3M0EA

Crystal structure of the atp-bound state of walker b mutant of ntrc1 atpase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDAIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Engagement of Arginine Finger to ATP Triggers Large Conformational Changes in NtrC1 AAA+ ATPase for Remodeling Bacterial RNA Polymerase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 83
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3m0eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3m0eA01
1VYTA 3LNCA 5JJKA 2OILA 5F2EA 1YE8A 3AP3A 5TB5A 4UJ5A 2EFEB 2Q21A 4HI0E 2Q3HA 1FZQA 3I4LA 4FMCF 3T1OA 721PA 2PEYA 2YOHA 1DOAA 1SVIA 3B1VA 3OIVA 4M1OA 1ZM4A 2ZI7A 2W6JA 3DM9B 2UZ3A 3O8DA 4IVPA 2QAGA 2VH5R 2GNOA 5A5GA 2ZRGA 2PZEA 3ECCA 1LF0A 5DGXA 4BFZA 1UFQA 2OG2A 1E98A 5J4KA 4CEHA 2WWWA 4Q4JA 3VAAA 3EASA 1XDBA 4E22A 1YZKA 3BFVA 1YHNA 2LKDA 3WBJA 2BCGY 3OZXA 3D6TB 2JLZA 1DE0A 4OK5A 4QL3A 3V9PA 3O8RA 4F93B 3THYA 3FMIA 4Q1FA 3W34A 2H5EA 3NHAA 4UJ3A 1R8QA 2ZRLA 1YJ5A 2C96A 5A0FA 1IN7A 3HWSA 1OE0A 2ZUDA 4FWHA 4TTPA 2ZRDA 5CB8A 1AN0A 1UKEA 4KLZA 5EE0A 3TSZA 5AR1A 3GLIA 3C5CA 3R20A 4NCIA 4WXRA 4URYR 4AWXA 3U3RA 2ZIAA 3TR5A 1ZAKA 4B43A 1BS1A 4DLSA 3EW9A 3GPLA 1G4UR 1U8AA 3J81k 2LCFA 3A8TA 4TLAA 2RGBA 1CR0A 5ELXA 2IYQA 2I1VB 4HLCA 2WICA 1CS4C 1OFIA 3REGA 3RS4A 3C4JA 2RGAA 4O2LA 4TL6A 1HQCA 3P27A 5KTYA 1X3SA 3MWJA 3EPKA 2NMVA 1KI8A 1LV7A 3ASZA 3TAUA 5BWMA 1FP7A 1R0XA 4JBWA 5JJIA 4TTQA 3K53A 4D0NA 1G21E 1S9DA 2KRKA 4EQ6A 4A0RA 1P75A 1LF5A 1OHHA 2RGDA 1TADA 4QHYA 4W5HA 4YMSA 1RRPA 5FOWA 1Z63A 3FMOB 2W0MA 4K81B 2QN6A 2FFHA 3F8TA 3MJRA 2ZR7A 1Q1EA 1IQPA 1R0WA 3ND9A 5FOSA 2RGNC 3RS3A 3C5HA 4N0EA 4D81A 3NKVA 3QKSA 3BB1A 5J4HA 1XD8A 3WYFA 4MRVA 1P6XA 5E3HA 3JZMA 3T1QA 1P61B 5EP4A 1N0UA 4JVSB 3OHMA 1E9FA 1HTWA 3C8UA 3RS7A 3T06B 3IILA 5EQTA 4EIWA 2ZJBA 2X19A 2IUSA 2WJHA 1BYUA 2ZAMA 3VHLB 2QMEA 2G0TA 2ODWA 1E2FA 5DHFA 2DFNA 2EYQA 2IWRA 4M9QA 2WWIA 1TUEA 2C9OA 2I1QA 1D8TA 1NLZA 1VKJA 4E5UA 2XGJA 3NBXX 2BBSA 2F1HA 3K8YA 4MKGA 4ZV4A 2K5UA 2L0XA 2ZE6A 1TNDA 4GZMA 5ANRB 4BUJA 3EZ9A 4LYJA 3QUSA 1VYVA 3QE0A 4OI1A 1E2HA 1U9IC 1W5SA 4US1R 1PZNA 3RNLA 4IDQA 2G1KA 3MCAA 1DO2A 1E1QA 3RRYA 4CIDA 4D4KA 3WYGA 3SZRA 2WAYA 5FBQB 3A36A 5AWFC 1KI4A 1AS3A 1JJVA 2IXGA 1GG2A 4URVR 5DN6D 3K1JA 4URWR 4F7WA 2XOKD 3TUZC 1WCV1 1DAKA 1P7CA 3UKDA 1T3SA 2KI5A 4GMXA 4Q48A 2HYIC 1XD9A 1AGPA 1VIYA 4A1FA 1N6RA 1Z47A 5AUOB 3SQXA 2P6UA 1TQ6A 1ZJ6A 4GI7A 1OPXA 1E79A 2ERYA 1ZC4A 1OB2A 2WJVA 3SN6A 3ZVMA 1N6HA 4L5BA 1SULA 1ANKA 2IWHA 1DAEA 2VPPA 2WAXA 4MGKR 1EK0A 2WTUA 2IS6A 5HZHA 2NO7A 4G5OA 4BLSA 2V3CC 3CRRA 2FPKA 1YRBA 2O8CA 2VP9A 4UNPA 2PT5A 4FMBB 3IIKA 2IUUA 2SHKA 3PUWA 1AA9A 2C8VA 3E2IA 2CCJA 4AKGA 2JIZD 4MUBA 2WWFA 2JA1A 1TF7A 2EFCB 2MMCA 4NYJR 3EA0A 4EFMA 5KYKA 4X8MA 4UNRA 2QT0A 2ZROA 1WA5A 1OXTA 2W6IA 3OFNA 1LW7A 3MWLA 4ZIRB 3WNDA 3K70D 3EPJA 1P9NA 1SVKA 2PCLA 2D06A 2P67A 1GDDA 3K0AB 2H7VA 4TMZA 2VRWA 2MSEB 4G5QA 3W3AA 4JIMA 2OHFA 1E0SA 4DDWA 1G16A 2VIIA 4OQNA 1YR9A 4PZZA 3SE0A 3IBYA 1CRPA 2D7CA 1SKYE 2H16A 1OYWA 2QA5A 1LFDB 5D3MA 4Z8YA 3BS4A 3VLFB 2IBMA 5JHHB 2FOLA 3K0FA 4WW0A 2GZDA 2H1LA 2A5JA 2D2FA 2QT1A 4GT1A 1J99A 1KJYA 3BORA 2H8KA 3AP2A 1E2EA 3KUCA 1EWQA 1KAGA 1QBKC 1UBEA 2GBLA 1M34E 1O3YA 3LFUA 3KTAB 3BGWA 3TR0A 5A4JA 2BMEA 2FF7A 4DDUA 1G8YA 3RS2A 3UPUA 3EIQA 2ZVPX 1X86B 4M2LA 4QBFA 2F43A 4LJ8A 1G64A 3PEVA 4BRUA 4R98A 1IY0A 1DAFA 1TEXA 1B23P 4DHEA 1N25A 4ACBA 2OAP1 4XD7A 4G01B 2GWHA 3QG1A 1P72A 3B1YA 2Z4SA 3U5ZB 2OCBA 1VCNA 2QQ0A 4TSFD 2VBCA 4NYMQ 4GBMA 2ODBA 3VHXA 4LJ9A 3MD0A 4BFVA 1CEEA 2REBA 4RD0A 3WYAA 5EP2A 1PLLA 1E0KA 4R2IA 4V0OA 3KXLA 3GLGB 1VYUA 1GITA 1KMHA 4HZUB 2GCOB 2QAGC 2DCUA 1XWIA 3LX8A 1XTIA 2CL0X 4LRTA 1KO8A 4I81A 1XCMA 4OHZA 1CULC 1W36B 3AKYA 4H1VA 2DB3A 1T3HA 2VP0A 4LC1A 5G41A 4F38A 1XMIA 2P6NA 3D8BA 4ON9A 3A1VA 4JL6A 4JYCA 5AUNB 4IXNA 2ZSBA 3KB1A 2FU5C 5FTKA 1TF2A 3CKLA 4W5JA 1CP2A 3QPWA 4KBGA 3HR7A 5JJLA 2QAGB 1N6NA 5JI2E 3HPQA 3CX6A 3AGPA 4UNSA 1OFTA 5FTNA 1W48A 5DISB 2PJZA 3QY0A 4QFMA 1G1MA 1YZGA 2OM2A 1NN5A 1TMKA 2C9YA 3CW2A 1UAAA 3IEVA 2RB4A 1COWD 3LQQA 3QI2A 2C2HA 4LHZA 4XVQA 3EARA 1CRQA 2JLQA 2OT3B 4MDEA 5GJBA 3B9PA 3U44B 2NPFA 4DT1B 2A5DA 2GCNA 5K8TA 3LW8A 1Q0UA 2WKRA 3KB2A 2FG5A 4TN1A 2HCBA 5TVKA 3U3KA 5CM8B 1G7CA 3S1AA 2ZREA 1KI2A 1OH8A 4FN5A 4G5RA 3ZGXA 1HT1E 1R4AA 2DFTA 2FSIA 2QEQA 5CLLA 4Z1MD 5FOVA 3LVRE 3TVDA 2DFKB 2QBYA 4S35A 3U7HB 3KFVA 2PMDA 3WBKA 4WZBE 3EZ6A 2J9RA 4PC3A 2IEZA 2CJWA 5C1BA 4B2PA 2BJVA 3RSOA 1FQJA 2WWXA 3EPHA 2BHRA 2AWNA 1KGDA 3TBKA 2FGKA 5H70A 1HQYE 3DPUA 4AY2A 5FOXA 3EWSA 1FMLA 2ANCA 2NPIA 1T91A 1UDWA 4XWKA 1UPTA 2J0UB 3ADKA 2VHTA 4O25A 5H8WA 1G18A 4AIIA 5JEEA 5CM9C 4WAUA 3VX4A 1IXZA 4NYIR 4FW9A 2UVQA 1I4DD 3QKSB 3FHCB 3U3JA 5EXXA 5E4FA 2QMOA 3WP0A 5FUXA 2WJYA 1LY1A 3R9XA 1I4LD 4OK6A 3NEJA 4Q7MB 4ZKEA 4CEJA 1Z08A 2YWFA 2VP2A 3FHOA 4B48A 3TNFA 2AHOA 3N5CA 4ZI3A 1G4AE 1AS2A 4KFRA 4D4MA 4OI0A 1Q21A 4DCTA 4OHXA 3I5XA 2RMKA 1KYIA 5DO9A 4TTRA 1KO1A 4LDJA 1NBME 2QSYA 3TRFA 4G3XA 1F2UB 4M4SA 4Q66C 5EE5B 2DWZB 3W3ZB 4FD2A 2AD1A 