4DV5M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv5M02
1K82A 2UXCM 4NRWA 4JI0M 2F5QA 3C58A 4PDIA 4JI3M 3W0FA 4X66M 5ITXE 4JI8M 3U6SA 4GKJM 5LMNM 1IBKM 4MB7A 3A46A 2UXDM 3U6OA 5ITRA 1Z5CA 4G4OA 1I94M 4X62M 5ITQA 4K0KM 3U6CA 1XMQM 1MX0A 3VK8A 1J5EM 3U6EA 4B3SM 3A45A 5ITTA 4NXNM 3GPYA 4G4QA 4DR5M 1XNQM 1R2ZA 1Q3CA 3TWLA 3VK7A 1Z59A 5LMUM 2UUCM 3A42A 4DV1M 3DOAA 2F5NA 5ITXA 3JR4A 4AQYM 2UU9M 4DR2M 3SASA 2OPFA 2Q2EB 2F5PA 1L2DA 2UUBM 3GQ5A 4DR4M 1Z5BA 3GPPA 1PM5A 1Q3BA 4LF5M 5IWAM 4JYAM 3TWMA 3TWKA 4B3TM 4LF9M 3GQ3A 2XZFA 4LF7M 1KFVA 4CISA 4DR7M 4DV5M 2HHHM 3GQ4A 4PD2A 1N34M 1L2CA 4JI6M 2OQ4A 4PCZA 4X64M 3SBJA 1PJJA 1MU5A 1L1TA 3U6DA 1HNWM 4LF6M 1L1ZA 4JV5M 4DR6M 2XZUA 1K3XA 2E5LM 2F4VM 4LF8M 1HNXM 4NXMM 3OTOM 5FLXS 1XNRM 4KHPM 3U6QA 2UXBM 1IBLM 4NRVA 4X65M 3J81S 3SAVA 1HNZM 1K3WA 4LFCM 4DV7M 4DR1M 1N32M 5ITUA 4DR3M 4LFAM 2F5OA 5IT9S 3U6LA 1N33M 3JR5A 3SAWA 3SARA 2VQEM 1HR0M 1IBMM 1PJIA 3J80S 1L2BA 3SAUA 4YHHM 4GKKM 4DV3M 4JI7M 2UUAM 3SATA 3GPUA 1TDZA 3U6MA 4DUZM 2ZBKB 5ITYA 5BR8M 4YY3M 1XC8A 4PDGA 1N36M 3J7AS 3JAMS 1NNJA 2HKJA 4JI1M 1R2YA 2ZM6M 4LF4M 4ITQA 4B3RM 1TDHA 4DV2M 4DV6M 2F5SA 2EA0A 4DV0M 4G4RA 3U6PA 4LFBM 4JI5M 4DUYM 3GO8A 3GP1A 1Z5AA 3GPXA 4OX9M 3T1HM 4JI2M 3T1YM 1Q39A 4B3MM 4DV4M 1FJGM 1XMOM 4G4NA 4JI4M 2VQFM 5A2QS 1EE8A
chains in the Genus database with same CATH superfamily
4LJAA 2DZLA 2ZANA 3B7NA 4FCWA 4PT5A 2VF7A 4NRWA 2QCUA 5FTKA 2R4JA 4LJ8A 3GLFB 3U61A 4JI8M 3FUTA 1DGGA 2QHOB 4KODA 4ZPXA 5FTJA 3U6SA 4GHLA 4MB7A 3SHGB 2UXDM 5ITRA 1ZAEA 2APLA 4X62M 1QAMA 4L6V6 3J7BA 4A3VB 5ITQA 1V33A 2FE8A 5JI2E 1H6UA 3ZH9B 2JY8A 2YQZA 5C18A 2I7NA 2J7OA 4MGHA 5EXXA 3VLFB 2DAKA 3J2PB 2D7EA 4AG5A 2QSFX 2NQ8C 3CGWA 5EXTA 3UK6A 2FOIC 1G59A 3KOYE 3PXGA 1DO0A 3NBIA 3LQRA 4GITA 5ITXA 3JR4A 1HQYE 4KO8A 5EP3A 1GO5A 2UU9M 1YUBA 3SASA 2OPFA 5EQTA 1L2DA 2K0BX 2DAEA 3GLHA 4IJFA 3HZJA 4GHAA 2X49A 3TWMA 3LVVA 2QPAA 3FUWA 4B3TM 3KS4A 1XHBA 3GQ3A 2XZFA 1V34A 1SXJE 3K9OA 1YSYA 4XK8F 4LF7M 3LQQA 1TGUA 3H4JA 1G71A 1NHGC 1NV9A 2AHMA 3E9SA 3M7GA 2Y0QA 3U61B 1QZMA 2FNAA 2HAKA 2LHGA 2CV2A 4GMQA 2YNMD 1SXJD 1GLNA 4L4UA 1WR1B 1OIZA 1OTRA 4FW9A 4DR6M 4LF8M 2VDBB 2R62A 4FWDA 1HNXM 1XNRM 2CEAA 2R44A 3FTDA 3IG5A 4LJ6A 4KHPM 4P16A 3FUUA 3T6PA 2BWEA 2LWXA 3K2LA 4GRIA 4NRVA 1R7RA 4X65M 3J81S 2MH8A 1DGHA 3M0EA 1IN8A 2HWJA 3AFHA 2CHQA 2R6FA 3T15A 4KT0F 2CV1A 4DR1M 4DR3M 3U5ZA 2WSEF 1LTMA 1WJ7A 2CHVA 1N33M 5EXPA 3SAWA 1HR0M 4LJ7A 4GKKM 2HCBA 3HU2A 7CATA 1VEKA 3LMMA 1HJPA 3E46A 3GRYA 4OVZA 2MGWA 4PDGA 2HKJA 2R4EA 3FTEA 2HL7A 1KYIA 2JA2A 1TR8A 3QYBA 3IHPA 4LRSA 3HHZA 1QDRA 1TDHA 4WURA 1JB0F 2L4FA 2LVAA 2Z8YM 3HU1A 3UGJA 1RU3A 3L25A 4G4RA 3CF0A 1ORYB 1A5TA 4DV0M 2WSCF 3VFDA 1I4WA 1WGNA 1TTEA 3CTWB 1R5LA 3U60A 3AOEC 2KEBA 3M6AA 3SMPA 3FD9A 1N77A 2XLJA 3T1YM 3B7ZA 2Y0TA 3GLFA 1D2NA 4B08A 2ZTCA 2JY5A 3HHWA 1NO1A 3FUXA 3Q8GA 2DI0A 4R7GA 4JI4M 1DGHB 2I7PA 1Q02A 3GRRA 4GIPA 3MMPA 3U5ZB 4B7HA 1Z6TA 3SMSA 2LBCA 2F5QA 2V1UA 2D7HA 4X66M 5ITXE 3AJIB 3U6OA 1S3SA 1Z5CA 4WP2A 4L16A 3C3DA 2FFJA 4OVZB 3ZC7B 4QOSA 3HHXA 5FSWA 2JUJA 2LVOC 3A45A 3GLHE 4B3SM 4AI6A 4G4QA 3KXEC 1TH4A 4GC9A 3GPYA 4QOZC 4HLQA 2KNZA 1R2ZA 2XSZA 4MGKE 2BJVA 2X4AA 3TWLA 3VK7A 1OAIA 4JN6A 3K8ZA 5KPTA 1OQYA 2L09A 3DOAA 3KVWA 4FD2A 3HKPA 3U60B 3W67A 4XGIA 4AZFA 1L8QA 2Z3XA 3LCUA 3FUVA 2DZNB 3GQ5A 4DR4M 3GPPA 2O25A 1PM5A 1T6OA 3KOXE 4JYAM 3I01M 2Z7JA 1NY6A 4S12A 3TWKA 1G3IA 1IXSA 1W5TA 2M5ZA 5JI3E 3IG8A 1IN7A 1OIPA 3HJQA 3VKHA 2ZTDA 3ZQJA 3FE3A 3PFIA 4JI6M 3AV0A 2OQ4A 3SFZA 2YR0A 1PJJA 3UMMA 4IIWA 1NHWC 3I04M 1L1ZA 2KA6B 3MK6A 4JV5M 4IBJA 1EIJA 2DNAA 1N78A 2CWBA 4IBCA 4Q7JA 2JZ0A 4NXMM 3AKZA 1NJFA 4D80A 3U6QA 4P17A 2XGNA 1QAOA 2L6OA 3PVSA 4LCBA 3BBZA 2A5YB 1HNZM 1OKSA 1JQJC 3L26A 5L8RF 4DV7M 2CE7A 2W82A 5ITUA 2F5OA 3U6LA 1QQWA 1UM8A 4BBAA 1HT2E 1MJGM 1J09A 1HT1E 2JWSA 5DNYA 1IBMM 1L2BA 1J7KA 1GABA 3D8BA 4YHHM 3C3EA 