4DV5M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv5M02
4PDIA 4DR6M 1EE8A 1HNZM 4B3TM 4JYAM 1Z5CA 4JI1M 3SASA 4B3MM 4G4NA 4LF8M 4DV4M 2UXBM 4LF4M 1R2YA 4PDGA 4PD2A 4DV0M 4JI0M 3U6OA 3GPXA 1IBMM 4NRVA 1XMQM 1Q3CA 3A42A 3U6MA 1K3WA 1PJIA 4LFCM 1MX0A 3A45A 5IWAM 4JV5M 4LFBM 5A2QS 1HNWM 4DV2M 2Q2EB 1J5EM 5ITXE 1Z59A 4JI8M 4K0KM 1N34M 5LMNM 3GPUA 4DV5M 3W0FA 3OTOM 1Q3BA 2VQEM 1XNRM 4LF9M 3J81S 4DUZM 1L2CA 1L1ZA 3GQ5A 3GPYA 4GKKM 3JAMS 4DR4M 4JI5M 1TDHA 1Q39A 4DUYM 2UUBM 3J7AS 3VK8A 1XC8A 4G4RA 3TWLA 2F5OA 1XNQM 4JI3M 4DV3M 1N36M 2ZM6M 3SBJA 3SATA 3U6CA 1L2DA 4B3SM 4DV6M 3JR4A 4JI2M 1NNJA 4YY3M 1HNXM 2VQFM 3SAVA 2UXCM 1FJGM 5ITQA 1Z5AA 3A46A 4LF6M 4JI6M 1Z5BA 2HKJA 1IBLM 4KHPM 2OQ4A 1L2BA 3GO8A 4LFAM 4G4QA 3TWMA 4NRWA 4CISA 3TWKA 4DR5M 4X62M 3T1HM 2UUCM 3U6SA 2ZBKB 4DV1M 3SAWA 3GPPA 5LMUM 3VK7A 2OPFA 1MU5A 5ITUA 3GQ3A 4NXMM 4X66M 4X64M 2F5SA 4JI7M 2E5LM 5IT9S 1R2ZA 2UU9M 2XZUA 3SARA 3J80S 2XZFA 4DR2M 2UUAM 5ITTA 3U6PA 5FLXS 1TDZA 4B3RM 4PCZA 3U6EA 4LF5M 2F5NA 3GP1A 3DOAA 4DR3M 1XMOM 4DV7M 4NXNM 2F5PA 3JR5A 1K82A 3T1YM 1PM5A 1HR0M 2EA0A 1N33M 4AQYM 2F5QA 4LF7M 5ITYA 3GQ4A 1PJJA 4GKJM 4DR1M 5BR8M 2UXDM 4DR7M 4ITQA 1KFVA 2HHHM 2F4VM 3SAUA 3U6DA 4JI4M 1N32M 1L1TA 4MB7A 1IBKM 4G4OA 4OX9M 1I94M 4X65M 3C58A 1K3XA 3U6LA 3U6QA 5ITRA 4YHHM 5ITXA
chains in the Genus database with same CATH superfamily
1XXHB 4PDIA 4NOOB 4DR6M 4UN2B 2MJ5B 2YQZA 1HNZM 1QZMA 2R4EA 1YUBA 3QYEA 2L4FA 4JI1M 2KEBA 4LF8M 2BJVA 4DV4M 4IBJA 3HHYA 3TL4X 5H37D 4QOZC 1R2YA 1NY5A 4DV0M 2LVQD 3B74A 2Z3XA 1G59A 2L09A 3T38A 3A42A 3TQSA 4AZFA 4LJ6A 1K3WA 1MX0A 4RF1A 4AKGA 4FWHA 2Z4SA 2DZOB 3KXEC 1WJ7A 3EIEA 1ZQ9A 1J5EM 4JI8M 2JZ1A 3FTFA 1F4IA 3SC3A 4LZZA 2VIIA 1Q3BA 2XFTA 2LVPC 3KDSE 2VQEM 1Z6TA 4F1IA 1OIZA 2LTUA 3VDUA 1SXJA 1LV7A 2C96A 2QNJA 2JA2A 1VEJA 2ZAOA 4GH9A 3B7NA 2J7NA 1NHGC 1TDHA 1IXSB 3I04M 3VLFB 2XSZA 3B7QA 4FWDA 2CHVA 2DAEA 2LNHC 1WHCA 3VK8A 1XC8A 2QZ4A 1SXJB 4G4RA 2KNAA 3KSJA 1N36M 2Z8YM 3E4RA 3C9PA 2GQFA 3BXWA 1WGNA 4FD2A 1VEGA 3K9OA 1DGBA 1NVMA 1SXJE 1V33A 3U6CA 3UK6A 3L26A 4B3SM 5FTMA 3QAUA 1R5LA 2BWBA 1H6UA 3JR4A 4JI2M 2G3QA 4LRSA 5KPZA 3PNYA 1VEKA 5EP1A 3E9SA 1QDTA 1MJGM 1EFUB 2MR9A 4L4UA 1FJGM 1Z5AA 3PNVA 3VKGA 4JI6M 1G41A 1IBLM 1DGFA 5KPRA 3U5ZA 1L2BA 3GO8A 4FCVA 1YLAA 5EXTA 3SHGB 4IBGA 2C5RA 2DWNA 4CISA 3TWKA 1WGLA 3M0EA 1MN3A 3U6SA 1VQ1A 4Y28F 2D7HA 2QHOB 3RGSA 3SMPA 5LMUM 2OPFA 2EJSA 4JN6A 1NJGA 3U5ZB 2FOIC 3QYBA 1IN5A 4GITA 4FCTA 3FRIA 3V76A 4X64M 1TR8A 1G3IA 2CE7A 3R8FA 2HL7A 1R2ZA 2V1CA 1WR1B 1QVRA 2QQ8A 1HJPA 3U61A 4L78A 5FTNA 2R44A 2XZFA 4REZA 1HQYE 1V92A 5IZ7D 3IG5A 2DAMA 3I4VA 4PCZA 1ZMUA 4LF5M 1FNNA 3HKPA 4GEWA 3GP1A 3VKHA 2X49A 2DENA 1KSFX 3CF6E 3VDPA 3U61B 4NL4H 1DO0A 1PGYA 3T1YM 1E94E 3GRVA 2EA0A 2N35A 3MK6A 4OVZA 4DR1M 5BR8M 2UXDM 3K8ZA 1OAIA 1R7RA 4M0DA 4F2LA 4IBDA 4DR7M 2ZAMA 2HHHM 2DZNB 3HJQA 5E6JA 3HHZA 4HLQA 4MGIE 2DHYA 3Q8GA 1N32M 2EO2A 3AJIB 1L1TA 3K1JA 1TH4A 2QBYA 4R71A 4OVZB 2XFSA 1I94M 4B7FA 4NSOB 1G71A 3U6LA 3U6QA 3CTWB 1GJTA 3K9PA 4YHHM 2K0BX 5ITXA 4XBOA 4ZPXA 3HU2A 1GJSA 3H4JA 2DVWB 4B3TM 1Z5CA 4I8OA 2QBYB 1R6BX 3HWSA 2KW0A 4HEOA 1YE9A 2KRKA 2EKFA 4II7A 4QHSA 4B3MM 3CGWA 3UJNA 3B89A 4GC9A 4I81A 2OOBA 3NBXX 2K47A 2DHRA 3IHPA 1D0KA 1JB0F 3TE6A 4PD2A 2BJWA 3KS4A 3FTCA 4NRVA 1IBMM 2KRUA 2R18A 2LBCA 3RFWA 1PJIA 5IWAM 2HWJA 2OO9A 4MH0E 2XEPA 2WSEF 2LH0A 3UGJA 1QAMA 2APLA 5ITXE 3E21A 1V34A 1ZMWA 1D0LA 1NO1A 2H5XA 2HCBA 4QHTA 4QOSA 2R46A 2ZTCA 2C98A 3W0FA 4DBGB 1KYIA 4L15A 3J27B 4KT0F 4M0WA 5FSWA 1L2CA 4AKIA 4HL4A 3L27A 4GKKM 2NQ8C 3AV0A 1XB2B 1NHWC 1Q39A 2CV2A 5KO3A 3CF2A 3DA1A 2DNAA 4AG6A 2DKLA 3CF0A 4IBKA 2UUBM 5GKNA 1N75A 2QP9X 1XNQM 2LXEA 3ZQJA 3AL0C 3KW6A 5DFLA 3SBJA 2ZTDA 3B7ZA 2RGOA 1QQWA 2CFOA 3HHWA 2Y21A 5FTKA 1NY6A 1C7YA 4S12A 1GL7A 1NSFA 2L6OA 2R6FA 3FYDA 4M9SA 2CHGA 3AOEA 3K92A 1NNJA 3C3EA 1OFIA 3HX3A 1E9RA 1HNXM 1IY2A 2UXCM 