3M0EA

Crystal structure of the atp-bound state of walker b mutant of ntrc1 atpase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDAIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Engagement of Arginine Finger to ATP Triggers Large Conformational Changes in NtrC1 AAA+ ATPase for Remodeling Bacterial RNA Polymerase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 83
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3m0eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3m0eA01
2BDTA 2BCGY 2ZM5A 1R8SA 1OXVA 1G41A 3C15C 4BGDA 2QRZA 4JMPA 1XCGB 2FSFA 3W3ZB 4PSKA 1NMZA 3Q72A 4LJ5A 5C2JB 2ZJBA 2IYTA 1Z0AA 1O87A 3CPHA 4TYNA 1ZBDA 2IYRA 1XEFA 2QU8A 5FTNA 4FMDB 4KCGA 4M1OA 1GRNA 4ZCIA 3LXRA 1CP2A 2AFHE 3B1XA 1OH6A 1CR0A 1GSIA 1ZYUA 1FUUA 2F43A 1N0VC 1N6KA 4BRWA 2BC9A 4A0FA 1AN0A 1E0KA 1RZ3A 4B3FX 5FBWB 4DDVA 3GFOA 1JR3E 1KK0A 2J87A 2B8WA 3EZ2A 1IQPA 1XEXA 1FOEB 3B13B 4KBGA 1HTWA 4MRSA 3RS0A 5DN6A 3ND9A 1QHIA 1JEDA 4KV9A 2I4IA 4Y0VA 3BORA 1XEWY 2JCSA 2XGJA 1H8EA 3AF0A 3I32A 5FL7A 2OM2A 4I4LA 3BH7A 5CM9C 3B9PA 1P2SA 1VG0B 2VHTA 3IIMA 3A4LA 1ZM3A 3A1SA 2CNWA 2ZU0C 1G3MA 2J0QA 1NN1A 3QF4B 3A1VA 1ELOA 4HB4A 3HYTA 2JDIA 3SU8A 4HUQB 3U3KA 4HAXA 1SVLA 1N5KA 1US8B 4BRUA 1KTVA 4IVQA 4TQUS 4P4SA 3MLEA 1Z06A 2ZI3A 2ZAOA 3CF2A 2GAAA 2IF2A 4LPSA 2QL6A 4Q1AA 1M7BA 4UXIA 1WBBA 2J46A 1D2NA 5LBIA 5KDDA 3BH0A 1XZQA 1R0WA 1PJRA 3QXHA 2QNRA 2QQ0A 2VH5R 2IS2A 4LYFA 5JFGA 1P3JA 4D80A 2JLWA 2RKOA 1OXTA 3ZQJA 2EVWX 3GLGE 3QY0A 2FGJA 4DRZA 1V43A 1E0SA 1DAIA 5FPHA 3B1YA 1YQTA 1Q12A 5HE8A 4ZV4A 1XTSA 2IUSA 4LWZA 5JHHB 1GRQA 1W36B 3AVOA 4B6FA 2VSOA 3Q5EA 4PX9A 1KI6A 1KDOA 1AS2A 5F2EA 1Z6TA 3ZD6A 5DI9A 1YR7A 4TYWA 1AA9A 1JB1A 3B78A 1I2MA 1CTQA 3OIWA 1R0ZA 3VAAA 1CS4C 3VR6A 5A5GA 2QBYB 4MYCA 2Q9BA 3HU3A 1X8JA 4Z54A 5B58C 3EIEA 3FHOA 4FI3C 4Q01A 1XD8A 2R6DA 2X19A 4RZ2A 5F98A 1G4AE 1DARA 1CRPA 4W9MC 3U7FB 1X86B 5F9HA 3TJZA 2GNOA 2P6UA 3LVQE 4PPNA 4LJ7A 2F9LA 4X8MA 3RRZA 5JJLA 3BRWD 2AN9A 3B60A 3PUXA 3SDZA 3NVAA 1JXOA 5FOWA 4C7OB 5K8TA 4QL3A 3CKLA 3A1WA 4JVNA 4B2PA 2DR3A 1IXZA 3CUEF 2JASA 2H17A 1YZUA 2C9CA 2OHFA 2ZS8A 2XOKA 4M9QA 2FPMA 4QM7A 4DB2A 4Q02A 1U0LA 4A8JB 2G0TA 3TLXA 5FOXA 3MUFA 2WIAA 2BBWA 1BS1A 2BKUA 5EE9A 2F55A 1COWD 1WB9A 2QORA 3RS7A 4KSBA 3DZDA 4EPVA 1G19A 3X1WA 4B71A 6Q21A 3C14C 1BMFD 4LHWA 2W6JD 2R8RA 3CNOA 3VNVA 3GLIE 3U61B 3EW9A 4KI0A 5DYGA 1DAHA 5ANRB 1KMHA 1XMSA 1G18A 5E95A 3BERA 2RGDA 5FTJA 3MD0A 4CYMA 2C77A 3LY5A 3T61A 1XD9A 3GJ3A 4LCBA 3BJIC 3MMPA 4A92A 1HT2E 1IJEA 4KVGA 2WWFA 2CLDX 1A82A 4WW0A 3P4XA 4M21A 4TZ0A 3UWOA 1EFCA 1JR3A 4C2TA 2A5DA 2GJ8A 1JAIA 1ZD9A 5L3QB 1P9WA 3U60B 1T91A 1F2UB 1QZXA 5J40A 1FTSA 1OPXA 2A2ZA 2WZQA 2ECKA 4Q1DA 3J81k 2B21A 3CNNA 2WWYA 5FUYA 2VIIA 4HAWA 2IHYA 3MJRA 1PUJA 2I1QA 3CF0A 5F9FA 4GMDA 1OE0A 3W6OA 1S4QA 3G5UA 4OK3A 1FTNA 5CLQA 1NBMD 5TVKA 4LRWA 4ZDJA 3Q8XB 2HUPA 2UKDA 2WHXA 2AHOA 1T9HA 4V0ME 1PUIA 1E79D 1M74A 2CLSA 5CK5A 3GLFE 1FNMA 5A4JA 1EX6A 2V1UA 1G1MA 2JJ1A 2AR7A 3LLUA 3ADDA 2YOGA 4HAVA 3FB4A 3TKLA 3UK6A 3D31A 2QPAA 4Z1MA 4XWOA 4A0GA 2J7PA 1EFRA 2QE7A 2ZSAA 1JPJA 1GZSA 1NLFA 4RCYA 2AWNA 3R9XA 3BFXA 4JYCA 1F6BA 4IJMA 4TZ6A 4IDOA 4L15A 3WRYC 4F93B 4LI0A 2D3WA 2V54A 2O8FB 3GLGA 1ZM2A 5HCNA 1KY2A 4W5WA 2FZ4A 2IF0A 1R10A 5TB5A 4CF7A 3VFDA 2BWJA 5UKDA 4C7OA 2WSSD 5M04A 5L3RA 3ASYA 4I1OA 1WMSA 3QE0A 2Z4SA 1PZNA 3VX4A 1VCOA 4OQNA 3ZYCA 1D9ZA 2IW3A 2FFBA 4YXWA 1W4AA 3H0KA 4ZI3A 4M1YA 1Q0UA 4KFTA 2GEVA 1W7AA 1I4TD 2XTMA 2A78A 2IEYA 1ZIOA 3NBYC 3HPQA 4ZDWA 5EUQB 2FSHA 3QEJA 4BZQA 3RAPR 3DVLA 3TMKA 1JBKA 4DSTA 1DG1G 1OB5A 3GJ6A 3AJIB 3SI7A 4A6PA 2HF9A 2IUUA 1UEJA 4L8GA 4GP7A 1BH2A 1YU9A 4PHHA 1AKYA 3I1FA 3W8NA 5E7MA 3K70B 3CF6R 5B64A 4FWHA 1YZQA 4TMWA 121PA 4US0R 2X1VA 4DXAA 2F7SA 3AQ4A 1QVRA 1E1RA 2G77B 4C0JA 3UMRA 2XSZA 3PV0A 3NC0C 3F0TA 2CHGA 4TMXA 3F5FA 4LV8B 2DCUA 4TYQA 1EFUA 1WXQA 1U9IC 4CT4B 4XD7A 4DKXA 3U3OA 1SQ5A 3KQLA 2WVJA 3CR8A 2D2FA 2AD1A 4M4SA 4DLZA 1IHUA 2WICA 1GNQA 2HLDA 1F5NA 3V4FA 4HAZA 4BFXA 4BLOA 2XTNA 4PZLA 2FDCA 1W48A 4R2IA 1U94A 4F4JA 3I62A 1W0KA 4D6PA 3GLIA 2J0UB 2FNAA 3KTAB 1E2QA 1Q1ZA 4AY2A 4KXFB 1ANKA 3AKEA 2XJ9A 5DO9A 1KSFX 2J7KA 1T4GA 4MITA 4Q4JB 2ZRKA 3GEHA 4C30A 2FFAA 4XVUA 2OLKA 5FR2A 2Q0HA 1K8RA 3SS8A 3FMFA 4D0GA 1T5LA 2ANCA 3NWJA 3ETLA 3E5HA 5KYKA 2QRNA 5FI1B 2ZANA 1N0UA 2PMKA 4WZBE 1IONA 2EWVA 3IBGA 1D9XA 4DSUA 5JBQA 2PZGA 4UQOA 2SHKA 1X6VA 2V6IA 4WBSA 3RDPA 4RFSB 3VX3A 2ZE8A 1MH1A 1N6IA 4PANA 2O52A 3QVVA 4AK9A 1IBRA 2NPIA 2OBNA 2NPFA 2ZRJA 1E9RA 5FTMA 2DFKB 3N70A 4JKIA 2QM8A 2REXB 4MKHA 2IBMA 3ECCA 2ZSFA 2ZUCA 3SC3A 3OF5A 4MRVA 4JT2A 3WNDA 1E32A 4V0NA 3CW2A 1Q22A 2G83A 1LNZA 3OE7A 4JVMA 3U44B 8OHMA 1G8FA 4E03A 2VP0A 4JJKA 3RRYA 5IK2D 4V0MA 4DLTA 2QZ4A 4Q21A 1FX0B 1RE0A 3AV0B 3GLFA 1M8PA 1P61B 1CR1A 4XTRA 1G291 1CJTC 2JLSA 3CZQA 1H8HA 4TYYA 1QHGA 1GAJA 3ZVNA 1YR9A 2DWZB 2IC5A 4GBMA 1SZPA 3HWSA 5J4HA 5C1BA 2J0SA 2ZTSA 4KFUA 4YMWA 2J45A 2AWOA 1LW7A 1W1WA 1ZVQA 4AYXA 3AH8A 3T15A 2FV8A 1FQJA 4PZZA 2R6FA 4FWGA 4C0HA 1UEIA 2OAP1 1ZUNB 3X2SA 2PLFA 4I1SA 2GZAA 2C96A 