1E32A 2B3TA 2N35A 1GJSA 2UUAM 4UN2B 1TH2A 3GLFE 2ZBKB 2DKLA 5BR8M 1IXSB 2BWBA 2JXNA 1N36M 2C99A 3JAMS 3H4MA 2JY7A 2Z4SA 3F92A 1DO2A 1GL6A 4RKUF 1AUAA 3HX3A 2F5SA 1JR3A 3SC3A 2G8LA 2EA0A 4LFBM 3U6PA 5IZ7D 2L2DA 3NWLA 1QVRA 2BJWA 2QP9X 1PGYA 4BLCA 4B7GA 2H1RA 1X37A 2LVPC 4JI2M 2R0IA 3SHFA 2R45A 5H37D 1WXQA 2RGOA 3VDPA 2CRUA 4DV4M 4B3MM 1FJGM 2DAMA 5FTMA 2CV0A 2J7NA 1ZQ9A 1VDLA 2DWMA 3GLIB 2G5GX 4CHTB 1K82A 3LVWA 1IY0A 2UXCM 1VQ1A 1LV7A 3ILKA 1AIPC 1QAQA 5EJCA 4JI0M 1IXZA 1G4AE 3C58A 2LHCA 1IN5A 4JI3M 3W0FA 4GKJM 5LMNM 1IBKM 3TPZA 2JP7A 3A46A 5DFLA 4I4LA 4G4OA 2R18A 4K0KM 4OW0A 3E4RA 3KS8A 3SYKA 1DV0A 1W5SA 4MGZE 3L29A 1J5EM 3BXWA 3U6EA 2DVWB 5DYGA 3HGIA 4FVMA 1XXHA 5ITTA 5KQ8A 2VF8A 4M9XA 3AL0C 1WIVA 3L27A 4B7FA 2FH0A 2Y20A 1NJGA 1IY2A 3MJ5A 1E9SA 2EUCA 4D82A 3DA1A 3B7QA 2L4EA 3A42A 5EP1A 2M60A 4DV1M 3R8FA 2RRUA 5KQDA 2F5NA 4L8RC 3B9PA 2CUZA 2DHRA 2LNHC 5E6JA 3GRUA 4CGYB 1E94E 4DR2M 4IBKA 2Q2EB 4LJ9A 2F5PA 4CIZA 1ZMVA 2EKFA 2KZSA 1Z5BA 3FTCA 4NC6A 1Q3BA 4Z6YA 3HU3A 5IWAM 4REZA 3HHYA 4LF5M 1E9RA 1IM2A 3RGSA 3K92A 3Q8XA 3I51A 1KFVA 4DV5M 2HHHM 3GQ4A 2O01F 2EJSA 2D7GA 1N34M 4M9ZA 1SG9A 2DENA 4M0WA 4PCZA 1GJTA 3T38A 4ANRA 2CP8A 4X64M 3SBJA 1MU5A 3L2AA 2DXIA 3U6DA 1HNWM 3HY5A 3TL4X 2GNOA 4LRTA 1XB2B 4QNRA 2XZUA 2Y21A 2E5LM 3OTOM 2V1CA 3L28A 4L78A 1Y8GA 1OFIA 1QDTA 1XXHB 4MGYE 1IFYA 2JZ1A 2JNHA 3K9PA 1IBLM 3RE8A 1D0LA 1N75A 2R65A 3SAVA 1NVMA 4GEWA 1QANA 1NNUC 1DGBA 2DZOB 3CF2A 4LFCM 3FKEA 3MHVC 1N32M 4AG6A 1T3TA 1JR3E 4LFAM 1QUTA 4TUWA 4GC5A 1UFZA 2KRKA 4EIWA 2BNKA 2KNAA 3SARA 3QWLA 2XFTA 3J80S 3SAUA 2C5RA 1DGFA 2RGHA 5FTNA 1V92A 3SATA 1YE9A 4IJEA 5ITYA 3PNVA 4IBFA 4IBEA 1XC8A 3IECA 3CF6E 4AKGA 3J7AS 1NNJA 1ZMWA 2RKOA 4JI1M 2K47A 1PJTA 3UJNA 2ZM6M 4WW0A 1G41A 3B74A 4B3RM 3KDSE 3WHKA 4DV2M 4DV6M 2QBYA 4IBBA 2KDLA 3HJ8A 4MH0E 1BVSA 1NY5A 4RF0A 3WHLA 2Z4RA 4DUYM 4FWGA 3GO8A 3GLIA 1Z5AA 3GPXA 2EO2A 4OX9M 4CJ6A 3C9PA 1QUSA 1YLAA 2G3QA 4FCVA 5KO3A 2ZAMA 1Q39A 2CFOA 4NOOB 5EP4A 1XXHE 1NSFA 2OO9A 1IY1A 1GVNA 2XH9A 4LGYA 1WHCA 5FTLA 5A2QS 2VQFM 4G4NA 1XMOM 3E21A 4MM3B 2CHGA 1QYRA 2DHYA 3PNYA 3W0LB 1P3QQ 3RGPA 2XEPA 3THGA 4PDIA 3KSJA 3GLGA 3KP1E 2LTUA 1GKIA 2L7HA 4IBIA 2MR9A 1C7YA 2K9DA 4G6ZA 2LVQD 4R3DA 1I94M 1VEGA 3U6CA 1XMQM 1MX0A 2P5TA 3VK8A 4I8OA 1EFUB 1PJQA 4QHTA 1VDDA 4RF1A 4NXNM 4DR5M 1XNQM 3D8LA 1Q3CA 1Z59A 3SYLA 2EKKA 2QZ4A 4DBGB 5LMUM 2FS1A 2UUCM 3VKGA 2MJ5B 1FNNA 1IN6A 4MGIE 4RNAA 1CUKA 2C9CA 1R4GA 3A98B 2LH0A 5GKNA 2OOBA 5KPRA 3AOEA 2C98A 2XF3A 4JXJA 4AQYM 4QHSA 3LCVB 2UUBM 4IBDA 1KSFX 2XSZD 3KOZE 2MROB 4NL4H 3EIHA 1D0KA 4M9SA 1C1KA 3VDUA 4LF9M 5IREB 1R6BX 2K6BA 3B89A 3GRVA 4M0DA 3I4YA 2KRUA 4CISA 4DR7M 5E26A 1OFHA 2GQFA 3FRIA 4PD2A 4AKHA 4FCTA 5KPZA 1L2CA 2KW0A 4IBGA 4LZZA 3RFWA 4BB9A 3GLGB 1TF0B 2QNJA 5F3WA 1L1TA 2QQ8A 3GLHB 4II7A 4LF6M 3W68A 3J27B 1ZV1A 3BOSA 1D0MA 2KNVA 3K1JA 3QYEA 1K3XA 2F4VM 3DZDA 2QENA 4F1IA 5FLXS 2DWLA 4I5SA 5EXSA 3NBXX 1OAOC 3I4VA 2KHHA 4KLNA 2ZAOA 2UXBM 2VIIA 4XBOA 3FTFA 2KXEA 1IXRC 1QZEA 4AKIA 4LJ5A 2LXEA 5DYIA 3UZUA 5BPVA 1SXJA 1F4IA 1K3WA 3KSXA 3ZCBB 3HWSA 1GL7A 4G3OA 3AOGA 3KP0E 4LGMA 4L15A 2C9OA 5IT9S 2R46A 3V76A 4QNMA 3JR5A 4OU7A 2QBYB 1ZMUA 2O5RA 3HJSA 4F2LA 2VQEM 2ERCA 1PJIA 3GLIE 1TH3A 1G8PA 4LY6A 4GH9A 4DV3M 1MN3A 2WSFF 1T43A 4HEOA 4Y28F 5EP2A 4JI7M 4AW4A 1VEJA 2DAGA 1IQPA 2KZUA 3GPUA 1TDZA 2H5XA 3U6MA 4DUZM 3KFUG 3KW6A 3TE6A 4YY3M 4LZJA 4R71A 1HQCA 1WGLA 3EIEA 2WZJA 2YFQA 1R2YA 4NSRA 3DFZA 3QAUA 4LF4M 4ITQA 2XFSA 1IN4A 2OOAA 3FRHA 3KOWE 2V6ZM 1NV8A 4FWHA 4HL4A 4D81A 2L7IA 1XWIA 2LVNC 8CATA 3GLGE 2JY6B 3LW5F 1VG5A 4JI5M 1PRBA 4NSOB 4I81A 3GP1A 2DWNA 1PJSA 2DAIA 1OJLA 4LG2A 3T1HM 3FYDA 2C96A 1SXJC 4Z8XA 2J5YA 3R9XB 2X8AA 4LJ4A 1JR3D 3FYCA 1SXJB 2DWZB 4W5WA 3TQSA 5C1BA 1EE8A
chains in the Genus database with same CATH topology
