RTGA 4C0QC 4MV6A 1XKXA 1Q3KA 5D3ZA 4YP9A 1T15A 1B3RA 1T4CA 4EGJA 4MV0A 5CJPA 1CXZA 1OAOA 3AIMA 3NUGA 2QNRA 1P80A 4LYJA 2HOQA 1JXAA 4HD8A 3C6XA 1VJCA 4HFMA 2CFOA 1YHYA 1YVEI 3V4FA 5JCJA 2JY5A 4L85A 4QELA 2AFHA 5EXTA 4M7OA 3HHYA 3A1DA 3FCXA 1Y8CA 4Y2RA 1MJFA 4TT3D 4GP9A 4H08A 4NBNA 3WRXC 1XB2A 5DEIA 3ZWOA 2NSJA 1G7CA 2XDQB 4E12A 5LP6C 4UTRA 4FYPA 1GG8A 5BV1A 5JISA 4LF4B 1WB9A 1P91A 5K3CA 1VHWA 4RGQA 2VPTA 3N8NA 5GKNA 1XT6A 4XH9B 4LXTA 3O9ZA 1Y9DA 1G7TA 3K2LA 1H5UA 4RAQA 3R9KA 3G13A 2XR1A 1SC3A 4FFNA 2OSBA 4PAWA 2DQYA 4ENUA 1JG4A 4C1BA 4M0UA 1H3EA 5H82A 1AU9A 2XUKA 5DDIP 4XGNA 3MTGA 2HA7A 3KS9A 4DLZA 3DC2A 3H5OA 1KGDA 3ZQ6A 2JI4A 4P0PB 4D0RA 3E3OA 3MLAA 3L6EA 1KE1A 5FEMA 1VXRA 4ND2A 3AHCA 2J67A 1JBKA 4R1QA 3I73A 4RF2A 1A8SA 5EERA 5EZYF 2IPXA 1DEHA 2E4VA 1TT7A 3EC2A 3VNRA 2HYDA 1T2AA 1C41A 1J4AA 4YRLA 1LJLA 1T2VA 3HXOA 4X7BA 2QCUA 4PS0A 5H9VA 3ZE7A 3PGLA 1ESDA 1NUSA 1H2XA 2A5FA 1D4FA 3SMPA 4L4XA 2B83A 3IXQA 3PJDA 2JKZA 3KR1A 4FDAA 3FVVA 2JK0A 3H05A 2WY2D 3KSRA 2FRDC 4DLTA 1VB3A 2XRMA 1LX7A 4WFIA 3U0BA 4BZPA 2AMJA 3QLEA 4QHSA 4JLBA 1YQ9A 4NX2A 2QQ5A 2QTVB 2OEPA 1YB6A 1IHPA 4XBOA 4UASA 4QGAA 4S05A 4HDNB 4LE2A 3VTKA 4XQ9A 3RSQA 2VP9A 2WDPA 3EEYA 4RK0A 1AUXA 5GJCA 4UOQA 1A9TA 4IZIA 5JZBA 4UEQA 2AB0A 2WYHA 5FOTA 2QYOA 4WGFA 1QCZA 4YJDA 3CLRD 3HBMA 4NJMA 3ANNA 1GZUA 1NLZA 4WP2A 3G2PA 4E3ZA 1JIVA 1ZI9A 4JLKA 2PA3A 2WD7B 1UKBA 3FMFA 4LF5B 5EIBD 2C2KA 1WA5A 5ALPA 3M33A 3NNNA 2QN7A 4UBIA 1UBOS 2VDJA 2RE8A 2G36A 1SUPA 3R0IA 4I1UA 4OYLA 5A3SA 1KE2A 4IDBA 4X95A 3AILA 5BN4B 3QA9A 2IYXA 5H4HA 1PJTA 3SJZA 1FUIA 1FMJA 4D9FA 4WN3A 2EBHX 3KP1E 2AUNA 3PF8A 5A5FA 5AK4A 5BURA 2LDBA 