3WRXC 2IYUA 2G1JA 1II8B 3RSLA 3WHKA 2JLVA 2ZTSA 1F6BA 1GL7A 3QXHA 2OZEA 3WNCA 3CRMA 2QE7A 1HV8A 4DSOA 2WWYA 3CUEF 4CT5A 3AKEA 1Q22A 2F3TA 3W5JA 3I8XA 4JBYA 4MRRA 1S96A 3RRZA 3R8FA 2C95A 1OXVA 2HYDA 1EWRA 2VSFA 3PEWA 2B92A 1U99A 1YZTA 2CE2X 3GJXC 4DBLC 4B6EA 2RHDA 4I1OA 4ZDWA 1F3OA 2OUKA 4XSGA 2QPOA 1NN0A 3Q9LA 2MMGA 3CLVA 4TL9A 2JJ1D 1ZD8A 5HCNA 5JCPA 4ZDJA 1E9EA 2CHVA 4C2TA 1Q12A 3SYKA 2XOKA 2OBLA 3Q7PA 3SHFA 1VIAA 1UEJA 4JLBA 1KNQA 1OT3A 1DBSA 3Q85A 4CYMA 2R9VA 3AUXA 3MJHA 1NIPA 1TEVA 4RZ3A 5IT5A 3HYRA 1SHKA 1Z6GA 2ZUBA 1DARA 5AUQA 2R65A 1A2KC 3FTQA 3OEEA 1A2BA 3LWNA 5AUPB 2OCPA 4FMCB 4M22A 4QGAA 3NVAA 4IDPA 1XF9A 4MRSA 5C4GB 2QP4A 4I1VA 3SHWA 1Z2AA 5GJWC 2HXYA 2C78A 2W2VA 4ASUD 4J0QA 5DI3A 4GMDA 3TUJC 1E1QD 1RE0A 2GBLC 2JIZA 4F92B 3D7MA 3F3YA 3T1TA 2ZRPA 1CJTC 2FSFA 4PZYA 5BQ5A 2FEMA 4HAXA 4B34A 3FE2A 2DFLA 3HPRA 1TPZA 1Z0KA 3P1JA 3W5IA 2ZXUA 4QJ5A 3AF1A 4M1YA 2IK8A 1C4OA 1E32A 4ZKDA 1KY2A 2ZSDA 4YONB 4MRPA 4RFSA 5FBRB 3KJHA 1EFTA 3RC3A 1OB5A 3GFPA 2GDJA 1U2RA 2W2TA 2V54A 3QJYA 2VA8A 3PUVA 4UXJA 1G3RA 1GNPA 1G9XA 4P0TA 1NSFA 5E7MA 3WMGA 1XBTA 1V43A 2TMKA 3PQCA 4LOAA 3EIHA 3U60B 1KZGB 1MO5A 4HLUC 3A4NA 1Z5ZA 3GLFA 1MOZA 1VCOA 1W46A 4JS0A 2ASEA 2YHSA 4LC0A 2QGZA 2VO1A 5L3SB 1FL9A 4IDNA 2YINC 2WIAA 3Q3JB 1Q1BA 2KBFA 2EW1A 1FX0B 4HAYA 1E94E 5SZKB 3T15A 4DSTA 2P6RA 3E1SA 1U98A 1CXZA 1QG2A 2R62A 4A4DA 4ZCLA 2RCNA 4BZXA 4NMMA 2XZOA 2OV2A 4B32A 2IXEA 1PVOA 2ORWA 3H84A 4URZR 1KI6A 3Q5EA 2VP4A 3DL0A 4B73A 3GJ0A 2JLUA 2YWGA 2IYTA 1D2EA 1A4RA 3EX7C 1ZNWA 1Z0AA 2ZRKA 2DVWB 4C7OB 2WVJA 1M7HA 2CCKA 3IPXA 1JI0A 1OH6A 2FFBA 5TARA 2EWVA 4KVGA 1ZIPA 1VTKA 2IYSA 1QDEA 2IF0A 1W47A 2F1RA 4IFBA 3ETLA 1U94A 5BW8A 3K09C 1NKSA 2FZ4A 3N2EA 5TDHA 1G7TA 3I92A 3AM1A 2G83A 1NLYA 2PL3A 5JCZA 2AKYA 3RRMA 4HSEA 1M2OB 2FH5B 3NIBA 1WE2A 4OYHA 1TAGA 4A0HA 3N70A 1LNZA 4KVAA 1DS6A 1EX6A 4A6XA 5J4YA 5KHOC 5EE3A 4D82A 3ZIAD 1T3LA 1RYHA 1XEXA 1SXJD 3AGQA 2C5LA 4QBHA 3BB4A 4CT4B 4QBIA 4BLTA 3LX5A 3K9LA 2GESA 3I32A 3A37A 4YLGA 421PA 3SI7A 1NMZA 1ZINA 2PX0A 3Q7QA 3KDSE 5HKKD 3IO3A 3PUZA 5F98A 4LI0A 1VG9B 1B0UA 4QXAA 3QNUA 2G0NA 2HF8A 2O52A 1E9CA 3OEHD 2FJUA 3B7GA 3IO5A 1NN1A 4FCVA 3CH4B 1COWA 1P9RA 4HYYA 4HDCA 1CKEA 3T5GA 2GAAA 2JCSA 1PUIA 3FB4A 5CB6A 3AB3A 2VP6A 4BASA 2GVZC 4WBSA 4ZPXA 4AURA 1EX7A 2V7QA 1Z0JA 2ZYUX 2A30A 4M1MA 4L9WA 3LY5A 4PQFA 3UMFA 1FUUA 2N1BA 4GZLA 1XJCA 1G8GA 1G5TA 4OK3A 1YQTA 1QHYA 5FUWA 1NNEA 2XNDD 4MDFA 2KB0A 4M0LA 3FWYA 4FINA 1FOEB 4Z1MA 1XJ0A 3HDTA 4P4SB 1E9DA 1U0LA 2WPDD 3SNHA 4R9UC 3H4MA 4Q7LA 3IQXA 4KHZA 3T34A 5JZVA 3AF3A 4V0KA 1M1YE 1JPJA 2VHQA 1WBDA 2O8EB 4PQYA 1Z22A 2ZE7A 3B82A 2Q3MA 1U0HC 4RZUA 3NBFA 4DLUA 2WHXA 3Q72A 5F9HA 1N5IA 4GL2A 1N6PA 4LBZA 1GTVA 4KO8A 2GETA 3ZZ0A 1FW6A 1XTJA 1KDRA 1ZM2A 3K9GA 5F9FA 5L8VA 1ODFA 2CL6X 2WMNB 4BWYA 5K8LA 4GITA 2OBMA 1LB1B 1DEKA 3BXZA 2C77A 4NL4H 4Q4HB 4RZ2A 4D0LB 4Q9LA 4DSUA 2R6AA 4AKHA 3AVPA 4RD1A 4AYTA 1OH5A 1GRRA 1P9WA 5L3RA 4B47A 4L16A 5JI3E 4II7A 3UG6A 3ADBA 1XNJA 3L82B 1WB9A 5G3ZA 1DAHA 1MO3A 3KKMA 2RH5A 1OJLA 3NXSA 2O8BA 2DZNB 2W00A 1AS0A 2NG1A 4EFNA 3HU2A 3P20A 4EJSA 4URUR 3SS8A 4RFVA 2FEOA 3K0EA 4B3DA 1H8HD 3W9YA 1UKZA 4GOKA 3MSXA 1HE1C 4EPRA 2B8TA 5GVRA 2XTMA 5EE9A 1K5GA 2BBOA 5HE9A 5L3VA 4KODA 1JXMA 2OFWA 3U6KA 1UM8A 4O0MA 3VR3A 1ZCBA 2YYZA 1A7JA 1HUQA 3GJ3A 2VLIA 1L8QA 3CNNA 3ND8A 1N6IA 1S3GA 3W6OA 4CEIA 3I5YA 3AVQA 2GZAA 1XEWX 2B7BA 5E95A 1DVRA 2D2EA 2W83A 2V55B 3BRWD 1XCPA 1C1KA 4KFUA 4EPVA 4RVCA 5KNBA 3VTKA 4GDFA 4Q21A 2ONKA 3MAAC 1WMSA 4B3BA 2LWIA 2YNMA 3PIRA 4EKDA 5JWRA 2B21A 1NG9A 4D0GA 4Q4AA 5EUQB 4DCNA 3ZH9B 3BFXA 4MGZR 1RRGA 3U7GA 2O8FB 3TK1A 3RRNA 3AVVA 3IKJA 2JJ1A 1YU9A 1Q1QA 1IBRA 4AG5A 3SC3A 5SZJA 4BZQA 3NDPA 3I73A 4ZCMA 4OJKA 5IF9A 5EXTA 3B6EA 5BXQC 3CX8A 4NCJA 1ZD1A 2HLDA 3BIFA 1FPMA 1RJ9A 3B9QA 4A0GA 4RD4A 1R0YA 2WJIA 3KQHA 3K70C 5KPJA 4A0FA 3LBIA 4GNKA 4B44A 3PG5A 4YMVA 3JVUA 1A1VA 5K8IA 1GP2A 2QE7D 4HB4A 3WRYC 2GVDC 2QTVB 4P31A 3B1WA 2QP3A 4OHVA 4C30A 2NO1A 2QG6A 4FMDF 1F48A 1GWNA 1Z29A 3THWA 3DMNA 2CHQA 4H1UA 4TLDA 2C98A 3KKQA 3WP1B 2J59A 4C3ZA 2QGNA 1F2TA 1YR6A 1UJ2A 4BZPA 3AVOA 3B60A 5FPTA 1P73A 1YR8A 1RIFA 2OLJA 4ASUA 2DBYA 3K70B 3WMEA 4DJTA 1AZSC 3TSOA 3V4RA 5H1YA 3AVXA 2J0SA 1BMFD 3D31A 4LPSA 2AK3A 1R2QA 4MYHA 2IXFA 4PSVA 2JATA 2H18A 5L3QA 4TYWA 4IRUB 4F4IA 2E1RA 4V0ME 3CR7A 4D25A 4PAQA 5DYIA 2BV3A 2XX3A 4HLDA 5EP1A 4PXAA 3T5DA 2IL1A 1AIPA 1ZNXA 4PZLA 4QRHA 4DUGD 1GILA 2KJQA 3I72A 2R44A 1YZNA 3SBEA 4DDTA 1AJEA 2OLKA 1OIXA 3OEED 4NPHA 4LJ6A 1P4SA 1ZNYA 2XZPA 4KXFB 2B6HA 3PV0A 4Z51A 1TL7C 1G8FA 5FI0B 1CJUC 2ZAOA 1XD2A 3TIFA 4A8JA 2R6FA 3F0TA 3GFTA 3MUFA 4BFXA 3CR8A 2QROA 2F1IA 4PQRA 1HA3A 1QHNA 1T8TA 3SYNA 2GXQA 2XXAB 2DWOA 1GAJA 1GKUB 2D7DA 1K6MA 1M7GA 4TYQA 3L0IB 1E4VA 4CW7A 2N46A 3IBGA 3IIMA 4UNQA 4DSNA 1ZVQA 2CNWD 1OIVA 5KOYA 4IJMA 4PO1A 1XPRA 1XMSA 2ZM5A 4LJ4A 4HB3A 4AYWA 1NVUQ 4ARZA 3DOEA 3G82C 2JLYA 2A5YB 5B58C 4KITB 3U7EB 3RDPA 2WWHA 1T6NA 4LUCA 5FI1B 4BFTA 3C14C 4PSAA 4F4JA 3TLXA 3FHTA 3PCRB 4V03A 2XEXA 5TXGA 1L2TA 1VG8A 5KSOA 1T4GA 1U0JA 1VCIA 