4LJAA 2ZANA 4FCWA 4PT5A 4NRWA 2QCUA 5FTKA 2R4JA 4LJ8A 3GLFB 3U61A 4JI8M 3FUTA 1DGGA 4ZPXA 4KODA 3U6SA 5FTJA 4GHLA 4MB7A 3SHGB 2UXDM 5ITRA 1ZAEA 4X62M 1QAMA 5ITQA 3J7BA 4A3VB 2FE8A 5JI2E 1H6UA 3ZH9B 2YQZA 5C18A 2I7NA 2J7OA 4MGHA 5EXXA 3VLFB 3J2PB 4AG5A 2D7EA 2NQ8C 1G59A 5EXTA 3UK6A 2FOIC 3KOYE 3PXGA 1DO0A 3NBIA 3LQRA 4GITA 5ITXA 3JR4A 1HQYE 4KO8A 5EP3A 2UU9M 1YUBA 3SASA 2OPFA 5EQTA 1L2DA 3GLHA 4IJFA 4GHAA 2X49A 3TWMA 3LVVA 2QPAA 3FUWA 4B3TM 3KS4A 1XHBA 3GQ3A 2XZFA 1SXJE 4LF7M 1YSYA 3LQQA 1TGUA 1NHGC 2AHMA 3E9SA 3M7GA 2Y0QA 3U61B 1QZMA 2FNAA 2CV2A 4GMQA 2YNMD 1SXJD 1GLNA 4L4UA 4DR6M 4FW9A 4LF8M 1HNXM 2R62A 4FWDA 1XNRM 2CEAA 3FTDA 3IG5A 4LJ6A 4KHPM 4P16A 3FUUA 2LWXA 3K2LA 4GRIA 4NRVA 1R7RA 4X65M 3J81S 1DGHA 3M0EA 1IN8A 3AFHA 2CHQA 3T15A 2CV1A 4DR1M 4DR3M 3U5ZA 2CHVA 1N33M 5EXPA 3SAWA 1HR0M 4LJ7A 4GKKM 2HCBA 3HU2A 7CATA 3LMMA 3GRYA 4OVZA 4PDGA 2HKJA 2R4EA 3FTEA 2HL7A 1KYIA 2JA2A 4LRSA 3HHZA 4WURA 1TDHA 3HU1A 3UGJA 3L25A 4G4RA 3CF0A 1ORYB 4DV0M 3VFDA 1I4WA 3CTWB 3U60A 3AOEC 2KEBA 3M6AA 3SMPA 3FD9A 1N77A 2XLJA 3T1YM 2Y0TA 3GLFA 1D2NA 4B08A 3HHWA 3FUXA 4R7GA 4JI4M 1DGHB 2I7PA 3GRRA 4GIPA 3U5ZB 4B7HA 1Z6TA 3SMSA 2F5QA 2V1UA 2D7HA 4X66M 5ITXE 3AJIB 3U6OA 1S3SA 1Z5CA 4L16A 2FFJA 4OVZB 3ZC7B 4QOSA 3HHXA 5FSWA 4B3SM 3A45A 4AI6A 4G4QA 3KXEC 1TH4A 4GC9A 3GPYA 4QOZC 4HLQA 1R2ZA 2XSZA 4MGKE 2BJVA 2X4AA 3TWLA 3VK7A 4JN6A 3K8ZA 5KPTA 2L09A 3DOAA 3KVWA 4FD2A 3HKPA 3U60B 4XGIA 4AZFA 1L8QA 2Z3XA 3FUVA 2DZNB 3GQ5A 4DR4M 3GPPA 1PM5A 3KOXE 4JYAM 2Z7JA 1NY6A 4S12A 3TWKA 1G3IA 1W5TA 2M5ZA 5JI3E 3IG8A 1IN7A 3HJQA 3VKHA 3PFIA 4JI6M 3AV0A 2OQ4A 3SFZA 2YR0A 1PJJA 3UMMA 4IIWA 1NHWC 1L1ZA 2KA6B 3MK6A 4JV5M 4IBJA 1N78A 4IBCA 4NXMM 3AKZA 1NJFA 4D80A 3U6QA 2XGNA 1QAOA 2L6OA 3PVSA 4LCBA 2A5YB 1HNZM 1JQJC 3L26A 4DV7M 2CE7A 2W82A 5ITUA 2F5OA 3U6LA 1QQWA 1UM8A 4BBAA 1HT2E 1J09A 1HT1E 5DNYA 1IBMM 1L2BA 1J7KA 3D8BA 4YHHM 1E32A 2UUAM 1TH2A 2ZBKB 5BR8M 1IXSB 1N36M 2C99A 3JAMS 3H4MA 2Z4SA 1DO2A 1GL6A 2F5SA 1JR3A 3SC3A 2G8LA 2EA0A 4LFBM 3U6PA 5IZ7D 3NWLA 1QVRA 2BJWA 2QP9X 4BLCA 4B7GA 2H1RA 1X37A 4JI2M 3SHFA 2R45A 5H37D 1WXQA 2RGOA 3VDPA 4B3MM 4DV4M 1FJGM 5FTMA 2CV0A 2J7NA 1ZQ9A 2DWMA 3GLIB 2G5GX 4CHTB 1K82A 3LVWA 1IY0A 2UXCM 1LV7A 3ILKA 5EJCA 1QAQA 4JI0M 1IXZA 1G4AE 3C58A 1IN5A 4JI3M 3W0FA 4GKJM 5LMNM 1IBKM 3TPZA 3A46A 4I4LA 4G4OA 2R18A 4K0KM 4OW0A 3E4RA 3KS8A 3SYKA 1W5SA 4MGZE 3L29A 1J5EM 3U6EA 2DVWB 5DYGA 3HGIA 4FVMA 1XXHA 5ITTA 5KQ8A 4M9XA 3AL0C 3L27A 4B7FA 2Y20A 1NJGA 1IY2A 3MJ5A 1E9SA 2EUCA 4D82A 3DA1A 3A42A 5EP1A 2M60A 4DV1M 3R8FA 5KQDA 2F5NA 4L8RC 3B9PA 2CUZA 2DHRA 2LNHC 5E6JA 3GRUA 4CGYB 1E94E 4DR2M 4IBKA 2Q2EB 4LJ9A 2F5PA 3FTCA 2KZSA 1Z5BA 4LF5M 1Q3BA 4Z6YA 3HU3A 5IWAM 4REZA 3HHYA 1E9RA 1IM2A 3RGSA 3K92A 3Q8XA 3I51A 1KFVA 4DV5M 2HHHM 3GQ4A 2D7GA 1N34M 4M9ZA 4M0WA 4PCZA 3T38A 4X64M 3SBJA 1MU5A 3L2AA 2DXIA 3U6DA 1HNWM 3TL4X 4LRTA 2XZUA 4QNRA 2Y21A 2E5LM 3OTOM 2V1CA 3L28A 4L78A 1OFIA 4MGYE 1XXHB 1IBLM 3RE8A 1N75A 2R65A 3SAVA 1NVMA 1QANA 1NNUC 1DGBA 2DZOB 3CF2A 4LFCM 3FKEA 3MHVC 1N32M 4AG6A 1T3TA 4LFAM 4TUWA 4GC5A 2KRKA 4EIWA 2BNKA 3SARA 3QWLA 2XFTA 3J80S 3SAUA 2C5RA 1DGFA 2RGHA 5FTNA 3SATA 1YE9A 4IJEA 5ITYA 3PNVA 4IBFA 4IBEA 1XC8A 3CF6E 4AKGA 3J7AS 1NNJA 4JI1M 2RKOA 2K47A 3UJNA 2ZM6M 4WW0A 1G41A 4B3RM 3KDSE 3WHKA 4DV2M 4DV6M 4IBBA 3HJ8A 4MH0E 1NY5A 4RF0A 3WHLA 2Z4RA 4DUYM 4FWGA 3GO8A 3GLIA 1Z5AA 3GPXA 2EO2A 4OX9M 4FCVA 5KO3A 2ZAMA 1Q39A 2CFOA 4NOOB 5EP4A 1NSFA 1IY1A 1GVNA 2XH9A 4LGYA 5FTLA 2VQFM 5A2QS 4G4NA 1XMOM 4MM3B 2CHGA 1QYRA 3PNYA 3W0LB 3RGPA 2XEPA 3THGA 4PDIA 3KSJA 3GLGA 3KP1E 1GKIA 2L7HA 4IBIA 4G6ZA 1I94M 4R3DA 3U6CA 1XMQM 1MX0A 2P5TA 3VK8A 4I8OA 4QHTA 1VDDA 4RF1A 4NXNM 4DR5M 1XNQM 3D8LA 1Q3CA 1Z59A 3SYLA 2QZ4A 3VKGA 5LMUM 2UUCM 1FNNA 1IN6A 4MGIE 4RNAA 2C9CA 5GKNA 2QBYA 3A98B 2LH0A 5KPRA 4AQYM 3AOEA 2C98A 2XF3A 4JXJA 4QHSA 2UUBM 4IBDA 1KSFX 2XSZD 3KOZE 4NL4H 3EIHA 4M9SA 1C1KA 3VDUA 4LF9M 5IREB 1R6BX 4M0DA 3GRVA 4CISA 3I4YA 2KRUA 4DR7M 