4DV5M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv5M02
1J5EM 1XNRM 3GQ3A 3SASA 2UUAM 4LF6M 3GO8A 3GP1A 4JI8M 1Z5AA 3JR4A 1R2ZA 1K82A 4DV1M 2XZUA 1R2YA 4PDGA 2EA0A 4G4OA 1Z5BA 4JI0M 2VQEM 1KFVA 3GPXA 4G4QA 4LF9M 4NXNM 4GKJM 2OQ4A 1N34M 4LFCM 1I94M 3SATA 3U6QA 1Z59A 4JV5M 4DV4M 4DV0M 3GQ4A 4PCZA 5ITTA 1NNJA 4DV5M 3VK7A 1L2DA 1HNXM 2UXDM 3J7AS 3T1YM 2ZM6M 3U6CA 4DR7M 5IT9S 4DR2M 1PJJA 2E5LM 3C58A 3J81S 3U6EA 4PDIA 4X62M 3TWKA 4DUZM 4AQYM 4NXMM 2F5OA 1XMOM 4KHPM 4JI6M 4X64M 1Q39A 4PD2A 1L2BA 4LF7M 2F5SA 1TDZA 4G4RA 3GPYA 2OPFA 4K0KM 3TWLA 3SBJA 5LMUM 3U6MA 4B3SM 1IBKM 1FJGM 3A46A 1IBLM 5ITYA 4JI7M 4YHHM 1K3WA 3U6SA 4ITQA 1K3XA 4DR4M 1MU5A 2UXCM 4JI1M 5A2QS 5ITQA 4B3TM 2HHHM 5FLXS 3W0FA 1HNWM 1XC8A 3J80S 5ITUA 3GQ5A 2VQFM 4DV7M 3SAVA 4GKKM 2HKJA 4MB7A 5ITXE 4DUYM 1MX0A 1XMQM 4DR1M 2UUBM 3SARA 4B3RM 4LFBM 3U6DA 4YY3M 1N36M 4NRWA 4G4NA 4OX9M 3T1HM 3A42A 3JAMS 1L2CA 2Q2EB 4DV6M 4NRVA 3A45A 4B3MM 1Z5CA 1Q3CA 5IWAM 3U6LA 4CISA 2XZFA 4LF8M 4DV3M 3SAUA 1XNQM 2F4VM 4JI5M 4DR3M 3SAWA 3U6OA 5ITRA 3VK8A 4X66M 1IBMM 1PM5A 4LFAM 4JYAM 1HNZM 5ITXA 3GPUA 4JI2M 3TWMA 5LMNM 1Q3BA 4X65M 1EE8A 3DOAA 2UUCM 2UU9M 4LF5M 1HR0M 4DR5M 4JI3M 4DR6M 1TDHA 2F5NA 1L1ZA 4DV2M 3OTOM 3GPPA 1N32M 3U6PA 1L1TA 1N33M 4LF4M 2F5PA 3JR5A 2UXBM 4JI4M 5BR8M 2ZBKB 1PJIA 2F5QA
chains in the Genus database with same CATH superfamily
1XNRM 2L4FA 3GQ3A 2VIIA 1Z6TA 2L7HA 2XLJA 2R65A 1W5SA 4L16A 3TL4X 2QZ4A 4B7FA 2RGOA 1ORYB 3PNYA 4DV1M 2QNJA 4Z6YA 1NY6A 4AG5A 4G4OA 2DAMA 2LVPC 4GH9A 1VEJA 1NO1A 2GQFA 4M0WA 1N75A 1G8PA 3GPXA 3GLIE 4L4UA 3AOEA 4GKJM 2OQ4A 1N34M 1HJPA 4BBAA 1ZAEA 3KOYE 1I94M 1W5TA 2L4EA 1YSYA 4FCWA 2JY5A 3U60B 3I01M 4LJ6A 5KQ8A 2CV1A 3J7AS 3NBXX 3KXEC 4DR7M 3RFWA 2CV2A 2XEPA 4IBIA 4LJ9A 1TR8A 2C9OA 1IN6A 4HEOA 4WURA 3LW5F 2QSFX 4RNAA 3U6EA 2YFQA 4NXMM 2Z3XA 4KHPM 1D0MA 4JI6M 3L28A 4X64M 2CP8A 1E9RA 1Q39A 2M60A 2JZ1A 1L2BA 1OTRA 3I4YA 2F5SA 2RRUA 2KA6B 3KDSE 1QANA 1TDZA 3FTEA 1QZMA 3U60A 3GPYA 1C1KA 3FUXA 3GRUA 1XB2B 1AIPC 5F3WA 1IBKM 1OKSA 5ITYA 4JI7M 3LCUA 4OVZB 4P17A 1GL6A 2O25A 1QUSA 3UZUA 4PT5A 2KW0A 4LY6A 