3M0EA

Crystal structure of the atp-bound state of walker b mutant of ntrc1 atpase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
247
structure length
247
Chain Sequence
b'EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDAIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Engagement of Arginine Finger to ATP Triggers Large Conformational Changes in NtrC1 AAA+ ATPase for Remodeling Bacterial RNA Polymerase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 83
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3m0eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3m0eA01
3O8CA 5FUVA 3KUCA 2RGCA 2WICA 5KDDA 5EQTA 3QXSA 2BWJA 1W36B 4YXWD 4TTPA 2N42A 3FHTA 3CRMA 4QBFA 1SZPA 3X2SA 4DLVA 2L0XA 2NO0A 4PAOA 3GLFA 5KNBA 3EPHA 4EPVA 4HATA 3GLFB 2PLRA 2H57A 4QBHA 1NN1A 5LB2A 1D5CA 1XXHE 2JJ8A 4JLPA 4MDEA 2PT5A 1KAGA 1ZUHA 4ZDIA 3WP0A 3W3ZB 1MKYA 2BC9A 5JS8A 3RSLA 2GESA 3PUZA 5IK2D 1FP6A 4JVSB 4Q1AA 3T61A 2QTHA 5FBWB 3KW6A 2QQEA 4FINA 3DM5A 4JIMA 4RZ2A 3EIHA 3PFIA 2J5XA 3UWKA 5J4KA 2P6NA 3GFPA 4Q7MB 4BPBA 3TKLA 4P4SA 3R20A 2AFHE 5TDHA 1RRFA 5HKKA 2RHDA 4U7DA 4PZZA 5DI3A 2QQ0A 3D31A 4CVNA 1CJKC 3NDPA 2CK3D 5DI3B 5DYIA 2XB2A 3MRSA 3SBDA 3SJCA 1CRQA 4DCTA 3K09C 1Q21A 2XX3A 2UVQA 5IT5A 1N0VC 4US2R 4KJZA 4Q1FA 4AD8A 1HT2E 2ZAMA 1ANKA 1S8FA 3HJNA 4C0SA 5JWRA 2VP5A 3VR3A 1EG7A 4HLDA 4E03A 3GPLA 2EFGA 3U6KA 3VQTA 2YV5A 4PC2A 1XD9A 5B2ZA 4EPWA 4C0LA 1HYQA 1N6IA 4NP6A 4RKFA 2OEPA 2REBA 3V4FA 2VHCA 1P9RA 3V9PA 2R2AA 4UNSA 2ZSEA 4B3FX 4GOXA 3SC3A 1N6LA 3ZS9A 1E94E 3LVQE 2XTMA 4RFVA 3C16C 8OHMA 2GA8A 2ZREA 1XZPA 3BIFA 3SYLA 4RD3A 2IC5A 4Z1MA 4CF7A 2P2LA 3GLGE 2ZYTX 5GJVC 5EXTA 3K9HA 4A92A 3LBIA 3AKDA 3DPUA 4OJQA 4DZZA 2IX3A 5IRCD 2PJRA 4TYNA 1R4AA 4BLOA 3CX8A 1ZD9A 1RPZA 4JJKA 1E1RD 4BASA 5KUTA 4UXJA 1B23P 2FPKA 1FX0A 1TMKA 3Q7QA 4A2QA 2VF7A 2ZRGA 1YR8A 1FX0B 1OIVA 1RJ9A 4Q1EA 3GLHE 1RJ9B 4GFDA 2JLSA 4AK9A 4PPQA 4DLRA 3RRMA 2FPLA 3WHLA 3U2QA 4XWOA 3K1JA 3DHWC 1XBTA 4G1UC 5E3HA 1Z0DA 2JLZA 4A36A 3T1TA 1KI1A 3QXJA 4X8OA 4FMCB 2D06A 2DVWB 4JLNA 4FMDB 2IYYA 2XZPA 4EDHA 2WTUA 3MWLA 4DT1A 5AUNB 1AK2A 1D2EA 1X6VA 5FI0B 621PA 1NMZA 2KI5A 4DT1B 3BORA 3RC8A 4L16A 3PJRA 2X19A 3A1VA 1VCIA 2GTPA 2AD1A 3K0FA 4IDOA 1ESMA 4QJ5A 4C0BA 5B58C 2ZJZA 1JECA 4NTZA 2BEJA 2PZGA 1YRBA 2CE2X 5DN6D 4D26A 2IA5A 4D80A 2BM0A 3LXXA 5K8LA 3WRYC 4Q9HA 2F3RA 4BQSA 4QGGA 3VU9B 1S1CA 4M22A 4HAXA 4C0QC 1FUUA 2J7PD 3IGFA 3FMOB 4LV6A 4PAMA 5E7JA 3LVRE 4FWIB 4B32A 5KU1A 3VNUA 3DDCA 2W0SA 4EPTA 1L4YA 3K70D 5JWOA 4D4KA 4V0OA 4LCBA 4URVR 4U00A 3WBKA 1JAHA 1U9IC 3Q7PA 1SVLA 1EFHA 3MLEA 2QP3A 2AX4A 3OFND 2GVDC 4M9ZA 4V0NA 5EJEA 1KGDA 1MT0A 3AKEA 5FOSA 3SFVA 1KHTA 1XF9A 4HLQB 4JLKA 5L3RA 1TUEA 2IF2A 5JMTA 1T3LA 2OFOA 5FPYA 1G9XA 2CHVA 1EFTA 2FZ4A 3H0KA 1NVVQ 3PXGA 2CL7X 1JI0A 2IBMA 3ZD7A 3QKRB 3T1QA 3QVUA 2F9MA 3AB3A 1M6NA 4H1VA 4B74A 1VYVA 4N1AA 1T9HA 1BH2A 1UM8A 3BERA 4BRUA 2C9OA 1CS4C 1L4UA 1KI3A 2G0TA 2R6CA 2ORVA 1P2UA 1Z3IX 2MSEB 3LO5A 4AG6A 3L43A 3KUDA 5HZHA 2WBLC 3JZAA 4YQFA 1E0JA 3K09A 2O8CA 2BBOA 3KJIA 2O8CB 2E87A 4OHZA 4XTRA 4C0KA 4Q9KA 4Y0AA 2JJ2D 1QDEA 1E9EA 1P61B 5C1BA 521PA 4DC9A 4TYQA 1LTQA 1WF3A 1E0SA 1ZNXA 3IQXA 2C04A 3THXB 1G6OA 4B3DA 4V0MA 1RRPA 1U8AA 5JJKA 1SHZA 4AIIA 3B6EA 4M9QA 2HF9A 5H8WA 2PJZA 4O3MA 3L0IB 2QM7A 3E70C 2DWPA 3E1SA 1HURA 1GUAA 4HB3A 4NBSA 3ZZUA 3R8CA 2O52A 1NF3A 5JWHA 2VP2A 4XWKA 2NO6A 2FEMA 4LJAA 1G7RA 1E2LA 1ZU4A 4KAXA 5TXGA 1SVSA 2ZYUX 4U02A 3FDIA 4BE7B 4A15A 4C3ZA 2JJ1D 3K0CC 3NXSA 1YR7A 2GK7A 1NIPA 3E5HA 3D8BA 2ZTSA 1P5ZB 2OILA 2QSYA 1E2KA 2D2FA 4UXIA 1Q1QA 1ZIOA 3DOFA 3IBGA 2ZI6A 4WIAA 1DO0A 4EFLA 4OK3A 1M7BA 1TF5A 2XNDA 2CHGA 3GJ5A 4FWHA 3OEEA 3CO5A 3TR0A 2QROA 3ZH9B 3LRPA 4LJ5A 4PX9A 3CB4A 5BWMA 1YKSA 1ZD1A 4B34A 1CJVC 2VEDA 4DSUA 2C03A 3AVWA 5FBRB 1XCPA 3MUFA 4Q03A 3KTAA 2W0MA 4LY6A 2DR3A 3AVTA 4UNNA 3ONWA 4D4JA 3TR5A 2DY1A 5A5GA 1GG2A 1ZRHA 2BKUA 3CRW1 4XVUA 1G4AE 2GRJA 4TMTA 1MRNA 4KO8A 2CLSA 3GJ0A 1MH1A 2OAQ1 3IUYA 4TSFA 1J2JA 1CU1A 4RJLA 2JLUA 3U7FB 3EWSA 4BECA 1E1QA 1R5NA 4Q4LA 1F48A 1AS2A 4TMKA 5SZHB 4KFRA 2ZE5A 2G3YA 3AGPA 1Z28A 2FMXA 1U98A 3IDQA 1VPLA 2FFAA 3EC1A 5LD2C 2PH1A 2WIBA 1R8SA 1L8QA 1CLUA 1DAHA 1JAIA 5A4JA 1Q1ZA 1QHSA 2CNWD 2GDJA 3NH6A 1A5TA 3R7WA 5FTLA 1FPMA 2ZRKA 3MFYA 3R7WB 4OI4A 1JQJC 1GNQA 2V7QD 1SHKA 3FB4A 1F6BA 2HXYA 3OEHA 1P75A 4LK2A 3EARA 3QPVA 4LBWA 2HT1A 3UMRA 3CX7A 4DSTA 3P4YA 5FTKA 4XVQA 1VYUA 1W36D 2JLWA 1S96A 4H1UA 3MJHA 2ANCA 2IF0A 3FKSA 4NCJA 4IEIA 4URZR 1W47A 4WZ6A 1YZUA 3O8DA 1CEEA 1ZVQA 2ASEA 4Q47A 4EJSC 1T0HB 1I2DA 2JATA 4IOMA 2ZRLA 1R8QA 4BEJA 3LFUA 3LW7A 1KDPA 4QGHA 2ZANA 2K5UA 2VPPA 4NU0A 1D9ZA 3RWMB 2BBSA 2ODNA 4WOPA 2FA9A 1KSFX 1T5IA 5EE0A 4DLXA 2GF9A 3RDPA 3AKYA 5KNDA 3UANA 2AK2A 5DYGA 5HKKD 5KSZA 5FBQB 3GLHA 2WAXA 3VX3A 421PA 4ARZA 4A0HA 2N1BA 5HZKA 4ZCIA 4ARZB 4HAUA 2KRKA 3SYKA 1Z8FA 4ABYA 1TL7C 4TT3A 1XZQA 2CJWA 4OHXA 2CJWB 2H18A 4MYHA 3ZQ6A 5EP1A 2VTKA 2YWEA 3ZLJA 3CONA 3EZFA 4KHZA 1RYHA 1XEWX 4PHFA 3V00A 1SVIA 3LAWA 1QHGA 4QC2A 1OYYA 1KJYA 4OJKA 4OQNA 2YZ2A 4ITRC 5BXQC 2ZJ8A 3GLFE 2ATVA 