5E26A 1OFHA 4PD2A 4AKHA 4FCTA 5KPZA 1L2CA 2KW0A 4IBGA 4LZZA 3RFWA 4BB9A 3GLGB 5F3WA 1L1TA 3GLHB 4II7A 4LF6M 3J27B 3BOSA 3K1JA 1K3XA 2F4VM 3DZDA 2QENA 5FLXS 2DWLA 4I5SA 5EXSA 3I4VA 4KLNA 2ZAOA 2UXBM 2VIIA 4XBOA 3FTFA 2KXEA 1IXRC 4AKIA 4LJ5A 2LXEA 5DYIA 3UZUA 5BPVA 1SXJA 1K3WA 3KSXA 3ZCBB 3HWSA 1GL7A 3AOGA 3KP0E 4LGMA 4L15A 2C9OA 5IT9S 2R46A 4QNMA 3JR5A 4OU7A 2QBYB 3HJSA 2O5RA 2VQEM 2ERCA 1PJIA 1TH3A 1G8PA 4LY6A 4GH9A 4DV3M 5EP2A 4JI7M 4AW4A 1IQPA 2KZUA 3GPUA 1TDZA 3U6MA 3KFUG 4DUZM 3KW6A 3TE6A 4YY3M 4LZJA 1HQCA 3EIEA 2YFQA 1R2YA 4NSRA 3DFZA 3QAUA 4LF4M 4ITQA 2XFSA 1IN4A 4D81A 3KOWE 2V6ZM 4FWHA 4HL4A 2L7IA 1XWIA 8CATA 4JI5M 4NSOB 4I81A 3GP1A 2DWNA 1OJLA 4LG2A 3T1HM 3FYDA 2C96A 1SXJC 4Z8XA 3R9XB 2X8AA 4LJ4A 1JR3D 3FYCA 1SXJB 2DWZB 4W5WA 3TQSA 5C1BA 1EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K82 A;  2UXC M;  4NRW A;  4JI0 M;  2F5Q A;  3C58 A;  4PDI A;  4JI3 M;  3W0F A;  4X66 M;  5ITX E;  4JI8 M;  3U6S A;  4GKJ M;  5LMN M;  1IBK M;  4MB7 A;  3A46 A;  2UXD M;  3U6O A;  5ITR A;  1Z5C A;  4G4O A;  1I94 M;  4X62 M;  5ITQ A;  4K0K M;  3U6C A;  1XMQ M;  1MX0 A;  3VK8 A;  1J5E M;  3U6E A;  4B3S M;  3A45 A;  5ITT A;  4NXN M;  3GPY A;  4G4Q A;  4DR5 M;  1XNQ M;  1R2Z A;  1Q3C A;  3TWL A;  3VK7 A;  1Z59 A;  5LMU M;  2UUC M;  3A42 A;  4DV1 M;  3DOA A;  2F5N A;  5ITX A;  3JR4 A;  4AQY M;  2UU9 M;  4DR2 M;  3SAS A;  2OPF A;  2Q2E B;  2F5P A;  1L2D A;  2UUB M;  3GQ5 A;  4DR4 M;  1Z5B A;  3GPP A;  1PM5 A;  1Q3B A;  4LF5 M;  5IWA M;  4JYA M;  3TWM A;  3TWK A;  4B3T M;  4LF9 M;  3GQ3 A;  2XZF A;  4LF7 M;  1KFV A;  4CIS A;  4DR7 M;  4DV5 M;  2HHH M;  3GQ4 A;  4PD2 A;  1N34 M;  1L2C A;  4JI6 M;  2OQ4 A;  4PCZ A;  4X64 M;  3SBJ A;  1PJJ A;  1MU5 A;  1L1T A;  3U6D A;  1HNW M;  4LF6 M;  1L1Z A;  4JV5 M;  4DR6 M;  2XZU A;  1K3X A;  2E5L M;  2F4V M;  4LF8 M;  1HNX M;  4NXM M;  3OTO M;  5FLX S;  1XNR M;  4KHP M;  3U6Q A;  2UXB M;  1IBL M;  4NRV A;  4X65 M;  3J81 S;  3SAV A;  1HNZ M;  1K3W A;  4LFC M;  4DV7 M;  4DR1 M;  1N32 M;  5ITU A;  4DR3 M;  4LFA M;  2F5O A;  5IT9 S;  3U6L A;  1N33 M;  3JR5 A;  3SAW A;  3SAR A;  2VQE M;  1HR0 M;  1IBM M;  1PJI A;  3J80 S;  1L2B A;  3SAU A;  4YHH M;  4GKK M;  4DV3 M;  4JI7 M;  2UUA M;  3SAT A;  3GPU A;  1TDZ A;  3U6M A;  4DUZ M;  2ZBK B;  5ITY A;  5BR8 M;  4YY3 M;  1XC8 A;  4PDG A;  1N36 M;  3J7A S;  3JAM S;  1NNJ A;  2HKJ A;  4JI1 M;  1R2Y A;  2ZM6 M;  4LF4 M;  4ITQ A;  4B3R M;  1TDH A;  4DV2 M;  4DV6 M;  2F5S A;  2EA0 A;  4DV0 M;  4G4R A;  3U6P A;  4LFB M;  4JI5 M;  4DUY M;  3GO8 A;  3GP1 A;  1Z5A A;  3GPX A;  4OX9 M;  3T1H M;  4JI2 M;  3T1Y M;  1Q39 A;  4B3M M;  4DV4 M;  1FJG M;  1XMO M;  4G4N A;  4JI4 M;  2VQF M;  5A2Q S;  1EE8 A; 
#chains in the Genus database with same CATH topology
 4LJA A;  2DZL A;  2ZAN A;  3B7N A;  4FCW A;  4PT5 A;  2VF7 A;  4NRW A;  2QCU A;  5FTK A;  2R4J A;  4LJ8 A;  3GLF B;  3U61 A;  4JI8 M;  3FUT A;  1DGG A;  2QHO B;  4KOD A;  4ZPX A;  5FTJ A;  3U6S A;  4GHL A;  4MB7 A;  3SHG B;  2UXD M;  5ITR A;  1ZAE A;  2APL A;  4X62 M;  1QAM A;  4L6V 6;  3J7B A;  4A3V B;  5ITQ A;  1V33 A;  2FE8 A;  5JI2 E;  1H6U A;  3ZH9 B;  2JY8 A;  2YQZ A;  5C18 A;  2I7N A;  2J7O A;  4MGH A;  5EXX A;  3VLF B;  2DAK A;  3J2P B;  2D7E A;  4AG5 A;  2QSF X;  2NQ8 C;  3CGW A;  5EXT A;  3UK6 A;  2FOI C;  1G59 A;  3KOY E;  3PXG A;  1DO0 A;  3NBI A;  3LQR A;  4GIT A;  5ITX A;  3JR4 A;  1HQY E;  4KO8 A;  5EP3 A;  1GO5 A;  2UU9 M;  1YUB A;  3SAS A;  2OPF A;  5EQT A;  1L2D A;  2K0B X;  2DAE A;  3GLH A;  4IJF A;  3HZJ A;  4GHA A;  2X49 A;  3TWM A;  3LVV A;  2QPA A;  3FUW A;  4B3T M;  3KS4 A;  1XHB A;  3GQ3 A;  2XZF A;  1V34 A;  1SXJ E;  3K9O A;  1YSY A;  4XK8 F;  4LF7 M;  3LQQ A;  1TGU A;  3H4J A;  1G71 A;  1NHG C;  1NV9 A;  2AHM A;  3E9S A;  3M7G A;  2Y0Q A;  3U61 B;  1QZM A;  2FNA A;  2HAK A;  2LHG A;  2CV2 A;  4GMQ A;  