2PYZA 3N2YA 5DU2A 4LYDA 1XD8A 5A2QA 4V2IA 4I5FA 2NWQA 4F2GA 2Y1DA 4CM9D 3ROEA 4UHFA 3KAPA 1JEYB 3J81S 4P16A 4OIFA 3C45A 5BUQA 4EVSA 3QXCA 4TTRA 2VDQB 3OLYA 4LECA 5LR6A 1UOPA 1Y9EA 2HXYA 3LDHA 2V0CA 3FZGA 5C1PA 3B7GA 4J0KA 4B81A 3IP3A 1JHQA 4OMFG 5ARDA 1RVDA 4Y2UA 3VNAA 2X9NA 2M60A 2GK4A 3UJBA 1MH1A 5TQVA 2JIBA 3S2GA 5CDFA 3L26A 3PC8A 1H2YA 3V2HA 5L6LB 1QAOA 4MWOA 4CEHA 3GXOA 4JXXA 2RG1A 1SGWA 1L5HA 2PE5A 1ZUNA 1FVHA 4I4TF 1ZHFA 5AIBA 3H9GA 1MEJA 1IOVA 4B7FA 5J4LA 3RC8A 4G0XA 1E2HA 5BNZA 1ZH0A 2OBMA 2GO7A 4DABA 4AJEA 2JGRA 1RLJA 1YQEA 1SXJB 1IZZA 3K92A 4YVFA 1TIBA 5EHQA 2O48X 4IJVA 1JEOA 1CHDA 1Y8RB 5DK4A 3RLIA 4AY6A 5T4BA 5JS1A 5B2FA 3FDZA 4YAEA 3HJ8A 2PAAA 5BQFA 4OU7A 3HY4A 5BYKA 1SCNE 2GPAA 1VCMA 1ZD1A 4HX5A 1RLTA 3SF8B 3F4BA 3M1YA 1NFQA 3H75A 3IQIX 2QQ0A 4L8YA 2QT1A 4TWZA 3GZNA 3O92A 3R3XA 1C1XB 1BGWA 2YHUA 3PHIA 2Z2IA 3IKVA 1G55A 1JFFB 2QU8A 3WS7A 3E9EA 5TEVA 1BH2A 3ELDA 2PAFA 1KK2A 2CJFA 1MOPA 4WOJA 5D7NA 3NWJA 3TZEA 4LJSA 3U37A 3NOXA 1REQA 4QOZC 2VJLA 2HM7A 2IXGA 2FK7A 4R54A 1HG1A 4RIEA 1PRBA 5IG2A 2JJYA 2CN1A 5G3ZA 1JVBA 3BEDA 5BOSB 1G6KA 3NVAA 3DAHA 1YA6A 1IN7A 3TM5A 2I03A 1MBZA 4DZRA 3N2LA 1SBTA 2RH8A 1ODJA 2FSIA 3D54D 2GQ0A 2V6MA 4RCVA 4LF4M 1J20A 2I2FA 3A06A 4ZGWA 4KFTA 5BWOA 3H5RA 4BEBA 4L07A 3VPCA 4Z4EA 2DY1A 1DKUA 5JNTA 4IXNA 2UVDA 5T6BA 4MW6A 2BELA 1NTOA 1H2RS 3PWTA 3D2LA 1LBHA 1QP7A 2AH5A 3QU7A 1YNSA 4UUNA 3OFSA 1VLLA 1OSNA 1SUWA 2VSNA 4YK7A 3KT0A 1RJFA 2AOWA 1SD5A 3Q8MA 5IVIA 2BHTA 1IRIA 2ZK7A 4RZSA 5EXEA 1D2CA 3ZWCA 1JNYA 1KYTA 3L6CA 1XCJA 3RFUA 2Q5OA 1IHDA 3H2YA 1U8EA 3PFGA 4L2IA 5FFNA 4NG5A 3GMIA 2A3NA 4TMXA 2O5RA 4LZNA 3NVDA 4FE7A 2FW1A 