4DV5M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv5M02
1TDZA 4AQYM 4DR2M 4DV0M 1TDHA 2UXCM 3A42A 5ITXA 5BR8M 4JI5M 2OPFA 3SATA 2UXBM 1K82A 4DR3M 2E5LM 2F4VM 3GPUA 1HNWM 3DOAA 4PD2A 3U6EA 3SBJA 1L2DA 3VK8A 2F5OA 1XNQM 3GPPA 4DV1M 4LF8M 3J7AS 1XC8A 4LFBM 4LF4M 4ITQA 4G4OA 5ITTA 4K0KM 4JI3M 4B3MM 2UUBM 4B3SM 4NRVA 2XZUA 1PM5A 3C58A 4PCZA 5ITUA 4MB7A 3U6OA 1Q3CA 1MU5A 1R2ZA 1K3XA 5A2QS 3T1YM 4CISA 3VK7A 4JI6M 4LF6M 1N36M 1IBMM 1Z5CA 5ITXE 1L2BA 4YHHM 1HNZM 3SASA 4X64M 4LF9M 1FJGM 4B3RM 2VQFM 3U6DA 4GKKM 3A45A 1IBKM 2OQ4A 3GQ4A 3GQ3A 4YY3M 3SAVA 3OTOM 3GO8A 3W0FA 2UUCM 4NXMM 4JI7M 1XMOM 1KFVA 4LF5M 1Q3BA 2F5SA 4NXNM 4DR5M 4DR7M 3U6LA 4JI1M 5ITQA 1N32M 4DR1M 5LMNM 3JR4A 5ITRA 4G4NA 3T1HM 5IWAM 1IBLM 1Z59A 4G4RA 4X65M 4OX9M 1N34M 4X66M 1L1ZA 4LF7M 3J80S 2EA0A 3U6SA 2VQEM 3TWMA 3GPXA 1NNJA 3J81S 1N33M 4DV5M 3U6MA 2UU9M 1XNRM 4LFCM 4DV7M 4DV3M 1R2YA 5FLXS 4JYAM 5ITYA 3U6CA 2ZM6M 3GPYA 3TWKA 1L1TA 1XMQM 4JI4M 2UUAM 5IT9S 3GQ5A 1PJJA 1L2CA 1MX0A 5LMUM 4DR4M 2XZFA 3JR5A 1Z5AA 1HNXM 4DR6M 2F5NA 3SAWA 3U6PA 4X62M 2UXDM 4JV5M 4DV2M 4NRWA 1PJIA 1Q39A 2HHHM 2Q2EB 4B3TM 2F5QA 4PDIA 4JI2M 4G4QA 4JI8M 2HKJA 3TWLA 4KHPM 4DV4M 1HR0M 3A46A 3U6QA 3JAMS 4JI0M 4PDGA 3GP1A 2ZBKB 2F5PA 4DUZM 4DV6M 1EE8A 4GKJM 1I94M 1Z5BA 4LFAM 1J5EM 4DUYM 3SARA 3SAUA 1K3WA
chains in the Genus database with same CATH superfamily
4AQYM 4M0WA 4G3OA 4B7FA 1TDHA 3SMSA 2VF7A 1DO2A 2A5YB 1SXJD 2APLA 2JP7A 1TR8A 4BLCA 1T6OA 1PJTA 4QHTA 4B08A 2UXBM 1K82A 3MHVC 3M6AA 4F2LA 2DAKA 3GPUA 1HNWM 2EUCA 3K92A 4FWHA 4GITA 3PNYA 4DBGB 3SBJA 4LZJA 3FUXA 3DZDA 1L2DA 1EIJA 2JUJA 2L7IA 1NVMA 1SXJB 1OAIA 2LVPC 4LCBA 3J7AS 1XC8A 3L29A 4WURA 4MGHA 4ITQA 3J2PB 2XH9A 1E9RA 3FKEA 4B3MM 1HT1E 1L8QA 1KYIA 4CGYB 4NRVA 3UZUA 4MGZE 2HCBA 5FTMA 2XF3A 1CUKA 2JY6B 5ITUA 3D8BA 1OFIA 3Q8GA 3T1YM 4JI6M 5KPZA 2X4AA 4GC5A 1NO1A 1Z5CA 3QWLA 1HNZM 3K9OA 1R5LA 1WJ7A 3LQRA 4B3RM 2VQFM 1NJGA 1DGGA 2L6OA 1W5TA 3GQ4A 3HWSA 2DENA 3GLFB 3AOGA 1IY1A 4FWDA 3R9XB 2KDLA 1GABA 2CHGA 3KW6A 2XEPA 4JI7M 4RKUF 2RGOA 5KQ8A 4KT0F 2LTUA 1W5SA 2CWBA 4G6ZA 4CJ6A 3GLGA 3U6LA 4JI1M 2QZ4A 1EFUB 5ITQA 1QAQA 3B7NA 2FOIC 2GNOA 2RKOA 5IWAM 1IBLM 2JZ0A 4UN2B 1ORYB 4IIWA 3FE3A 4L16A 1VEKA 4MH0E 1ZMVA 3J80S 2FE8A 1IN5A 3FYDA 1E94E 2QENA 1J09A 2QSFX 4GIPA 3PXGA 4ZPXA 1QUSA 2DVWB 5EXPA 3M0EA 2C98A 3U6MA 4LFCM 2CV1A 2KW0A 3GLFE 3LW5F 3IECA 4NC6A 1NNUC 3I51A 1XXHE 3MMPA 1HQCA 1G4AE 3E4RA 1AUAA 3B7QA 2HWJA 3HU3A 2ZM6M 4AZFA 3HX3A 3CF0A 4FW9A 1L2CA 1IY0A 3LCVB 5KO3A 4DR4M 3KSXA 5DNYA 3HHZA 3KS4A 4JN6A 3SAWA 2Y0QA 5KQDA 3UJNA 3U6PA 2FH0A 4AW4A 4X62M 3K2LA 4JV5M 4Z6YA 1OIPA 2L7HA 2WSFF 1IM2A 3SHFA 2N35A 1C1KA 1TH3A 3GRRA 3ZH9B 1IFYA 2YR0A 4I5SA 1MN3A 4LRTA 2Z3XA 2Z7JA 4JI2M 2HKJA 5FTJA 1N75A 3C3DA 4Z8XA 1H6UA 4LY6A 2KZUA 3HKPA 3VLFB 2DWLA 2R45A 4CIZA 2ZBKB 2X49A 4GKJM 5C18A 2D7EA 3MJ5A 4NSRA 1T43A 5E6JA 5EXTA 5GKNA 5DFLA 3SAUA 1LTMA 4DR2M 3ZQJA 3L2AA 1KSFX 1TH4A 2LBCA 3LVWA 3A42A 5EP1A 5ITXA 1HQYE 3PFIA 2OPFA 4BB9A 2QHOB 1OJLA 4DR3M 1Z6TA 1QAMA 2OO9A 2DZLA 3FUWA 3GLIB 3QYEA 1A5TA 2H5XA 4FWGA 4I81A 4P17A 4LG2A 4AI6A 2EO2A 2L4FA 3FRIA 2R4EA 1YE9A 3SYKA 3BXWA 5H37D 1NHWC 3FUUA 2KEBA 5F3WA 3HJSA 1F4IA 3GPPA 1NY5A 4LJ5A 2CV0A 4L4UA 4LF4M 2DZNB 2LXEA 3AJIB 4W5WA 5ITTA 1G41A 4K0KM 2UUBM 2I7PA 4LJ4A 1OIZA 2VIIA 2V1UA 3FTDA 1D2NA 5EQTA 2K47A 1JR3E 2R0IA 5DYIA 1R2ZA 3A98B 1OQYA 1N36M 4XGIA 3K9PA 3SASA 5ITXE 4NSOB 2R6FA 4BBAA 2O5RA 1OAOC 4GKKM 2KXEA 1Y8GA 2QCUA 1VG5A 2KRKA 3GLGB 4LJAA 4GC9A 1IBKM 1PRBA 2C5RA 1VDLA 3V76A 3RFWA 3RE8A 3GQ3A 4LJ6A 1GJSA 2LVOC 2J5YA 3HU1A 3W0FA 3GO8A 3FRHA 2Z4RA 5EXXA 1P3QQ 3PVSA 1XXHA 1WIVA 1ZV1A 8CATA 4GH9A 3RGPA 3TQSA 1IN8A 1R4GA 2VQEM 4IJEA 3CF6E 1ZAEA 3E21A 3VFDA 3H4MA 2CE7A 4QNMA 2KRUA 1N32M 3THGA 4KODA 2BJVA 3IG5A 3JR4A 2CP8A 5FTNA 5FTKA 1Z59A 4FVMA 2Z4SA 5IREB 1N34M 4HL4A 2DWZB 4RF1A 2FS1A 3C9PA 1NNJA 1JB0F 2XSZA 1R6BX 4IBKA 