2YNM D;  1SXJ D;  1GLN A;  4L4U A;  1WR1 B;  1OIZ A;  1OTR A;  4FW9 A;  4DR6 M;  4LF8 M;  2VDB B;  2R62 A;  4FWD A;  1HNX M;  1XNR M;  2CEA A;  2R44 A;  3FTD A;  3IG5 A;  4LJ6 A;  4KHP M;  4P16 A;  3FUU A;  3T6P A;  2BWE A;  2LWX A;  3K2L A;  4GRI A;  4NRV A;  1R7R A;  4X65 M;  3J81 S;  2MH8 A;  1DGH A;  3M0E A;  1IN8 A;  2HWJ A;  3AFH A;  2CHQ A;  2R6F A;  3T15 A;  4KT0 F;  2CV1 A;  4DR1 M;  4DR3 M;  3U5Z A;  2WSE F;  1LTM A;  1WJ7 A;  2CHV A;  1N33 M;  5EXP A;  3SAW A;  1HR0 M;  4LJ7 A;  4GKK M;  2HCB A;  3HU2 A;  7CAT A;  1VEK A;  3LMM A;  1HJP A;  3E46 A;  3GRY A;  4OVZ A;  2MGW A;  4PDG A;  2HKJ A;  2R4E A;  3FTE A;  2HL7 A;  1KYI A;  2JA2 A;  1TR8 A;  3QYB A;  3IHP A;  4LRS A;  3HHZ A;  1QDR A;  1TDH A;  4WUR A;  1JB0 F;  2L4F A;  2LVA A;  2Z8Y M;  3HU1 A;  3UGJ A;  1RU3 A;  3L25 A;  4G4R A;  3CF0 A;  1ORY B;  1A5T A;  4DV0 M;  2WSC F;  3VFD A;  1I4W A;  1WGN A;  1TTE A;  3CTW B;  1R5L A;  3U60 A;  3AOE C;  2KEB A;  3M6A A;  3SMP A;  3FD9 A;  1N77 A;  2XLJ A;  3T1Y M;  3B7Z A;  2Y0T A;  3GLF A;  1D2N A;  4B08 A;  2ZTC A;  2JY5 A;  3HHW A;  1NO1 A;  3FUX A;  3Q8G A;  2DI0 A;  4R7G A;  4JI4 M;  1DGH B;  2I7P A;  1Q02 A;  3GRR A;  4GIP A;  3MMP A;  3U5Z B;  4B7H A;  1Z6T A;  3SMS A;  2LBC A;  2F5Q A;  2V1U A;  2D7H A;  4X66 M;  5ITX E;  3AJI B;  3U6O A;  1S3S A;  1Z5C A;  4WP2 A;  4L16 A;  3C3D A;  2FFJ A;  4OVZ B;  3ZC7 B;  4QOS A;  3HHX A;  5FSW A;  2JUJ A;  2LVO C;  3A45 A;  3GLH E;  4B3S M;  4AI6 A;  4G4Q A;  3KXE C;  1TH4 A;  4GC9 A;  3GPY A;  4QOZ C;  4HLQ A;  2KNZ A;  1R2Z A;  2XSZ A;  4MGK E;  2BJV A;  2X4A A;  3TWL A;  3VK7 A;  1OAI A;  4JN6 A;  3K8Z A;  5KPT A;  1OQY A;  2L09 A;  3DOA A;  3KVW A;  4FD2 A;  3HKP A;  3U60 B;  3W67 A;  4XGI A;  4AZF A;  1L8Q A;  2Z3X A;  3LCU A;  3FUV A;  2DZN B;  3GQ5 A;  4DR4 M;  3GPP A;  2O25 A;  1PM5 A;  1T6O A;  3KOX E;  4JYA M;  3I01 M;  2Z7J A;  1NY6 A;  4S12 A;  3TWK A;  1G3I A;  1IXS A;  1W5T A;  2M5Z A;  5JI3 E;  3IG8 A;  1IN7 A;  1OIP A;  3HJQ A;  3VKH A;  2ZTD A;  3ZQJ A;  3FE3 A;  3PFI A;  4JI6 M;  3AV0 A;  2OQ4 A;  3SFZ A;  2YR0 A;  1PJJ A;  3UMM A;  4IIW A;  1NHW C;  3I04 M;  1L1Z A;  2KA6 B;  3MK6 A;  4JV5 M;  4IBJ A;  1EIJ A;  2DNA A;  1N78 A;  2CWB A;  4IBC A;  4Q7J A;  2JZ0 A;  4NXM M;  3AKZ A;  1NJF A;  4D80 A;  3U6Q A;  4P17 A;  2XGN A;  1QAO A;  2L6O A;  3PVS A;  4LCB A;  3BBZ A;  2A5Y B;  1HNZ M;  1OKS A;  1JQJ C;  3L26 A;  5L8R F;  4DV7 M;  2CE7 A;  2W82 A;  5ITU A;  2F5O A;  3U6L A;  1QQW A;  1UM8 A;  4BBA A;  1HT2 E;  1MJG M;  1J09 A;  1HT1 E;  2JWS A;  5DNY A;  1IBM M;  1L2B A;  1J7K A;  1GAB A;  3D8B A;  4YHH M;  3C3E A;  1E32 A;  2B3T A;  2N35 A;  1GJS A;  2UUA M;  4UN2 B;  1TH2 A;  3GLF E;  2ZBK B;  2DKL A;  5BR8 M;  1IXS B;  2BWB A;  2JXN A;  1N36 M;  2C99 A;  3JAM S;  3H4M A;  2JY7 A;  2Z4S A;  3F92 A;  1DO2 A;  1GL6 A;  4RKU F;  1AUA A;  3HX3 A;  2F5S A;  1JR3 A;  3SC3 A;  2G8L A;  2EA0 A;  4LFB M;  3U6P A;  5IZ7 D;  2L2D A;  3NWL A;  1QVR A;  2BJW A;  2QP9 X;  1PGY A;  4BLC A;  4B7G A;  2H1R A;  1X37 A;  2LVP C;  4JI2 M;  2R0I A;  3SHF A;  2R45 A;  5H37 D;  1WXQ A;  2RGO A;  3VDP A;  2CRU A;  4DV4 M;  4B3M M;  1FJG M;  2DAM A;  5FTM A;  2CV0 A;  2J7N A;  1ZQ9 A;  1VDL A;  2DWM A;  3GLI B;  2G5G X;  4CHT B;  1K82 A;  3LVW A;  1IY0 A;  2UXC M;  1VQ1 A;  1LV7 A;  3ILK A;  1AIP C;  1QAQ A;  5EJC A;  4JI0 M;  1IXZ A;  1G4A E;  3C58 A;  2LHC A;  1IN5 A;  4JI3 M;  3W0F A;  4GKJ M;  5LMN M;  1IBK M;  3TPZ A;  2JP7 A;  3A46 A;  5DFL A;  4I4L A;  4G4O A;  2R18 A;  4K0K M;  4OW0 A;  3E4R A;  3KS8 A;  3SYK A;  1DV0 A;  1W5S A;  4MGZ E;  3L29 A;  1J5E M;  3BXW A;  3U6E A;  2DVW B;  5DYG A;  3HGI A;  4FVM A;  1XXH A;  5ITT A;  5KQ8 A;  2VF8 A;  4M9X A;  3AL0 C;  1WIV A;  3L27 A;  4B7F A;  2FH0 A;  2Y20 A;  1NJG A;  1IY2 A;  3MJ5 A;  1E9S A;  2EUC A;  4D82 A;  3DA1 A;  