1OAOC 3HJSA 5ITQA 3A46A 2CUZA 4KHPM 5IREB 2OQ4A 1XWIA 3UMMA 2QCUA 2L2DA 4G4QA 3TWMA 1IXRC 2V1UA 3MHVC 4X62M 3L29A 1JR3A 3M7GA 4DV1M 1QUSA 2JY8A 1IN8A 3HZJA 2O01F 2KXEA 2L7HA 4QNRA 2XLJA 3NWLA 3PVSA 3DZDA 2RKOA 1OFHA 3GLHA 2DXIA 1HT2E 3LVVA 2Y0TA 1CUKA 2QENA 4MGYE 4X66M 2C9OA 5EQTA 3GLGA 3ZCBB 1N77A 4WP2A 2Y0QA 8CATA 4WURA 3SARA 2CRUA 1LTMA 4R3DA 4B7HA 5C1BA 2UUAM 1IN7A 3U6PA 1TDZA 2JY5A 3L28A 5DYIA 1NV9A 4LJAA 3GLHB 4MGKE 5EP2A 1ORYB 1GLNA 2B3TA 1JR3E 3FUXA 3HU3A 3MJ5A 3AKZA 1S3SA 3U6EA 3GLGB 4DR3M 4IBBA 4DV7M 3KP0E 2CHQA 2JWSA 2MROB 2K6BA 3DFZA 3HU1A 4NXNM 4FVMA 3JR5A 3GLHE 1PM5A 1HR0M 1N33M 2F5QA 2WSCF 3GQ4A 4GKJM 5FTJA 3GLGE 3I4YA 2RGHA 4GRIA 4PT5A 4FCWA 3U6DA 4JI4M 2WSFF 2A5YB 1AIPC 2QPAA 3L25A 1NNUC 2LHCA 2VDBB 1IBKM 1EIJA 4X65M 1K3XA 2JY7A 2MH8A 2KNZA 2DWZB 4IBIA 1G8PA 1QAOA 1I4WA 2DAGA 4JYAM 1P3QQ 1UFZA 2GNOA 3ZH9B 3GRRA 2CV1A 1DGGA 1GL6A 3SYLA 3M6AA 4G4NA 3KVWA 1UM8A 3WHLA 1IY1A 3U6OA 3GPXA 1XMQM 1W5TA 3A45A 4P16A 4GHLA 2K9DA 4I5SA 3C3DA 5A2QS 2Q2EB 1T43A 3I51A 3W68A 2C99A 1YSYA 4MGZE 4AG5A 5LMNM 1OJLA 1R4GA 2I7PA 5FTLA 3A98B 3GPUA 1XNRM 4FWGA 2BNKA 1DGHA 4WW0A 3FTEA 4DR4M 4JI5M 1TGUA 2LHGA 2CP8A 2O5RA 2XGNA 1HQCA 4GMQA 4L6V6 2DWLA 3GRUA 2BWEA 5KPTA 2FNAA 1IY0A 1VG5A 3HGIA 1QAQA 1DGHB 3KP1E 3TWLA 4LRTA 3ILKA 1AUAA 3FYCA 2LVNC 4JI3M 4DV3M 5DNYA 2LVAA 4IJFA 2ZANA 4B7GA 1NJFA 4G3OA 2DZLA 2G8LA 4B08A 4XGIA 3THGA 5C18A 2FFJA 3D8LA 1Y8GA 3VFDA 4D81A 3LQQA 4LCBA 1Z5BA 3U60A 2Y20A 1GABA 4Z8XA 2MGWA 1SG9A 2M5ZA 2FH0A 4NRWA 2VF7A 2KDLA 4L8RC 3HHXA 3UZUA 3E46A 3T1HM 2UUCM 4NC6A 2ZBKB 4CIZA 3FUVA 1TF0B 3SAWA 4KO8A 3B9PA 5KQDA 3LCVB 1L8QA 3Q8XA 4MM3B 1MU5A 1E32A 2KNVA 4IBFA 1J09A 2DAIA 1WXQA 1IM2A 1XXHA 3SYKA 2JXNA 3U60B 1SXJD 4LY6A 3GQ3A 3HJ8A 2FS1A 2H1RA 2F5SA 2E5LM 1QYRA 1DO2A 2UU9M 2XZUA 4Q7JA 2JNHA 4IJEA 2XSZD 3J80S 1QANA 1W5SA 1X37A 3KOWE 3GLFA 2YNMD 2D7EA 2QSFX 5JI2E 2R4JA 2XF3A 1Q02A 3FUTA 2DWMA 4LGMA 1PJSA 1D0MA 1GVNA 1XMOM 1PRBA 2JP7A 3KOXE 2Z7JA 4LJ4A 2KHHA 3EIHA 1K82A 1XXHE 2R45A 4M9ZA 3GLFB 4KODA 4OU7A 1OIPA 2EKKA 2J7OA 4AW4A 1OKSA 4ITQA 1A5TA 2XH9A 5JI3E 2F4VM 1IQPA 3GLFE 2X4AA 2KA6B 1J7KA 7CATA 1IXSA 4A3VB 3FUUA 3LQRA 5DYGA 5EJCA 2FE8A 3PXGA 3H4MA 2HAKA 1IN4A 3C58A 3QWLA 1NV8A 4AKHA 5ITRA 3FE3A 2VF8A 2LWXA 2KZUA 3LVWA 1C1KA 1EE8A 2R62A 3W67A 5EXPA 4R7GA 3SASA 5EXXA 4LJ8A 2J5YA 3AFHA 5L8RF 1VDLA 2UXBM 3FKEA 4CHTB 4PDGA 4LF4M 4MGHA 4JI0M 1Q3CA 4IBEA 3U6MA 3KFUG 4LFCM 4JV5M 2KZSA 4ANRA 4LFBM 2OOAA 1HNWM 1IFYA 4DV2M 2JZ0A 3SFZA 1QUTA 1Z59A 3IG8A 1PJTA 4K0KM 1ZV1A 2R65A 3KSXA 1N34M 3RGPA 4DV5M 3OTOM 1ZAEA 1TH2A 2CV0A 3WHKA 2C9CA 3SMSA 3J81S 4DUZM 4LF9M 1L1ZA 3KS8A 4EIWA 3GQ5A 3GPYA 3JAMS 5KQ8A 3J7BA 5E26A 2EUCA 2L7IA 1IN6A 2CEAA 4DUYM 4GIPA 3MMPA 3J7AS 2ERCA 3IECA 4CGYB 3FD9A 2X8AA 2DI0A 4KLNA 2F5OA 2ZM6M 1XHBA 1TTEA 3SATA 3KOYE 4LZJA 2DAKA 4OW0A 2AHMA 4BLCA 1L2DA 2G5GX 4DV6M 2L4EA 4LJ5A 4YY3M 1OQYA 2VQFM 3SAVA 5EP3A 3AOEC 2P5TA 3T6PA 3HY5A 4LF6M 1N78A 2HKJA 2M60A 1GO5A 3FUWA 1IXZA 1D2NA 4QNMA 4LFAM 3D8BA 4M9XA 1SXJC 3FTDA 1QDRA 3F92A 4AI6A 1T6OA 3NBIA 4DR5M 4GHAA 1RU3A 4Z6YA 1PJQA 2R0IA 5EXSA 3GPPA 1QZEA 3ZC7B 1GKIA 1WIVA 3VK7A 3LMMA 4TUWA 1G4AE 2O25A 2D7GA 3PFIA 4LJ9A 5ITUA 5F3WA 4NXMM 3T15A 2JY6B 4JI7M 5IT9S 3LCUA 4GC5A 3RE8A 2YFQA 4JXJA 3FRHA 4D80A 4DR2M 5ITTA 5EP4A 4LJ7A 5FLXS 1ZMVA 4I4LA 5BPVA 4IIWA 3LW5F 4RKUF 3GLIA 4B3RM 4LGYA 3R9XB 2CWBA 2RRUA 2F5NA 4BB9A 3DOAA 1OTRA 3SHFA 3I01M 1TH3A 2W82A 2F5PA 4IBCA 4W5WA 3TPZA 2JUJA 4AQYM 4LF7M 5ITYA 1PJJA 1DV0A 4D82A 2WZJA 1HT1E 3GLIB 4BBAA 3W0LB 1KFVA 2Z4RA 3L2AA 4NSRA 3BOSA 3SAUA 2LVOC 1E9SA 2I7NA 1JQJC 4L16A 3AOGA 4RF0A 4MB7A 3GLIE 3KOZE 4RNAA 4G6ZA 1VDDA 2V6ZM 3BBZA 4XK8F 1BVSA 4G4OA 3K2LA 4OX9M 4LG2A 3J2PB 2YR0A 1JR3D 3GRYA 4FW9A 1T3TA 4P17A 4CJ6A
chains in the Genus database with same CATH topology