2JAQA 4ESHA 1XPRA 3RWOA 1FMLA 2WWGA 3F8TA 1VG0B 5L3SA 1T91A 2ZI7A 2HJVA 2QGNA 4GMXA 2GJSA 4DIDA 5L3SB 4DDWA 4YMWA 1ZCBA 4JT4A 4OYHA 2WWFA 4A8JC 3U7EB 1G8PA 2GBLC 4HLUC 4ILEA 5FUYA 2Q3MA 1ONBA 1KMHA 4J0QA 5AUQA 4V0LA 2VHQA 3AV0B 2HLDA 1KMHB 4AKGA 4AKHA 5EP3A 4G5SA 4Z1MD 2HF8A 3WRXC 3KFVA 1CR4A 1VKJA 3Q5DA 4YMTA 3P20A 1W0KA 4B3CA 4Z8YA 4ERNA 1EX6A 4EAQA 5DH9A 3TGPA 3KJEA 2GJKA 1M8PA 3NHBA 4ZDJA 2EU8A 4TMVA 3QXCA 3TW8B 2HYDA 4M9SA 2RGNC 2QT0A 3T1VA 2B8TA 4W5JA 4KLZA 1V43A 2WWWA 2ZUCA 1N6NA 3GD7A 2Q6TA 4BLTA 3CW2A 3AF3A 3WP1B 1KSHA 3SHFA 1N5IA 4LJ6A 4R7ZA 3ICEA 3KXKA 4WA7A 3RAPR 5DHFA 4WZAE 3AVQA 3N2EA 1UBFA 4JVLA 4RKEA 4B47A 2QMHA 3WYGA 4UJ3A 1P2TA 3T15A 2XITA 5LDDC 1F60A 1TEXA 4DDUA 2V6IA 2YC4C 4HEJA 4EPYA 2FJUA 3HR7A 2HV8A 3R9XA 2V6JA 1DG3A 3GMTA 2Z6VA 3QIAA 2ZRDA 4FN5A 2J45A 1IXZA 5FUXA 1AKYA 4FIDA 3PUXA 4JMPA 4ACBA 2IS4A 4LHWA 4QNMA 1NKSA 2P6UA 1VG8A 1G3IA 1BYIA 3HWSA 2J87A 4DB4A 3X1XA 2W2VA 3QOFA 4P32A 1P3JA 3ZZ0A 1KIMA 5HPYB 1ZUNB 3KB1A 5H1YA 1XTJA 1AS0A 2KBEA 4F4JA 1AIPA 4RZ3A 3S1AA 1J99A 4TL8A 4URXR 4D25A 2QI9C 1IONA 3S1AB 3BFXA 4HDQB 2FE4A 4IEEA 4D82A 1VCOA 2WJHA 1IY0A 4M9XA 2B6HA 1G17A 3Q5EA 4LBZA 3MMPA 2QN6A 1Q1BA 2IEYA 1WBDA 2IYVA 4LUCA 4HUTA 1TTTA 3VR5A 4YONB 1FTNA 4AC9A 6Q21A 4PXAA 3AVVA 1W0JA 4EJSA 5JI2E 3PEWA 4URYR 4WW0A 4EJSB 3B9PA 1G18A 1AGRA 2ZRMA 4X8MA 2HCJB 5FBLB 3C5HA 3EPJA 4ASUA 2R8RA 1KZ7B 3KKOA 3ECCA 1X8JA 3A37A 4DDVA 4HAYA 4UNQA 1NBMA 4HB4A 4OQLA 4RCZA 1XTIA 2BJVA 2O0KA 3WBJA 4D6PA 2XZOA 2GCNA 3BD9A 3CZQA 3SN6A 5FPTA 3TVDA 1JPJA 1DELA 2BV3A 3SEAA 2PX0A 1JEDA 1FQJA 3RRNA 4BLPA 2ZI4A 5FR1A 1NVUQ 1PLKA 4JN6A 4JLBA 4HZIA 1G3UA 2GEUA 4B35A 1Z47A 2YYZA 3ND8A 4W7SA 4LC1A 2ODEA 1YU9A 2BCGY 3DZ8A 3B5JA 4I99A 4O25A 2D62A 3IBYA 4PO8A 4YMUA 1Q3TA 2W58A 5DIFA 5JJIA 2ECKA 1WP9A 2IS1A 2GXQA 4BFVA 1XP8A 1FQKA 1TUIA 5G41A 4EQ6A 4JKIA 1R0XA 3RNLA 4EQ6B 4PSVA 1VG9B 3PENA 2WWHA 4XH9B 3MG9A 1E2MA 4O0MA 1KO8A 3U7HB 4KCGA 1EFCA 5EE9A 3VMFA 4A8JB 4HLUA 3H2YA 3CF6R 1KK3A 2AXPA 1HH4A 2Y8EA 4FMCF 1ODFA 3P1JA 3SI7A 1G64A 2OT3B 4TL7A 4FMDF 3K9LA 3TIFA 3W6OA 4AG5A 4Q7LA 1E98A 3NG1A 3KQKA 3WXMA 4JLAA 3H1TA 3TSWA 4GOKA 4DLTA 2XNDD 4MKGA 1P2VA 3OEED 3MSXA 3X1DA 3AVXA 4LJ7A 1NI3A 2Z43A 4DLZA 4EFMA 5JBQA 3I5YA 4LJYA 4S35A 3EASA 1GIAA 2RGNA 4US1R 1OFHA 5K8TA 1OV4A 1E79D 3B9QA 5DNYB 4DSNA 3ZVRA 5JEDA 4TL6A 4G5RA 1CTQA 4M1MA 1YZGA 1KSGA 1E2GA 4BWYA 5FH9A 2NGRA 4JLDA 3R8FA 1KAOA 2H5EA 4V0ME 1K5DA 3GLIA 1E0KA 1XTRA 3GLIB 3CX6A 4TYWA 4TSFD 3GEIA 821PA 2DFLA 1E9DA 3KX2A 2V1XA 3QENA 1W7AA 3C41J 4R2IA 1RRGA 1DAFA 4G0NA 3LQRA 5EE3A 1GL7A 1E1QD 1KNQA 2GCOA 4QJ4A 4LJ8A 3AF0A 2GCOB 4B2IA 2BMEA 4JKYA 2RGGA 4IFBA 3LX5A 4II7A 2G83A 4MUAA 5KDOA 2CNWA 3W6NA 2RGXA 1JPNA 2WJGA 1OH8A 1O3YA 3RABA 3FFBA 4PPGA 2FDCA 1KNXA 5DISB 3BBPA 1KO1A 1DBSA 2GKSA 4M0LA 5LPNA 4C0HA 4POAA 1YZKA 2WVJA 4HB2A 1EFUA 2XB4A 2CCKA 1ZP6A 2DZOB 3MAAC 4A3VB 1X1RA 3KB2A 1KZGB 1NY5A 1UKEA 3OEHD 3PR1A 1X3SA 4LV8B 3SJBA 5KYKA 2FX3A 1IHUA 4URWR 4Q02A 4Q4JA 3SNHA 3CUEF 4Q4JB 4D81A 5E7MA 2EWWA 2QP4A 4LRSA 3KDSE 1W49A 3FKSD 1Q44A 4P4TA 5D3MA 3RS3A 4MGIR 5D3MB 3KZ1E 3QXHA 3B78A 1KTVA 2JASA 3FOZA 4HAWA 1JEEA 2NPFA 1MO4A 2XJ9A 1VHTA 1N3BA 3AVPA 1E2EA 4TLEA 4OQMA 3K9GA 2PEZA 1EFRA 1Z63A 2MSCB 3VKGA 5J4LA 1TPZA 2ZE7A 1FMJA 3ZQJA 1DPFA 1ZNWA 1E9BA 3B8HA 5JCZA 3BB1A 2DWOA 4LYAA 4D4MA 4DWJA 1KI8A 2AFIE 4HUQA 5HE9A 721PA 4I4LA 3TAHA 4HUQB 1BO6A 3BS4A 3D6TB 3WY9A 2Q9AA 2F1JA 2F3TA 1DAIA 2QPOA 4TN1A 2WJIA 5CM8B 3PUVA 1FZQA 3NC1C 4UQOA 2ZPTX 2XTZA 1UKVY 3K53A 2GEVA 4CZ2A 1KYIA 3LXRA 4JYCA 1UJ2A 4DIEA 4LPSA 4TT3D 4US0R 1SVKA 1YE8A 3W5JA 1IN5A 2YWGA 2FWRA 2W2TA 5E95A 2A5GA 4V0KA 3VTKA 4DCSA 2C96A 4OQFA 1ZINA 1P4SA 4TLCA 2ONKA 2GXAA 4LRTA 5JHHB 4C0JA 1LV7A 1I2MA 2FNAA 2FGKA 3EWAA 4CT4B 2RGBA 2ZRBA 1L7VC 3FPAA 1S9DA 2A2ZA 3GP8A 4C4PA 2I1VB 2V55B 1SULA 1OFTA 4NDZA 1G7TA 4IOJA 1E9FA 2OCBA 2OM2A 4I1OA 5JCPA 3MGCA 2IW3A 4HSEA 1R10A 1XJ0A 2JDIA 3HR8A 4C9BA 3CH4B 4MGYR 4BRWA 2IYLD 2HLDD 2H17A 4HYYA 3TNFA 4Q1CA 4M1TA 3RC3A 4M8NE 4JBYA 4O2RA 4PQRA 4ZIRA 2ZEJA 2CLDX 3LY5A 4YMSA 1N6KA 4OI1A 4ZIRB 1YR6A 5CB6A 3K0SA 1W0KD 5EUQB 1Q0UA 3FHOA 1BS1A 4BFYA 1GM5A 1KI6A 1JALA 1XD2A 1GL6A 1KI6B 2DFKB 1MOZA 1XD2B 2RMKA 1H65A 2CVFA 5SZIA 4KFUA 2MSDB 2IYXA 2B92A 2GJAA 1HQYE 2CCGA 5E4FA 4M4SA 1WE2A 2BMJA 2J0SA 3OHMA 1P72A 2YWFA 3T5DA 4LSGA 3VR1A 4C30A 3FMIA 3FMPB 3A4LA 2ZSDA 2RAPA 3LBHA 1E2NA 1X86B 1UBGA 2FN4A 4JSYA 3SDZA 1KOFA 2REOA 2VYFA 1DTSA 1UBCA 2GF0A 3THYA 1CRPA 2EQBA 2J9RA 2G9NA 3THYB 1XEFA 4X8HA 5BYJA 3T34A 3W3AA 2BVNA 2W6JA 4DCNA 2PT7A 2G1JA 2O8EA 2XSZA 4IOKA 3CNLA 2O8EB 4NMMA 3VU9A 4FW9A 2GAOA 1OXSC 5KO2A 2QMEA 3BAFA 3LWNA 3VNVA 3U3RA 3I62A 4DHEA 2QZ4A 2EWVA 4QXAA 4TTRA 2BOVA 3IILA 1NMXA 1LF5A 1AQYA 2FSFA 2WPDA 3L0PA 4WAUA 2O8BA 3ZS8A 2V8OA 1Z5ZA 2ONJA 4NCNA 4XJXA 3AVUA 2O8BB 3IQWA 1XX6A 5CM9C 1BKDR 2ZJ5A 3SJZA 4ZO4A 2VO1A 2WKQA 3LH5A 3B1VA 1M7GA 3BE4A 4L9SA 2GXUA 3HDTA 3NWJA 4JLJA 1DO2A 1EK0A 1WA5A 2ZR0A 2NOAA 5CK5A 4C2UA 4GITA 3GCGA 3Q72A 2CMKA 3ZVNA 1OXXK 1C1YA 3CPEA 2J0UA 5E7IA 2J0UB 2OCAA 3CRVA 3QKRA 4BLQA 1W0JD 1ZU5A 