3M0EA

Crystal structure of the atp-bound state of walker b mutant of ntrc1 atpase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDAIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator (NtrC family)
publication title Engagement of Arginine Finger to ATP Triggers Large Conformational Changes in NtrC1 AAA+ ATPase for Remodeling Bacterial RNA Polymerase.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 83
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3m0eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3m0eA01
4M8NE 4JSTA 1QHSA 2CCKA 2YWFA 3PUWA 5DH9A 2IYXA 1E1RA 4NONA 1OFUX 4DXAA 3SJBA 1MO3A 5CIQA 5DNYB 2GDJA 1FUUA 4B47A 4TYQA 1JI0A 2ZI5A 3PQCA 1II8B 1WDTA 3CO5A 4JLKA 3RRNA 3EPLA 1D2NA 2QE7D 2O52A 2WJYA 4Y0VA 1KI8A 2ATVA 4BUJA 1SVOA 3GLFB 1XTSA 3QPVA 3M0EA 4IVQA 1N3BA 1SXJC 1VECA 1W4BA 4Q9HA 2C2HA 1KKMA 2GK7A 4OBEA 1F48A 3FOZA 1EFHA 4URYR 3I62A 2IEZA 3AM1A 1P62B 4HAZA 1XZPA 4HDOB 4BZQA 1OYWA 3R9WA 4IDPA 1G7CA 3TE6A 5EE0A 1ZRHA 2ZJYA 3KZ1E 4JLMA 1Q1BA 2IXFA 4URVR 2FEOA 5BYKA 4BFUA 5LDDC 3NEJA 4UXIA 5BYJA 1AZSC 1MT0A 4A92A 1U94A 1ZJ6A 1ZIOA 3PR1A 4BFWA 1U0HC 1OFTA 3DKPA 4LC1A 4PPFA 1VYVA 1E79D 3I92A 3SU8A 5DN6D 2REOA 1HT1E 1RRPA 1TPZA 1U98A 3AGQA 3DMDA 1P2UA 4DHEA 1RRGA 1OE0A 3ZD6A 2NPIA 1CR0A 4B73A 2W2VA 3ADDA 1JB1A 4B6FA 3SI7A 3EARA 4PPQA 3W3AA 4B75A 3SBDA 2VSFA 1G8HA 4KFUA 4PHFA 2C77A 5AJXA 2BKEA 2F1HA 4FWHA 1G4AE 3SJAA 2ZSDA 2VO1A 2Q0HA 1W44A 1GILA 3ETLA 3LX8A 4IVPA 4MYTA 3BK7A 2HJGA 2OFWA 1TMKA 4NCHA 1LS6A 1H8HD 4N1AA 4RCYA 1C4OA 1XBTA 4S35A 4C0KA 1GIAA 1CEEA 4KYUA 4A2QA 2OBMA 4CEIA 3OZXA 4ZDKA 1ZUNB 3QXSA 4B33A 1NN0A 2RGXA 4ERNA 2YC4C 3DKVA 3IDQA 1ZIPA 4XVRA 3KXKA 1X1RA 4NYMR 3RNLA 4ACBA 3I73A 3ND8A 3ADCA 2NG1A 3AVOA 4POAA 5IRCD 2ZRMA 2PEYA 1X8KA 5DSZA 5TXGA 2OT3B 4YLGA 5KNBA 3KDSE 1TU3A 5DE3A 2CBZA 3K0FA 5K8UA 3I32A 4AK9A 2BCJQ 1XTJA 1E0JA 1GUAA 4ESVA 1JBKA 1OIXA 2BCGY 5JJIA 3BB3A 2WJHA 1E2EA 3NG1A 1MO5A 3TAUA 3MSXA 4IOLA 821PA 1PV4A 3W90A 4LPSA 2PLFA 4XD7A 3V9PA 3I61A 4TYNA 1KMHA 2FDCA 3AVXA 1QHIA 4CEJA 2DFKB 4V0LA 2CL0X 4RSGA 4CEHA 4F4JA 4ZO4A 4D4KA 3E2IA 3AVWA 1CJUC 2PL3A 4C2TA 1U0JA 2QBYA 1DARA 2E9SA 4J0QA 5HR5A 1P2TA 4BPBA 4WZAE 2P6NA 3B9QA 3BAFA 5CIWA 4DJTA 4XSGA 1TQ2A 1AQUA 4L9SA 3QKUA 3U7HB 4PHGA 1OXVA 2WAXA 4LWZA 1EWQA 1TUIA 4NE2A 3K0FB 1AS2A 4C0JA 1ZM3A 2ZR9A 2P6RA 3P32A 1E2DA 2PJZA 2V9PA 3GJ6A 1W36B 3D6TB 3X1XA 1E9DA 1NF3A 2WSSD 5K8TA 2A78A 2B92A 1VCNA 3Q7PA 1MABA 2ZI9A 3LQQA 1G3QA 4LHWA 1D9XA 4Q7JB 5LD2C 3MWKA 1IBRA 2FH5B 3Q85A 4QFMA 2GVZC 4MKHA 2CHVA 4KJZA 2OAQ1 4A8JA 3ZD7A 2PEZA 1G7RA 1A7JA 4CEJB 1G41A 2CK3A 2PZFA 3Q72A 4DKXA 4CEHB 2R6GA 3I3SR 3T1OA 2BMEA 2GZHA 3OEEA 1I4DD 2ORIA 5CM9C 3R7WA 2QBYB 3NDPA 3SEAA 2JJ1A 2FGJA 2XZPA 1EXMA 4C4PA 3OIWA 3THOA 3LVQE 1N6LA 3KFXA 3N2EA 1HEIA 3H1TA 3SJCA 2KWIA 4I1VA 5DYGA 5DIFA 4GDFA 1YR9A 4EFNA 4L9WA 3FKSA 4Z54A 3OE7D 3ND9A 2D2FA 2D74A 1S2MA 1MABB 4URUR 8OHMA 2AL7A 5FBWB 4DEYA 5J4HA 1U8AA 4A8JB 2VP6A 4HAXA 2ZSEA 2PH1A 3B7GA 1FPMA 1P72A 5H68A 2IX3A 1VYUA 1T8TA 4FW9A 2J0QA 2NTYC 3TVTA 3AUXA 4PPGA 4M1YA 3CX7A 5AUQA 3RHFA 1S1MA 2HCBA 4M2LA 1JQJC 2BMJA 3CPEA 5H70A 3GEEA 3BRWD 2ZRGA 3I4LA 4AY2A 2PZGA 2PT5A 4AKGA 3QVUA 4WVFA 2EFGA 2FE4A 1WMSA 1KK0A 2Y8EA 4XWOA 1ESNA 2AD5A 3VNVA 2KBFA 2ZE6A 1YR7A 2PBRA 4BWYA 1R0YA 4QNRA 1KAOA 3KX2A 4GZMA 3EC2A 2X77A 1IJEA 1W4CA 2ZRDA 3GLGE 3RS5A 1OH7A 1NIJA 4F38A 4DSTA 1E2JA 1AKYA 1U99A 1XX6A 3AKEA 2IK8A 4QHSA 1GL7A 4GBMA 1NIPA 3ZZTA 1LF0A 2VP9A 1Z5ZA 3TLXA 1U9IC 4QJ4A 2XB2A 3CZQA 5HTKA 2QSYA 2IL1A 4EPYA 2EYQA 2OXRA 4YMSA 1IY1A 1R2QA 4WZ6A 1KJZA 1RIFA 5JS7A 4LJ6A 1UKEA 1JAIA 3DVLA 1DELA 2OG2A 5TY0A 4NDZA 4RKEA 2IWHA 1WBDA 1RZ3A 3IIKA 2CEAA 4NL4H 2DHRA 5G40A 2VEDA 2LKDA 5DISB 1E3MA 2J0UA 2YC2C 4OQNA 4TT3A 2PX3A 2NO0A 5FPYA 2WKRA 1JEDA 1RVDA 4TLCA 1ZP6A 3BB4A 1CR4A 1Q44A 4HB2A 2IS2A 2GXSA 2WWGA 2W0SA 5A0FA 1OHHD 1GNRA 2RHMA 3VKWA 4E22A 3K1JA 2QQ0A 3AF2A 3RRMA 3REFA 3S1AA 2R62A 3HU1A 2CL7X 2RH5A 2JCSA 1WQ1R 2OXCA 4ACAA 3NVAA 3CF2A 2FJUA 4RD6A 3TIFA 3QKTA 4TTPA 3ZIAA 1E0SA 5KDDA 1NN1A 1KOFA 2VH5R 2WPDA 2SHKA 2KSQA 2QN6A 2ZSBA 3VMFA 1R8SA 1U8ZA 2HCJB 4Q03A 2YHSA 1KI3A 5JJKA 4FMDB 1JECA 3E5HA 2P0EA 2J0UB 4Q5IA 1AA9A 2NO6A 1X3SA 5AWFC 4RZXA 3VR4A 3N70A 3LLMA 3EPJA 2QGZA 1W2GA 2BEJA 5JCPA 2N1BA 4R2IA 3TKLA 5JHHB 1DPFA 3M6AA 1FNNA 4DLTA 1VKJA 4OI2A 2OCYC 2JA1A 3S1AB 2D4HA 1YZGA 1G1MA 3GLHE 1ZUIA 2QAGB 3EZ9A 4M9SA 3FHCB 1OLOA 3AVPA 3LXXA 2BMFA 3JZMA 1N6HA 5C1BA 1FX0A 2FSGA 4R9UC 4RD2A 1JQLB 3ZDQA 1N2CE 2QTHA 4UXHA 4EKDA 2P5TB 2JATA 2V7QD 2OHFA 5KNCA 2NO9A 3PEUA 2IXEA 2ZROA 4JMPA 2QSZA 3QBVA 4IFEA 1IY0A 2JLZA 5EQTA 1KJYA 5AK0A 3SNHA 2NOAA 1YZLA 2IYUA 4UKDA 2WV9A 2G0NA 5J4YA 1SVSA 4M1SA 4BLOA 3W8NA 4TMVA 1SVMA 1FOEB 1OKKD 1P4SA 4ZIRA 2FMXA 5C18A 4MGYR 5IDVA 3DM5A 4N3NA 3D3QA 2ZREA 3QF7A 4RD3A 3WBJA 1OXTA 2JLWA 3GJ3A 4NCIA 1ZD1A 5HCIA 3SC3A 3UXMA 2XZOA 1N25A 1R0WA 2F3TA 3TBKA 1WF3A 4JJKA 5FTLA 4XSHA 5FR2A 4EPXA 4OI0A 3FHTA 4HB4A 4QRHA 4B32A 4AG6A 3NBFA 4M1TA 4BEJA 4M21A 2GRJA 1UKVY 2ZRAA 2C9YA 2XSZA 1XTRA 4RY2A 4KVAA 1CJTC 221PA 