4QNRA 3J81S 1N33M 3CGWA 3VKHA 4XK8F 2CHQA 2DHYA 3B74A 4DV7M 2DI0A 5FLXS 1DGFA 3GPYA 3MK6A 1NJFA 1DGHA 2C99A 4Y28F 4OU7A 3I4VA 2UUAM 2CHVA 3DFZA 7CATA 1PJJA 1GLNA 2D7GA 2BJWA 3HZJA 4WP2A 3JR5A 1HNXM 2QBYB 2Y21A 2JA2A 1PGYA 2D7HA 4CHTB 4DR6M 3AKZA 4HEOA 2C9OA 2OOBA 1VEJA 3CTWB 4DV2M 1Q39A 3I4YA 2HHHM 2BWBA 2HL7A 4QOSA 2Q2EB 4IBFA 3HHWA 2MGWA 2I7NA 4I8OA 4LJ9A 3SMPA 2NQ8C 2CRUA 2QNJA 3J27B 3W0LB 3KDSE 3TWLA 4JXJA 4DV4M 2L4EA 2FNAA 5EXSA 1WR1B 3JAMS 4PDGA 3KOWE 2DAGA 2DWNA 1EE8A 4PT5A 4L6V6 4R7GA 2LVNC 2EKFA 4LFAM 1NV8A 2R62A 1G59A 2M60A 4QOZC 2DKLA 4GRIA 1IXZA 2VF8A 5KPRA 1HJPA 4GMQA 3NBIA 1YSYA 3GLFA 3VDPA 3W67A 5BR8M 3LCUA 2QP9X 4NL4H 2G3QA 3SATA 2L2DA 1DGHB 1XWIA 1JR3A 5FSWA 1SXJC 4A3VB 3AFHA 3NBXX 1SXJE 2F4VM 2Z8YM 4L78A 2QBYA 3C3EA 3U5ZA 2DWMA 3LVVA 1V92A 4II7A 3KVWA 4FD2A 4IBEA 3VK8A 1IN7A 1D0MA 3FTFA 1DV0A 1FNNA 4LF8M 4RNAA 2ZAOA 4I4LA 1N78A 3U60A 2LWXA 4AKGA 3Q8XA 1X37A 1T3TA 3SC3A 4JI3M 3SYLA 4EIWA 4B3SM 2XZUA 4GHAA 1JR3D 1PM5A 4FCWA 4LJ7A 3B9PA 4MB7A 1Q3CA 1RU3A 3HY5A 1AIPC 3L28A 2JNHA 5A2QS 3VK7A 1K3XA 4CISA 1IBMM 1OFHA 4LF6M 1G3IA 3VDUA 1Q02A 4B7GA 4X64M 4YHHM 4LF9M 3U6DA 4IBIA 1NV9A 3AOEC 1VEGA 4IBGA 4FCTA 2OQ4A 3L25A 1IXSA 3GRYA 4RF0A 3HU2A 2EJSA 2WSCF 4M0DA 3OTOM 4Q7JA 3W68A 3I01M 4TUWA 3K8ZA 1NSFA 2WSEF 3B7ZA 3WHKA 3I04M 2Y20A 3IHPA 1XMOM 1KFVA 2CUZA 2R65A 4LF5M 2F5SA 4NXNM 1QYRA 4DR5M 1E32A 1IN4A 3T15A 3RGSA 2V6ZM 5ITRA 1GL7A 2QQ8A 3GLHB 4G4NA 3T1HM 4D80A 2XGNA 4M9XA 2Y0TA 1E9SA 3U61B 2EA0A 1YLAA 3U6SA 4LF7M 3TWMA 4NOOB 2LHGA 1QZEA 3AV0A 5BPVA 1DO0A 1WGLA 2O25A 2DXIA 2DAIA 1GO5A 2ZTCA 4JYAM 2CV2A 1VDDA 5ITYA 1OKSA 1I4WA 3U6CA 3CF2A 3KFUG 1UM8A 3LMMA 1D0LA 2LNHC 5KPTA 1N77A 4AG5A 4MGYE 1MX0A 1QANA 1ZMWA 2DNAA 3ZC7B 1IXSB 5LMUM 2XZFA 1C7YA 1QVRA 2K0BX 2V1CA 4KLNA 2JWSA 4IBCA 2F5NA 3R8FA 2DAMA 2O01F 3TPZA 3BBZA 3NWLA 2UXDM 2ZAMA 4R71A 4NRWA 5JI3E 3EIHA 1IN6A 2X8AA 4G4QA 1LV7A 2MR9A 2MH8A 4GHLA 3UK6A 5E26A 3K1JA 3A46A 4JI0M 3GP1A 2F5PA 3KP1E 1GKIA 4DUZM 2YFQA 2G8LA 2LVAA 3WHLA 4QHSA 3T6PA 2YNMD 5L8RF 1I94M 1Z5BA 4R3DA 5EP4A 4B7HA 4DUYM 3SARA 2R4JA 4LZZA 3H4JA 4REZA 2XSZD 1TDZA 1K3WA 3U5ZB 1XHBA 4DV0M 2CEAA 1JQJC 2R18A 4MGKE 1R7RA 3M7GA 4HLQA 2UXCM 1ZQ9A 3VKGA 3ZCBB 4JI5M 2BWEA 3EIEA 3DA1A 3KXEC 2EKKA 2HAKA 3HJ8A 2FFJA 2C96A 2GQFA 4F1IA 2E5LM 3BOSA 3FTCA 3FYCA 3FD9A 1IXRC 2JY5A 3DOAA 4PD2A 2JZ1A 3U6EA 2LVQD 3KOZE 4ANRA 4M9SA 2F5OA 4OVZB 3SHGB 1UFZA 3ILKA 1XNQM 2P5TA 2JXNA 4LRSA 1QDTA 3GLIE 4DV1M 3GLHE 2VDBB 4LFBM 3LQQA 4G4OA 3GRVA 4M9ZA 1DGBA 2JY7A 2CFOA 3L27A 2MROB 4PCZA 3C58A 1PJQA 3U6OA 1J7KA 1QAOA 1MU5A 4MGIE 2RGHA 2RRUA 2KNVA 1SG9A 1TH2A 2XLJA 3E46A 1L2BA 1FJGM 2WZJA 2C9CA 3A45A 1TF0B 5JI2E 3HHXA 1V34A 2K9DA 2KZSA 1QZMA 1YUBA 2LHCA 1IQPA 4S12A 3GLHA 3QYBA 4YY3M 2M5ZA 3SAVA 1IY2A 2AHMA 2KA6B 2UUCM 4D81A 3HHYA 2H1RA 3AL0C 4NXMM 2ZANA 1GL6A 3B89A 1NY6A 5EJCA 5EP3A 1NHGC 1Q3BA 1TTEA 1WGNA 4DR7M 1WXQA 1PJSA 2W82A 1VQ1A 4DR1M 4OVZA 1MJGM 5LMNM 1HT2E 4L8RC 4WW0A 1WHCA 2R46A 3QAUA 2ERCA 3AOEA 1QDRA 4X65M 2J7NA 4G4RA 4OX9M 4KO8A 3J7BA 3KP0E 4FCVA 4X66M 1L1ZA 4GEWA 4IBJA 2MJ5B 2OOAA 4AKHA 3GPXA 3FTEA 1TGUA 3UMMA 4DV5M 3D8LA 5FTLA 2UU9M 5DYGA 3TL4X 3UGJA 4MM3B 1XNRM 1GJTA 4DV3M 3GRUA 1R2YA 2KNZA 3KS8A 2B3TA 2DAEA 2YQZA 2JY8A 1BVSA 2KHHA 5IZ7D 3FUVA 3TWKA 3E9SA 1L1TA 4L15A 1XMQM 4LGYA 4JI4M 5IT9S 3GQ5A 3U61A 3KOYE 4XBOA 2K6BA 1V33A 4AG6A 2DHRA 1Z5AA 2ZTDA 4LJ8A 4IJFA 4IBBA 3L26A 3IG8A 4LGMA 3KSJA 4P16A 4D82A 2QPAA 1XXHB 1PJIA 1SXJA 3T38A 2KNAA 2J7OA 5C1BA 4AKIA 2XFTA 3SFZA 2G5GX 3FUTA 3KOXE 3U60B 4B3TM 2F5QA 1S3SA 4PDIA 4JI8M 2L09A 1G8PA 1QUTA 3GLGE 1OTRA 1HR0M 4KHPM 4OW0A 3U6QA 2R44A 3HGIA 2BNKA 2XFSA 3PNVA 3TE6A 5EP2A 1XB2B 4DV6M 4IBDA 1ZMUA 1GVNA 1G71A 3GLIA 1J5EM 2DZOB 1QQWA 3HJQA 2LH0A 1D0KA 3F92A
chains in the Genus database with same CATH topology