3T5DA 1G5RA 5EXXA 1GILA 2XZLA 5KSPA 4HLCA 1MR3F 4JLOA 4L4UA 4MKGA 4QOSA 4OYHA 1EFTA 4HDOB 2GCOB 4OL0A 1R8QA 2VP5A 3AF4A 3ZVRA 3FHTA 4TTQA 5FUVA 3U7EB 5EZ5A 5BN4A 1L4UA 3P20A 4URUR 5DHFA 1RRGA 4B47A 2GXQA 2Q9AA 4F92B 1Z5ZA 2BV3A 1XU4A 2IYWA 1VDZA 3BXZA 3HU1A 5E3HA 4BE7B 1FMLA 1JQLB 1UF9A 1W47A 3JVUA 1SVKA 2L0XA 2GJAA 3PR1A 1WQ1R 4TLBA 3RVBA 1E1QD 2NG1A 2YC4C 3MJHA 2J0UA 3MSXA 4TN1A 2O8EB 1G20E 1E69A 3QENA 1NLYA 4HI0E 3I61A 1NVMA 2N46A 1IXRC 1DAMA 2ZE5A 3PIRA 2W00A 1N6LA 3EZ6A 4OJQA 4ASUA 4QBHA 4US2R 3THXB 1HE8B 2YC2C 3IO5A 1G5TA 5JSZA 3KJIA 1CBUA 1XD2A 1BYIA 2A3RA 3ASZA 3LH5A 4DCSA 1OIXA 2Y8EA 3LV8A 3QKTA 1T8UA 1JI0A 3AGQA 4G1UC 3T34A 3TSOA 1Z6YA 1W36C 4NKRA 5G53C 3TW8B 3FFBA 5SZJA 3BOSA 3KW6A 3WP1B 2IS1A 5AJZA 4C0BA 3ICEA 4BASA 4X8LA 1C1KA 4KSCA 2ZE6A 3EWAA 3DEFA 3LO5A 4RFSA 3CRRA 1ESNA 1EK0A 1W4CA 3CH4B 3I5YA 3SZRA 2FSIA 4C2UA 3OZXA 4BECA 3A1UA 3ZS9A 3IPXA 2GVZC 4I1VA 3WMEA 2Q3FA 1P75A 2WOOA 1J8MF 1RPZA 5FOVA 4Q7MB 4B3GA 1ONBA 2QSZA 3CRVA 2O8CA 4JL8A 3R8CA 4JSTA 2C03A 1V5WA 2REOA 4V02A 4MYUA 1E9CA 2GA8A 2QA5A 4AYWA 2GCNA 4XH9B 3PXGA 1KKLA 2OCAA 1KI3A 2GRJA 5EXTA 2LKCA 1G6OA 1YZNA 2WWWA 4IOJA 1U2RA 4Q19A 3DHWC 4TL8A 4DSOA 2FWRA 5EP1A 1AQYA 1Z6XA 3BBPA 4WVFA 1KMQA 3N2EA 2KE5A 5AJWA 4A8JC 5JWRA 1G3UA 2W6IA 2W0SA 2RGCA 1N2CE 4Q7LA 4Q9IA 5B2ZA 5DSZA 2OCPA 3R7WB 4ESVA 1ZM9A 2AXPA 3IPYA 5TXGA 1KSHA 3IILA 1CR4A 2RGNC 1U81A 1Z47A 1Z29A 4JBWA 2FOLA 2A5YB 2VP9A 5B57C 1KNQA 5JEEA 1XMVA 3LBIA 1NG9A 4Q48A 2OCYC 2G1JA 3O8RA 2A7QA 4PC6A 4TT3A 1A5TA 4AKGA 1H65A 3VKHA 3D3QA 2ZITA 1N5JA 1OXUA 3O47A 1MABA 4QGAA 4Q9LA 2FEMA 4U7DA 2QGZA 1UBGA 5KNCA 2WKRA 4BLPA 1WCV1 3QOFA 3FFAA 1II8B 1AJEA 4AKIA 3WHKA 5BN3A 3SBDA 4FCVA 3TW4A 4B43A 1Q3TA 4GNKA 4GITA 2OSBA 1G7SA 1LTQA 3KJEA 1HQCA 1GL7A 3EZ7A 5FBQB 5JI2E 1Z63A 1DO2A 4G3XA 1VPLA 2O8DB 3U7HB 2X8AA 2XB2A 1DE0A 5J4KA 1E2LA 2YJTD 4Z8XA 3H86A 3U3MA 2VLIA 4KJZA 1P5ZB 2CNWD 3GFPA 1E9EA 2CHVA 3LX5A 2DPXA 1TUIA 3OIYA 3THXA 3B7GA 1R0XA 4A9AA 2P6RA 1VYVA 2QPOA 5LB4A 2OFXA 4IDPA 4A36A 1AQUA 1CJMA 5HE9A 2VTKA 4KLNA 4NYMQ 2FU5C 1XZPA 2H18A 3BH6A 4GPTA 3NDPA 1ZUIA 2OUKA 1KHTA 5HZKA 2TMKA 1R0YA 3T5GA 3GP8A 3FPAA 2JJ2A 4IDHA 4EUNA 1HYQA 2BCJQ 3D8BA 2WJJA 2YHSA 3TUIC 4QFMA 1Z0KA 1NVVQ 3RANA 3OFNA 1KK3A 4A2WA 4EAQA 3HYRA 2WAYA 2CCJA 3OIVA 3QXJA 1KI2A 5IHPA 3TRFA 4ARZA 2IT1A 4RKEA 4DUGA 5KO2A 3GEIA 1MT0A 2EFGA 4M2LA 4V03A 5SZIA 3T06B 1G3QA 4DLXA 1CJUC 1MOZA 4V0OA 2PH1A 3FVQA 3Q7PA 2CE2X 2GJKA 3LX8A 1J7KA 5DIFA 4Z8YA 3AVTA 2NMVA 3DMNA 5CJ2A 4D4LA 4Q4HB 3AVVA 1ZUHA 2PLRA 4URWR 3MCAA 1OT3A 1TADA 5HPYB 2C5LA 3AVPA 1WP9A 3BK7A 2AXNA 3IHLA 4X8OA 5EXPA 3R9WA 1DELA 1Q1EA 3QKUA 5JS7A 5ELXA 3QIAA 4P4TA 4XSGA 1GP2A 4C0QC 2ASEA 1OF1A 1ZP6A 2RHMA 4CDGA 3C8UA 2GK7A 3B5JA 3S1AB 3TR0A 5KPJA 3EPHA 1J90A 1GWNA 4NCNA 4FWDA 2N1BA 2H92A 1WBDA 1E2NA 5L3SB 1KKMA 1VHLA 2LWIA 2ZU6A 2H8KA 2HF8A 4KAXA 2R62A 5GJCA 4H1UA 4QRHA 4DVGA 4CT5A 3LFUA 2CVHA 3K70C 4D0NA 1LVGA 2IXGA 4Y0AA 2W2TA 4LZZA 1VG8A 2CK3A 2WPDA 2ERXA 3CLVA 5G41A 2YWGA 4NCIA 4HDQB 2AK2A 3T1TA 1TF7A 4DEXA 5AJYA 3CRQA 3EZFA 5AR1A 1UPTA 5DHAA 2FE4A 4B3DA 3KDSE 1OKKA 2VP2A 2YVUA 3EA5A 4LYHA 1M2OB 1R6BX 4EFMA 4FWIB 2D74A 1W5TA 3MGCA 4LBVA 4UJ3A 5LB2A 4HLQB 3OEHA 2B7BA 4Q1CA 1Z2AA 2Q21A 4TQ9A 3UKDA 4EKDA 4B76A 2VHUA 4QXAA 3LQRA 5AUOB 3AF1A 3MG9A 3O8DA 2ZRIA 1XBTA 3K0EA 1L8QA 1EXMA 2JIZA 5SZHB 3AVWA 3RRNA 3THOA 3FMOB 3WP0A 4ITRC 2PJRA 1E2GA 3TQFA 4RJLA 1MRSA 1XEWX 2B6HA 3N2IA 2B92A 1P62B 3AKYA 4DT1A 3DOFA 4RY2A 2E87A 2GXAA 3QXCA 3A6PC 3KQNA 4QNMA 1VYTA 2V6JA 1NVWQ 4JLBA 1TQ4A 1DOAA 4HZUB 4JYBA 1CRQA 2VEDA 4MRNA 4ERNA 1OFUX 1OHHA 1UFQA 1UBEA 3K9HA 4PC2A 2CLCX 4UNRA 5DLQC 2BMDA 4WXPA 1JECA 2VP4A 4Q00A 1OSNA 1M6NA 1G17A 3IGFA 1ZCBA 4B3CA 1SVWA 4JLMA 2FN4A 4WZAE 1XPOA 3LW8A 4CEIA 2DWQA 3T1OA 3AB3A 2DB3A 3TK1A 1KDTA 5LPNA 4Q4HA 3EPJA 1U9IA 1LFDB 2CCKA 3I8XA 3VKWA 1E9DA 4B35A 1OYWA 1Q44A 3IO3A 1NSFA 3T1QA 2QEQA 2JJ1D 4GZLA 4Q47A 5CM8B 4QHYA 4KLZA 2MSEB 1AS0A 2ZRFA 3IEVA 1EFHA 3I72A 3A36A 3UANA 4Z1MD 2J7PD 3QKRB 5BYJA 3R8FA 2JGNA 1JR6A 5H70A 2YINC 3RS5A 4JT4A 4RKFA 2JLXA 3ZIAA 3S1AA 2XTZA 1XB2A 4LGMA 4YMVA 5JRJA 2BOVA 4Q4AB 5KNDA 5L3VA 1SVIA 2RAPA 4Q18A 3EZ9A 3PUYA 1D6JA 2ZJAA 1W0JA 1NJGA 3MHVC 1I2DA 4TSFD 1TTTA 2HT1A 4G5OA 3HPRA 3K09C 1T0HB 5JLJA 1KYIA 3LA6A 1RJ9B 4G01B 2ATXA 3H4MA 2GEUA 4TL7A 1NIPA 1J8YF 1ODFA 4HSEA 4YONB 1HV8A 4YXWD 1NI3A 1E2DA 1WF3A 2VP6A 4NU0A 4EJSB 4DCTA 2OEPA 2QQEA 2R6AA 1DAGA 1P9RA 2VSXA 3K0AB 4PSAA 5KUTA 2BMJA 3SQWA 2OV2A 3AP1A 1E0AA 1L2TA 4NHOA 2C04A 3K9LA 2ZS9A 2WIBA 2DFLA 1LY1A 1TX4B 3GLHB 4MDFA 2ZRMA 4G5RA 4LBZA 2IL1A 1KZ7B 3CH5A 5HKKA 3HP1A 1LF5A 4CEJB 4C0KA 2OAQ1 3P27A 2NIPA 2GETA 4DWJA 1YZGA 1FW6A 2X77A 4FCWA 1QHHB 4TLCA 3RS3A 2ZYTX 3RC3A 1A1VA 2VRWA 4H1VA 3THYB 5DE3A 4TMKA 1L7VC 3K1JA 1N6RA 1VG9B 4PQRA 4RSGA 1ZRHA 1GIAA 2CL6X 2E1RA 1UKZA 4N3NA 3M4YA 3BIFA 4CEHB 1S3GA 3KUCA 5AUNB 3QSYA 1OXSC 4GMXA 1S9HA 4HZUA 1TU4A 4DEYA 3DL0A 4FMCF 3RYTC 4N0DA 4AKEA 4O3MA 1O3YA 2F1IA 2PBRA 3EC2A 2HLDD 4LHVA 1VG1A 2IWRA 3L0OA 1ETUA 3C5CA 1BO6A 4AURA 2ZI6A 1Q21A 5DNYB 4M9XA 