3FYCA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
b'AAQCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAKEGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable dimethyladenosine transferase
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 90
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fycA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fycA01
3HVIA 4QVKA 2IIPA 1NBIA 2LD4A 4OQDA 5DSXA 2ADMA 1I4WA 5CM2Z 3MTEA 2ZVJA 5CIYA 2I62A 1D2GA 1KIAA 3GIWA 5EHIA 1DL5A 1NW8A 3P9CA 5CVEA 2ZCJA 5KQSA 3RODA 5HIKA 1U2ZA 1O9GA 2AN4A 1L3IA 3MQ2A 3SVZA 4Z2YA 4EVIA 5KYGA 3P8ZA 4R6WA 4FT2A 3IHTA 5GINE 2NXCA 2IH4A 2WA2A 1NT2A 2JH8A 2IH5A 1KYZA 5ICGA 3DH0A 3NVMB 1I1NA 4E2ZA 3PX3A 3M33A 1IXKA 1ZGJA 2YVLA 2ZSUA 4AZTA 4HTFA 2ONYA 3TFWA 1KPIA 2PT9A 3VC2A 5DM0A 3DTNA 3NVKI 5FUBA 3A26A 3RIEA 4YV0A 2PSSA 2OB1A 5M5BA 3R3HA 4C05A 5BXYA 5P8WA 5IH3A 2UYHA 4AZVA 2P3OA 3JWHA 4HGZA 3VSEA 4X63A 4YUYA 3LDGA 1UWVA 2PXXA 3E8SA 3A27A 3GCZA 3R0QA 5U4XA 3X0DA 4X61A 4YMHA 2NP6A 3Q87B 2JHAA 4RVHA 3M6WA 2XYQA 4C03A 3KQPA 2G72A 1UFKA 2OO3A 2P40A 5JUWA 3UA4A 2PJDA 3FPHA 1RI3A 5ICEA 4K6MA 2N47A 3A7DA 3P9NA 4V0QA 4GC5A 2G1PA 3KQWA 5CVVA 4RX1A 4E32A 2BZGA 1JQDA 2EX4A 3LKZA 1QZZA 3B3GA 3HCFA 4E33A 4ER5A 2OKCA 2ZIEA 3DULA 3SM3A 4EMSA 1EIZA 4F86A 1SKMA 5DX0A 3UZUA 3HCBA 1TW2A 3G8AA 1YFLA 2P1DA 3TQSA 1SQFA 3V8VA 1NKVA 3A7EA 3GJYA 4GOOD 2YUIA 3DXXA 4FGZA 4RVDA 3SXJA 4OX9Y 3NDIA 4OA8A 2B78A 2H11A 4DKJA 4LWOA 2Z6UA 1N2XA 2FK8A 2EFJA 3AY0A 5EOVA 2PX5A 1ORIA 3UBTA 3NTVA 5K0JA 4PYMA 1VQ1A 2O57A 5DRTA 1QYRA 5IKMA 2ZLBA 3BKXA 1D2CA 3KR2A 4Y2HA 1XTPA 2VS1A 3A4TA 4QDKA 1O54A 3BUSA 3ERCA 3QV2A 1VBFA 3BZBA 3UFBA 3UJ8A 4ATNA 2KW5A 5FTWA 2AOVA 3EGEA 1XDUA 5F2OA 3Q7EA 2EG5A 3FRIA 4P7FA 5FWDA 4ER3A 5K03A 2P35A 3FZGA 1KR5A 4CXMA 3DXYA 1FP2A 3PFHA 4PIPA 3OE5A 1R8XA 2I6GA 4MWZA 5ERGB 2A14A 3FPEA 3LKDA 2VDVE 5D1HA 5C1IA 4ER6A 1AV6A 3KQQA 3MGGA 3BGVA 3AJDA 3GXOA 4LWPA 4PYKA 4BLUA 3MB5A 4DZRA 1NV9A 3PT9A 3TLJA 5GIOE 3DMGA 4X41A 2YXDA 5EVJA 4O29A 5FADA 2P8JA 2AOXA 1SUSA 3IEIA 3E05A 1SQGA 3I5UA 5HEKA 2XBMA 4QDJA 1HNNA 2IPXA 4POOA 4HH4A 5CCXA 5EPEA 3LDFA 1RI5A 3P2IA 1VPTA 3DUWA 4DM3A 1RJGA 4LECA 5F2KA 3BKWA 5K0NA 3GRZA 2VDWA 2IDKA 1P91A 2IDJA 4QQKA 8MHTA 4RV9A 3T0IA 5E2AA 2AZTA 4QTTB 5ICFA 3S68A 3ELUA 1QAMA 1AQIA 5EZSA 5HIIA 4XUDA 2G8NA 5HFJA 4AUKA 3SSOA 4EKIA 3KPVA 1IY9A 5LQNA 2PT6A 2V74B 3DR5A 1H1DA 1X1CA 4P58A 4AZSA 3G2QA 5HOQA 2C7RA 5E8RA 1WXXA 4RTJA 3P71T 2JH9A 4RTLA 3OU7A 3HP7A 2PKWA 1EAMA 1XVAA 3DOUA 3PX2A 4QPNA 2JHPA 2OB2A 2ERCA 3TPZA 1WG8A 3U81A 5KS2A 3BGDA 3HA3A 2Z6AA 1SUIA 2OBFA 3KQYA 3G2MA 2WA1A 3SX0A 5K05A 3DMHA 3G7UA 2ZZKA 5HIMA 3UJBA 4QVGA 1X1DA 2V7EA 2DULA 3DLCA 3GDHA 4PINA 4B17A 5LQCA 3F4KA 5LR6A 1NW5A 2BH2A 1JG4A 3GGDA 3MERA 3FTFA 4YMGA 3MAGA 4DCGA 3GRRA 4CKBA 4GF5A 3B89A 3HA5A 4E2YA 3NMUF 2GA9A 3EVCA 2PXCA 5DM2A 4GQBA 5CD1A 2HR1A 1NBHA 1Y8CA 3UJAA 3TOSA 2PLWA 2OY0A 2PGXA 5DTRA 5BW5A 1NW3A 2FHPA 2HTEA 4PWYA 2HWKA 3OFJA 2HMYB 4QTUB 2BM9A 3DP7A 3B5IA 2BR5A 4JXJA 4X1OA 3TM4A 3EVGA 1YF3A 3LX6A 1RI4A 1MJFA 3BT7A 2NNWB 2UZ4A 3C0KA 5HZMA 2AVNA 3BXOA 1R18A 4OA5A 2VZ9A 3GO4A 4ER0A 5FULA 4DMGA 5C9ZA 5FWAA 4HRAA 2IBSA 4L7VA 4KIFA 1G8SA 4YUZA 1YUBA 4A6EA 4C07A 5K01A 2PVCA 5D1NA 2OXTA 3K6RA 1YB2A 1EJ0A 1R6AA 1T43A 2ZWAA 4FSXA 3HA7A 4RWZA 2PBFA 2AOWA 5EKUA 3KQVA 5EG5A 4E30A 2I9KA 2NXEA 3ELWA 3G2OA 3GWZA 5GWXA 4RTSA 2O0LA 4PONA 1JQ3A 3HVKA 4X60A 3C3PA 5DTQA 4KDCA 5JR3A 1JSZA 2VDUE 2ZZMA 1L1EA 4HG2A 2PV0A 3LECA 5GM2A 5B1SA 2R6ZA 1MHTA 2GH1A 2XVMA 3T7SA 2O06A 2QRVB 1VP9A 3CVOA 3I9FA 1Q0SA 5K0BA 3MCZA 3ER8A 3IV6A 2Y1XA 3M70A 3MHTA 5BP7A 2AOTB 5K09A 2P7HA 3KQMA 2Q41A 2CKDA 3VYWA 3PLAE 1X19A 4R6XA 3LDUA 4RTQA 3FTCA 2FRXA 4FP9A 3EMBA 1XDSA 4DA4A 5H02A 4R8RA 1XCJA 3HM2A 4AZWA 3EVBA 5FA8A 3C3YA 3OE4A 4OQEA 3FPFA 4RTNA 3DMFA 2ZIFA 3PVCA 3GNLA 3I53A 5EKXA 3TKYA 4KVZA 2IFTA 3G2PA 4UOEA 3KPYA 5T64A 4CKCA 5LQKA 3GRVA 2PWYA 4Y30A 1O9HA 3LL7A 4H0NA 4R8SA 3MCTA 5K0CA 7MHTA 3AWIA 3LPMA 3FUWA 3CC8A 4F84A 4BY9E 9MHTA 5EMKA 2NP7A 3PS9A 5E1DA 1KPGA 1R00A 1WS6A 2GAFA 3HVHA 1JG2A 3HCCA 3LSTA 5DSTA 3FTDA 1TPYA 2AOUA 1G38A 4PGHA 5T67A 1BC5A 3SR4A 4E70A 5K0EA 1DCTA 1VIDA 1TW3A 5CCBA 10MHA 2AOUB 5LQRA 4GOND 1PJZA 4LG1A 5FHQA 3HVJA 3JWJA 1M6EX 3LGAA 1X1BA 1VE3A 2O05A 3ID6C 3WSTA 2YR0A 1VP3A 3HCAA 1X1AA 5T6BA 2H00A 1EQAA 5EIWA 1F38A 3JWIA 2XYRA 4HC4A 5DTMA 3NDJA 3BWCA 5E1MA 4EQZA 2GB4A 2PY6A 2BM8A 4IWNA 2R3SA 1IM8A 1R74A 2ZW9A 4ISCA 4OBXA 1NV8A 3M6UA 5EQJB 5GOZA 3UWPA 5LQUA 1HMYA 5EMJA 2GLUA 2FPOA 4U7TB 3CCFA 3T7RA 4IV0A 2AVDA 3M4XA 3NWEA 3OCJA 1JG1A 2Y1WA 3CKKA 1F3LA 3LHDA 3UJ6A 3SMQA 1UIRA 5DXAA 2UYQA 5EMLA 2EJTA 2P41A 1G55A 1KXZA 2ORED 1RJFA 1ZKDA 2FCAA 3G5LA 3MTIA 4A6DA 4BLWA 3EGIA 5E2BA 2E5WA 3OZSA 1VLMA 4C06A 5FA5A 4GUAA 4YV2A 4WXHA 4FSDA 4PGGA 3CJRA 3E23A 2H1RA 3OU2A 4QQNA 3UJ7A 3LCVB 2B25A 2OPBA 5CVDA 2ONZA 3ELDA 4PYJA 4P7JA 2IH2A 2DPMA 2EJUA 1JTEA 3KR1A 3TMAA 4RTRA 2P3LA 4DCMA 5K8VA 2C7OA 1NW6A 2PX2A 4GOLD 4KDRA 1Z3CA 3C6KA 2K4MA 5E9QA 4RTOA 4RTMA 3KPUA 4FS8A 3JWGA 4QPPA 