4AQYM 4M0WA 4B7FA 1TDHA 3SMSA 1DO2A 2A5YB 1SXJD 4BLCA 4QHTA 4B08A 2UXBM 1K82A 3MHVC 3M6AA 3GPUA 1HNWM 2EUCA 3K92A 4FWHA 4GITA 3PNYA 3SBJA 4LZJA 3FUXA 3DZDA 1L2DA 2L7IA 1NVMA 1SXJB 4LCBA 3J7AS 1XC8A 3L29A 4WURA 4MGHA 4ITQA 3J2PB 2XH9A 1E9RA 3FKEA 4B3MM 1HT1E 1L8QA 1KYIA 4CGYB 4NRVA 3UZUA 4MGZE 2HCBA 5FTMA 2XF3A 5ITUA 3D8BA 1OFIA 3T1YM 4JI6M 5KPZA 2X4AA 4GC5A 1Z5CA 3QWLA 1HNZM 4B3RM 3LQRA 2VQFM 1NJGA 1DGGA 2L6OA 1W5TA 3GQ4A 3HWSA 3GLFB 3AOGA 1IY1A 4FWDA 3R9XB 2CHGA 3KW6A 2XEPA 4JI7M 2RGOA 5KQ8A 1W5SA 4G6ZA 3GLGA 3U6LA 4JI1M 2QZ4A 5ITQA 1QAQA 2FOIC 2RKOA 5IWAM 1IBLM 1ORYB 4IIWA 4L16A 4MH0E 3J80S 3PXGA 2FE8A 1IN5A 3FYDA 1E94E 1J09A 2QENA 4GIPA 2VQEM 4ZPXA 2DVWB 5EXPA 3M0EA 2C98A 3U6MA 4LFCM 2CV1A 2KW0A 1NNUC 3I51A 1HQCA 1G4AE 3E4RA 2ZM6M 3HU3A 4AZFA 3CF0A 4FW9A 1L2CA 1IY0A 4DR4M 5KO3A 3KSXA 5DNYA 3HHZA 3KS4A 4JN6A 3SAWA 2Y0QA 5KQDA 3UJNA 3U6PA 4AW4A 4X62M 3K2LA 4JV5M 4Z6YA 2L7HA 1IM2A 3SHFA 3GRRA 1C1KA 1TH3A 3ZH9B 2YR0A 4I5SA 2Z3XA 4LRTA 4JI2M 2Z7JA 2HKJA 5FTJA 1N75A 4Z8XA 1H6UA 4LY6A 2KZUA 3HKPA 3VLFB 2DWLA 2R45A 2ZBKB 2X49A 4GKJM 5C18A 2D7EA 3MJ5A 4NSRA 5E6JA 5EXTA 5GKNA 3SAUA 4DR2M 3L2AA 1KSFX 1TH4A 3LVWA 3A42A 5EP1A 5ITXA 1HQYE 3PFIA 2OPFA 4BB9A 1OJLA 4DR3M 1Z6TA 1QAMA 3FUWA 3GLIB 4FWGA 4I81A 4LG2A 4AI6A 2EO2A 2R4EA 1YE9A 3SYKA 5H37D 1NHWC 3FUUA 2KEBA 5F3WA 3HJSA 3GPPA 1NY5A 4LJ5A 2CV0A 4L4UA 4LF4M 2DZNB 2LXEA 3AJIB 4W5WA 5ITTA 1G41A 4K0KM 2UUBM 2I7PA 4LJ4A 2VIIA 2V1UA 3FTDA 1D2NA 5EQTA 2K47A 1R2ZA 5DYIA 3A98B 1N36M 4XGIA 3SASA 5ITXE 4NSOB 4BBAA 2O5RA 4GKKM 2KXEA 2QCUA 2KRKA 3GLGB 4LJAA 4GC9A 1IBKM 2C5RA 3RFWA 3RE8A 3GQ3A 4LJ6A 3HU1A 3GO8A 3W0FA 2Z4RA 5EXXA 3PVSA 1XXHA 8CATA 4GH9A 3RGPA 3TQSA 1IN8A 4IJEA 3CF6E 1ZAEA 3VFDA 3H4MA 2CE7A 4QNMA 2KRUA 1N32M 3THGA 4KODA 2BJVA 3IG5A 3JR4A 5FTNA 5FTKA 1Z59A 4FVMA 2Z4SA 5IREB 1N34M 4HL4A 2DWZB 4RF1A 1NNJA 2XSZA 4QNRA 1R6BX 4IBKA 3J81S 1N33M 3VKHA 2CHQA 4DV7M 5FLXS 1DGFA 3GPYA 3MK6A 1NJFA 1DGHA 2C99A 4OU7A 3I4VA 2UUAM 2CHVA 3DFZA 7CATA 1PJJA 1GLNA 2D7GA 2BJWA 3JR5A 1HNXM 2QBYB 2Y21A 2JA2A 2D7HA 4CHTB 4DR6M 3AKZA 2C9OA 3CTWB 4DV2M 1Q39A 3I4YA 2HHHM 4QOSA 2HL7A 2Q2EB 4IBFA 3HHWA 2I7NA 4I8OA 4LJ9A 3SMPA 2NQ8C 3W0LB 3J27B 3KDSE 3TWLA 4JXJA 4DV4M 2FNAA 5EXSA 3JAMS 4PDGA 3KOWE 2DWNA 1EE8A 4PT5A 4R7GA 4LFAM 2R62A 1G59A 2M60A 4QOZC 4GRIA 1IXZA 5KPRA 4GMQA 3NBIA 1YSYA 3GLFA 3VDPA 5BR8M 2QP9X 4NL4H 3SATA 1DGHB 1XWIA 1JR3A 5FSWA 1SXJC 4A3VB 3AFHA 1SXJE 2F4VM 4L78A 2QBYA 3U5ZA 2DWMA 3LVVA 4II7A 3KVWA 4FD2A 4IBEA 3VK8A 1IN7A 3FTFA 1FNNA 4LF8M 4RNAA 2ZAOA 4I4LA 1N78A 3U60A 2LWXA 4AKGA 3Q8XA 1X37A 1T3TA 3SC3A 4JI3M 3SYLA 4EIWA 4B3SM 2XZUA 4GHAA 1JR3D 1PM5A 4FCWA 4LJ7A 3B9PA 4MB7A 1Q3CA 3L28A 1K3XA 5A2QS 4CISA 4LF6M 3VK7A 1IBMM 1OFHA 1G3IA 3VDUA 4B7GA 4YHHM 4X64M 4LF9M 3U6DA 4IBIA 3AOEC 4IBGA 4FCTA 2OQ4A 3L25A 3GRYA 4RF0A 3HU2A 4M0DA 3OTOM 4TUWA 3K8ZA 1NSFA 3WHKA 2Y20A 1XMOM 1KFVA 2CUZA 2R65A 4LF5M 2F5SA 4NXNM 1QYRA 4DR5M 1E32A 1IN4A 3T15A 3RGSA 2V6ZM 5ITRA 1GL7A 3GLHB 4G4NA 3T1HM 4D80A 2XGNA 4M9XA 2Y0TA 1E9SA 3U61B 2EA0A 3U6SA 4LF7M 3TWMA 4NOOB 3AV0A 5BPVA 1DO0A 2DXIA 4JYAM 2CV2A 1VDDA 5ITYA 1I4WA 3U6CA 3CF2A 3KFUG 1UM8A 3LMMA 2LNHC 5KPTA 1N77A 4AG5A 4MGYE 1MX0A 1QANA 3ZC7B 5LMUM 2XZFA 1IXSB 1QVRA 2V1CA 4KLNA 4IBCA 2F5NA 3R8FA 3TPZA 3NWLA 2UXDM 2ZAMA 4NRWA 5JI3E 3EIHA 1IN6A 2X8AA 4G4QA 1LV7A 4GHLA 3UK6A 5E26A 3K1JA 3A46A 4JI0M 3GP1A 2F5PA 3KP1E 1GKIA 4DUZM 2YFQA 2G8LA 3WHLA 4QHSA 2YNMD 1I94M 1Z5BA 4R3DA 5EP4A 4B7HA 4DUYM 3SARA 2R4JA 4LZZA 1TDZA 4REZA 2XSZD 1K3WA 3U5ZB 1XHBA 4DV0M 2CEAA 1JQJC 2R18A 4MGKE 1R7RA 3M7GA 4HLQA 2UXCM 1ZQ9A 3VKGA 3ZCBB 4JI5M 3EIEA 3DA1A 3KXEC 3HJ8A 2FFJA 2C96A 2E5LM 3BOSA 3FTCA 3FYCA 3FD9A 1IXRC 3DOAA 4PD2A 3U6EA 3KOZE 4M9SA 2F5OA 4OVZB 3SHGB 3ILKA 1XNQM 2P5TA 4DV1M 4LRSA 4LFBM 3LQQA 4G4OA 3GRVA 4M9ZA 1DGBA 3L27A 2CFOA 3C58A 4PCZA 3U6OA 1J7KA 1QAOA 1MU5A 4MGIE 2RGHA 1TH2A 2XLJA 1L2BA 1FJGM 2C9CA 3A45A 5JI2E 3HHXA 2KZSA 1QZMA 1YUBA 4S12A 1IQPA 4YY3M 3GLHA 