1XXHB 4PDIA 4NOOB 4DR6M 2YQZA 1HNZM 1QZMA 2R4EA 1YUBA 4JI1M 2KEBA 4LF8M 2BJVA 4DV4M 4IBJA 3HHYA 3TL4X 5H37D 4QOZC 1R2YA 1NY5A 4DV0M 2Z3XA 1G59A 2L09A 3T38A 3A42A 3TQSA 4AZFA 4LJ6A 1K3WA 1MX0A 4RF1A 4AKGA 4FWHA 2Z4SA 2DZOB 3KXEC 1J5EM 3EIEA 1ZQ9A 4JI8M 3FTFA 3SC3A 4LZZA 2VIIA 1Q3BA 2XFTA 3KDSE 2VQEM 1Z6TA 3VDUA 1SXJA 1LV7A 2C96A 2JA2A 2ZAOA 4GH9A 2J7NA 1NHGC 1TDHA 1IXSB 3VLFB 2XSZA 4FWDA 2CHVA 2LNHC 3VK8A 1XC8A 2QZ4A 1SXJB 4G4RA 3KSJA 1N36M 3E4RA 4FD2A 1DGBA 1NVMA 1SXJE 3U6CA 3UK6A 3L26A 4B3SM 5FTMA 3QAUA 3JR4A 1H6UA 4JI2M 4LRSA 5KPZA 3PNYA 5EP1A 3E9SA 4L4UA 1FJGM 3VKGA 1Z5AA 3PNVA 4JI6M 1G41A 1IBLM 1DGFA 5KPRA 3U5ZA 1L2BA 3GO8A 4FCVA 5EXTA 3SHGB 4IBGA 2C5RA 2DWNA 4CISA 3TWKA 3M0EA 3U6SA 2D7HA 3RGSA 3SMPA 5LMUM 2OPFA 4JN6A 1NJGA 3U5ZB 2FOIC 1IN5A 4GITA 4FCTA 4X64M 3R8FA 1G3IA 2CE7A 2HL7A 1R2ZA 2V1CA 1QVRA 3U61A 4L78A 5FTNA 2XZFA 4REZA 1HQYE 5IZ7D 3IG5A 3I4VA 4PCZA 4LF5M 1FNNA 3HKPA 3GP1A 3VKHA 2X49A 3CF6E 1KSFX 3VDPA 3U61B 4NL4H 1DO0A 3T1YM 1E94E 3GRVA 2EA0A 3MK6A 4OVZA 4DR1M 5BR8M 2UXDM 3K8ZA 1R7RA 4M0DA 4DR7M 4IBDA 2ZAMA 2HHHM 2DZNB 3HJQA 5E6JA 3HHZA 4HLQA 4MGIE 1N32M 2EO2A 3AJIB 1L1TA 3K1JA 1TH4A 2QBYA 4OVZB 2XFSA 1I94M 4B7FA 4NSOB 3U6LA 3U6QA 3CTWB 4YHHM 5ITXA 4XBOA 4ZPXA 3HU2A 2DVWB 4B3TM 1Z5CA 4I8OA 2QBYB 1R6BX 3HWSA 2KW0A 1YE9A 2KRKA 4II7A 4QHSA 4B3MM 3UJNA 4GC9A 4I81A 2K47A 2DHRA 4PD2A 3TE6A 2BJWA 3KS4A 3FTCA 4NRVA 1IBMM 2KRUA 2R18A 3RFWA 1PJIA 5IWAM 4MH0E 2XEPA 2LH0A 3UGJA 1QAMA 5ITXE 4QOSA 4QHTA 2HCBA 2R46A 2C98A 3W0FA 1KYIA 4L15A 3J27B 4M0WA 5FSWA 1L2CA 4AKIA 4HL4A 3L27A 4GKKM 2NQ8C 3AV0A 1NHWC 1Q39A 2CV2A 5KO3A 3CF2A 3DA1A 4AG6A 3CF0A 4IBKA 2UUBM 5GKNA 1N75A 2QP9X 1XNQM 2LXEA 3AL0C 3KW6A 3SBJA 2RGOA 1QQWA 2CFOA 3HHWA 2Y21A 5FTKA 1NY6A 4S12A 1GL7A 1NSFA 2L6OA 3FYDA 4M9SA 2CHGA 3AOEA 3K92A 1NNJA 1OFIA 1E9RA 1HNXM 1IY2A 2UXCM 3HJSA 5ITQA 3A46A 2CUZA 4KHPM 5IREB 2OQ4A 1XWIA 3UMMA 2QCUA 4G4QA 3TWMA 1IXRC 2V1UA 3MHVC 4X62M 3L29A 1JR3A 3M7GA 4DV1M 1IN8A 4QNRA 2KXEA 2L7HA 2XLJA 3NWLA 3PVSA 3DZDA 2RKOA 1OFHA 3GLHA 2DXIA 1HT2E 3LVVA 2Y0TA 4MGYE 2QENA 4X66M 2C9OA 5EQTA 3GLGA 3ZCBB 1N77A 2Y0QA 8CATA 4WURA 3SARA 4R3DA 4B7HA 5C1BA 2UUAM 1IN7A 3U6PA 1TDZA 5DYIA 3L28A 4LJAA 3GLHB 4MGKE 5EP2A 1ORYB 1GLNA 3FUXA 3HU3A 3MJ5A 3U6EA 3AKZA 1S3SA 3GLGB 4DR3M 4IBBA 4DV7M 3KP0E 2CHQA 4NXNM 3HU1A 3DFZA 4FVMA 3JR5A 1PM5A 1HR0M 1N33M 2F5QA 3GQ4A 4GKJM 5FTJA 3I4YA 2RGHA 4GRIA 4PT5A 4FCWA 3U6DA 4JI4M 2A5YB 2QPAA 3L25A 1NNUC 1IBKM 4X65M 1K3XA 2DWZB 4IBIA 1G8PA 1QAOA 1I4WA 4JYAM 3ZH9B 3GRRA 2CV1A 1DGGA 1GL6A 3SYLA 3M6AA 4G4NA 3KVWA 1UM8A 3WHLA 1IY1A 3U6OA 3GPXA 1XMQM 1W5TA 3A45A 4P16A 4GHLA 4I5SA 5A2QS 2Q2EB 3I51A 2C99A 1YSYA 4MGZE 4AG5A 5LMNM 1OJLA 5FTLA 2I7PA 3GPUA 3A98B 1XNRM 4FWGA 2BNKA 1DGHA 4WW0A 3FTEA 4DR4M 4JI5M 1TGUA 2O5RA 2XGNA 1HQCA 4GMQA 2DWLA 3GRUA 5KPTA 2FNAA 1IY0A 3HGIA 1QAQA 1DGHB 3KP1E 3TWLA 4LRTA 3ILKA 4JI3M 3FYCA 4DV3M 5DNYA 4IJFA 2ZANA 4B7GA 1NJFA 2G8LA 4B08A 4XGIA 3THGA 5C18A 2FFJA 3D8LA 3VFDA 4D81A 3LQQA 4LCBA 1Z5BA 3U60A 2Y20A 4Z8XA 2M5ZA 4NRWA 4L8RC 3HHXA 3UZUA 3T1HM 2UUCM 2ZBKB 3SAWA 3FUVA 4KO8A 3B9PA 5KQDA 1L8QA 3Q8XA 4MM3B 1MU5A 1E32A 3U60B 4IBFA 1J09A 3SYKA 1WXQA 1IM2A 1XXHA 1SXJD 4LY6A 3GQ3A 3HJ8A 2H1RA 2F5SA 2E5LM 1QYRA 1DO2A 2UU9M 2XZUA 4IJEA 3J80S 2XSZD 1QANA 1W5SA 1X37A 3KOWE 3GLFA 2YNMD 2D7EA 5JI2E 2R4JA 2XF3A 3FUTA 2DWMA 4LGMA 1GVNA 1XMOM 3KOXE 2Z7JA 4LJ4A 3EIHA 1K82A 2R45A 4M9ZA 3GLFB 4KODA 4OU7A 2J7OA 4AW4A 4ITQA 2XH9A 5JI3E 2F4VM 1IQPA 2X4AA 2KA6B 1J7KA 7CATA 4A3VB 3FUUA 3LQRA 5DYGA 5EJCA 2FE8A 3PXGA 3H4MA 1IN4A 3C58A 3QWLA 4AKHA 5ITRA 2LWXA 2KZUA 3LVWA 1C1KA 1EE8A 2R62A 5EXPA 4R7GA 3SASA 5EXXA 4LJ8A 3AFHA 2UXBM 3FKEA 4CHTB 4PDGA 4LF4M 4MGHA 4JI0M 1Q3CA 4IBEA 3U6MA 3KFUG 4LFCM 4JV5M 2KZSA 4LFBM 1HNWM 4DV2M 3SFZA 1Z59A 3IG8A 4K0KM 1N34M 2R65A 3KSXA 3RGPA 4DV5M 3OTOM 1ZAEA 1TH2A 2CV0A 3WHKA 2C9CA 3SMSA 3J81S 4DUZM 4LF9M 1L1ZA 3KS8A 4EIWA 3GQ5A 3GPYA 3JAMS 5KQ8A 3J7BA 5E26A 2EUCA 2L7IA 1IN6A 