2YXLA 1RJDA 4U7PB 3KKZA 1AQJA 3UA3A 3HCEA 4AX8A 2Z6QA 3B3JA 4BP3A 2OYRA 4ER7A 1Q0TA 1FP1D 5ICCA 2B3TA 1EJ6A 3O4FA 4GEKA 3IYLW 3M6VA 4R05A 2QYOA 3FUTA 3K0BA 3A25A 3I58A 1XCLA 1YZ3A 2IGTA 1M0EA 1DUSA 1KPHA 3P97A 3VC1A 3HCDA 5CVUA 5DX8A 3PTAA 1ZGAA 3KR9A 4EK9A 5FQNA 5F2NA 3FUXA 1P1BA 3LBYA 4PNEA 2C7QA 5C0OE 2IP2A 2NXJA 1XXLA 3EVZA 3R24A 1JG3A 5CUQA 2AS0A 4BP1A 3KR0A 3OU6A 2CMHA 1JQEA 5GM1A 3M6XA 2B2CA 5DM1A 1BHJA 1AF7A 1B42A 4GBED 2PWPA 2AR0A 4M36A 1RJEA 2CL5A 3LCCA 3REOA 3V97A 4PYLA 2O07A 3O7WA 2VP3A 2FK7A 3R6TA 1XJ5A 1NE2A 5K0GA 4V0RA 2YXEA 2F8LA 5EHGA 5EIFA 5LQAA 4RTKA 2I7CA 3G8BA 3NW9A 2ZBQA 3O31A 5GIPE 4HTFB 2OZVA 1QAQA 4KIGA 4EKGA 4PYNA 4PYQA 4MHTA 3THRA 1WXWA 4OBWA 4MTLA 1ZQ9A 2QRVA 5EEHA 2UYOA 1PRYA 1WY7A 4IV8A 1KHHA 1SVUA 4KWCA 5DPMA 4DF3A 3ER9A 1BKYA 2CWWA 5LSAA 3KPJA 2P3QA 3TR6A 2AOTA 3CJQA 3PB3A 4YUWA 1L3CA 2NYUA 4XUCA 1OR8A 1P39A 2QY6A 1D2HA 3CGGA 3EPPA 5DRYA 3SSNA 2ZZNA 4G56A 1YZHA 3EVFA 1I9GA 5KQRA 3OZRA 4RTPA 3FUUA 5EMMA 3DLIA 3UJCA 3QOXA 3RW9A 2HV9A 4E31A 5E1BA 4PYOA 3EVDA 4FT4A 4XCXA 1L3BA 1FPQA 3FYDA 1SG9A 2ZBRA 3EGVA 3EVEA 5CVJA 2UYCA 3KQOA 5BW4A 4PCLA 1VL5A 5MHTA 5DWQA 3T7TA 3L8DA 2B9EA 3FYCA 3KQTA 2YX1A 4YUVA 5DX1A 2QM3A 3UJ9A 3AXTA 4HGYA 3OZTA 3KU1A 3CJTA 3ANXA 4CTKA 4E2WA 4C04A 3OPNA 3OFKA 2HNKA 3H2BA 2ZULA 3P9IA 3BWMA 3NJRA 1WZNA 5E8JA 5E9JA 5E9WA 3QOWA 4RYLA 4YUXA 5FQOA 4C4AA 1FBNA 5FCDA 1JR4A 1P1CA 4PYIA 1JSXA 2JJQA 1N7JA 3B3FA 2PX4A 3P2KA 5HILA 3BWBA 1M6YA 1N7IA 3HEMA 1YFJA 4RVGA 3R9XB 2BR3A 3ELYA 3HNRA 3CBGA 3EEOA 4PCAA 4M7RA 1KP9A 3EVAA 3D2LA 5LQJA 2ESRA 1QAOA 1V39A 4CTJA 4IKPA 3FUVA 4CKEA 5DLYA 4RSRA 5DT2A 3EEYA 1QANA 2ZWVA 3KPWA 1JTFA 5DXJA 5K0FA 2XVAA 4DQ0A 3FPJA 1NW7A 3SGLA 5DM4A 3KHKA 1G8AA 4P7KA 4XUEA 5EEGA 4F85A 3C6MA 3GRYA 4FR0A 4C08A 2C7PA 3P2EA 2ZBPA 1ZG3A 2BR4A 3AXSA 4KRGA 2P7IA 2ZFUA 3ME5A 2GS9A 4RVFA 3THSA 3UJDA 4BLVA 1RI2A 3G89A 3P9KA 3TKAA 4P7GA 4PIMA 3BWYA 2CMGA 2ZIGA 2AN5A 3E7PA 3GRUA 4MIKA 1INLA 5EGSA 1KYWA 3HTXA 2ZTHA 2JG3A 3DXZA 3NWBA 3PFGA 4MQ4A 4NECA 4E2XA 3ORHA 5G02A 1EG2A 1L9KA 2XYVA 3EMDA 2IBTA 5EZQA 2NXNA 4GOMD 4M37A 3BGIA 3G5TA 2G71A 2YQZA 3FRHA 3TM5A 3TRKA 3G88A 3GU3A 4KW7A 4ZTBA 1FJXA 5EC8A 2AN3A 2JHCA 3FTEA 3FPGA 3SSMA 4YV1A 5KVAA 5K0LA 4CWAA 2PXAA 2WK1A 5HIJA 2GPYA 1ZHFA 4M38A 1R8YA 5E1OA 2QE6A 1G6Q1 1ORHA 1BOOA 2YTZA 1RI1A 3B7PA 3I64A 3LBFA 4FZVA 1G60A 1XDZA 3KQSA 5GP1A 3LCUA 4GC9A 5FHRA 4WVLA 2FYTA 4HSGA 2G70A 2PX8A
chains in the Genus database with same CATH superfamily
4TT3D 5AHXA 1OZFA 3TFQA 4DTCA 1AZSC 3LK7A 2P6MA 4DR4B 5HIKA 2R85A 2GAJA 1M7BA 2EX0A 3IP5A 3MRSA 1KNXA 3U6OA 3TRHA 5C8XA 2L09A 2UUBM 1U7HA 2POQX 3DBHA 3ORRA 4WZZA 4MQFB 2H7XA 1PN3A 4N3GA 4JLPA 1HH4A 2VPYA 2GM9A 1O8CA 4GMFA 4HYYA 4NENB 1OLXA 4QDZA 2C3PA 5TRTA 3AVPA 4RD6A 1GKUB 3EC2A 4TVBA 5FL7D 2IYNA 2D7GA 1AHNA 2D7JA 3K2QA 5SYAA 3SI7A 3BRSA 3UAYA 4EG1A 3HG7A 4EJ6A 2EL9A 2R6R1 3RKRA 1FA9A 4OBBA 3ODPA 3UAOA 4C7XA 1EWQA 3MCVA 1B6RA 4JOBA 4F3NA 3VH4A 1TOAA 2VDLB 4G1FA 4L4RA 1OXXK 1P2DA 5F9MA 4D42A 4C0SA 1BKSB 4WCFA 3AF0A 2YJ4A 5DGTA 2Q0QA 1ORRA 1BOFA 1J2TA 4H7DA 4D0RA 5GKNA 1DP4A 4JHLA 2PKWA 1ACJA 2IODA 3U81A 2L17A 2JLAA 4AJJA 3I6IA 2DX7A 4QM7A 4GVXA 2YV1A 4O2RA 4UM9B 4O2AA 3EZ9A 4MVJF 5J47A 1S7CA 3ORYA 1KMHA 1L4BA 3TW8A 2MJLA 1JKJA 1H0KA 2ODNA 4WESB 1YFZA 1X80B 5EG5A 5B4UA 2V03A 5ECGC 1L1EA 2FZCA 1A04A 4CL2A 1C9JA 3CUYA 4ZI7A 4A92A 2HIMA 2EF1A 4PNZA 4OHCA 4PG5A 1TZJA 4D9NA 4TT8A 1OWNA 5CFPA 4DR1M 2GN4A 2Q3HA 9MHTA 3AUSA 3IPAA 4JI4B 4RHTA 1GPWB 1RZRA 5FBRB 1XLUA 1UF9A 2BUCA 4V38A 1ZJWA 5AHWA 3OPXA 1LSUA 3H1GA 4N6OA 5AI0A 2XNHA 4KNVA 2EBWA 1QDTA 1ZWKA 4D9EA 1PQWA 4I9UA 2HREA 5FPYA 1RZUA 4YMWA 1W4ZA 4YRDA 4AJ4A 4R68A 3K1TA 5K4HA 4IFEA 4HMQA 1RDFA 2IOFA 3A46A 3FCUB 1NN0A 5DNUA 2FSVA 2DWZB 4QT4A 1AKTA 2F9LA 1K8XB 5B2ZA 1O97C 3FHJA 4LDAA 2H2DA 1ZOOA 3KDAA 4A1FA 3VTZA 2C83A 2R5FA 4MYSA 3RUPA 3WL3A 3SASA 1SUFA 1V7CA 2B2CA 4PRZA 2BHLA 4YY3M 2VT7A 3HU5A 2PQ0A 1K9SA 5JXIA 2JIRA 3TNYA 1NQ5A 4PXAA 4WW0A 5HS4A 1BSVA 1M75A 1ZNZA 2IZ0A 2AOTA 2AHOA 2JAWA 3JQ8A 5FX2A 1O9BA 1TQ2A 3MRXA 5I7OA 1ZV1A 4PZPA 1ZIYA 4NEHB 2NTEA 3WJ1A 4Q3CA 1XZEA 5E4TA 4H6VA 1W4AA 4NAVA 2YV3A 2X76A 1PR3A 3VHLB 4C04A 1VHDA 5H3HA 1ZGHA 2WKWA 2HF7A 4OHWA 3E53A 4BB9A 2BMWA 4RLHA 4RZQA 3L7YA 2I3DA 4A0FA 4L8WB 1YDFA 4XK8F 3UVEA 4CEIB 2BFBA 3ITDA 4FJ1A 4PHTA 2ECPA 3TKAA 2FPXA 3WAJA 1KYWA 3DO6A 1GEGA 2DJ5A 621PA 2Z5VA 3V4VB 4IQGA 2IA5A 1ADGA 4KPEC 3PX7A 3PICA 4TTRA 4S12A 2YTZA 1X2EA 1C1YA 5AW3A 1A8SA 1FUKA 4P16A 3R5JA 2FMKA 1J9GA 3EQ6A 1L5RA 3P9RA 2YRXA 1O6CA 2Q5HA 4F1JA 9ABPA 4P34A 4CU2A 3GEMA 3IDSA 1ZAKA 3HJSA 4QYIA 1YR9A 3FG9A 5AVZA 2GK7A 1A5SB 3JZIA 2JLUA 4PLFA 1L7NA 3TG2A 2XHZA 1Q7CA 4BMCA 1Z7YA 3AIIA 3W05A 1GVNA 2ZYRA 1P1HA 4HX2A 4K9DA 2OUKA 4DA7A 4AY2A 1QHFA 3P4YA 3MT8A 4DLXA 1BCRB 4PZZA 4ZGBA 3SBOA 2MR9A 3P9ZA 1T6XA 2Q1XA 1BU8A 1SQFA 1MQ8B 4D8VA 1DJOA 1RWNA 3C6XA 2OENG 2VJMB 5K0JA 3CMMA 5HF8A 2FY8A 4FR2A 3QV2A 2QDXA 3WQQA 4DWOA 4Q1CA 4DCSA 3S2ZA 2VJCA 3UUWA 1BWPA 3OQNA 2J9ZB 3Q0IA 2AOXA 4US0R 5DIFA 3AOEC 3BJIC 1S0UA 2WZCA 2JW5A 