3SAVA 2M5ZA 1IY2A 2AHMA 2KA6B 2UUCM 4D81A 3HHYA 2H1RA 3AL0C 4NXMM 2ZANA 1GL6A 1NY6A 5EJCA 5EP3A 1NHGC 1Q3BA 4DR7M 1WXQA 2W82A 4DR1M 4OVZA 5LMNM 1HT2E 4L8RC 4WW0A 3QAUA 2R46A 2ERCA 3AOEA 4X65M 4G4RA 2J7NA 4OX9M 4KO8A 3J7BA 3KP0E 4FCVA 4X66M 1L1ZA 4IBJA 4AKHA 3GPXA 3FTEA 1TGUA 3UMMA 4DV5M 3D8LA 5FTLA 2UU9M 5DYGA 3TL4X 3UGJA 4MM3B 1XNRM 4DV3M 3GRUA 1R2YA 3KS8A 2YQZA 5IZ7D 3FUVA 3TWKA 3E9SA 1L1TA 4L15A 1XMQM 4LGYA 4JI4M 5IT9S 3GQ5A 3U61A 3KOYE 4XBOA 4AG6A 2DHRA 1Z5AA 4LJ8A 4IJFA 4IBBA 3L26A 3IG8A 4LGMA 3KSJA 4P16A 4D82A 2QPAA 1XXHB 1PJIA 1SXJA 3T38A 2J7OA 5C1BA 4AKIA 2XFTA 3SFZA 2G5GX 3FUTA 3KOXE 3U60B 4B3TM 2F5QA 1S3SA 4PDIA 4JI8M 2L09A 1G8PA 4KHPM 1HR0M 4OW0A 3U6QA 3HGIA 2BNKA 2XFSA 3PNVA 3TE6A 5EP2A 4DV6M 4IBDA 1GVNA 3GLIA 1J5EM 2DZOB 1QQWA 3HJQA 2LH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDZ A;  4AQY M;  4DR2 M;  4DV0 M;  1TDH A;  2UXC M;  3A42 A;  5ITX A;  5BR8 M;  4JI5 M;  2OPF A;  3SAT A;  2UXB M;  1K82 A;  4DR3 M;  2E5L M;  2F4V M;  3GPU A;  1HNW M;  3DOA A;  4PD2 A;  3U6E A;  3SBJ A;  1L2D A;  3VK8 A;  2F5O A;  1XNQ M;  3GPP A;  4DV1 M;  4LF8 M;  3J7A S;  1XC8 A;  4LFB M;  4LF4 M;  4ITQ A;  4G4O A;  5ITT A;  4K0K M;  4JI3 M;  4B3M M;  2UUB M;  4B3S M;  4NRV A;  2XZU A;  1PM5 A;  3C58 A;  4PCZ A;  5ITU A;  4MB7 A;  3U6O A;  1Q3C A;  1MU5 A;  1R2Z A;  1K3X A;  5A2Q S;  3T1Y M;  4CIS A;  3VK7 A;  4JI6 M;  4LF6 M;  1N36 M;  1IBM M;  1Z5C A;  5ITX E;  1L2B A;  4YHH M;  1HNZ M;  3SAS A;  4X64 M;  4LF9 M;  1FJG M;  4B3R M;  2VQF M;  3U6D A;  4GKK M;  3A45 A;  1IBK M;  2OQ4 A;  3GQ4 A;  3GQ3 A;  4YY3 M;  3SAV A;  3OTO M;  3GO8 A;  3W0F A;  2UUC M;  4NXM M;  4JI7 M;  1XMO M;  1KFV A;  4LF5 M;  1Q3B A;  2F5S A;  4NXN M;  4DR5 M;  4DR7 M;  3U6L A;  4JI1 M;  5ITQ A;  1N32 M;  4DR1 M;  5LMN M;  3JR4 A;  5ITR A;  4G4N A;  3T1H M;  5IWA M;  1IBL M;  1Z59 A;  4G4R A;  4X65 M;  4OX9 M;  1N34 M;  4X66 M;  1L1Z A;  4LF7 M;  3J80 S;  2EA0 A;  3U6S A;  2VQE M;  3TWM A;  3GPX A;  1NNJ A;  3J81 S;  1N33 M;  4DV5 M;  3U6M A;  2UU9 M;  1XNR M;  4LFC M;  4DV7 M;  4DV3 M;  1R2Y A;  5FLX S;  4JYA M;  5ITY A;  3U6C A;  2ZM6 M;  3GPY A;  3TWK A;  1L1T A;  1XMQ M;  4JI4 M;  2UUA M;  5IT9 S;  3GQ5 A;  1PJJ A;  1L2C A;  1MX0 A;  5LMU M;  4DR4 M;  2XZF A;  3JR5 A;  1Z5A A;  1HNX M;  4DR6 M;  2F5N A;  3SAW A;  3U6P A;  4X62 M;  2UXD M;  4JV5 M;  4DV2 M;  4NRW A;  1PJI A;  1Q39 A;  2HHH M;  2Q2E B;  4B3T M;  2F5Q A;  4PDI A;  4JI2 M;  4G4Q A;  4JI8 M;  2HKJ A;  3TWL A;  4KHP M;  4DV4 M;  1HR0 M;  3A46 A;  3U6Q A;  3JAM S;  4JI0 M;  4PDG A;  3GP1 A;  2ZBK B;  2F5P A;  4DUZ M;  4DV6 M;  1EE8 A;  4GKJ M;  1I94 M;  1Z5B A;  4LFA M;  1J5E M;  4DUY M;  3SAR A;  3SAU A;  1K3W A; 
#chains in the Genus database with same CATH topology
 4AQY M;  4M0W A;  4G3O A;  4B7F A;  1TDH A;  3SMS A;  2VF7 A;  1DO2 A;  2A5Y B;  1SXJ D;  2APL A;  2JP7 A;  1TR8 A;  4BLC A;  1T6O A;  1PJT A;  4QHT A;  4B08 A;  2UXB M;  1K82 A;  3MHV C;  3M6A A;  4F2L A;  2DAK A;  3GPU A;  1HNW M;  2EUC A;  3K92 A;  4FWH A;  4GIT A;  3PNY A;  4DBG B;  3SBJ A;  4LZJ A;  3FUX A;  3DZD A;  1L2D A;  1EIJ A;  2JUJ A;  2L7I A;  1NVM A;  1SXJ B;  1OAI A;  2LVP C;  4LCB A;  3J7A S;  1XC8 A;  3L29 A;  4WUR A;  4MGH A;  4ITQ A;  3J2P B;  2XH9 A;  1E9R A;  3FKE A;  4B3M M;  1HT1 E;  1L8Q A;  1KYI A;  4CGY B;  4NRV A;  3UZU A;  4MGZ E;  2HCB A;  5FTM A;  2XF3 A;  1CUK A;  2JY6 B;  5ITU A;  3D8B A;  1OFI A;  3Q8G A;  3T1Y M;  4JI6 M;  5KPZ A;  2X4A A;  4GC5 A;  1NO1 A;  1Z5C A;  3QWL A;  1HNZ M;  3K9O A;  1R5L A;  1WJ7 A;  3LQR A;  4B3R M;  2VQF M;  1NJG A;  1DGG A;  2L6O A;  1W5T A;  3GQ4 A;  3HWS A;  2DEN A;  3GLF B;  3AOG A;  1IY1 A;  4FWD A;  3R9X B;  2KDL A;  1GAB A;  2CHG A;  3KW6 A;  2XEP A;  4JI7 M;  4RKU F;  2RGO A;  5KQ8 A;  4KT0 F;  2LTU A;  1W5S A;  2CWB A;  4G6Z A;  4CJ6 A;  3GLG A;  3U6L A;  