2W6JA 3LP6A 3PLAE 4EUNA 3MHPA 4A1OA 1KO7A 2WRZA 2BTQA 1U6KA 3BFJA 3A2NA 1KAEA 1BS2A 3GGPA 4PLVA 3EXG2 1U0BB 4CLHA 5IT4A 2CUNA 3H2BA 2FY8A 1RQPA 4OXIA 1OIPA 2XNDA 3Q3GE 4HDKB 4KIJA 4AS3A 4KDRA 4CM7A 4W63A 4KE8A 1OW3B 3B7QA 2JAWA 2BZGA 3GP8A 2FDXA 2DT5A 4MV7A 1GQYA 1UKAA 3H11B 2QMHA 5ALQA 3U48A 2AVNA 1KJZA 2XHEA 3KOYA 2DBZA 5A0VA 2FCAA 4ZOQI 3FCSB 4RCYA 1RE1A 3X1MA 4EPYA 2KNAA 4KMOA 5F77A 5LJLA 2B5VA 3O4FA 5B1DA 1SQFA 1O6FA 4F06A 3AJ9A 1GA6A 1YS9A 3AFHA 2ODWA 4XCVA 2GAJA 5BP7A 2HMAA 4G4SO 1ZBQA 3HU1A 3QF4B 3HTXA 4BNXA 4LF5M 4B3DA 2QGFA 4BNYA 2GEKA 2LR0A 3COSA 2DB3A 3I34X 1MW9X 3U6DA 3NBAA 1VA5A 4YMIA 4IKOA 5JBIA 1N6HA 2KX7A 2AD5A 4BE7B 4FIDA 1U1IA 5FPTA 1RCFA 3ZD9A 1UZAA 3OQ6A 1XZCA 3SWWA 2GNPA 2HKJA 2M1ZA 3EFEA 5EWMB 4K6KA 4OFZA 4H6WA 1WPXA 3FPAA 4GE3A 1TD1A 3LY5A 1N2HA 4FYVA 5EFOA 4L0MA 2C2YA 3WJ7A 4R98A 5BY2A 1L4MA 1SIBE 4FFBB 4PY2A 3WOVA 1GA4A 4HB2A 2V4ZA 1JNXX 5JNSA 4OKIA 1KOGA 4QO8A 3T5DA 4ZYWA 3P9CA 3PE6A 4NVRA 1UP4A 1MA3A 4MRMA 4B4UA 5CB0A 5FDFA 2DWUA 4I9GA 2IUEA 1DSSG 3A10A 1SXJE 1B2LA 5EXSA 4D9BA 3INRA 3WWYA 3KNZA 4HEOA 1UPTA 1XVIA 4L0CA 2H2HA 4HBGA 4D1YA 4YV1A 1XZFA 1CDEA 1Q3BA 5IVPA 4J7AA 2O8EA 1YE3A 1FDUA 3FDXA 1OV4A 4TMYA 4LVOA 1C7EA 1FS6A 4ZOLB 1UJ2A 4AKTA 4TWRA 5KJEA 3B7ZA 2AC7A 4FLMA 5GIPE 3NDJA 3NGXA 1MRNA 3AUXA 5BT8A 2GN8A 2Z3WA 3HBJA 2YJ5A 3I04A 4ZVTA 3GPDG 2M32A 1JVNA 1WF6A 3GZJA 3BS4A 2QJRA 3O90A 3DMYA 1XXHB 3S2IA 2QTGA 3NTVA 4PPFA 4DSZA 1L5NA 1TFRA 1JQJC 1QHIA 1RAGA 1R4MA 2ST1A 1VYUA 2XUDA 3EWAA 1J70A 1YB4A 3ORQA 1D4AA 1U7WA 3EPLA 2I34A 3RBXA 4V0OA 3KQPA 4YPFA 4WBNA 1GJRA 3PLNA 2RB4A 1FPMA 4FSXA 3CLSD 2NO5A 2WE8A 2D1TA 3BTUA 3FH0A 4ONEA 