3JQ7B 2YJTD 3S68A 1DBWA 1GPKA 5K8IA 4LJSA 1WB4A 3WZLA 2JFZA 4RIEA 2D62A 4C1NA 1XHEA 3DBLB 4V0LA 1XU4A 4GVLA 4G4RA 4H3HB 1ZNYA 4E2YA 3B7WA 2BZSA 3KHTA 2NWQA 3MINA 4US2R 5IREB 5IJWA 3TLEA 4PDGA 3BEOA 3HABA 2Q29A 1MVNA 3HWSA 1C3LA 4LMAA 1U65A 1HSZA 2ZXEA 3AJEA 2A88A 3DT6A 3N86A 3DEYX 4PFJA 3I04M 1VBNA 3AK4A 5JCOA 4JCCA 2J5YA 3WTCA 4HPJB 5ELMA 4P3NA 5K0BA 4W9NC 1OI3A 2XE6A 2GSWA 2V7UA 1SU7A 1L8OA 4BLPA 3P5SA 5EJFA 3C41J 3WJ2A 4IKOA 3STXA 3KB1A 2CNBA 2OZLB 1RWPA 3KCQA 5IANA 5I9NA 4O1MA 3SHOA 3RBZA 4KDEA 5BN3A 1VSQA 3TEMA 2G7MC 4RCVA 1NGSA 4M2LA 1QDLB 3J80S 3IOCA 5C32A 1PE0A 1VE3A 1P7PA 2H48A 1FYEA 4MS3B 4OVZB 4NYJQ 1MA0A 1AKMA 3UK6A 1ULUA 4BXOA 3OQIB 1HC7A 5TNXA 3IUPA 2BF4A 1ACMA 1SHKA 4FWTA 1Y3AA 4FFBA 3PKZA 1NXWA 2ZREA 1NM5C 1JP7A 4MROA 1I3KA 3R6WA 5LZ9A 4TVOA 3Q7SA 1W4BA 2IY9A 2HRBA 2F00A 3H6KA 4BUCA 1FL9A 1DDIA 4JUBA 4P2BA 2OBYA 3DMTA 3NBYC 3PYLA 2ZEJA 1L5HB 1XK6A 3M9WA 4UQPA 3PXBA 5EN4A 3ZDFA 5BSUA 3ZDXB 3M81A 4FS3A 4LYJA 1Z0JA 4TKUA 4MH0E 3B1ZA 3RVSA 3ROPA 4DV6M 3VDQA 4EB6A 1SG6A 5JT1A 3EQ8A 5T4EA 2GA8A 1WKCA 3H2BA 1DLJA 3MT7A 2PZLA 4U6NA 3H1FA 1Z0DA 5JDIC 4LBWA 1V5IA 1S8AA 1QRUA 3QY0A 3PWKA 4ZVUA 3AY6A 4G8DA 4LRSA 4FC6A 5JOQA 4F4JA 1UM8A 2GM3A 3HFJA 4PGAA 2PZMA 3Q11A 4OL0A 4JT2A 2C7PA 1DVRA 2IYQA 4DFDA 3PEWA 3IR7A 1K5HA 3V1UA 3KBOA 2DTDA 4UNRA 1XAIA 4JLNA 2NXNA 4GMHA 4ZTBA 2RJNA 2C2MA 5K0LA 4FFOA 5C8VA 2QT0A 3OZXA 2DWMA 2BIFA 4G1VA 1LU9A 2MSCB 3ZK8A 1ADBA 2GEBA 3G6WA 2PO7A 4GI1A 1YU9A 1GGFA 1R0YA 4UHJA 4EUHA 1WTAA 1I1NA 2DWLA 5HCUA 3FPCA 1NR7A 2FG6C 4C05A 1M1ZA 3AHCA 1PFVA 2X2FA 3I62A 1XQXA 2XYQA 4NFLA 4IBIA 4GPEA 2CMDA 2W6QA 2IS6A 1XLTA 1R2YA 1SKMA 3SLGA 3BSFA 2G17A 4Q7LA 4GPAA 1SKAA 3IG5A 4JI1M 2N75A 4Q7QA 2SCUB 1P18A 4KVGA 1KK1A 4EGFA 4AO7A 4BEVA 5B57C 4PWZA 1HLDA 2D4AA 2O8NA 4GEGA 2VJBA 3VU9B 2MYNA 1BMTA 1B4DA 2ZXFA 4YROA 3HL0A 2LKCA 5EIAA 4KQ9A 4CGYA 4PIPA 2WYUA 4MWZA 5GJVC 5J2TB 4EGSA 4QT0A 4XCQA 3P2IA 1CJUC 1Z62A 1FLNA 1RPAA 1JMYA 5KWSA 4PAOA 1A7KA 4DYVA 5BYJA 1V25A 1KRXA 1AKEA 3UW3A 2XGSA 4DLAA 4F3KA 3I4YA 2DULA 3J7AC 1GSHA 4ESEA 2OORC 2HR1A 4AD8A 1CCWA 1KH3A 3NEPX 3UJNA 4PWYA 5FBWB 5F21A 1XYGA 2W4IA 2ZXUA 2QG4A 5FXMA 3AGPA 4A5SA 4OJNA 4IXMA 2VAMA 4BMNA 2E4ZA 2ZWAA 4AJHA 2VQEM 3A9TA 3ZWCA 4MHOA 3TAXA 2DCMA 4G65A 1P0FA 2IV3A 1ORDA 5K99A 3BDIA 4REZA 1SPXA 1TU4A 2BKVA 1ODCA 4LBYA 3H5NA 4C7OA 2Z3XA 2VO1A 3RVLA 2EHJA 4ZXPA 5T41A 1XWIA 3P20A 4R8SA 3MCTA 1GDTA 1OT5A 1Q3KA 4JC0A 1E6EA 4CIBA 1NDUA 3HBLA 4ENUA 4KMRA 1GPDG 3MLEA 1JZQA 1WEHA 3FX2A 2FLVA 3EAQA 2WF8A 3KVVA 3K8QA 1NFRA 3ET5A 2DAKA 1U8AA 2TRSB 4AX4A 5DHRA 5CVTA 2OXFA 3PDIB 1X42A 1GGEA 2N9UA 5B3LA 4XOUA 2QTVB 3CKLA 4BIIA 4KDRA 1EIJA 5BPVA 4ZA2A 1UXOA 2OV3A 2ZAOA 2DHDA 4B6QA 2PUGA 3IYLW 4DIUA 2Z2IA 4F5YA 2OHJA 5AVTA 1XCOA 5KVQA 3BD6A 2QP3A 1JG3A 3GLIA 2NZ8A 1D4OA 1KAEA 3D3JA 2XVXA 2HQOA 3FCYA 1WOYA 2YMQA 3CUEF 2GCOA 1JPJA 1AGYA 4FLMA 2XY4A 3AW8A 3SX4A 1MU5A 5LP6C 1H6BA 1HYQA 3M1YA 5A6SB 3TL2A 1A4RA 1JFVA 1KXJA 2HRZA 5EP3A 1NMXA 1XXHA 1KOGA 4PQRA 1YMQA 3HB1A 1PKEA 4RZSA 4UDNA 4B7UA 3AUTA 4E5UA 4LZAA 4EECA 2XB6A 3WLNA 2H1SA 2EKZA 1QJCA 1V43A 4TV8F 3C8HA 3CMCO 3TSOA 4IDCA 2HWWA 3M4NA 2X86A 4RU1A 3C6MA 3FM9A 2YWCA 2QAJA 4FLEA 2O2DA 1VZ2A 1Q0RA 1XV5A 2DKLA 3D6JA 2JL1A 2A3NA 4LF8M 3L7MA 3PFGA 1DDOA 1U81A 1XZGA 3GLHA 1KWGA 3SSMA 4B84A 3H9EO 3TL6A 1P7WA 3NM5A 3ZS9A 3W7VA 4KO2S 4RZXA 4IS3A 3BFVA 5ALQA 1M2KA 2TYSB 3O9ZA 1UBLS 4MUHA 3WV4A 2PVPA 4MQ5A 5JPIA 4EVIA 3LTEA 1G2PA 3RJ5A 1TK2A 4DOMA 2XTNA 4DLSA 3CVJA 4PZAA 3LBIA 4CKYA 2RH8A 2A9KA 3GUUA 1Q3TA 1J22A 2YN2A 4RETA 2P11A 5LP1A 3RNLA 5L9AA 4KR2A 1QX4A 4XWAA 4X6XA 2GEKA 3IAAA 3QVXA 4IJQA 1PZHA 3NNDA 2DAPA 3EBPA 3GLUA 1JLLA 3IRVA 4BQRA 5BQPA 4NY1A 2Y4NA 1EIZA 2LTUA 2NTYC 4BNFA 4JUAA 2OCKA 4IMIB 4B4WA 3OCUA 3VVCA 1M5UA 2AUTA 1PGYA 1V4NA 1J90A 3PJFA 4AS1A 1WCIB 1FYXA 3TXAA 3ZE1B 5H83A 1G8JA 4DDKA 2CLHB 2WU4A 2F1IA 3GN2A 2BI4A 4MV1A 1X13A 4U0JA 4BMYA 1FJGB 5AW1A 5CT9A 4GWLA 3RRMA 4EUEA 4XGKA 4GQAA 5FSWA 1ABBA 4MR7B 1ZJ5A 3KP1E 3I2JA 3UMMA 4JCOA 2N42A 4YDQA 1NR5A 1JGTA 3SP1A 5BWMA 4CMBA 4CISA 4W6ZA 4B3GA 1U8EA 3LNCA 2OB2A 1GU7A 2V7WA 1G18A 1DT5A 1K98A 1JX6A 1RT9A 1MC5A 3PJRA 1ELOA 3P9XA 3UPTA 1WQ4A 4GOKA 4OI4A 2YYYA 3DXFA 1E7QA 3ONDA 3OPYI 1NJGA 4QWWA 2O7VA 5IRCD 1XGKA 3EPKA 3VYRB 3PWTA 1SHJA 3KALA 4LOIA 2X15A 3TWKA 1PS9A 4K0RA 5D00A 3BHNA 1OGYA 2F1KA 1MZVA 3BHIA 4MV7A 1RQXA 5ITSA 1W96A 2JLBA 2H51A 2NVOA 2BTOA 2KNZA 2OO9A 4LG2A 2DECA 2RARA 1N5JA 4JBYA 3GNLA 1X7WA 4U9UA 2ZIWB 3OECA 2BGTA 2V6IA 4AN0A 7MHTA 2GHTA 4F6RB 1JG2A 3PYMA 2HUNA 4FFPA 3EXHC 5CT5A 3PQFA 4J2OA 2C2HA 3T0GA 3NRJA 3IESA 2GLUA 3AVUA 1Q12A 4MITA 2Z04A 3BOSA 2H2AA 4PHGA 4KGVA 4BO3A 3TECE 1C30A 4MXDA 2NOAA 1K3WA 4IKEA 4LXQA 1S8OA 3KQKA 3HXMA 4GHWA 3ASUA 3I6ZA 3R1IA 2RRUA 4RCZA 3GA5A 1L5LA 3X1WA 4W7HA 2XVZA 4E3WA 3RHZA 5DNYA 5F7XA 2P8SA 1GNSA 3QGMA 5KNCH 4YFVA 5LQAA 1HL3A 2YJ6A 3LQ4A 5IZCA 2WJHA 5AM3A 2GM4A 5DRYA 4JVNA 4P0PB 2O8EA 5SY4A 1PTKA 2QU8A 1CR1A 1E2GA 3QKWA 4H7JA 1E4VA 2A9FA 3KSZO 3R3SA 4TTJA 4DIFA 5IKPA 3G8DA 4QPDA 4ZHQA 4P3XA 4IIUA 5E9JA 