2CLCX 2WIAA 1Z08A 2HYIC 2QNRA 2ZM5A 4NYJQ 2QSZA 3QNUA 1YQTA 4A4DA 2P67A 4E5UA 4D4LA 4ASUD 3NVAA 1OXTA 3N5CA 2ZITA 4RFSA 3U3OA 4RFSB 1WCV1 2ZJYA 4P4UA 4C2TA 1NBMD 3A36A 1KKLA 4WXRA 4Q1DA 3EZ7A 3QJYA 3RS5A 3WNDA 2IS6A 2GXSA 2Q3FA 4XIGS 4LPKA 2XXAA 1DE0A 3M4YA 2XXAB 2J0VA 2JLYA 3A4MA 2ZETA 3REGA 2WJJA 2XZLA 3NDBB 4FI3C 3NKVA 4GDFA 3THXA 4A1FA 3WNBA 2GWHA 1I4DD 1CF4A 4B2LA 1JR3E 1U8YA 3LD9A 4LV5B 4R9UC 2IUUA 4B6FA 4ZCLA 2XEXA 4DLWA 3MD0A 4B6EA 2IS2A 2AD5A 3EZ6A 2NMVA 4X8LA 2O8DA 3QKUA 1E9SA 5BYKA 2IXFA 2O8DB 4XTCS 4KLNA 4TL9A 3A4NA 4AYXA 2FOLA 4UXHA 2JGNA 5EZ6B 3TLXA 4NYMR 2WOJA 5FOTA 2AK3A 3A1UA 1NJFA 2C8VA 4DCVA 2NTYC 1LVGA 2D4HA 1N5KA 2REXB 1NBME 4RD2A 1VCNA 3OIUA 2ZS8A 3QPUA 3EA0A 2EVWX 4IDNA 4NPHA 1LY1A 5FPHA 2EFHB 3AF1A 2VHTA 1XNJA 1XU4A 3PVSA 1G5TA 1E79A 2ZE8A 4FWGA 5A0FA 1Y3AA 1PZNA 5IHPA 1KO7A 1LFDB 4NHOA 4UNPA 1XFAA 2WMOB 5K8IA 2FU5C 3NBYC 4Q5IA 3T12A 3D7MA 2ZIAA 1AQUA 1AA9A 2P0EA 1XB2A 4QKQA 2LKCA 1MO6A 5JHGB 2RGAA 2VA8A 1HEIA 3VHXA 4Z51A 5JSZB 1VCMA 4Q9IA 4ZDWA 1RFLA 2E9SA 3JVUA 1QG4A 4M1OA 1S2MA 3JZMA 5C4MA 4MKHA 4EPRA 4C7OA 3CRQA 3ADKA 2J1LA 2OBLA 4F92B 5J4VA 3NTUA 4C0AC 4C7OB 1G7SA 5KDLA 4URUR 4U5XA 2ZXUA 1XTQA 2Q9BA 3A8TA 4MKFA 2C9YA 5CIQA 2F43A 4B73A 4AURA 4FCVA 1SXJC 1T8TA 2F43B 1QHYA 5CJPA 2D3WA 4LWZA 5DHAA 1W1WA 5KSPA 1N5LA 3ADDA 1O87A 2B21A 1CKEA 1G7CA 1S4QA 3QI2A 2YNMA 2QPAA 5KSYA 4OK6A 3ZJYA 2QU8A 3B85A 2J46A 4JLMA 1GRNA 1KK2A 4A0FA 2V4ZA 2IYRA 3PCRB 3RVBA 4WVFA 4ESVA 4F4CA 1DAKA 3A1WA 3QG5A 2CL6X 4LHVA 5TARA 4QM6A 1IN4A 1U9IA 1GSIA 1QBKC 5L8VA 1XRJA 4GRAA 5FPKA 3BC1A 3WYFA 221PA 3B1ZA 3DKVA 3TSOA 2VL7A 1CJUC 4TYYA 2NZ8A 3WNCA 3BH7A 4MYCA 1FL9A 3CNNA 5GJCA 2ZRIA 1WMSA 3U4QA 2F1HA 1HQCA 3MHVC 3BH6A 5FOUA 4W5WA 1JR6A 3Q9LA 3U4QB 4NONA 1XPOA 2EW1A 3GLIE 2AN9A 1KY2A 2F7SA 2PCJA 1R0WA 3UMSA 4GL2A 3TUIC 3REFA 2R6AA 4WBSA 3UG6A 4ZI2A 2AKYA 5B30A 5SZKB 5BN3A 3CIOA 4JVNA 1VDZA 1ZNYA 3ZD6A 2LKDA 2PZEA 2A9KA 3IKJA 2PCLA 4GZMA 1EFRD 2Q21A 2QMUA 4UJ5A 3QUSA 1CJMA 1L2TA 4B3BA 1P9NA 1E99A 2OLKA 2O5VA 1KI4A 2VP6A 5C2JB 3K9NA 2XOKA 3OIWA 1YZLA 5K8UA 2MMGA 1EX7A 2R6GA 4AI6A 1N6PA 2A5YB 1A4RA 1G8GA 2F55A 3N2IA 3RS4A 3ASZA 4I1VA 1Q12A 4D0NA 3L8YA 4GSYA 1NLFA 2BDTA 2IWRA 3B60A 2VRWA 2PBRA 3TJZA 2YVUA 1CXZA 1QG2A 3EC2A 1OFIA 3C4JA 2WWYA 2C98A 3KJHA 1NSFA 1W4RA 3BRWD 3AF4A 4LBVA 3T06B 4MUBA 2ERYA 4ZDKA 3KQHA 4TLAA 4D0GA 1N0UA 1OKKA 1ZD8A 3UPUA 1U81A 2E1RA 2W83A 1QZMA 1HT1E 2Z0MA 3K0CA 3PEUA 3SU8A 3ZYCA 3QSYA 5LBIA 2WSSA 4F38A 4LOAA 5JZVA 3R9WA 1Q20A 3BOSA 4TYPA 4FCTA 3U44A 4PHHA 1NP6A 2ZSBA 4CYMA 2F6RA 4W9MC 2QRZA 3U44B 2RGEA 3NEYA 2J0QA 2VHJA 5GVRA 1KKMA 3FWYA 1HE1C 4Q00A 1U2RA 5FOXA 1CR1A 2NIPA 2FFHA 1K6MA 4H9GA 2ZJ2A 4XSHA 1KO5A 4M53A 4OK5A 3EA5A 5BN4A 3GEEA 2JDID 5AJZA 1NN3A 2C5LA 3VAAA 1E9AA 3IEUA 3QE0A 4Y0VA 3AVYA 1GFIA 5DI9A 2CE7A 1OXVA 4JBXA 1ZAKA 4ZKEA 2WAYA 3SYNA 4ZKDA 4NCHA 2Z83A 2R65A 3M1IA 3THWA 2D2EA 3LA6A 4LX0A 4Q9JA 3THWB 4G3XA 4B48A 1CR2A 1TQ6A 1SVMA 2QEQA 1X8KA 3C5CA 3RSOA 3DMNA 2O8FB 3FVQA 4A0RA 3LX8A 4KI0A 2YWHA 1XTKA 2P5SA 4LI0A 1ZBDA 1NVWQ 4I1UA 1JQLB 4TQAA 3IIMA 4OL0A 3WMGA 5LD2B 1SXJA 4JLOA 1HY3A 4TQ9A 4TMXA 1SXJB 2WKPA 4L15A 2DCUA 2VSXA 5FI1B 4JL8A 4CEIA 3SQWA 5EP2A 4CEIB 2W6JD 1TF2A 2EYUA 5BN5A 4L5BA 2OO7A 2XSZD 5HCNA 1R0ZA 1Z2AA 4MA4A 2F9LA 5CLLA 5J4YA 2I4IA 2YJTD 1NVMA 2KWIA 3U5ZB 4B3XA 1JR3A 2QGZA 3EAQA 1I4TD 1G5PA 1XCMA 2IL1A 1BMFA 4QHSA 3I73A 4QFMA 5D3QA 2QMOA 1IM2A 2WPDD 3TUZC 2DFTA 1XPUA 4B33A 2X8AA 2FPMA 2IYQA 3I5XA 3LDAA 2ZSFA 1IN6A 2D7DA 3I4LA 3U7GA 2OAP1 2ZS9A 4IJMA 1J8MF 3TE6A 3E2IA 2D74A 4FWDA 1DAGA 3EIQA 4RZXA 4IVQA 4YDHB 3K8YA 1Y63A 1U94A 5CDFA 1II8A 3PEYA 2A7QA 3QF7A 1II8B 4FWTA 1IAQA 4IVRA 4DLSA 3IEVA 2WZQA 4AKIA 2AL7A 3I1FA 2W6IA 3L2OB 4PO9A 2YKGA 2DZNB 4BFXA 1KO4A 3O8BA 1XJCA 2WHXA 4ZPXA 2IYWA 3BWDD 4PANA 3RYTC 5FL7A 4KBGA 4FMBB 4JL6A 3QPWA 2P6RA 4QRHA 1YVDA 4MQBA 2ZR7A 5L3QA 5L3QB 1J90A 1ZM4A 4XD7A 5KPDA 3ZZTA 3BH0A 4RD6A 5DLQC 4IFEA 4LBYA 4MYTA 1F2UB 2FSGA 1IOZA 3KQLA 2VSFA 3W5IA 2B8WA 1N6HA 2KBFA 2ZRNA 2WV9A 3I72A 1GAJA 1PUIA 2JEOA 1B0UA 4R2HA 3TK1A 4LRWA 1NVVR 4A8JA 2QY9A 2C9CA 1GITA 1TAGA 3IPXA 2GBLA 2IHYA 5F9FA 1G3MA 4KXFB 3J81k 3U60B 1GNPA 2I3BA 1W5SA 4BGDA 3AP3A 1OSNA 1Z6YA 4D0LB 4LJ9A 2J3EA 3MWYW 4IDPA 2IWHA 1OYWA 2ZVPX 2ZVQX 1WQ1R 2FH5B 1D2MA 1T5LA 5F2EA 3GJ3A 1Z83A 3G5UA 1XJQA 3OIVA 2IHBA 3TRFA 3KKPA 3W8RA 4BFSA 1EWQA 4DKXA 2C77A 3ZDQA 2XTNA 1N0WA 5TY0A 3BXZA 2KB0A 3ZVLA 3LLMA 2R6FA 1MO5A 1JXOA 3KQUA 3L0OA 4BLRA 2FSIA 2O0JA 4M1YA 2ZSAA 4MYUA 3ASYA 2H16A 3KL4A 3N70A 5CK4A 1D6JA 2AWOA 1E2IA 1OXUA 1PJRA 121PA 1VIYA 1Z0KA 1AZSC 3A1SA 3UG7A 4B44A 3Q3JB 4QHTA 5EXXA 2GZAA 3QBVA 1FTSA 2QAGC 3EZ9A 1FOEB 3VX4A 1P9WA 4A2PA 2BBWA 1T4GA 3Q85A 4ZV4A 4L4UA 2OBNA 4P33A 2BM1A 1M7HA 4M21A 4TWZA 2BMDA 4KFTA 1FNMA 3DZDA 1E0AA 3QG1A 4DUGA 2YHSA 3DL0A 3DVLA 3C14C 3RANA 1XMSA 4I81A 3TUJC 1Z22A 2H92A 2W00A 1LNZA 4PQYA 1CULC 3CWQA 4F7WA 2VF8A 4F4IA 2OFXA 2F1RA 3NIBA 4QG7A 1Z6AA 1UEJA 2J41A 2B7BA 3CH5A 4LGMA 1NL3A 4XOIA 3B1YA 1CP2A 1G21E 4UNRA 5BW8A 2GCPA 4KODA 2OV2A 3AUYA 3VR4A 1V5WA 3FKQA 4IXMA 2X2FA 