4JI1 M;  2QZ4 A;  1EFU B;  5ITQ A;  1QAQ A;  3B7N A;  2FOI C;  2GNO A;  2RKO A;  5IWA M;  1IBL M;  2JZ0 A;  4UN2 B;  1ORY B;  4IIW A;  3FE3 A;  4L16 A;  1VEK A;  4MH0 E;  1ZMV A;  3J80 S;  2FE8 A;  1IN5 A;  3FYD A;  1E94 E;  2QEN A;  1J09 A;  2QSF X;  4GIP A;  3PXG A;  4ZPX A;  1QUS A;  2DVW B;  5EXP A;  3M0E A;  2C98 A;  3U6M A;  4LFC M;  2CV1 A;  2KW0 A;  3GLF E;  3LW5 F;  3IEC A;  4NC6 A;  1NNU C;  3I51 A;  1XXH E;  3MMP A;  1HQC A;  1G4A E;  3E4R A;  1AUA A;  3B7Q A;  2HWJ A;  3HU3 A;  2ZM6 M;  4AZF A;  3HX3 A;  3CF0 A;  4FW9 A;  1L2C A;  1IY0 A;  3LCV B;  5KO3 A;  4DR4 M;  3KSX A;  5DNY A;  3HHZ A;  3KS4 A;  4JN6 A;  3SAW A;  2Y0Q A;  5KQD A;  3UJN A;  3U6P A;  2FH0 A;  4AW4 A;  4X62 M;  3K2L A;  4JV5 M;  4Z6Y A;  1OIP A;  2L7H A;  2WSF F;  1IM2 A;  3SHF A;  2N35 A;  1C1K A;  1TH3 A;  3GRR A;  3ZH9 B;  1IFY A;  2YR0 A;  4I5S A;  1MN3 A;  4LRT A;  2Z3X A;  2Z7J A;  4JI2 M;  2HKJ A;  5FTJ A;  1N75 A;  3C3D A;  4Z8X A;  1H6U A;  4LY6 A;  2KZU A;  3HKP A;  3VLF B;  2DWL A;  2R45 A;  4CIZ A;  2ZBK B;  2X49 A;  4GKJ M;  5C18 A;  2D7E A;  3MJ5 A;  4NSR A;  1T43 A;  5E6J A;  5EXT A;  5GKN A;  5DFL A;  3SAU A;  1LTM A;  4DR2 M;  3ZQJ A;  3L2A A;  1KSF X;  1TH4 A;  2LBC A;  3LVW A;  3A42 A;  5EP1 A;  5ITX A;  1HQY E;  3PFI A;  2OPF A;  4BB9 A;  2QHO B;  1OJL A;  4DR3 M;  1Z6T A;  1QAM A;  2OO9 A;  2DZL A;  3FUW A;  3GLI B;  3QYE A;  1A5T A;  2H5X A;  4FWG A;  4I81 A;  4P17 A;  4LG2 A;  4AI6 A;  2EO2 A;  2L4F A;  3FRI A;  2R4E A;  1YE9 A;  3SYK A;  3BXW A;  5H37 D;  1NHW C;  3FUU A;  2KEB A;  5F3W A;  3HJS A;  1F4I A;  3GPP A;  1NY5 A;  4LJ5 A;  2CV0 A;  4L4U A;  4LF4 M;  2DZN B;  2LXE A;  3AJI B;  4W5W A;  5ITT A;  1G41 A;  4K0K M;  2UUB M;  2I7P A;  4LJ4 A;  1OIZ A;  2VII A;  2V1U A;  3FTD A;  1D2N A;  5EQT A;  2K47 A;  1JR3 E;  2R0I A;  5DYI A;  1R2Z A;  3A98 B;  1OQY A;  1N36 M;  4XGI A;  3K9P A;  3SAS A;  5ITX E;  4NSO B;  2R6F A;  4BBA A;  2O5R A;  1OAO C;  4GKK M;  2KXE A;  1Y8G A;  2QCU A;  1VG5 A;  2KRK A;  3GLG B;  4LJA A;  4GC9 A;  1IBK M;  1PRB A;  2C5R A;  1VDL A;  3V76 A;  3RFW A;  3RE8 A;  3GQ3 A;  4LJ6 A;  1GJS A;  2LVO C;  2J5Y A;  3HU1 A;  3W0F A;  3GO8 A;  3FRH A;  2Z4R A;  5EXX A;  1P3Q Q;  3PVS A;  1XXH A;  1WIV A;  1ZV1 A;  8CAT A;  4GH9 A;  3RGP A;  3TQS A;  1IN8 A;  1R4G A;  2VQE M;  4IJE A;  3CF6 E;  1ZAE A;  3E21 A;  3VFD A;  3H4M A;  2CE7 A;  4QNM A;  2KRU A;  1N32 M;  3THG A;  4KOD A;  2BJV A;  3IG5 A;  3JR4 A;  2CP8 A;  5FTN A;  5FTK A;  1Z59 A;  4FVM A;  2Z4S A;  5IRE B;  1N34 M;  4HL4 A;  2DWZ B;  4RF1 A;  2FS1 A;  3C9P A;  1NNJ A;  1JB0 F;  2XSZ A;  1R6B X;  4IBK A;  4QNR A;  3J81 S;  1N33 M;  3CGW A;  3VKH A;  4XK8 F;  2CHQ A;  2DHY A;  3B74 A;  4DV7 M;  2DI0 A;  5FLX S;  1DGF A;  3GPY A;  3MK6 A;  1NJF A;  1DGH A;  2C99 A;  4Y28 F;  4OU7 A;  3I4V A;  2UUA M;  2CHV A;  3DFZ A;  7CAT A;  1PJJ A;  1GLN A;  2D7G A;  2BJW A;  3HZJ A;  4WP2 A;  3JR5 A;  1HNX M;  2QBY B;  2Y21 A;  2JA2 A;  1PGY A;  2D7H A;  4CHT B;  4DR6 M;  3AKZ A;  4HEO A;  2C9O A;  2OOB A;  1VEJ A;  3CTW B;  4DV2 M;  1Q39 A;  3I4Y A;  2HHH M;  2BWB A;  2HL7 A;  4QOS A;  2Q2E B;  4IBF A;  3HHW A;  2MGW A;  2I7N A;  4I8O A;  4LJ9 A;  3SMP A;  2NQ8 C;  2CRU A;  2QNJ A;  3J27 B;  3W0L B;  3KDS E;  3TWL A;  4JXJ A;  4DV4 M;  2L4E A;  2FNA A;  5EXS A;  1WR1 B;  3JAM S;  4PDG A;  3KOW E;  2DAG A;  2DWN A;  1EE8 A;  4PT5 A;  4L6V 6;  4R7G A;  2LVN C;  2EKF A;  4LFA M;  1NV8 A;  2R62 A;  1G59 A;  2M60 A;  4QOZ C;  2DKL A;  4GRI A;  1IXZ A;  2VF8 A;  5KPR A;  1HJP A;  4GMQ A;  3NBI A;  1YSY A;  3GLF A;  3VDP A;  3W67 A;  5BR8 M;  3LCU A;  2QP9 X;  4NL4 H;  2G3Q A;  3SAT A;  2L2D A;  1DGH B;  1XWI A;  1JR3 A;  5FSW A;  1SXJ C;  4A3V B;  3AFH A;  3NBX X;  1SXJ E;  2F4V M;  2Z8Y M;  4L78 A;  2QBY A;  3C3E A;  3U5Z A;  2DWM A;  3LVV A;  1V92 A;  4II7 A;  3KVW