4NNJA 1M5TA 4KMMA 3BWBA 2VHUA 1PTJC 5JSZA 4RORA 1V39A 2IS1A 3KXEC 2O3JA 4X1YA 3N7UA 3O8RA 3LFUA 4UM8B 3K0AA 4DSUA 5I5GA 5AVUA 1RYZA 1V9LA 2R751 4EJMA 1B0ZA 2GS9A 4BLVA 4D92A 4CLXA 1SKYB 2ID9A 3H4TA 1W0KD 3FRHA 2YZ2A 1U3WA 1Y5RA 4MWSA 5B4VA 2HMWA 5JW6A 3SJUA 5DE3A 2L6OA 3CRQA 4P82A 1G21A 4D6XA 4ANRA 2UXDB 1ESNA 4CIAA 4NYMQ 1K6XA 1XC7A 3OEEA 3MTDA 3S4YA 4CMIB 4M0EA 5JQWA 2VI5A 2JWSA 4HT3B 3VTFA 4E2ZA 1H6UA 1TO1E 2X58A 4Z4EA 5EJ4A 2EOAA 1C7RA 4OYHA 4FINA 1FXUA 3GP8A 9LDBA 3K20A 1E1QA 4MB0A 3L2OB 2ZRQA 3LKVA 5H3LA 1L4MA 3QLUC 3EBLA 3PXAA 1BN7A 4QNNA 3LRTA 3I4CA 3GJYA 2QVLA 4KYTA 3PITA 2JRCA 3REFA 1FFAA 4G8JA 3OF5A 5ABPA 2I6UA 3N2KB 2ZYSA 3A9SA 2AOVA 1XRNA 1WQ1R 3PFHA 3M3DA 1Z68A 3CN9A 3MMXA 5SY6A 3GELA 2V65A 1WU7A 2A14A 5D1HA 1FXSA 4PYKA 4M3NA 1AKUA 3U26A 3OZIA 4XVHA 4BVAA 4Y1RB 5IS2A 1C81A 1X77A 3FUCA 4YACA 1I13A 4K6GA 4CEHB 1FFWA 3X1JA 1M0TA 1GPLA 1WB5A 4C88A 3HYSA 4OXKA 4HLDA 2UXBB 4B6JA 4XQCA 4MRMB 4BJ1A 4XASA 4HDRA 1Z2OX 3WLLA 2Q6OA 4BO8A 2XA1A 4DCGA 2ON6A 2JF0A 1EHYA 2QPTA 4ENTA 3NEAA 5JS8A 1W52X 4L5BA 5KZMB 3H2GA 5HBGA 2NU8A 4NRDA 2HU2A 5JJCA 1U63A 2PCLA 5AI5A 5JMWA 2V6JA 4QWMA 3D6HA 1XEWY 1JEDA 1UMBB 2I9KA 3AQ4A 4KFRA 3PC6A 4HAUA 3EXFB 4UE3S 4O6VA 2OV8A 4I4LA 4TV9B 4E09A 4EZEA 4WJZA 3AETA 3Q7IA 5FA8A 1PHRA 3SG0A 1IHXA 1VIAA 3V6LA 1BXRA 1T2NA 2ZRNA 1ZK3A 2DPXA 1CNEA 2Y0CA 1MIHA 2QNIA 5KWVA 3BD7A 2BDTA 4KWEA 4ZYWA 3E70C 1C80A 3CR8A 2WE7A 1NUHA 2HJWA 3K35A 2Y1WA 2AF4C 3M6FA 4WLUA 5EHXA 2V3WA 4QJ4A 1R0LA 3IEUA 1T6YA 3E23A 5CXQA 2E49A 4LXIA 2IYVA 5CDFE 5E9QA 3UA3A 2C8VA 2CXHA 1Q7TA 1FMLA 3LA8A 4GEKA 5ALFA 1CF9A 221PA 3IOMA 5ITWA 4CODB 3ANTA 1P1BA 1WU8A 2AS0A 3EZXA 1A4XA 4Q03A 3N6XA 4CN9A 1SKQA 1MGOA 1OROA 5JECA 4F5ZA 2X5XA 2OHOA 4MUGA 1O0CA 4CQJA 2ZBQA 5DFAA 3Q3HA 3THRA 5EIHA 3RSHA 1M8PA 2IU0A 1EK1A 2WICA 2I2XB 1OY1A 1J2EA 4TTVA 4M9ZA 1OH6A 4I8DA 1S4QA 4BKMA 4MR8A 2O0MA 4MA5A 3TK1A 3X43A 4CV0A 1AH2A 2ZT5A 2YMPA 5KKCA 5KSZA 2JAUA 3UMVA 5AW0A 1I3OA 2BW0A 2XX3A 8ADHA 1X87A 1R0RE 1PDWA 1ENZA 2CDAA 2H1IA 3W2HA 4F56A 2MJ5B 3GRFA 1TQDA 3DT8A 2VDKB 3RDPA 2BI7A 4C5AA 4NJEB 2QLFA 4DUZM 3ZGLA 4Q24A 2H5EA 3ZTWA 3FPAA 3W6NA 3HXKA 2J30A 4KO8A 3T3NA 3N75A 3VJLA 1Y6QA 1I4WA 3GJSA 3ZXIA 2AA3A 2TMGA 4KLZA 1OHHD 5IBRA 5BSKA 5DBHX 1GSIA 3DMPA 4HO1X 4ALNA 1EVEA 4BX9A 4AL4A 1ZGJA 5DHTA 5DZSA 3F5DA 2R84A 4F92B 2IF2A 1OFVA 5EZYA 3L7NA 3QWAA 4JU8A 2AFIE 2UV8A 5FKJA 3ORSA 3LDAA 1F8FA 3MHPA 3RT1A 4MPJA 2DTXA 1JVNA 4IGIA 1X7GA 4LVUA 4K6MA 1NVMA 4A0GA 4KUGA 4I1OA 3DDSA 1H4TA 3QE9Y 1QZXA 2NZVG 3VAZA 2H4ZA 2PZFA 1V3UA 1IG0A 1SXJC 3IMEA 2HLNA 1KMNA 2X4DA 3JYPA 4LKOA 2ATIA 4YJ2B 1LDEA 3GYGA 5FTWA 2HMTA 2O3QA 4UHKA 3W2FA 3FBTA 3DCNA 3MMPA 4KC0A 1FU8A 2FOIC 1MN3A 1TQ8A 2X1HA 3CNEA 4KQCA 1HQYE 5LYJA 3N8GA 2Y20A 2JK0A 4L8YA 5IT9A 1IHOA 4ADSG 2VDWA 1AGPA 1YACA 4JA2A 4G4JA 4U6SA 3FZYA 1JZTA 2RAVA 4KXMA 1N3LA 3AILA 4MWBA 5C1OA 5BN4A 2HSWA 3B7QA 1P5JA 3D6AA 1K5GA 1ZR4A 1R8JA 1EGHA 1SWVA 2DBQA 4DIBA 4DXAA 5L53A 2HHCA 1DC7A 2O1XA 4PG6A 5TEWA 4IIJF 4DIEA 3NHYA 1G5FA 4GH9A 1I3NA 4UFNA 2YVUA 1FNMA 2LZ0A 1RRGA 3NIGB 1P4SA 3LW5F 4ZEMA 3UAGA 1CG6A 5AIBA 5EHZA 3AI2A 4ND5A 2L4EA 5F64A 1IBLB 3UOAB 4BMDA 4ALKA 3SC6A 1KVUA 4D6PA 3FF1A 3TDKA 5FH9A 3C3PA 1G6KA 3KIPA 1RZRD 1N5KA 1BDIA 5JZMA 2VDBB 2HY7A 4XQEA 2R6FA 2VNSA 4B7HA 4ZICA 3FTCA 4YDRA 2VH5R 2GBGA 3EVBA 3CLSD 3FR7A 1E6WA 2H2GA 1VL0A 1DGBA 4IX9A 2YUTA 2R1VB 3Q8GA 4UHFA 4RPGA 2FQWA 1JEOA 3TZLA 4RF1A 3LK6A 2WWYA 1VPLA 1NVUQ 5KUTA 3LVVA 3BICA 3AC0A 3RTGA 5E0OA 1HMYA 5AUQA 5EJ5A 4Y6OA 4D45A 1Y9AA 4F2WA 2HC9A 3PEUA 2P41A 3EW9A 4PLGA 4UHEA 5JAIA 4XQGA 1JT9A 1F9EA 3OWXA 4N3NA 4KQMA 2RG7A 1V48A 3VO2A 1LNSA 2XMDA 3IPYA 3ZX4A 1F7UA 2Z58A 2ZGVA 5TJHA 2AXQA 1D0MA 4AX8A 4IZOA 3ZW9A 2QYOA 4RPHA 5IMBA 3K0FB 2HA2A 3Q5DA 1M0EA 3VC1A 2Y9PB 2WZDA 2Z7JA 3OJCA 1PFGA 1W0KA 4JBLA 5E38A 3BXZA 1IUPA 4F6LA 1KTIA 4IQ8A 4X44A 3IMGA 2EBHX 2PD4A 1T1JA 1OR8A 4ZOBA 1VIYA 1TAQA 2Z09A 3D3WA 4AP5A 3ENKA 5IZ7D 1J23A 3RAJA 1N6IA 1Z12A 2BEUB 3H1EA 4RSHA 1SELA 2YX1A 1PWHA 3OI7A 2QJOA 1EHIA 1WZNA 5B2EA 4AJ1A 4DJTA 3PDCA 4CMEA 3ND7A 1LW7A 1AM4D 5F1OA 5EWMB 4R5MA 5J4HA 1Q1GA 4X62B 1P80A 4HYEA 2Y0TA 1EG7A 3VNQA 1PSWA 4C89A 2WD7B 1ZCJA 3FH0A 3F74A 3SNHA 1S3GA 3F92A 4IGAA 3ETEA 4JR0A 3WL8A 3AB3A 4KBYA 3VZDA 4LRUA 3R4VA 3SFZA 3I9OA 5K8UA 2ET6A 3F78A 3CIFA 4RK0A 2G63A 5C46F 1NVVR 3CZ5A 3C3CA 2FSFA 2AN1A 3WG9A 3D6TB 3K9CA 2VKQA 3BIFA 4S1OA 4TWIA 4CKZA 1CIJA 2HNAA 2YHBA 1BS9A 4PC2A 3OX3A 4MUEA 3ROXA 1J8YF 3WZMA 3TLXA 4N65A 5EE3A 4FFVA 5C18A 3EFOA 1O5OA 3M1AA 1QV9A 2B6NA 2CHFA 4F8YA 4MVJE 3LIPA 4DJDC 2Y27A 4PC1A 4HH0A 3SXJA 3KOXE 1A1VA 1KZYC 1C9DB 3FWYA 3T3MB 3NTVA 2BFNA 2EEPA 4AJIA 3PUJA 2X0NA 5KTKA 3WP1B 2W00A 3BFPA 4DSNA 1E1LA 4DV1B 1Z3IX 1N4DA 2PZJA 4GBGA 4UNSA 3JARB 5J1SB 2YJZA 4ZCPA 5DMHA 3C7AA 3MB5A 4GOJA 1KU6A 3IEIA 1A76A 4P31A 4EAAA 2CZGA 2WTEA 1XP8A 1J25A 3H7IA 4YPOA 5F5NA 3WV5A 2RKWA 1BXKA 1PZEA 3MS2A 3BDAA 1WGNA 4LJYA 1VFPA 2R0QC 3IVMA 4J6FA 3KQYA 4RK5A 5CAEB 2GCNA 2XITA 3NHWA 1H23A 1JG4A 3GGDA 3HA5A 2E37A 3EY4A 3K9BA 3G59A 2VBFA 1RBMA 2HA7A 1HG1A 