2VXOA 4X44A 3D6MA 3CUWA 5E7JA 1UFZA 2BGNA 2HA4A 5L7TA 1Q7BA 3EAFA 3KCNA 3CMCO 3ME5A 1YL6A 1TK2A 1J2RA 2GKGA 1DKRA 1PFQA 2WAXA 3CH5A 5FL7A 1SC9A 3BB3A 3ETDA 1J1ZA 3IPXA 4WDRA 2RH4A 2YC2C 3O0DA 4FUQA 5ALIA 2MYNA 3CNOA 1KEEA 1QZMA 1NT2A 1YDMA 4DGSA 1PBTA 3V4SA 2R00A 3OCWA 1LDGA 1SKMA 3GJTA 1XHEA 1YMVA 3JQAA 4UAGA 1YS7A 3TIIA 3L28A 4YBRA 3I9JA 1F5NA 2JD1A 5DLEA 5AYVA 4KAAA 1NVVR 1W96A 2WTNA 4ND1A 2NO7A 2O01F 1E60A 1PIWA 4Y3UA 1E3WA 2JARA 1ORYB 1QG2A 3JALA 4BASA 3DOCA 3VR3A 1HXHA 4IIJA 1LBEA 1XZAA 4IGIA 2EFDB 3E35A 3HP4A 4BAUA 1FP4A 2JEOA 2ZIXB 2BGGA 4UXHA 5EGNA 2PH3A 5CB4F 1OBOA 3MQFA 3LBYA 4JLPA 1E1KA 4GBGA 2IY8A 4BLOA 3V6LA 1SUEA 2ZE8A 3VYWA 4IBEA 2FQ1A 4KQEA 3KPYA 4Y1GA 2CV0A 4GS5A 1M8JA 4FGLA 1MDFA 5AJXA 2GBIA 4LZAA 3FDFA 1SCAA 5KMGA 4WFJA 2PWBA 1W2WB 3QEOA 2YVLA 2FPGA 4AKEA 1XDSA 5JD4A 2QY6A 1Z37A 3G5TA 3D0QA 4RNCA 3BTOA 4FFVA 4FMPA 5BWMA 2ARKA 4QZVA 1P1IA 3E61A 5CDGA 2PZMA 1YUBA 2BONA 5IJ0A 1JA9A 4QM7A 2R7AA 4BQFA 1TKCA 5AI0A 4TS4A 3GGCA 1KH3A 1F3OA 3JD1A 1DBQA 3GYBA 2IC5A 1UADA 5AXCA 2FMFA 4OHFA 4HS4A 4PFKA 2P75A 5JWRA 4KWEA 1IXZA 4CG1A 2MR9A 2M2IA 5C7OO 2KHZA 4HQKA 1SURA 2AE2A 1P3Y1 3EF3A 4QTTB 2DFVA 1T36B 2X4AA 1E8MA 5BSRA 4QDTA 2QX9A 3H3FA 3NXSA 1BE8A 4LJ5A 3RVQA 1N0VC 3LPDA 3QK7A 2Z5FA 1RI2A 1WCIB 4Q1BA 4X8MA 4NPCA 1IH8A 2W2NA 3JQ7A 1UC9A 2I6FA 3GPPA 1SUAA 4BC0A 5E1MA 1USUA 3DOUA 4ZWNA 4UHEA 4DM4A 1DFHA 1W88A 5K0TA 4RV4A 4G25A 5LQUA 4HZUB 3QX3A 1J24A 5ED4A 5E3JA 2YN4A 4OSPA 4GLLA 3W1WA 1JZQA 3DB1A 3LQRA 4HN4B 4JBXA 4HS9A 4JX8A 3HU2A 4FYWA 4W9NA 3DBVO 1YS6A 4F4DA 3SI7A 4DV1B 1KY2A 5CDTA 3DYVA 4W8GA 1NNI1 2YWFA 1FL9A 4MVJF 2VSQA 4IBGA 5LP1A 4QYIA 1AV7A 5FT9A 