2B8WA 4YMWA 5AJZA 2FGJA 3X1YA 1CJMA 3RWMB 3PITA 4Z8XA 4TL8A 4JVMA 3FMFA 4NBSA 1JR3E 3EXAA 4OQMA 3SFVA 4IKEA 3GQBA 1JAIA 3MMPA 2ZJZA 4KAXA 4TQUS 3WY9A 2FDCA 1E9BA 4LZZA 4CF7A 2GK6A 2HJGA 5AJYA 2KBEA 1W0KD 1J90A 5GADl 4DLZA 4Q1EA 5C2JB 1OSNA 2PMKA 4KBFA 1DAIA 2D3WA 3DZ8A 1JR6A 3KJGA 2HUPA 3IPYA 2F7SA 3ZIAA 1N0VC 1SXJA 2CDNA 3FMPB 3NG1A 1EG7A 1S1MA 1NVMA 2A5FA 3QXCA 1MABA 3WMFA 4QOSA 2CMKA 3QXJA 5G3YA 3ZZTA 3PJRA 1KO5A 5HTKA 3KJEA 4JSTA 5HKKA 4HLQB 5FBVB 2IS4A 2IHYA 3R9IA 5JECA 4DEYA 5BN3A 1EFRA 3G0HA 2VL7A 5JSZA 5E7JA 3OEHA 5DN6A 4M8NE 4TLCA 4XVUA 4KU4A 3QKTA 2FSHA 3O8BA 2O8DB 1XXHA 3QF4A 4TLEA 3SYLA 5DIFA 4LGMA 3QIAA 4LV6A 3RS0A 1QVAA 4DLTA 1ELOA 1X8LA 3FFBA 4ESVA 1KJWA 1XZQA 2IYZA 2GJSA 4PPQA 1TF5A 2QI9C 3LD9A 2GILA 3U7FB 4NCKA 3GJ8A 3EZFA 1H8EA 5AJVB 1IHUA 2J7PD 1FFHA 2OAQ1 3CRQA 1VHTA 1AKYA 2I4IA 1XB2A 5GJCA 2AD5A 5J4VA 4D80A 2GF9A 2IS1A 1Z0DA 4YMTA 4LBWA 2YWEA 1D2NA 4MYCA 2JEOA 3QQ5A 4B2LA 3MG9A 4A92A 5B30A 2XNDA 1N5KA 3CNLA 3N2IA 4QNMA 3LH5A 4PX9A 5B57C 1OYYA 4DLXA 3K9HA 2WPDA 3PUYA 2YKGA 3AVTA 5J40A 3NBZC 5J5CA 2IYXA 1AK2A 2ZR0A 3FFAA 4MYUA 1PV4A 4CEHB 5J47A 4HAZA 2ZE8A 4Q4JB 3U61B 5SZHB 2ZU6A 1JQJC 2KWIA 2AR7A 4QHTA 4JVLA 4U02A 2AK2A 4HDOB 4HUQA 5TMPA 3THYB 2DHRA 2GJKA 5CDFA 3SQWA 1VCMA 1JBKA 3DKPA 4PR0A 4ZDKA 2V7QD 3NC0C 4XJXA 4XVRA 1RW4A 3AVWA 1N6OA 3UWKA 3GLIB 4U5XA 2EWWA 1W49A 1IAQA 1U8YA 2PZFA 1JQLB 1HH4A 3ZVRA 2GHIA 4AKIA 3W8RA 3QPVA 3CB4A 4MGYR 5H68A 3TGPA 5KU1A 2ZS8A 1ZNZA 3IIJA 1IONA 2NZ8A 4LCBA 1IM2A 2WIBA 3EC1A 5JWHA 821PA 1KO4A 3MHVC 4DCVA 3THXA 2FE4A 4JT2A 2YV5A 3U2QA 621PA 1H8HA 4MKFA 3VNVA 5G40A 1ZIOA 1Q20A 4D2IA 3PEYA 4CEIB 1VG1A 1OXSC 1JALA 2NQ2C 5IK2A 3AH8A 2CLDX 4CVNA 1E1RD 5CYOA 3AJIB 4DEXA 4EQ6B 2Q6TA 4M1KA 3X1XA 2N42A 2ZRNA 4N0DA 3W8NA 2QAJA 3C15C 1D5CA 3NWJA 5EZ5A 2QNRA 4MQBA 1CF4A 1E9RA 4K8OA 1W36D 4M9XA 4Q1AA 4NHOA 4DLWA 1I4TD 2HF9A 4R2HA 2WOJA 1GSIA 5JBQA 4JLNA 4JBXA 2OFXA 1US8A 3VU9A 2F55A 1U90A 1EFCA 2OEPA 5LDDC 2V1UA 2ZI6A 2IS2A 4Q9IA 2YOFA 1ZC3A 2FZLA 2Q9BA 4QKQA 1CJKC 3M6AA 4M1TA 3T35A 4LJ7A 1GKIA 4S2EA 1OXXK 3CM0A 2ZVQX 3SJAA 3FPAA 1RKBA 3TVTA 1RJ9B 2W0SA 3P26A 3WHLA 1KK0A 2AFHE 2IYWA 2CVHA 4QBGB 4BFYA 4GOJA 1E2LA 1GNQA 3L8YA 4YXWD 3SJCA 1K8RA 4AKEA 4L9SA 4KSBA 1QHIA 2ECKA 3GEHA 3HR8A 3CRW1 3THWB 4B74A 2ATXA 3BC1A 3LDAA 2VQSA 4DC9A 4EUNA 4Q19A 2AKAB 4HB0A 4IW3B 4NYJQ 2EVWX 1E4YA 1F2TB 5CJPA 1YKSA 3MWKA 2YZ2A 5KSPA 1E99A 1M7BA 2EFDB 3O8CA 3ADDA 2ZRAA 5EUMA 2GTPA 2HXSA 4LPKA 1NVVR 3KQNA 2VHJA 5IRCD 2QU8A 1O87A 2ERXA 1S9HA 4BLRA 1HT2E 2HJVA 4PPFA 4B2IA 4YDSA 2BOVA 3EC2A 4EPTA 1ZU5A 4A8JC 4JLOA 4NTZA 1WBBA 2QMUA 3I62A 1KJZA 1OF1A 1ESNA 2QY9A 1IXRC 4KFSA 2ORVA 1RC8A 4QHSA 1BMFA 3HJNA 2WM9B 2RHMA 4OL0A 4B76A 1LS1A 2GJ8A 4IOMA 3CWQA 1EFUA 4WOPA 2X2EA 3KXKA 1ZM3A 1N6KA 1KK2A 5LPNA 2WSSD 2VYFA 1RFLA 4Q7JB 4DUGA 3M0EA 4GFDA 4QNRA 2HLDD 1HY3A 3K9NA 4O3MA 4RD2A 4LBVA 4JLVA 3REFA 3DOFA 1Y63A 2JASA 1UKVY 1G3QA 2C04A 4UXIA 3FKSD 2O8CB 3GJ4A 3RYTC 3NH9A 1SVLA 2IT1A 2XZLA 5JS8A 4DLVA 1L4YA 2Y8EA 5LB2A 4DRZA 3L2OB 5TY0A 4TMVA 1T0JB 5B2ZA 1S0UA 1KMQA 4YDHB 3ZS9A 4PO9A 2HDNB 1FQKA 1P5ZB 2WJJA 4US0R 2FN4A 5KDOA 4JYBA 4QM6A 2PLFA 3IHWA 4DCSA 4PTLA 2AXNA 5FFMA 2V6IA 2CNWA 4OHWA 2D74A 1NMXA 2MSCB 3WXMA 4FCTA 3BBPA 4K46A 3ZQ6A 1ZM7A 1JB1A 5KNDA 1W4BA 4NCNA 5D3MB 3IUYA 1SXJC 3K0FB 3SR0A 3CPEA 5FTLA 1G3MA 5CIQA 1WXQA 4M1WA 2ZI9A 2RGCA 2IYVA 4ILEA 3UG7A 5EJEA 4QC2A 2CCGA 2IYLD 3VMFA 2ZI4A 3B78A 3ASYA 2IYYA 3CZQA 1XMJA 2YOGA 2ZPTX 5KSZA 3CF2A 1D9XA 3CF6R 3LV8A 5JRZA 1R5OA 1LVGA 2F43B 4JMPA 2HT6A 1SXJB 4GRAA 3LA6A 3BH6A 1ZP6A 1Z2CA 1KDPA 3BOSA 3CWZA 1W0KA 3CH5A 2BCJQ 2ZS9A 3GMTA 2O0KA 4RCYA 4B71A 4I1UA 1OLOA 3LQRA 3QF7A 1S2MA 3GJ5A 4KYUA 4Q02A 2DWPA 2R6CA 3PENA 2BJWA 4KV9A 2I3BA 1R8SA 4PSKA 5CK4A 1E9SA 4TZ0A 1SVWA 4JZKA 1U9IA 1E2IA 1QRAA 1KSHA 2GAOA 1XZPA 1XXHB 4X8LA 4D4LA 1KMHB 8OHMA 1G3IA 2YC2C 3UMSA 5LBIA 1GFIA 4DDVA 3SEAA 2V9PA 2VSOA 3CONA 4GSYA 4DVGA 5JEDA 2PJRA 2V8OA 4OI4A 3FVQA 3X1WA 4P3YA 3JVVA 2YJTD 1XTQA 4TQ9A 2V4ZA 1S8FA 3QPUA 3R8CA 4NCHA 5DH9A 2GXUA 5B64A 1L7VC 2FMXA 1S4QA 2OCYC 3BB3A 4M53A 3GLHA 5J4LA 2JLWA 1ESMA 3AV0B 4AD8A 4B3GA 2C99A 2P3SA 2OFOA 3MLEA 3ZS8A 1GM5A 3LW7A 1N3BA 3L0OA 3T12A 3VKGA 3VR1A 2ZI3A 1L4UA 3K0SA 1GKYA 5BYJA 4C0BA 2J7PA 2BC9A 2OE2A 1PLJA 5FH9A 1JEDA 4QGGA 1YZQA 2CLCX 2BKEA 4DB2A 4Y0AA 2FSGA 3GLIE 4ZIRA 4TMTA 2ZUCA 1P2SA 1IOZA 3AKDA 1NVXQ 5HE8A 4FMDB 3K0AA 4BFWA 1Z06A 4B3FX 1X1SA 4PHFA 3X2SA 4DLYA 4Q18A 4NYIQ 2JGNA 1JJ7A 1NP6A 4XTRA 4CGZA 3TKLA 3DVLA 1Z83A 4AYXA 4H9GA 3DM5A 1AKEA 1IN8A 4EDHA 1DAGA 4L8GA 1GOTA 3QEOA 1VDZA 4B75A 4A36A 2BM0A 2FPMA 3KUDA 3UMRA 3A6PC 2J5XA 1EFRD 1M6NA 1G6OA 1FNMA 4TYPA 4AI6A 3VFDA 5FPKA 1EFHA 1CBUA 1FTNA 2J7KA 4C0LA 4MYTA 2G9NA 5P21A 4Y0VA 5FTJA 1HURA 1Z07A 2ATVA 1NG1A 3S1AB 2Z83A 5KDLA 4AC9A 4R71A 1E2NA 1GUAA 2DZOB 1VHLA 1Z8FA 2KE5A 4Q9JA 2PLRA 3U3OA 3EAQA 3KQKA 4OHYA 1H8ED 4W7SA 2V6ZM 2PH1A 5FBWB 1Z3IX 3QVUA 4OQXA 1KDTA 2DWQA 2QBYB 2JJ2D 1BIFA 1GIAA 4Q7KA 4EPXA 4ZI2A 3AVUA 1CIPA 3PVSA 3QXSA 4UKDA 4TT3D 1ETUA 4JLJA 3AF4A 1T9HA 4URXR 4RD3A 3MRSA 2CJWB 