2CLDX 3TW8B 3EIHA 4DLRA 4XIGS 1BYIA 2OCAA 4NYIQ 2KB0A 1JEEA 3QG5A 1GG2A 2QA5A 3UG7A 2FV8A 1KIMA 1A1VA 2ZS8A 2JASA 2ZR7A 4B44A 1QHGA 2PX0A 1PLLA 4WIAA 4ZIRB 2CJWA 1PVOA 3MHVC 3IHWA 3N5CA 2ZI7A 3NBXX 5KHOC 3CNOA 2AN9A 1DAEA 1DBSA 1FL9A 4DDVA 2ASEA 1IXSB 4GOXA 2H5EA 4BLTA 4D0NA 4ASUA 1DE0A 2XTZA 1KHTA 1HV8A 1QHYA 2I1QA 3WNCA 1L4UA 4QGFA 4YMUA 2CVFA 3U3MA 1E98A 5EE1A 4HLUA 4I1UA 5GVSA 1G16A 1E6CA 1HT2E 1YZTA 1XU4A 1N0UA 2A2ZA 3SZRA 5EZ6B 2VP4A 4HUQB 1NLZA 1OV4A 1EFTA 2OSBA 4RFSA 1NNEA 5JI3E 2OLJA 2ZI3A 3VR3A 4PFSA 3B8HA 3TR5A 3SS8A 2G6BA 2JIZD 4TL8A 1TAGA 1GOTA 2VHJA 2Z43A 1T3LA 1ZM4A 1E9AA 3QBTA 3SJZA 2IT1A 2CNWA 2YWEA 5CK5A 2HT1A 3CR7A 1W46A 2FPLA 3GJXC 1JR6A 4BFYA 3U5ZB 3RS7A 4B71A 1NVMA 2EW1A 2GHIA 1BS1A 2OILA 3PUVA 5FFMA 5B2ZA 5FTKA 3AKDA 1IY2A 3K0SA 2ZSFA 5H8WA 4Q4LA 1N5IA 1Q20A 2JLSA 2R6FA 1TF7A 4I1SA 2HYIC 1E1QD 2B21A 3M4YA 1SXJA 4LJYA 1CJKC 2FSFA 1U0LA 2X8AA 3JVVA 4LV8B 1YR6A 2BHRA 3K70B 4A0HA 2QPAA 5CLLA 2QY9A 1DO0A 4JLBA 4KXFB 3ZS9A 1DAIA 1RFLA 3PITA 1COWA 3A1TA 1L7VC 1SVIA 2WKPA 2Z0MA 3FWYA 3L0IB 4RFSB 5JZVA 4P4UA 2ZQ5A 2GJSA 2WWWA 1Y63A 2AK3A 2FG5A 1MV5A 3KTAA 1XJCA 2ZXUA 1VG9B 3PXGA 1I4LD 3SHWA 2HLDA 3AF3A 4R98A 4I4LA 1CULC 1X8JA 1CU1A 3AF0A 1W49A 1GP2A 1NP6A 1X86B 2ZU6A 1J2JA 1M8PA 2DFNA 5SZKB 1XTQA 3C4JA 2ODWA 3L8YA 4OHWA 3LBNA 4TLBA 1KI1A 4FMCB 2PZEA 1J8YF 4YXWD 2BBTA 4LYFA 2W6ID 4A2WA 5H1YA 4DLXA 4TSFD 1SXJB 1JPNA 1P6XA 3R9XA 4GOJA 4LJ8A 5L8VA 4QJ3A 1ZMXA 1F3OA 3DPUA 1OSNA 2ERXA 5G3ZA 1UKYA 3TQCA 3VR5A 2G77B 3OESA 3C41J 2GNOA 3ZQ6A 5J4VA 5G3YA 4CGZA 3KXLA 4WA7A 5AJVB 3TK1A 4B43A 4MDEA 1HA3A 2AFHE 3KTAB 3AGPA 4EFMA 3GFTA 1NN3A 4PQFA 1TEXA 4PX9A 4V0KA 4X8MA 2FPKA 5ANRB 2EVWX 1GWNA 4V0ME 3TR0A 2UZ3A 2H57A 4Q1EA 2AKYA 3OFNA 4NZYA 4B34A 4Q9KA 4PC1A 3KJIA 4B2LA 3RC8A 1YVDA 3ZVMA 5D3QA 2AR7A 3OAAA 1NJGA 1Z08A 4NYJQ 3O8DA 4PC3A 4Q7LA 3C15C 2H18A 2AWNA 3KJEA 5DO9A 4HAUA 4M4SA 1E9CA 1DS6A 3ASZA 2EYUA 2FEMA 3REGA 3LDAA 5HKKA 1NY5A 1G6HA 1I2MA 1PZNA 1R5BA 3GJ4A 3X1YA 2ZRCA 4BZPA 4PXAA 1N0VC 1I4TD 4FN5A 2WOOA 1KI9A 1L2TA 1R6BX 2ZU0C 4ZCIA 1TX4B 1E99A 1FP6A 1YZUA 2BBOA 2NQ2C 2JLQA 1XPUA 3H0KA 2WOJA 1IXRC 1EFRA 4CDGA 4QG7A 4JYCA 2I4IA 4KYIB 2B8WA 4IVRA 4TMKA 5GJCA 2CE7A 2VP5A 1XEWX 1UBEA 3QXXA 2ANBA 5JHGB 2FPMA 4A2PA 1UEJA 3EAQA 5EE9A 3IUYA 3SFVA 3CZPA 2XNDA 5DHAA 2WWYA 3SFZA 5BN3A 1CR2A 3RWMB 3WYGA 5F9FA 2Z83A 4EPVA 4KBGA 2R8RA 3PIRA 1VCMA 3BD9A 2GVDC 1T5IA 1LFDB 4LHZA 1XD2A 3AB3A 2ZTSA 1G3UA 1DAKA 3I5YA 3VFDA 3AKCA 1W0JA 3CWZA 4KU4A 1FFHA 4Z1MD 2ZRIA 3AVVA 3HYTA 1VHTA 4DSNA 2PMKA 4EAQA 1JNYA 4BFSA 4NU0A 4RD0A 1F6BA 2QNRA 1Z22A 2BMDA 3FB4A 4LSGA 5L3QA 2D3WA 2C99A 2V6JA 3U3JA 1S8FA 2R44A 3EW9A 4CYMA 2O0HA 3UATA 5LPNA 5B57C 1T91A 5KDOA 1TNDA 3U4QA 3F0TA 4OHXA 5JEDA 1NVWQ 4XVUA 1Q21A 2BIFA 5IF9A 5KTYA 2ZIAA 4DWJA 3W5IA 1ANKA 1E69A 3EXAA 2ONJA 1CTQA 2J3EA 2AHOA 2V6IA 3JZAA 3T12A 3KL4A 4TLAA 1AIPA 1XD2B 2QQEA 4GNKA 4M1OA 4UNPA 1GDDA 1SQ5A 1XCPA 3KFVA 3RRYA 5LD2B 5AUOB 2XX3A 4MRPA 4QXAA 3HPRA 3CKLA 4AURA 2FWRA 4HYYA 4BZXA 1G5PA 4RJLA 4BFZA 4EPRA 1H8EA 3A6PC 5L3QB 2QENA 3D31A 3OEHD 2FZ4A 2QORA 3EZ7A 1P9NA 3U4QB 3DO6A 2Q3FA 4B3GA 2G88A 4YC7A 5TARA 4BEBA 4O3MA 5FPHA 2ZRPA 4TYPA 3U3KA 2J7PA 3FMOB 4Q18A 3KQUA 1EESA 3DL0A 3KB1A 1EFCA 5HE9A 4BRWA 1P61B 4EQ6B 4LJ7A 3EC1A 1QHXA 3KW6A 4AI6A 1MRNA 1GSIA 3PG5A 4KI0A 2GBLA 3G5UA 1N6PA 4IDOA 3X2SA 3A36A 3EPHA 4QM6A 1I2DA 2BM0A 2FFHA 3LWNA 3LH5A 1W1WA 2EQBA 4DIDA 5CM8B 2F1RA 2GJKA 2HDNB 1CRPA 4HSEA 2W6JA 2OM2A 1NBME 4ZDJA 3GMTA 4JBYA 2G1KA 3L0PA 4NHOA 3FE2A 2LCFA 2HYDA 4MGKR 1EWRA 1U9IA 2IYTA 3BH0A 1G7TA 3W5JA 2HXYA 1E2QA 3AVQA 1M6NA 1SKQA 2W0MA 1XNJA 4KITB 3BWDD 3DDCA 4HB3A 2QM7A 1P2SA 1T0HB 2VHUA 1Z6AA 4LV5B 1OIWA 1CRQA 2QG6A 4LRWA 4ZI2A 3GFOA 1W5TA 2QM8A 2ORWA 3PCRB 4I99A 4KFTA 1Z6XA 2XTNA 2ZYUX 2HUPA 3HJNA 1Q1EA 2J45A 2NGRA 4R2HA 1QRAA 3FMPB 4MYUA 4LHYA 5B30A 1E2LA 1S0UA 2RGAA 2YV5A 1KDPA 2ZJAA 1ONBA 2RGDA 5DHFA 2RHDA 3TSWA 3EIEA 3A4MA 1Z06A 4PO8A 2RCNA 5M04A 1G6OA 5D3MA 3ZH9B 2QUZA 4LBWA 3Q5DA 3IBYA 1BIFA 1XDBA 4QOSA 1CKEA 2KBEA 1RW4A 1IHUA 4OQMA 3T1VA 3NKVA 2XTMA 3WMFA 1Q3HA 4LCBA 4DT1A 5FBVB 5KO2A 4FINA 1NBMA 5JCZA 1G3RA 4V03A 3AEZA 4C0AC 3VQTA 5E95A 1KY3A 3ZVLA 4TL6A 2A5JA 3EASA 3IGFA 1P9RA 2B6HA 4B48A 3VX3A 1L4YA 4GOKA 4OK6A 3B78A 3EPKA 5EUQB 3NTUA 2MSEB 1D2EA 3KXIA 5JSZA 5KPJA 4CEIB 3IILA 1A82A 1W0KD 2VBCA 3SN6A 1LY1A 2UVQA 4MRSA 2F1JA 2WVJA 4MUAA 3ZQJA 5FH9A 4B2PA 3NIBA 1C9KA 4B3FX 3C5HA 1YHNA 1UF9A 2Q3HA 2WJIA 4NCJA 1CXZA 3K9NA 1NJFA 1VDZA 5IK2A 2A5FA 2Z6VA 1NVXQ 3FDIA 3TUJC 4DT1B 1KK2A 3EWAA 2WWXA 4HDCA 4Z8XA 2V8OA 5CJPA 4DSOA 1KI2A 2ZRLA 3IEUA 1S96A 5AJWA 5BWMA 4WZBE 2X2FA 3CRQA 3T06B 3UMRA 3ADKA 1KDRA 3AJIB 4KV9A 1BMFA 4TL9A 4V02A 4I81A 4BRUA 2IF2A 4CVNA 4IDQA 2H16A 4QHTA 1KNQA 3EA5A 2CHGA 4DUGA 1KMHB 4DRZA 4OK5A 3R20A 4YONB 5G53C 4FCWA 1CLUA 5JSZB 1RYHA 4C2UA 4JN6A 4TTRA 4YDSA 3MWYW 3W34A 3MRSA 3X1WA 4LRTA 3T35A 2K5UA 4NYMQ 2CL6X 2QU8A 4EIWA 1ZINA 2RGGA 2PCJA 1XRJA 2D7DA 4V0NA 2VSXA 1SULA 1N5LA 2D2EA 3WMEA 1NMYA 4KBFA 1KI6A 3T34A 2YWHA 2FF7A 2JJ2A 2JLVA 2WBLC 5F3WB 2DBYA 3GJ7A 