4QNRA 3QF4A 2IEZA 2JLVA 4R7ZA 3WYAA 2NO6A 2ZYWX 4HUQA 2IXFA 2CL0X 1K6MA 1US8A 4RZ3A 3LDAA 3ZH9B 1CEEA 2W2XA 4JZKA 5FFMA 3SYKA 1SVOA 4IW3B 2C78A 4LBWA 3Q85A 3Q3JB 2OESA 4PTLA 1N5IA 3T35A 5TDHA 2B8TA 2V9PA 2BHRA 2WKQA 3TVTA 3DPUA 2FPLA 3QKRA 2VF7A 1W2GA 2GCPA 3B2EA 4MGYR 3WYGA 1ZC3A 1TEVA 2XITA 1W49A 4JLDA 2KSQA 4WOPA 1QVAA 1E0JA 2AL7A 4DCUA 1OFTA 4A2QA 2ODBA 2ZYVX 3LVRE 5HTKA 5FPTA 1VYUA 4RD4A 4LRTA 4PAOA 3QJYA 3DZ8A 5FBVB 1F3OA 4Q1BA 3ZDQA 2QMHA 3P1JA 4C4PA 3HJNA 5CITA 4DJTA 5H8WA 4RZUA 3BWDD 3KXLA 1Q57A 3KZ1E 2GBLA 4L5BA 3KUDA 4JL5A 4RD3A 2R9VA 5G3ZA 2ZJ5A 2QP3A 4P31A 4Q1EA 3PITA 2AFIE 2G6BA 4MUBA 4TWZA 1ZNZA 3CX6A 3NXSA 1A2KC 1NBME 2QBYA 2DZNB 1IJFA 3KFVA 4EDHA 3K0AA 3KFXA 5H1YA 1W44A 1F2TB 2ZRPA 3X1ZA 1MRNA 1YZKA 4A15A 3VKGA 1RIFA 4B44A 2AKAB 4WA7A 1RRPA 3QG5A 1IN5A 2FPKA 2QMEA 3ADCA 4CEJA 2FA9A 4JKYA 4OJKA 3ZS8A 1XPUA 1GL9B 4X8HA 1SHZA 3LW7A 4YMTA 2R2AA 3KQHA 5CDFE 3DM9B 1RRCA 1D2EA 1KK2A 1NL3A 1MO6A 2IYQA 3OAAD 4PPGA 3WXMA 1G16A 2E9SA 2FFQA 4RD6A 3THYA 1NLZA 2QAGC 4HATA 2C98A 3SJZA 3SOPA 4O0MA 4KYUA 1KOFA 4A8JA 2ZSBA 4JL6A 4DLSA 2BBSA 2VHJA 2OXRA 3BGWA 4MUAA 4WAUA 5C4MA 2PZFA 2KRKA 2KWIA 4P3YA 5FL3A 5KTYA 4KFSA 1PLKA 2ZSDA 3AVXA 2RGNA 1XRJA 2KBFA 4PAMA 3MWJA 1J99A 1ZM7A 3NBZC 4QHSA 2D4HA 4RD0A 1FUKA 3QF7A 1HH4A 1EWQA 5C4GB 3H2YA 2RHDA 2Z4RA 5F3WB 1GNRA 1UDWA 3KXKA 4B32A 3UXMA 5FPSA 4PC1A 1FP6A 3TIFA 4QC2A 1HT1E 2GZHA 3B82A 3K9GA 4AIIA 4LOAA 4NYIR 1KO1A 3OEED 1QZMA 5JEDA 5C46F 4BFVA 4B6EA 2OLJA 1XWIA 2EFDB 2DHRA 2RB4A 4A0RA 2YKGA 3FTQA 4GRAA 4PXAA 3AGPA 4PC7A 4GOXA 5L3QA 1PLJA 3I4LA 4JLKA 1TNDA 1W4BA 1F2UA 1NNEA 2C9YA 4JN6A 4ZCMA 2JAQA 4KBFA 3CX7A 2ZRHA 1GTVA 5DYIA 2ZAMA 1L4YA 2ZS7A 5FTLA 2A5GA 3RHFA 2YV5A 2HYIC 3C16C 1UKVY 1KI8A 3BE4A 2C2HA 3I73A 1T5IA 2DFTA 2Q9CA 3LXXA 3TAHA 4PSVA 5GJVC 4HYYA 4M1WA 5JJIA 4NONA 4UNPA 1G3RA 3FHCB 1DO0A 4QJ4A 1DTSA 1EX7A 5EP3A 2PMDA 2FSGA 2WV9A 3OIUA 2XXAB 1P6XA 1UADA 3QBTA 4XVRA 4EPRA 3LD9A 3ZVLA 1CF4A 4GOKA 5D3MB 4DSNA 3RC8A 3PFIA 3PEYA 4AG6A 2FJUA 4Q66C 4GL2A 4LHZA 4BLTA 2WJGA 4P4UA 3WRXC 3GQBA 3W34A 1NKTA 1Z83A 4HEJA 2O8FA 2FH5B 5E7JA 3NG1A 3N5CA 3CPJB 4BFTA 5G40A 2C8VA 2EFEB 4XWKA 4IOKA 2GESA 4LJ4A 4EPYA 3BC1A 3UG6A 2IYSA 4QGHA 4TYPA 5KU1A 3VR3A 4AI6A 2KB0A 4M53A 4ESHA 4FMBB 3CIOA 1A7JA 3X1DA 5JCZA 3FOZA 3MWLA 3QUSA 4OHZA 3V00A 1U98A 4BLSA 4GDFA 4LV5B 4JLPA 4PC3A 4Q03A 4TMVA 1YR6A 3W90A 1NBMA 4QG7A 3EWSA 3UPUA 3B1ZA 1E4VA 4A3VB 3IDQA 2DZOB 3KKMA 4HLDA 5CJPA 3ADKA 4QGGA 2H57A 4MYTA 4AKHA 2FG5A 1X8KA 4I81A 1RW4A 4ON9A 4FXPA 3GJ7A 2WM9B 2IS4A 3PVSA 5C18A 3VR5A 2UVQA 1N3BA 3GD7A 2V4ZA 4UJ5A 2QI9C 1ZC4A 3SFVA 1KI9A 5CDFA 3E1SA 4URVR 3VHLB 5AWFC 2F1RA 3K0FB 4CRWB 1E9AA 3TAUA 3EXAA 1II9A 3EPKA 2ZXUA 2N42A 2VO1A 2QP9X 3QPWA 4A4DA 5H68A 3VR2A 1VIYA 1X37A 2YWHA 4IVRA 5E7IA 1R4AA 1Y63A 3RWOA 2WSSA 3QPVA 1NIJA 2DY1A 3PJRA 3VNUA 4B73A 2X2EA 2ZJ8A 3K0SA 3NBXX 4ZDIA 1NKSA 2F1HA 4UXHA 3K8YA 5BWMA 5FOUA 1FZQA 3TH5A 3KTAA 2G3YA 1ZU4A 1XMIA 3DKVA 1VCNA 3FWYA 4PQFA 1HQYE 2V6ZM 1S9DA 1ZU5A 2W83A 4HZIA 4Q4JA 3V9PA 1CKEA 2V55B 2DVWB 3WMFA 3EX7C 1WA5A 2C9OA 3PEWA 1G7CA 1E2KA 3Q7QA 2PL3A 2RCNA 2NOAA 1KZGB 2WMOB 3REFA 4M8NE 1Y3AA 1N6OA 3H84A 4ZIRB 5G3YA 2BBTA 4DLRA 3LBHA 1SXJD 3CZPA 4O25A 5D3MA 1JNYA 2GF0A 2ZI5A 2GBLC 3QEOA 1PV4A 2DBYA 4KYIB 4IEIA 5E4FA 3CR7A 4P33A 1QBKC 4B75A 2NZJA 2A5FA 3SJBA 1B0UA 1TUEA 1YE8A 2AKYA 3I8SA 4NYJR 4EJSC 4F91B 5KSYA 2EFCB 3W9YA 2JATA 2G88A 1G6HA 1IOZA 2J1LA 4TTRA 1JJ7A 5K8IA 3AVYA 2R6GA 3CWQA 3U44A 2MSCB 2Z0MA 1GRRA 2I1VB 2OT3B 2ZREA 3GFTA 1FX0A 1K5GA 3QVUA 1XXHB 1GKYA 2JA1A 4OK5A 4E5UA 1KIMA 4HAUA 3DMDA 1CLUA 2VSFA 1S96A 1LS1A 2WWIA 4G0NA 2MSDB 1P60A 1GKUB 1U8ZA 2PCLA 4PR0A 1XPRA 2ODNA 2P65A 2ZJ2A 4NYIQ 2D62A 1X1SA 2AD5A 1KAOA 2A9KA 4FMDF 3AKCA 5IDVA 3U4QB 4LJ6A 1MO3A 4QBFA 1GOTA 1IN7A 1JQJC 3FYHA 4PHFA 3TNFA 4KO8A 4AYTA 3RRMA 2VA8A 4BEBA 4NCHA 1ZIPA 4L9WA 4EFNA 3RS2A 2NO1A 1SXJB 2ANBA 2DWOA 3K09A 1E9BA 4P0TA 3ZQ6A 4R9UC 1OIWA 3NKVA 3SFZA 2BJWA 1Z0DA 1N5LA 2ZQ5A 3K0FA 5JJKA 1VMAA 2GTPA 3KL4A 1SVMA 2GCOA 1U0HC 2ZR9A 4V0LA 3E70C 1C9KA 3C41J 1N6PA 3W6PA 2ORVA 2GILA 3PEVA 3AUXA 1UM8A 3DOEA 2FX3A 2GAOA 4DDWA 4Z51A 3KKPA 1I4LD 3JVVA 4EPWA 5DN6D 1HE1C 3LNCA 721PA 3O8CA 1Z3IX 4JIMA 1NN0A 5IK2A 5BQ5A 1OH7A 1GG2A 4YLGA 4Q1FA 3Q5DA 4DC9A 2O8EA 4PFSA 5LDDC 2DYKA 1OHHD 1ZNYA 1MV5A 5GADl 1D2MA 4PPFA 1H8ED 5FL7D 1N6NA 1XP8A 3MRSA 4D4JA 4KITB 3NHBA 1P72A 5TMPA 2QAGB 2QTVB 2ZPTX 4BQSA 1X8LA 4DIDA 2PT5A 1T6NA 1K5DA 2OFOA 4JSYA 1AS3A 3IKJA 3U2QA 4BFUA 2JDID 1AM4D 4US1R 1CXZA 2ZVQX 2BM0A 4QJ3A 3BB4A 5P21A 4ZIRA 3VHXA 2IA5A 1KI7A 3KQUA 2HYDA 2EQBA 1G8PA 2X2FA 4P32A 4D81A 1M1YE 4TL9A 4A1FA 2F3TA 3T1VA 1R5OA 1G7TA 1NG1A 2J3EA 2PEZA 4LC1A 1TF5A 1G7RA 4EIWA 2F43B 3KB2A 2EFHB 4OI4A 1KI1A 1QHSA 4JVSB 4IFBA 2ORIA 3H1TA 4ZCLA 2J41A 3ZIAD 4L9SA 3NC1C 2YOHA 1NP6A 5TY0A 1RVDA 2GVDC 2UZ3A 4LHYA 1XJCA 1XEXB 4QGFA 5FPKA 5JMTA 5AK0A 3A37A 3F3YA 1M7GA 2WJIA 3KKQA 3CRW1 3KJHA 4EPXA 2D2EA 1FPMA 4A2PA 2RGGA 1E1QA 4UNSA 3NDBB 1I4DD 4TQAA 2XJ4A 5JCPA 3K0CA 1E98A 4MDEA 3RSOA 2J9RA 2QTHA 5FTKA 1OV4A 4JBYA 3EC1A 2GJ9A 