2CEAA 4DUYM 4GIPA 3J7AS 2ERCA 4CGYB 3FD9A 2X8AA 4KLNA 2F5OA 2ZM6M 1XHBA 3SATA 3KOYE 4LZJA 4OW0A 2AHMA 4BLCA 1L2DA 2G5GX 4DV6M 4LJ5A 4YY3M 2VQFM 3SAVA 5EP3A 3AOEC 2P5TA 4LF6M 1N78A 2HKJA 2M60A 3FUWA 1IXZA 1D2NA 4QNMA 4LFAM 3D8BA 4M9XA 1SXJC 3FTDA 4AI6A 4DR5M 3NBIA 4GHAA 4Z6YA 5EXSA 3GPPA 3ZC7B 1GKIA 4TUWA 3VK7A 3LMMA 1G4AE 2D7GA 3PFIA 4LJ9A 5ITUA 5F3WA 4NXMM 3T15A 4JI7M 5IT9S 4GC5A 3RE8A 2YFQA 4JXJA 4D80A 4DR2M 5ITTA 5EP4A 4LJ7A 5FLXS 4I4LA 5BPVA 4IIWA 3GLIA 4B3RM 4LGYA 3R9XB 2F5NA 4BB9A 3DOAA 3SHFA 1TH3A 2W82A 2F5PA 4IBCA 4W5WA 3TPZA 4AQYM 4LF7M 5ITYA 1PJJA 4D82A 1HT1E 3GLIB 4BBAA 3W0LB 1KFVA 2Z4RA 3L2AA 4NSRA 3BOSA 3SAUA 1E9SA 2I7NA 1JQJC 4L16A 3AOGA 4RF0A 4MB7A 3KOZE 4RNAA 4G6ZA 1VDDA 2V6ZM 4G4OA 4OX9M 3K2LA 4LG2A 3J2PB 2YR0A 1JR3D 3GRYA 4FW9A 1T3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDI A;  4DR6 M;  1EE8 A;  1HNZ M;  4B3T M;  4JYA M;  1Z5C A;  4JI1 M;  3SAS A;  4B3M M;  4G4N A;  4LF8 M;  4DV4 M;  2UXB M;  4LF4 M;  1R2Y A;  4PDG A;  4PD2 A;  4DV0 M;  4JI0 M;  3U6O A;  3GPX A;  1IBM M;  4NRV A;  1XMQ M;  1Q3C A;  3A42 A;  3U6M A;  1K3W A;  1PJI A;  4LFC M;  1MX0 A;  3A45 A;  5IWA M;  4JV5 M;  4LFB M;  5A2Q S;  1HNW M;  4DV2 M;  2Q2E B;  1J5E M;  5ITX E;  1Z59 A;  4JI8 M;  4K0K M;  1N34 M;  5LMN M;  3GPU A;  4DV5 M;  3W0F A;  3OTO M;  1Q3B A;  2VQE M;  1XNR M;  4LF9 M;  3J81 S;  4DUZ M;  1L2C A;  1L1Z A;  3GQ5 A;  3GPY A;  4GKK M;  3JAM S;  4DR4 M;  4JI5 M;  1TDH A;  1Q39 A;  4DUY M;  2UUB M;  3J7A S;  3VK8 A;  1XC8 A;  4G4R A;  3TWL A;  2F5O A;  1XNQ M;  4JI3 M;  4DV3 M;  1N36 M;  2ZM6 M;  3SBJ A;  3SAT A;  3U6C A;  1L2D A;  4B3S M;  4DV6 M;  3JR4 A;  4JI2 M;  1NNJ A;  4YY3 M;  1HNX M;  2VQF M;  3SAV A;  2UXC M;  1FJG M;  5ITQ A;  1Z5A A;  3A46 A;  4LF6 M;  4JI6 M;  1Z5B A;  2HKJ A;  1IBL M;  4KHP M;  2OQ4 A;  1L2B A;  3GO8 A;  4LFA M;  4G4Q A;  3TWM A;  4NRW A;  4CIS A;  3TWK A;  4DR5 M;  4X62 M;  3T1H M;  2UUC M;  3U6S A;  2ZBK B;  4DV1 M;  3SAW A;  3GPP A;  5LMU M;  3VK7 A;  2OPF A;  1MU5 A;  5ITU A;  3GQ3 A;  4NXM M;  4X66 M;  4X64 M;  2F5S A;  4JI7 M;  2E5L M;  5IT9 S;  1R2Z A;  2UU9 M;  2XZU A;  3SAR A;  3J80 S;  2XZF A;  4DR2 M;  2UUA M;  5ITT A;  3U6P A;  5FLX S;  1TDZ A;  4B3R M;  4PCZ A;  3U6E A;  4LF5 M;  2F5N A;  3GP1 A;  3DOA A;  4DR3 M;  1XMO M;  4DV7 M;  4NXN M;  2F5P A;  3JR5 A;  1K82 A;  3T1Y M;  1PM5 A;  1HR0 M;  2EA0 A;  1N33 M;  4AQY M;  2F5Q A;  4LF7 M;  5ITY A;  3GQ4 A;  1PJJ A;  4GKJ M;  4DR1 M;  5BR8 M;  2UXD M;  4DR7 M;  4ITQ A;  1KFV A;  2HHH M;  2F4V M;  3SAU A;  3U6D A;  4JI4 M;  1N32 M;  1L1T A;  4MB7 A;  1IBK M;  4G4O A;  4OX9 M;  1I94 M;  4X65 M;  3C58 A;  1K3X A;  3U6L A;  3U6Q A;  5ITR A;  4YHH M;  5ITX A; 
#chains in the Genus database with same CATH topology
 1XXH B;  4PDI A;  4NOO B;  4DR6 M;  4UN2 B;  2MJ5 B;  2YQZ A;  1HNZ M;  1QZM A;  2R4E A;  1YUB A;  3QYE A;  2L4F A;  4JI1 M;  2KEB A;  4LF8 M;  2BJV A;  4DV4 M;  4IBJ A;  3HHY A;  3TL4 X;  5H37 D;  4QOZ C;  1R2Y A;  1NY5 A;  4DV0 M;  2LVQ D;  3B74 A;  2Z3X A;  1G59 A;  2L09 A;  3T38 A;  3A42 A;  3TQS A;  4AZF A;  4LJ6 A;  1K3W A;  1MX0 A;  4RF1 A;  4AKG A;  4FWH A;  2Z4S A;  2DZO B;  3KXE C;  1WJ7 A;  3EIE A;  1ZQ9 A;  1J5E M;  4JI8 M;  2JZ1 A;  3FTF A;  1F4I A;  3SC3 A;  4LZZ A;  2VII A;  1Q3B A;  2XFT A;  2LVP C;  3KDS E;  2VQE M;  1Z6T A;  4F1I A;  1OIZ A;  2LTU A;  3VDU A;  1SXJ A;  1LV7 A;  2C96 A;  2QNJ A;  2JA2 A;  1VEJ A;  2ZAO A;  4GH9 A;  3B7N A;  2J7N A;  1NHG C;  1TDH A;  1IXS B;  3I04 M;  3VLF B;  2XSZ A;  3B7Q A;  4FWD A;  2CHV A;  2DAE A;  2LNH C;  1WHC A;  3VK8 A;  1XC8 A;  2QZ4 A;  1SXJ B;  4G4R A;  2KNA A;  3KSJ A;  1N36 M;  2Z8Y M;  3E4R A;  3C9P A;  2GQF A;  3BXW A;  1WGN A;  4FD2 A;  1VEG A;  3K9O A;  1DGB A;  1NVM A;  1SXJ E;  1V33 A;  3U6C A;  3UK6 A;  3L26 A;  4B3S M;  5FTM A;  3QAU A;  1R5L A;  2BWB A;  