1UDWA 1JJVA 3BE4A 1E32A 2Q9BA 3LFUA 2JDID 3LW8A 2XB4A 2V4ZA 1JAHA 2A7QA 2VYFA 3HU2A 2IS6A 2VLIA 2GETA 2X1VA 2V1UA 2GWHA 5AJZA 4A4DA 1IJFA 4A36A 4E03A 1JR3E 5FL7A 3RYTC 1EX7A 4A9AA 3CRRA 1KYIA 3R7WB 1DAHA 1FP7A 2C8VA 5BW8A 3B6EA 1XWIA 2VHQA 2H17A 1UBCA 4MRVA 2C95A 2QZ4A 3TVDA 1NMZA 3L0SA 2GAAA 3KKPA 4D6PA 1R5NA 3CR8A 1E2KA 1KI6B 4ZDWA 2W00A 1II0A 2VRWA 4AKHA 1UFQA 1P2VA 2Q9CA 2WMNB 4OK3A 2IYQA 1II9A 2AWOA 2QMHA 4XH9B 1RKBA 1YRAA 2YVUA 3UKDA 5BXQC 5HPYB 1AN0A 1G291 1BKDR 1CP2A 1XB2A 5E3HA 4JLNA 3AUYA 3NBYC 3BGWA 3DZDA 1YKSA 2FSHA 3DMNA 4JLVA 4DCTA 1KSGA 2P67A 1Y3AA 4US0R 3B13B 1PJRA 1Q0UA 5IT5A 1Z0FA 3U7GA 2AK2A 3CRW1 5C4GB 3E70C 2OLKA 4XJXA 3T5GA 5KSPA 2YZ2A 1W4AA 4ZDIA 3FFBA 4RKFA 1T5LA 1CIPA 2ZUDA 4P31A 1KTVA 3FYHA 3A1UA 1AK2A 2C9CA 3FHOA 3QI2A 4IDHA 2HV8A 1M2OB 1JR3A 3Q9LA 4FMDF 4PAQA 5KUTA 4P3YA 2AXNA 1R5OA 5EE3A 1QDEA 5DYIA 3SYKA 2JLUA 2OEPA 3K9LA 3K0CC 3ECCA 3VU9A 1GRNA 4LJ9A 2IS1A 2RB4A 3QENA 1IOZA 1Z07A 1E2NA 3QEJA 5FOTA 2IHYA 4A6XA 1JPJA 1E2IA 2GESA 2RGNC 4OQXA 4ARZA 3TH5A 3G0HA 1IM2A 2ZRFA 1HURA 1ZD8A 3WYFA 4FMBB 3RANA 4B3DA 1GL9B 4PZYA 1GKUB 3FVQA 1S4QA 2X2EA 4A15A 4Q7KA 1ZC4A 4M53A 1E1RD 1Z47A 5SZHB 4PZLA 1OH6A 2WIAA 4RFVA 4FWTA 4M0LA 4QBGB 4CW7A 2W2TA 4GITA 5JRZA 2F6RA 1B0UA 5L3SA 4YDHB 1E94E 1TF5A 3J81k 3M1IA 3ASYA 3UMFA 3A8TA 2NZ8A 2GCPA 2XOKA 3RDPA 3K09C 2GKSA 2WJJA 1DG3A 5DLQC 1XEXA 4L4UA 5EXPA 1UPTA 1VPLA 3AF4A 4H1VA 4Q19A 1YQTA 4KSBA 2ODEA 4BLPA 1XEFA 1O3YA 3MJRA 2ZRHA 4AKIA 4L8GA 1BYUA 2VPPA 4GZLA 2E1RA 2IA5A 4KSCA 4ARZB 2OUKA 3EWSA 5AJYA 4OJKA 5FUYA 1LB1B 1YE8A 1KSFX 3PUZA 3WRYC 1UBFA 4M9QA 1DO2A 3OIYA 4KO8A 3WMGA 1SKYE 3VNUA 5FOWA 2C03A 2A5GA 2AX4A 2RAPA 3L2OB 5L3SB 2IW3A 1W4RA 4IRUB 1UADA 5FBRB 2MSCB 3CBQA 4JS0A 4JVMA 2KJQA 4IDNA 4LY6A 2IHBA 3IPXA 4ZCLA 3IBGA 2HT6A 3K0AA 5JS8A 2VF7A 4A3VB 3LVRE 4UNQA 1KKLA 2NPFA 1FUKA 1Z0DA 1NL3A 1QG2A 3MLEA 3HPQA 2WIBA 4G01B 3U60B 3B2EA 3GD7A 2NZJA 1JXOA 1QHNA 2C5LA 1HE1C 3CX8A 3CH4B 3U7EB 4XWKA 2QP9X 4QC2A 1K5GA 4WW0A 2GXUA 1GKIA 3QE0A 5FOXA 3QUSA 1AKEA 4Q9IA 2QE7A 4XWAA 4FWIB 1FX0B 1XMVA 1U90A 5FL3A 2VL7A 3ZS8A 1J8MF 3LA6A 4JBXA 2EWVA 5FPSA 1S3GA 4O2LA 5J40A 3H2YA 2HEIA 3SHFA 5FR1A 4Q00A 2O8FA 2OAP1 2DPXA 2W2XA 3Q5EA 1ZD9A 1KO5A 2Q6TA 1S9HA 5JFGA 2QPTA 3WY9A 4HLDA 1C1KA 4B74A 2IEYA 2I3BA 3QVVA 3K0AB 4L15A 2DY1A 2Q21A 1SXJE 1JALA 3SQWA 2IYLD 5ELXA 2CCJA 4NP6A 4Q21A 4MGZR 1NRJB 4QKQA 5G41A 1W36D 4PAOA 1JJ7A 2QAJA 3BBPA 4ZCMA 3A1VA 4DSUA 3W3ZB 1NMXA 1KO1A 2BDTA 3WBKA 4GP7A 5FOUA 2J46A 1S9DA 2J59A 1PUJA 4OL0A 4PAMA 4EPTA 3AVYA 4XD7D 5E7IA 1E79A 3RRZA 3TAHA 5DN6A 3AF1A 3K0EA 5BQ5A 3G82C 1OJLA 2VF8A 4JSYA 4PPNA 4EFLA 2NO7A 5GJVC 5BN4A 3L0OA 1Z6GA 2O8FB 521PA 1TTTA 5DI9A 3AP2A 2XEXA 3HP1A 2RGEA 3R8CA 2VHCA 3A4NA 2OZEA 1TEVA 2KE5A 4TLDA 3W8RA 1P75A 3NDBB 1CJMA 3TQFA 5HZHA 4LGMA 4BLQA 2AFIE 4LHVA 4W9MC 121PA 2HXSA 1N6IA 2CJWB 5L3VA 3RSOA 2ZRBA 3O8RA 1SKYB 3AQ4A 4C3ZA 4LJ4A 4QGHA 3THWA 4JYBA 4MDFA 3PJRA 4TZ6A 3BOSA 3P20A 1XXHE 2F9LA 1ZNYA 4GPTA 3EG5A 4UJ5A 1HQCA 1E0KA 4A0GA 2CXXA 1H8HA 3AVUA 2ZJ5A 4M1WA 2FA9A 1MKYA 2WJGA 4FMCF 1VHLA 1DAMA 3CUEF 3KQLA 1A2BA 2F3RA 3RS0A 1XEWY 2CK3D 4L5BA 4N0DA 2FFBA 3OEED 3P26A 4F4IA 4PHTA 2GILA 3NH9A 3CRMA 3H4MA 1Z8FA 2OFOA 3TUIC 2JJ1D 4EJSC 2XJ9A 1UBGA 5DGXA 1EGAA 2BJVA 3K9HA 3D7MA 1F2UA 4Q1AA 1GAJA 1UM8A 1Z2AA 2EWWA 4BECA 4OHYA 2GF0A 3CX6A 4URWR 4FWDA 3V4RA 1NVVQ 2WM9B 2GF9A 5JWOA 4NYJR 4OQFA 5J47A 3BB1A 3O8CA 4DC9A 3A1WA 2IYYA 2ZJZA 3LO5A 3FKSD 1MO6A 5DI3A 4GP6A 4E09A 2QMOA 3ZGXA 5C46F 2BBSA 1NN5A 4FI3C 1AS0A 3KQNA 3DHWC 1E9EA 4G3XA 3CNLA 2QT0A 2ZM5A 3K8YA 1YZNA 3IIMA 1XXHA 1UDXA 1Z0AA 4WAUA 3T1QA 1YR8A 2FGKA 4GMXA 4G5RA 4IOKA 4MITA 4MKGA 4URZR 2QAGC 3EIQA 2WWIA 1F2UB 2H8KA 1TL7C 4D80A 3BC1A 2WSSA 4HLCA 4FCVA 3QIAA 4LPKA 4M1KA 3QXHA 1GNQA 3HYRA 2GEDA 2BVNA 3NC0C 5FBQB 1XD8A 4TMWA 4AD8A 1XPRA 2OBNA 1AGPA 5DI3B 1G20E 3ADBA 2Q3MA 2ZJ8A 1KO7A 4W5JA 4HAVA 2NMVA 3MCAA 2QMUA 1OB5A 4HDQB 1T3SA 4LUCA 3WNBA 2IYWA 4Q4JA 1W2HA 3VTKA 2WSMA 2L0XA 1XPOA 1DTSA 1Z28A 2QI9C 4JVNA 1XF9A 2J87A 4IEEA 4K8OA 3U6KA 1N5KA 1XXHB 1E9FA 1NKTA 1M1YE 1W5SA 4MKFA 3V00A 3QXJA 4E07A 3HU3A 1FNMA 3D8BA 4JKYA 4GRAA 5BN5A 5CDFE 1DAFA 1AJEA 1ZM2A 2YOFA 2FNAA 2Z4RA 4KFSA 4D4MA 3WXMA 3OE7A 2LKCA 2GXAA 1Q1ZA 4W5WA 1YRBA 2R9VA 5FI0B 4B35A 2ODBA 3LD9A 4TT3D 2REXB 4Q4HA 1XTKA 4UNNA 3AP3A 3PEWA 4OYHA 4IXNA 2B7BA 5HZKA 3WNDA 3KJGA 1YZQA 2FX3A 2R2AA 3P4XA 4K81B 4AIIA 1Z83A 4X8HA 2GJ9A 2FSIA 2ZS9A 5F9HA 1AM4D 1RYFA 1QF9A 2YOGA 2P6UA 4HI0E 4HLQB 4Q4JB 3R9IA 2CCGA 4TYWA 2DWZB 4JJZA 3ZZUA 3MJHA 4FD2A 3FMFA 3MAAC 2HF9A 4KVGA 5TDHA 5GADl 4U00A 3SQXA 2UZIR 3WYAA 3NHBA 3THYA 3ZIAD 5LBIA 4C0SA 4OJQA 2QP4A 5E7JA 2WPDD 3ZLJA 1D8TA 3IO5A 2PJRA 1V5WA 4PZZA 4JT4A 3CPHA 2BEKA 4HATA 4OKSA 1G3MA 4DB4A 1OFIA 5FTNA 5KYKA 1WA5A 2CLCX 5EP1A 1KJWA 2IYVA 4AWXA 1BOFA 3THXA 2QROA 3CNNA 2QEQA 3P27A 4MGIR 4NTZA 4US2R 5J4LA 2WTUA 5KNDA 5AUPB 1XFAA 4Q4HB 4QNMA 3T1TA 4FIDA 5KU1A 2DVWB 2F1IA 4PSVA 2J0SA 1HTWA 2ONKA 2VIIA 1NLYA 3X1ZA 1ZUHA 4P33A 3FGNA 5CDFA 1KO4A 1E4VA 4UJ3A 3BERA 1MR3F 5JEEA 4A1FA 2WWHA 4D0GA 1TQ4A 