3DS8A 1M6HA 1Z83A 4Q3KA 4A8TA 4EKDA 1ZS9A 1NR5A 5IKEA 3K53A 3HYNA 4LQLA 5TPWB 5IUKC 1U0GA 2W6IA 1W34A 2JLAA 3KZOA 3Q40A 5JDCC 3W7VA 3QFHA 3F7MA 1Q44A 2DUJA 3TXAA 4XVHA 2PPLA 3GLTA 3HA2A 1HOXA 2JCXA 2B4RO 2J0UA 3RSCA 3W2IA 4I5EA 4E5DA 3FE3A 4XARA 3WKAA 2R86A 4FMCB 2ICAA 4CM4A 4N3AA 5ITZA 3PFNA 1M34B 4C2UA 2HQ1A 2WKSA 4UTZA 1UXGA 1P0PA 3P2MA 1L4UA 4C0HA 3PL1A 4G86A 1DO8A 5P8WA 4K81B 1E2EA 1XXHE 1CE8B 2FSGA 3LUPA 1B4DA 4O2AF 2XUZA 1SOVA 4DUPA 1PVVA 2ONCA 3A3KA 2FUEA 2X15A 4B3RB 4MI1A 2QVBA 3S8EA 1DXYA 3I1YA 1HM5A 4ER6A 1GEEA 1FP1D 1Q7TA 3V46A 4Y2YA 3UW3A 4QUKA 3KFUG 3QLVC 5FLXA 2FPPA 1UJMA 3ZQUA 3CIOA 1C2TA 3FGNA 2VDUE 2ZUWA 3MSCA 1SY7A 1X70A 2RGCA 2C20A 5G1PA 5K4GA 3LDAA 1TZKA 1PK7A 2V97A 1YI8A 2NUTA 2G40A 1X94A 1ZRSA 1EWKA 2A9JA 2H1SA 2AFRA 1X39A 1WMSA 1ZN8A 1W1UA 3NCHA 3DZKA 4Y6PA 1TK9A 1H22A 3R3HA 2VCEA 4MQUA 4NS1A 1PTKA 1CSEE 1KZHA 3WIBA 5CU7A 4IVNA 1FCJA 3N7AA 3QBEA 3CNQS 4MR9B 3BSSA 3RJ9A 1G2PA 2V5AA 1UCFA 1LBSA 1ORDA 2IOFK 4TSRA 4FM9A 4IIWA 2W8BA 1OH7A 1A88A 1UDWA 4L73A 1MXFA 1ISSA 2HWYA 3GLFA 2DUUA 2R6CA 4DUGA 4AWXA 1U3GA 4Y9TA 3RARA 3C3EA 4OHOA 3OETA 3MCUA 1CKEA 3CLUD 3UV6A 1NL3A 5HKKA 4YAJA 4JUBA 1C14A 1IYZA 4UEWA 2UZAA 1F51E 1PVDA 4KYUA 3CF6E 2I7CA 2OFWA 1T0IA 1NM5A 1M9NA 2JANA 3EOBI 5DX0A 2ZROA 1ZSYA 4DEVA 1Y7IA 4NMHA 3WP1B 1D5CA 2ECKA 3QLUC 1RM0A 1YH3A 3O26A 2PGIA 2QTZA 4D02A 2C0CA 1OWLA 3GRAA 1S2NA 3RBZA 1CNMA 2B99A 2YMPA 5KTSA 4KV9A 1UXJA 4HJXA 2Y20A 5KU7A 3EDRA 3GUVA 2KYRA 4OL9A 3J7BA 3I5UA 1OB2A 1RC8A 2W37A 5EQJB 2A9OA 1KBOA 4FGSA 3RF7A 2W2QA 2ZAOA 1ZWLA 4I5SA 3OLZA 1X92A 3PI7A 1KXJA 2N35A 3GLQA 3GCGA 2F8TA 4JELA 3AFMA 2A4MA 3FE2A 1GAWA 4L0DA 