2IYVA 1XMJA 1QF9A 3R7WA 1E6CA 1NMXA 2ZI9A 2CEAA 3NBFA 3REGA 3U4QA 5GJWC 4HLUC 2QUZA 4NE2A 4OI1A 5EQTA 1G5PA 1U8AA 4JS0A 3P32A 4U02A 3U6KA 1R2QA 5KDOA 2XEXA 4TLDA 4B2IA 5J47A 4P4SB 4BFSA 3K53A 4KHZA 4B34A 1G8HA 1TL7C 4MKFA 2ONJA 3BD9A 4YQFA 4LYAA 3VMFA 4FINA 3M0EA 4KU4A 621PA 4M0LA 1XJQA 3HR7A 1YVDA 1Z07A 4OI2A 3WBJA 1HURA 1IXSB 1E2MA 1VECA 3AKDA 2XOKD 3KQKA 2CVFA 2ODWA 1II8A 1W46A 3AF2A 2GKSA 4F38A 4R71A 4LDJA 2P3SA 3FMPB 4IRUB 2OBLA 3B1WA 2NO0A 1ZCAA 3KX2A 4OHVA 3LQQA 1XTRA 2RGXA 2O8DA 5CYPA 2PZEA 4PPQA 2CBZA 4XTCS 2ZR7A 3FKSA 4RD1A 2ZYUX 3VU9B 3RS4A 1KO7A 4LYJA 2QAGA 2NO7A 4IVPA 4LJYA 2I3BA 2J59A 4LUCA 1OH5A 3B8HA 1YR8A 4B33A 5AJXA 2QY9A 3SJCA 4ZO4A 4NYJQ 4LC0A 1KK1A 1UKEA 4JLAA 3OHMA 2VHQA 4JJZA 5EE5B 1OXXK 4Q4LA 5EE0A 1JR3D 3X1XA 1FP7A 1DPFA 5JI3E 4LJAA 1T8TA 4CZ2A 3ZD7A 1T3LA 1Z0FA 1Z8FA 1GL6A 4WZ6A 2CDNA 2V7QA 1P7CA 2XAUA 2OXCA 1SULA 2IYXA 3PCRB 1YJ5A 2PT7A 5AJVB 4FWTA 4MGIR 2LCFA 4RCZA 1IN8A 1NY6A 4II7A 2XNDA 2Z43A 3K9NA 1LF0A 1RC8A 4RVCA 2H5EA 2RMKA 4G5GA 2B7CA 4NTZA 4UXJA 1SKQA 4PHGA 1UKYA 2ZI4A 1KSJA 1CULC 1W36D 1QHXA 2YYZA 2QENA 1KGDA 2PEYA 4UKDA 2HV8A 4S2EA 4CGZA 1KDRA 4O2RA 3U7GA 5FBRB 2KJQA 1E3MA 1P4SA 3ZZUA 2IUTA 3DM5A 4B3BA 2P5SA 1KO8A 3FGNA 3RABA 1E2HA 1JAHA 2WWGA 1KMHB 3CPEA 4OQMA 1XX6A 1LV7A 4C9BA 1P2UA 1U99A 4GP6A 4DLYA 1EFRD 2QE7D 2FMXA 1P2TA 4OI0A 2G1KA 1ZW6A 2OO7A 4DDTA 3GLHE 1FQKA 3WNCA 1EESA 4CIDA 2P0EA 3EG5A 2ZETA 3GJ8A 2WKPA 2ZR0A 1RFLA 2PX3A 1DAEA 3WHLA 2EYQA 3ZZ0A 4BFWA 5L3SA 3RSLA 1E2JA 1XF9A 3MWKA 1WRBA 1KY3A 3M6AA 1N0WA 2HDNB 1TU3A 2HCJB 2JLQA 3KXIA 4W5HA 1VKJA 3CRMA 3L0IB 5DISB 1Z08A 1W5SA 4NCJA 1TF2A 4HB3A 1XJ0A 2XX3A 2D7DA 4KVAA 3IEUA 2J5XA 4XWAA 1NVXQ 5DH9A 3AVUA 5FH9A 1R7RA 3EIQA 2OE2A 4HB2A 1N25A 1HA3A 4Q5IA 1G4UR 3BB1A 1OFHA 4KFRA 3WBKA 3T12A 4FIDA 1Z6AA 1Q3HA 2ZRGA 2VYFA 2F6RA 3VU9A 2EWWA 2OZEA 2VF8A 3QBVA 1GDDA 1ZD8A 1GUAA 1D5CA 1KJZA 2O5VA 5BXQC 3LAWA 1ZNWA 1AGPA 2D06A 3QG1A 2QG6A 1E1RD 1OLOA 2DFNA 5J4LA 1AK2A 2XSZD 4PO1A 4CVNA 1GVNB 2WBLC 3BFKA 4U5XA 2NTYC 2ZRCA 1Z22A 2C95A 2GJSA 4XD7D 3GLGB 2WAXA 3KB1A 1E96A 5DI3B 2JEOA 1KSGA 1XTIA 1PLLA 5EUMA 3EA0A 3UIEA 4YMUA 521PA 4XIGS 1J2JA 2RGEA 4LSGA 4L16A 4OQXA 5CLLA 1W0KD 4OHXA 4O2LA 5CIWA 3IBYA 5KSZA 3LBNA 3P26A 2NQ2C 5FOTA 1F60A 4BLQA 2GHIA 2QMUA 4LK2A 2WMNB 3U5ZB 3IQXA 4PO9A 1TEXA 4XSHA 1Q1QA 1KDPA 5J4VA 2FFHA 3Q9LA 2VPPA 5SZKB 3D7MA 3M1IA 4U00A 2IYYA 2QT0A 1E2IA 1Z28A 4CW7A 3UG7A 3GJXC 4KODA 4DLVA 4BPBA 1MO5A 2ZE7A 2FGKA 1TQ6A 3GJ4A 3K0CC 3SEAA 4K8OA 4N1AA 4D26A 2CMKA 3PENA 5KDLA 2PX0A 4NZYA 1KJYA 3HDTA 3UMSA 3BS4A 1ZNXA 2GXSA 4TLAA 4GZMA 4NL4H 2QPTA 2R65A 4F7WA 1OH8A 1OFIA 2IYLD 2NZ8A 4Q4AA 4OKSA 5KNBA 4QHTA 4PZYA 4C3ZA 1G8GA 1JALA 1XTQA 4R98A 5EE1A 5FR1A 3EPLA 3OE7D 4BZXA 3TGPA 2RH5A 1DVRA 3NEYA 1HY3A 1Z0IA 1SXJC 3HU2A 3R9IA 1M34E 4DLWA 1RJ9A 3B1VA 3L2OB 2WOJA 3FKQA 4YMSA 3ND8A 1H8HD 3GLIB 2BJVA 3W5IA 4NBSA 2WTUA 4EJSA 3CB4A 3TSWA 4B48A 2BM1A 2Z83A 2JLYA 5HR5A 1CIPA 2CJWB 3A1TA 2HCBA 4YC7A 5L8VA 4B3XA 3GLHA 1R5BA 2QAJA 4EPTA 5BW8A 1NRJB 1E94E 1QG4A 2W58A 4MRPA 4W7SA 3G0HA 1FL9A 3BAFA 3W6NA 5IF9A 2P2LA 1QHHA 1LB1B 4ILEA 2BEJA 1KAGA 3IHWA 221PA 4YDHB 3K70D 1XFAA 1FMJA 4B2LA 2OG2A 1EG7A 4BFYA 5KSOA 4GFDA 3CONA 2QM7A 2RGBA 1QHNA 3AEZA 4TTPA 5GVSA 1E2FA 3THWB 4CEHA 3AF3A 1S2MA 3ZJYA 4M1SA 2ZRBA 2J0VA 5DI3A 1ZM4A 1YKSA 3DO6A 4DCVA 2ZUDA 3NTUA 1T0JB 4TSFA 2UZIR 4LPKA 2WSMA 3TE6A 1IN4A 1AGRA 4JLJA 2W0MA 4M1KA 3GLFB 2WJVA 5LD2B 2IXEA 1BYUA 4DDUA 3RNLA 1QRAA 3U3JA 4ZDKA 2FEOA 2P6NA 4ASUD 4JLNA 4URYR 4EQ6B 3AVQA 3HR8A 3SBEA 4PHTA 2ZROA 3L8ZA 4M9ZA 3UMFA 5CB6A 3IIJA 3QNUA 4HAYA 821PA 2HXSA 5BYKA 3GPLA 1ZJ6A 2QMOA 421PA 2IX3A 1TQDA 2JLRA 3C5HA 5AUQA 5HZHA 5IRCD 5TARA 4LJ9A 3UATA 2IWHA 1BKDR 4MRRA 4DZZA 4F4CA 5EXSA 2VL7A 5JHGB 4DB4A 1G8YA 2WJYA 1TMKA 3X1YA 5AUPB 3V4RA 5HCIA 3I3SR 4N0EA 5A0FA 1UAAA 1M7HA 1R5NA 2HJGA 3TBKA 1MO4A 1AIPA 4ABYA 1COWA 3TQCA 1IY2A 2V8OA 5JWHA 3TSZA 1OB2A 4D82A 1DS6A 5TV2A 2V3CC 1BMFA 4XOIA 4PQYA 4BFZA 2W6JA 4IKEA 3IQWA 4AC9A 1JJVA 3VQTA 4LX0A 1XTKA 4MGZR 2HEIA 4NDZA 4FMCB 5DGXA 3A58B 2HJVA 3ONWA 2LKDA 1F2TA 2IS6A 2W6ID 2CJWA 4XJXA 4ZKDA 4FD2A 1E2EA 3SYNA 5JSZB 4D25A 4GOJA 3R20A 3VR1A 5GJBA 1XD2B 4LHXA 2IK8A 2Z6VA 4QM6A 4MQBA 2O8BB 1BIFA 3AM1A 5CIQA 4IDQA 2WWHA 1AZSC 5EP2A 1J70A 1CJVC 5K8LA 2F3RA 2PCJA 2OBMA 2YWFA 3LWNA 4TT3D 1NVUQ 2F1JA 4K81B 2K5UA 4JLVA 1ZMXA 2WJHA 5J4YA 5BN5A 3LRPA 4J0QA 2EW1A 3THWA 2ZUBA 2ZRNA 3EAQA 2CCGA 2O0KA 4HLUA 1RRFA 4TL6A 4AD8A 1HEIA 4D0LB 2D7CA 4NYMR 2R6CA 3P4YA 4DCNA 2Q3HA 3G82C 5KPDA 4NP6A 4E22A 1Q20A 4YDSA 2ZJYA 1E79A 1NN3A 1X3SA 5JECA 2A5JA 4XVQA 2O8CB 3MAAC 2JJ8A 2QSYA 1S0UA 2REBA 3VR4A 3CX8A 1NVVR 4DLUA 4URXR 3CO5A 3W8RA 2ERYA 4BUJA 3B85A 4OQLA 3A4NA 4A6XA 5FBLB 3MFYA 3BB3A 4Q7JB 4EQ6A 3CWZA 4IOMA 1IY1A 3L8YA 2G0NA 5CK4A 3LLMA 2KI5A 1GNPA 3PG5A 2CHQA 2YZ2A 3I5XA 1YRBA 1P73A 2BMFA 4AG5A 1GKIA 1Z6GA 1XCMA 4E09A 2RGAA 4Q7KA 1WDTA 4GI7A 4LBYA 1NY5A 2CXXA 4B74A 5EJEA 3A4MA 1P9NA 1YZLA 2JJ2D 3ZLJA 1TAGA 3KJGA 3OAAA 4E07A 4MH0R 2GZDA 2PJZA 4FW9A 4RZXA 3SJAA 4DHEA 2QP4A 2XNSA 3TUZC 3DKPA 