3VR6A 4XVQA 2NO1A 4DIEA 2QRZA 3KQKA 4LX0A 4BE7B 1AS3A 1R0XA 1Q12A 4LYHA 3W6NA 4Z51A 4Q48A 3PEYA 4TTQA 3C16C 4D2IA 3GP8A 1KI7A 4ON9A 1W7AA 1ZNWA 2ZE7A 4RCZA 4OQLA 3OIUA 2XZLA 2ZUBA 5A4JA 3GLFA 1FQJA 4GI7A 1MO4A 2QTFA 4TL7A 4PTLA 3CF6R 1E0AA 3VLFB 1HUQA 2QP3A 2YINC 4G5OA 4IOJA 3KKMA 1U2RA 3THXB 3RS4A 1NSTA 4TMXA 1QVAA 3MG9A 2VP2A 1RRCA 1AZTA 1OHHA 1KY2A 3R8FA 1RJ9A 5KSOA 2ZI6A 4AG5A 3C14C 1FMLA 4IKEA 5GVRA 2ZE8A 1BO6A 2V3CC 4DB2A 4JLPA 1ZNZA 1C1YA 1VIAA 2H1LA 4B6EA 2RGBA 3B1XA 2MSDB 2GK6A 2V54A 3DZ8A 4XTRA 2G1JA 4DEXA 1AGRA 4TMTA 5FPTA 1LVGA 2DFTA 4FXPA 1D9ZA 5B64A 4FWGA 5FUXA 5FTMA 2H7VA 2QRNA 3WP1B 1CS4C 2BKUA 2F43A 3VKGA 2FFQA 5AUNB 4P32A 4YQFA 2OV2A 3PEVA 2XSZD 3BFKA 1WXQA 1E2HA 4QBHA 4PQYA 3SYLA 1N6NA 4IHQA 1G8GA 3LRPA 1D5CA 2BOVA 1J99A 5JLJA 1ZNXA 1LNZA 3WHLA 2CLSA 1Z63A 1RJ9B 2PMDA 4B3BA 2CDNA 1M7HA 2Z5FA 2ZVPX 4R7ZA 3U3OA 4OHVA 3QEOA 3CB4A 2F55A 3B9PA 2FZLA 3Q7QA 4ITRC 4C0LA 3IQWA 5K8LA 3Q8XB 1CBUA 2GEUA 4MUBA 3W6OA 1KSJA 3SYNA 1E9RA 3VR1A 2B7CA 2JJ8A 2GXQA 1E2FA 1Q3TA 2IUTA 3NHAA 2V7QA 2ZUCA 1OXSC 2AXPA 3EZFA 4G5QA 3WRXC 4ASUD 1OW3B 5FBLB 3RLFA 1E2GA 2F43B 1TU4A 3W6PA 3K0CA 1P3JA 3RS3A 5SZIA 3IKJA 1UJ2A 2DZOB 4PC2A 2ZAMA 3JVUA 1OKKA 1PLKA 2A5DA 3CRVA 3K70D 4Q1FA 1R0ZA 2RGNA 1K8RA 3T15A 1XP8A 2BC9A 1ELOA 4D82A 4G1UC 4G5SA 4M22A 3A58B 3QNUA 3BJIC 3F5FA 1ODFA 3B1ZA 4EPWA 1QG4A 2CNWD 4RVCA 5FUVA 2DWOA 4NCKA 2HJVA 3U3RA 3MMPA 2JLRA 1XMSA 1QBKC 2TMKA 2C96A 1A4RA 5B58C 4PSAA 3I8XA 4LK2A 2A5YB 3K09A 1Z6YA 4DLZA 1OXUA 3EZ6A 1VYTA 1SXJD 3I72A 2ZSAA 4TWZA 2LWIA 4HZIA 2O5VA 1ESMA 1P9WA 2VQSA 1OYYA 1DAGA 5LB4A 1SZPA 1M7BA 3U44A 2WKQA 1S3SA 4TZ0A 2RGCA 6Q21A 4Q1CA 4Q9LA 1KMQA 1COWD 4HAWA 4X8OA 2WWFA 5TV2A 5D3MB 1IAQA 3O47A 4F92B 3FPAA 2Q9AA 3SOPA 1CJVC 2HLDD 3GEHA 5JRJA 1WBBA 3QG1A 3UANA 1N6RA 3X1DA 3AV0B 2ZANA 1TQ6A 2MMCA 4BGDA 1T3HA 1G17A 3TJZA 1OF1A 3RVBA 3RSLA 1GL6A 1GRQA 3BFVA 4B3XA 4A0FA 3UIEA 1Q1QA 4QJ5A 2YNMA 4IEIA 2D7CA 2W83A 1G5RA 2ZRNA 5FI1B 2J0VA 1ETUA 1VCOA 3QF4A 2JIZA 4JKIA 4QGGA 5JECA 3U44B 1BH2A 4V0OA 5E4FA 3LW7A 3FFAA 3BH6A 4DCUA 2F7SA 2ZAOA 2FN4A 2ECKA 4ZI3A 2QTVB 4MA4A 3TMKA 3VHXA 4ZKEA 2YKGA 1NG9A 5KDLA 1SHZA 2ZETA 3KUDA 1RC8A 4LBZA 4C30A 1MH1A 1E1QA 4DDTA 4Q01A 4U5XA 4KCGA 1Q57A 3IQXA 3ZZ0A 4A0RA 3OFND 1U8YA 4HUTA 3W9YA 4JT2A 2ZJBA 5HCNA 2Z4SA 3QPWA 3OAAD 3KUCA 4YMTA 2E87A 1TUEA 4PQRA 1X37A 4LZZA 4AKEA 3TGPA 3QY0A 3U6BA 4LJAA 4DDUA 1HYQA 2CE2X 5C2JB 1EK0A 3PUXA 3QF4B 2KI5A 5HKKD 1GNPA 2YYZA 2QT1A 3CIOA 1ZVQA 4TYYA 1G9XA 2ZI4A 4Q02A 4ESHA 5TB5A 4D0LB 3ICQB 4R71A 2BM1A 1IQPA 2ZITA 3QKRA 1ZCBA 1VCIA 1W48A 2VTKA 2ZVQX 1G21E 3V4FA 3H84A 5EP2A 3HWSA 1ZU5A 4YXWA 4C9BA 3L8ZA 4TQAA 1EFRD 2V55B 2W6IA 4TSFA 4KAXA 2O8EA 4BFVA 1P5ZB 1W47A 4Q7MB 1SHKA 3U61B 1Z29A 1ZAKA 3BXZA 2AD1A 2W58A 3FMIA 4M1MA 2XNDD 1KGDA 3KJHA 2O8DA 1D2MA 5EE5B 2A30A 2O0KA 4D26A 4KODA 5KPDA 5KSYA 2VA8A 1LF5A 4OI4A 1TADA 2PCLA 4LYAA 2N42A 4G5GA 3B60A 3QQ5A 1SGWA 1H65A 2WAYA 3LNCA 1W0JD 2ODNA 5GJBA 4Q66C 4GT1A 1IN6A 1Z2CA 1E2MA 4DDWA 2GBLC 1F60A 2UKDA 2JLXA 3QKRB 3U2QA 1PUIA 2DWQA 4URXR 1UAAA 1FMJA 1RRFA 5CLQA 2D06A 1KNXA 1KDTA 3ONWA 4AC9A 1NLFA 1A2KC 2DB3A 4WBSA 1CF4A 1KI4A 4HAYA 1S1CA 2J7KA 1NKSA 2O8EB 4I1OA 5CYOA 2G0TA 4EJSA 2OFXA 3ZJYA 2ATXA 1SVLA 4JLDA 1F5NA 4LHXA 4XTCS 2C78A 2RMKA 4JLAA 3OF5A 4LC0A 3NEYA 3KQHA 2O8DB 3GPLA 3RS2A 2JEOA 2ZEJA 3AKYA 3F3YA 1DG1G 4NMMA 1WB9A 1RE0A 4HB0A 4S2EA 3GJ8A 1Z0KA 2X19A 4MRRA 3PUYA 2C98A 4IW3B 1YZKA 4II7A 4UNSA 4AYXA 3B1VA 1XCGB 1WP9A 4FCTA 1G19A 1ZU4A 4LV6A 5FTJA 1OPXA 2ANCA 3UK6A 3B85A 2ZJOA 1XMJA 2GJAA 3EZ2A 2NIPA 4QHYA 4ZV4A 1H8ED 1OXXK 4TLEA 1NVUQ 2R65A 1P7CA 2XAUA 3QKSA 4DLUA 4CT4B 1KK1A 4EJSB 1X8LA 5GJWC 3RAPR 1HE8B 2QAGA 3VU9B 4KHZA 3TUZC 2XNSA 1MRSA 4F91B 2GEVA 4PC7A 4AYWA 3AP1A 2P65A 3QXCA 2J7PD 4RD1A 1DOAA 3GQBA 4DLSA 4P4TA 3GLGA 4Z1MA 1FTNA 4BFTA 2QGNA 1RPZA 4NYIR 3BS4A 3VAAA 1FTSA 1HQYE 4JLJA 3SE0A 2RKOA 1UEIA 4CT5A 1W36C 4CIDA 4PC6A 4GSYA 1G8PA 1IN7A 4H9GA 4MKIA 1KDOA 1G18A 3BH7A 1DADA 2DR3A 2FFAA 3TSZA 4JVLA 4OHZA 4DCNA 2IXGA 2W6JD 2IYRA 1N6KA 2DFLA 2OESA 1OT3A 2ZE5A 4M9XA 3SBEA 4D25A 4O0MA 2J9RA 2VHTA 1E2PA 3QKSB 4HEJA 3MGCA 1M7GA 4X8LA 3B1YA 2WJVA 1XEXB 2EFEB 1GVNB 3A37A 2OBLA 3IEVA 2A3RA 2ZYWX 1R10A 2N46A 4G0NA 1ZBDA 4PSKA 1OH5A 4JZKA 5EUMA 1JXMA 4DVGA 4KLZA 3MWJA 3GLGB 2GJ8A 1P73A 4XOIA 3K53A 4WXRA 4F93B 3L82B 5J5CA 5EXXA 3UG6A 5A5GA 5EJEA 1WRBA 1E9BA 3C5CA 2IC5A 1TF2A 4QBFA 4A6PA 2OCPA 2PT7A 2G3YA 3GLIE 4JVSB 1G4UR 4Q1DA 4A8JC 3OEHA 3L43A 5SZJA 3UWOA 1YU9A 5E7MA 4OI1A 1R8QA 2O0JA 1GM5A 1WCV1 4ZKDA 4QGAA 5JWRA 1FZQA 1NSFA 4GFDA 3IO3A 2C9OA 2R6AA 5J4KA 3KB2A 1HH4A 2R6CA 1E4YA 3CWQA 4JL6A 1NI3A 2EFCB 4KFRA 1Z3IX 3AVTA 1SVWA 3NBZC 1U81A 4MYCA 1OB2A 5JJLA 2H92A 621PA 5LB2A 1NBMD 4UQOA 4U02A 3K9GA 4C7OA 4HUQA 1PLJA 2G9NA 2V1XA 3DOEA 2G83A 2DZNB 3GLHA 2EFHB 3KKNA 2J1LA 3CM0A 5L3RA 4W7SA 3RC3A 2JAQA 2O8CA 2QPOA 1GTVA 2IUSA 3TW4A 1KZ7B 1NVVR 2FOLA 5IHPA 3WHKA 4KLNA 3LXRA 3ZVRA 4F7WA 2QL6A 3LQRA 3LAWA 2IYZA 3IPYA 1VG1A 3TNFA 5FOVA 3C7KA 1LS1A 4TMZA 3UMSA 1T6NA 3T5DA 4LDJA 3GLIA 3QPUA 5C4MA 1US8A 2IBMA 