3B7Q A;  2L4E A;  3A42 A;  5EP1 A;  2M60 A;  4DV1 M;  3R8F A;  2RRU A;  5KQD A;  2F5N A;  4L8R C;  3B9P A;  2CUZ A;  2DHR A;  2LNH C;  5E6J A;  3GRU A;  4CGY B;  1E94 E;  4DR2 M;  4IBK A;  2Q2E B;  4LJ9 A;  2F5P A;  4CIZ A;  1ZMV A;  2EKF A;  2KZS A;  1Z5B A;  3FTC A;  4NC6 A;  1Q3B A;  4Z6Y A;  3HU3 A;  5IWA M;  4REZ A;  3HHY A;  4LF5 M;  1E9R A;  1IM2 A;  3RGS A;  3K92 A;  3Q8X A;  3I51 A;  1KFV A;  4DV5 M;  2HHH M;  3GQ4 A;  2O01 F;  2EJS A;  2D7G A;  1N34 M;  4M9Z A;  1SG9 A;  2DEN A;  4M0W A;  4PCZ A;  1GJT A;  3T38 A;  4ANR A;  2CP8 A;  4X64 M;  3SBJ A;  1MU5 A;  3L2A A;  2DXI A;  3U6D A;  1HNW M;  3HY5 A;  3TL4 X;  2GNO A;  4LRT A;  1XB2 B;  4QNR A;  2XZU A;  2Y21 A;  2E5L M;  3OTO M;  2V1C A;  3L28 A;  4L78 A;  1Y8G A;  1OFI A;  1QDT A;  1XXH B;  4MGY E;  1IFY A;  2JZ1 A;  2JNH A;  3K9P A;  1IBL M;  3RE8 A;  1D0L A;  1N75 A;  2R65 A;  3SAV A;  1NVM A;  4GEW A;  1QAN A;  1NNU C;  1DGB A;  2DZO B;  3CF2 A;  4LFC M;  3FKE A;  3MHV C;  1N32 M;  4AG6 A;  1T3T A;  1JR3 E;  4LFA M;  1QUT A;  4TUW A;  4GC5 A;  1UFZ A;  2KRK A;  4EIW A;  2BNK A;  2KNA A;  3SAR A;  3QWL A;  2XFT A;  3J80 S;  3SAU A;  2C5R A;  1DGF A;  2RGH A;  5FTN A;  1V92 A;  3SAT A;  1YE9 A;  4IJE A;  5ITY A;  3PNV A;  4IBF A;  4IBE A;  1XC8 A;  3IEC A;  3CF6 E;  4AKG A;  3J7A S;  1NNJ A;  1ZMW A;  2RKO A;  4JI1 M;  2K47 A;  1PJT A;  3UJN A;  2ZM6 M;  4WW0 A;  1G41 A;  3B74 A;  4B3R M;  3KDS E;  3WHK A;  4DV2 M;  4DV6 M;  2QBY A;  4IBB A;  2KDL A;  3HJ8 A;  4MH0 E;  1BVS A;  1NY5 A;  4RF0 A;  3WHL A;  2Z4R A;  4DUY M;  4FWG A;  3GO8 A;  3GLI A;  1Z5A A;  3GPX A;  2EO2 A;  4OX9 M;  4CJ6 A;  3C9P A;  1QUS A;  1YLA A;  2G3Q A;  4FCV A;  5KO3 A;  2ZAM A;  1Q39 A;  2CFO A;  4NOO B;  5EP4 A;  1XXH E;  1NSF A;  2OO9 A;  1IY1 A;  1GVN A;  2XH9 A;  4LGY A;  1WHC A;  5FTL A;  5A2Q S;  2VQF M;  4G4N A;  1XMO M;  3E21 A;  4MM3 B;  2CHG A;  1QYR A;  2DHY A;  3PNY A;  3W0L B;  1P3Q Q;  3RGP A;  2XEP A;  3THG A;  4PDI A;  3KSJ A;  3GLG A;  3KP1 E;  2LTU A;  1GKI A;  2L7H A;  4IBI A;  2MR9 A;  1C7Y A;  2K9D A;  4G6Z A;  2LVQ D;  4R3D A;  1I94 M;  1VEG A;  3U6C A;  1XMQ M;  1MX0 A;  2P5T A;  3VK8 A;  4I8O A;  1EFU B;  1PJQ A;  4QHT A;  1VDD A;  4RF1 A;  4NXN M;  4DR5 M;  1XNQ M;  3D8L A;  1Q3C A;  1Z59 A;  3SYL A;  2EKK A;  2QZ4 A;  4DBG B;  5LMU M;  2FS1 A;  2UUC M;  3VKG A;  2MJ5 B;  1FNN A;  1IN6 A;  4MGI E;  4RNA A;  1CUK A;  2C9C A;  1R4G A;  3A98 B;  2LH0 A;  5GKN A;  2OOB A;  5KPR A;  3AOE A;  2C98 A;  2XF3 A;  4JXJ A;  4AQY M;  4QHS A;  3LCV B;  2UUB M;  4IBD A;  1KSF X;  2XSZ D;  3KOZ E;  2MRO B;  4NL4 H;  3EIH A;  1D0K A;  4M9S A;  1C1K A;  3VDU A;  4LF9 M;  5IRE B;  1R6B X;  2K6B A;  3B89 A;  3GRV A;  4M0D A;  3I4Y A;  2KRU A;  4CIS A;  4DR7 M;  5E26 A;  1OFH A;  2GQF A;  3FRI A;  4PD2 A;  4AKH A;  4FCT A;  5KPZ A;  1L2C A;  2KW0 A;  4IBG A;  4LZZ A;  3RFW A;  4BB9 A;  3GLG B;  1TF0 B;  2QNJ A;  5F3W A;  1L1T A;  2QQ8 A;  3GLH B;  4II7 A;  4LF6 M;  3W68 A;  3J27 B;  1ZV1 A;  3BOS A;  1D0M A;  2KNV A;  3K1J A;  3QYE A;  1K3X A;  2F4V M;  3DZD A;  2QEN A;  4F1I A;  5FLX S;  2DWL A;  4I5S A;  5EXS A;  3NBX X;  1OAO C;  3I4V A;  2KHH A;  4KLN A;  2ZAO A;  2UXB M;  2VII A;  4XBO A;  3FTF A;  2KXE A;  1IXR C;  1QZE A;  4AKI A;  4LJ5 A;  2LXE A;  5DYI A;  3UZU A;  5BPV A;  1SXJ A;  1F4I A;  1K3W A;  3KSX A;  3ZCB B;  3HWS A;  1GL7 A;  4G3O A;  3AOG A;  3KP0 E;  4LGM A;  4L15 A;  2C9O A;  5IT9 S;  2R46 A;  3V76 A;  4QNM A;  3JR5 A;  4OU7 A;  2QBY B;  1ZMU A;  2O5R A;  3HJS A;  4F2L A;  2VQE M;  2ERC A;  1PJI A;  3GLI E;  1TH3 A;  1G8P A;  4LY6 A;  4GH9 A;  4DV3 M;  1MN3 A;  2WSF F;  1T43 A;  4HEO A;  4Y28 F;  5EP2 A;  4JI7 M;  4AW4 A;  1VEJ A;  2DAG A;  1IQP A;  2KZU A;  3GPU A;  1TDZ A;  2H5X A;  3U6M A;  4DUZ M;  3KFU G;  3KW6 A;  3TE6 A;  4YY3 M;  4LZJ A;  4R71 A;  1HQC A;  1WGL A;  3EIE A;  2WZJ A;  2YFQ A;  1R2Y A;  4NSR A;  3DFZ A;  3QAU A;  4LF4 M;  4ITQ A;  2XFS A;  1IN4 A;  2OOA A;  3FRH A;  3KOW E;  2V6Z M;  1NV8 A;  4FWH A;  4HL4 A;  4D81 A;  2L7I A;  1XWI A;  2LVN C;  8CAT A;  3GLG E;  2JY6 B;  3LW5 F;  1VG5 A;  4JI5 M;  1PRB A;  4NSO B;  4I81 A;  3GP1 A;  2DWN A;  1PJS A;  2DAI A;  1OJL A;  4LG2 A;  3T1H M;  3FYD A;  2C96 A;  1SXJ C;  4Z8X A;  2J5Y A;  3R9X B;  2X8A A;  4LJ4 A;  1JR3 D;  3FYC A;  1SXJ B;  2DWZ B;  4W5W A;  3TQS A;  5C1B A;  1EE8 A; 