3ZI0A 1ZW1A 2J4CA 3O0TA 4DR2B 5FLEX 3C0KA 1ZM9A 1WB9A 4MV8A 3H1TA 1V41E 1EJ0A 4UE2A 1FRZA 1TTQB 1SCUB 2V9PA 2LCQA 3LCMA 1M1YE 4IUCS 3KHUA 3L8EA 1P17A 2JJ8A 1PWXA 1N9GB 4YCAA 4OQFA 4V0NA 3KC2A 3LVRE 1Q02A 1FQOA 4HEJA 1W46A 2C00A 1B6TA 3E22A 3CNNA 5D5HA 2ZM6B 4M1YA 5T67A 1C9NA 1XPJA 4YRTA 4ZQEA 4J76A 1WHSB 2F3RA 4KO3S 3W3AH 4O2BA 4OHYA 2PY6A 2FOXA 4JP3A 3M6UA 4D80A 2V7BA 2HF9A 3PQ7A 2J0UA 4Q82A 4UVEA 5HKBA 4DIMA 1W36B 4WXHA 2ZUCA 3DA1A 4QPCA 4MGYE 3L6CA 3PNPA 1U7OA 2IT1A 4U5QA 1HLGA 3W8FA 2VIIA 1BU5A 4RTOA 4M7PA 3KUKA 4WCFC 1K8QA 1Y33E 3ZOKA 5ALPA 1T8SA 2NYAA 1LBEA 1GKLA 3ZE9A 1Y6JA 2PUHA 1PT9A 3OJLA 1N2IA 2WZQA 3E7XA 1P62B 5EINA 4DBZA 3U1TA 1JHVA 3G9TA 4TVKA 4ECEA 1WNTA 1U6KA 1I5EA 1UKVY 1V8BA 4RTKA 1UEIA 4UAGA 2WKPA 5JI2E 4YUWA 2I4LA 1SFRA 5KYUB 4HZGA 3AV0A 1OHHA 2ZETA 3M4YA 3TBHA 4PPFA 3ZLTA 5MHTA 2VA9A 4DMUB 2M6SA 4D82A 2RK3A 3I09A 1R66A 3QE2A 1LLCA 1BE8A 4OYRA 1GNVA 1XNHA 1W5BA 5A4MS 3AR7A 4FDTA 2H2WA 1JWBB 1COWD 2XFTA 3U7QB 5JWOA 2ZWVA 3ADKA 1PDVA 3B36A 3SYNA 4KPYA 1G8AA 3DL4A 2WHRA 4OXIA 1Q22A 4O2LA 3HJUA 4FMBB 1PV1A 3SATA 3P9KA 4R3DA 5IZ4A 2PDAA 4ABYA 1L0BA 4PANA 3UEOA 1VHTA 1TX4B 1Z6PA 4G86A 2B1IA 4XZ3A 1Y8ZA 4OLBA 3ZBPA 3PLNA 1BCSA 1A8HA 3CLSC 5DCLA 1GV0A 2ZI6A 2A84A 2QQFA 2XTAA 3NC4A 2GBFA 3AU8A 2E7ZA 3HSYA 3CLUD 3TFWA 4BECA 3UENA 4RM2A 4M53A 4GMGA 2DU8A 4IOKA 5C1DA 3MF4A 2E21A 1ZBQA 2FSVC 3MOIA 2DETA 5JO9A 3SWWA 1O6FA 3N2GA 5DISB 1NQXA 1O7JA 4BQFA 4I36A 3VHXA 1CUAA 2ZYAA 3LWBA 1NATA 4P98A 4XVCA 3WRXA 2QZ4A 5ER9A 2JFFA 2F4NA 5BPFA 5H1YA 4TL9A 4U3JB 3HCWA 5JNUA 3IVAA 3N53A 3UB4A 1SK8A 1IVYA 2BUAA 2CNKA 2G5TA 4QICA 3GJ3A 2ZE7A 1XZJA 1YCFA 2JIPA 5KYYA 2VRWA 4CEJB 4F12A 2ZTMA 1I24A 5CFMA 5A3VA 2XCUA 4LXUA 1ECFA 1A77A 4FJ0A 4MJ7A 3WGYA 3I5XA 3ICOA 2BBTA 2ERCA 1TZCA 3O1LA 3G2MA 4IIHA 4L4XA 3DZKA 3TLGA 2JIOA 4K03A 1GT6A 3F4KA 3EEFA 4ZU3A 2XHEA 1B3BA 4LMBA 3TDMA 3S29A 4ZJPA 2PQ2A 1C7QA 1DU4A 5KC8A 2F5PA 1PQPA 2CV1A 1E3QA 4JDPA 1WTCA 4LQCA 5TJ9A 1N34M 2OVBA 4X60A 2FZ4A 1H42A 1D9ZA 4FDLA 2PZBA 4PBSA 2W6OA 3PCXA 2ZR9A 1DHTA 4K46A 3KQMA 1X19A 1O6ZA 4DV3B 4NI5A 3LQKA 5EP4A 2BFEB 2WUDA 3L0SA 4H77A 4O5AA 3EAFA 1E2PA 1L4LA 3QEKA 4LY3A 4JB3A 2QD5A 3W7AA 5EVCA 1ZUIA 1L5NA 1QJ4A 2FEKA 4RKQA 2J9FB 3W79A 3AF6A 2H5LA 4MA0A 2JIDA 2AX4A 5EJ9A 2HDWA 1ZVJA 2CFRA 5SYNA 4TKVA 3NBXX 5TGTA 1RWWA 1N2EA 1M2FA 2ZYDA 4ZQCB 5KOJB 4Y1FA 3CEMA 6CHYA 3LCVB 4RFSB 4KAFA 2WPNA 5AW5A 4PX2A 4ZAVA 3H17A 2VSXA 3MAJA 4OYYA 2XRMA 1TEXA 2RGCA 1U4OA 1YZFA 2R6AA 3N59A 3WFIA 1PK8A 1C1XB 2JAXA 5E6UA 3RWBA 1OC4A 1TCBA 1AC5A 1O96A 4JLSA 2VBCA 2R5NA 1NXVA 4IV8A 5LQMA 4AI6A 2QRKA 1FSZA 4F4UA 3NHMA 1K92A 4LZWA 5M3BA 3WA6A 3V46A 4G0ZA 4O25A 5FL3A 5TARA 4ND1A 3RSGA 3D8UA 2BFFA 3NJRA 2W6JD 2B69A 5B3JA 2JPDA 4ZOAA 2WLTA 4M7RA 4DIDA 1RHUA 4DV2B 5JCOC 4IDEA 5DT2A 3IEXA 4W6QA 4LZLA 3RUAA 3VPAA 4J43A 1XMQB 4JI6M 1O94A 4KHZA 2MT9A 2IU3A 4JI3B 2PYZA 3MEQA 3MJRA 1EG2A 3UT0A 3AR3A 4BN0A 4Y67A 4ZOLB 1WXHA 1U7ZA 2UZ1A 1UDCA 3HKPA 4M1TA 4AUNA 2L18A 1UBSB 1J00A 1SMKA 1T1EA 4MKHA 4NNOA 4CCWA 5LU9A 4H1HA 4LJ9A 3RWMB 3MWFA 2O2YA 2UUCB 4EW2A 1Z25A 4EW6A 3U6PA 2Q6VA 2O2CA 2B2XA 3EA5A 4CL3A 4B7FA 5F23A 3V4RA 3JR7A 3DZIA 2I03A 1DAPA 2Z3WA 2D2XA 1L4UA 4C4TA 3CLHA 3RLIA 1IK6A 2A5YB 1E5LA 3SAUA 5IFKA 2HHLA 3M6WA 4P17A 4C4YA 1N6LA 2I78A 4AWXA 1XQWA 5EUMA 4GM1A 1GTJ1 1JIJA 4RX1A 1CBUA 4E33A 4TUWA 4GHAA 4GKAA 3M7IA 4OKIA 5EYPB 1G20B 1L6RA 3DMTC 1E6UA 4Q9DA 2CCKA 1D2CA 3FKJA 3BZWA 4Z0HO 1J1IA 2RGEA 2GYWA 1DTWB 3ZCUA 1V6AA 4F3CA 4K1LA 3O8CA 3FPEA 1N33B 2IHZA 5EWJB 3TLJA 2VPWA 5ED0A 3Q7RA 3QKRA 1KEWA 1J0BA 3ROZA 5IJ0B 4EYKA 2I7XA 3KAKA 3WLMA 1NBMD 4TMXA 1HY3A 2BE7A 5FAKA 2YN0A 1JR3A 1U3GA 3R75A 3BMCA 3MBKA 2GO1A 4WI1A 4P08A 2V7EA 3CLKA 3W9YA 1L7MA 3WMXA 3T1YB 4QLOA 5C4MA 2JFYA 1NMEA 2O14A 1GGNA 2A9VA 3B5IA 5HZMA 4TMKA 1WBBA 2Q3EA 5L3QB 2G36A 1CHNA 5JCZA 4FOOA 2DNAA 1ZH6A 2A9RA 2PKYX 4A0SA 4Q3BA 1YQUA 4XA8A 3SYTA 4UVIA 2LTAA 3RAFC 3ROQA 4KT0F 3CTWB 4ZQHA 4GP9A 1XA3A 5CDHA 3D8LA 3B1FA 4JP1A 4UBOA 3SHTA 2PLNA 3OZVA 1G41A 1XLTC 3QVOA 3KUXA 4I99A 1I10A 3WYNA 1VKZA 3WGLA 3R7DA 1HXHA 3CLUC 2Q3FA 2XSZD 2I1VB 2QT1A 4EQZA 2GB4A 2H4XA 4BFLA 5LQUA 3G2KA 3PRKE 1X7XB 1VMAA 5C5EA 1YASA 2OBMA 1U0OC 2I66A 4XOIA 2AZ4A 4CYMA 2WF6A 1BHO1 4D4MA 1COWA 1RYMA 3DZCA 4L0DA 4U7PB 2JCXA 3BULA 4YCBA 1QMPA 1Z08A 2CD9A 1DZIA 1CZNA 1LA2A 1RWMA 1GZUA 2ZRBA 3K6SB 3USCS 1KYXA 1P9NA 3V97A 1XJ5A 2ILTA 2CXSA 2PD3A 3O31A 3QW2A 1CETA 2BLNA 2PAAA 2EKKA 3ST7A 3FOCA 3FMPB 2X0IA 1UC8A 5I9IA 3RJ9A 3B6KA 4G0YA 2O8DA 1C9MA 2UVPB 2HV9A 4EVQA 2R66A 3GJZA 4DDVA 5BR4A 2WVGA 1WUKS 3G9ZA 3UC9A 2R18A 2P6UA 1NF3A 1OXKB 2C78A 1N7JA 1R6DA 5TIIA 2W7TA 2NU7A 1UBMS 4OLHA 1I4TD 3WE7A 1H0SA 4QUJA 5L7YA 4FZJA 4TTPA 1VG1A 3ZY3A 3OEED 4EYOA 2VQFB 3GFPA 1JAIA 2X9VA 2PRJA 1F2TB 2JFBA 2RCYA 4REMA 1WJ7A 4ZREA 3EIEA 2DH5A 2IYAA 1JG7A 2DLNA 5AW7A 1NUPA 1UZUA 4FR5A 1E1QD 3KLBA 3JZDA 1RFGE 3VBCA 4X7RA 2CNWA 3K4PA 4R16A 4F8EA 3CZ4A 1JH8A 1I1QB 2IH5A 1YRQA 4CLRA 3AEQB 2HO5A 2DT8A 5C4GB 1OAKA 2ZWIA 4NBNA 5I3ZA 3ITKA 3NVKI 4AK9A 3AVXA 5G1OA 5F35A 4PSUA 1AXEA 