3OFND 1QDEA 4Q9KA 1FFHA 3U6BA 3U3RA 4C0LA 4G5SA 1YHNA 2AX4A 4G5QA 1DAKA 4GSYA 3L0SA 2ATVA 4RD2A 4V0KA 4DUGD 1MABB 1NN5A 3AUYA 4D4MA 3NIBA 1IM2A 3BFVA 3UWKA 1U8YA 1A4RA 2IHBA 1W4RA 1S1CA 3FE2A 1XXHE 5FUXA 1VHTA 1G3IA 1CR2A 5JS8A 3GCGA 1UBCA 2XXAA 4JVLA 4ZPXA 1U0JA 4HB0A 1IN6A 3CNLA 3KKOA 3PQCA 3KKNA 3NH9A 2JLZA 2ODEA 1JEEA 2ORWA 4IDNA 2VHCA 3A8TA 2DWPA 1C4OA 4MKIA 4RFVA 3SR0A 1E99A 4PAQA 4OHWA 1SKYE 1XNJA 2MMCA 1KI4A 3D6TB 3OEEA 4ACAA 2F9MA 2O0JA 1II0A 4BEJA 1EGAA 2H16A 1U90A 5CYOA 2O8BA 1SXJE 2NGRA 3TVDA 2QN6A 1BOFA 4POAA 3IIKA 1QG2A 1X1RA 5JZVA 3C4JA 3JZAA 4IHQA 1VIAA 2VBCA 2ZSEA 1SVSA 2CL7X 2OFWA 4OK6A 3PUVA 5JWOA 2Q3MA 1E4YA 1D8TA 1ZINA 3ICQB 4I1UA 2CK3D 2MMGA 3SHWA 2WPDD 3SNHA 4GT1A 1LS6A 4ARZB 4TLEA 2XZOA 3AP2A 1T3HA 2ONKA 3PEUA 4FN5A 3EIHA 2H1LA 2EYUA 4DBLC 3SE0A 1OKKD 1SKYB 4PO8A 1F48A 1NJFA 3EASA 3ZZTA 3MWYW 2ZVPX 3NEJA 2GF9A 3OESA 5FI0B 2V1XA 4LRSA 3OEHD 4IOLA 1A2BA 4LV6A 4H9GA 2R44A 3FKSD 1S3SA 2ZJOA 5JRZA 2ZRLA 3WYFA 2VQSA 2CE7A 1YZTA 2P67A 3GJ5A 2JIZD 2WWXA 2C99A 4IXNA 1XDBA 4QBIA 3CBQA 4IFEA 3O8BA 2NO9A 1JPNA 1IAQA 4IEEA 2XZPA 5FUWA 3WY9A 4M1MA 4C0AC 1G21E 4HUTA 1DBSA 1AKEA 4M1TA 4JBXA 3QKSB 2BKEA 2GK6A 4BZPA 2FZLA 2GDJA 1OJLA 3WMGA 4D4KA 2ZI7A 1SGWA 5B30A 2V7QD 3L43A 4F4IA 4HDCA 3SN6A 5KOYA 4TMZA 3L82B 3AP3A 3SHFA 1WE2A 1S8FA 1Q1BA 2XNDD 4ACBA 1NMYA 2FF7A 1ESMA 1DAFA 4S35A 2OCBA 1FNNA 4DIEA 1GM5A 3B6EA 2YNMA 3SQXA 5IT5A 2IYZA 2HT6A 2EU8A 2BVNA 2QROA 1KNXA 1VCMA 3B9QA 4MA4A 1EWRA 3GMTA 4NH0A 3TR5A 5CB8A 3ZVMA 5D3QA 3QXSA 1SHKA 1N6HA 1OYYA 2P5TB 3QXXA 3EARA 4M9SA 3RWMB 1Z0JA 1S1MA 3VTKA 4QKQA 4UNNA 3NH6A 4IXMA 2QT1A 1AZTA 4Q9HA 3NHAA 1PVOA 1XCPA 2BEKA 3PUZA 2H7VA 3SYLA 1HUQA 3W3AA 4QBGB 4TMTA 3W5JA 1B23P 4ZKEA 4EFLA 1VTKA 1UJ2A 4DT1B 4OHYA 1NF3A 2W2VA 1GFIA 5GVRA 2JLUA 2Q6TA 1XXHA 3DDCA 2ZJZA 2GEDA 4K46A 1W0JD 4OBEA 1TQ2A 4URZR 4WIAA 4ZI2A 1DG3A 1E2PA 1P2VA 2ZEJA 3FDIA 4MGKR 4QJ5A 1E9FA 5FOSA 1IY0A 2YOFA 1ZAKA 2QTFA 4Q9JA 1CU1A 4D2IA 2IYUA 4NCKA 4WXRA 3IUYA 3QPUA 2O0HA 4R2HA 4CEIB 1TPZA 4NPHA 1CJKC 2AK3A 1DEKA 5FPYA 4LY6A 1MKYA 1OW3B 4I99A 1RKBA 1RYFA 3WNBA 2BMEA 2Z5FA 1SXJA 4FCTA 4A82A 1UDXA 1OIVA 4NMMA 5HKKD 1DADA 3C7KA 2BIFA 1VCIA 3QI2A 5J5CA 1ZD1A 3GJ0A 4C0SA 4LJ8A 5EP4A 2GWHA 2GXUA 2XB4A 3I92A 3TUJC 3RLFA 5LD2C 1JXMA 1RYHA 1XTJA 1QHYA 2HXYA 3GEEA 3VLFB 2G9NA 2OILA 2A30A 4A0HA 4AWXA 1C1YA 1Z2CA 1E9SA 2KBEA 4M22A 3ZGXA 3CM0A 1W2HA 1KO4A 2BBOA 5K8UA 3QKSA 2ZIAA 1UBFA 3QQ5A 1KO5A 5KHOC 2QGNA 2YWEA 4UNQA 4MYHA 1YRAA 1G9XA 4BLRA 3FMIA 3L0PA 1KJWA 4OQFA 3ADBA 1GITA 1NSTA 2ZRAA 3PUWA 5EE3A 4BWYA 1KI6B 3JZMA 1G64A 3E2IA 1T3SA 2ZRDA 4W5JA 5EZ6B 3F8TA
chains in the Genus database with same CATH superfamily
2PVCA 4G67A 4PSKA 1BDIA 4FOPA 1CUHA 2QU8A 4X7MA 3F9CA 3DMRA 1H6BA 5JNRA 3DE2X 3FTFA 5FBWB 2OYCA 4AY4A 2HJRA 1JFVA 5FT9A 4KV9A 3OF2A 2XGJA 1H8EA 3ILYA 4I1PA 5KU7A 3KOUA 2G5TA 2PGAA 3D5EA 4B4DA 2VXOA 2YTZA 1AZLA 3G68A 1SOUA 1N5KA 2V7WA 4BRUA 2QR5A 4IJVA 4RM2A 3CSDA 2EGHA 1AK1A 2DPLA 3TTXA 2J46A 2J0EA 4TS4A 2NXWA 3P52A 4MQMA 1GL3A 5FNVF 1FJXA 2X2OA 1JJIA 2V4UA 4R9VA 2FPGA 4DZTA 1J9GA 3UH1A 5CPBA 4LXGA 1KPHA 5B58C 5EKUA 3O83A 1DARA 1V4NA 1O95A 1VIDA 4HMPA 4JFAA 1JXOA 1USKA 4QL3A 1WHSB 3E81A 2DR3A 2HL7A 4M99A 2C9CA 3U7QB 4QM7A 1PRYA 3AY6A 4G1CA 4MARA 1Z5PA 3EUWA 5KQGA 4F5YA 2E3JA 5DOZA 1JEAA 1JP7A 4BATA 1XMSA 5E95A 1G9SA 3N2KA 2PSDA 2DHQA 2QRJA 5DBGA 3U26A 4C2TA 3OM0A 3UXEA 4OQQA 3L9WA 1T91A 3KR9A 1SD5A 3GFQA 3J81k 5FUYA 2HDWA 2Z8ZA 4W8OA 2I1QA 3R5JA 1WQ3A 4RHEA 4RH1A 5AXCA 4MRAA 1YQ9A 2UKDA 5L40A 3PPXA 1NQTA 3H17A 5JD3A 3GLFE 4XBOA 2AR7A 3NANA 3FB4A 2R1VB 2ZIVB 2ERCA 4Y6SA 3PFWO 5DNAA 4O59O 2VJBA 3NBAA 4RCYA 2WF7A 2HRZA 4IJMA 3ZE1B 4CF7A 2G6TA 4KE9A 1ZVJA 5EMLA 3ORYA 5ITSA 2UU9B 2IW3A 4YRTA 2AHRA 2PUTA 2IEYA 5ILOA 4IIDA 2MINB 5SYAA 2XIQA 4KTTE 3GFBA 1ATZA 1QO9A 2POQX 3SQLA 4X61A 3LPMA 4TKUB 3FYUA 4M4SA 4LTMA 4HAZA 5HDQA 4X94A 3LMMA 3HKCA 3IVGA 1LNSA 3NT5A 1E2UA 1SOWA 3REOA 2YRFA 2P91A 1BS2A 3E61A 2AI1A 3R3UA 2H5LA 1TEHA 3QSGA 1QLJA 2I1WA 4XYGA 4P5PA 4RIGA 2C2WA 4P36A 4UQOA 3LCVB 2XBUA 3SZ3A 3QVVA 2NPIA 4EJFA 4P1ZA 2YFQA 2ZSFA 5E1BA 5I9MA 5CVTA 3BHIA 1HETA 4V0MA 1GGMA 1GRCA 1QHGA 1JEYB 1J2YA 3JQGB 5CP8A 1RT9A 4PRLA 1QUEA 5TT1A 1D2AA 4X1YB 1LVUA 1ORDA 4MVJH 4I1SA 1GPH1 3I6ZA 4WASA 2I62A 2XZLA 2WLTA 4HDRB 4OYHA 2VHVA 4GPZA 3AF4A 3U7EB 5IF3A 2HY7A 1E4EB 1UQRA 2GJAA 3PR1A 4TN1A 4CM4A 5JVDF 1NVMA 1AD2A 1TZJA 1ZS9A 3EVFA 5EWMA 3WWEA 4JI0B 4EJ6A 5DEIA 1DT5A 3MT8A 4DLBA 4LY9A 1I7NA 3KBOA 3IV9A 4NZPA 5AVTA 4ZT2A 1W4CA 3ESZA 3GIWA 2AXEA 3VC2A 1YB4A 1YNOA 4G0OA 1CY1A 1M3SA 2GVZC 3TKAA 3U09A 1RPZA 4IG4A 1ZX1A 1ZGGA 4G26A 1L5ZA 3KLPX 4ZXPA 1FYFA 4MV6A 3SC2A 4PE5B 3I5UA 2NW6A 2XA9A 3IRUA 2W6IA 5GIOE 4DUYM 3WHPA 1KSHA 3IILA 2LBPA 1U81A 1JZSA 1Z29A 3HDQA 4JI5M 2A7QA 4TT3A 3LT1A 2OC4A 1N5JA 1WKVA 4KXLA 5CD1A 2VAPA 1AJEA 2ZUTA 2PQMA 1LTQA 4ER0A 3FUTA 1VPLA 4Q37A 1USWA 4CTJA 3G6KA 1P5ZB 3PXXA 4R1LA 1TUIA 2LE0A 2HPVA 3U6SA 2WHEA 3Q11A 3SSNA 1AQUA 1P19A 2IYPA 3P9CA 4ZRNA 4KLNA 3CLSC 4X66B 3W3AH 1DDIA 2XUJA 4LFCM 5U9CA 2O8NA 2RD2A 1JKJA 