5DSZA 3U6BA 4QL3A 3F3YA 5F9HA 4CEJA 2Q0HA 1LB1B 4I1SA 4CEJB 3GJ8A 1KSJA 4KV9A 1FUKA 1Q3HA 5LB4A 3PG5A 2IYSA 4DRZA 1KJWA 1AJEA 4KVGA 3KXIA 1VTKA 1IJFA 1ESNA 2FG5A 4DLYA 2UZIR 1COWA 4PO1A 2WJVA 4TZ0A 4V02A 4E07A 2A30A 3UXMA 4F93B 2QG6A 1WBBA 4XWAA 5TVKA 1NNEA 2JLQA 1UKZA 1IJEA 1UF9A 2A5FA 4BZQA 4CT5A 2OESA 1UDXA 2R9VA 3RRYA 1EWRA 1BOFA 4JLVA 2QRNA 2EFDB 4A82A 1TX4B 3U61B 2I1QA 3ZVMA 5AR1A 5KHOC 3TQFA 3VR6A 1Q22A 5FUWA 4P31A 5DO9A 2F1IA 3TQCA 1SQ5A 1ZM7A 4Q01A 5SZJA 4OHYA 3FFAA 2OCPA 4HB0A 2V6ZM 1P73A 2VBCA 2XOKD 1N2CE 3TSZA 3P4XA 1J7KA 1NIJA 3LV8A 4PHGA 5HTKA 5CJ2A 2RH5A 3B1XA 4Q21A 2QTVB 3OAAA 4KFSA 3T1OA 2JLXA 5FFMA 3B13B 1CR0A 3GJ7A 3U3MA 4M1KA 1W4BA 3AGQA 5EE5B 5TB5A 4QJ3A 5IF9A 5KOYA 2RHMA 1LW7A 3AJIB 1T3HA 4P4SB 3H84A 4GI7A 2X1VA 4NYIQ 1HV8A 3AVOA 5HCIA 2ZR9A 4TLBA 2BCJQ 3UK6A 4A2WA 3QKSA 3EG5A 1MO3A 4JBWA 1Q57A 3QKSB 1RW4A 3OESA 4EUNA 1Z6GA 2ZE6A 3ICQB 5GJWC 1OKKD 4R98A 3BK7A 1E4YA 3KKMA 4PSKA 1PV4A 3NC0C 2NO9A 4RD4A 2QE7A 5TMPA 1ZYUA 3NBFA 2Q9CA 2WSSD 2C2HA 5AJWA 2VP9A 1E9RA 4DSOA 4K81B 5AWFC 4FXPA 3FHCB 1S3GA 4QBGB 2CBZA 1G20E 2HUPA 3HP1A 1GZSA 1M1YE 1GP2A 2ZI9A 1CBUA 1M34E 5FTJA 1ZM3A 4EFNA 1YZTA 1GRRA 2G77B 4KYIB 4JT2A 5C18A 3BGWA 1XMJA 1N5JA 1OLOA 4CW7A 5JJLA 1N6OA 2VSOA 5EUMA 1E2JA 2PEYA 4BLSA 4E09A 1E3MA 4PC1A 4YDSA 2PLFA 2ZRFA 4JL5A 3NBZC 2V9PA 2LWIA 3FMFA 2A3RA 4CEHA 4JSTA 1KDOA 2A5JA 2ZYWX 4CEHB 4G5QA 1EXMA 4KSBA 2JCSA 2QAGA 1NLZA 3MJRA 4G5OA 2Z4RA 4RY2A 2DWZB 1XEXA 1SVWA 2QAGB 1JXMA 3IIJA 1XEXB 1GILA 1M2OB 1VYTA 3CR7A 1R5OA 4LHZA 5B64A 1OE0A 3FYHA 4GNKA 2RKOA 1LS6A 5JS7A 2WKRA 2JIZA 1MR3F 1OT3A 1DAMA 5JEEA 2DPXA 3KKNA 4GP7A 1YJ5A 3SZRA 1NKTA 4HI0E 3D3QA 1JBKA 1F3OA 1GDDA 2R6DA 2Z4SA 5FBVB 2WOOA 1RIFA 1SXJD 4DJTA 1QHNA 3LQQA 4GT1A 1G19A 1RRCA 1W44A 3PQCA 2BIFA 4HAVA 1J8YF 3HPQA 1DG1G 4O2LA 4P3YA 4OI0A 1OPXA 2GEDA 4QOSA 1II0A 2AHOA 5CYOA 4ZI3A 2BMFA 2DHRA 1CIPA 1RKBA 2IT1A 2P65A 4B3GA 1JJ7A 2ZRAA 5JI3E 3BJIC 3K0FB 3I8XA 3RRZA 1A82A 2ANBA 2ORIA 1TU3A 1S0UA 3LLUA 4OQXA 2ZRHA 2DWQA 2IYTA 5UKDA 1ZM2A 1JR3D 2FFBA 1UAAA 1AN0A 4YC7A 1QRAA 2ATXA 5G53C 1BMFD 1NLYA 2XNSA 2H8KA 1XTSA 3UWOA 1S1MA 4DVGA 3VFDA 3DO6A 4DCUA 3CWZA 1G41A 2ZJBA 2MMCA 4FCWA 4TLDA 1OH7A 2QP9X 3VKHA 3L0SA 3U3JA 1GRQA 4OBEA 4JZKA 2ODBA 5ANRB 2XGJA 2ZQ5A 4KBFA 1ZCAA 1Z0AA 2OE2A 1UDWA 1SXJE 1T0JB 2V3CC 1UFQA 1AGPA 4GBMA 1SKYB 2ZUDA 3AQ4A 4PTLA 3CLVA 1F2TA 1F2TB 1QF9A 3AM1A 1P62B 2W6ID 4N0EA 2G0NA 3T5GA 1U0LA 1M74A 1DARA 3GEHA 5EZ5A 1J70A 1XMVA 4BZXA 3SQXA 5FL7D 2CL0X 3B82A 2OHFA 1U0HC 4B71A 4AYTA 1PUJA 4MRSA 3HU2A 2QT1A 5CITA 1K8RA 5ELXA 3TBKA 4GMDA 1ZUIA 1UBEA 4XD7D 2NO7A 2A5DA 2RGDA 1UPTA 4CGZA 4FD2A 4XSGA 3WYAA 1G8YA 4HAZA 2HXSA 2QBYA 1NY6A 1S3SA 2QBYB 3SJAA 1H8EA 3NH9A 3CKLA 1ZC4A 3LW8A 3UKDA 1NG1A 5CDFE 5HR5A 4AWXA 1JB1A 4MKIA 1QHXA 2FZLA 1KDTA 1AKEA 3HYTA 1LS1A 3C8UA 3CPHA 2CXXA 3EW9A 5B57C 1ETUA 5H70A 5FR2A 2BEKA 1US8A 1G3RA 1US8B 2UKDA 3F5FA 5G40A 3TH5A 2GZHA 4Q7JB 2G88A 1LF0A 1YRAA 4PC3A 1D2NA 5KTYA 3KQNA 4XVRA 1DOAA 2NO1A 2Z5FA 4Q1BA 1NSTA 3QEJA 2OCYC 3RLFA 1BIFA 4W5HA 5BQ5A 3SBEA 4GPTA 3RHFA 3HYRA 5FTNA 3X1WA 4MGZR 5JSZA 5AK0A 3SFZA 1G16A 2EFEB 2GVZC 1UADA 3OE7A 4IRUB 3EX7C 2J7KA 3QEOA 2OXRA 4QGFA 4JVMA 3RS7A 1WDTA 4B43A 1JJVA 2AWNA 1YZQA 3GFOA 3A6PC 2AR7A 2V54A 5GADl 1C1KA 2FEOA 4A6XA 3KTAB 5EP4A 1OFUX 1YR9A 3H4MA 3NEJA 4M1SA 1KMQA 2HDNB 3LNCA 2G1KA 2BKEA 1X37A 2EYQA 3I92A 4DUGD 1XMIA 1ZC3A 1XXHA 2GAAA 2ZU6A 4IDHA 2ZI3A 1H8HA 4IDQA 1XXHB 1IBRA 3C7KA 1R7RA 4UKDA 1Z06A 1P6XA 4Z54A 1K5GA 2BHRA 4MH0R 2C78A 5FPSA 3DEFA 4B75A 4KITB 5IDVA 3QXXA 1RC8A 1NG9A 1G1MA 3EIEA 3SOPA 4OKSA 4Q4AA 1RYFA 5FL3A 2QAJA 4E22A 1E96A 4Q4AB 4OHWA 3FTQA 1A2BA 1A2KC 1TU4A 1KY3A 1QHIA 2AXNA 1E9CA 3DMDA 2G6BA 2GHIA 1UEIA 2V1UA 1C4OA 1T3SA 3F0TA 1MV5A 3QBTA 3W8NA 1Z0FA 2NG1A 3ADCA 3ZIAD 5JECA 3CBQA 4OI2A 2HT6A 3NHAA 4DXAA 2PMDA 4NH0A 4YXWA 3K70C 3P26A 1OHHD 1COWD 4QGAA 1SVOA 1OH6A 2ZI5A 2YOGA 3IIKA 5JLJA 4PC7A 4TZ6A 1EESA 1GWNA 3G0HA 4KU4A 4HZUA 3AKCA 2DBYA 4HZUB 4GP6A 1IY1A 2UZ3A 1GTVA 1X8LA 2IYUA 4MITA 1W48A 2ZU0C 3MWJA 3U3KA 1QVAA 5J47A 3IO5A 3PEVA 3WMEA 1GKUB 4QHYA 1G8HA 2PZFA 4M1WA 1Z6TA 2R44A 3B1WA 5IK2A 4AY2A 4PZYA 2JA1A 1ZM9A 2ZAOA 3CM0A 4EPXA 1UKYA 2ZS7A 1TQ4A 2WWXA 1IY2A 1NN0A 2CCJA 1GVNB 2IEZA 2QL6A 1U8ZA 3GLGA 4LYJA 1OW3B 1I4LD 1E2DA 4QM7A 3GLGB 2NQ2C 1G4UR 1KI7A 3UATA 3ETLA 2H7VA 1KJZA 1OIXA 2RB4A 4PSAA 2LCFA 2CK3A 2ZROA 1E2QA 1QHHA 2Q3HA 3OAAD 1QHHB 1HTWA 4ZCMA 5JRZA 3IHWA 5JFGA 3V4RA 5KNCA 3VKWA 4V03A 2GNOA 1EGAA 3AEZA 3NBXX 3GLHB 3CR8A 4HDCA 1BYUA 1WB9A 2GETA 4B76A 1Z0IA 1JNYA 3WHKA 3L82B 2PX3A 4RD0A 4AKEA 3DKPA 2HJGA 1Q1EA 1A7JA 3HU1A 4LJ4A 1W5TA 3TAUA 3ZGXA 4HDOB 1G291 3EPLA 2VP4A 4Q48A 4WZBE 2RCNA 1DS6A 1TQDA 3G82C 4TQUS 2FF7A 4L9WA 4JJZA 4PQFA 2QE7D 3BB3A 1MRSA 4LDJA 2NPIA 3JVVA 1XCGB 2PL3A 5AUPB 1G5RA 2NZJA 3ND9A 3C15C 1W4CA 2VIIA 2ZRCA 3P32A 4PPFA 2BBTA 5DGXA 5EXPA 1FP7A 2ZUBA 4NCKA 1VHLA 5EE1A 3SR0A 3LBNA 2XJ4A 2QTFA 1W2GA 1RVDA 4G5GA 1WXQA 3O8RA 2ZRPA 1RZ3A 4PPNA 5AJYA 3W9YA 3VHLB 4CDGA 1Z07A 3P27A 1W4AA 2YC2C 1ZIPA 2P5TB 1E1RA 1Z6XA 3OIYA 4DEXA 1F5NA 1XD8A 