A;  4FD2 A;  4IBE A;  3VK8 A;  1IN7 A;  1D0M A;  3FTF A;  1DV0 A;  1FNN A;  4LF8 M;  4RNA A;  2ZAO A;  4I4L A;  1N78 A;  3U60 A;  2LWX A;  4AKG A;  3Q8X A;  1X37 A;  1T3T A;  3SC3 A;  4JI3 M;  3SYL A;  4EIW A;  4B3S M;  2XZU A;  4GHA A;  1JR3 D;  1PM5 A;  4FCW A;  4LJ7 A;  3B9P A;  4MB7 A;  1Q3C A;  1RU3 A;  3HY5 A;  1AIP C;  3L28 A;  2JNH A;  5A2Q S;  3VK7 A;  1K3X A;  4CIS A;  1IBM M;  1OFH A;  4LF6 M;  1G3I A;  3VDU A;  1Q02 A;  4B7G A;  4X64 M;  4YHH M;  4LF9 M;  3U6D A;  4IBI A;  1NV9 A;  3AOE C;  1VEG A;  4IBG A;  4FCT A;  2OQ4 A;  3L25 A;  1IXS A;  3GRY A;  4RF0 A;  3HU2 A;  2EJS A;  2WSC F;  4M0D A;  3OTO M;  4Q7J A;  3W68 A;  3I01 M;  4TUW A;  3K8Z A;  1NSF A;  2WSE F;  3B7Z A;  3WHK A;  3I04 M;  2Y20 A;  3IHP A;  1XMO M;  1KFV A;  2CUZ A;  2R65 A;  4LF5 M;  2F5S A;  4NXN M;  1QYR A;  4DR5 M;  1E32 A;  1IN4 A;  3T15 A;  3RGS A;  2V6Z M;  5ITR A;  1GL7 A;  2QQ8 A;  3GLH B;  4G4N A;  3T1H M;  4D80 A;  2XGN A;  4M9X A;  2Y0T A;  1E9S A;  3U61 B;  2EA0 A;  1YLA A;  3U6S A;  4LF7 M;  3TWM A;  4NOO B;  2LHG A;  1QZE A;  3AV0 A;  5BPV A;  1DO0 A;  1WGL A;  2O25 A;  2DXI A;  2DAI A;  1GO5 A;  2ZTC A;  4JYA M;  2CV2 A;  1VDD A;  5ITY A;  1OKS A;  1I4W A;  3U6C A;  3CF2 A;  3KFU G;  1UM8 A;  3LMM A;  1D0L A;  2LNH C;  5KPT A;  1N77 A;  4AG5 A;  4MGY E;  1MX0 A;  1QAN A;  1ZMW A;  2DNA A;  3ZC7 B;  1IXS B;  5LMU M;  2XZF A;  1C7Y A;  1QVR A;  2K0B X;  2V1C A;  4KLN A;  2JWS A;  4IBC A;  2F5N A;  3R8F A;  2DAM A;  2O01 F;  3TPZ A;  3BBZ A;  3NWL A;  2UXD M;  2ZAM A;  4R71 A;  4NRW A;  5JI3 E;  3EIH A;  1IN6 A;  2X8A A;  4G4Q A;  1LV7 A;  2MR9 A;  2MH8 A;  4GHL A;  3UK6 A;  5E26 A;  3K1J A;  3A46 A;  4JI0 M;  3GP1 A;  2F5P A;  3KP1 E;  1GKI A;  4DUZ M;  2YFQ A;  2G8L A;  2LVA A;  3WHL A;  4QHS A;  3T6P A;  2YNM D;  5L8R F;  1I94 M;  1Z5B A;  4R3D A;  5EP4 A;  4B7H A;  4DUY M;  3SAR A;  2R4J A;  4LZZ A;  3H4J A;  4REZ A;  2XSZ D;  1TDZ A;  1K3W A;  3U5Z B;  1XHB A;  4DV0 M;  2CEA A;  1JQJ C;  2R18 A;  4MGK E;  1R7R A;  3M7G A;  4HLQ A;  2UXC M;  1ZQ9 A;  3VKG A;  3ZCB B;  4JI5 M;  2BWE A;  3EIE A;  3DA1 A;  3KXE C;  2EKK A;  2HAK A;  3HJ8 A;  2FFJ A;  2C96 A;  2GQF A;  4F1I A;  2E5L M;  3BOS A;  3FTC A;  3FYC A;  3FD9 A;  1IXR C;  2JY5 A;  3DOA A;  4PD2 A;  2JZ1 A;  3U6E A;  2LVQ D;  3KOZ E;  4ANR A;  4M9S A;  2F5O A;  4OVZ B;  3SHG B;  1UFZ A;  3ILK A;  1XNQ M;  2P5T A;  2JXN A;  4LRS A;  1QDT A;  3GLI E;  4DV1 M;  3GLH E;  2VDB B;  4LFB M;  3LQQ A;  4G4O A;  3GRV A;  4M9Z A;  1DGB A;  2JY7 A;  2CFO A;  3L27 A;  2MRO B;  4PCZ A;  3C58 A;  1PJQ A;  3U6O A;  1J7K A;  1QAO A;  1MU5 A;  4MGI E;  2RGH A;  2RRU A;  2KNV A;  1SG9 A;  1TH2 A;  2XLJ A;  3E46 A;  1L2B A;  1FJG M;  2WZJ A;  2C9C A;  3A45 A;  1TF0 B;  5JI2 E;  3HHX A;  1V34 A;  2K9D A;  2KZS A;  1QZM A;  1YUB A;  2LHC A;  1IQP A;  4S12 A;  3GLH A;  3QYB A;  4YY3 M;  2M5Z A;  3SAV A;  1IY2 A;  2AHM A;  2KA6 B;  2UUC M;  4D81 A;  3HHY A;  2H1R A;  3AL0 C;  4NXM M;  2ZAN A;  1GL6 A;  3B89 A;  1NY6 A;  5EJC A;  5EP3 A;  1NHG C;  1Q3B A;  1TTE A;  1WGN A;  4DR7 M;  1WXQ A;  1PJS A;  2W82 A;  1VQ1 A;  4DR1 M;  4OVZ A;  1MJG M;  5LMN M;  1HT2 E;  4L8R C;  4WW0 A;  1WHC A;  2R46 A;  3QAU A;  2ERC A;  3AOE A;  1QDR A;  4X65 M;  2J7N A;  4G4R A;  4OX9 M;  4KO8 A;  3J7B A;  3KP0 E;  4FCV A;  4X66 M;  1L1Z A;  4GEW A;  4IBJ A;  2MJ5 B;  2OOA A;  4AKH A;  3GPX A;  3FTE A;  1TGU A;  3UMM A;  4DV5 M;  3D8L A;  5FTL A;  2UU9 M;  5DYG A;  3TL4 X;  3UGJ A;  4MM3 B;  1XNR M;  1GJT A;  4DV3 M;  3GRU A;  1R2Y A;  2KNZ A;  3KS8 A;  2B3T A;  2DAE A;  2YQZ A;  2JY8 A;  1BVS A;  2KHH A;  5IZ7 D;  3FUV A;  3TWK A;  3E9S A;  1L1T A;  4L15 A;  1XMQ M;  4LGY A;  4JI4 M;  5IT9 S;  3GQ5 A;  3U61 A;  3KOY E;  4XBO A;  2K6B A;  1V33 A;  4AG6 A;  2DHR A;  1Z5A A;  2ZTD A;  4LJ8 A;  4IJF A;  4IBB A;  3L26 A;  3IG8 A;  4LGM A;  3KSJ A;  4P16 A;  4D82 A;  2QPA A;  1XXH B;  1PJI A;  1SXJ A;  3T38 A;  2KNA A;  2J7O A;  5C1B A;  4AKI A;  2XFT A;  3SFZ A;  2G5G X;  3FUT A;  3KOX E;  3U60 B;  4B3T M;  2F5Q A;  1S3S A;  4PDI A;  4JI8 M;  2L09 A;  1G8P A;  1QUT A;  3GLG E;  1OTR A;  1HR0 M;  4KHP M;  4OW0 A;  3U6Q A;  2R44 A;  3HGI A;  2BNK A;  2XFS A;  3PNV A;  3TE6 A;  5EP2 A;  1XB2 B;  4DV6 M;  4IBD A;  1ZMU A;  1GVN A;  1G71 A;  3GLI A;  1J5E M;  2DZO B;  1QQW A;  3HJQ A;  2LH0 A;  1D0K A;  3F92 A; 