1XTSA 4RKFA 4NP6A 2OSBA 3CRVA 4FWGA 2QSZA 3VQTA 3QSYA 5KNCA 3IDQA 3ZQJA 3IHLA 1Q44A 4HUTA 1I2MA 1Q57A 2QTFA 2D4HA 1OIWA 3OAAD 4WXPA 4BE7B 1M74A 3BJIC 2NGRA 2CE7A 1E0AA 1FUKA 1T5IA 3GLGA 2CL7X 1Z6TA 5CK5A 1IY1A 1JNYA 1S3SA 2FV8A 2GCOA 1IJEA 1E1RA 2ZRHA 3QVVA 2X8AA 1TX4B 4HZUA 5CLQA 1TQ2A 3TQCA 4IOJA 2EU8A 2BMJA 1NSTA 4X8OA 3LXXA 1KY3A 1I2DA 1KI9A 3H0KA 3AUYA 4TMWA 3CNOA 5FR2A 4P33A 2CXXA 3QKRA 1ZUNB 4B3XA 2GF0A 4CEJB 4ERNA 3VKHA 3DO6A 1T5LA 2A78A 1KO7A 2IA5A 1MRSA 4PAOA 3RHFA 5C46F 3EZ2A 1QVRA 2DY1A 2XITA 6Q21A 5KO2A 4LHYA 2BMDA 3KJIA 2ZSAA 5JFGA 1P60A 2Q3FA 2DR3A 4JL5A 5M04A 4F4CA 2Z0MA 1X37A 1XEWY 3UIEA 4EPWA 3L43A 4LWZA 1OKKA 1ZMXA 1E3MA 3KKOA 4JVNA 4ITRC 2F9LA 1R5NA 4NU0A 3Q5DA 3SJBA 1UF9A 3RAPR 3AF0A 3A1WA 3W6PA 2QRZA 2XJ4A 2ZU0C 3PUXA 4YXWA 4DKXA 4IVRA 2EQBA 1Z28A 1JR3D 2AL7A 1G6HA 4YQFA 2IYRA 5IK2D 3R7WA 2QL6A 4CDGA 2NZJA 2CK3D 5BN5A 1MR3F 3U44A 4NYMR 4DT1A 1VECA 4V02A 3BH7A 1U8ZA 1XU4A 2XTNA 1GL6A 4V0LA 2VTKA 1CJVC 4BFUA 1XJQA 1GNRA 2V6JA 3EIEA 4AK9A 2IUTA 2AX4A 3W6NA 1KAOA 221PA 4DIEA 3AF2A 3VKWA 4PHHA 3BFKA 4Z54A 1IXSB 3PXGA 1E6CA 3GD7A 5DI9A 4LJYA 2LKCA 2PX3A 2GA8A 1X1RA 3LXRA 3DEFA 1YZUA 2O0HA 3UATA 2XTZA 3QG5A 1OFHA 4LRSA 4BQSA 4C0KA 2WKQA 1QZXA 2BM1A 4IEEA 4IVQA 1G7RA 4OI2A 4N1AA 4G5GA 1E2JA 1KKMA 4XWAA 1YRAA 2CBZA 2VF7A 5IDVA 4Q9HA 1EESA 1Z0IA 4NE2A 3OE7D 4WA7A 2CVFA 4EFLA 3L0PA 3KW6A 4ACAA 2WSSA 5FTMA 2GRJA 3AKCA 1FP6A 4B3CA 2J41A 2ZANA 2XNSA 4HB2A 1NIJA 3SJZA 4OQFA 3H1TA 1V5WA 4PC7A 3HYTA 1Q1ZA 2J0UA 2A3RA 3SDZA 4BFSA 2IX3A 3FKSA 3BERA 2OBNA 1T0HB 1YZLA 2A2ZA 2P65A 2RGGA 1Z6XA 2YVUA 2BWJA 1GZSA 3L8ZA 5E7IA 5EZ6B 4XWOA 2WMOB 1GRNA 4DB4A 1ZUHA 2AXPA 2GJAA 5DI3B 1KK1A 1PUJA 4G0NA 5FOUA 1R7RA 2Q0HA 3T61A 1QHSA 2ZE5A 4QGHA 2PZGA 3B8HA 2P5SA 3VNUA 1J7KA 4UQOA 4LHWA 4WVFA 2V1XA 4P4TA 2QPAA 2DPXA 1SXJE 2JDID 3H86A 1UDXA 2NOAA 2ZRMA 4BLQA 4LY6A 3BH0A 4JKYA 3OIWA 4XIGS 1Z0FA 2PT7A 2OO7A 1EXMA 1RRFA 2F9MA 2QORA 2WBLC 1D6JA 1F2UA 3LVQE 4RFSB 1P3JA 1IY2A 4TL7A 5DSZA 1II8A 4MH0R 1G8PA 1OH7A 3A58B 1KHTA 4Q1DA 1DADA 2NTYC 4PPGA 4GPTA 3PEUA 1XXHE 3KFXA 1RZ3A 2QM7A 4CZ2A 1NF3A 1G20E 1NKTA 5JRJA 3B13B 4XH9B 4JLMA 4P4UA 3GLFB 1P2UA 2F6RA 2FFQA 3SFZA 1W0JD 1HYQA 4QGFA 5LD2C 2ZRJA 3FGNA 4HEJA 4TYNA 2FA9A 1NJGA 2MSDB 4BECA 3A1UA 5DLQC 1AQUA 3RLFA 1KSJA 1PLKA 5KPDA 1P62B 4Q00A 3RANA 1KI6B 4IEIA 1NY5A 1D2MA 1JXOA 3A1SA 5AJXA 3TQFA 2ZRIA 1KTVA 3FKQA 4A82A 4C4PA 3IQWA 1XPOA 1T8UA 3IGFA 4E07A 1KSFX 2KSQA 3QENA 1E2DA 1W5TA 2GKSA 4BEBA 1JAHA 3IEUA 3PR1A 4XTCS 5LD2B 3ONWA 4FIDA 3ZVNA 1TQDA 1TTTA 3KKPA 4IOLA 2GCPA 1SVMA 5GVSA 3GLHB 4OQLA 4CRWB 2H92A 3M1IA 1MKYA 3EWAA 2YWHA 4Q1BA 3P32A 3VR5A 4ZDIA 5CDFE 3GP8A 1CR1A 4BGDA 3TAHA 4RKEA 1QG4A 4NZYA 2J46A 4LV5B 5G53C 1BH2A 1Q3TA 2BKUA 3EG5A 5AJWA 1UBFA 2R6DA 4Q1CA 1KI1A 2A7QA 1AZTA 3GJ7A 3M4YA 3LO5A 3OF5A 3VR2A 1KK3A 4B35A 1IN4A 1XEXB 2CLSA 2W2XA 2BEKA 1ZBDA 3JZAA 3NC1C 2XAUA 1ZD9A 4ABYA 4DWJA 2VEDA 2E9SA 1KKLA 1E2GA 1NBMD 2ZJ5A 2XSZA 3LBNA 4PFSA 1MH1A 4RCZA 3VX3A 3OIYA 3ICQB 1TQ4A 2ORIA 1VMAA 3QEJA 2VP5A 2X2FA 1WRBA 1N6LA 4RJLA 1EGAA 2G88A 3EZ7A 4EPYA 3FDIA 2WZQA 3DKVA 1E0JA 2WV9A 5HPYB 3ZVLA 3MFYA 3RWOA 2ZJYA 4U00A 3NEYA 4LV8B 2GJ9A 4Q5IA 4LHVA 3KX2A 4JLPA 3U4QA 2P2LA 4LX0A 3G5UA 2ZR9A 2OCAA 1J8YF 4NH0A 1DG1G 4A6PA 3NBYC 4IHQA 2AN9A 2FFAA 2R2AA 3NH6A 2PBRA 2FPLA 2IW3A 3TJZA 1W1WA 4GOXA 4KYIB 4HAUA 4XSHA 1H65A 3ZD6A 1XTRA 5KSYA 4M9SA 5L3SA 5K8UA 1FX0A 1W36C 3THOA 1J70A 5FUYA 1E9AA 1KI7A 1MRNA 4JT4A 4V0MA 5HCIA 3R9WA 1C1YA 1G5RA 2JJ2A 2X77A 4MRNA 4D6PA 1SHZA 1Q3HA 4PPNA 4TT3A 1Z6YA 5CYPA 1GRQA 3MGCA 1UBCA 4KI0A 1S1CA 4BLPA 1R6BX 4HLUA 4HZIA 2C9CA 3TE6A 2IF2A 1N5LA 2F1JA 1AQYA 4C7OA 3GEEA 1D9ZA 3UANA 3OAAA 4JKIA 1YR7A 4MGIR 4EJSC 1U81A 2Q9AA 4C2UA 2BBWA 4KSCA 3QKRB 2ZRCA 2ZJ8A 2CEAA 3E70C 4JL8A 4LRWA 2HV8A 3TUIC 4NDZA 3ZJYA 1WDTA 1C9KA 4MKIA 2Z4RA 3ZLJA 1G41A 3LLUA 2ZJ2A 2ANBA 2ZEJA 1FTSA 4FWIB 1X8KA 5IHPA 2Z6VA 121PA 2E87A 4M21A 3VR6A 2GEUA 1KI3A 4PC1A 4BLOA 1E2KA 3ZD7A 2QPTA 3LLMA 2O8BB 1UBGA 2ZQ5A 3GEIA 2OXCA 4EJSB 5FPYA 1ZCAA 3DMDA 4JLKA 3SOPA 3WNBA 4C0HA 2JLRA 5JHGB 1NVWQ 3K09A 2XB4A 3K0CA 4G1UC 4E03A 4E09A 3V4FA 1G17A 2Q9CA 3BAFA 4C9BA 3TW4A 4TQAA 3R7WB 2J45A 3AP1A 2ZJAA 5FUVA 2ZI5A 5F3WB 3AQ4A 1TU4A 1QHHA 4R7ZA 1XP8A 5FL7D 3EPLA 4PC2A 3TMKA 4DZZA 4JJKA 5DE3A 1JR3A 1YVDA 1VG0B 1IJFA 5HR5A 4D26A 5C18A 4DCUA 2QM8A 1KOFA 4PO8A 4TMXA 3QBVA 2CK3A 4TWZA 1QZMA 4EAQA 1OXUA 2A5GA 3BK7A 4Q03A 1NL3A 2OXRA 2QZ4A 1N5JA 1XEFA 1RVDA 4MITA 3SBDA 3E5HA 2ZYTX 4Q4AB 1E2PA 2ZYVX 1XX6A 2REOA 3I8SA 2QRNA 1NY6A 4UNNA 4FXPA 4G5SA 2BDTA 3UK6A 1ZYUA 2RAPA 2VF8A 4FWTA 5FPHA 5UKDA 2AWOA 1MO4A 3CX7A 2ODNA 2QTHA 4DLRA 2W6JD 1NN3A 2B7CA 2J3EA 1MO6A 1TU3A 4P4SA 3KQUA 2UKDA 3ADCA 1F60A 1OKKD 1SGWA 3I3SR 4IDOA 2BMFA 4D4JA 2GXSA 2IEYA 2O8EA 1CR4A 3U6BA 4HATA 2J0VA 4ZCIA 5EXPA 5JLJA 4BEJA 4LK2A 2GXAA 3CZPA 4JLDA 3CIOA 1SZPA 3OE7A 4RZXA 4W9MC 4TLBA 2UZIR 1NMYA 3HP1A 1F5NA 1XCGB 3C41J 2W58A 2WJGA 2ZYWX 2GEDA 1J2JA 5KUTA 1JECA 1M8PA 4C0JA 3RABA 1K5DA 4Q4HA 2JAQA 3UXMA 4LJAA 1OFUX 2G77B 1N2CE 1W4RA 4FWDA 1QHXA 1CTQA 1HE8B 