3R9IA 4DEYA 4PR0A 2HCBA 1P2SA 1RE0A 4RSGA 2FSHA 5GJBA 5DE3A 2O8FA 3TVTA 2DFNA 3SS8A 4NYIR 2ZYVX 1R0YA 3UMFA 5L3VA 2ZJAA 3EZ2A 3QVVA 1IXRC 1KI9A 1D9XA 1HUQA 1XDBA 4Q66C 1DAEA 3TMKA 1ELOA 2FGJA 3AF2A 1NJGA 1QZXA 3W34A 3W6PA 3CPJB 1KDRA 2QPTA 3IO3A 4K8OA 1VECA 4LYHA 2GJ8A 2JIZD 1XEWY 4QNRA 3VLFB 4TMZA 1G6HA 3QF4A 4NKRA 2VLIA 1W2HA 4N3NA 2C95A 5G3ZA 1KI2A 1G3QA 3QF4B 4BUJA 4F91B 5F3WB 5CIWA 1A1VA 4EIWA 1N25A 1SGWA 2WM9B 2HEIA 1MABA 4LC0A 1MABB 2YOHA 1OJLA 3PITA 3QY0A 4R71A 4IKEA 4RZUA 1ZNZA 2FV8A 2WWIA 5DN6A 5P21A 4MDFA 2EFCB 1YZNA 1NVXQ 4ON9A 4IVPA 1IQPA 4M2LA 4YMVA 1GNRA 3DM9B 1ZJ6A 1W46A 3QKTA 4EKDA 3Q8XB 3OZXA 1DADA 1TADA 2OLJA 1OIWA 1TF7A 1AZTA 2J7PA 4WXPA 3BB4A 5AJXA 1VMAA 1HE8B 4PC6A 4RD1A 3WMFA 1OB5A 4PHTA 2OFWA 4JYBA 3L8ZA 3H86A 5KPJA 1IN7A 3FE2A 3CNOA 3B2EA 4GZLA 1E69A 2VH5R 3A58B 3K70B 3A1TA 4YLGA 4DB2A 1KK0A 1Z2CA 4IXNA 5J40A 3THOA 3I61A 3FGNA 1NN5A 4JS0A 4BFTA 1W36C 3OFNA 2DYKA 4Z8XA 2OXCA 4NZYA 3K0EA 2CEAA 4L8GA 1OB2A 3HPRA 1OF1A 1GL9B 2ZRJA 3VR2A 2IK8A 3B7GA 5FOWA 1T6NA 2B7CA 4GOJA 1DVRA 1GKIA 1Z29A 4D2IA 4A0GA 1IN8A 4LYFA 4N0DA 4NYMQ 4RVCA 2W2XA 1HA3A 2GILA 3GQBA 1PLLA 3O47A 4IHQA 3DOEA 3CF0A 2PMKA 1PVOA 1U99A 3MWKA 4KSCA 1R6BX 1R5BA 5KSOA 4DLUA 4B2PA 1IXSB 1DEKA 4BEBA 1AS3A 4MRRA 4A6PA 4CRWB 1E6CA 1TEVA 2ORWA 4MRPA 1F2UA 2YINC 2IYZA 2KE5A 5CLQA 2VHUA 1NRJB 2AKAB 2OUKA 2TMKA 1KK1A 2WSMA 1P7CA 5FTMA 3IPYA 3K0AA 3M6AA 3PIRA 3AP2A 4LHYA 2JJ2A 3K0AB 3X1ZA 1TQ2A 1WRBA 4G01B 5JRJA 1YHNA 1P60A 1R2QA 1E2HA 2IXEA 2VP0A 4P0TA 2JLVA 4TTQA 4S2EA 1GKYA 5AUOB 1PLJA 2WMNB 1GOTA 2D7CA 4BFWA 5C46F 3AP1A 5G3YA 4QBIA 2OG2A 2KJQA 1C9KA 4A9AA 5CYPA 3IHLA 4NYJR 3EXAA 1CJTC 2XAUA 4IW3B 2ODWA 2QORA 1FW6A 2SHKA 1H8ED 5HE8A 1Z0JA 4BFZA 1E2FA 1VIAA 3KFXA 3SE0A 3GJXC 4PZLA 3W90A 4IOLA 1FNNA 1U90A 3RS0A 2GK6A 1AM4D 2KSQA 1X1SA 2N46A 2J59A 1FFHA 2JJ1A 5H68A 1SKYE 2WJYA 1II9A 5EXSA 4ACAA 3AH8A 3T35A 2H1LA 1E2PA 3GJ4A 5TV2A 2O0HA 2OZEA 2CVHA 5GVSA 2JLRA 3BFVA 4MRVA 4BFUA 4TMWA 5M04A 1NMYA 2OBMA 4Q9LA 5FOVA 2QUZA 4PFSA 4Q18A 3CF2A 2QENA 3CRRA 1SKQA 2DB3A 2A78A 3MCAA 4MGKR 2GZDA 5J5CA 2IUTA 4OHVA 2C99A 4BZPA 4Q7KA 2YOFA 2BJWA 4DDTA 3PUYA 4CIDA 5F98A 1TNDA 4KYUA 4NCIA 1U0JA 1VG1A 3OE7D 3GFTA 4PAQA 2P3SA 4NE2A 1G8FA 3RS2A 3KJGA 4KVAA 4AYWA 2OSBA 3AUXA 2CDNA 3CZPA 4Q19A 4MRNA 5C4GB 1S9HA 3I32A 4LZZA 3TW4A 2QA5A 1D8TA 1N6RA 1OH5A 3PV0A 4RCYA 4Q4HA 4HLCA 5AJVB 3QQ5A 3KXLA 4Q4HB 4LHXA 1QVRA 2ERXA 1H8HD 1E4VA 2VQSA 3GJ6A 3PUWA 3I3SR 2X77A 1XWIA 5CB8A 3M0EA 3I8SA 2X2EA 3UIEA 1E32A 3OF5A 2CHQA 4K46A 3KKQA 2IXGA 3EPKA 3ADBA 5J4HA 3SHWA 2R62A 2IUSA 1ZW6A 2GJ9A 3ZIAA 4DBLC 3HU3A 2QM8A 2V7QA 4NL4H 3BFKA 2FFQA 1T8UA 2ZJOA 1ZMXA 1OHHA 3X1YA
chains in the Genus database with same CATH superfamily
5FUVA 4P86A 1M2JA 3KUCA 2R2GA 1RHKA 3V1UA 3T3IA 3UMMA 2L0XA 5A4KA 3UFXA 5CEJA 1VG5A 2LDXA 2A9VA 3CLTC 3KW6A 1LA2A 2G7ZA 1EXVA 4NJMB 3R20A 4RETA 4GI2A 3NDPA 1CRQA 1CUVA 4OW0A 4D74A 4F1JA 3BK1A 4KDCA 4ZVPA 3WWCA 1OX6A 4WOKA 4X9XA 2LRHA 2OEPA 3SHOA 3NHWA 4H7HA 4GOXA 3TQSA 4X90A 4OCZA 4OSPA 1UBRS 1A9SA 3DWIA 4E5PA 2IP2A 2Y1WA 3LBIA 1UZNA 2FEAA 2CL5A 5CHEA 2PJRA 1WKBA 3BEDA 3SYRA 1XC8A 1CUZA 1ENPA 1X2BA 3ZJVA 1FVXA 2GCEA 3QWAA 1W87A 3GNLA 5E2IA 2PKEA 3DHEA 2EZ4A 4FZ3A 1T5DX 3AY0A 4WDRA 2X0IA 1JIVA 1TZ2A 3IS3A 1WDWB 1XWFA 4WLOA 1NMSA 2A0FA 4JHLA 2ID4A 1PHRA 2PVPA 4Q9HA 3LC7O 2UZ1B 1G59A 2BJHA 2O59A 4PYKA 2D5BA 3IDFA 3LRTA 2C9MA 4ABTA 1SEVA 2ST1A 4LCBA 1KETA 3KD2A 3HXTA 4B5KA 1UM9B 3MAJA 3NHUA 2A14A 1ZJ5A 2CL7X 3AXTA 2D6FA 4GR4A 4RPKA 5HXAA 1UXOA 1VYVA 1T9HA 1SBYA 2PGIA 1EHIA 1XZJA 1VHWA 2GBGA 3G88A 3HCNA 3THXB 2A35A 3MQ2A 2YHIB 4TXHA 1PR9A 1SOMA 1YQQA 4OXYA 3O75A 1RC0A 1NIPA 3E5HA 3DOFA 4NNJA 3OLQA 3EF0A 2CHGA 5JS6A 5K2OA 4B34A 1XE3A 1ESDA 3N8DA 3QLVA 1JT2A 1LK0A 3UGQA 1DQRA 1WUJS 2EJVA 1PJCA 2O48X 4TMTA 3KWJA 3HS3A 4KO8A 1MH1A 3FLBA 3KCNA 4XM2A 4A91A 4FGSA 2BFBA 3I12A 1N78A 5HTOA 5K7SA 3QTBA 3IDQA 5LD2C 3VPDA 1L8QA 1YK1A 1QHSA 4ZZ0A 4ZQGA 3TZKA 4E0BA 2CF5A 2HT1A 2QRPA 3DV0A 1IEWA 4XVQA 1VYUA 2KW5A 1FXWA 1RJGA 4IOMA 4TTTS 1H2EA 2ZPUA 2GKOA 2P27A 2WP8J 4INOA 3KFLA 3NGXA 2BLNA 2PO7A 3I5AA 2FA9A 1KSFX 2GF9A 4PFJA 3UANA 2QZ9A 1GZ7A 5FEMA 2VWGA 3LQKA 2UUAM 3VX3A 4A0HA 2KRKA 2IOFA 2V4MA 2CJWA 3TFQA 1P4JA 4RH1A 4CMEC 2DCMA 3HYSA 3H2JA 2YWBA 4OXNA 1ZCBA 1ST2A 2Q3BA 1LGYA 3EGVA 3U6QA 2P1RA 4X7PA 2HF7A 5I9LA 4BOYA 2WR8A 4ERNA 4G89A 2WYHA 4WKGA 2GQ0A 3R7FA 5HIMA 4MKXA 3PQFA 5G0TA 4MUFA 4AJIA 2TSYB 1ZH6A 3A6EA 2P9CA 4MWGA 3DEYX 5K6RA 1WWKA 1Z4IA 1KH3A 1P2TA 1A04A 3T9AA 2E18A 3W1WA 5B6PA 1NYLA 1VG8A 1I0IA 1FUEA 2PKWA 1Y82A 3V5NA 5H1YA 3WK5A 1AS0A 1X1DA 2PNFA 2J67A 3BFXA 1VCOA 3PS9A 1ZMWA 4FVTA 3MMPA 2IYVA 1HMPA 1D4FA 5JI2E 1U7PA 2IYNA 4LRXA 3W5SA 3KKOA 2G63A 4PYLA 2C61A 1COZA 4JQZA 3KD3A 3SHTA 2BJVA 1S7CA 3CZQA 1B00A 4G4SP 1FQJA 2XUQA 3K5PA 3EH2A 3K96A 3EH1A 4HZIA 4MQLA 4W5TA 4X1OA 2AYYA 3V7FA 4QTXA 3KSAC 1JHRA 2O7NA 5A6SB 4N5DA 1Z5UA 5J2TB 3K1TA 3AR9A 3U5TA 5H82A 5CW2A 2PZLA 2JIBA 5K0NA 3SYMA 3E9QA 1OT5A 5F77A 1A4XA 3VZRA 4ENPA 1IZ0A 3CF6R 1KK3A 3W6OA 3MSCA 3KQKA 4BNLA 4KQ6A 1OWMA 4BO6A 2M98A 