4BNDA 1G3QA 4J1TC 4V0OA 4YS6A 2CE2X 1HE2A 1KEUA 4WUTA 5CJ2A 1NJSA 4URWR 4OXRA 3IOCA 4ZQBA 3ZDBA 2XMSA 1O94A 3VSEA 1V1RB 1ZOIA 3Q7SA 5JSHA 3RAGA 5KPJA 5JY6A 5L3SB 1P7YA 3S4YA 3KG2A 4DVGA 4LFBM 3WGQA 3HNRA 1DG9A 4UCXA 2X3UA 4KQJA 5ITRA 3T38A 4B3DA 1N2CA 1U9CA 1FLNA 1M2OB 1RPTA 4UJ3A 5LB2A 3OEHA 1EWVA 2ZUSA 3R0JA 2VZ9A 3ZCQA 2I2XB 4LY3A 3ANTA 3AF1A 3AVWA 4H7FA 1TLTA 1KETA 4ND7A 4YJFB 3U31A 2NO5A 3V8QA 4TRMA 2IJGX 3LPCA 4FUTA 4MRMB 1YA6A 3K6KA 4Q39A 4UD6A 1M6NA 3P2EA 2FN4A 2OR3A 3EPJA 3MUOA 4PRYA 3UJ8A 3L7AA 4KLZA 3ED1A 4XPIA 1U0TA 4WJKB 1V5IA 4EOGA 1P18A 3O75A 4PCZA 1BCRA 4G0WA 2SBTA 3SASA 1YZHA 1XZLA 2A9QA 3EZ9A 3MCWA 1N5OX 2PSHA 2B7LA 2GHTA 4D3ZA 3LBAA 4DYVA 3JQ8B 2Q4RA 1L2TA 1UP4A 1O6CA 2IX9A 4I08A 1NLUA 2OOAA 1V8ZA 1VG9B 1PNOA 3BMQA 1TU4A 4DEYA 3ZCXA 4G56A 4O3MA 1FYXA 2IWRA 3L1VA 1ZH6A 2V98A 5G1PA 5DNYB 4MPDA 4QNRA 5DBEX 4G65A 2IXFA 1AXGA 5KS2A 3C1AA 4LBWA 2O7QA 2NUPB 1NBIA 2FAXA 3ID6C 2YJ3A 2EKLA 2XRYA 3HWWA 1T2FA 4YRNA 1XNQB 2C54A 3TOVA 1XG5A 1TUBA 3PVZA 5KVVA 1VRCA 4UHCA 1CLEA 3QJYA 1SCAA 1CUXA 2ST1A 3P1JA 3CTWB 1RBMA 1VDMA 4OAPA 2MDTA 2GPJA 3VKGA 3T4XA 2AKAB 5FA8A 3QG5A 1PT7A 3BXEA 2CUNA 4JKYA 1GL9B 4YMTA 2QYSA 4OHFA 4RSRA 2QAGC 2EX1A 3HU5A 5FCDA 5BN5B 4WAUA 4RDHA 2CT8A 4PAMA 5FLXS 5BMVA 1I4EB 5LQNA 2C3OA 2X5KO 1I7DA 2W6NA 3MMXA 3K1AB 1N7JA 2C83A 4PC7A 4XD2A 4RK4A 4MIKA 1T2NA 1XLTA 3E3AA 3O92A 3BE4A 3I73A 3Q8XA 2CGEA 4RKUF 2LTAA 2NVUB 3THSA 3FHCB 2X76A 2H9AA 3W2GA 1CV2A 3DXZA 1M1XB 1TRKA 2XUPA 3HI4A 2QVZX 2JG3A 3U0VA 2MH8A 3KP0E 1ZITA 4AG6A 2YZMA 3MZ0A 4LF8M 3WRXC 4HKTA 1NKTA 4M60A 2BH9A 2R48A 3N5CA 2JEYA 4LJ4A 2Z2KA 3C3MA 4RNCA 4DCMA 4BV9A 3CIOA 1BGVA 3V00A 2C1XA 4J8PA 4Q03A 1AV6A 5A5FA 3D7SA 4HK4A 3SARA 4HDAA 5CJPA 5BQ3A 2DH6A 2H57A 3R24A 2WE8A 2HV9A 2XDQB 4P5EA 3WJ1A 5AWFC 4OPMA 4GM4A 1BXGA 2G40A 1V48A 4OXNA 5H68A 4N0PA 3S99A 5E7IA 1N2HA 1Y7HA 3VZSA 4JJ7A 2F1HA 2CP8A 1C3VA 4B6SA 1EJ0A 2A33A 2H2WA 1QCZA 3CLUD 4BNIA 3H3JA 4V24A 2PSEA 2GN8A 3RQSA 4DLRA 2ZI5A 1PV4A 3L6OO 4KT0F 4P33A 3AETA 2NZJA 1P5HA 3I8SA 3MQ4A 4KYTA 5F4BA 1KRHA 2OT3B 2JFVA 3O4GA 3AV0A 4EYSA 3AW9A 3NHUA 4UULA 5BORA 1YS4A 2HQBA 3A3NA 2AB0A 2NSYA 1WR1B 1R6UA 5HUJA 2VA8A 4D74A 1H0RA 4JKOA 2JC3A 3FCXA 1OIWA 2RAVA 2HJHA 2F5OA 5HX7A 3HVJA 1JB9A 4X97A 2CXRA 3O8CA 2GBCA 4AM8A 3FZNA 5KOHB 4PFSA 4C22A 3AWDA 3UGJA 1VZ2A 4HEHA 4DYHA 3MYRA 1W5EA 2C3PA 1TZKA 1IBKM 3IKJA 4AICA 1CF2O 2W70A 4NIMA 3MB8A 4U8GA 5I7RA 4BQEA 2EJVA 4FBLA 4PYMA 3OA2A 2B8NA 3NP9A 3C3PA 5ADUS 2BFBA 4EUFA 2WJIA 3KKQA 2GKOA 1H1TA 4H3HB 4D3SA 4IMJB 1B0PA 1MU0A 2J9RA 3UK1A 3EC1A 3ZU4A 4QQRA 4OQPA 2R96A 3KOZE 2F00A 1BU5A 4WQMA 3WLQA 2HOQA 5LLSA 2CWBA 3F92A 4ZOLA 5IZCA 4B9AA 1TL7C 3GDOA 3VI4B 3GRVA 2P3SA 3QI7A 2DMRA 1JIJA 1EFPA 4PPQA 3FKSA 5ES4B 4PIMA 1WS6A 4GP9A 5DT2A 4B46A 3JR3A 1KK1A 3F78A 1UKEA 3U4CA 1KOLA 5EE5B 1UBUS 3VH4A 3RADC 3P2IA 1XMQB 3DV9A 1U5BA 1L5QA 4X64M 2QTWB 2BW0A 3QLVC 5J2TB 1LX7A 2XMZA 1BFDA 1Y9JA 2J9FB 4ZO6A 5FHRA 3G0IA 3WTCA 3DZBA 3E7WA 3GFSA 1XX6A 4R2JA 1XL1A 1H2FA 1UOEA 4EY5A 5JJCA 1KJQA 3NDJA 1OILA 1LKZA 1N0WA 1S8AA 3RUAA 4W5HA 3RGWS 1M54A 3DVQX 3AVUA 5KYWB 1U9YA 4RS4A 4GYJA 3P2MA 5IANA 1M6VA 1EUQA 5CCEA 5LZ4A 2BE9A 3FNQA 1E2BA 1SIWA 3TWKA 1ZNWA 2ECOA 3L8GA 4D9HA 1DQPA 1AGPA 1CQXA 5J4LA 3R9XB 1OREA 2QQFA 3N76A 4OXIA 2B69A 1F38A 2Y71A 3KQYA 3KB1A 2FEKA 3B20A 3IXQA 1CFZA 4RPHA 2RGEA 3WLLA 1B26A 4RMNA 4H6WA 2H2IA 3IQXA 1JHRA 4AMYA 3Q9LA 4I5GA 3M1IA 3D6FA 5PNTA 3SEAA 3KLNA 2D8AA 3PU6A 3KZKA 1OFIA 5KNBA 1JALA 3QJ5A 1FJGM 1Z4OA 4IZOA 5C5CA 2PZBA 5HK9A 2OM6A 1TDJA 1RJ9A 4DLWA 1QGUA 2WOJA 4MP3A 1GYRA 4B83A 4HN9A 3KHSA 2Q6IA 3EGWA 5E3JA 2I0FA 4B8YA 4DIKA 1BJTA 2W58A 2QN8A 4J75A 4MRPA 4DWWA 3LRXA 2EJWA 5FF9A 5TMBA 3IHWA 221PA 3GJYA 4GI2A 2NAFA 4Z86A 3ZJYA 4WBNB 4M1SA 1ZM4A 5CCDA 3DO6A 2VA9A 1WZ2A 2UZIR 3F2IA 3HP7A 1DGHA 2PIDA 1LTMA 3H9CA 5EPEA 3CVYA 3SC4A 4PHTA 4L8LA 2QMOA 3FOBA 2JLRA 3RARA 5IRCD 3Q88A 5HCIA 5CT4A 1L4MA 3HBLA 3TSZA 3QEBZ 1J0XO 1QYCA 3AIOA 4OIMA 2OSVA 1R5JA 2V7UA 4IKEA 4CMEA 3GA0A 3JQ7A 2NN3C 4TV8B 2IP2A 3DTNA 2X6QA 4XJSA 4P7GA 5DW0A 4X7PA 3M5CA 1TCAA 2XGSA 2FPPA 3A6EA 3UWSA 1CUIA 4DR3B 3HHWA 1V9LA 4J0QA 1ECGA 1TGUA 1RRFA 1DLJA 3BHMA 1O95C 1P7VA 4AXXA 1OFUA 3P2KA 5F3WA 3TTSA 5TJ9A 1UXOA 3DT8A 3BB3A 1WLYA 2CFCA 3HY5A 2DHYA 1VL6A 4MVJA 4Q7KA 1NUHA 2Z1NA 2PJZA 4FW9A 1GUDA 1GXSB 3TUZC 1Z5BA 4L8VA 4CKCA 4FKZA 4D4MA 3U48A 2EUCA 2ZB3A 2RJOA 4G8JA 4NDNE 1N75A 4IH1A 3P9IA 4OHWA 5FWYA 1SKYE 2D5AA 4CJXA 2AJLI 1KI4A 3OEEA 1TYEB 3D4PA 2F9MA 3QWFA 2A9PA 4L6V6 3TPZA 3QKWA 3V3KA 2H16A 4RQTA 4ZI5A 4KQFA 3ZU6A 4DR7B 5HIJA 3U0BA 3O73A 5LNK6 1LS6A 4TLEA 1EUCA 3ZGVA 4CCAA 3OO0A 3ESXA 5FI0B 3BZBA 2EBFX 1GQFA 3FKSD 2ZRLA 5FPQA 1VPVA 3CBQA 1N2JA 3W8FA 2A8YA 2NSHA 3NYRA 3UFXA 4OP2A 2BKEA 4O2BB 1W30A 4QGBA 3MIZA 1Z36A 4RZHA 5IYZA 5DFAA 4ZVOA 5KVAA 4EB3A 3INTA 5K4GA 3IERA 2ZQYA 4DGSA 2OCBA 1FNNA 4JUDX 1L7XA 3FYUC 3HNOA 4J76A 5IT5A 2PS3A 2G5PA 3D64A 3VTKA 1P7WA 4UNNA 3JQFA 4CPDA 3W3AA 3U39A 4OHYA 4FD3A 3SR4A 2HLPA 5LA6A 1SURA 2OHVA 1I4WA 4I5SA 1DCFA 3BWEA 2Y4NA 1P2VA 3D7LA 5IH7A 4NCKA 2PYDA 