1H6U A;  3JR4 A;  4JI2 M;  2G3Q A;  4LRS A;  5KPZ A;  3PNY A;  1VEK A;  5EP1 A;  3E9S A;  1QDT A;  1MJG M;  1EFU B;  2MR9 A;  4L4U A;  1FJG M;  1Z5A A;  3PNV A;  3VKG A;  4JI6 M;  1G41 A;  1IBL M;  1DGF A;  5KPR A;  3U5Z A;  1L2B A;  3GO8 A;  4FCV A;  1YLA A;  5EXT A;  3SHG B;  4IBG A;  2C5R A;  2DWN A;  4CIS A;  3TWK A;  1WGL A;  3M0E A;  1MN3 A;  3U6S A;  1VQ1 A;  4Y28 F;  2D7H A;  2QHO B;  3RGS A;  3SMP A;  5LMU M;  2OPF A;  2EJS A;  4JN6 A;  1NJG A;  3U5Z B;  2FOI C;  3QYB A;  1IN5 A;  4GIT A;  4FCT A;  3FRI A;  3V76 A;  4X64 M;  1TR8 A;  1G3I A;  2CE7 A;  3R8F A;  2HL7 A;  1R2Z A;  2V1C A;  1WR1 B;  1QVR A;  2QQ8 A;  1HJP A;  3U61 A;  4L78 A;  5FTN A;  2R44 A;  2XZF A;  4REZ A;  1HQY E;  1V92 A;  5IZ7 D;  3IG5 A;  2DAM A;  3I4V A;  4PCZ A;  1ZMU A;  4LF5 M;  1FNN A;  3HKP A;  4GEW A;  3GP1 A;  3VKH A;  2X49 A;  2DEN A;  1KSF X;  3CF6 E;  3VDP A;  3U61 B;  4NL4 H;  1DO0 A;  1PGY A;  3T1Y M;  1E94 E;  3GRV A;  2EA0 A;  2N35 A;  3MK6 A;  4OVZ A;  4DR1 M;  5BR8 M;  2UXD M;  3K8Z A;  1OAI A;  1R7R A;  4M0D A;  4F2L A;  4IBD A;  4DR7 M;  2ZAM A;  2HHH M;  2DZN B;  3HJQ A;  5E6J A;  3HHZ A;  4HLQ A;  4MGI E;  2DHY A;  3Q8G A;  1N32 M;  2EO2 A;  3AJI B;  1L1T A;  3K1J A;  1TH4 A;  2QBY A;  4R71 A;  4OVZ B;  2XFS A;  1I94 M;  4B7F A;  4NSO B;  1G71 A;  3U6L A;  3U6Q A;  3CTW B;  1GJT A;  3K9P A;  4YHH M;  2K0B X;  5ITX A;  4XBO A;  4ZPX A;  3HU2 A;  1GJS A;  3H4J A;  2DVW B;  4B3T M;  1Z5C A;  4I8O A;  2QBY B;  1R6B X;  3HWS A;  2KW0 A;  4HEO A;  1YE9 A;  2KRK A;  2EKF A;  4II7 A;  4QHS A;  4B3M M;  3CGW A;  3UJN A;  3B89 A;  4GC9 A;  4I81 A;  2OOB A;  3NBX X;  2K47 A;  2DHR A;  3IHP A;  1D0K A;  1JB0 F;  3TE6 A;  4PD2 A;  2BJW A;  3KS4 A;  3FTC A;  4NRV A;  1IBM M;  2KRU A;  2R18 A;  2LBC A;  3RFW A;  1PJI A;  5IWA M;  2HWJ A;  2OO9 A;  4MH0 E;  2XEP A;  2WSE F;  2LH0 A;  3UGJ A;  1QAM A;  2APL A;  5ITX E;  3E21 A;  1V34 A;  1ZMW A;  1D0L A;  1NO1 A;  2H5X A;  2HCB A;  4QHT A;  4QOS A;  2R46 A;  2ZTC A;  2C98 A;  3W0F A;  4DBG B;  1KYI A;  4L15 A;  3J27 B;  4KT0 F;  4M0W A;  5FSW A;  1L2C A;  4AKI A;  4HL4 A;  3L27 A;  4GKK M;  2NQ8 C;  3AV0 A;  1XB2 B;  1NHW C;  1Q39 A;  2CV2 A;  5KO3 A;  3CF2 A;  3DA1 A;  2DNA A;  4AG6 A;  2DKL A;  3CF0 A;  4IBK A;  2UUB M;  5GKN A;  1N75 A;  2QP9 X;  1XNQ M;  2LXE A;  3ZQJ A;  3AL0 C;  3KW6 A;  5DFL A;  3SBJ A;  2ZTD A;  3B7Z A;  2RGO A;  1QQW A;  2CFO A;  3HHW A;  2Y21 A;  5FTK A;  1NY6 A;  1C7Y A;  4S12 A;  1GL7 A;  1NSF A;  2L6O A;  2R6F A;  3FYD A;  4M9S A;  2CHG A;  3AOE A;  3K92 A;  1NNJ A;  3C3E A;  1OFI A;  3HX3 A;  1E9R A;  1HNX M;  1IY2 A;  2UXC M;  1OAO C;  3HJS A;  5ITQ A;  3A46 A;  2CUZ A;  4KHP M;  5IRE B;  2OQ4 A;  1XWI A;  3UMM A;  2QCU A;  2L2D A;  4G4Q A;  3TWM A;  1IXR C;  2V1U A;  3MHV C;  4X62 M;  3L29 A;  1JR3 A;  3M7G A;  4DV1 M;  1QUS A;  2JY8 A;  1IN8 A;  3HZJ A;  2O01 F;  2KXE A;  2L7H A;  4QNR A;  2XLJ A;  3NWL A;  3PVS A;  3DZD A;  2RKO A;  1OFH A;  3GLH A;  2DXI A;  1HT2 E;  3LVV A;  2Y0T A;  1CUK A;  2QEN A;  4MGY E;  4X66 M;  2C9O A;  5EQT A;  3GLG A;  3ZCB B;  1N77 A;  4WP2 A;  2Y0Q A;  8CAT A;  4WUR A;  3SAR A;  2CRU A;  1LTM A;  4R3D A;  4B7H A;  5C1B A;  2UUA M;  1IN7 A;  3U6P A;  1TDZ A;  2JY5 A;  3L28 A;  5DYI A;  1NV9 A;  4LJA A;  3GLH B;  4MGK E;  5EP2 A;  1ORY B;  1GLN A;  2B3T A;  1JR3 E;  3FUX A;  3HU3 A;  3MJ5 A;  3AKZ A;  1S3S A;  3U6E A;  3GLG B;  4DR3 M;  4IBB A;  4DV7 M;  3KP0 E;  2CHQ A;  2JWS A;  2MRO B;  2K6B A;  3DFZ A;  3HU1 A;  4NXN M;  4FVM A;  3JR5 A;  3GLH E;  1PM5 A;  1HR0 M;  1N33 M;  2F5Q A;  2WSC F;  3GQ4 A;  4GKJ M;  5FTJ A;  3GLG E;  3I4Y A;  2RGH A;  4GRI A;  4PT5 A;  4FCW A;  3U6D A;  4JI4 M;  2WSF F;  2A5Y B;  1AIP C;  2QPA A;  3L25 A;  1NNU C;  2LHC A;  2VDB B;  1IBK M;  1EIJ A;  4X65 M;  1K3X A;  2JY7 A;  2MH8 A;  2KNZ A;  2DWZ B;  4IBI