5IK2D 5P21A 3Q3JB 5TVKA 1J90A 3QSYA 3VKHA 3MD0A 4F4CA 4LBYA 5HE8A 3CH5A 3MWLA 2ZJ2A 4AYTA 1FQKA 1FW6A 2WMOB 4Q9JA 3RABA 4C7OB 4W5HA 3LBIA 4CZ2A 1XZQA 3DM9B 4EUNA 1V43A 1BMFD 4UNRA 2V6ZM 2IF0A 1QHHA 1OFHA 3GLHB 1KAGA 1UKZA 4DUGD 1G8YA 3MFYA 3NC1C 1T4GA 4BLRA 4PO9A 5CJ2A 5TMPA 2O8CB 2WHXA 1Z0IA 2PLRA 4NH0A 1T8UA 4HZUA 3GEIA 3IIJA 3KKOA 4RZ2A 5EXTA 3RWOA 2GZAA 2HF8A 2YJTD 2VSOA 1LTQA 3C8UA 4RZUA 1F2TA 1NY6A 3FKQA 3NXSA 2A9KA 3ICEA 721PA 3GLIB 5FPKA 1US8B 1T0JB 2CVHA 2ORVA 2YOHA 2DWPA 3IHLA 4TQUS 2ZPTX 5CK4A 3CPJB 3THWB 2O8BA 4K46A 2WICA 1EFUA 4US1R 5KSZA 2JJ2D 4DBLC 1VTKA 1XMIA 1N5JA 2GZDA 4JIMA 4QBIA 4DZZA 3GCGA 4N0EA 1N6OA 1L8QA 1QHHB 1TQDA 3AH8A 1W0KA 4IFBA 4LOAA 1R4AA 1LV7A 4JLOA 1M74A 4C0BA 1ZW6A 2J41A 1NG1A 3I8SA 3GFPA 2ZYVX 1XTIA 5FL7D 4HZUB 3BFXA 3N2IA 1G3IA 3LY5A 3QOFA 4LYJA 2JGNA 3U7FB 3CLVA 3CONA 421PA 2GCNA 3OIVA 1F2TB 1Z0JA 1ZM7A 3BIFA 4PANA 1VG8A 1OIVA 4H1UA 3B82A 5FOSA 3TSOA 4C0QC 4D81A 5CB6A 2P5SA 2O8BB 4TQ9A 2KRKA 1Q22A 3ZVNA 2EFDB 1KK3A 1CR1A 2BJWA 4NPHA 3ZYCA 1VG0B 1IN4A 3LLUA 4IJMA 4Q4AA 4JL8A 4B3CA 2QMEA 2BWJA 3FTQA 3PVSA 4P4SA 4Z8YA 4NCNA 5UKDA 3HDTA 4O25A 1GITA 1KSHA 4BQSA 4DCVA 1Z6TA 1K6MA 1QZMA 3PENA 2GTPA 5JBQA 1G7SA 2P3SA 2EU8A 1ZCAA 3KKQA 3GJ0A 3SR0A 4GL2A 2ZR0A 1ZYUA 5EZ5A 4IOMA 4LRSA 5JI2E 4CF7A 1DVRA 2CMKA 3LX5A 5JWHA 3E1SA 4Y0AA 3MUFA 1G5TA 2VP0A 4YMWA 1G8FA 3SDZA 3F8TA 4M9ZA 3OHMA 1X6VA 2F9MA 5CB8A 5JMTA 1T9HA 2P2LA 3I5XA 1A5TA 4A82A 3CF0A 1GKYA 2D62A 2AKAB 4C0HA 4PHHA 3VR2A 1QZXA 3A1SA 3LV8A 2JDIA 1XD9A 3BORA 1JR3D 1HY3A 5EP3A 3B5JA 5F98A 4BASA 4RZ3A 4CRWB 1M34E 1OH8A 1E9SA 3B1WA 4QM7A 4ZPXA 3NH6A 4Q47A 4Q1BA 2GCOA 4Q4AB 4DLWA 1N0WA 3GLFE 5EP4A 1VMAA 3P1JA 1VIYA 4P4SB 2ERYA 2IS4A 1IN5A 4JBWA 4NKRA 1KO8A 4TN1A 4UXJA 3VX4A 1GRRA 1EG7A 1IN8A 4ILEA 1J70A 1GFIA 4O2RA 2CHQA 1DEKA 3QJYA 3TRFA 2GAOA 1P60A 1KZGB 4WXPA 1X1SA 4MRNA 5CITA 3EA0A 3NWJA 4D4JA 3PV0A 2ZRKA 4GMDA 2DYKA 1ZC3A 1J7KA 1XJ0A 3CW2A 4PO1A 2IUUA 1D6JA 2OCBA 4DLVA 3UPUA 2XXAA 4MQBA 5FUWA 2J5XA 4B76A 1IONA 5EXSA 3DEFA 4JL5A 4WOPA 3EX7C 4LBVA 4ABYA 1ZM9A 4DCSA 2XOKD 4DLYA 4NBSA 1IXZA 1SVKA 2OO7A 2OE2A 2IWRA 4LJ5A 3H86A 3O8BA 3I1FA 4V0MA 2IYSA 5CYPA 5AR1A 3PFIA 2GCOB 1WE2A 3LBHA 2BV3A 2XJ4A 4LI0A 5KOYA 1EX6A 1K5DA 1AQYA 1QVRA 1LW7A 3HR8A 2FU5C 2XITA 4RD4A 2ZYTX 1O87A 3VHLB 1E96A 2BBWA 1XCMA 1II8A 3WP0A 2JLYA 2REBA 2ZS7A 4BLSA 5F2EA 3THYB 4MYHA 4EDHA 4L16A 2GA8A 1R7RA 3HR7A 4B2IA 2XXAB 3P4YA 2DCUA 1YJ5A 3GJ5A 3UWKA 4HLUC 2R6DA 2XGJA 1B23P 4BFXA 1MOZA 4PR0A 4E5UA 4QL3A 3DOFA 2WZQA 3K70C 2YWGA 4D4LA 4U7DA 1GZSA 4YMVA 2B8TA 4EQ6A 1XJQA 3A4LA 2ZRJA 4P0TA 1G64A 2MMGA 4IXMA 4MH0R 3T61A 5K8IA 2I1VB 2C04A
chains in the Genus database with same CATH superfamily
3WSVA 1L5NA 3L1KA 3O8LA 1E1RA 1R4GA 2HGZA 4TYQA 4LGCA 2PRYA 4HNGA 1JEQA 1NVAA 4O2AB 3WYEA 3NBMA 4HQFA 2NM0A 2N1MA 1VE9A 1FQOA 1XZPA 3R9WA 1FDSA 3KDPA 3EISA 3KZ1E 2OOKA 1ML3A 2XUGA 1AZSC 3DKPA 2HJSA 4BO8A 4KE9A 1Y9AA 1NWHA 3ZDCA 2EA0A 2XECA 3SI7A 1P3DA 2YZKA 1M2VB 1J8QA 1HT3A 1PDWA 4B75A 3WGVA 5K3EA 1UFRA 2BKEA 1G4AE 4PCAA 4U2KA 3HZRA 1MU0A 2OFWA 4PY2A 2ETXA 1U5CA 4N03A 1SQSA 4JU8A 4ERNA 2I54A 3ND8A 3ZXYA 3ADCA 5JNVA 2ZRMA 4YLGA 3KDSE 3THRA 5F2NA 3IQGX 1W93A 1GUAA 1JBKA 3WV5A 4BO9A 4DQ0A 3TAUA 1FFAA 3RC2A 1Z5OA 1KHHA 4BPBA 1NUAA 2HPVA 2GEFA 4AICA 1NP7A 3RSHA 1MW9X 2B3DA 4LSWA 1AZWA 5AVYA 1RLTA 1T1SA 2A78A 1VCNA 4Q7JB 1UJBA 4EO9A 3MWKA 2PZFA 1PR1A 1S8NA 1PJBA 1GCAA 2XZPA 2CHEA 3BRSA 4ZK6A 2V9ZA 3ME5A 2PGOA 1G8AA 2G76A 1Y8CA 1P2DA 3OE7D 2D2FA 2YXPX 3EZYA 3LCUA 1OZFA 3TN7A 1HDIA 1EFPB 2X5NA 2GRUA 4WINA 3H2ZA 2VPTA 1RPAA 4FZRA 2ZWAA 1WDLA 4WZBA 2ALJA 3MINB 1P3Y1 1R8JA 1L8LA 1MT3A 5CEJA 2CNOA 4BWYA 1KAOA 3U19A 4PLPA 4LZAA 4JI4B 4F6RB 4QUHA 2ESRA 2BH9A 2IL1A 1C0IA 2W8BA 1C41A 4FR0A 2GAJA 2WYUA 5DISB 3U7RA 2YC2C 5FPYA 2PD3A 4Y1RA 1WZUA 1O94A 4AZWA 4D44A 1BGWA 5THXA 5IT0A 4MJLA 5TLSA 3B7QA 3W9BA 3MIZA 2ZUTA 2R4EA 3QKTA 2VH5R 1QG0A 1ISSA 1JQ5A 3IBTA 3EQ6A 3N2KA 3I30X 2XYPA 3N39C 3GCWA 2PZ8A 4Q5IA 1AGNA 1GR1A 3EMKA 3LLMA 4I14A 1ADBA 1W2GA 2BFDA 2NSDA 4UVHA 1LA2A 3MB5A 1OLOA 1T0UA 3EFOB 4D9IA 4UXHA 1KDVA 5KNCA 2NO9A 1FB5A 1W6UA 5IDVA 4O4HF 3ZGYA 3D3QA 4IBJA 1JKXA 1G6KA 4RD3A 4NCIA 1CDOA 1RHQA 3ZHUA 2ORED 3S68A 4E5VA 3H6KA 3NBFA 4HQNA 4UHHA 2C9YA 4Z2AA 2PGIA 4XGIA 5BWLA 4N6OA 1GGHA 4M9RA 4H1HA 1U7ZA 1XJ5A 2KXEA 3D5TA 2JHFA 3G68A 3IV9A 3K4HA 3N59A 3RO7A 3LXUX 3WNCA 1XZCA 2YNMD 4W1SA 1NLZA 5EJGA 3VR3A 1Y4DE 1E9AA 3HA7A 3VOTA 5DWQA 1UZUA 3WLIA 1BS1A 4BYMA 1DTWA 2O8VA 4B9AA 3CZ9A 1ND5A 4J91A 4IBGA 4L51A 4LV8B 5AT1A 2QPAA 4MTLA 4P4UA 3V8RA 4E33A 5EHZA 2JWSA 2GK3A 1GAWA 4I4LA 1N1MA 3AF0A 3UJ6A 1NVMB 1R6DA 4K40A 2BDEA 1RZVA 1O6ZA 4XX1A 3B9BA 4K7JA 1EFUB 1JPNA 3ODPA 3R9XA 1F3OA 3AX6A 1ACJA 4WWHA 1X94A 3GGCA 5KBYA 2C1EA 3N74A 4MDEA 4EFMA 4EHLA 3QXGA 3I01M 1E1LA 2FSPA 4ZOAA 4XIYA 5JNUA 2VOJA 3NDJA 5G02A 1UFKA 2ZKLA 1RQNA 3UO8B 3O3NB 3W1VA 5AVVA 2XRFA 1HDGO 1YACA 1Z35A 5DLPA 5JSFA 4R8MA 4I9GA 2V7PA 3E2MA 4L74A 2WOOA 2OD2A 1KJJA 3ZBPA 3SBJA 1ZUWA 4J0KA 1X80A 4WLEA 3H0KA 1EFRA 4QG7A 1XEWX 3F49S 3RVDA 4RJKA 1PJSA 4P3NA 