1Z36A 2Y2UA 5DCUA 2DZDA 2RH5A 5J40A 5JUWA 4HWOA 3UA4A 3NBAA 1J24A 4RIIA 2N47A 1Y6FA 4NATA 4Y2UA 2R25B 3SKVA 1B76A 1ZJYA 2YUIA 3WKAA 1QLWA 2W70A 4YB8A 3EXG2 2C57A 2QLLA 1KVSA 1N25A 4MJ3A 2B1RA 3Q3VA 3OAAA 4I4TB 5CFZA 2OT3B 4GIPA 1G7SA 5JNWA 4TMTA 5H8WA 1I30A 3FRIA 1EXNA 2B5OA 3FZGA 1OZ0A 4CXMA 3ANMA 2DAGA 3FCCA 4AN4A 1AV6A 2V4MA 2W6NA 3O94A 4WWHA 4QDJA 3ZR4B 3SZUA 1TD1A 2PS0A 3RKUA 2XBLA 1I94M 3LOPA 2EDCA 4Z3OA 4LI3X 3WBJA 3RS9A 3T34A 1ZITA 1A9RA 2GK6A 4BBPA 5F98A 4WZAE 1PG2A 2XADA 2HT6A 3DMDA 4RHXA 2XE4A 1I4LD 4YJGB 2HPAA 5F51A 3OPQA 2WU1A 4M9QA 2P2LA 4JQOA 5DTRA 1RM0A 3KZKA 2FHPA 1J06A 1HTWA 1KS9A 3RAEC 2J9GA 2AJCA 3U19A 4OMUA 4IHJA 2PSJA 5JQGB 2ZYIA 3VH1A 5JS1A 4RMIA 3SC2B 2IWHA 2YWEA 3W5HA 4ND8A 3Q88A 4MUKA 4ZI5A 3N9IA 1WVIA 3T5AA 3SNKA 3DAOA 1R3UA 2D7HA 3EGCA 1IAVA 5JROA 4LSGA 2XJ4A 1PS0A 4M55A 1VYTA 1RVV1 2Q41A 1JLSA 4WJLA 4NH4A 3C9PA 3S8EA 4DNXA 1PZNA 2ZJAA 2ZRKA 3EG9A 4K2HA 5M2QA 3P27A 3GVXA 3CC8A 4H3SA 3ZH2A 4QPZA 1W9MA 3VRHA 1TCAA 4TS9A 4XR4A 1UK9A 2EW1A 4BNNA 4MEBA 5CBKA 5CCBA 4BO4A 1FSFA 4L85A 4RLQA 5DN9A 3WKEA 3TGPA 2I34A 3NORA 2C20A 4B31A 4W8OA 2Q28A 2R3SA 3BAZA 4LDJA 3AUFA 1ZBDA 1JEAA 2IYTA 4LSWA 4NK4A 3AVYA 1ZLYA 2W6JA 1QKIA 4N7BA 1EX6A 2DPMA 1EBFA 3KYCA 5EAIA 1AE1A 1M0SA 4I55A 2YXNA 5IM4A 1KO8A 5H4GA 1DQZA 4Q3DA 4WKGA 3CRNA 1XXLA 4YA6A 3VA7A 4RZ3A 1RJEA 4JKOA 1K27A 3FVTA 4WHMA 2CWWA 2ZB4A 1ISGA 3V33A 1N2CB 2RGXA 1CUEA 4ZOCA 1L7BA 4F6CA 4RF5A 5KSPA 4EJ0A 1AKYA 3A9CA 3GLGE 2CYBA 3M82A 4KPGA 3GQBA 3J7BA 1N75A 4LOJA 4MQUA 3EGWA 5FLXA 3FNEA 4B9EA 4ETMA 4E6EA 4V03A 4O8ZA 1SNYA 3HCPA 1LFDB 5K2OA 1U0HC 2ZJOA 4BJ3A 3OQ6A 1WF3A 1CS0B 3IR5A 1HWYA 4D79A 3ROTA 2Q0XA 5A9TA 3VMFA 3L04A 4NL4H 1C9YA 1GGJA 3QJ5A 1E3DA 1PJBA 2ZRMA 5DU2A 5IX8A 1WDMA 4OU5A 7ADHA 3GBVA 4D02A 1CDDA 3M6LA 2XMSA 1XZAA 2YV4A 4RXMA 3FOBA 1DKPA 1OPRA 3OC6A 4Y2JA 2AQIA 5HGXA 5HYVA 1HZJA 3CV3A 4DLUA 1UZMA 4E5VA 1T15A 4KL8S 3OJFA 3EG5A 3T9DA 1NBMA 5ERXA 4G25A 1LKZA 2PSSA 4ZAGA 1LVUA 2XWSA 1P3JA 4UATA 4B35A 1LBSA 1G291 1BX3A 1UFKA 1WGLA 1VG5A 1EGQA 1IM5A 1RNLA 2ZIEA 4PBTA 2A57A 3TF5A 2HMSA 1CRZA 1TQ6A 1B8PA 3UBTA 1SBZA 3KOWE 1SC4A 2GNPA 1NKSA 4QG7A 4RVOA 3UFBA 5IZCC 2X0EA 3W6PA 4IVPA 1MAVA 2BZ1A 2GF2A 1X8XA 1ODJA 1VM6A 1Q0HA 3RUEA 3E2IA 1CK4A 2HBYA 3CPHA 1UBEA 5K0NA 5FOQA 4DJAA 1NASA 4BLOA 3WGOA 3HDJA 3NANA 5JV5A 1AQIA 4M1EA 2D0PB 3FGZA 4FCWA 2OESA 1H1DA 4HPXB 1IZ7A 3ORFA 1EE1A 2QXTA 1Z38A 1WG8A 1VPDA 1KDTA 3G7UA 1X1DA 4XX0B 2DM6A 4HAOA 4V0SA 2REQB 1XAGA 2VJQA 1VKNA 4GITA 1ULAA 1ATZA 2ZJBA 2XSZA 3I52A 4OKSA 4GLJA 3LJKA 1JA9A 2WSSA 1U0BB 4E21A 2AG1A 4A10A 3QMWA 3B20A 4DMGA 3A9RA 3HNOA 4JU9A 4C6RA 3B6IA 4DVGA 5GONB 1V3VA 3WK4A 3TIFA 4HQFA 4X84A 3GRPA 2WJ6A 3QPVA 5AK5A 1KEVA 2BE9A 5J23A 4UUQA 1ECLA 4MR9A 2CKDA 2VYNA 4L5IA 4CR8A 2ETVA 3NBMA 3IQXA 1Y8QB 1XVIA 2L4FA 1ZFNA 3UK2A 2QI9F 4KAJA 1GLVA 5C4IA 3L1HA 3O93A 2DI0A 5E1DA 2C2YA 3GUYA 3HA2A 1TW3A 1RXUA 1M6EX 2HLPA 3ZBTA 1N8NA 2R7MA 4FTWA 5A5GA 1QTIA 3RHSA 2ORED 4BO6A 2EQAA 1DBVO 1S2NA 4X54A 4B75A 1SHLA 4IDAA 3WRYC 4FCCA 1IU9A 3F47A 2IGBA 1YOBA 2FKAA 4F9EA 1P2FA 5LFAA 1EWVA 5GADl 4YP7A 1FP4B 2M32A 1II8A 1H8HA 6REQA 4HR7A 1YAJA 4UDYX 5A2QS 5CT6A 3RU9A 1G5TA 1B2RA 4MVWA 4TTTS 2PWZA 2KWIA 4WZBB 1DS6A 3L8HA 5FPSA 3ZXUB 1UDXA 1EDBA 3CF4A 3G1UA 3KJEA 5BSFA 2QW8A 4JDUA 4RSMA 1UZAA 3PQ4A 1XEXA 5UKDA 3DOCA 3R41A 2L2QA 4Y98A 4AXBA 3SZLA 4OU4A 3UF0A 2QM3A 2CEAA 1A5AB 2OFWA 4COOA 1L5VA 2ZULA 2E4WA 2F9FA 1FYWA 1QPGA 4Z99A 4H59A 3B3FA 1N7IA 3D4OA 2BR3A 2YHUA 4PCAA 3KLOA 1LK0A 3W06A 2PX6A 4ZZIA 1T0PA 1FUEA 3DKPA 1QYXA 3VKGA 4RHFA 3QRWA 4AQ7A 2XDWA 2C9ZA 3RNOA 2WHYA 5HHTA 2BEVB 2BEKA 1IN5A 2HRQA 3MUFA 3WRYA 4OL9A 3G89A 5H82A 4UUOA 3H97A 1SRQA 2H07A 2HFKA 5E6SB 4JR2A 4GOMD 2Z6UA 1P5ZB 1Z6QA 1LSJA 2PXAA 5HIJA 1T0IA 1KKUA 4EHJA 2GK4A 4OHRA 1ZM2A 3FROA 3K3PA 3GIWA 4YRFA 2ZCJA 1U8FO 4ZEVA 4X8LA 5A3RA 3T6KA 3KTFA 3TPFA 2WI8A 1DV2A 3TQOA 1V9CA 3UCEA 1EI9A 3C87A 5WRFA 3KS9A 1YS2X 1E7YA 2VL7A 2H6EA 3CRMA 5DYIA 3P9NA 1B8VA 3LMKA 1EK0A 1U98A 3JS5A 3NUQA 1IBCA 1TT7A 4HDNA 2MSNA 1FPMA 2B78A 4G0QA 4I1RA 4FOLA 3MTJA 5IWAM 1MB0A 2ZANA 1LVGA 3QKTA 5F1PA 4KITB 2WJGA 3PT5A 3FLEA 1PK7A 5FYQA 3SOZA 4B7GA 1CVRA 3PC7A 5CPBA 3L0BA 1XRJA 1WM1A 4YRKA 3SMVA 4B8WA 3UAXA 5EPEA 1NNUA 3O95A 1E1CA 5AKXA 2Q7OE 4YWJA 1QFSA 1AN9A 1XQ6A 2JDID 2QJRA 3T7DA 2PT5A 1T6ZA 5ISMA 1TEZA 4Q4HA 3OU7A 4DSZA 2X1LA 3CZPA 5K8JB 1YDWA 1DQPA 3NBUA 4LYGA 4OPMA 1OI7A 3HPQA 4CI0B 1JA0A 1YK0A 4Q7EA 5COQA 1NJSA 4GSLA 4Q9JA 4FUQA 2VAPA 1IXSB 2FB9A 4EUNA 4NULA 2Y99A 1P29A 3MBIA 1QFZA 3L0YA 2GYYA 4V2IA 1BYUA 3JD3A 3LBNA 3JAWA 3B7NA 4CFZA 2CJWA 2XF3A 1CFJA 1XDSA 4GDMA 3RVBA 1A9ZA 1OJ7A 4PLZA 4D8XA 3EGDB 4CKCB 4JN6A 1IE3A 2P27A 2O2HA 1OIWA 3PI6A 3HKDB 10MHA 2Q9AA 2H59A 3CCBA 3VAYA 4MWDA 1GILA 3BERA 1LRJA 3AH8A 4MWTA 1Y1RA 1VDDA 3BG5A 2J4FA 1V8DA 4HBGA 2XFSA 3ISJA 3T7RA 1JMVA 2LH0A 3B1YA 4WFJA 2Z5FA 2BFAA 1L2CA 2YBDA 4LNAA 1KL7A 1GXSB 2OZKA 4BNVA 4CDMA 2UZAA 4WMLA 5H70A 3TBFA 4YAKA 3UHOA 2R8BA 3RSSA 1UFZA 4M1WA 4EK9A 4D99A 5KIAA 1Z74A 1OX4B 1Y1LA 2O07A 4ZPXA 2WG0A 4IDOA 4BBJA 