3UT6A 1RR6A 2EGGA 3ENKA 3IP8A 3QHPA 4FJ2A 1TGVA 2NT4A 3KUCA 1KZ4A 3VZCA 5K0LA 3HL0A 1SZDA 2WJVA 4LG1A 7REQA 3LGXA 1O03A 1RRGA 1SKYB 2WWXA 1QS0A 2DGDA 1MO4A 4Z6YA 2DJIA 2IZ7A 4ZCTA 2EF0A 2HCRA 5F1PA 4DGQA 3HDQA 2F5NA 1KK1A 5B1YA 4XTCS 1YASA 1N2CA 2B92A 4PEVA 2W2MA 1P3JA 4A3VB 2C7QA 4P38A 4YDSA 2P9BA 3M6IA 3MMPA 1S2MA 4M6WA 2HSEA 4A8JA 5FWAA 3AO0B 1W0JD 1QP4A 1D9XA 2YH2A 3SXJA 3MS2A 4MGIR 2NU9B 2XUQA 1U7DA 1L7PA 4UUMA 2CFIA 4FDUA 4AO7A 2HO5A 1CUHA 3U3JA 1CY7A 2NXWA 1GARA 3R6LA 1E66A 3EYWA 1W36B 1Y3BE 3H5TA 3IQDB 2VZEA 1KYXA 4L6AA 4BTLA 2V6IA 1DKOA 3A25A 1ZD5A 3E2IA 3IV9A 4PXSA 3I9V1 2RMKA 1XRQA 4ITQA 3DUFB 3ZY5A 1W4LA 4JN6B 5LMZA 2P5TA 5K8LA 4N8DA 3W4JA 2HSZA 2GEUA 1VDDA 4MQ5A 2D2EA 1CUIA 3TZBA 1BKDR 1XNGA 3FFTA 3G2MA 5EJ2A 3K30A 5TQ2B 4IR7A 1I51A 2FWBA 2AXPA 1VLQA 3UMCA 1IJBA 3S5JA 3ZNQA 3R3VA 4YCMA 3B1FA 3SXPA 3O4JA 3VDRA 4ATNA 1UUFA 4G5SA 4J0HA 4PSUA 3E3MA 4DLXA 2QMEA 4DV1M 4M99A 2QT9A 1M34E 1BXGA 3L8FA 3EE6A 1HJPA 1EK6A 3DEKA 3BD8A 5JSZA 4CKCB 2WPDA 6REQA 2WT8A 1DAGA 4U7HA 1FBNA 4GHLA 1P5RA 3DZFA 3I6YA 2FPSA 4F6RB 4XOIA 1TH2A 3IBFA 2JKVA 3WRWA 2G82A 1PL6A 1W4RA 4C6SA 5FTNA 1GAEO 3GFRA 3TL2A 1YVPA 4L6IA 5FR2A 3SE7A 2PBFA 3FKQA 4YAWA 2IUFA 4WINA 4EQ6A 4Q3DA 3I0ZA 1QOQB 4QOSA 1C3LA 4HYYA 3EMKA 2H7YA 1ZGCA 5JALA 3LNTA 1FLAA 4F1WA 1JJBA 1T34A 5IJWA 3CG0A 2ZKIA 2WZCA 4JI6B 2ZAMA 2DEUA 5GVRA 4ZMSA 1KMCA 4P92A 1NSYA 2EARA 1E0SA 1JECA 5JRJA 1F9EA 2Y6UA 1XHFA 3CRQA 4BVJA 2KB0A 1K4MA 5DSZA 5IWCA 1SKUA 4AUKA 5JJLA 2PH7A 3O1LA 4MGYR 4FVMA 3JYQA 3RR2A 4ZCSA 4B3RM 1PR3A 1RZVA 3ZG6A 1RHJA 5J4VA 2WWWA 4H35A 2JGIA 3AMVA 4Z2YA 5IDXA 1M2NA 2HW8A 1Z4LA 3PWSA 3QTBA 4XQ0A 1VJRA