4FKMA 2V5UA 3E7WA 4TKUA 3U9LA 2R8RA 4YO8A 1Z13A 3P9SA 4GMGA 4D45A 3LF2A 1RYYA 2V6MA 1UZLA 2IY7A 1BN7A 4J0JA 2FK7A 5K7SA 1T91A 3QI7A 2CWBA 4UBOA 4XVUA 1IBLB 5CXQA 2P9EA 1EFLA 4DWJA 1ANKA 2A35A 1ZESA 5JTUA 1XD2B 3ZQKA 2C1ZA 3FWKA 2Y9PB 5AUOB 4WKPA 2O9JA 4JB0A 4EPRA 1M1YB 2VKTA 4CV0A 5CFPA 4C04A 1SWVA 4OQ4A 2GSWA 2LDXA 1W9MA 4DV7M 1HNXB 1XP5A 3U3KA 2NTEA 3AEQA 3PG5A 3G5UA 3LWNA 4HSEA 4MGKR 4TRNA 4MYSA 3FOFC 1E60A 5CHYA 3AF6A 1M6NA 3S8MA 3JD2A 1L5WA 1B2RA 1IIBA 4I0WB 1HYGA 2XTNA 2C4HA 1FTYA 2FPRA 3K2BA 5CT6A 1JA9A 3IL2A 2YQ4A 5B3LA 1QK4A 1HDCA 1ZGJA 2OHJA 3ZDEA 3CA8A 1NBMA 2Y2UA 3WJ2A 2EKPA 4OFXA 4CLRA 4MQUA 2IDZA 3G0CA 4EDFA 2QRPA 1TRKA 3WGYA 1X70A 2NV0A 1EK1A 2C58A 3UY4A 2VJQA 4HPXB 1CWUA 1YCHA 2A5FA 3TUJC 4W8HA 1L5HA 2GS9A 4KFCA 4F2LA 1BKSB 2OQ4A 4CHGA 3WGIA 5GKNA 4NECA 1X1AA 3EA5A 5BMOA 3NPAA 4QVKA 4WY2A 4OMFG 2RI0A 4JUFA 4R51A 2CB9A 2HHHM 1J9ZA 4ADSG 1GAXA 3KUXA 2J4CA 3THGA 3Q9NA 4AMGA 3T34A 1QR2A 4JZYA 2NUTA 1E32A 2WWRA 3LW8A 2XB4A 3OU7A 4L6AA 4C89A 2VLIA 3T7SA 3DBRA 3DTVD 4A36A 4B81A 3UMJA 4YPOA 1O95C 3B6EA 4IBOA 4R83A 2BRUC 2EO2A 4ESOA 3QRWA 3PE6A 1V33A 2UXBB 4CODB 1LBTA 3USZA 1ZOSA 1ISFA 3ZW9A 3RIMA 4N0MA 3WZ2A 3E18A 4IXDA 3G1WA 3T5GA 5A6VA 1V9CA 3ISJA 1TM7E 3VGPA 4FMDF 4PAQA 1W52X 1RKQA 3BWXA 3K20A 4JI2B 4OQXA 1IM2A 3Q6MA 3ETCA 2GYWA 1N2OA 4GITA 2WHRA 1B8NA 1B0UA 1M5TA 3UMFA 4QG3A 3HDHA 4CQJA 4HL6A 1BYUA 4KSCA 1D7OA 5I48A 2LXEA 3L26A 6PFKA 1YHYA 3GF4A 4UREA 1W9HA 3G9TA 2JFNA 3NBKA 1KGSA 2ZBVA 1EJBA 2JI8A 2VRNA 4JVMA 4LY6A 2CD9A 1FUKA 3NDRA 1A9QA 3IP9A 1HKUA 5I7AA 4Q9IA 1XTVA 1ESZA 3U4HA 5FL3A 3BCRA 4G3OA 1MC8A 3Q15C 1ZD9A 1E9VA 3KHUA 3KVNA 4DQLA 5EMMA 1SXJE 1FLAA 4XUDA 2QAJA 3ZV7A 4DSUA 3EVAA 1KEKA 3II6X 1AV6A 1PK8A 2BGWA 3AF1A 1LPAB 1JBEA 3Q7TA 2ZTCA 3U6DA 4ZCQA 2Y1XA 2J9YB 3N87A 3KJXA 2CJWB 5BMVF 2UUAM 4INJA 4RZQA 2CXXA 5DK6A 3AONB 4M1WA 2CW5A 1DAMA 3KQLA 4QOZC 3GRKA 3IJ5A 4O1MA 4N0DA 4G37A 1SCUA 4PHTA 2GILA 1NYQA 2A94A 1KBZA 4BMZA 4FWDA 2ZTUA 2GF9A 1V6AA 1RYDA 3DP7A 1A77A 2ZJZA 5DI3A 1RWMA 1LNQA 3FKEA 1FPQA 1V4NA 3NHZA 4G3XA 3HB4X 2JA2A 3EOZA 1M67A 1CZLA 5DCYA 4AXXA 2EJBA 2G4LA 2Q6VA 4J76A 2IU6A 3TZQA 1NASA 2VYQA 3EVTA 2NMVA 1M1NA 3W79A 5AKZA 3NONA 5DX1A 1F7VA 4HGZA 1UPAA 4LYYA 1NKTA 3LZ6A 1DXHA 1W5SA 3QXJA 4M0WA 1EE8A 4RORA 3OIDA 2YH2A 3H18A 3MRTA 3MK6A 3L0YA 4B35A 3ZU3A 1C5KA 2GJ9A 4A73A 3I1YA 2AOUA 2B4RO 2D0IA 2WMDA 4PICA 1XRRA 3LPMA 4P7BA 2XDYA 2IV2X 1EX9A 3THYA 3ZIAD 2M1ZA 4Z5XA 2SKDA 2OGUA 3THXA 4NEQA 3CEAA 4US2R 5AUPB 1AY0A 2HSDA 2WHPB 5HMLA 1QWOA 2Y67A 5CDFA 3COPA 2NPOA 4LX0A 5CT5A 1VGQA 1CUVA 2BH2A 1O96A 2LBCA 1XAHA 5A4JA 2QTFA 1T9ZA 5KZMB 2YINC 3KKMA 3U56A 3OLYA 4JQZA 5TT1A 3MJ4A 4OY3A 2YXEA 1XZHA 5KVCA 3AHDA 2YZMA 5FTMA 1MTZA 5JH7A 2XSZD 3BFKA 2NWQA 4FFSA 1SCJA 2BFFA 3LRPA 2EXXA 2BOVA 1ZNXA 1LNZA 2GCEA 1T43A 3N8NA 3ZCSA 1X1QA 3UYKA 4ITRC 2QVBA 1GNSA 4RLQA 1T9KA 4DNPA 1P7YA 3PC7A 4HVCA 2V7QA 4LHSA 3W6PA 1KR2A 3RYFA 4G09A 2Y77A 3F98A 1QVWA 3V46A 2DZOB 5KQDA 3JVUA 3DE1X 3T4XA 1X7WB 1LFAA 1ODFA 3RVLA 1R8XA 4EPWA 3WIVA 1N34M 1WSBA 2BGTA 3U3RA 2C96A 1U4SA 4JQOA 4KGDA 4DLZA 3I72A 2BY4A 1GZDA 2EKBA 4RGVA 3UMMA 1D0KA 3IMGA 3QEMB 3WX0A 2AE1A 2Q3JA 3R0ZA 5IM5A 4GGOA 3OY7A 4B4WA 2HAKA 2Q29A 3WWCA 4JBNA 4CLOA 2IV7A 3L8DA 2FEPA 4ZALA 4CDNA 3ZZ0A 3RT9A 3QUQA 4LC9A 2JARA 5GP1A 1ID1A 1RHJA 3CUTA 4TWJA 3HKCB 1IEQA 4UMDA 1USWA 4AJOA 2JH9A 1GQFA 2C5SA 1SEPA 4N18A 1ILWA 3BTUA 3EF0A 3FPSA 4JFRA 4KAXA 2ZJ3A 3U61B 1JFFA 1VL0A 1XO1A 3KJHA 3O8NA 1GGMA 4NZNA 1U28C 2O0KA 4HQKA 2GBLC 2JGEA 3W05A 3KL2A 1KDTA 2FP4B 1KI4A 4BZZA 3RSSA 3ZUGA 4M0FA 5BVGB 1FTGA 4RNCA 1WJGA 4REQA 2X7JA 4JY7A 1UBHS 4LC0A 3D0QA 2OXTA 4GXRA 1RE0A 1A4IA 3PUYA 4BNHA 3MIIA 3EY9A 2O2YA 1XMJA 5J43A 5IUJC 1VHDA 3AOEA 1F4PA 3SOZA 4ZU3A 3LP6A 2J7PD 3TQOA 5FADA 3BL5A 3QUBA 4WN3A 3SR3A 4P36A 4HQLA 1G8PA 3EF1A 4MKIA 3FSGD 4JKOA 1C7IA 1K7CA 3QEAZ 2FFAA 2O14A 1Z82A 2QX4A 5JNTA 4HEJA 2YQZA 1RHKA 1AKUA 3PIDA 1H0HA 1RC1A 4FOLA 3ZWBA 1Z75A 4EGCB 3BPSA 5EXXA 1IYZA 3HR4A 1NZDA 1KEEA 3KSXA 1T5OA 2XE8A 3DW1X 2BKXA 5JROA 5JWRA 1IWPB 5J2TB 3IO3A 1C2YA 3C6KA 5J4KA 3GFBA 3AFIA 4FHCA 2NUBA 1OB2A 4NFSA 5IW8A 1H66A 3G23A 4WL0A 3L4SO 1AKRA 4PG7A 4QFCA 4YCJA 1YOVB 4C07A 1FVHA 2JIPA 2QUJA 1NUHA 4M7WA 3I5MA 2WYOA 1TKCA 2WEKA 4W7SA 4HH1A 3RC3A 4KKXB 3FFTA 3S27A 1U9JA 5C4MA 4KO3S 1NUQA 3R0IA 2AE2A 4W5HA 3I3OA 4X90A 1BMFD 2IF0A 1ICEA 4NH0A 3GEIA 2GZAA 5CT8A 5BPFA 4KG7A 4N5NA 3B70A 4WI1A 3GLIB 5FPKA 5C7IO 1J07A 2PXAA 4DGQA 5AVXA 4HRYA 3THWB 2J3JA 3HBAA 2IODA 4K6GA 3ESBA 3NHFA 4Y2XA 4EGQA 1SUBA 3GCGA 1DGHB 1V25A 2W2PA 4MP8A 4YAFA 5KYUB 5HQTA 4GBGA 2HL7A 2J9FA 4RMIA 1CUZA 3ZX5A 4YB8A 421PA 3L6DA 4Q4DA 2E5WA 3UK7A 2KRKA 3CT6A 1XNQM 1KK3A 3RVNA 3DP9A 4DS3A 4B3CA 2QMEA 2BWJA 3PDCA 3G79A 5ITZB 3SR0A 3K8OE 1FW8A 5B36A 2O2GA 2JFWA 1MZPA 4NZOA 2B4AA 2CJYA 4A82A 2DUJA 3CF0A 2GEBA 5E6SA 4X65B 1JEAA 3DZJA 1KEPA 3TBHA 3B1WA 2C7PA 5CA1F 5LZ9A 3P1JA 4C43A 5CX1B 5IUNC 1GRRA 3C3MA 2UU9B 5C8XA 1SU6A 3TRFA 5T4HA 2ZRKA 2DYKA 5AQEA 4UUNA 3DTNA 2QLTA 5FUWA 1LDMA 1XQVA 1KERA 5DT9A 1SCBA 3OCUA 3D8HA 4UVEA 4LJ5A 2IWRA 