A;  1G8P A;  1QAO A;  1I4W A;  2DAG A;  4JYA M;  1P3Q Q;  1UFZ A;  2GNO A;  3ZH9 B;  3GRR A;  2CV1 A;  1DGG A;  1GL6 A;  3SYL A;  3M6A A;  4G4N A;  3KVW A;  1UM8 A;  3WHL A;  1IY1 A;  3U6O A;  3GPX A;  1XMQ M;  1W5T A;  3A45 A;  4P16 A;  4GHL A;  2K9D A;  4I5S A;  3C3D A;  5A2Q S;  2Q2E B;  1T43 A;  3I51 A;  3W68 A;  2C99 A;  1YSY A;  4MGZ E;  4AG5 A;  5LMN M;  1OJL A;  1R4G A;  2I7P A;  5FTL A;  3A98 B;  3GPU A;  1XNR M;  4FWG A;  2BNK A;  1DGH A;  4WW0 A;  3FTE A;  4DR4 M;  4JI5 M;  1TGU A;  2LHG A;  2CP8 A;  2O5R A;  2XGN A;  1HQC A;  4GMQ A;  4L6V 6;  2DWL A;  3GRU A;  2BWE A;  5KPT A;  2FNA A;  1IY0 A;  1VG5 A;  3HGI A;  1QAQ A;  1DGH B;  3KP1 E;  3TWL A;  4LRT A;  3ILK A;  1AUA A;  3FYC A;  2LVN C;  4JI3 M;  4DV3 M;  5DNY A;  2LVA A;  4IJF A;  2ZAN A;  4B7G A;  1NJF A;  4G3O A;  2DZL A;  2G8L A;  4B08 A;  4XGI A;  3THG A;  5C18 A;  2FFJ A;  3D8L A;  1Y8G A;  3VFD A;  4D81 A;  3LQQ A;  4LCB A;  1Z5B A;  3U60 A;  2Y20 A;  1GAB A;  4Z8X A;  2MGW A;  1SG9 A;  2M5Z A;  2FH0 A;  4NRW A;  2VF7 A;  2KDL A;  4L8R C;  3HHX A;  3UZU A;  3E46 A;  3T1H M;  2UUC M;  4NC6 A;  2ZBK B;  4CIZ A;  3FUV A;  1TF0 B;  3SAW A;  4KO8 A;  3B9P A;  5KQD A;  3LCV B;  1L8Q A;  3Q8X A;  4MM3 B;  1MU5 A;  1E32 A;  2KNV A;  4IBF A;  1J09 A;  2DAI A;  1WXQ A;  1IM2 A;  1XXH A;  3SYK A;  2JXN A;  3U60 B;  1SXJ D;  4LY6 A;  3GQ3 A;  3HJ8 A;  2FS1 A;  2H1R A;  2F5S A;  2E5L M;  1QYR A;  1DO2 A;  2UU9 M;  2XZU A;  4Q7J A;  2JNH A;  4IJE A;  2XSZ D;  3J80 S;  1QAN A;  1W5S A;  1X37 A;  3KOW E;  3GLF A;  2YNM D;  2D7E A;  2QSF X;  5JI2 E;  2R4J A;  2XF3 A;  1Q02 A;  3FUT A;  2DWM A;  4LGM A;  1PJS A;  1D0M A;  1GVN A;  1XMO M;  1PRB A;  2JP7 A;  3KOX E;  2Z7J A;  4LJ4 A;  2KHH A;  3EIH A;  1K82 A;  1XXH E;  2R45 A;  4M9Z A;  3GLF B;  4KOD A;  4OU7 A;  1OIP A;  2EKK A;  2J7O A;  4AW4 A;  1OKS A;  4ITQ A;  1A5T A;  2XH9 A;  5JI3 E;  2F4V M;  1IQP A;  3GLF E;  2X4A A;  2KA6 B;  1J7K A;  7CAT A;  1IXS A;  4A3V B;  3FUU A;  3LQR A;  5DYG A;  5EJC A;  2FE8 A;  3PXG A;  3H4M A;  2HAK A;  1IN4 A;  3C58 A;  3QWL A;  1NV8 A;  4AKH A;  5ITR A;  3FE3 A;  2VF8 A;  2LWX A;  2KZU A;  3LVW A;  1C1K A;  1EE8 A;  2R62 A;  3W67 A;  5EXP A;  4R7G A;  3SAS A;  5EXX A;  4LJ8 A;  2J5Y A;  3AFH A;  5L8R F;  1VDL A;  2UXB M;  3FKE A;  4CHT B;  4PDG A;  4LF4 M;  4MGH A;  4JI0 M;  1Q3C A;  4IBE A;  3U6M A;  3KFU G;  4LFC M;  4JV5 M;  2KZS A;  4ANR A;  4LFB M;  2OOA A;  1HNW M;  1IFY A;  4DV2 M;  2JZ0 A;  3SFZ A;  1QUT A;  1Z59 A;  3IG8 A;  1PJT A;  4K0K M;  1ZV1 A;  2R65 A;  3KSX A;  1N34 M;  3RGP A;  4DV5 M;  3OTO M;  1ZAE A;  1TH2 A;  2CV0 A;  3WHK A;  2C9C A;  3SMS A;  3J81 S;  4DUZ M;  4LF9 M;  1L1Z A;  3KS8 A;  4EIW A;  3GQ5 A;  3GPY A;  3JAM S;  5KQ8 A;  3J7B A;  5E26 A;  2EUC A;  2L7I A;  1IN6 A;  2CEA A;  4DUY M;  4GIP A;  3MMP A;  3J7A S;  2ERC A;  3IEC A;  4CGY B;  3FD9 A;  2X8A A;  2DI0 A;  4KLN A;  2F5O A;  2ZM6 M;  1XHB A;  1TTE A;  3SAT A;  3KOY E;  4LZJ A;  2DAK A;  4OW0 A;  2AHM A;  4BLC A;  1L2D A;  2G5G X;  4DV6 M;  2L4E A;  4LJ5 A;  4YY3 M;  1OQY A;  2VQF M;  3SAV A;  5EP3 A;  3AOE C;  2P5T A;  3T6P A;  3HY5 A;  4LF6 M;  1N78 A;  2HKJ A;  2M60 A;  1GO5 A;  3FUW A;  1IXZ A;  1D2N A;  4QNM A;  4LFA M;  3D8B A;  4M9X A;  1SXJ C;  3FTD A;  1QDR A;  3F92 A;  4AI6 A;  1T6O A;  3NBI A;  4DR5 M;  4GHA A;  1RU3 A;  4Z6Y A;  1PJQ A;  2R0I A;  5EXS A;  3GPP A;  1QZE A;  3ZC7 B;  1GKI A;  1WIV A;  3VK7 A;  3LMM A;  4TUW A;  1G4A E;  2O25 A;  2D7G A;  3PFI A;  4LJ9 A;  5ITU A;  5F3W A;  4NXM M;  3T15 A;  2JY6 B;  4JI7 M;  5IT9 S;  3LCU A;  4GC5 A;  3RE8 A;  2YFQ A;  4JXJ A;  3FRH A;  4D80 A;  4DR2 M;  5ITT A;  5EP4 A;  4LJ7 A;  5FLX S;  1ZMV A;  4I4L A;  5BPV A;  4IIW A;  3LW5 F;  4RKU F;  3GLI A;  4B3R M;  4LGY A;  3R9X B;  2CWB A;  2RRU A;  2F5N A;  4BB9 A;  3DOA A;  1OTR A;  3SHF A;  3I01 M;  1TH3 A;  2W82 A;  2F5P A;  4IBC A;  4W5W A;  3TPZ A;  2JUJ A;  4AQY M;  4LF7 M;  5ITY A;  1PJJ A;  1DV0 A;  4D82 A;  2WZJ A;  1HT1 E;  3GLI B;  4BBA A;  3W0L B;  1KFV A;  2Z4R A;  3L2A A;  4NSR A;  3BOS A;  3SAU A;  2LVO C;  1E9S A;  2I7N A;  1JQJ C;  4L16 A;  3AOG A;  4RF0 A;  4MB7 A;  3GLI E;  3KOZ E;  4RNA A;  4G6Z A;  1VDD A;  2V6Z M;  3BBZ A;  4XK8 F;  1BVS A;  4G4O A;  3K2L A;  4OX9 M;  4LG2 A;  3J2P B;  2YR0 A;  1JR3 D;  3GRY A;  4FW9 A;  1T3T A;  4P17 A;  4CJ6 A; 