#chains in the Genus database with same CATH homology
 4AQY M;  4M0W A;  4B7F A;  1TDH A;  3SMS A;  1DO2 A;  2A5Y B;  1SXJ D;  4BLC A;  4QHT A;  4B08 A;  2UXB M;  1K82 A;  3MHV C;  3M6A A;  3GPU A;  1HNW M;  2EUC A;  3K92 A;  4FWH A;  4GIT A;  3PNY A;  3SBJ A;  4LZJ A;  3FUX A;  3DZD A;  1L2D A;  2L7I A;  1NVM A;  1SXJ B;  4LCB A;  3J7A S;  1XC8 A;  3L29 A;  4WUR A;  4MGH A;  4ITQ A;  3J2P B;  2XH9 A;  1E9R A;  3FKE A;  4B3M M;  1HT1 E;  1L8Q A;  1KYI A;  4CGY B;  4NRV A;  3UZU A;  4MGZ E;  2HCB A;  5FTM A;  2XF3 A;  5ITU A;  3D8B A;  1OFI A;  3T1Y M;  4JI6 M;  5KPZ A;  2X4A A;  4GC5 A;  1Z5C A;  3QWL A;  1HNZ M;  4B3R M;  3LQR A;  2VQF M;  1NJG A;  1DGG A;  2L6O A;  1W5T A;  3GQ4 A;  3HWS A;  3GLF B;  3AOG A;  1IY1 A;  4FWD A;  3R9X B;  2CHG A;  3KW6 A;  2XEP A;  4JI7 M;  2RGO A;  5KQ8 A;  1W5S A;  4G6Z A;  3GLG A;  3U6L A;  4JI1 M;  2QZ4 A;  5ITQ A;  1QAQ A;  2FOI C;  2RKO A;  5IWA M;  1IBL M;  1ORY B;  4IIW A;  4L16 A;  4MH0 E;  3J80 S;  3PXG A;  2FE8 A;  1IN5 A;  3FYD A;  1E94 E;  1J09 A;  2QEN A;  4GIP A;  2VQE M;  4ZPX A;  2DVW B;  5EXP A;  3M0E A;  2C98 A;  3U6M A;  4LFC M;  2CV1 A;  2KW0 A;  1NNU C;  3I51 A;  1HQC A;  1G4A E;  3E4R A;  2ZM6 M;  3HU3 A;  4AZF A;  3CF0 A;  4FW9 A;  1L2C A;  1IY0 A;  4DR4 M;  5KO3 A;  3KSX A;  5DNY A;  3HHZ A;  3KS4 A;  4JN6 A;  3SAW A;  2Y0Q A;  5KQD A;  3UJN A;  3U6P A;  4AW4 A;  4X62 M;  3K2L A;  4JV5 M;  4Z6Y A;  2L7H A;  1IM2 A;  3SHF A;  3GRR A;  1C1K A;  1TH3 A;  3ZH9 B;  2YR0 A;  4I5S A;  2Z3X A;  4LRT A;  4JI2 M;  2Z7J A;  2HKJ A;  5FTJ A;  1N75 A;  4Z8X A;  1H6U A;  4LY6 A;  2KZU A;  3HKP A;  3VLF B;  2DWL A;  2R45 A;  2ZBK B;  2X49 A;  4GKJ M;  5C18 A;  2D7E A;  3MJ5 A;  4NSR A;  5E6J A;  5EXT A;  5GKN A;  3SAU A;  4DR2 M;  3L2A A;  1KSF X;  1TH4 A;  3LVW A;  3A42 A;  5EP1 A;  5ITX A;  1HQY E;  3PFI A;  2OPF A;  4BB9 A;  1OJL A;  4DR3 M;  1Z6T A;  1QAM A;  3FUW A;  3GLI B;  4FWG A;  4I81 A;  4LG2 A;  4AI6 A;  2EO2 A;  2R4E A;  1YE9 A;  3SYK A;  5H37 D;  1NHW C;  3FUU A;  2KEB A;  5F3W A;  3HJS A;  3GPP A;  1NY5 A;  4LJ5 A;  2CV0 A;  4L4U A;  4LF4 M;  2DZN B;  2LXE A;  3AJI B;  4W5W A;  5ITT A;  1G41 A;  4K0K M;  2UUB M;  2I7P A;  4LJ4 A;  2VII A;  2V1U A;  3FTD A;  1D2N A;  5EQT A;  2K47 A;  1R2Z A;  5DYI A;  3A98 B;  1N36 M;  4XGI A;  3SAS A;  5ITX E;  4NSO B;  4BBA A;  2O5R A;  4GKK M;  2KXE A;  2QCU A;  2KRK A;  3GLG B;  4LJA A;  4GC9 A;  1IBK M;  2C5R A;  3RFW A;  3RE8 A;  3GQ3 A;  4LJ6 A;  3HU1 A;  3GO8 A;  3W0F A;  2Z4R A;  5EXX A;  3PVS A;  1XXH A;  8CAT A;  4GH9 A;  3RGP A;  3TQS A;  1IN8 A;  4IJE A;  3CF6 E;  1ZAE A;  3VFD A;  3H4M A;  2CE7 A;  4QNM A;  2KRU A;  1N32 M;  3THG A;  4KOD A;  2BJV A;  3IG5 A;  3JR4 A;  5FTN A;  5FTK A;  1Z59 A;  4FVM A;  2Z4S A;  5IRE B;  1N34 M;  4HL4 A;  2DWZ B;  4RF1 A;  1NNJ A;  2XSZ A;  4QNR A;  1R6B X;  4IBK A;  3J81 S;  1N33 M;  3VKH A;  2CHQ A;  4DV7 M;  5FLX S;  1DGF A;  3GPY A;  3MK6 A;  1NJF A;  1DGH A;  2C99 A;  4OU7 A;  3I4V A;  2UUA M;  2CHV A;  3DFZ A;  7CAT A;  1PJJ A;  1GLN A;  2D7G A;  2BJW A;  3JR5 A;  1HNX M;  2QBY B;  2Y21 A;  2JA2 A;  2D7H A;  4CHT B;  4DR6 M;  3AKZ A;  2C9O A;  3CTW B;  4DV2 M;  1Q39 A;  3I4Y A;  2HHH M;  4QOS A;  2HL7 A;  2Q2E B;  4IBF A;  3HHW A;  2I7N A;  4I8O A;  4LJ9 A;  3SMP A;  2NQ8 C;  3W0L B;  3J27 B;  3KDS E;  3TWL