2BWEA 3D6MA 4I3FA 1ECFA 2HWWA 3AHEA 2FMUA 3J7BA 4IX1A 2XB6A 2BBWA 1HX7A 5JZOA 1HNWM 1V92A 3ESYA 4IKPA 3HJUA 3QTBA 3OCZA 5BUSA 3R6TA 5LM3A 4D9EA 3KEFA 4MH0R 1Z4KA 1HGXA 2IPMA 1NHWA 2VJLA 1JI0A 4Z7JA 2YJ6A 4Q9AA 3JVIA 1Y6QA 4G41A 2X86A 3GLFB 5A71A 4BWVA 1N3BA 2J30A 4WESA 1FDRA 3O4GA 4QPPA 4DLAA 3AM1A 4BZQA 3T3EA 1K0UA 1I6LA 2HF7A 4MCJA 4URVR 1OLSB 2IXFA 5LDDC 3NEJA 3SKXA 3HJSA 2F4VB 4ZOQI 4HWOA 4PPFA 3V8QA 4JI5M 1HT1E 4EY6A 1P0CA 1UOOA 5DNVA 1P2UA 4DHEA 1AUPA 3EARA 3W3AA 3SBDA 4H3VA 4KFUA 4N9QA 5C8YF 4I55B 4NFHA 1QH0A 3L7LA 2QJFA 4FNOA 1ZUNB 4YUZA 3QXSA 1IBCA 3CZ5A 4BX0A 5CB4B 4POAA 5A03A 1U7PA 2UAGA 1TUBB 5K8UA 2PUBA 4MRMB 1E6KA 1CUEA 1E3LA 4KL8S 2ZK7A 5EWJB 4EJ0A 4C2TA 2C84A 3GLQA 2LP4Y 4EI7A 3LPDA 4WBNF 3WLJA 4YRMA 3MMXA 3TMAA 4NC6A 3L2AA 1YDFA 4FYPA 1WMFA 3O03A 3O0DA 2B0JA 4BNDB 2BMEA 3OEEA 4FLFA 4WXMA 1XUOA 3GCDA 3SJCA 1NXVA 3KZMA 2F9FA 4DBVO 1AIPC 4RA9B 4BO2A 2IZ1A 4YJFA 4OL9A 4C4SA 1T8TA 1FQWA 3TXXA 2HCBA 1JQJC 5H70A 2BGNA 2ZRGA 4AKGA 1J7JA 1ZMUA 3JARA 1IJKA 3MS7A 1TK3A 4IIBA 4XWOA 3LOUA 3S2FA 2KBFA 2QW1A 4QGSA 4QNRA 3S8EA 4LMBA 1OVMA 2HMWA 1CUKA 1RTTA 1IB6A 4PYIA 1W96A 1U9IC 2XCUA 3E5MA 2L82A 4YMSA 2PXXA 4LJ6A 1JU4A 1WABA 3QVWA 4M1ZA 2VZ9A 3HVKA 2HRZA 3O8OB 3EXEA 2QQ0A 2O0LA 2XA2A 4PLFA 4BQRA 3H42B 4IRXA 4Z9AA 3TEFA 4RULA 4MW1A 2C20A 2HA0A 4L02A 3C3KA 4YAIA 3TKLA 2OD7A 1M72A 3OKCA 3Q3IA 1ULZA 2VI5A 4XQ0A 3AVPA 3C7AA 1NX9A 2FSGA 3BK1A 4QYSA 1JQLB 2XE7A 2H1CA 4FHZA 4HV4A 2QSZA 2ZBKB 1W4LA 3W8NA 3A6ZA 1KWGA 2JXNA 1ZSVA 2PE5A 1NZFA 1TU0A 2F3TA 3PUKA 4RDHA 3WV4A 5CA0A 5IXSA 4RVDA 1SUPA 2IGBA 2Y0EA 1UMKA 3TW8B 1QV9A 4XIGS 1NWCA 4FNGA 3ZCXA 1DT3A 1BXKA 1H0RA 4E5KA 3R5SA 4R1SA 7ADHA 4G4GA 1N2CA 3NTQA 4U9UA 3N5CA 4CMIA 2VPZA 3RODA 3JYQA 1DBSA 2YFQA 2ASEA 1IXSB 2H5EA 2XTZA 3L02A 3SKVA 3H8VA 4Z6YA 1G0NA 3D8TA 2O59A 3CHYA 1YZTA 4R1QA 2LIVA 1NNEA 4DR4B 3COWA 1TAGA 1RHUA 3S4YA 4YCAA 2CNWA 3PHBE 4HOYA 3BFPA 2X6TA 2C82A 3IUPA 1P1BA 5BT9A 2DH6A 2QRUA 5CLLA 4KXFB 4RPKA 1YR3A 3A1TA 3R3SA 1Y63A 3DBVO 3CVVA 5IVHA 2P68A 1GO2A 3BHNA 3AR3A 3RAJA 4AY5A 3VOAA 1XQ9A 3BE5A 4FMCB 2BBTA 2ZLBA 1QG6A 3SY8A 3F6RA 5IJ9B 5HVNA 5G3ZA 2CVQA 1I1QB 1H2WA 2NXJA 2GNOA 1FSSA 4B43A 1I01A 5HJEA 4L5CA 5ANRB 3VZQA 4Q1EA 2COEA 4KIUA 2BFEB 1DBQA 1NY5A 2KQUA 5BUZA 4MVJG 1D07A 3G89A 2AS0A 1R6BX 4RJTA 5HS6A 1YZUA 4AZ3B 2F2TA 4KYIB 2PH3A 2VP5A 5JHGB 1V8FA 4J0EA 3M6VA 5BN3A 1I1HA 5F9FA 3QP9A 2ZAIA 3FPBA 1VCMA 1P5FA 4GL4A 1X39A 4GEWA 4PGAA 2CXUA 4NAVA 3C39A 2QNRA 3WK4A 4GKKM 1IQUA 4LXXA 3DUFA 4F3YA 3IT3A 3V80A 2ABWA 3ELBA 3F0TA 2JP7A 4JP1A 4F5ZA 4G2NA 1E5DA 3L84A 1K82A 2J3EA 4HVTA 4TLAA 3DAYA 4OP3A 5K51A 4ZI7A 1VSUA 5H37D 2UZAA 2XX3A 4AURA 2BEUA 2WF5A 4FJ2A 4OHCA 4BKRA 4N47A 3F73A 1XWFA 1BE0A 3L0BA 3WO0A 4G1VA 4YC7A 1JHRA 1EFCA 1P4RA 3X2SA 1GQRA 3LH5A 2F1RA 4WUTA 1JG1A 3Q2IA 4Y2TA 2XQVA 3NNNA 5FWYA 1I6WA 4F6CA 2EARA 4Y6LA 3GFOA 2ORWA 1Q1EA 2H7XA 4LHYA 1E2LA 2HA2A 3OKPA 1V34A 4EG0A 3UFXA 1QE3A 1Z06A 1RW4A 3AHFA 3EOBI 1A5AB 4ZVPA 3JALB 1BQEA 5CPBA 3AEKB 1XLUA 4ARIA 1QZ3A 4YJ2B 1DEAA 4QRDA 2UDPA 5ITUA 2FPWA 3IUEA 2WVJA 4LZLA 4MHSA 3CC8A 3NIBA 2BKVA 4HRVA 1FF9A 2NVWA 3E9QA 4HDCA 1QORA 1QX4A 2BTOA 2RC5A 1S96A 2ZB3A 1SD5A 1F17A 2X2FA 4HC4A 2IF2A 1SA0A 2VT2A 1CLUA 4EKYA 1GUZA 3OT1B 2ZUEA 4YV1A 5AW5A 1U9YA 1OVGA 1IC6A 3HKEB 5LP6C 1TM5E 3QWBA 1XTTA 3IAEA 3KQVA 3KWFA 1PS0A 3EDYA 2DBYA 3QSGA 4UQPA 4ZCRA 2XUDA 1M75A 2XPCA 3KLPX 5AIAA 4IAOA 2RIPA 3WQQA 2XW6A 3FZEA 1VL1A 2ID4A 4C87A 4ISCA 1Y8QA 3WYDA 1DAHA 1FP7A 5BW8A 4UTPA 1MC5A 5MDHA 4AF8A 1QOZA 2AXQA 4L50A 2Q3CA 3C3WA 4OK3A 4HGNA 3KQQA 3PX2A 1T2EA 3BQMB 2VN8A 3GH3A 3WFJA 4B3TB 3G7SA 2V6GA 2AK2A 2Z04A 2HBQA 3A1UA 2HV8A 1U1IA 1JS1X 4NARA 4P84A 5IZCC 2QZZA 2AN4A 3AU8A 3JPYA 2V3VA 3RHSA 2JAUA 1Z4QA 2HNAA 4PEVA 3KT8A 1ZK1A 4PZYA 5ICFA 1FSPA 1E1RD 3ANYB 1B6RA 2FPPB 5F3DA 3I4FA 1IB0A 1EHYA 2OZPA 4U6QA 2GZ1A 3A8TA 4FE3A 4JI8M 4AUKA 3ZZ1A 3SHQA 1F6DA 2R5FA 5GONB 1QXSA 5FWDA 4IZ6A 3HY5A 4Y9TA 4P3KA 2WJ3A 4RQAA 1LB1B 3DNMA 4IVNA 1TDJA 2JI4A 2IW3A 3IT1A 1FRQA 1LGYA 2Q41A 4FS3A 2FHPA 2CLHB 3BD7A 4FK8A 4MS1B 4HT3B 4ZCLA 1NPYA 2F59A 4OBXA 4U7JA 1HE1C 3HB7A 4NBRA 4P3PA 1K8QA 4EG4A 3DJYA 4RIHA 3O90A 2QW0X 2OCDA 4XCXA 3SHFA 3T52A 5BO5A 2IEYA 1R3UA 5ELXA 3U6PA 1LSSA 3W3ZB 5CVTA 2YHIA 4OJYA 2BUBA 1OWMA 1GYPA 3V1LA 4IJUA 2VF8A 5A4AA 2VJKA 3RAEC 2O8FB 2Z3VA 4UEQA 4HN9A 3G6KA 3WXBA 1QNFA 4Z9BA 1XAGA 5CCXA 2AFIE 2QVXX 1BVHA 1QLWA 2C4MA 3BOSA 5KYWA 3TO5A 5I7RA 3F2IA 1IG3A 4RX1A 1V5FA 4ECEA 4B8ZA 2JG3A 2Z6AA 4HTFA 4BB6A 4HGQA 2BGIA 4JIGA 2ET6A 2FZEA 2WSFF 5ADUS 2ZYIA 2QHOB 2QL5A 3GQ3A 3R3YA 1Y1KE 2VH2A 3C6QA 1N1GA 1L5SA 3HM9A 3R0VA 3KQNA 3IHKA 1KF0A 5KTOA 3JR4A 1PQYA 2CXHA 2V5VA 1YZNA 3IIMA 1UDXA 3EFEA 3DT8A 1RAIA 2RE8A 2X4GA 4GMXA 5EUCA 3CLSC 2MYUA 4H6PA 4MB0A 2PDAA 5EMJA 4HLCA 5E9WA 3ADPA 5FEMA 2H48A 2HTEA 5D2CA 3OMWA 1ORYB 4YV7A 2VAPA 3U1TA 4MQEA 3EGXA 1KFVA 4BGEA 2FMFA 3V00A 1HSOA 5LQNA 4XQEA 1ZM2A 2YOFA 3T9FA 1J06A 1FNSA 1GA1A 2REXB 3TFOA 1DB3A 3L7OA 4NICA 2PR2A 1U5BB 5REQB 1O94D 3RHZA 2ZQZA 1U6KA 1Z83A 4X8HA 5ALGA 4A1OA 5F9HA 1QF9A 1IHOA 4GPEA 3EQ7A 