3D1VA 1CUDA 5DYTA 3ZDYB 1IK4A 1CTQA 4M1MA 2NGRA 5CBPB 5JQGB 1QH8A 1E0KA 4IS3A 3GEIA 2CF6A 4DBZA 1E1QD 5CA0F 1UC8A 3O1JC 5C8YB 1C80A 5FWAA 1Q14A 4UTNA 3GA5A 2FDCA 1ZK0A 3GBSA 3RKSA 5KOIA 2RGOA 3OY7A 2PIDA 3E22B 2ALJA 1JHDA 3HM9A 3CURA 2JGAA 3SNHA 3MK6A 1NDQA 5ITYA 2W2QA 4MGIR 4CKBB 1AB6A 1CDZA 4RMJA 1RJWA 2FJ0A 3P5BA 1EM8B 2O6LA 3TEJA 5ITSA 1WVGA 1SVUA 1E5LA 4HUQA 1BO6A 3EEOA 3M6WA 4HY3A 2WJIA 1RJFA 3IKVA 3I58A 4K6GA 1U2SA 3QRWA 1YZHA 1PT9A 3OPYI 5DU2A 5I6DA 1Y9ZA 3L0YA 1SULA 2DI0A 3OP4A 1Q6YA 3MINA 4MA0A 1R10A 4MGYR 4KH1A 2CNBA 3WQHA 3M8KA 4L4RA 5EUQB 3QV1A 2VQEM 5G0SA 5I9SA 2HAEA 2XGGA 3VM6A 2YWFA 1QYDA 3FMPB 1AKVA 5EESA 4JSYA 4F6RA 3OCCA 5EERA 3DEKA 2Y27A 4DCNA 4UUMA 2XSZA 4DV7B 1CZLA 2HZ7A 1K7XB 5IANA 2EWVA 1IEQA 3K2LA 2FSFA 3B1VA 4LXYA 3M1AA 1R0BA 2ZR0A 5IX8A 1P77A 1VPDA 3IVMA 4D4LA 1HDEA 2H31A 1NMQA 3EUAA 1WCV1 1RRVA 2AOXA 4YV1A 3QJYA 4O2AB 2CP8A 2IS6A 4QOEA 3FNQA 3S0JA 1TVKB 3REGA 2XZLA 4FI3C 2C97A 2R7NA 1JR3E 2GM9A 4LV5B 2IUUA 4ID9A 3M6XA 3IEPA 2O8DB 4AYXA 1MORA 1SMKA 3PFNA 1WOMA 3OIGA 4NULA 2I1WA 1G21A 3TMYA 2EFHB 3MPOA 2Q5HA 2IH2A 5KQGA 3RPEA 4GAEA 5KAMA 3DOIA 2E4YA 3GBPA 4NHOA 3AFMA 1HRKA 3LCRA 5F73A 2O4CA 3D3EA 1TKAA 1XB2A 3MLAA 3UHPA 1ZQ1A 1HEIA 3VHXA 2HSDA 4M1OA 1UC4B 2FWBA 2FZGA 2J1LA 2OBLA 1G7SA 1DBQA 5TPZD 3HL4A 3ZZMA 3LTNC 1QHYA 2VPIA 2VDUE 4LWZA 1KZ9A 1NUAA 3LWZA 5I5GA 1BW9A 3A1WA 3ELDA 2P3QA 1J1IA 1WY7A 221PA 3RU9A 2SCUB 3DS8A 2ZATA 5AH0A 1FJGM 3G85A 4RH0A 2EW1A 4KEAA 3D5TA 4LGVA 1JQBA 1MJNA 1XTTA 4BQIA 4C87A 3CIOA 1OC4A 3QU7A 4DQDA 1PN3A 2QMUA 5CLJA 3P9YA 2Q5IA 4BZZA 1WDKA 1I3CA 1DRWA 1A4RA 2C7GA 2Q1WA 3L8YA 3QVSA 2VRWA 3STTA 1H6BA 4WKOA 2PGXA 2R1TB 4DGSA 1TKCA 2WWYA 1J56A 3OU2A 3KKLA 4KR3A 4BNNA 4RA9A 2C83A 5ARCA 5AFSA 5J2UA 2W42A 3NWOA 4B3TB 4WMLA 5B3KA 5EAIA 2J0QA 3BZUA 4LVCA 1VL1A 3HI6A 4UVHA 5AJZA 3HZZA 2WAYA 2E6KA 3HKCB 3HC7A 4QUEA 2VXBA 1RYBA 4EO9A 4ENWA 1K66A 1R6DA 2G9UA 3FNIA 3RVRA 2HU5A 4CEIA 1WETA 1K97A 3BUSA 1BRMA 2J0EA 5LQUA 3K4PA 4O59O 1P6QA 1JE0A 1XQ6A 5IVDA 5DXAA 3F6SA 1A27A 4CQMA 3FPHA 2C7BA 1H4SA 1QDRA 2DZNB 1KO4A 2WUDA 2W98A 5ALSA 3WGMA 2I34A 2RH8A 3DTYA 2ZZMA 4URHA 3LBYA 1R0KA 3PNKA 1HDCA 1GUDA 2GBLA 1W5SA 4YIKA 1HNNA 1DJQA 4NPAA 4U2DA 2Q50A 2M32A 3GJ3A 3PGKA 1N0WA 1UFRA 2AS0A 5TGDA 2DERA 4UUPA 3U6SA 2N0SA 1PRBA 2PBLA 1K1EA 3PUHA 1VDMA 3A46A 3MN1A 3WHIA 1QGUA 1OLSB 1ORVA 5KOJB 4DV0M 1AUXA 2Q7DA 1FS6A 1GT6A 3TUJC 3HGTA 3A4TA 4FFNA 1Z73A 3CH5A 4R1NA 2QLJA 5JZSA 3P2EA 1N4AA 2V7TA 4IBJA 3KE8A 1Q3HA 4UDOA 1AJEA 2LPMA 4EQZA 2XDQA 2I4OA 1X70A 2QRKA 2HIHA 1FP1D 5TVKA 4MB7A 1UKZA 1UF9A 2G0AA 2GPAA 4H7PA 4JLVA 2B9EA 2O1SA 3U61B 3RG2A 3TNDA 5L8RF 4OHYA 3K0BA 4UTXA 4TUYB 5B12A 4Q21A 5ER9A 4UBJA 3AJ8A 2H4HA 1F8FA 3V3TA 4P4SB 3AT1A 1BHJA 5DULA 3EG5A 1WULS 1QZZA 1GZ4A 2C9DA 1NI5A 3RB8A 2ZE6A 4RD4A 4UVDA 4EF5A 4IIXA 4BX8A 3WNVA 1B0AA 1GP2A 4RHCA 5THXA 5FTJA 1MNQA 1T0UA 4LXIA 2QMQA 3EEQA 3WB0A 5D7BA 1P4GA 3NATA 5K0CA 5JJLA 1N6OA 4RJ2A 1E3MA 3M2PA 4LZWA 2PLFA 4K3UA 1E1NA 4CLRB 1HLGA 2A5JA 3AF5A 4G5OA 2H00A 1R5OA 4EYGA 2OV3A 5T8KC 1X80A 1YJ5A 5FJIA 5E1BA 3KSUA 4L28A 4J1TC 2VUHB 5T4HA 4LDQA 1W44A 1J8YF 3RODA 1VCHA 3AHEA 5FPPA 2ORIA 2A58A 4IIDA 4TVOA 1LQTA 4YC7A 3K1YA 2IDJA 4DVGA 5BWLA 3SR3A 2VNJA 1JLSA 2PRZA 4RPJA 3GLQA 3W6UA 1DX4A 3NIDB 2X4LA 4O5AA 3FCCA 4D8TA 1XMVA 1THZA 1SQSA 2YRFA 4X97A 3TBKA 4XD7D 3ON5A 2K9DA 2A9QA 1E3LA 3E8XA 3IJ5A 3NBMA 2QBYA 1NY6A 3C6QA 2B3TA 5M5BA 3CCFA 4DWWA 3CKLA 1NG1A 3IR6A 3PD0A 3C8HA 2HKJA 1PR6A 4ALKA 4KAAA 2FZLA 2AVNA 1LS1A 4RZQA 2BUBA 1G3RA 4GLJA 2OECA 4OGFA 4RE6A 1RI5A 3UUWA 2C5SA 3UUGA 2RK6A 4MGZR 3IAXA 4I8OA 1UADA 4RTRA 3CW8X 3PPWA 5BMVA 2VA9A 1OXMA 2AR7A 2V54A 1JB9A 1XRQA 4NARA 4DUGD 4IQ8A 3F3KA 1AD2A 3TLMA 1AXRA 3DFFA 3AY7A 1NG9A 1D6SA 3FNBA 1GADO 4RESA 4YRAA 5BR7A 3EGXB 1A8SA 3CUVA 1MV5A 1Z2OX 2PL5A 3I05A 3ID6C 4LXXA 1E7QA 1R0RE 3P2OA 1KVSA 3JQBA 4RHTA 1ILEA 5JLJA 2BM9A 4BB0A 4FFLA 2RHOA 2ODQA 2R4QA 3DCIA 3CEPB 3ZNOA 1UMKA 4I1YA 4O08A 3LU1A 1ZM9A 4CMCA 1JKMA 4XIIA 2CCJA 2EO2A 2Y1CA 2XE4A 3FKJA 4QM7A 2OA0A 3UATA 1KJZA 3LOPA 1FF9A 2JEYA 3N0WA 4DV2B 1DTEA 3RROA 2AG1A 3QLEA 2FUNB 2PRSA 4DCJA 3L82B 4MUNA 2ZJ3A 4HDOB 1HE3A 4QEDA 2PX5A 1X7WB 3GO8A 5JE8A 3ND9A 4PPFA 3RIGA 1UXIA 4CU5A 2W6MA 1FP7A 1UWCA 4G5GA 3ZDFA 3R3JA 2X8JB 5LZ9A 4DA9A 1KEKA 3ZE7A 2I5PO 2DFNA 3SS8A 4NYIR 3HGIA 4M0MA 4TRMA 2K4MA 1I14A 1L4LA 3OQVA 3CPJB 3W6PA 4LYHA 5K01A 2WJZB 4QNRA 1GQRA 2C95A 5G3ZA 4J1NA 1FFXA 3U9TA 2PTGA 2GM5A 3DVRX 1V47A 1MABB 1YASA 4A8TA 2H63A 4LYGA 4HFJA 3KKEA 4A73A 2B78A 3X2FA 4EVQA 3JWJA 1ZJ6A 4G9BA 1S2NA 3FX2A 3BB4A 1USVA 2EDCA 1RQ7A 2OFWA 2Z5GA 3EWIA 3MOGA 2VH5R 4PGMA 4RQAA 5IABA 3VK8A 4Z8XA 5DNVA 4KO3S 4Y28F 3FW1A 4D02A 4JDUA 4BO9A 3JWPA 2GNAA 3DE7X 1N36B 2EG5A 4MQ4A 3G17A 4RTJA 3B7ZA 1S5PA 2GN1A 5ICFA 3MQ4A 1E6CA 4ZYWA 3AFIA 4RTSA 1SG9A 4JKOA 4QYIB 2BY4A 4NABA 1ISJA 5THKA 2IXEA 1YL6A 3O0DA 4P0TA 4S2EA 1QOPB 3DE6X 1TJYA 2JY8A 2FSVA 4Z4EA 3IHLA 2QORA 2IZOA 1H8ED 2GZMA 2B4AA 3D8LA 1X1SA 3SSAA 3UNXA 5EXSA 1BWQA 3A04A 2QIPA 2XBLA 1JIKA 5GVSA 5M04A 3JATA 5ECDA 3VDPA 3ORHA 3CCCA 1GA4A 3GFTA 