#chains in the Genus database with same CATH homology
 1XXH B;  4PDI A;  4NOO B;  4DR6 M;  2YQZ A;  1HNZ M;  1QZM A;  2R4E A;  1YUB A;  4JI1 M;  2KEB A;  4LF8 M;  2BJV A;  4DV4 M;  4IBJ A;  3HHY A;  3TL4 X;  5H37 D;  4QOZ C;  1R2Y A;  1NY5 A;  4DV0 M;  2Z3X A;  1G59 A;  2L09 A;  3T38 A;  3A42 A;  3TQS A;  4AZF A;  4LJ6 A;  1K3W A;  1MX0 A;  4RF1 A;  4AKG A;  4FWH A;  2Z4S A;  2DZO B;  3KXE C;  1J5E M;  3EIE A;  1ZQ9 A;  4JI8 M;  3FTF A;  3SC3 A;  4LZZ A;  2VII A;  1Q3B A;  2XFT A;  3KDS E;  2VQE M;  1Z6T A;  3VDU A;  1SXJ A;  1LV7 A;  2C96 A;  2JA2 A;  2ZAO A;  4GH9 A;  2J7N A;  1NHG C;  1TDH A;  1IXS B;  3VLF B;  2XSZ A;  4FWD A;  2CHV A;  2LNH C;  3VK8 A;  1XC8 A;  2QZ4 A;  1SXJ B;  4G4R A;  3KSJ A;  1N36 M;  3E4R A;  4FD2 A;  1DGB A;  1NVM A;  1SXJ E;  3U6C A;  3UK6 A;  3L26 A;  4B3S M;  5FTM A;  3QAU A;  3JR4 A;  1H6U A;  4JI2 M;  4LRS A;  5KPZ A;  3PNY A;  5EP1 A;  3E9S A;  4L4U A;  1FJG M;  3VKG A;  1Z5A A;  3PNV A;  4JI6 M;  1G41 A;  1IBL M;  1DGF A;  5KPR A;  3U5Z A;  1L2B A;  3GO8 A;  4FCV A;  5EXT A;  3SHG B;  4IBG A;  2C5R A;  2DWN A;  4CIS A;  3TWK A;  3M0E A;  3U6S A;  2D7H A;  3RGS A;  3SMP A;  5LMU M;  2OPF A;  4JN6 A;  1NJG A;  3U5Z B;  2FOI C;  1IN5 A;  4GIT A;  4FCT A;  4X64 M;  3R8F A;  1G3I A;  2CE7 A;  2HL7 A;  1R2Z A;  2V1C A;  1QVR A;  3U61 A;  4L78 A;  5FTN A;  2XZF A;  4REZ A;  1HQY E;  5IZ7 D;  3IG5 A;  3I4V A;  4PCZ A;  4LF5 M;  1FNN A;  3HKP A;  3GP1 A;  3VKH A;  2X49 A;  3CF6 E;  1KSF X;  3VDP A;  3U61 B;  4NL4 H;  1DO0 A;  3T1Y M;  1E94 E;  3GRV A;  2EA0 A;  3MK6 A;  4OVZ A;  4DR1 M;  5BR8 M;  2UXD M;  3K8Z A;  1R7R A;  4M0D A;  4DR7 M;  4IBD A;  2ZAM A;  2HHH M;  2DZN B;  3HJQ A;  5E6J A;  3HHZ A;  4HLQ A;  4MGI E;  1N32 M;  2EO2 A;  3AJI B;  1L1T A;  3K1J A;  1TH4 A;  2QBY A;  4OVZ B;  2XFS A;  1I94 M;  4B7F A;  4NSO B;  3U6L A;  3U6Q A;  3CTW B;  4YHH M;  5ITX A;  4XBO A;  4ZPX A;  3HU2 A;  2DVW B;  4B3T M;  1Z5C A;  4I8O A;  2QBY B;  1R6B X;  3HWS A;  2KW0 A;  1YE9 A;  2KRK A;  4II7 A;  4QHS A;  4B3M M;  3UJN A;  4GC9 A;  4I81 A;  2K47 A;  2DHR A;  4PD2 A;  3TE6 A;  2BJW A;  3KS4 A;  3FTC A;  4NRV A;  1IBM M;  2KRU A;  2R18 A;  3RFW A;  1PJI A;  5IWA M;  4MH0 E;  2XEP A;  2LH0 A;  3UGJ A;  1QAM A;  5ITX E;  4QOS A;  4QHT A;  2HCB A;  2R46 A;  2C98 A;  3W0F A;  1KYI A;  4L15 A;  3J27 B;  4M0W A;  5FSW A;  1L2C A;  4AKI A;  4HL4 A;  3L27 A;  4GKK M;  2NQ8 C;  3AV0 A;  1NHW C;  1Q39 A;  2CV2 A;  5KO3 A;  3CF2 A;  3DA1 A;  4AG6 A;  3CF0 A;  4IBK A;  2UUB M;  5GKN A;  1N75 A;  2QP9 X;  1XNQ M;  2LXE A;  3AL0 C;  3KW6 A;  3SBJ A;  2RGO A;  1QQW A;  2CFO A;  3HHW A;  2Y21 A;  5FTK A;  1NY6 A;  4S12 A;  1GL7 A;  1NSF A;  2L6O A;  3FYD A;  4M9S A;  2CHG A;  3AOE A;  3K92 A;  1NNJ A;  1OFI A;  1E9R A;  1HNX M;  1IY2 A;  2UXC M;  3HJS A;  5ITQ A;  3A46 A;  2CUZ A;  4KHP M;  5IRE B;  2OQ4 A;  1XWI A;  3UMM A;  2QCU A;  4G4Q A;  3TWM A;  1IXR C;  2V1U A;  3MHV C;  4X62 M;  3L29 A;  1JR3 A;  3M7G A;  4DV1 M;  1IN8 A;  4QNR A;  2KXE A;  2L7H A;  2XLJ A;  3NWL A;  3PVS A;  3DZD A;  2RKO A;  1OFH A;  3GLH A;  2DXI A;  1HT2 E;  3LVV A;  2Y0T A;  4MGY E;  2QEN A;  4X66 M;  2C9O A;  5EQT A;  3GLG A;  3ZCB B;  1N77 A;  2Y0Q A;  8CAT A;  4WUR A;  3SAR A;  4R3D A;  4B7H A;  5C1B A;  2UUA M;  1IN7 A;  3U6P A;  1TDZ A;  5DYI A;  3L28 A;  4LJA