2IHZA 3KQSA 4U00A 4M54A 1G20A 3WYAA 1V5WA 2EX1A 2CKMA 3ZEIA 3WTBA 1BOFA 4C29A 3DOJA 3CF6E 4FIDA 4MR9B 5JEEA 5IAAA 1QC5B 1D0LA 1UAYA 2KS6A 4NSRA 3UB4A 4Q48A 1PK7A 4IIEA 1MO4A 1HUQA 4G5OA 2C2BA 5KNCD 4XEHA 4TTAA 3QFRA 1OHHA 5JSQA 3HBNA 5BPHA 1Y8AA 4DEXA 1RWNA 1G9TA 5LP6B 5G0SA 1RM3A 4ID3A 3JYLA 2IDJA 3RBAA 3PRYA 3VXKA 2FZVA 2H7VA 4Q12A 4GKBA 2AOTB 2HKIA 1KY4A 3SYLA 1N6NA 1X9IA 3L4JA 2Z5FA 1Z56C 4D9KA 3DEJA 3CLKA 2F55A 1HYBA 5LYJB 1KSJA 5EIWA 2B7CA 5HTOA 2ZUCA 1GA6A 1OXSC 2AXPA 1VJCA 4QOHA 3WRXC 4ZAWA 2G08A 5G0UA 1N4DA 1XZIA 4LDQA 2BR5A 2ZAMA 4GE0A 3G9UA 3RRXA 3VR3D 3CG4A 4O29A 4RVCA 3AV0A 1SXHA 4KR2A 5IF3A 1PWHA 2HIAA 5B58C 4Y6GB 4WLFA 1Z6YA 2J6HA 4ENWA 1UK9A 1B14A 4DV1M 3H5LA 3T3NA 1L8XA 3K73O 3M6IA 1ZITA 4D8UA 3M6XA 2UV8A 3GEHA 2QB5A 4BX2A 2MMCA 4OPMA 1VE6A 3G3EA 1I4WA 2L6OA 4DRXA 1HRKA 3LWBA 3F9CA 1ETUA 3E9MA 4ERXA 4EQZA 2EEPA 3GG2A 5TQVA 3MUNA 3L40A 4J16A 3L04A 3M6FA 2AKEA 1SC3A 4MA4A 2B35A 4KDRA 3AK4A 2A9QA 5KDLA 3VR0A 1FMFA 3JVEA 3VI4B 1Q57A 2BN4A 1QZZA 1U8YA 4D9MA 2Y93A 4FS8A 1N2ZA 1DX4A 1J2EA 3GDGA 3FUTA 2KI5A 3CE6A 2YYZA 1G9XA 4WEOA 4Q02A 4KE7A 1T2AA 2BM1A 4BMSA 3QKRA 1ZCBA 4IDDA 3P71T 1G21E 3RC7A 3HSSA 2WTEA 1EFRD 3HHZA 3I6MA 5AI8A 3F3KA 1H6DA 1U9ZA 1Z29A 2NAFA 3BXZA 2UXCB 4RTQA 4G5GA 4HHEA 2A92A 3D4OA 1A7AA 3DE3X 2YY6A 2XUPA 3AV3A 4BC1A 2F62A 5ALSA 2ZG6A 3DMTA 1GZVA 4Y0NA 1F5NA 3ZW7A 1SJ9A 4N0QA 3F4LA 3NEYA 2RHTA 2UUBM 4GH5A 4NMMA 1U8CB 1G0OA 1RXWA 4AYXA 3NM4A 1QLHA 3B1VA 4YGXB 4DLBA 2YWXA 1USUA 3HY3A 1TVKA 3S55A 2WFLB 3U0VA 2HMTA 4MP6A 2QAGA 2ZPUA 3GBSA 4QULA 2PD6A 1Q15A 3O93A 1TM3E 3RIXA 2BZSA 3VDUA 2BISA 4IDBA 3UF0A 5CG1A 2PO5A 1GTMA 2Q2EB 1IN7A 1PVDA 1MGOA 4D8YA 1NUPA 3IAFA 3P0RA 5EVJA 5D5PA 2AW5A 3LI2A 4ZYTA 3QW2A 2NACA 3TL4X 4X8LA 5DBHX 3OG9A 1JXMA 3DMPA 4XVHA 2J32A 3BIXA 4QPNA 2Q5EA 4UOQA 5DXJA 2ZIXA 3IERA 1ZIXA 4WX2B 2OCPA 4MQLA 4W99A 1KY5A 5SZJA 1TD1A 1NU6A 3ULKA 5CT9A 3I42A 1FZQA 3C8ZA 2XYQA 3I9OA 4DQUA 5E8JA 2H7CA 5CYFA 4G2TA 2DFPA 1NBMD 4Q4CA 1WDWB 3KTDA 4PYNA 2VJPA 5IWAM 1L1ZA 1XZFA 4R2LA 3KKNA 3CM0A 3L5OA 1N5MA 4ZQHA 1IXYA 4W1PA 1LWNA 1ODKA 1XELA 3FBTA 1US8A 3A70A 1J90A 3H3XA 2C3MA 4AYTA 3R3VA 1SC1A 3OIFA 3DM9B 3C3CA 5B1YA 5EJ4A 1CUBA 1M1UA 1NGSA 1ISGA 1T8UA 4HZUA 2ZYHA 1QIKA 1DLIA 4RVFA 3DLBA 1F2TA 5EHNA 2FOIC 1V39A 3WA6A 1QUSA 5CLFA 1FS4A 4LZPA 3AYZB 1O9HA 1EK2A 3BEDA 1KYWA 4NMHA 5C8VA 4JQCA 4N0EA 3URKA 2B0CA 1N6OA 5I9LA 4BVKA 3UEOA 2J41A 2PRJA 2BDUA 2ZYVX 3OU2A 2Q6OA 1U3VA 1ZGBA 3ZE8A 1FFDA 4E2ZA 2IDKA 3TWKA 4H1UA 3B82A 3GO4A 5BSFA 4F9EA 4NXNB 2C29D 3VBCA 3WLRA 2AHMA 2BJWA 2JAOA 5D7NA 4PQGA 3PGKA 4BQSA 3T5AA 3F74A 4EJFA 5JQGF 1TGYA 2GSDA 2HHJA 3WWZA 3PP8A 4V0RA 2CMKA 3LX5A 2PUVA 2QNBA 3VPFA 5ITXA 3KU4A 2BMWA 5TJ9A 2B83A 1XV5A 1ZN2A 2JDIA 1XD9A 5CH3A 3O2NA 1WGLA 5F98A 2X6RA 4CRWB 3HK2A 1VOTA 4LFAM 3O6VA 1O08A 1HL7A 1DQZA 4TN1A 4O2RA 4GEGA 4L0MA 5A5FA 1R4MA 3ISVA 5LP1A 1Y8GA 1XJ0A 4D8TA 4RXUA 3UPUA 1XMOM 3KOXE 2AFHA 3PNSA 4DMCA 1HFJA 1KXJA 2IY8A 2YCBA 2J3HA 2OE2A 4BQOA 2QRQA 5TF0A 3GXOA 1O03A 3PPIA 5KOYA 4H7EA 5DCUA 3O75A 2F3SA 3Q5GA 3AJAA 3KAJA 3WB2A 3SF8B 3CSUA 4ZAYA 1V7PC 3RE8A 1OV6A 2NNWB 4B8WA 4YX9A 3MCTA 3MQFA 3DOFA 4UUOA 1PTJC 1HT0A 2PBFA 2IVFA 4N39A 4P0TA 3GIDA 4W9MC 4JSTA 2Q6LA 3L7BA 2Q6KA 3QVTA 1WOMA 2ZI5A 4JLKA 2RJNA 1H4VB 3D6NB 3HP4A 4YPVA 2Y1WA 4UEOA 1T9GS 1XTSA 4TV9B 4HD8A 3TJRA 5LNK6 1KKMA 1F48A 4URYR 4HDOB 2X40A 1SOAA 4E15A 1JIKA 2WD9A 2L7HA 2Y0TA 3RSZA 3EQZA 2D4AA 5JYCA 4J0DA 5EJCA 1NUSA 4PV7A 2CSUA 1YRLA 4LXUA 4IUYA 4B4UA 3T1YB 1WNFA 2VO1A 2Q0HA 5LJLA 3A0RB 2F8TA 4BB5A 4LDPA 4HAOA 1ZIPA 4HVLA 1ZV1A 1FVOA 5I9BA 5TXGA 1T36B 4JUCA 1ZOPA 3K0FA 1BHSA 1WXEA 1MB0A 2FRVA 2ARKA 2JZOA 3QZUA 3AETB 5E4JA 4LPSA 2BYTA 2FWPA 3I61A 5IC5A 3HZJA 1JKJA 1IRXA 3OTGA 2YDXA 4RKQA 4XSGA 1TQ2A 1AQUA 3QKUA 4MLZA 4X6YA 4QFMA 2R6GA 4CM5A 1HM5A 4FGSA 1OAAA 1I4DD 5CM9C 5D5HA 2FGJA 5C51B 3DZHA 3T7EA 3MEQA 4RSMA 2WNSA 2NQ8A 4I1VA 2GPTA 1QB7A 1ZJZA 3FKSA 3O9VA 5LU8A 2QDKA 5KJCA 4ZVSA 3G2OA 1GDTA 2XKAA 3U6LA 2IX3A 4DBLE 1Q3CA 2OTCA 3VTAA 1F9EA 1QQ7A 2BMJA 1K3WA 2C88A 1L6RA 4TXHA 4Y2QA 1Q6ZA 4FFDA 2QL7A 1I94M 3X2FA 3MXOA 1TT7A 1JLLA 2CUNA 4RXMA 4ICIA 4DC0A 4LG1A 4DSTA 1ZJ5A 3TLJA 4HDAA 3RROA 4GBMA 1W75A 4DILA 3KOYE 5HFJA 1RZ3A 3KP1E 4U2GA 3Q8KA 2YFKA 3WLLA 2IS2A 5JATA 2W0SA 5LNK1 5DHTA 2EJTA 1TK9A 1Z88A 1WQ1R 4OVZA 3RASA 4ACAA 3GLVA 3NVAA 2IZOA 2KSQA 5TVGA 4U9IS 4PG4A 4FB5A 4R8VA 1KI3A 2A88A 2HU5A 4COKA 1TYAE 3T41A 3SLRA 2PUJA 3FOWA 3JYNA 4HDRB 4OI2A 3S1AB 1FFSA 2D4HA 1F0PA 3E9YA 3TQTA 2RJOA 2QNJA 2PS9A 2DXIA 2V7QD 2G9UA 3TIVA 5FHRA 5EQTA 3SNHA 4BLOA 3DVQX 4ZIRA 1I1NA 4J7AA 2EKFA 1OXTA 2QTTA 4FFLA 1KIFA 1R0WA 1OZGA 3TBKA 1RBMA 4EPXA 4OI0A 1XA4A 2GRJA 4DMKA 4IFTA 1VSBA 3EIHA 1K7YA 1UIMA 1U2SA 3HWRA 1UDAA 1OI2A 1Z2OX 3KJQA 1FL9A 1OBFO 1JEYA 1VXOA 1HV8A 1Y8ZA 4QGFA 3B5EA 5EE1A 1EUCB 4ZPJA 3BJMA 3WADA 3PT9A 1X7YB 5L51A 3PVCA 3DT9A 5KVSA 1KFBB 5BSVA 2D1RA 2ZP1A 3M7GA 4XJTA 3QMVA 1Y1PA 3KAPA 3U6QA 4O4IB 4C3VA 3WL8A 3CR7A 5ER9A 3RS7A 1JAXA 1EQ2A 3AKDA 4D57A 2FHSA 4Q4LA 2J09A 4ENVA 3F6SA 3QWHA 2PKWA 4BKOA 4OSEA 2QU7A 3RSGA </