2XV1A 1U9JA 2IBMA 1SHTX 1PRBA 3V4PB 3C24A 2PIDA 3DLTA 4UN2B 2VP0A 3KKQA 1Z5NA 4C4SA 4NC6A 4I8OA 3I92A 5HQ3B 3RIYA 1E92A 3IPLA 1G9XA 3IIKA 4KDFA 1UZLA 1Q84A 4Q9LA 5I8PA 1LFAA 5AW2A 4INPA 1ZUHA 4RPCA 1A3CA 4BKOA 2WJ4A 5KOHA 2HBRA 3OT5A 4F9TA 2AL7A 1JQ5A 1ZN2A 3EQ9A 3DPUA 2C82A 3FPJA 3TZQA 1EFVB 1KZ6A 3A0UA 3N0WA 3F9RA 4O3MA 1A97A 4CMJA 4B3XA 2QM0A 3P26A 1P5RA 1CZOA 1Z88A 1MJGM 2QZ9A 2OC4A 2Z4TA 2I91A 2EZUA 4Q05A 2D1QA 2BWJA 4MKRA 4RJTA 2P9JA 1QE5A 1AB6A 5IVIA 2ZRIA 4US1R 3OC0A 1LD3A 3ZWPA 5ALEA 1K2WA 3RPEA 4D9BA 1YMVA 4UULA 4HDMB 2H4HA 5EJ6A 2W90A 4QASA 4IQFA 3JV7A 1X7YA 1IZ0A 2XA9A 3U6DA 2HLDD 4BX8A 3TZ6A 5F3WA 3O2NA 4PVDA 3U60A 1FB5A 3D5EA 1SUCA 4YCSA 4N47A 1HPLA 1MJ5A 2WWHA 4WK2B 2VSQA 1L5GB 4BFWA 1EFKA 4TRRA 1TW2A 2AMYA 5IU6A 1EA7A 2FK8A 4D9FA 4KCGA 3EZGA 3ZHQA 1JJFA 3GA0A 3I42A 3FOZA 2KZSA 5JCPA 1UT8A 5HVNA 4AY3A 1BWQA 5CA0F 2GN9A 5KJCA 4FNMA 2OK7A 2P6NA 2VDVE 5C5DA 3SZ3A 2A1UA 3LY9A 5EVJA 2GFQA 1YRWA 1H9BA 3ICEA 4S1TA 3U40A 3HP4A 5KWIA 3WKCA 2DTEA 4CMEC 4EKIA 4I6GA 4HXGA 1L2BA 2QNRA 4PQYA 3TNFA 4Y9SA 1A9SA 5LC1A 4I46A 5H5JA 5F3DA 1QF7A 2JHPA 2OZEA 1H66A 2LIVA 3IBTA 2I80A 4Q93A 2A9QA 3K70D 3OFND 2IZOA 2ID7A 2NQ8A 1T9GR 4JROA 2OD9A 3ZLBA 4D1YA 4B45A 2I29A 3O8OB 4CJ6A 7CATA 4V3CA 2R00A 3SAWA 1YJ8A 3ISVA 4DCJA 5IP5A 3HO1A 3L25A 2Q4BA 3ETCA 1MH9A 1PYDA 2HXGA 3HU1A 1G8SA 1KC3A 4UDOA 2ZITA 4FEAA 2IEYA 2A7QA 1QH8B 1A7JA 2RH4A 4EPYA 3H05A 2WYIA 4XI9A 4ILEA 4MGYR 9ATCA 5IAOA 3WMWA 1EFDN 4E0BA 3FKEA 1NVAA 2NLOA 3NUGA 1PR1A 1VHLA 3GCWA 1A7AA 4BFYA 1MJHA 2PM8A 5C1BA 3AHJA 2QTHA 1CDZA 1EXVA 4KUEA 4Q3LA 1W85A 1DKLA 4TGLA 3FZQA 2WFMA 1NVBA 3ZNQA 1HQKA 2D2FA 1M34B 1GOTA 3IULA 4NFYA 2BLLA 4E13A 1UCFA 3V34A 1G7RA 3CINA 3KSUA 3H2ZA 1GIAA 4RJLA 2APJA 3UJ7A 1EUQA 3PA8A 5IVDA 2HH9A 2WHPB 4QYMA 2H4FA 1XRSB 3IODA 4MQBA 3FMOB 3LWDA 3KKZA 2J5XA 2Q0HA 4C22A 1ZVQA 2JAQA 1J39A 4RDXA 2VZ0A 4PNEA 2F3TA 3DEIA 3ZE6A 1UKZA 4Q3KA 4Z3KA 2YXEA 1SXJB 4TZ0A 2QJTA 4B3MB 2FHSA 5F2EA 3SQXA 3JTMA 3HEAA 1Y48E 3FNGA 2WSCF 2QN8A 4KXWA 1PLJA 4DPLA 4Z0PA 2ES4A 8ATCA 2IF0A 1V11A 4TYYA 2RJ3A 4QOFA 1AMNA 4EMTA 1T5DX 2C5LA 2R62A 2WM3A 1O94D 2JY5A 5DX1A 4LF5M 3BXFA 4J94A 4BB6A 4YMVA 3T9FA 2XCOA 4JYCA 1EESA 1Z18A 3DFUA 3L6RA 3IBFA 3UYLA 2QROA 2W2LA 3IX7A 1Q2XA 1Q14A 3G8YA 1K4KA 1Z0AA 1ZZGA 1FFSA 1LQTA 4RKUF 3OMXA 2EKPA 3R7FA 2FW7A 3E7PA 3OOEA 1J5XA 1S2MA 3RGPA 3HTXA 3VR5H 3KELA 2IQIA 4TRJA 4YV1A 4CWAA 4JI2M 4HEA1 1RI1A 4Y2PA 1IBSA 4DE5A 3HWRA 4BBAA 1JNYA 3V6MA 1TO2E 5KKAA 3SM9A 3OKPA 1NBIA 3D7NA 1UPBA 4HZUA 3GPLA 3MTEA 5EI5A 1LS6A 5CVEA 3BCHA 4WNYA 4YRPA 5DT9A 1QGYA 3C1UA 4QXRA 1A5ZA 4L0QA 5FYDA 2WMYA 3IQFA 4AW9A 3QBJA 1GJTA 1BQEA 4DV5B 3MJ5A 2PO5A 2JDIA 4RANA 4QUGA 1QUEA 3REGA 4RDCA 4NARA 1JHOA 1U6IA 4KV9A 3COSA 2HZ7A 1ZN7A 3ZWMA 5BOSA 3PD7A 4GP6A 3HCFA 4WIAA 5DX0A 1I6KA 5CBPA 1LUAA 4NNPA 2R7LA 3V76A 1IOZA 2JI7A 2VJDA 1N2XA 2PX5A 1YO6A 3R8FA 4RFVA 3SSAA 3WDMA 1OLUB 1JR3D 3S81A 5FWDA 3AKCA 4HTAA 5K03A 4LCBA 1OKKA 4MLDA 2V1CA 3TWOA 4BNWA 2YRWA 1HNZB 4RULA 3LKDA 3BC1A 3S44A 1XPOA 4JJZA 3WWZA 2IE0A 2WHEA 1N1EA 2CDCA 5I7HA 2VTEA 3ZG6A 3U09A 4H7HA 4IWXA 1Q5PA 1G19A 2ZR7A 4F2DA 2VZLA 3R0IA 1X7DA 1X1CA 5JFOA 2YRFA 2AKAB 1E9VA 2GWRA 4ZO4A 2Z6AA 1SUIA 3QTTA 4IFTA 3TOXA 1TA4A 2EKQA 3OEWA 2Z56A 4H4EA 4MS4A 3F6CA 4FONA 4NV3A 2H29A 5BO5A 3WLSA 1CXZA 4D5GA 4IF4A 2BI8A 4FMCF 3PQ8A 3G8CA 2ZG6A 1Z6YA 3JAMA 2F5QA 2GZDA 4MZXA 5HJ5A 4MV4A 2VT3A 4UU7A 5J2UB 5KPZA 4W5TA 3PXDA 3AFIA 5CPFA 1YQXA 4JFRA 2NV2B 1ZXBA 1MA3A 2Z5GA 4HXFB 1I2BA 4NLLA 3T1TA 2WAYA 2R1ZA 1NYRA 2EP5A 5H59A 2CLEB 1YB1A 5LPNA 1KJIA 3D0OA 3RV3A 2AD5A 3UNXA 1GGKA 2JIBA 1XMIA 2HV8A 4JC8A 1F38A 3L7OA 4ZODA 4K5QA 2ODWA 4HC4A 1MJGA 1H2AS 3WRXC 4KPFC 1E99A 1LC3A 1ML3A 1NPYA 4MRVA 4BO9A 4FFDA 4Z6YA 4KQHA 3PQCA 3OIFA 2E1RA 4QQNA 5EE5B 3AGQA 4O4HA 1QRRA 4A82A 3X3HA 5C3MA 5GGYA 1U7WA 5IJAA 3MPOA 1O08A 4CCAA 2AXEA 2X77A 3LC7O 3FE3A 4R3NA 3OEHA 3C8UA 5LZ2A 5FQNA 3UHAA 2HA0A 5F2NA 3VVBA 5JARA 3ZW7A 1EFRD 5IJ9A 1F2UB 1P4GA 4LMRA 4A2PA 3ZWBA 1UWKA 3BEDA 1HDRA 3QIAA 4OYLA 2FPWA 5AVJA 3WTBA 3MXTA 3WJ7A 2XXBA 4KGXA 4FW8A 2QLNA 1T4CA 4UU0A 4NEGA 3BWMA 1SBCA 1B93A 2XD4A 5CYOA 4ONEA 3HNRA 5E95A 3R3WA 1NVVQ 2A86A 3U56A 1T3HA 2HLDA 5IULC 2QEQA 3HI6A 4A2QA 3G0BA 3PCRB 3S1AA 2NSHA 3VC7A 2F4VB 2CNWD 2P7IA 4OIMA 1ONNA 1INLA 4I1SA 5JVDA 3M5PA 4H2DA 1WMDA 4DBLE 1IPEA 1TTEA 1FCJA 5BR7A 1ORHA 3ZS8A 1IIRA 1JHAA 4C78A 3QVVA 4HQOA 1BJKA 4XRRA 2WD8A 1FDUA 2E4VA 3D3EA 1TMOA 2FPPB 2LKDA 1E3JA 3C3JA 4LWQA 3G7SA 4WDQA 1V8OA 3IOBA 4FFSA 4BTEA 4WOPA 3M2PA 4JSYA 3TQRA 3U61A 4RJIA 4KN8A 2G0AA 4JASB 2C3UA 4RKYA 3R6LA 1SO8A 5EUBA 5DM0A 3OAAD 3DBHB 4B43A 3RB8A 1ADFA 4HS9A 1V92A 5KQDA 1U7DA 3MRTA 2P30A 3OFNA 1GZ3A 1L7VC 2OPFA 4O4IB 4R1LA 1OLXB 4IJUA 1YSCA 1LZKA 2EX4A 2HU7A 5A5FA 1ZC3A 2ISQA 1JU4A 3L8FA 4GM4A 5JJLA 2M6KA 3T5MA 1JL3A 3KYDA 4ZVMA 4TZTA 3O5AA 3WDSA 2DUUA 1F9AA 5KC9A 4J7AA 2VN8A 5E6RB 2WQ7A 4HNAB 2DFPA 2WT9A 4YVFA 4G3XA 3KQQA 1WHTB 2QCUA 1L5WA 4QOEA 4L6V6 3W4JA 4Y2GA 1IHDA 4BP9A 5B3JC 4BGDA 1KK2A 5DULA 4XFJA 4KAAA 4KBGA 4H0FA 1QWOA 2IXAA 3OCVA 