A;  4JXJ A;  4DV4 M;  2FNA A;  5EXS A;  3JAM S;  4PDG A;  3KOW E;  2DWN A;  1EE8 A;  4PT5 A;  4R7G A;  4LFA M;  2R62 A;  1G59 A;  2M60 A;  4QOZ C;  4GRI A;  1IXZ A;  5KPR A;  4GMQ A;  3NBI A;  1YSY A;  3GLF A;  3VDP A;  5BR8 M;  2QP9 X;  4NL4 H;  3SAT A;  1DGH B;  1XWI A;  1JR3 A;  5FSW A;  1SXJ C;  4A3V B;  3AFH A;  1SXJ E;  2F4V M;  4L78 A;  2QBY A;  3U5Z A;  2DWM A;  3LVV A;  4II7 A;  3KVW A;  4FD2 A;  4IBE A;  3VK8 A;  1IN7 A;  3FTF A;  1FNN A;  4LF8 M;  4RNA A;  2ZAO A;  4I4L A;  1N78 A;  3U60 A;  2LWX A;  4AKG A;  3Q8X A;  1X37 A;  1T3T A;  3SC3 A;  4JI3 M;  3SYL A;  4EIW A;  4B3S M;  2XZU A;  4GHA A;  1JR3 D;  1PM5 A;  4FCW A;  4LJ7 A;  3B9P A;  4MB7 A;  1Q3C A;  3L28 A;  1K3X A;  5A2Q S;  4CIS A;  4LF6 M;  3VK7 A;  1IBM M;  1OFH A;  1G3I A;  3VDU A;  4B7G A;  4YHH M;  4X64 M;  4LF9 M;  3U6D A;  4IBI A;  3AOE C;  4IBG A;  4FCT A;  2OQ4 A;  3L25 A;  3GRY A;  4RF0 A;  3HU2 A;  4M0D A;  3OTO M;  4TUW A;  3K8Z A;  1NSF A;  3WHK A;  2Y20 A;  1XMO M;  1KFV A;  2CUZ A;  2R65 A;  4LF5 M;  2F5S A;  4NXN M;  1QYR A;  4DR5 M;  1E32 A;  1IN4 A;  3T15 A;  3RGS A;  2V6Z M;  5ITR A;  1GL7 A;  3GLH B;  4G4N A;  3T1H M;  4D80 A;  2XGN A;  4M9X A;  2Y0T A;  1E9S A;  3U61 B;  2EA0 A;  3U6S A;  4LF7 M;  3TWM A;  4NOO B;  3AV0 A;  5BPV A;  1DO0 A;  2DXI A;  4JYA M;  2CV2 A;  1VDD A;  5ITY A;  1I4W A;  3U6C A;  3CF2 A;  3KFU G;  1UM8 A;  3LMM A;  2LNH C;  5KPT A;  1N77 A;  4AG5 A;  4MGY E;  1MX0 A;  1QAN A;  3ZC7 B;  5LMU M;  2XZF A;  1IXS B;  1QVR A;  2V1C A;  4KLN A;  4IBC A;  2F5N A;  3R8F A;  3TPZ A;  3NWL A;  2UXD M;  2ZAM A;  4NRW A;  5JI3 E;  3EIH A;  1IN6 A;  2X8A A;  4G4Q A;  1LV7 A;  4GHL A;  3UK6 A;  5E26 A;  3K1J A;  3A46 A;  4JI0 M;  3GP1 A;  2F5P A;  3KP1 E;  1GKI A;  4DUZ M;  2YFQ A;  2G8L A;  3WHL A;  4QHS A;  2YNM D;  1I94 M;  1Z5B A;  4R3D A;  5EP4 A;  4B7H A;  4DUY M;  3SAR A;  2R4J A;  4LZZ A;  1TDZ A;  4REZ A;  2XSZ D;  1K3W A;  3U5Z B;  1XHB A;  4DV0 M;  2CEA A;  1JQJ C;  2R18 A;  4MGK E;  1R7R A;  3M7G A;  4HLQ A;  2UXC M;  1ZQ9 A;  3VKG A;  3ZCB B;  4JI5 M;  3EIE A;  3DA1 A;  3KXE C;  3HJ8 A;  2FFJ A;  2C96 A;  2E5L M;  3BOS A;  3FTC A;  3FYC A;  3FD9 A;  1IXR C;  3DOA A;  4PD2 A;  3U6E A;  3KOZ E;  4M9S A;  2F5O A;  4OVZ B;  3SHG B;  3ILK A;  1XNQ M;  2P5T A;  4DV1 M;  4LRS A;  4LFB M;  3LQQ A;  4G4O A;  3GRV A;  4M9Z A;  1DGB A;  3L27 A;  2CFO A;  3C58 A;  4PCZ A;  3U6O A;  1J7K A;  1QAO A;  1MU5 A;  4MGI E;  2RGH A;  1TH2 A;  2XLJ A;  1L2B A;  1FJG M;  2C9C A;  3A45 A;  5JI2 E;  3HHX A;  2KZS A;  1QZM A;  1YUB A;  4S12 A;  1IQP A;  4YY3 M;  3GLH A;  3SAV A;  2M5Z A;  1IY2 A;  2AHM A;  2KA6 B;  2UUC M;  4D81 A;  3HHY A;  2H1R A;  3AL0 C;  4NXM M;  2ZAN A;  1GL6 A;  1NY6 A;  5EJC A;  5EP3 A;  1NHG C;  1Q3B A;  4DR7 M;  1WXQ A;  2W82 A;  4DR1 M;  4OVZ A;  5LMN M;  1HT2 E;  4L8R C;  4WW0 A;  3QAU A;  2R46 A;  2ERC A;  3AOE A;  4X65 M;  4G4R A;  2J7N A;  4OX9 M;  4KO8 A;  3J7B A;  3KP0 E;  4FCV A;  4X66 M;  1L1Z A;  4IBJ A;  4AKH A;  3GPX A;  3FTE A;  1TGU A;  3UMM A;  4DV5 M;  3D8L A;  5FTL A;  2UU9 M;  5DYG A;  3TL4 X;  3UGJ A;  4MM3 B;  1XNR M;  4DV3 M;  3GRU A;  1R2Y A;  3KS8 A;  2YQZ A;  5IZ7 D;  3FUV A;  3TWK A;  3E9S A;  1L1T A;  4L15 A;  1XMQ M;  4LGY A;  4JI4 M;  5IT9 S;  3GQ5 A;  3U61 A;  3KOY E;  4XBO A;  4AG6 A;  2DHR A;  1Z5A A;  4LJ8 A;  4IJF A;  4IBB A;  3L26 A;  3IG8 A;  4LGM A;  3KSJ A;  4P16 A;  4D82 A;  2QPA A;  1XXH B;  1PJI A;  1SXJ A;  3T38 A;  2J7O A;  5C1B A;  4AKI A;  2XFT A;  3SFZ A;  2G5G X;  3FUT A;  3KOX E;  3U60 B;  4B3T M;  2F5Q A;  1S3S A;  4PDI A;  4JI8 M;  2L09 A;  1G8P A;  4KHP M;  1HR0 M;  4OW0 A;  3U6Q A;  3HGI A;  2BNK A;  2XFS A;  3PNV A;  3TE6 A;  5EP2 A;  4DV6 M;  4IBD A;  1GVN A;  3GLI A;  1J5E M;  2DZO B;  1QQW A;  3HJQ A;  2LH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...