1MT0A 5FL3A 1N0WA 3GLFE 1Z6AA 4PC6A 2PEZA 2Z5FA 2F3RA 5GJVC 1QHGA 2P0EA 3ZZUA 4PHGA 1PJRA 5DHAA 3DZDA 4C0AC 2QUZA 5L3QB 1W4CA 3NHBA 2O0JA 4IFEA 5BN4A 4LYFA 2JDIA 2RKOA 3X1DA 5JS7A 1E69A 2ZJOA 5KDDA 1BO6A 3AVYA 2DYKA 3HU3A 4LYHA 1A5TA 4TYYA 1X6VA 1UEIA 2ZSFA 4C0SA 2YC4C 3BD9A 5EXSA 2EFGA 1OHHD 3P4XA 5CITA 2GZHA 4GP6A 4LYAA 4QM7A 3KQLA 4WIAA 2J87A 1XRJA 1XD2B 3B1ZA 3F5FA 4A8JB 5C4MA 2RGEA 4HAVA 4OKSA 3B5JA 2P5TB 1ZM9A 1R10A 3ZYCA 3GLHE 4O2RA 4NKRA 1XFAA 4NONA 1ZU4A 1JEEA 3A1TA 3LRPA 1KDOA 3SU8A 1AM4D 5LB4A 5AK0A 3QKUA 1UADA 5JMTA 1TUIA 1W0JA 2WOOA 4BPBA 3KZ1E 1ONBA 4Q4LA 3A4LA 4XOIA 1P2VA 1W2HA 4ZO4A 4AG6A 4A2WA 1W4AA 3BE4A 2O8FA 3OESA 5CIWA 4L15A 1OW3B 2FWRA 3B85A 4I99A 4YMUA 3CF0A 1LTQA 4ARZB 2H57A 2ZSEA 3UWOA 4LBYA 1FNNA 1SKQA 2ZITA 4MUAA 2R8RA 3I61A 4A3VB 3GJ6A 3VR4A 4PAMA 3NTUA 1OV4A 5TV2A 4X8HA 4HDQB 4FCWA 1WF3A 5FOTA 3TSWA 2NIPA 3O47A 1G3UA 2ODEA 1AGRA 1E96A 2RGNA 1JPNA 5CJ2A 4V0NA 4KFTA 2G3YA 3KXIA 3P4YA 5JWOA 1QF9A 3GFOA 4LSGA 4JLAA 4LHXA 2ZRBA 3TH5A 4U7DA 1R0ZA 2WSMA 1BOFA 4DXAA 1W7AA 3H2YA 2ZS7A 2R6GA 1LS6A 3LBHA 4PHTA 3BWDD 2RGXA 2WKPA 2JJ8A 3Q8XB 2X1VA 1II9A 2XB2A 2EFHB 1XPUA 2JLSA 1SVSA 4B33A 4PANA 1MABB 4KLNA 2BIFA 1RYFA 3HU1A 2O5VA 2EYUA 3QOFA 5EE1A 1J8MF 1FMJA 1NBMA 1KSGA 4A9AA 1E79D 4IDHA 4OJQA 3AEZA 5FR1A 2QQEA 1G8HA 4UXHA 5SZIA 2BVNA 3U4QB 5JSZB 3GLGE 2REXB 2Z43A 3A4MA 3QF4B 3W90A 3U3MA 1E2QA 2VHUA 1RPZA 1XMVA 4N3NA 3CO5A 1ZRHA 3KKNA 2PCJA 1RRCA 2XJ9A 4Q9KA 4WZ6A 3EA5A 3KL4A 3QBTA 4QG7A 2QMHA 5FPSA 1HEIA 2GK7A 2XXAA 2WWGA 3ICEA 2W6ID 3OFND 4TMKA 1P2TA 1IN5A 4I1SA 4Q47A 1KZ7B 1DG3A 1WP9A 2ZRFA 4TSFA 4LJ5A 3B2EA 1Y3AA 3RVBA 1GL9B 4M9ZA 3T1VA 4TZ6A 1VPLA 3X1ZA 1R5BA 2XSZD 4Q01A 3V00A 1GVNB 3ZDQA 2AFIE 4MA4A 3RS5A 3CBQA 2QENA 2J1LA 3C16C 4B6FA 4DIDA 1W2GA 4MKHA 5FBLB 2HEIA 4A2QA 1XTKA 3K0CC 4P32A 4IOKA 1CLUA 4L4UA 3L0SA 2BBTA 4JSYA 4IXMA 4W5WA 4HUQB 3QXXA 4YC7A 5EP3A 2FNAA 4US2R 3B1XA 4F91B 1CR2A 5DNYB 1CU1A 1E2MA 2NO0A 3DDCA 2A9KA 2D62A 1G19A 3MWYW 2VSXA 3RC8A 1DAMA 4RSGA 2ONJA 1DO0A 1NLFA 3KTAA 4OBEA 1A82A 2ZETA 1G5PA 1X8JA 2FX3A 3FYHA 4HAWA 4XD7D 4JN6A 2BEJA 4QJ4A 4QJ3A 1G291 2HT1A 3CPHA 1DPFA 1BKDR 1WQ1R 4RY2A 5DYGA 4JJZA 4C0QC 5D3QA 2JLXA 1QHHB 1BYIA 1SKYB 3THXB 3OIUA 1II0A 3CPJB 1KIMA 4GP7A 1W44A 4KJZA 1UKYA 1NJFA 4WZAE 1NRJB 521PA 3GCGA 2IHBA 1DTSA 1NVVQ 2C03A 4A15A 3LAWA 1SQ5A 3PFIA 4A2PA 2H17A 1NI3A 2NO6A 3FOZA 2VHCA 5FL7A 1DELA 4KCGA 4FI3C 2IC5A 1SVOA 3TW8B 3NDBB 4M1SA 1ZUIA 4I4LA 2G6BA 1IN6A 3I1FA 3C7KA 2O8DA 2GEVA 2OESA 3DHWC 2J0QA 1ZW6A 4POAA 1KNXA 4RD6A 2NO9A 4BRWA 1US8B 4ESHA 2HCJB 3VU9B 2CHGA 1G7SA 1MV5A 5BYKA 5HZKA 3D3QA 2QP9X
chains in the Genus database with same CATH superfamily
1T0PA 4G8CA 1RAAA 4WXYB 1KEUA 4DYHA 3FZEA 2PSHA 1DRJA 1BW9B 1BWSA 1DWPA 4XRRA 1CS0B 2FZGA 3E9EA 3LWZA 2W6JA 5HSGA 1EVEA 4JP1A 4KE6A 1LF0A 3NAMA 2CB9A 3ZEIA 2WWWA 5KYGA 4BBAA 4IMRA 1J06A 2C8LA 4K9QA 2WYOA 5AXCA 5A0FA 4DIBA 2I65A 3WK4A 3TSZA 3JD4A 3IL2A 3C5CA 4Z3DA 4URYR 3K32A 3MTEA 2LCFA 2I1VB 4LY9A 2ZUUA 1W73A 4PY2A 2V0GA 4IBGA 3ZW9A 4RVUA 3F6YA 1SURA 1R0XA 1ICIA 1R4MA 4B3TM 1S9DA 4N01A 1WVMA 4IKOA 5TQ2B 4W5HA 1ZMTA 5FOWA 1EDOA 3MJRA 2I1WA 2RBKA 3MBIA 3PD0A 1NA5A 3NKFA 3NKVA 3D6VA 1JQKA 3WLNA 3ZQKA 3GRCA 1CEQA 4EG1A 3MBOA 2XVAA 4L4XA 4NJEB 3SMPA 2IXBA 3FWPA 5CP8A 5HM8A 3I6IA 2F1HA 4G0WA 4R2XA 1Z5CA 3L93A 5FNVB 2Q2QA 3IODA 4US1R 3L6DA 1QQ6A 3MCAA 4O29A 4EHAA 3RU2A 2BCEA 4NC6A 4URVR 2F3SA 4RGYA 4HFRA 1OCEA 2AUNA 1TQ6A 1FYXA 3ZVMA 4P7KA 4UVDA 2HDOA 1HE4A 5JOQA 2IQ5A 2PKEA 3UB2A 2QDXA 4E5VA 4I46A 3O4GA 3PUWA 3SYMA 5CLFA 1SD1A 3UJ9A 2WSBA 4UZEA 4DQVA 3Q2KA 1SIBE 2HAEA 3NAZA 1PTJC 4RVDA 1SU4A 4M1ZA 4COOA 4ZVLA 1OYWA 3F3SA 3AIOA 4NZMA 4WW0A 4IH4A 3N8KA 3KXEC 5HW0A 5FNZA 4IWXA 4N47A 1XQYA 2PAAA 1IY0A 1TEXA 4DHEA 2MU1A 4MSUA 2FLWA 1T9BA 1HE2A 3D2CA 1ZEJA 1V5FA 4R2IA 2OHGA 4ZT4A 2JLCA 3SF8B 1MV8A 5IAKA 2IHVA 1W0CA 1YACA 4BO6A 2GEJA 1NWHA 1J97A 1DTWA 2QRJA 2YZ7A 1OGJA 3A1VA 5AUNB 3ZDDA 2B78A 1U5BB 1TIKA 1CUKA 3H7IA 1XTBA 5FP0A 3CKYA 4ZVRA 1OFTA 3GPCA 2JL1A 5IWCA 4R9SA 1IZZA 2QN8A 1Q6YA 1FEZA 2WHQA 2AI2A 3U44B 2LH0A 1WTCA 2BLNA 2FOIC 1DJLA 3EVZA 4R2WA 1WS6A 1ZWLA 1XVIA 3JQ9A 3ESQA 4ND5A 5I45A 3H2GA 3MJFA 3WNZA 2HRCA 4NU8X 1MXHA 4HH0A 1DMRA 4MQFB 4WFIA 5ABPA 5C1BA 3DBRB 1J24A 1RWWA 1PEAA 4MB7A 3LXMA 4JC4A 4YACA 3D0OA 3HB5X 3QE3A 2V7GA 1GARA 3LUGA 5LA6B 4ZKEA 5A6SA 5ADWA 3FHOA 3GQ3A 4X64M 4MXDA 1A27A 2HFJA 4L95C 2QSYA 4G3XA 2GO7A 3FKEA 2V74B 5A4AA 3AKEA 3GAAA 4LE2A 1Q22A 3W5JA 3DE1X 4EG3A 2HYDA 3IHKA 2D7EA 2CE2X 1VIMA 1K98A 1ZXLA 1NN0A 4LXGA 1H9CA 3WBBA 2QX6A 3E3OA 4DPKA 3V76A 3COZA 3LCVB 4IGIA 4MP3A 2H2WA 4X1YB 4M22A 1VSQA 2X14A 2HJHA 1ZJJA 3GW8A 4IIWA 3T0GA 4LJLA 4JYAB 4HNGA 4R1QA 3N2NA 1TVCA 3IIEA 1K68A 4PZYA 4GMGA 2QZSA 4LE0A 3E22A 1FF9A 3GYBA 4FHEA 4RFSA 1UIRA 4KVZA 4D43A 1U2RA 1U4SA 5HZGA 1BHJA 2VA8A 4RTSA 1ZH8A 3LNTA 1QAOA 2BEVB 1DQYA 1VSVA 4LXXA 2Q4TA 2ZCUA 1ONNA 4CLHA 2YINC 2WIAA 3N0RA 3SARA 2AUMA 4ZCRA 4IYRA 2OV2A 2ZBRA 4REMA 1QIMA 3WGNA 1JLMA 1D2EA 3QUTA 3I28A 1DIHA 1OZAA 3D59A 2EWVA 4DPLA 1U94A 3I42A 3L4EA 1CUCA 