3LT5A 2HU8A 2VK1A 2W4QA 1RIIA 2GI4A 3THRA 1B7GO 3AWIA 1RKBA 3HFJA 1SXJA 1JN0A 1T29A 1YA4A 3GLTA 1B0AA 1TZMA 2FW1A 1E9SA 5JBIA 3L7BA 1BTOA 1OU0A 4FLFA 4P38A 2CSUA 5KYXA 3H42B 4KKVA 4G37A 3RT1A 3JCZA 2PGLA 2ZT6A 1OXVA 4XIJA 3E4RA 1XCGB 2C2ZA 3CPHA 1RCFA 3K4HA 1GRNA 2WG2A 1CP2A 1I36A 1Z8HA 3B1XA 3K2BA 1CR0A 1N0VC 3A14A 2YWRA 1XWWA 3O8QA 2QSFX 4MRSA 3RS0A 5KNBD 2FP4A 4PNEA 4EF6A 3A6FA 5B53A 1F2VA 2JCSA 2R87A 3IIMA 5KPRA 5DTRA 2QIOA 3OTOM 3VO9A 4IHAA 1Y8GA 3I9V1 5B1DA 3DVSX 3Q41A 4WT7A 2JK0A 4PRZA 5K3DA 2PUFA 1IXSA 3NHKA 1R0WA 1E7RA 5H83A 1J0EA 1AQJA 2D0IA 4WZAB 1Q12A 4XB6B 1TT5A 4B6FA 2MSWA 3OQ6A 1S01A 2DUJA 4S1OA 3S6JA 4RZ2A 3H9JA 4OJNA 5KOJA 4OF4A 3PUXA 1T6XA 1Z9BA 1VE6A 4JVNA 4RZIA 2H17A 4HWOA 4N6GA 3WLPA 4M9QA 1U0LA 1M5TA 1CQPA 3STTA 3QPAA 1ZA1A 3L4EA 5B3AA 3G23A 3RVPA 2BD0A 3IUJA 4MUYA 2ZBGA 5ANRB 3UJ6A 2AFHA 4XJTA 4G1VA 3T94A 3R0IA 3CLUC 4TZ0A 3PJEA 3NHYA 4FEGA 1QYVA 3LTNC 1G55A 1O94C 1JH9A 5IKXA 4N8EA 3E53A 4LRWA 3NO4A 5IKPA 3HUFA 4DPKA 5E2AA 5LJIA 4V0ME 4YYEA 5HJ2A 4GMHA 3ADDA 5H3CA 5K3OA 1T2VA 2YBEA 1GZSA 3IFSA 3LC0A 3KM0A 3NASA 3GDHA 3OJEA 4H1WA 3IUEA 5F7OA 4E2FA 4CV3A 2LDBA 3K2LA 5IJAA 3RW9A 1V37A 2HXGA 2O7RA 5HF8A 1NUQA 3H0KA 2YUTA 1RLTA 3PHCA 4X60A 1CCWA 3WYDA 4DFDA 2JCYA 4LK3A 5F4ZA 4JI6B 3O94A 4OFXA 4LDNA 3VSCA 4GC9A 4TMXA 3F5FA 3MMNA 2LH0A 1C8BA 3BFPA 4KUEA 4XGKA 2PUCA 1TM2A 2I34A 4JV5M 3KQLA 2NUTB 3CR8A 4RLQA 1WSAA 2HLDA 4I1IA 3D2BA 2FDCA 1W48A 2J9XB 3M7IA 1HOTA 1W0KA 1E2QA 1Q1ZA 4DILA 1U9JA 3JQAB 5DCLA 2OLKA 2L42A 5CEFA 1PGOA 3VNBA 1DHRA 4YRFA 3D59A 3CT6A 3E5HA 2E82A 1D9XA 5DW3A 1QRDA 1NFRA 2OHIA 1VL2A 3IA2A 2NWQA 1BXRB 4WKNA 4URFA 1U7HA 3RTDA 3LSTA 4BZZA 1PNTA 1W76A 3U44B 1YHZA 4YMIA 1DNPA 1ZJZA 2HA3A 4KC0A 1P61B 4GKBA 1CJTC 3NIFB 4L3WA 4TYYA 1YR9A 4RQBA 4O2AB 3NXKA 4B17A 1H4QA 4YJKA 1ZZGA 5THKA 1XCBA 2ZYRA 3NBUA 3V8MA 3RTBA 2VATA 3R6TA 1U63A 1YR3A 3PEFA 5C8VA 3K6SB 4HLCA 4F3TA 4OGKA 2DWLA 1KEVA 3HHPA 3ORQA 4A10A 2ARKA 1YUBA 1UZUA 1DTEA 1N3YA 2NTNA 3WGNA 2YC4C 1T25A 2J0UA 1T24A 4HY3A 3AR6A 2G4VA 2FOXA 3E8SA 2RK4A 1YBVA 3OECA 2A3RA 3A7EA 4K86A 3RU7A 1GUYA 5KYYB 1SHLA 1KZHA 3IKVA 1IUOA 4UUOA 3PGKA 3R3XA 1MX3A 1EK0A 4RIIA 4LOLA 3L40A 3TXXA 2F5NA 2WG1A 4YJ2A 4HDMB 3RUDA 1YGYA 4XH9B 3E7PA 2OCAA 5AOAA 2J07A 4DSOA 4NZZA 3CW9A 1HG0A 2XKKA 4Q7JA 3N2EA 2KE5A 3TZ6A 1N2CE 3R7WB 3L3BA 3K92A 1SBTA 4OGWA 1XMVA 3E03A 4BBAA 2EKQA 2EHDA 4MWBA 4DV4M 4CDNA 3FPBA 2ZGVA 4OXKA 4FDTA 4BLPA 5IJ9A 2ZYDA 3TM4A 4R3WA 5CFLA 3EZ7A 5FBQB 5JI2E 5KVQA 2XB2A 3PDJA 1Y6QA 3PD7A 3DBVO 3HRIA 3ON5A 3D8BA 1V9CA 2R751 4BBPA 2H4ZA 1MO2A 4RF5A 4MWZA 3VC7A 1LWNA 2XUAA 2WAYA 2CCJA 5FYDA 2PH1A 2WHYA 2QZ9A 4JNKA 3DMNA 3AVVA 1SB8A 2PLRA 4CMJA 4RA9B 4HYTA 4IDDA 2LW7A 1Q0TA 3HP4A 4XSGA 3AFMA 2X8LA 2GK7A 3TR0A 2IDKA 1A27A 2I6TA 5A7FA 1ZOPA 3OM9A 3Q3HA 4LE1A 2Y0BA 3O5AA 1VP9A 5ENVA 1DBIA 3NTRA 3UAZA 3HE3A 3T3MB 1O97D 1NMSA 4FYVA 1DZ3A 3A0RB 3UT6A 5AHRA 5GWXA 1OLUB 2YVUA 5H9WA 3G85A 2Y0DA 4M3NA 1E5DA 4RXTA 1ID1A 2MYPA 1QR2A 2RGHA 3FMOB 3U1TA 2HPZA 3AR4A 2QW8A 4KJXA 3GPXA 1LRKA 3AFIA 2J67A 4JLBA 1CRQA 1U1EA 3RK4A 3F4BA 2CLCX 2G67A 1JECA 1TQHA 4B3CA 3LOUA 2HKJA 1P5JA 4LC9A 3R75A 4FOLA 3F7MA 3VKWA 4U2CA 1NW6A 1UJ5A 4OOEA 1KY4A 2VPTA 3LOPA 1X87A 4QXRA 3S1AA 3L77A 4N3BA 4XDZA 2O2JA 4L5JA 1NDQA 3MHVC 3USZA 1BWQA 3RAFC 2DJ5A 3TIVA 4B7CA 3C43A 4TTAA 4NU0A 3T3PB 4MVJF 4ZRDA 2OV2A 4NHOA 2XTJA 2YN4A 3CH5A 2O2IA 2WM8A 2B5WA 2OAGA 2HU2A 3FNIA 1L7VC 3K1JA 1QV7A 3SP1A 2D1FA 1VLJA 5HW0A 2VRCD 5KZMB 3PHGA 5AQ1A 2PBRA 3EC2A 2HLDD 3TM5A 2WMDA 3QYPA 3L0OA 2ZTDA 3GH3A 4D43A 2M5ZA 2GLXA 3DCYA 3QF4A 1XVUA 4ZWNA 1K6MA 3LDAA 3E2MA 2BHRA 4BQQA 4J2TA 4D44A 1JI3A 1OFTA 2ZYVX 1TH3A 2X5JO 4ZVVA 5E9JA 3QOYA 1EAYA 5IZCC 2X3YA 3KXLA 1A1SA 5KCMA 3U6PA 1W4ZA 4LKRA 2OHGA 4P31A 1XWFA 1N9ZA 5AVVA 1C3OA 1Y1PA 2XBLA 2BEWB 1MRNA 2B4QA 3VV2A 2DSNA 3H1GA 2FPKA 3GRKA 4X8HA 4J0IA 3KQHA 3WXMA 1G16A 1GV0A 3FNHA 3RFTA 3HB7A 4YP5A 1NWHA 1OAAA 1PLKA 1OTRA 3CXUA 1NXQA 1VBKA 3WADA 2QVLA 2YICA 3VNSA 4NDAA 3SZUA 3UKOA 2RHDA 2QJRA 3QMMA 4Y2RA 2ZJ3A 4QC2A 2DBZA 4UPVA 3O2SB 4ISBA 3H05A 5DZSA 5DBOA 2HRRA 5LA6F 3T52A 5L3QA 4MS4A 4JLKA 3M5WA 3GI1A 2C9YA 3UJ3X 2LR0A 1Z4NA 3I2HA 4F5WA 3RHFA 2A5GA 4RPCA 4PLCA 3VZPA 5EJ2A 3PRJA 5CBPB 4S3MA 5JJIA 1DIBA 4C6TA 3TI9A 4QJ4A 2YWBA 2PMDA 3OIUA 2GQFA 1Y6RA 3RC8A 3RSSA 5BQPA 3WTBA 4YCCA 5K0NA 1ZIDA 4DEVA 3CPJB 4P81A 5G40A 5TGDA 2KW0A 1DO8A 2WIKA 1IXKA 4M8KA 3X1DA 1RZVA 4OHZA 3Q8WA 2AFIA 1NNLA 2FK8A 3E27A 3HJHA 2WZDA 3ADKA 1GEEA 4W1SA 1X8KA 4H35A 1CY6A 1N3BA 3GD7A 1ZMTA 3ZLVA 3E1SA 4URVR 3ES9A 4PNPA 3R41A 5ISMA 4ZV7A 3R8XA 1MPTA 3SXPA 4IVRA 3GARA 4WX2B 1ENOA 1H23A 4L5CA 3QE2A 5B6JA 2P4QA 1RI1A 1OV6A 2UYCA 4M0EA 1WCIA 3HJSA 4FFPA 2R8OA 1QFYA 1U2PA 1E2KA 2CHFA 1JU4A 4QPPA 5U4XA 1PGQA 3W2TA 2GF0A 5D00A 2MTBA 4LXYA 4MQLA 3HYCA 4ES6A 2VWQA 3BHNA 5I01A 3NTLA 4IH4A 3EEQA 1QPBA 3OJWA 2WWIA 1LS1A 1J6UA 4TUYA 1PCXA 4WUVA 4LF4B 4FFRA 4KO8A 3WA6A 1P0QA 3QWIA 2C5FA 3L7IA 3UTCA 3QVXA 2ANBA 2FZCA 3ZQ6A 1JKMA 2OV1A 1N5LA 5LP6A 3E6AA 3K0FA 5CA0F 1RFGE 1SVMA 2FQQA 4TRJA 1CHDA 3TS1A 1UM8A 5IX8A 3FYSA 