#chains in the Genus database with same CATH homology
 4LJA A;  2ZAN A;  4FCW A;  4PT5 A;  4NRW A;  2QCU A;  5FTK A;  2R4J A;  4LJ8 A;  3GLF B;  3U61 A;  4JI8 M;  3FUT A;  1DGG A;  4ZPX A;  4KOD A;  3U6S A;  5FTJ A;  4GHL A;  4MB7 A;  3SHG B;  2UXD M;  5ITR A;  1ZAE A;  4X62 M;  1QAM A;  5ITQ A;  3J7B A;  4A3V B;  2FE8 A;  5JI2 E;  1H6U A;  3ZH9 B;  2YQZ A;  5C18 A;  2I7N A;  2J7O A;  4MGH A;  5EXX A;  3VLF B;  3J2P B;  4AG5 A;  2D7E A;  2NQ8 C;  1G59 A;  5EXT A;  3UK6 A;  2FOI C;  3KOY E;  3PXG A;  1DO0 A;  3NBI A;  3LQR A;  4GIT A;  5ITX A;  3JR4 A;  1HQY E;  4KO8 A;  5EP3 A;  2UU9 M;  1YUB A;  3SAS A;  2OPF A;  5EQT A;  1L2D A;  3GLH A;  4IJF A;  4GHA A;  2X49 A;  3TWM A;  3LVV A;  2QPA A;  3FUW A;  4B3T M;  3KS4 A;  1XHB A;  3GQ3 A;  2XZF A;  1SXJ E;  4LF7 M;  1YSY A;  3LQQ A;  1TGU A;  1NHG C;  2AHM A;  3E9S A;  3M7G A;  2Y0Q A;  3U61 B;  1QZM A;  2FNA A;  2CV2 A;  4GMQ A;  2YNM D;  1SXJ D;  1GLN A;  4L4U A;  4DR6 M;  4FW9 A;  4LF8 M;  1HNX M;  2R62 A;  4FWD A;  1XNR M;  2CEA A;  3FTD A;  3IG5 A;  4LJ6 A;  4KHP M;  4P16 A;  3FUU A;  2LWX A;  3K2L A;  4GRI A;  4NRV A;  1R7R A;  4X65 M;  3J81 S;  1DGH A;  3M0E A;  1IN8 A;  3AFH A;  2CHQ A;  3T15 A;  2CV1 A;  4DR1 M;  4DR3 M;  3U5Z A;  2CHV A;  1N33 M;  5EXP A;  3SAW A;  1HR0 M;  4LJ7 A;  4GKK M;  2HCB A;  3HU2 A;  7CAT A;  3LMM A;  3GRY A;  4OVZ A;  4PDG A;  2HKJ A;  2R4E A;  3FTE A;  2HL7 A;  1KYI A;  2JA2 A;  4LRS A;  3HHZ A;  4WUR A;  1TDH A;  3HU1 A;  3UGJ A;  3L25 A;  4G4R A;  3CF0 A;  1ORY B;  4DV0 M;  3VFD A;  1I4W A;  3CTW B;  3U60 A;  3AOE C;  2KEB A;  3M6A A;  3SMP A;  3FD9 A;  1N77 A;  2XLJ A;  3T1Y M;  2Y0T A;  3GLF A;  1D2N A;  4B08 A;  3HHW A;  3FUX A;  4R7G A;  4JI4 M;  1DGH B;  2I7P A;  3GRR A;  4GIP A;  3U5Z B;  4B7H A;  1Z6T A;  3SMS A;  2F5Q A;  2V1U A;  2D7H A;  4X66 M;  5ITX E;  3AJI B;  3U6O A;  1S3S A;  1Z5C A;  4L16 A;  2FFJ A;  4OVZ B;  3ZC7 B;  4QOS A;  3HHX A;  5FSW A;  4B3S M;  3A45 A;  4AI6 A;  4G4Q A;  3KXE C;  1TH4 A;  4GC9 A;  3GPY A;  4QOZ C;  4HLQ A;  1R2Z A;  2XSZ A;  4MGK E;  2BJV A;  2X4A A;  3TWL A;  3VK7 A;  4JN6 A;  3K8Z A;  5KPT A;  2L09 A;  3DOA A;  3KVW A;  4FD2 A;  3HKP A;  3U60 B;  4XGI A;  4AZF A;  1L8Q A;  2Z3X A;  3FUV A;  2DZN B;  3GQ5 A;  4DR4 M;  3GPP A;  1PM5 A;  3KOX E;  4JYA M;  2Z7J A;  1NY6 A;  4S12 A;  3TWK A;  1G3I A;  1W5T A;  2M5Z A;  5JI3 E;  3IG8 A;  1IN7 A;  3HJQ A;  3VKH A;  3PFI A;  4JI6 M;  3AV0 A;  2OQ4 A;  3SFZ A;  2YR0 A;  1PJJ A;  3UMM A;  4IIW A;  1NHW C;  1L1Z A;  2KA6 B;  3MK6 A;  4JV5 M;  4IBJ A;  1N78 A;  4IBC A;  4NXM M;  3AKZ A;  1NJF A;  4D80 A;  3U6Q A;  2XGN A;  1QAO A;  2L6O A;  3PVS A;  4LCB A;  2A5Y B;  1HNZ M;  1JQJ C;  3L26 A;  4DV7 M;  2CE7 A;  2W82 A;  5ITU A;  2F5O A;  3U6L A;  1QQW A;  1UM8 A;  4BBA A;  1HT2 E;  1J09 A;  1HT1 E;  5DNY A;  1IBM M;  1L2B A;  1J7K A;  3D8B A;  4YHH M;  1E32 A;  2UUA M;  1TH2 A;  2ZBK B;  5BR8 M;  1IXS B;  1N36 M;  2C99 A;  3JAM S;  3H4M A;  2Z4S A;  1DO2 A;  1GL6 A;  2F5S A;  1JR3 A;  3SC3 A;  2G8L A;  2EA0 A;  4LFB M;  3U6P A;  5IZ7 D;  3NWL A;  1QVR A;  2BJW A;  2QP9 X;  4BLC A;  4B7G A;  2H1R A;  1X37 A;  4JI2 M;  3SHF A;  2R45 A;  5H37 D;  1WXQ A;  2RGO A;  3VDP A;  4B3M M;  4DV4 M;  1FJG M;  5FTM A;  2CV0 A;  2J7N A;  1ZQ9 A;  2DWM A;  3GLI B;  2G5G X;  4CHT B;  1K82 A;  3LVW