A;  3GLH B;  4MGK E;  5EP2 A;  1ORY B;  1GLN A;  3FUX A;  3HU3 A;  3MJ5 A;  3U6E A;  3AKZ A;  1S3S A;  3GLG B;  4DR3 M;  4IBB A;  4DV7 M;  3KP0 E;  2CHQ A;  4NXN M;  3HU1 A;  3DFZ A;  4FVM A;  3JR5 A;  1PM5 A;  1HR0 M;  1N33 M;  2F5Q A;  3GQ4 A;  4GKJ M;  5FTJ A;  3I4Y A;  2RGH A;  4GRI A;  4PT5 A;  4FCW A;  3U6D A;  4JI4 M;  2A5Y B;  2QPA A;  3L25 A;  1NNU C;  1IBK M;  4X65 M;  1K3X A;  2DWZ B;  4IBI A;  1G8P A;  1QAO A;  1I4W A;  4JYA M;  3ZH9 B;  3GRR A;  2CV1 A;  1DGG A;  1GL6 A;  3SYL A;  3M6A A;  4G4N A;  3KVW A;  1UM8 A;  3WHL A;  1IY1 A;  3U6O A;  3GPX A;  1XMQ M;  1W5T A;  3A45 A;  4P16 A;  4GHL A;  4I5S A;  5A2Q S;  2Q2E B;  3I51 A;  2C99 A;  1YSY A;  4MGZ E;  4AG5 A;  5LMN M;  1OJL A;  5FTL A;  2I7P A;  3GPU A;  3A98 B;  1XNR M;  4FWG A;  2BNK A;  1DGH A;  4WW0 A;  3FTE A;  4DR4 M;  4JI5 M;  1TGU A;  2O5R A;  2XGN A;  1HQC A;  4GMQ A;  2DWL A;  3GRU A;  5KPT A;  2FNA A;  1IY0 A;  3HGI A;  1QAQ A;  1DGH B;  3KP1 E;  3TWL A;  4LRT A;  3ILK A;  4JI3 M;  3FYC A;  4DV3 M;  5DNY A;  4IJF A;  2ZAN A;  4B7G A;  1NJF A;  2G8L A;  4B08 A;  4XGI A;  3THG A;  5C18 A;  2FFJ A;  3D8L A;  3VFD A;  4D81 A;  3LQQ A;  4LCB A;  1Z5B A;  3U60 A;  2Y20 A;  4Z8X A;  2M5Z A;  4NRW A;  4L8R C;  3HHX A;  3UZU A;  3T1H M;  2UUC M;  2ZBK B;  3SAW A;  3FUV A;  4KO8 A;  3B9P A;  5KQD A;  1L8Q A;  3Q8X A;  4MM3 B;  1MU5 A;  1E32 A;  3U60 B;  4IBF A;  1J09 A;  3SYK A;  1WXQ A;  1IM2 A;  1XXH A;  1SXJ D;  4LY6 A;  3GQ3 A;  3HJ8 A;  2H1R A;  2F5S A;  2E5L M;  1QYR A;  1DO2 A;  2UU9 M;  2XZU A;  4IJE A;  3J80 S;  2XSZ D;  1QAN A;  1W5S A;  1X37 A;  3KOW E;  3GLF A;  2YNM D;  2D7E A;  5JI2 E;  2R4J A;  2XF3 A;  3FUT A;  2DWM A;  4LGM A;  1GVN A;  1XMO M;  3KOX E;  2Z7J A;  4LJ4 A;  3EIH A;  1K82 A;  2R45 A;  4M9Z A;  3GLF B;  4KOD A;  4OU7 A;  2J7O A;  4AW4 A;  4ITQ A;  2XH9 A;  5JI3 E;  2F4V M;  1IQP A;  2X4A A;  2KA6 B;  1J7K A;  7CAT A;  4A3V B;  3FUU A;  3LQR A;  5DYG A;  5EJC A;  2FE8 A;  3PXG A;  3H4M A;  1IN4 A;  3C58 A;  3QWL A;  4AKH A;  5ITR A;  2LWX A;  2KZU A;  3LVW A;  1C1K A;  1EE8 A;  2R62 A;  5EXP A;  4R7G A;  3SAS A;  5EXX A;  4LJ8 A;  3AFH A;  2UXB M;  3FKE A;  4CHT B;  4PDG A;  4LF4 M;  4MGH A;  4JI0 M;  1Q3C A;  4IBE A;  3U6M A;  3KFU G;  4LFC M;  4JV5 M;  2KZS A;  4LFB M;  1HNW M;  4DV2 M;  3SFZ A;  1Z59 A;  3IG8 A;  4K0K M;  1N34 M;  2R65 A;  3KSX A;  3RGP A;  4DV5 M;  3OTO M;  1ZAE A;  1TH2 A;  2CV0 A;  3WHK A;  2C9C A;  3SMS A;  3J81 S;  4DUZ M;  4LF9 M;  1L1Z A;  3KS8 A;  4EIW A;  3GQ5 A;  3GPY A;  3JAM S;  5KQ8 A;  3J7B A;  5E26 A;  2EUC A;  2L7I A;  1IN6 A;  2CEA A;  4DUY M;  4GIP A;  3J7A S;  2ERC A;  4CGY B;  3FD9 A;  2X8A A;  4KLN A;  2F5O A;  2ZM6 M;  1XHB A;  3SAT A;  3KOY E;  4LZJ A;  4OW0 A;  2AHM A;  4BLC A;  1L2D A;  2G5G X;  4DV6 M;  4LJ5 A;  4YY3 M;  2VQF M;  3SAV A;  5EP3 A;  3AOE C;  2P5T A;  4LF6 M;  1N78 A;  2HKJ A;  2M60 A;  3FUW A;  1IXZ A;  1D2N A;  4QNM A;  4LFA M;  3D8B A;  4M9X A;  1SXJ C;  3FTD A;  4AI6 A;  4DR5 M;  3NBI A;  4GHA A;  4Z6Y A;  5EXS A;  3GPP A;  3ZC7 B;  1GKI A;  4TUW A;  3VK7 A;  3LMM A;  1G4A E;  2D7G A;  3PFI A;  4LJ9 A;  5ITU A;  5F3W A;  4NXM M;  3T15 A;  4JI7 M;  5IT9 S;  4GC5 A;  3RE8 A;  2YFQ A;  4JXJ A;  4D80 A;  4DR2 M;  5ITT A;  5EP4 A;  4LJ7 A;  5FLX S;  4I4L A;  5BPV A;  4IIW A;  3GLI A;  4B3R M;  4LGY A;  3R9X B;  2F5N A;  4BB9 A;  3DOA A;  3SHF A;  1TH3 A;  2W82 A;  2F5P A;  4IBC A;  4W5W A;  3TPZ A;  4AQY M;  4LF7 M;  5ITY A;  1PJJ A;  4D82 A;  1HT1 E;  3GLI B;  4BBA A;  3W0L B;  1KFV A;  2Z4R A;  3L2A A;  4NSR A;  3BOS A;  3SAU A;  1E9S A;  2I7N A;  1JQJ C;  4L16 A;  3AOG A;  4RF0 A;  4MB7 A;  3KOZ E;  4RNA A;  4G6Z A;  1VDD A;  2V6Z M;  4G4O A;  4OX9 M;  3K2L A;  4LG2 A;  3J2P B;  2YR0 A;  1JR3 D;  3GRY A;  4FW9 A;  1T3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...