2P1RA 3JVVA 4DNXA 4HNGA 5AM2A 3S2ZA 2FR0A 1SEPA 2ZOSA 4B7FA 5IAKA 2F1KA 2JBAA 4ID3A 4YI5A 2V0GA 4NJEB 2YDYA 4CMEC 1P74A 4U9UA 3WNQA 5CPFA 4E5VA 4EIWA 4WDRA 3HA5A 4DCJA 1RCTE 4L9SA 3CE6A 2FDRA 1NPTO 4LHYA 1XJCA 1UZAA 4WEQA 4OGGA 3CRW1 3KJHA 3MTBA 4QPDA 1QWSA 1P5RA 4MDEA 2Z57A 2PQ0A 4AJLA 3AR3A 4S0XA 2QRGA 3NBFA 2PGOA 3VYRB 5DTMA 5JFOA 3D9QX 2NXNA 2VUIB 2OQIA 1A0OA 2FX2A 2GN4A 4H7IA 4GAEA 5GONA 2IIBA 1ACLA 4GX5A 1PE0A 1W46A 3TQHA 4UCQA 1OAIA 2XPCA 1OGIA 3DEZA 5JLJA 1NAHA 3I1JA 3C39A 1NQOA 2LZ0A 4B33A 2C2GA 4AIRA 5HRUA 1JE0A 1XYYA 2AN5A 1L8OA 3SIXA 3GPDG 3WR5A 4I14A 2P9ZA 3D7NA 4K1LA 3FZYA 4CLRA 5ES3A 3MWDB 2IV3A 2BHTA 1RC8A 4RVCA 3PIIA 1TVCA 1Z6PA 3FUVA 4P84A 2ZVDA 4RZQA 2QU7A 4RTSA 4OD0A 1E3IA 1QH0A 4NARA 4F6CA 4J2OA 3MOSA 1JAHA 3FRIA 2QRQA 2O01F 1EFRD 3AEQB 4OI0A 3NBQA 2GNAA 1AQIA 2IYFA 2P0EA 1J5EB 4ISCA 1ZIYA 3CKYA 3G1UA 3RSLA 3IBSA 4RJIA 4EK9A 3KXIA 2HIAA 4NCJA 1TF2A 5A71A 2PWYA 3U17A 4MDHA 4XFJA 1K4KA 3LX6A 5A5EA 1N8KA 2GASA 1TOAA 1C3XA 1HR0M 2F6RA 4DY4A 3CCCA 4PN3A 2PWAA 4X3PA 1E1RD 2DFNA 1V47A 4ZT6A 4R2WA 2NX2A 3DC7A 4X95A 4AQ7A 1PLLA 521PA 2GCGA 2XODA 3BRCA 3D6HA 1UWKA 4U2GA 2ID7A 3JQFC 1M6HA 5DN9A 5B5SA 1Q1QA 2XUQA 3QU5A 4I4IA 4KPFC 2UDPA 3WGIA 2YJGA 3N2GB 3STHA 2R45A 3OQIA 2PX0A 4BP3A 3DEJA 4NCXA 4XCXA 4L27A 2Y1LA 4YJ2F 1H2YA 4R98A 3GJZA 2L09A 2BMAA 1SXJC 1MOQA 5KNBH 3HZHA 3KKLA 3FKQA 4YMSA 5BSWA 1I7PA 2BGTA 3ONFA 4OQDA 3K1YA 4H08A 4IMRA 1R5BA 3FVWA 1W35A 3AR2A 1U2DA 1Q7RA 3G7UA 4YDHB 4IV0A 2Z5LA 3D2LA 4JI2M 4RAOA 2WV7A 1GPUA 3HYNA 1XRPA 1RS0A 4MVJE 3IBCA 3BXHA 2VT6A 1F8GA 1H4SA 3FCEA 5D3ZA 3RF6A 2H9YA 3CKMA 4DWOA 2ZYAA 3JYNA 2NV0A 3WK8A 3MJSA 2RAFA 3U3JA 2P6NA 4URHA 2H1VA 1FDTA 5WRFA 1O8BA 1T0PA 6PFKA 3RJZA 3VJLA 2XFTA 4HNAB 5AIBA 2GBGA 4REQB 5B37A 4L07A 2O3UA 3GFRA 4Y9UA 1GZHB 5A0FA 1OYVA 1L7EA 4K9QA 1IY2A 1M2VB 3R44A 5LLTA 1MC8A 2A6PA 2V3CC 2I3AA 4LX0A 5CX1B 4NDZA 5SY9A 5ICCA 4FMCB 3A58B 5EZYB 5TC4A 1SC3A 5EIFA 4NMXB 3B74A 4MOWA 2IITA 2JFYA 3R20A 4TZKA 3VR1A 5CIQA 3G2NA 13PKA 1VE1A 1CJVC 4YRCA 5A6SA 1MAUA 2YWFA 3LWNA 1T35A 2HH9A 5LFAA 3IVXA 5A4KA 2ZUBA 4CFZA 4NYMR 4DCNA 1GARA 4RF2A 4E3ZA 4KMMA 4Q34A 4E22A 3O6VA 4I6JA 1EVQA 3IPRA 5JAPA 1R12A 1O97C 3HUUA 2QZPA 1IFXA 4F04A 3OJOA 1UBHS 1Q2XA 4ENWA 2E21A 3W9UA 1V4VA 1YRBA 1P73A 1LW6E 2JJ2D 4CFSA 1QFJA 1U6KA 1FFHA 1EK6A 5L4LA 3BFVA 1K8YB 2I22A 4TN5A 1UOQA 3KELA 1FU7A 1Z12A 1IN6A 3CNLA 5F21A 5LIPA 1SY7A 1HFEL 3FZEA 2XQGA 1QIMA 3EFOA 3S2UA 1SXJE 1BOFA 1E7SA 2WG0A 3ZHUA 1RZRD 4JQSA 1QG2A 4M55A 5ALLA 4HVTA 4HGYA 2AR9A 3EVBA 1WF6A 5KJ6A 2OFWA 4R40A 4IIJB 3QMVA 4MJ3A 4QJIA 4GKKM 4GT1A 3QNMA 1OKKD 3NONA 1A88A 1V7PC 1A2BA 4H9GA 2R44A 1OPRA 4CJ6A 1GG8A 5COBA 4L7VA 2OV6A 2QYHA 1B14A 1DQYA 4XGIA 1Z5VA 3TF5A 3L25A 1ABEA 3HCRA 1CEYA 3MS7A 3WFIA 3DW1X 3X3HA 1LXCA 4YR7A 5H37D 3IQEA 3TTYA 4MWCA 1O7JA 1Z45A 1R18A 1DEHA 1XAHA 4QKQA 4R3UC 1JSXA 1C30A 3OIFA 1AZTA 1PR5A 3VTAA 1PVOA 1B23P 4BAGA 5B7QA 1XXHA 2G1AA 1VJ1A 1REQB 3F6CA 4URZR 2RI0A 5F23A 3A45A 3WKBA 3FDZA 2RB5A 4HRVA 2I7PA 4Q12A 2O0HA 2RFLA 2AC7A 4FCTA 4A82A 5EP4A 3NWOA 1RYHA 4GO1A 3GEEA 5FBKA 3JRNA 4IICA 3HHXA 3QKSA 2ZIAA 1STOA 2J33A 4AMGA 4LWQA 3FMIA 4XX0A 1XDGA 4QRDA 4RY0A 4E08A 3GJSA 4JGGA 1U8EA 3VPXA 2QZSA 4ATNA 2E55A 2AFHE 4UFNA 1OH6A 4ZQFA 1QE3A 5C52B 1N6KA 4UW9A 4QFDA 4YEDA 3DXYA 4EO9A 1CNEA 1L7NA 1PO7A 3AF0A 4YGXB 2O7NA 4OCZA 4W5NA 3SU8A 5L7TA 4EYEA 4OXXA 4RVGA 5J43A 4P4SA 4R2KA 2FW7A 2ZAOA 2PPVA 2IELA 3DMYA 3FUWA 5ECWA 2HQ1A 4LPSA 2QL6A 2R7KA 4BLUA 1D2NA 3BA6A 4I3GA 4R31A 3Q3CA 2NM0A 3ZQJA 3I9FA 1QS0A 3HO1A 4NF2A 2UXBB 1E0SA 1YJBA 3IE0A 3B1YA 5HE8A 2Y1XA 1GRQA 5DCUA 4OUDB 3ZD6A 1R0RE 1YMQA 3VAAA 2BWEA 4CIWA 4D5EA 3UWMA 2WSIA 2JASA 3WRVA 1V7CA 3O31A 4R01A 4WNYA 2XECA 5B7NA 2WIAA 2BKUA 3LI2A 2HCTA 3LU1A 3LUAA 3MWEA 3RYCB 3CLTC 1YCDA 3H2BA 2PDAA 3CUTA 4C4XA 1K92A 5KTSA 3VNVA 4Y6RA 5C1DA 3AKZA 3Q3IA 1PEAA 1G18A 4B45A 1EHIA 3BERA 4EY4A 1HFKA 2WW8A 2YUIA 2X42A 3BJIC 4FOTA 2PXXA 4RVHA 3HY3A 4Y3UA 2HRQA 4GQIA 4MV5A 3DQPA 5H80A 2NU6B 3P0JA 4JN6B 3NHLA 4DIOA 1QDTA 4TUYF 3V2GA 4UTOA 4KGVA 3QEAZ 3BMNA 4CCYB 2P8JA 4GLJA 4NECA 1S4QA 1IH8A 3DNPA 1E6LA 4NATA 2IEIA 3E22A 3RKSA 4MR9B 1R0BA 4NZMA 4OP3A 1E89A 1GZDA 5J2UF 1L4BA 5A4JA 4LSWA 3NBKA 4XWOA 2HK7A 3WBFA 3ZN2A 4JYCA 5TS2A 4F93B 1ZI8A 4CKWA 3SDSA 2OC9A 2O06A 3DT6A 3ZYCA 4GMFA 5F7XA 5I3ZA 2PM8A 4KFTA 5LQMA 1ZIOA 1TLLA 4PYNA 4H16A 4CKYA 4UBLA 3ZVKA 3QEJA 2W9XA 1J33A 1TVMA 1DG1G 2Z4TA 4FX5A 1L8AA 1GPNA 1WO8A 5B4TA 1NBOA 4NOKA 4DXAA 4KR0A 4DRXB 4EY6A 4QVGA 2RSLA 2P9CA 1ZCZA 5IJ0B 5DHSA 4HTFB 2YHBA 4TMFA 4KQIA 2GCIA 5JU6A 2RIPA 2J4FA 2R1TB 5DF1A 1WPGA 5DJ5A 3N05A 4BCDA 5TQ0A 3B48A 3RODA 5JCJD 3FMFA 2PLAA 5FFNA 4PF1A 1LDGA 1IEWA 5IJWA 2JGJA 3TLEA 1ULZA 1IBRA 2OBNA 2QG9A 1S2DA 2ZRJA 4LNUB 1N5RA 3ZHRA 4EHDA 4MVJP 1RI2A 4MRVA 1MW8X 2VP0A 3HGMA 3ITDA 2HN9A 3LLCA 6ADHA 3HWSA 1X7GA 3QFRA 5AVKA 4GR9A 4MW0A 3KOWA 2E7ZA 1W85B 4PZZA 3HDJA 4MB6A 2O8VA 3ESAA 3HKDB 3N86A 4U2EA 3FWHA 2V4MA 1JHQA 3OJLA 1FDSA 1N2EA 3OZ7A 4XGRA 4F92B 5IAOA 3V7FA 2CNOA 3W7AA 4H2DA 1E69A 3HXOA 3LK7A 5CM2Z 3TQOA 1G5TA</