2QYSA 2G83A 5JCZA 1V3UA 2W9XA 2RC5A 5BSHA 2B98A 3ENKA 1ZJYA 3N87A 4ZARA 4NMHA 2O23A 5HWSA 4QBIA 1ADBA 1PN3A 4NK4A 3UMCA 1XFDA 2GESA 4L3OA 4RTKA 2MINB 1PFGA 1ZINA 1HSOA 4X66B 3T5CA 5DN6D 3UKOA 2ZWMA 1EUZA 1M54A 3ZBUA 1G5HA 3D7RA 3ZWAA 2C5BA 4Y7DA 2CNLA 5T57A 2QX7A 5F9MA 4W6ZA 2VAVA 5FA8A 5HIMA 4L9WA 5TX7A 4FLMA 3EY9A 4Z7JA 3M4XA 4KHPB 4FDVA 5LMUM 4Z0HO 3FWYA 5JV5A 2Q2WA 3HDTA 2OOAA 3R3JA 1CFZA 2VHQA 3Q72A 5B1EA 5K05A 4C07A 3DB1A 2C4WA 2PLNA 1LB1B 2C77A 4KO1S 2GZRA 2EKPA 3TIVA 4LF6B 2VKQA 4RAOA 1JDSA 1KZ6A 4AF7A 3TI7A 3ZHVA 4F8JA 5LXTB 1PR0A 1H8HD 5GWXA 2FZVA 1L8QA 2BI7A 4CM7A 1DBVO 5KREA 4GW3A 4RVCA 4QFBA 1WMSA 4L74A 4LOKA 5AXBA 4BMPB 1SHJA 3ZH9B 3BFXA 4G9BA 3Q11A 3TOCA 3S2EA 3RTGA 5EXTA 4R1UA 2EJVA 1RJ9A 3D3WB 4RMGA 5D01A 4WLVA 4A0FA 3OE5A 1HX7A 3KKQA 4PF1A 1PFQA 2J59A 5AJTA 4QUGA 1YR8A 4H1TA 4LPSA 5B1SA 1D0LA 1XMPA 4A6DA 3L1UA 2QJTA 4J16C 4JQCA 3FNBA 2DSTA 3ORQA 4TKUA 4G1FA 2IIBA 4XVHA 1M0EA 4I4TA 4N7JA 5FI0B 1CJUC 2XCUA 4MIYA 4WBNA 3UZUA 1HA3A 1RC0A 1A9XB 3L0IB 5AOVA 3Q0TA 3HNOA 3RFUA 4UHFA 1XPRA 1ULAA 4FMPA 3KOWA 3QFSA 3C1UA 4KITB 1T6NA 4LUCA 4BJHB 3EGEA 4BFTA 2FZEA 4IG4A 4ND4A 4XLTA 1A88A 3UGJA 3R7BA 3E9CA 4MVYA 4MA5A 2X9VA 4D8YA 1SBNE 4LZZA 4BQQA 1J90A 4HQ0A 1EK6A 2JCGA 3QVMA 3OF2A 3RKUA 1T6OA 4XVCA 2JY8A 5K0LA 1RJGA 2V5AA 2QTLA 4JB0A 1OLUA 2WUWE 5JNSA 4JI3M 3SYLA 1X8LA 4LOIA 3FW1A 4NCKA 3M7GA 1IHUA 4RMHA 2G08A 3FZYA 3QQ5A 5FCDA 2PYDA 3N2IA 4LOJA 2XB8A 3UK0A 1TD9A 2DE0X 1UKCA 7ADHA 3UT5B 3O1JC 3GFVA 4M88A 1Y7TA 3C5VA 5DTIA 1SKUA 1U1FA 4HDOB 1HYBA 3UAOA 4UOZA 4PIVA 5AW9A 5AICA 1LV8A 3U19A 3LK6A 1X80B 3B5EA 4NSRA 3AVWA 2OV4A 2IYOA 1WDMA 3DKRA 1ZGHA 1D1SA 3TGPA 3G8BA 1OV6A 3FYDA 5KNCD 1U0RA 2YV5A 1ZIOA 4CU5A 3R5FA 3R76A 3JW8A 5LZ7A 5LKAA 3VSEA 4ZOBA 2XMRA 4AROA 1CF4A 2QNRA 1EEHA 1L3IA 3P8ZA 5K3SA 4R2HA 3Q2OA 2Q6KA 2JEYA 3OU7A 1R64A 4EY6A 5A5VA 3AR8A 4EHLA 1YB5A 2CVQA 3EVCA 4BKUA 3DEYX 4P2GA 2Q5OA 3EFHA 1C9EA 4IW3B 1QFZA 3PU6A 4EY5A 4DR1M 2YZ2A 2ZXFA 4KQIA 1CJSA 2GTPA 1CZRA 1Y5RA 5JY1A 2WU8A 1IJBA 2WTBA 1QH8A 1CUGA 3H6HA 3C8HA 1G63A 3R3WA 3KO8A 2WIDA 4PVDA 1QK5A 4O3MA 3MIIA 4BNKA 4N4AA 1HOTA 1ZONA 4MP8A 2O8CB 3NH9A 4B7ZA 3JQ7B 4DLVA 3ANSA 4UM5A 4XFJA 3NJ8A 3L05A 4QM6A 2QR5A 2HSZA 4FFOA 3A14A 3JQPA 2Z2YA 3PF8A 4FR5A 1YRLA 5ITRA 2IRWA 4HEHA 2ATIA 4B8YA 4HXGA 3WIOA 1U3WA 1Z39A 3ASYA 4P7GA 1XDWA 2P68A 4XWTA 3HYCA 4BVBA 4RQUA 3RC1A 2VJDA 3EMKA 1ZP6A 1MOQA 4B71A 5BSEA 4NRDA 3MWEB 5BWOA 1JHPA 4PSKA 3HC7A 1E9SA 2DWLA 1SVWA 2YXLA 3HBLA 3T94A 4O4LF 2VFAA 3LDFA 4P3YA 2YJTD 1XMXA 2JFOA 1O96A 1S4QA 1R15A 4TRJA 5SYMA 3QZUA 4YRDA 2ZI3A 2QOEA 1PLJA 4BLVA 2OP1A 1P2SA 1UBKS 1QR2A 3K0AA 1CE8B 1KIFA 4DLYA 1YO6A 3T1HB 2AG6A 2QRGA 3T52A 2O59A 3NHSA 3A6PC 1EFRD 3KDAA 4AI6A 1V4BA 3EA4A 3PRHA 1GQQA 2BFCB 2O01F 4ZANA 2C7VA 1Z17A 3E7XA 4R71A 1GUAA 2PLRA 3FGPA 4EA9A 5T5QA 1PV1A 1PR6A 3K1ZA 1GIAA 1SIWA 3UQZA 2AMLA 2CJWB 1FP1D 4WOJA 4XDYA 4FWGA 1JU9A 1SM4A 3ZQJA 3IHLA 1JHAA 1Q57A 1WDKA 2NWQA 4WV3A 1T26A 2GCOA 2Z1MA 3DTVD 3WYNA 3AUYA 2AN5A 3EPPA 4GICA 1JLKA 3W2EA 4CEJB 1KO7A 4MZXA 3RHFA 2KLHA 4YY3B 3RV3A 2YJ4A 3BX1A 2DY1A 4AM8A 2WZJA 4AMGA 4Z0NA 3RRJA 4MRMA 4IWYA 3SJBA 1UF9A 1Z28A 1RWNA 4RSMA 5H80A 1P2FA 3IEMA 1Q0TA 4B31A 5LMNM 1CJVC 3I2KA 2V6JA 1OX6A 1X1EA 4H7PA 3BFKA 3WWPA 2HBRA 3I1IA 4QG3A 4LZAA 4P1ZA 3J7TA 1TI7A 3B38A 2V7VA 3OX2A 5AW4A 3ITEA 1Z0IA 3L49A 4GKBA 3F1LA 1JMVA 4OQFA 4LYYA 1YA6A 1YZLA 5FADA 1SKAA 3RU3A 5E7IA 1GZSA 5H3LA 4LVCA 3TTYA 5LBTA 1U11A 4HWGA 5EIWA 3OIWA 1EAMA 5DBFA 3O1LA 2OXIA 1FUEA 2Z8XA 2ZWAA 3K7EA 1I4WA 2V5VA 5LL6P 1T9GS 5JRJA 4MVJD 5JAQA 2Z58A 2H11A 4M83A 3HJRA 1RI4A 5B58T 3IQWA 2KSQA 3OZIA 1TQDA 3KQWA 3I2HA 3ZN2A 1JAXA 5F1KA 1XLUA 1CR1A 1P0MA 3TAHA 1Q3TA 1KI1A 2R0QC 1H42A 3R77A 4HYQA 4B2YA 3PP8A 1HR0B 3ABOB 1BXGA 3PT9A 2A94A 4ANRA 3OWOA 4ZOEA 2ZJYA 5EL0A 4EY4A 3UWMA 3U4QA 1QCYA 2NO5A 3DG9A 1WB5A 1Y5IA 1GGNA 4OXRA 4B7GA 3DZKA 2QK4A 4V0SA 3WADA 3ZWOA 1UJ4A 3Q6IA 2IH5A 1PG0A 2DY0A 3OZWA 1VZ2A 1XZEA 1AQJA 1DWOA 1WHSB 2DBZA 5MGBA 1FQWA 2Q9AA 3L04A 3T9FA 4JI8B 2CEAA 1CQIB 3E70C 4JL8A 4E2FA 5C8YF 4DV7B 2XA1A 1UBHS 3TNLA 5FWYB 3QFCA 4C7BA 2ZBUA 2A58A 2Z6VA 4Z0PA 2F4VM 1PJ2A 5EPEA 5JHGB 4IKPA 5DNVA 1X7HA 2NTEA 2IPLA 2ZJAA 1AV6A 4U7PB 4JA0A 4RTLA 4ZEVA 4YMGA 3SAUA 3QBVA 1DBQA 2XZDA 3LLCA 4FKZA 3D8HA 2GOYA 6REQA 4BVHA 2O7SA 3JS5A 4N3GA 4ZT6A 3I8SA 2XAAA 1CHNA 2XGGA 5ES3A 3E9QA 1NN3A 5C32A 1YR3A 1MO6A 2C7QA 1SCDA 4CMAA 4GKKB 3AFOA 3V5NA 2GXSA 1ODKA 5H4HA 4JP5A 1XCGB 4JK3A 2V0NA 4MOWA 3M4ZA 2CKDA 2C59A 2W2KA 1QHXA 2IELA 1ZMRA 4J1TA 1KYZA 5L3QB 4GF5A 1K3WA 2XXJA 1K08A 3TFQA 3BBZA 3AJDA 4B3JA 1BO6A 5DP2A 4QICA 2ZSFA 2YV4A 4HWOA 5HDBB 4MMYB 5JG7A 1EQAA 4J4TA 4MCHA 3B1ZA 1VEKA 2KW0A 2VDLB 2DULA 3L7LA 4MULA 4TXLA 1L5RA 3AERB 1TECE 5AK0A 1UADA 1Q83A 3A4LA 4G67A 1Y3CE 4J7XA 2QL5A 3F73A 1F4VA 2JG3A 1I7LA 1ISHA 2WWTA 1K63A 1SU6A 2I8AA 3BTSA 5IZ4A 2QUIA 1FRFS 3LQ1A 4EMUA 3TS1A 4YJ2F 5KAPA 3GQBB 3DMTC 2ZRBA 1IPEA 3QE2A 3GGCA 1W7AA 1NJSA 3H8WA 3PC4A 4NK5A 4RA9B 1BHSA 4C7VA 1F14A 4BN0A 1GPJA 3CVJA 4WMLA 1S2IA 3G5MA 2GN8A 2AOTB 1XPUA 4KLNA 1N2HA 