1G41A 1V33A 4B7GA 4G3OA 3W0FA 1IXRC 1IY1A 2QENA 3FUWA 3FTCA 2JA2A 5ITUA 3GQ5A 1IXSA 2G8LA 4CJ6A 4MGYE 1DGGA 2V1CA 3K1JA 3FD9A 4RKUF 4DV7M 5KQDA 1TTEA 3HY5A 1DGHB 4DUYM 2LHGA 3HJSA 1XMQM 5KO3A 1OIPA 2EKFA 3M7GA 4JXJA 4LFBM 2XSZD 3Q8XA 1L8QA 2QQ8A 3BBZA 3A42A 1VQ1A 3KOWE 4GC5A 4XBOA 1Z5CA 1AUAA 2K6BA 4LZZA 1YLAA 4WW0A 3SFZA 4IJEA 1LTMA 2EJSA 2F4VM 3UMMA 4CGYB 3K8ZA 2I7NA 1S3SA 2DZOB 3K9PA 3SAWA 1R7RA 1QDRA 2ERCA 2GNOA 3THGA 4MGZE 2LXEA 2JY7A 1UFZA 3KVWA 4LCBA 4F2LA 3L27A 1DGHA 3HGIA 3KOXE 3LMMA 3TWMA 1HT1E 4IBFA 1VDLA 2D7EA 2Z4RA 2HWJA 1H6UA 3GLFA 1G59A 2CE7A 4FWDA 4AKGA 2WSEF 4DR5M 4DBGB 2JWSA 4DR6M 1E32A 5E26A 1L1ZA 2DHRA 3OTOM 2MH8A 3GPPA 3FTDA 2HCBA 4UN2B 2VDBB 2ZAMA 2F5PA 1D2NA 2Q2EB 3CF6E 2BWEA 1SXJB 3T6PA 5BR8M 1PJIA 2Y0QA 2F5QA 1N32M 1F4IA 3VKHA 3K92A 1N78A 4G6ZA 2LVQD 2YR0A 2R0IA 4M0DA 3GO8A 1Z5AA 2W82A 3T15A 2X49A 3LVVA 1A5TA 1Z5BA 1ZMUA 3QYEA 4NC6A 4B7HA 2C98A 4G4QA 4LF9M 3J7BA 3EIEA 1MN3A 3HU3A 2R46A 1PRBA 4LFCM 4BLCA 4IBBA 1C7YA 1HQYE 4LGYA 4Z8XA 5L8RF 1JB0F 4DV4M 3GQ4A 5KPTA 5E6JA 1NNJA 4RF0A 1EFUB 3GRVA 1OIZA 2KRUA 3HU1A 3NWLA 5IT9S 4DR2M 1IM2A 3J81S 4PDIA 3TWKA 4DUZM 2C5RA 2O5RA 3IECA 1T6OA 2F5OA 1XMOM 3VDPA 4IBDA 3C9PA 1OFHA 2L6OA 3I4VA 4AG6A 4OU7A 1HT2E 3BXWA 4FCVA 2DVWB 2LBCA 4ZPXA 1WXQA 4K0KM 3TWLA 2X8AA 5LMUM 2DKLA 3U6MA 4I81A 3VDUA 2C99A 3HZJA 3T38A 3IHPA 4M9SA 4CHTB 2VF8A 4GITA 3C3EA 1K3XA 1WGLA 2JZ0A 3HJ8A 4FCTA 4L8RC 1NVMA 4JI1M 4II7A 1RU3A 2Y0TA 2B3TA 2HHHM 2EUCA 5FLXS 3FKEA 1CUKA 4LZJA 4AI6A 1QAMA 3W68A 1VDDA 1R6BX 5KPZA 2CEAA 2KNVA 2WZJA 3SYLA 2EKKA 1VEKA 3SAVA 2HKJA 2CFOA 4MB7A 3SHFA 3KSXA 5EP4A 5ITXE 2UUBM 3K9OA 4D81A 2C96A 1PJSA 3U6DA 2YQZA 4YY3M 1N36M 4M9ZA 4OVZA 1IY0A 1GLNA 3T1HM 2FS1A 3HJQA 4B3MM 2DAGA 2ZAOA 4CISA 2H1RA 2DWZB 3QWLA 4LJ5A 2DI0A 4DV3M 4JI5M 3E4RA 4DR3M 3KFUG 2MROB 3HHXA 3SMPA 1YUBA 1SXJD 1SXJA 3U6OA 2D7GA 2Y20A 3VK8A 2QBYA 7CATA 1XXHB 1TGUA 2L09A 2JUJA 1XXHE 1PM5A 3KS8A 4IBEA 5IREB 5FSWA 3UJNA 4LJ8A 5LMNM 4MGKE 3PNVA 1Q3BA 3HWSA 1SXJE 1OAOC 2D7HA 4LF5M 5FTJA 3FTFA 4JI3M 1NSFA 4L6V6 4AKIA 3RE8A 1ZQ9A 2K47A 2MGWA 1IN5A 4R7GA 3GLHE 1QAQA 