3OPXA 2XGMA 3JQ9C 4AY4A 2NZUG 3WGHA 2QW8A 3QE2A 2QA5A 1N5OX 4HGRA 5FHQA 4B3IA 3WK6A 4AS1A 5LFAA 2X77A 5BRNA 3P9RA 3K5WA 1E32A 1NAIA 5J4HA 2WY2D 4NL4H 4X63A 3J7AS 2HPVA 1ZMXA 4WINA 4HDNA 3O8CA 2O1XA 4NK4A 1MQAA 4KXXA 2Q7XA 3OMLA 1KARA 1X7ZB 2OGUA 3ILXA 1TZKA 3TL3A 4BEVA 1BD4A 3AUJB 1PBTA 5DK4A 3PXAA 1GR1A 3UMGA 3GAFA 1ZJYA 2HA2A 3N9IA 1DX6A 2RHBA 3PFIA 2X3FA 3BPSA 1A8QA 1IBSA 3OIDA 1YNOA 2NSLA 3RSZA 4ZMSA 2GBCA 5AK4A 2ZIGA 3RVJA 2IQ5A 3NP7A 2ZAMA 1S8FA 3BIJA 1EE9A 1ISHA 5IYZA 3PC3A 1RHUA 4EPWA 3KOUA 3HV0A 1XCLA 2NYRA 1E94E 3ZTWA 3GWGA 2GA8A 4CNBA 3LDHA 4Z1MA 5DFLA 4DIUA 3AESB 4JOCA 2JFZA 5KUTA 5AXBA 1IFYA 3SAVA 1FX0A 3ZE2B 1Q3KA 1N9ZA 3MELA 4PV7A 1RJ9B 4NE7A 3D6FA 2FPLA 2IV7A 2LGJA 1XBTA 5E4YA 3WAJA 3ZBTA 2KYRA 3U7JA 1NMZA 1UQRA 4GHLA 1ULHA 1H4TA 3DE2X 3HXPA 2BM0A 1FUYB 1XALA 2WE7A 2WHQA 3EGDA 3IPLA 2W0SA 1ZH8A 4KN6A 1YJCA 4QJBA 2E48A 3SFVA 2OQIA 1LRJA 2CHVA 4UARA 1XZDA 4OSOA 2EKLA 1UAGA 2I6QA 2Q07A 1Y5LA 1E4EA 4HADA 2K87A 2PLNA 4WBXC 1Q2XA 4AG6A 4D3XA 4EF4A 2O8CA 2X8LA 4XTRA 4AUEA 3EVZA 1ZNXA 2C04A 4RIIA 4O3MA 2HJWA 2QM7A 2DWPA 5A5DA 1TAUA 3URMA 3IKMB 1G6Q1 2QSYA 4RLFA 2D2FA 3VSCA 1CUUA 2AMVA 1R2YA 1JEYB 2FQ1A 1SBZA 3H1BA 3VR6H 4JFRA 3LRPA 1UMBB 5A2GA 3K6SA 1CJVC 5B55A 3N2GA 4FYHA 3E82A 2FSSA 2IBTA 1N1MA 3A0UA 4BQNA 1V34A 2VAXA 2PGLA 3IUYA 3DKKA 2HA5A 3L26A 5DLEA 4IM7A 4M83A 2PWYA 3UGJA 3HBNA 2HD4A 2HPZA 4IH1A 5DP1A 4EYSA 4M98A 2FMXA 4Y2JA 2A67A 1V5IA 4RDCA 4EUEA 1O96A 1Q1ZA 4NEHB 1FNBA 2DU8A 2HWJA 5K45A 1TAQA 1QUSA 2G6TA 3MJHA 3KK0A 2XKJE 2HTFA 1WPGA 3O8DA 1MX3A 4I8XA 2BR4A 2G4LA 4NU6A 5F35A 3R3WA 4BEJA 3K2QA 2K5UA 1A72A 1T5IA 3L6EA 5CVEA 1EDEA 3IA2A 3RIXA 5FBQB 2Y67A 3JQDA 1P3QQ 1F6DA 4D8WA 2ZIZA 2PRYA 5BYAA 2REQB 3CONA 2VHXA 4PHFA 2FQWA 1T0PA 2W11A 4MROA 3I6YA 4J94A 2YJ5A 2MWMA 3HXQA 2HJVA 2GJSA 3UCFA 2CXUA 1KMHA 1BDJA 1E6MA 4UE3S 3HUEA 2WUEA 4B3CA 5A4DA 3TGPA 4DGQA 2EU8A 1JVBA 1VLMA 2JFNA 1KSHA 1FIUA 5CUQA 5A3SA 5FWYB 2JJQA 3T15A 4L3VA 5CVVA 2HMVA 1ENZA 3IQZA 3R3XA 2V6JA 2Y0BA 4FE4A 3MB5A 5G0WA 2YCLA 3SLGA 1P3JA 2Y1DA 3ZZ0A 3O0TA 1KAHA 1O6GA 1HM5A 3KB1A 3HBAA 4YB8A 4RZ3A 4JBLA 1J99A 2P9EA 1R64A 4JT8A 2Z5VA 5BOSB 5JTUA 2IRWA 3I52A 3B5IA 1TTTA 3VR5A 4ND4A 1B16A 2EJTA 2H85A 2Y0EA 4EITA 4DDVA 1EZ1A 4UNQA 4J1QA 5LP6F 3SEAA 3LLVA 1L7AA 3KQMA 4ND6A 4B35A 2VAWA 1SIBE 2X7HA 1B6TA 5C34B 4MEAA 2W58A 4O2BF 1FFCA 4MPPA 2GXQA 1XP8A 1N1GA 5LQNA 4O0MA 3RU7A 3WOVA 3ZR4B 4FT2A 1HH4A 2ZZNA 3NG1A 1KMNA 3H1TA 1Y48E 3AVXA 4JBNA 4UE2A 2I0FA 1OTHA 4JNKA 1U2DA 5M34A 4TSFD 3B74A 5TQ2B 4AS3A 4CM8A 4GVPA 2OL4A 3W4KA 4BXOB 4CWAA 2P68A 1JXAA 1YD7A 4JY7A 3ZHYA 1YZKA 3T0IA 3G5MA 4A3VB 3SZMA 2V7XA 4YS6A 3LPMA 2WF9A 4AF6A 4GPIB 5IT0A 5D3MA 4LRSB 1YB4A 1JEEA 1N3BA 4OQMA 2PEZA 3T0GA 5FLKA 3ESAA 4W8OA 3NKLA 4RVHA 2X0NA 4C4RA 2FR8A 3IMGA 3HTXA 3BS4A 2SECE 4R1OA 2O8NA 1L5LA 2WT9A 1FZQA 1H5NA 4CZ2A 2XFSA 3QEKA 5EWJA 5E3JA 3JAMA 2GXAA 4DEVA 4C0JA 5I48A 1D0VA 3FOFC 1I2CA 1JDJA 2E37A 1KEUA 2PXAA 2MHCA 2DPYA 2BEWA 4H7DA 3ZKWB 3VR5H 5IXJA 1IXKA 4C9BA 2DG2A 4HYYA 3G5LA 3T5PA 4ADSG 3CJRA 4BFYA 1QTIA 4KFUA 3I28A 2X0EA 3OHMA 4LSGA 4C30A 1Y9DA 2PT9A 1YI1A 1T8RA 1NHWA 3G0OA 4X1YB 5ENZA 3AERA 1P9OA 3THYB 1XEFA 5FV7A 3HE3A 5LLTA 4J0GA 2CDRA 3PQ8A 1WCXA 4B7CA 4QXAA 4PYIA 4HNGA 3R76A 3STWA 2L6OA 1EINA 5JRDS 2RH9B 4ZO4A 3LH5A 3CN7A 2C59A 1FRQA 2NOAA 1KZHA 4Y6LA 1QFSA 5DLYA 1QTQA 1NBHA 4C0XA 4FDVA 3U3OA 3JVEA 1XZGA 2J09A 1R9JA 3U4HA 3I4YA 3UJCA 3MRXA 2VYVD 4X7BA 4RL6A 2P7IA 2QX4A 1EXNA 3LT0A 3VVCA 4WFQA 1IQ0A 3HCRA 1QLHA 2JGNA 2I55A 3DAGA 1Q95A 1DCKA 1X1QA 3FZGA 1F4IA 2FPRA 4B85A 4KN5A 2GWRA 1U5BB 1XNJA 2WFMA 1KS2A 4KNYA 3LHIA 1KYWA 2YXEA 1VCMA 4ZDWA 3ANNA 2A4MA 4XWWA 4JIGA 3SQOA 2WTEA 1O94C 1JA0A 4B3SM 1CQJB 1GPDG 2AFIB 3QI2A 3KJZA 3F6CA 4WNIA 3Q0TA 2B4QA 4BKMA 3QG5A 2CL6X 4OD0A 4N18A 2F1HA 3JQAA 2J3KA 4EA6A 4EWLA 3OG9A 4IJ5A 5LVAA 3ZI4A 1QUEA 1RWNA 2XV1A 4NSRA 4WERA 5BN3A 1VDZA 3INTA 4QOZC 1W9HA 2ZAIA 1HPLA 4B0OA 2EWMA 3RTCA 1WXHA 3GCZA 4HDSA 4IQFA 4F7DA 2UUBB 2Q6VA 1F7VA 2HMSA 1J21A 2A4KA 3TJZA 3L2AA 2FQXA 1BS2A 2C98A 1S2GA 1OGYA 3BRWD 4AMGA 2VF5X 4JMLA 1A7KA 4ESEA 5JZVA 3KJQA 3IMKA 3GNTA 1HDYA 2RHHA 1HE1C 2ZDGA 3TSCA 1TKRA 1K6MA 3PPVA 5K3FB 3AIKA 4YV7A 3KHTA 1ZLXA 5A62A 4BNDB 1XAIA 2HWYA 3LG2A 5AQEA 1DTWA 3IHTA 4G3XA 1DWQA 3V2UA 3MYRA 2AT1A 1EP3B 4IBCA 3EEFA 1O0BA 3F98A 1J23A 4M0FA 2F5SA 5KO3A 4EI7A 3N5KA 2J9YB 1R0ZA 1A5BB 2WU8A 1FRZA 5HSGA 1ZK3A 3EAQA 3ZU4A 2UYGA 1SU6A 4F6LA 5AK5A 1IN6A 4X6UA 4MCHA 2ZYGA 3L4SO 2K0BX 2D74A 4YDHB 1E92A 3GYBA 1RAIA 1ZNQO 1PJAA 1IAQA 4WFJA 4AKIA 2W6IA 2YY6A 3IT1A 5CEFA 3GMIA 3RSFA 4MUGA 2P6RA 3UK2A 3T38A 5L3QB 2WSEF 2X14A 1AQ6A 3KQLA 1F2UB 2FSGA 2EEPA 4DRXA 2B8WA 2FH0A 3AFHA 2I29A 3GT3A 3RHZA 2ZKLA 2OCKA 3K71B 2QY9A 2JBHA 2C4KA 1H93A 5ICEA 2CB9A 2YIVX 2AZMA 5E6RB 4WXMA 1DB3A 2HIAA 2J3EA 5ARBA 3TRFA 3F8SA 4B4WA 3FBWA 1EJ0A 2CYBA 1TMGE 2GPWA 2HRBA 3N70A 1FU8A 1QU2A 4ZZIA 4N0MA 1OJ7A 4AY3A 4QUHA 2ZK7A 1T4GA 3DDUA 3P0RA 2NZ2A 3NBUA 4C4OA 4QARA 2CMFA 2QRQA 5CFZA 3KWFA 3GT7A 1U0GA 4AY5A 5EFOA 4GOND 2QN2A 3TR6A 5COAA 4N5MA 2P3OA 3QFCA 3UENA 3B36A 1PFGA 