3HU1A 1M3SA 1GUZA 4M6WA 2FB9A 2BVNA 5JSZB 2XFTA 1PBTA 3ELYA 4OFXA 3U49A 4KXVA 4ND7A 5KYWA 1RPZA 4RIEA 1VJGA 1AXEA 5B12A 3VR5D 4CNQA 4JUIA 4O0LA 2EJTA 5E4TA 1XB2B 3OE1A 1P29A 3HDQA 4Q82A 1P74A 5I7EA 3FPEA 3K2IA 3T1VA 3X1MA 3VPXA 2VQFM 1GVNB 3ZDQA 3GFSA 4HPXB 3OQOA 1W52X 5TGTA 1U6KA 4RE5A 4WKNA 4P6VF 2HEIA 4P32A 3QTTA 2BBTA 4E5MA 1MZVA 2G9UA 4F91B 1GUYA 2YIMA 1X8XA 3A0RB 3RC8A 4EY8A 3UJBA 2OHXA 2C4VA 1A82A 2H4JA 4CGYB 1A9ZA 5ICSA 2JRCA 3D7LA 1F1JA 4AJOA 4WRRA 4E12A 1U63A 2AYYA 4A2PA 1XC7A 1SVOA 2QZJA 4PRKA 3FCCA 4I4LA 5LP6A 1Z5NA 4POAA 2NO9A 1US8B 1P81A 5A4IS 1QF7A 3L8CA 2CXPA 4XK8F 3DH0A 5B2FA 1R2YA 3I4LA 1CZHA 1W9MA 2VPQA 4R16A 3ANNA 2UZ3A 2QAGA 1W1IA 2GNOA 4RNCA 3PNQA 3O0TA 3P45A 2UAGA 1E98A 5J4KA 2A0WA 1IMOA 4CEHA 4Q4JA 4ER6A 3PJDA 1YHNA 2BFBB 1NBHA 1YMQA 1QVWA 5CFRA 3VVBA 4GX5A 1UKEA 1BS9A 5AHOA 2NN3C 5H37D 3PCXA 3R20A 1ORRA 2SKEA 2A88A 2RGBA 1CYDA 3RS4A 3ZKWB 1HQCA 5KTYA 4PIMA 5CUQA 3GT7A 3VH1A 3TAUA 3H2JA 4TV9B 3KOZE 2AX3A 1OHHA 2RGDA 3DFIA 5DKFA 2YWRA 4HEA6 1TM4E 2XBLA 2VF2A 2RGNC 5EINA 5HZMA 1BVHA 2WZDA 3L6BA 3E82A 3TRHA 1TK3A 3G8DA 1DV0A 2JAWA 3PPVA 3MB8A 1L5VA 2BI4A 3ZD8A 1IB6A 2ZJ6A 1VKJA 3IP6A 3PC8A 1CEXA 2K5UA 2ZE6A 4KQJA 4OGLA 2GPTA 3BUSA 1E2HA 1UPUA 3RNLA 2VWQA 3F1KA 2BYTA 5D87A 4AW4A 1D2CA 1CDEA 4D42A 1XJWA 4OMFG 3RADC 3SK0A 1GG2A 1JEYA 2V7BA 1C0LA 3V6LA 2XOKD 3F5MA 5JAZA 1U0TA 2RBEA 2IPOA 3EXG1 4G89A 1WGLA 1E5XA 1ANKA 2H85A 4P17A 1GEGA 3VJKA 3C4QA 1FS6A 5BNTA 3H5VA 4AKGA 5LMCA 3B8EA 3W1WA 2W6IA 5LDHA 4NARA 4ZIRB 4DR7M 2QG9A 3K70D 1LX6A 4AJ2A 3QRWA 2H0RA 2OHFA 4CFYA 2QXYA 2VHWA 5AI4A 2ATCA 2E3JA 2QYTA 4D9JA 1K06A 2A5JA 3ZW7A 2GPNA 3TR0A 3BGWA 5A4JA 5IT9A 2F43A 4UEJA 4MV7A 2KW5A 2O57A 4JI1B 1REQB 2O20A 2QQ0A 4TSFD 3QH4A 3MD0A 4MV0A 2H5IA 1NQOA 1PLLA 3E03A 1GCGA 4C6TA 5HKLA 1KMHA 3EHEA 6AT1A 1D1TA 4RV5A 4D44A 2IZ1A 2IYNA 5AFSA 3D02A 4F38A 5G41A 1TFUA 3AV0A 5FTKA 2HX1A 3L7CA 4ESOA 1KEEA 5DISB 2PJZA 3IEVA 4LHZA 4B7XA 5JR3A 1LBQA 1IWBB 1RLMA 2Y0QA 2VH1A 2FG5A 2DENA 5CYGA 2X0KA 2ZREA 2RBGA 3WVNA 2PTHA 4L85A 4JITA 1KZHA 3NHFA 4J75A 3A3YA 5LBUA 2AXEA 1OWMA 1EVYA 2IGTA 1A9SA 4XGQA 3UVEA 3F46A 4F6LA 2NPIA 5KWJA 1M5RA 1UPTA 4NNOA 3QLJA 5I51A 2IU6A 4ZAYA 4OREX 3UBTA 5DU2A 3K8QA 2BR3A 3Q8KA 4E4YA 3OZGA 2YJ3A 2Y66A 3JAWA 4PGFA 3MCZA 2BH2A 1CT9A 4MGIE 2CF6A 5AT1A 1GY8A 4PYNA 3HACA 1IATA 4LDJA 4DR5M 3ORSA 3TRFA 4EGFA 3FRHA 3WRXC 4KQMA 1EP2B 4DG9A 4KTTE 2AS0A 1C7EA 4CT5A 3IMCA 3UMVA 1U0NA 5JTTA 4EG8A 3BRSA 5HS6A 4MRRA 1ZR4A 4I8DA 3RNOA 4XCQA 2VDQB 5IREB 3Q3EA 5DLYA 3Q9LA 3TQTA 2QRVA 2O07A 4OL9A 1Q12A 4JUCA 4JLBA 2R9VA 4FM9A 3FD9A 1DARA 3PHHA 4HGPA 4YRJA 3IE1A 3ZR4B 4EFDA 2I4NA 2FW7A 4MRSA 1P0FA 3B3AA 3SHWA 5KOHA 1ML4A 2QTTA 1C81A 1NUAA 4AZ3B 2P4EA 3F3YA 4UHKA 1SCBA 2RHJA 3C6QA 4M1YA 3SZ3A 4QXQA 3Q10A 1WHTA 1U2ZA 1SOVA 5FBRB 2W2TA 4I9GA 4UXJA 4TQGA 1J8QA 5K3OA 1PDWA 3F47A 1UZAA 1O08A 1MO5A 5L53A 3CSSA 3UJHA 4LC0A 2QGZA 5L3SB 1JR2A 2YJGA 2P2SA 1E3IA 3C7AA 2IXEA 4ALMA 2ORWA 3RFCA 3GJ0A 1J9ZA 2EGHA 2ZRKA 2RHCA 4OU4A 2FF5A 4MWBA 1NU6A 4DFDA 2XVXA 5TDHA 5BQFA 2YTZA 3NIBA 2O25A 4KG7A 1Y1RA 3NLLA 3A2MA 4DEVA 5IBCA 2GBFA 2YYAA 4KO3S 4HYEA 1U2GA 3ESAA 1TTQB 5HKKD 3C45A 4X44A 5F98A 1RLUA 2WFMA 4CL3A 2GQ0A 4HN4B 4HDCA 2ZWOA 1TCBA 3HHXA 4MEBA 1C9DB 3P0HA 2E4UA 5IP5A 2CDRA 3PLRA 3TWLA 1YI8A 2QR3A 4PQFA 3Q0EA 4GZLA 4POOA 5BMVF 5MHTA 4H60A 1M1UA 3ILYA 1RXWA 4UEQA 3T34A 3AF3A 1M1YE 3U1TA 1VEGA 3ZU3A 2RAFA 5BSVA 4KC0A 1N5IA 3T9CA 4KO8A 5KTRA 4G2TA 3ZZ0A 1ZM2A 1LGYA 2OBMA 1DEKA 1P9WA 1W29A 3UG6A 1JVSA 1EJBA 2RH5A 4XPZA 2NG1A 5ALSA 2AZTA 2GLUA 3P20A 2WFZA 1D8AA 3FR8A 1QH1B 4Y1FA 1T5DX 2EKLA 2X3YA 1VE3A 4R4JA 3ROKA 3F9RA 3W6OA 4UDYX 4W7IA 2YVLA 4WURA 3LKVA 4PE5B 4FB4A 4Y7CA 1FTGA 4CL2A 3LRXA 3DAOA 1MA3A 4IIHA 1NJ5A 3E9SA 3KVOA 2ZSIA 4QSMA 3PPWA 3RYHA 1OI7A 2I2BA 2PO7A 1A9QA 3PG5A 3IOYA 4DTIA 3AJ8A 1RMTA 2P9FA 3LA8A 2GVDC 1OLSA 3B1WA 3CG4A 1C1DB 5I4IA 3AO0B 5EGSA 5K0ZA 2F1KA 3FOCA 3D4PA 4CBVA 3LY7A 3NJ4A 4L27A 4MYHA 2B2CA 1XK6A 3NORA 3DCIA 1J07A 3ETHA 2IYPA 3CR7A 3V1MA 3JRNA 1ZNXA 3C1AA 1QUFA 3JCZA 1VFPA 4Q7EA 1PS9A 3HYSA 3F2IA 1XYVA 4RZIA 1SG6A 1J0CA 2JANA 2XZPA 2EX4A 1USWA 3C58A 1ACMA 2QROA 2P5TA 1ZHHA 3HV2A 5I5EA 1QHNA 4GL4A 3ZZMA 1GAJA 3TRDA 2D7DA 2Y1OA 4RV9A 1JWAB 3IFSA 4KMSA 3CTMA 1ZVKA 1AGXA 3LOQA 4IJMA 2ZM5A 2W6PA 4LJ4A 4HB3A 1NR1A 2WWHA 1KJNA 1CZLA 3KIPA 2FG7C 3IOMA 2VYNA 4IKEA 3QHQA 2ZJZA 5LU9A 4Q1EA 3M9LA 1MUUA 2EP8A 5F5XA 4BX0A 2CDNA 2PWBA 3VDQA 3NATA 3SC2B 4OD0A 3HL4A 3NM5A 2MROB 2O2SA 1N1DA 1N33B 2AVNA 1T1EA 1MJGM 3O8BA 1N2XA 3OTHA 1XXHA 1E6MA 4QFCA 3FHLA 4AT1A 3IV7A 2XCSB 4I2NA 4E1BA 3JQ8A 3PE6A 5I8PA 4D80A 1Z56C 4YMTA 1XA4A 1FFEA 3NU1A 2EF1A 4PX9A 5CA1F 3OZDA 1QGOA 4OQQA 1M5TA 4OP1A 4EW1A 5ALZA 1BOOA 2XRYA 2XUIA 5IF3A 5TMPA 2BEWA 3DKPA 4ZDKA 4IRMA 1JZTA 1PT7A 2NYVA 1JXQA 1HH4A 3QPVA 4OHOA 2AOWA 2ZS8A 2NZ8A 4QOHA 5FI5A 4PDIA 5ITZA 3AY7A 3SXUA 1HDRA 5CG2A 1HFKA 4D9IA 3IMFA 1AB6A 5AH0A 4GRIA 3FNGA 3GAMA 2ZRNA 3HVRA 1OMOA 3TMAA 5FLEX 2ZZNA 2B69A 3HRHA 5JBQA 5SYAA 2ETXA 2OFXA 1T3GA 2COKA 3CNHA 4LVOA 2V1UA 5EN4A 1DBRA 1ZOIA 1Y1LA 1R9GA 