3KRTA 3NNSA 4MH0R 2WNHA 4NG5A 2L2DA 3UWKA 3HA3A 3GDFA 5FTNA 5FDFA 2Z43A 4F4FA 4E6PA 2V8BA 1O94C 1CUVA 3NBZC 1IUNA 3OPYB 3CVVA 3OQPA 3CRVA 5D5QA 3KWJA 1K75A 3C1OA 4U2GA 1I0LA 2E4AA 2ZVQX 1OVMA 4N5LA 5G3ZA 1VKRA 2W8BA 4IIBA 5IBCA 1E2DA 3R0XA 3PEFA 1PL6A 3EDQA 3MD9A 2O50A 2ST1A 1SXPA 1T43A 1JG6A 1IEXA 5HP4A 3UY4A 1JKJB 1JFFA 3NC0C 1M8GA 3QELA 4TX1A 1MLDA 3RUDA 4QNRA 2O25A 2IHYA 3I9FA 5NLLA 4P86A 3QKUA 3LDUA 2F1OA 4ACAA 3UHPA 4ZHSA 1ND5A 3ZTYA 3CRW1 1YB4A 3VZBA 3RVJA 4BN5A 4TKMA 1Y6ZA 5LQKA 2J5BA 1QVWA 4ZJZA 4B8ZA 4NMXB 2DPHA 5IUJC 3LPMA 2HDNB 4RKWA 3O0DA 4DWVA 2QS9A 3KTAB 3GLQA 2EQ5A 5F5XA 4E70A 4WKCA 3HVJA 5JI3E 5CX1A 2YR0A 4UAUA 4P3OA 4MVYA 4DAOA 2J6BA 5HUJA 4F71A 1H94A 4ZT2A 3LYUA 2Y0QA 1X8LA 1O87A 1E7WA 1YIAA 2I7NA 4RKEA 1JDUA 3FWPA 1P0IA 4AMVA 1DRJA 3KKKA 3T4PA 1L4YA 2Q5LA 2JP7A 1OU4A 3CSDA 3JQGB 2JIQA 4KVAA 4D9KA 1AQJA 2W9XA 1M9NA 3SS7X 4DQUA 3THOA 4EF6A 1X8JA 4HDOB 1XTSA 4JL8A 1NVFA 3VR6A 2AI2A 2HNBA 4HEHA 4BQSA 1Q3CA 4B6PA 4R4JA 4MTLA 2G5PA 4WK6A 5EP1A 3GYBA 3KOZE 1VLJA 3V7WA 1OTHA 1J0XO 1N0HA 2HYDA 3JQ8B 4EAQA 3UJCA 3QKIA 3C16C 4N39A 2GQFA 1T9CA 4RUKA 1VI2A 5TEVA 3TZHA 5MN6A 1DWQA 5A2GA 4L9SA 1JJBA 1ZM3A 5AKKA 2SICE 4Y0NA 3RRXA 3QVGB 3RQIA 1M10A 2DCUA 5KQLA 2RHTA 4IINA 2JGDB 3TNDA 3K9GA 1BMQA 1HA3A 2PVSA 2ZJ0A 4W99A 3GMTA 2ZSEA 2PLRA 3QXHA 4HDKA 4C7VA 2A4MA 2CK3A 2ZATA 3JVDA 1GCAA 1E4EB 2VDOB 3A04A 4MJLA 1XDZA 5FLYA 1N5LA 3UHFA 4YJ3B 5IJXA 3L4JA 3V1MA 3CN7A 4OSEA 2B94A 2FP4B 3RODA 1ISSA 1CQXA 3MQ2A 1E1YA 3O74A 1GZHB 3KOOA 5JYCA 2FWJA 1E3MA 3KOUA 3TX2A 1TAHA 3LT0A 2O7RA 1KY5A 5HNKA 5KYVA 3KSAC 5D01A 1QGUB 2AJLI 4LHVA 3RIEA 1Y1KE 2VPQA 5KNBH 1RYYA 5KSYA 2EO2A 3DWGA 3WX0A 3X0DA 2BM1A 4MV6A 5KX5F 3ZBQA 4YAGA 1T29A 3KB8A 2BWEA 1L2TA 4FNGA 5E3JA 4F86A 3CH6A 3WBBA 3CCCA 1DOAA 3EHEA 1T1RA 2IIVA 4Q6WA 4QLAA 2O2EA 2UU9M 2G1JA 2RIPA 3JQ9A 3MLAA 5KSWB 3CRRA 4WUTA 5MGNA 1NV9A 4PAMA 3D81A 1JFTA 3DUWA 5BQ5A 1BW9A 4BZZA 2QVXX 4LRWA 4RJJA 1T2AA 1FTNA 3T0IA 4I3HA 1LPPA 4IBOA 3RV4A 2WSSD 2NTVA 4YP6A 1BTOA 2HRCA 1R12A 4TM8A 5MN4A 2CCJA 1UDWA 4W1QA 4WFIA 3G0GA 3KP1A 4TL7A 5JZSA 4PLTA 2JFHA 1SUDA 3UB3A 2RGHA 4QATA 1IWPB 1UJCA 2VYND 2O7SA 3U0BA 2ZRJA 1G63A 2YMLA 3T5TA 3OHSX 4TLBA 2OA0A 4U2KA 4JBNA 2PBFA 1JMKC 3H11A 4B5LA 3EZLA 1WCWA 2X7HA 2KQUA 1Y1PA 3TI9A 3SEQA 4OJTA 4OG2A 3X1DA 2M9MA 1NVWQ 4HNVA 1E2UA 2H2IA 3M70A 5BV1A 1NUAA 2WRZA 5H02A 2ADOA 2F3QA 4IXTA 2IFTA 4MRSA 4IJMA 3LQQA 1EFRA 2KHZA 1OX5A 1T9KA 3HVHA 4A0RA 3KYBA 4NK5A 5KB3A 2JCBA 3JD0A 4HFRA 2PUDA 3LQ2A 1AJEA 5FHQA 4JVLA 4A8JA 2G4VA 4H6PA 2GAAA 1ZXXA 1H8HD 5EQJB 3I6MA 4IUYA 1B26A 1XVUA 3FZNA 3B5EA 5H9VA 3PGJA 5H37D 4BNUA 1ZKDA 1CS4C 1Q1EA 1SOMA 4CPDA 8ABPA 1GT91 2ZUVA 1U8TA 1OE0A 1EKXA 4R0NA 2YQ4A 2NIPA 4HQ0A 3F9CA 3DP9A 3C6KA 1X7ZB 1YZLA 1ODFA 1WXEA 3VX4A 4AYWA 4FFBB 1U4SA 4H1UA 3PPYA 5CB4B 3BXHA 2I4IA 3PC8A 4MW6A 2UUBB 3OO1A 3RF7A 3RJTA 4BLRA 3DB2A 1G7TA 5ITVA 1TGVA 4ABTA 4MPTA 4YK7A 3SLKA 3P0HA 1B42A 1GKKA 3TDNA 3O7WA 1JFRA 4PAGA 4U2FA 3L27A 2YJNA 3ND5A 5FBZA 3E8MA 1YCDA 2CXQA 1KSHA 3HNPA 1AZTA 5GY7A 3WL6A 2AZXA 2VF5X 3V42A 4G0XA 3T4EA 3WYFA 4N0EA 5BN1A 2SKCA 1Z5ZA 2FPUA 4L27A 3UICA 1S3IA 3A2KA 2R68A 4IOJA 2FDCA 4P7BA 3LQFA 5FQOA 4C4AA 3NX4A 4ARCA 3VO1A 1LTKA 2QX6A 2XXAB 1RQLA 4LRSB 2WM8A 4GXRA 1AD2A 5TMBA 3PHCA 2I22A 3RHFA 1OB2A 2I8LA 5AJHA 4RGBA 3PG5A 4G8CA 4O33A 3AM3A 4HI0E 1K2VN 1NN3A 4U8GA 3C3MA 5EZQA 2X3YA 1Z0IA 4BPBA 1B7GO 3HU2A 1N2OA 2JHCA 3RRFA 3CLTD 1RE1A 2R2GA 1TZKA 1XE3A 2PGIA 4PX5A 5KJ1A 3N58A 2EBFX 4LX8A 4U2DA 1P73A 3QXCA 1HNXB 1MAAA 4CIYA 4KLCA 1N5RA 2R60A 2DZNB 4ZRDA 1DTEA 1CB7A 1VGVA 1JDBC 1EYZA 3SJBA 3RFXA 3V1NA 1D4ZA 5AHKA 3GFOA 3BXEA 4QYTA 1UFVA 1TVCA 5G0SA 4QNMA 2E3JA 1Y8RB 2X8WA 5FOWA 1IEQA 4B76A 3WIVA 2ZSKA 3VPXA 1CZRA 3RSFA 4DSAA 1ISRA 2VUTA 2VOEA 3CPJB 2KBFA 5CR9A 3I0ZA 4JBHA 1T25A 4W82A 1XVVA 3NWPA 1WCV1 1O54A 2XMGA 3H87A 2ATCA 1CZLA 2GDZA 2X9NA 3EXEA 4MCHA 1TGYA 2P9BA 2OHXA 3ABIA 1RKUA 4AECA 1GAXA 2I6TA 1SA0A 2I71A 3VU1A 1VCMA 3VZQA 4U0KA 1XAJA 3ZHVA 2ZJZA 3HKCB 4QQKA 2QX4A 3QPUA 2FGJA 3EH1A 2Q8NA 5FUQA 4DBGB 4KIWA 2QZZA 3CX7A 2VPPA 4OM8A 5FWXA 2E18A 1XNQM 1N7HA 1MRZA 2VEOA 5GOTA 4I50F 1YD7A 5LR6A 1LWOA 5L4SA 4DIKA 1KIMA 1U8CB 6LDHA 4TPKA 4NXNM 2RMKA 2WU3A 3LSYA 5KMGA 3GO4A 5HJEA 3PXCX 2G9VA 4RK1A 3H2YA 4KR7A 4ZO8A 5ALJA 4DUYB 2CD7A 1M8KA 1Q0QA 2ZUSA 1OLOA 4OH7A 2G0TA 1UJ2A 1PZFA 4ITQA 4L5YA 1T5IA 2Q9CA 1VHJA 2JAHA 5A7GA 1QLJA 1QWSA 2GHQA 1WABA 1FRNA 3FHOA 1FNCA 1V9SA 2NTNA 4PBRA 4B73A 2PFGA 1O9HA 5A5VA 3ILYA 2UKDA 1VEGA 3OCCA 1XC8A 4M98A 2DZLA 3WB0A 2JGIA 2PMBA 3UAVA 2O2GA 4HNRA 3R0ZA 1ZD3A 4MAFA 1W35A 3OTWA 4PTZA 4DJJA 4BFTA 1QHEA 2C8LA 3O2QB 2BGNA 4MVJM 3T61A 1X15A 3GMSA 1XD9A 5KKNB 1XJCA 3PEEA 1HZZC 3WRWA 2RI6A 3GOHA 3K5WA 1EM8A 1HKUA 4DLZA 4YV2A 1JLRA 4B2IA 4N8EA 2EJUA 4Z7JA 2H7VA 3HE3A 4X65M 4UBKA 5BN5A 3MS7A 1MX5A 1A71A 1HX7A 3PGA1 1GZ4A 5LA6B 1N6RA 1PEYA 3K96A 2WJZB 1OLSB 4DA6A 4HP8A 1V2GA 1I5OA 1RM3A 2CL5A 1NE2A 4CKWB 1X1RA 3WHKA 1BMFD 2QMUA 4CNQA 1OB5A 1O2DA 1USIA 3K9LA 3ZHYA 4D8YA 2X0FA 3WGIA 4YECA 1E60A 1VTKA 1BFKA 5TX7A 2G9QA