2Q0HA 1KSJA 3CZAA 3LP5A 3KXIA 3VU0A 4PIMA 4LI3X 1QDLB 1VKRA 1Q83A 2QRNA 4A82A 2G5GX 3I45A 3KR9A 2I3GA 3ODGA 5HK9A 1K63A 2O2ZA 3VO2A 4WURA 3U6LA 4QOJA 4S2UA 3HJ8A 2W22A 4KFSA 1OUMA 4OBXA 3AEQA 3U3MA 2FPOA 3I04A 1I01A 4NZOA 4LF9M 1UPFA 1MU5A 1KOJA 3DTVD 1M66A 5DGCA 4FR2A 5F9MA 2HAKA 2DJ5A 2ZBPA 3KKMA 2NO9A 2ZFUA 4ZANA 2QV0A 4JODA 4JI1M 4D0RA 1YAJA 1OU0A 3BHNA 1X13A 3IA7A 2QG4A 2PHZA 1FCJA 1WCIA 1V3UA 1KDOA 4FFDA 1KPHA 1R4MB 3PU6A 4FGLA 1EXMA 4KSBA 1NLZA 4EKIA 3ZWKA 3GDFA 4KREA 3KVOA 3DE0X 4JXJA 4R40A 2PMEA 4G0QA 2WOOA 3ZY2A 2VT7A 1UPUA 5GOTA 3NI2A 1ZSYA 1TLTA 1RCTE 1WU7A 2CRUA 4ITVA 1K6JA 1KEWA 1Y1SA 4BU1A 4HEOA 1FQWA 2DWQA 3KQQA 4XGNA 1XTSA 4M0UA 4FI3F 1V11A 3GG9A 2Q1UA 5D8DA 3VKHA 2DAMA 5AHWA 1GRQA 2XCTB 2ZBGA 5I4IA 5ANRB 5AXCA 1QO0D 5ED4A 3CINA 2X7XA 3QUQA 3S6JA 1E66A 3CNEA 4N0EA 4RE5A 4PZ0A 4YAFA 3SQXA 1Z7WA 4IBKA 4AYTA 4G9EA 2QF7A 3TL6A 3BSWA 3ROXA 4P98A 2UAGA 1S3SA 3IUQA 1LRKA 1EBUA 5CDFE 3VDQA 5JJ5A 4MDYA 5BP7A 4PZPA 4F8YA 1KDTA 4BNIA 3ORYA 2ZQYA 3F5FA 1H85A 3N7AA 2OXEA 3WTCA 1QO9A 1LF0A 4BUCA 3NHRA 1SCQA 1NSTA 2MJ5B 1WEHA 1MNAA 4Q3NA 3A1NA 4IGIA 2JFWA 5GADl 4ZU1X 4LRUA 4X44A 5BUSA 3QYFA 2GASA 4D5GA 3G2IA 3NB0A 3LNCA 4BO3A 4BQQA 2DVMA 2YIJA 4UKDA 5KVCA 3QVGB 4Q4AB 1A2KC 1TU4A 4U7GA 3VNBA 1E9CA 4ARSA 4B80A 5EWLA 1TOAA 2QOEA 3T7KA 1ADYA 1K4YA 3UPTA 3P26A 4RGQA 1Y6RA 1IB0A 1U0SY 2G80A 2JCYA 3AKCA 4HZUB 4LY9A 1W48A 2ZU0C 3R2JA 1WB6A 1OA1A 4AY2A 3OJWA 2GGSA 3GT0A 1JMVA 1T1RA 4EPXA 3DJFA 1EI9A 1Q3CA 1GVNB 1I4LD 3ZGLA 5EMLA 3SZGA 1WUHS 4BVGA 4ZCMA 5JAQA 3V4RA 5KNCA 1OBFO 4HDCA 3NUGA 2C7PA 3ZU6A 4Q4DA 4WZBE 1CY6A 2W4QA 3WYNA 4L9WA 3FPEA 1U1DA 4KQMA 2PL3A 1G5RA 5DTJA 4BQFA 2X4GA 4AF8A 2JNHA 4RXTA 2VOEA 3RYCB 1AUPA 2VEOA 4MHTA 1DGHA 3W9YA 4OP3A 3JQQA 2P5TB 1E1RA 3OIYA 4JYMA 1U8FO 1ZHOA 3OZWA 1T9GS 5JARA 2ZYVX 3E05A 4JT9A 3Q7IA 1IXRC 3HYLA 4NBTA 1HUQA 5KMGB 3RAFC 3HCFA 3PRJA 1CZNA 1Z4LA 2BSAA 3M4JA 4HMQA 4JELA 3JWEA 5KWJA 1G4HA 5HWSA 5D6NA 1OJLA 2P91A 3GX1A 4RZUA 1ESZA 1O9BA 4IVPA 4M2LA 4YMVA 3D4IA 2IHJA 3DT8A 2VDKB 4WXPA 1MQ8B 1LNQA 4KHPM 1KK0A 2OORA 4B3RM 2OXCA 1ZD3A 4E13A 5CNMA 1ADBA 1T6NA 1YKGA 1Z29A 4BAGA 4Y3UA 4N0DA 4NYMQ 2GO1A 1YQ9A 3MWDA 4CTMA 1HA3A 2H6EA 1U65A 4QIHA 4BQRA 2CDBA 3WIOA 4MH0E 1AS3A 2KE5A 2X1HA 4GPZA 2TMKA 4MS1B 4EY6A 1QR2A 5MN5A 5FTMA 4DQ0A 1TQ8A 3FDJA 1KYVA 1YHNA 1P60A 5J5AA 3MERA 1NBAA 4RORA 1WIWA 5FUBA 2N46A 1JLKA 1PSDA 4MUEA 4WESA 1DRVA 4IO1A 1WABA 3EZLA 3VKVA 4KI7A 1SKQA 1QV9A 4F4DA 2NVUA 3A9WA 5HGXA 1MRZA 3Q40A 1J8FA 4Q7KA 5FBHA 3QX9A 4DDTA 1P5HA 1PNVA 4G4JA 4CIDA 1SJ9A 1OGIA 3BHMA 2JBAA 3IP6A 5D5PA 4BTLA 1N7HA 4J3JA 3BX1A 1ZPDA 5EJAA 1TM2A 5KNCH 5J1SB 2ERXA 5EWMB 4L5YA 1UUFA 3ICPA 2YWJA 1NUQA 1Y1RA 2ADFA 3SHWA 2D00A 1ZXLA 3JW8A 2FK7A 3KQOA 2DKNA 4TS1A 1B2RA 1THTA 1GZ3A 5K0ZA 4PQEA 5JROA 1JLMA 1M9NA 4TPKA 1B6SA 3TIXB 3PXDA 1G1AA 1EVZA 4NG4A 1KXZA 2I4RA 4PLVA 5ITZA 1U1FA 3OM8A 2FOIA 4E32A 4OX9M 2RHDA 1XHBA 1WR8A 1TCUA 2UVQA 2WYWA 3C43A 2V7VA 1HT2E 3VNRA 4FDAA 4P3PA 3R75A 1ZD4A 2REBA 4XQ9A 1EFLA 3BL5A 3NBAA 3ZS9A 1W73A 1L1TA 2GERA 2NU8B 3I4FA 3FGZA 2IC5A 3HCEA 3WMWA 1OI7A 4QE3A 2ZYTX 1UP4A 4DZZA 1Q0LA 2PN1A 4C7KA 3EIOA 1BQ3A 3C97A 3U37A 2H1VA 3PSAA 5FF9A 2W8BB 4H0NA 1IM5A 5KX5B 1Q7CA 1O89A 2GAIA 3O90A 2VRCA 3B3AA 4XCQA 4FE3A 4C1NA 2BFEA 3K20A 2XZPA 1H05A 1POXA 2I7XA 5F7ZA 5IULC 3H1EA 1U3GA 5FT9A 4BV3A 1LZKA 3L1HA 3SG0A 2I8CA 1OAAA 3I30X 1IM8A 1J24A 2O07A 4L2IA 1TUEA 3PFBA 1S01A 3KQVA 4XPIB 1JI0A 1D4ZA 2QZZA 2F8TA 3HVRA 1R9GA 3EK2A 2X5XA 1DQZA 1PJ4A 1Z2NX 2G0TA 4PT5A 2WM8A 2HSZA 4GI5A 1E9EA 4DC9A 1WF3A 2XUOA 4B3DA 2CVZA 3U17A 4M9QA 1XRMA 5BT9A 4EAAA 3E1SA 1HURA 3WV4A 1XRSB 4LJAA 1UOOA 4BE7B 3AOEC 3MWGA 1AY0A 3NXSA 1CC1S 4GYKA 2B35A 3KM0A 4G26A 2PUFA 2PFSA 5LYJB 2E3JA 5DN9A 3CB4A 2ZWVA 5ALOA 4QBKA 1J2RA 2Q2EB 1Z6QA 3OOJA 2GRJA 1FSZA 3MILA 2ZYSA 3EXHB 3U7FB 1QTRA 1GPWB 4GI3A 3SZUA 1YWGO 4LCJA 2Z04A 4WFIA 3E5RA 2W5UA 3S27A 3HABA 5FSWA 1M6VB 4RGBA 2E5LB 4G0OA 1JP7A 5A7FA 2ZRKA 4LZNA 4NOLA 2DQZA 5B1DA 4MVJF 5E4TA 1Y8AA 3L8HA 3CX7A 2IF0A 4GRDA 2EF0A 3QWFA 4YCAA 4FFOA 5JZMA 4B6GA 1Y1LA 3LW7A 2NO5A 4NU0A 1ZVJA 4WT7A 2XA9A 1IU9A 4FEGA 5EE0A 1DOHA 3AKYA 2PSHA 2M6KA 1ZL2A 4K2AA 1H0HA 3IP5A 2DKOA 4QZVA 1PJTA 4KMOA 2O50A 1UBNA 1P4HA 3EZGA 4JEMA 4AQYM 4PS0A 4DDHA 1VSBA 5L3SA 1NM5C 4U39A 4AKHA 5EP3A 4ZEXA 3P20A 1W0KA 2K2QB 5BW5A 1LBHA 4N41A 1LEHA 2RGNC 4A8PA 5K6TA 3OLCX 1UXHA 4DG9A 1JVSA 1P29A 4BLTA 1V9SA 5REQB 4M54A 3ICEA 4WA7A 4QWMA 5IJWA 1C9JA 5CVCA 2V6IA 3COSA 1TM4E 3IMFA 4DLNA 3R9XB 4P2GA 1D0LA 5DTEA 3TOCA 4LHWA 1GPMA 3DUFB 2OOKA 1AIPA 2Z9DA 2WJHA 2Z58A 4Z99A 4LUCA 4HUTA 4DR6M 3HFJA 1E2BA 3IH5A 4ASUA 1XU9A 4I7EA 1X8JA 4HAYA 4D6PA 4XUCA 4FLFA 1ZGBA 4W1QA 3H11A 2FPPA 3BMOB 1H6DA 5FR1A 3ZUPA 1ZUD1 2PGNA 4BWVA 2GUWA 2RD2A 1Q3TA 1NNJA 3H5IA 4OH7A 3SK0A 1A7AA 3INRA 2XRYA 4FE7A 3MG9A 2HTEA 5BSFA 4IIEA 2WTBA 4Q7LA 1QE0A 4RM2A 4RF4A 3BGVA 3WXMA 4JLAA 4P4GA 1C1XB 1M67A 4RS3A 4CIVA 2IYEA 1XF1A 3BZWA 2OSVA 5GM2A 5KQDA 3IBSA 2PSFA 3S7ZA 1L8LA 4II7A 4EB6A 4YUWA 4XDGA 1A98A 1KZ6A 1NNSA 4ZO7A 4J0JA 4WLVA 4G9GA 4QX6A 5BQFA 3U3XA 3FVWA 4PZ