2X0FA 4IJFA 3NS7A 1BVRA 3OOWA 3DO8A 1NBOA 4AN0A 5KSPA 3O8CA 2DWNA 2DOKA 4LPKA 1EFDN 3KQNA 3HZZA 4FFVA 2WF8A 3HCWA 4A8JC 1RC8A 2RHMA 2OO5C 3ZHOA 5KTSA 1X7YB 4JJ4A 4BCDA 3L46A 1I24A 1CZUA 5C7YA 1L4KA 4UUAA 2IT1A 3RKRA 1H94A 4HNUA 3W9UA 3MQ2A 1MTOA 3FUTA 2B4YA 2CV0A 3V55A 4CF4A 1VG5A 4MKRA 4FCTA 3PHJA 4HR7A 3ZQ6A 3QMWA 1ZKDA 3K0FB 1G3MA 5EJEA 2IYLD 3RS8A 4Y9DA 3ESDA 3EISA 5F64A 2H2FA 5I7SA 1FXUA 1SXJB 3TINA 3JWIA 1PFUA 4GX2A 3CJTA 3SZOA 1E5QA 3VYVA 4BX9A 2QU7A 1M76A 1EDEA 2RFLA 3R5JA 1DCTA 4KV9A 3CZRA 4OU7A 8OHMA 3BT7A 4GBGA 4DDVA 3SEAA 2FR0A 2V8OA 1AQIA 2W2LA 2RI1A 1RQGA 4M53A 1HE3A 3FPLA 5J4LA 4HDNB 4JFRA 1SCQA 4JGIA 5BYJA 2GM5A 1K8YB 3UUGA 3QWAA 4QQRA 1T2NA 1KBOA 3LBAA 4MQ6A 2Q2EB 2AFVA 4D74A 2W2NA 2WJWA 3QEOA 4EB3A 4BMYA 4TYPA 1R6AA 5FPKA 2HR1A 4C0LA 1V6CA 5P21A 5FTJA 3NB0A 4DJAA 1NG1A 1U9JA 4N49A 1CG6A 3N8NA 1H6UA 3EAQA 3T4EA 1RWVA 4W7SA 1KDTA 1CY8A 4TT3D 3VPSA 4JLJA 1ISPA 2XE7A 3W2HA 4HGYA 5DBEX 1TT7A 4IFIA 2XBMA 3N5KA 4MIOA 1T5IA 4DNXA 2FV8A 1ZCZA 5C8DA 3AHJA 4X8OA 4P4LA 3K31A 1ZK2A 1QP8A 1ZUNB 3E9ZA 1A8SA 4LFCM 1EKXA 1CUUA 3OG9A 2D1QA 4OBBA 5KO2A 4LHYA 4CKBB 1ZD4A 4ZHQF 4PG7A 2FHPA 4LWZA 1FRVA 4PZUA 1C7QA 4EVSA 2ZU0C 4Z9XA 4DKXA 4Z6KA 2IYRA 1XL1A 4RJTA 2FRXA 1H69A 1CW2B 2XTNA 2V4UA 1G2IA 3TIXB 2JY5A 4BE9A 3DE3X 4ICIA 5G1PA 2FMUA 4B46A 4NEQA 3UV6A 1V5GA 4BMCA 2AR9A 3A7DA 4G5GA 5HF5A 4UOQA 2LW7A 2Q5EA 1FFSA 5IDVA 4HQ6A 4HN9A 2AZMA 4BVKA 2A7XA 1Y81A 1FYFA 3GPYA 2FG6C 2C29D 3SDZA 4C2AA 3FKSA 2J4DA 2AXPA 4QGHA 1JSZA 1YTLA 2H2IA 3JQFC 4BDTA 4EH1A 3H86A 4J2HA 4X3OA 3Q8LA 4UQPA 3ER6A 4JKYA 1CX9B 1W9HA 1NF8A 2VLBA 3H5LA 4MUYA 1G8PA 2G1UA 2XQJA 3QELA 4G0OA 1L1QA 1AMOA 4X84A 3BIXA 4LSWA 1EINA 1T1GA 2H7CA 2WB4A 3RYCA 1B7GO 1GAXA 3RANA 4EHNA 1T8UA 1RYYA 3R1IA 3LZDA 4BUZA 4K0KB 3S8EA 3NEPX 3WLHA 3KYCA 2ZPUA 1R5LA 1QG4A 1JA9A 2W6CX 3C8MA 1B26A 3SHQA 1ZH6A 1X9GA 1J1UA 4LSZA 3JQAB 1ZBDA 5I4BA 4DWJA 3EZYA 1JHQA 4MUXA 3P2KA 1CRWG 3FOWA 1NHWC 4H0NA 3WIVA 4U00A 4YBZA 1R6TA 4B6PA 3ZY2A 2ZR9A 4NH0A 5H83A 1XTZA 1CNFA 3VKFA 2FPLA 5KYXB 2AC4A 1BFUA 4A0SA 3WFZA 2JIPA 1FX0A 1QLJA 4QPDA 3THOA 1WDWB 3D1JA 3LBYA 8ATCA 4I08A 3JYOA 3ZE6A 4HQLA 3OAAA 5EIAA 3P9NA 4LA4A 2PUFA 3R5KA 1J4AA 4LW8A 1E2KA 1EDBA 1UBGA 2IOQA 3RBZA 1U8EA 1P4HA 2G5CA 3I1YA 1MB3A 1NQWA 3K0CA 4G1UC 4C9BA 1LZLA 2F9FA 3K9FC 1FNBA 5F3WB 1TU4A 5CA0F 3W5AA 2B94A 1JR3A 1K6IA 4D26A 5ENVA 2OV6A 2CZCA 2YJZA 4WZZA 4O4LB 4CKCB 3E46A 2VF8A 3TZ6A 5FPHA 4WZAB 4Y18A 5DMXA 2REQA 3W8DA 1OKKD 3HKEA 4BCBA 4QPNA 3HCOA 1U7XA 3F71A 4HATA 3JAKA 1F12A 4LNUB 3GN1A 1DINA 1J2JA 1YRQA 2YCBA 1AIPC 1ZH4A 1HDGO 4BGIA 4NOKA 3CZAA 4DIMA 2OV3A 3SIXA 2WSLA 2PUJA 5DSTA 1N32M 2G06A 3HEAA 3F5SA 2ZDHA 4TYYA 4JC0A 3CUTA 2JBWA 1R0LA 4EGCB 3UHOA 3HK2A 1NT2A 4X90A 2RGEA 2XYHA 1ECCA 4GS5A 1D7AA 4ZC8A 4HNAB 4BVFA 4GOLD 2P90A 1Y3DE 1W0JA 5EZYF 3NCHA 4U8GA 4OHKA 2GKGA 2BAGA 3CSUA 3OESA 4D7AA 4L15A 3B85A 5L7TA 2RGRA 2WU4A 1G21B 1Q39A 4HDQB 2PGOA 4NVRA 4RF2A 1TF0B 3L06A 2VJQA 4RS4A 5CM2Z 4C0XA 3KXIA 5KKAA 4M7RA 2PZMA 3QYAA 2R6GA 1LS6A 1KAQA 4BN5A 4IDAA 2PGAA 1WMBA 2O5EA 4MR7A 2VH2A 1KSGA 4WESB 3AEZA 5BN3B 4QLBA 2P69A 5BR8B 3E1GA 4WQMA 4IIXA 1QFMA 1U28A 1ZEMA 3AJEA 3D54D 1F4PA 2BM8A 2PCJA 4C6HA 1N9KA 4BNUA 4W1PA 1UC9A 2QMHA 2BGLA 1NT4A 2PUWA 5KYYA 2SNIE 2CXTA 1PL8A 1P2TA 3KU4A 1SQSA 1SUCA 2B37A 4EI8A 1GNTA 3B2EA 3W3AD 4IXTA 3O8NA 4MS3A 2GVNA 4EB6A 4US2R 3AJRA 1CU1A 3MINA 2QRQA 3PI7A 2H4HA 1GG5A 2GN1A 4KMRA 1UKAA 3KTAA 5AW3A 1X8JA 2BEJA 4W5NA 1G291 1YFLA 3GA0A 1WXEA 4RDHA 3EVTA 3W6ZA 4CMHA 4FYVA 3S7ZA 1SUDA 1OZFA 3OWXA 3GCGA 1Y1KE 2VA9A 1DTSA 3HLYA 5AI0A 3FOZA 4KCGA 4KXLA 2EJSA 1ZUIA 4YP7A 1ORIA 4LRQA 1VYTA 3ASUA 1WY7A 3LNCA 5GV8A 2J5YA 4CDRA 3B1VA 1U02A 2VH5R 1QMPA 1U65A 4YT5A 2DAEA 4L76A 1YOVB 2N1MA 1A7KA 2VXOA 3BJMA 4LNHA 4K6MA 1BU8A 3O94A 3GP1A 5JD4A 3W34A 2XCOA 1XMOB 1L7OA 4FEEA 3RT1A 3IC5A 2Z3XA 3H99A 4AP9A 1N8SA 4BIMA 9GPBA 1X7ZB 3REGA 4O2LA 3W8EA 3RSGA 1EJ0A 1KI8A 2CFCA 3HWWA 4Y2GA 3BXFA 2KRKA 2D13A 3NV7A 4IUDS 1LF5A 3SEQA 3BSFA 9ATCA 1Z82A 1TLLA 3L92A 2W71A 4D81A 1K89A 5TVGA 3B7QA 5ADVA 3C3BA 1O8CA 1NXWA 3DP7A 1BFDA 1EP3B 1T2DA 5C8YB 3A9SA 1E9FA 1FK8A 2H06A 3DHVA 4MS4B 3V1UA 2CY0A 3N1UA 3OE4A 3A11A 2O3QA 1ZBQA 2JRLA 5ALDA 4N3CA 4IIDA 2ZWIA 1U9IC 1E1QA 1AV7A 1SWVA 4MP6A 2ONCA 4AQ7A 1JAYA 3C85A 4TLMB 3BWVA 3EK2A 2R18A 1DAKA 1J0AA 7REQB 5EIEA 2H4XA 4LG2A 3SQXA 5LZ5A 3M82A 4S1WA 3SN6A 3AHFA 1SCKA 4CWAA 4HGZA 3HNPA 3WKDA 1YRBA 1J1IA 3E2IA 2XYPA 5AP9A 4AY6A 1PT6A 2UXCB 1ARZA 2FZWA 5U4XA 4W1SA 2JI8A 2C94A 4PZZA 1DQRA 1R6DA 3C3WA 1MJNA 3BS4A 4BYGA 4DJ5X 1KJYA 3WSTA 3G9UA 2EDAA 4UE6A 2IZ6A 4YAIA 1Z5GA 3OFJA 4UATA 5EMHA 3L8MA 4XD7A 4CLDA 3E4DA 5L6LB 4JOBA 4LZOA 3U5ZB 4RF5A 3L8DA 2REBA 1R0SA 3VNQA 1E0KA 1AURA 3GDWA 2HFKA 4UFPA 3LX8A 2DHQA 2VP0A 4LC1A 1JHYA 5BP7A 4JL6A 4D9FA 4R69A 3DBVO 3QPWA 3OJEA 4BJ3A 5JJLA 1MGPA 1N6NA 2ZPAA 4IX9A 4YJ2B 2XMBA 2HREA 1YZGA 2OM2A 3DT9A 4JR1A 2JUJA 3GJSA 1EUDA 1SCUB 1BCSA 4ND3A 5GJBA 1XRRA 4DT1B 3BTUA 2FW0A 3HKBB 2UZAA 4DCJA 5KINB 2GEKA 1BKSB 1OH8A 1YRHA 4FN5A 1VZ3A 1QV6A 2WQ7A 4ISCA 3EZ6A 4E51A</