A;  1IY0 A;  2UXC M;  1LV7 A;  3ILK A;  5EJC A;  1QAQ A;  4JI0 M;  1IXZ A;  1G4A E;  3C58 A;  1IN5 A;  4JI3 M;  3W0F A;  4GKJ M;  5LMN M;  1IBK M;  3TPZ A;  3A46 A;  4I4L A;  4G4O A;  2R18 A;  4K0K M;  4OW0 A;  3E4R A;  3KS8 A;  3SYK A;  1W5S A;  4MGZ E;  3L29 A;  1J5E M;  3U6E A;  2DVW B;  5DYG A;  3HGI A;  4FVM A;  1XXH A;  5ITT A;  5KQ8 A;  4M9X A;  3AL0 C;  3L27 A;  4B7F A;  2Y20 A;  1NJG A;  1IY2 A;  3MJ5 A;  1E9S A;  2EUC A;  4D82 A;  3DA1 A;  3A42 A;  5EP1 A;  2M60 A;  4DV1 M;  3R8F A;  5KQD A;  2F5N A;  4L8R C;  3B9P A;  2CUZ A;  2DHR A;  2LNH C;  5E6J A;  3GRU A;  4CGY B;  1E94 E;  4DR2 M;  4IBK A;  2Q2E B;  4LJ9 A;  2F5P A;  3FTC A;  2KZS A;  1Z5B A;  4LF5 M;  1Q3B A;  4Z6Y A;  3HU3 A;  5IWA M;  4REZ A;  3HHY A;  1E9R A;  1IM2 A;  3RGS A;  3K92 A;  3Q8X A;  3I51 A;  1KFV A;  4DV5 M;  2HHH M;  3GQ4 A;  2D7G A;  1N34 M;  4M9Z A;  4M0W A;  4PCZ A;  3T38 A;  4X64 M;  3SBJ A;  1MU5 A;  3L2A A;  2DXI A;  3U6D A;  1HNW M;  3TL4 X;  4LRT A;  2XZU A;  4QNR A;  2Y21 A;  2E5L M;  3OTO M;  2V1C A;  3L28 A;  4L78 A;  1OFI A;  4MGY E;  1XXH B;  1IBL M;  3RE8 A;  1N75 A;  2R65 A;  3SAV A;  1NVM A;  1QAN A;  1NNU C;  1DGB A;  2DZO B;  3CF2 A;  4LFC M;  3FKE A;  3MHV C;  1N32 M;  4AG6 A;  1T3T A;  4LFA M;  4TUW A;  4GC5 A;  2KRK A;  4EIW A;  2BNK A;  3SAR A;  3QWL A;  2XFT A;  3J80 S;  3SAU A;  2C5R A;  1DGF A;  2RGH A;  5FTN A;  3SAT A;  1YE9 A;  4IJE A;  5ITY A;  3PNV A;  4IBF A;  4IBE A;  1XC8 A;  3CF6 E;  4AKG A;  3J7A S;  1NNJ A;  4JI1 M;  2RKO A;  2K47 A;  3UJN A;  2ZM6 M;  4WW0 A;  1G41 A;  4B3R M;  3KDS E;  3WHK A;  4DV2 M;  4DV6 M;  4IBB A;  3HJ8 A;  4MH0 E;  1NY5 A;  4RF0 A;  3WHL A;  2Z4R A;  4DUY M;  4FWG A;  3GO8 A;  3GLI A;  1Z5A A;  3GPX A;  2EO2 A;  4OX9 M;  4FCV A;  5KO3 A;  2ZAM A;  1Q39 A;  2CFO A;  4NOO B;  5EP4 A;  1NSF A;  1IY1 A;  1GVN A;  2XH9 A;  4LGY A;  5FTL A;  2VQF M;  5A2Q S;  4G4N A;  1XMO M;  4MM3 B;  2CHG A;  1QYR A;  3PNY A;  3W0L B;  3RGP A;  2XEP A;  3THG A;  4PDI A;  3KSJ A;  3GLG A;  3KP1 E;  1GKI A;  2L7H A;  4IBI A;  4G6Z A;  1I94 M;  4R3D A;  3U6C A;  1XMQ M;  1MX0 A;  2P5T A;  3VK8 A;  4I8O A;  4QHT A;  1VDD A;  4RF1 A;  4NXN M;  4DR5 M;  1XNQ M;  3D8L A;  1Q3C A;  1Z59 A;  3SYL A;  2QZ4 A;  3VKG A;  5LMU M;  2UUC M;  1FNN A;  1IN6 A;  4MGI E;  4RNA A;  2C9C A;  5GKN A;  2QBY A;  3A98 B;  2LH0 A;  5KPR A;  4AQY M;  3AOE A;  2C98 A;  2XF3 A;  4JXJ A;  4QHS A;  2UUB M;  4IBD A;  1KSF X;  2XSZ D;  3KOZ E;  4NL4 H;  3EIH A;  4M9S A;  1C1K A;  3VDU A;  4LF9 M;  5IRE B;  1R6B X;  4M0D A;  3GRV A;  4CIS A;  3I4Y A;  2KRU A;  4DR7 M;  5E26 A;  1OFH A;  4PD2 A;  4AKH A;  4FCT A;  5KPZ A;  1L2C A;  2KW0 A;  4IBG A;  4LZZ A;  3RFW A;  4BB9 A;  3GLG B;  5F3W A;  1L1T A;  3GLH B;  4II7 A;  4LF6 M;  3J27 B;  3BOS A;  3K1J A;  1K3X A;  2F4V M;  3DZD A;  2QEN A;  5FLX S;  2DWL A;  4I5S A;  5EXS A;  3I4V A;  4KLN A;  2ZAO A;  2UXB M;  2VII A;  4XBO A;  3FTF A;  2KXE A;  1IXR C;  4AKI A;  4LJ5 A;  2LXE A;  5DYI A;  3UZU A;  5BPV A;  1SXJ A;  1K3W A;  3KSX A;  3ZCB B;  3HWS A;  1GL7 A;  3AOG A;  3KP0 E;  4LGM A;  4L15 A;  2C9O A;  5IT9 S;  2R46 A;  4QNM A;  3JR5 A;  4OU7 A;  2QBY B;  3HJS A;  2O5R A;  2VQE M;  2ERC A;  1PJI A;  1TH3 A;  1G8P A;  4LY6 A;  4GH9 A;  4DV3 M;  5EP2 A;  4JI7 M;  4AW4 A;  1IQP A;  2KZU A;  3GPU A;  1TDZ A;  3U6M A;  3KFU G;  4DUZ M;  3KW6 A;  3TE6 A;  4YY3 M;  4LZJ A;  1HQC A;  3EIE A;  2YFQ A;  1R2Y A;  4NSR A;  3DFZ A;  3QAU A;  4LF4 M;  4ITQ A;  2XFS A;  1IN4 A;  4D81 A;  3KOW E;  2V6Z M;  4FWH A;  4HL4 A;  2L7I A;  1XWI A;  8CAT A;  4JI5 M;  4NSO B;  4I81 A;  3GP1 A;  2DWN A;  1OJL A;  4LG2 A;  3T1H M;  3FYD A;  2C96 A;  1SXJ C;  4Z8X A;  3R9X B;  2X8A A;  4LJ4 A;  1JR3 D;  3FYC A;  1SXJ B;  2DWZ B;  4W5W A;  3TQS A;  5C1B A;  1EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...