2VF7A 1Y8GA 4LJAA 3UGJA 2J7OA 2K0BX 1J5EM 3GLIA 4LGMA 1DGFA 2UUAM 4KODA 3QAUA 4P16A 2CUZA 3TQSA 3L26A 1GL7A 5IZ7D 3LQRA 3M6AA 3JR4A 1K82A 2DHYA 5DYIA 2XZUA 3RGPA 3HHZA 4PDGA 2EA0A 2I7PA 4JI0M 4D80A 1PJTA 3KP0E 3PVSA 1GVNA 2Z7JA 4Y28F 2LVNC 2QPAA 5C18A 2ZANA 3SHGB 3KOZE 3VLFB 3D8LA 2AHMA 3W0LB 2CV0A 2DZNB 3E21A 1DO0A 3U6QA 1Z59A 1V92A 4LRSA 2K9DA 2FH0A 2R44A 4ANRA 1OFIA 2KRKA 3GLGB 4JV5M 4QOZC 3R8FA 5ITTA 1P3QQ 2KNZA 2KEBA 3WHLA 3MHVC 1L2DA 3R9XB 1BVSA 4AZFA 3T1YM 1LV7A 2ZM6M 2DWMA 5C1BA 3B9PA 4I4LA 3FUTA 4AKHA 2LH0A 3C58A 2KNAA 4FW9A 4X62M 3GRYA 3E9SA 3GLHA 1NY5A 1XHBA 2HL7A 3H4JA 5EXSA 4NOOB 1NJGA 4IBJA 4PD2A 2BWBA 1OJLA 5JI3E 1ZV1A 1VG5A 5EJCA 1GABA 3ILKA 4G4RA 3PXGA 3LVWA 4I5SA 2G3QA 1R5LA 5JI2E 3LQQA 4R3DA 4B3SM 2LTUA 4MGHA 3QYBA 1UM8A 3I04M 4BB9A 2FFJA 2Z4SA 1DGBA 2L2DA 2HAKA 3MJ5A 4AW4A 1K3WA 4ITQA 4DR4M 3ZCBB 5FTNA 1IN7A 1WHCA 2BJVA 5A2QS 5ITQA 4B3TM 1G3IA 2LWXA 5EP3A 3GLHB 4HLQA 2G5GX 2LHCA 1HNWM 4MM3B 1QYRA 3J80S 3MMPA 3FUUA 4M9XA 3B89A 1QUTA 1J7KA 4I8OA 1WIVA 3L29A 1IN8A 2CHQA 3VKGA 4QOSA 1N77A 4JN6A 3RGSA 4DR1M 3SARA 2J7NA 3HU2A 5DYGA 4B3RM 2O01F 4OX9M 2C9CA 2R4EA 3L2AA 2KDLA 3JAMS 1L2CA 4NRVA 5DFLA 3A45A 1GJSA 3U6LA 4GHLA 5IWAM 2XZFA 4LF8M 1NHWC 1I4WA 1XNQM 2LNHC 2BNKA 4NSRA 3NBIA 2XFTA 4RF1A 3GLFE 1NV9A 4QHTA 1IXSB 3K2LA 4FWGA 1QQWA 4X66M 5ITRA 3U5ZB 4GHAA 3HHYA 1V34A 3EIHA 3U5ZA 3FRIA 2N35A 1XXHA 3A98B 3IG5A 1Q02A 5KPRA 4MH0E 1KYIA 1HNZM 4JI2M 2QCUA 3GLFB 4GC9A 1VEGA 3J27B 5EP2A 2V6ZM 1X37A 2XH9A 4REZA 2UU9M 3ZQJA 3KSJA 8CATA 1HR0M 1SG9A 3KW6A 1IQPA 2R45A 1TDHA 2F5NA 1IXZA 3V76A 4IBCA 1GO5A 3U6PA 1L1TA 4B08A 3LCVB 3JR5A 4FD2A 4JI4M 2UXBM 2X4AA 4IBGA 1DO2A 3U61B 1G4AE 4Q7JA 5EQTA 3HHWA 3SASA 2KXEA 2RGHA 3AFHA 3AV0A 4LF6M 2XFSA 1JR3D 2R62A 4LRTA 1TH3A 4TUWA 2ZTDA 3GP1A 1IY2A 1KSFX 1R2ZA 4JI8M 1FNNA 1GJTA 4QHSA 1DV0A 3M0EA 2FOIC 4NSOB 4GEWA 3E46A 1R2YA 3L25A 1NV8A 4QNRA 1D0KA 4A3VB 2J5YA 2VQEM 3B74A 3VFDA 3FE3A 1KFVA 2L7IA 2R4JA 4NXNM 2QHOB 1YE9A 3FYCA 4FWHA 2APLA 3F92A 2QP9X 3SATA 1WR1B 3W67A 3U61A 1JQJC 4S12A 4DV0M 3GLIB 1D0LA 3UK6A 4PCZA 4DV5M 3VK7A 1HNXM 3KP1E 3AOGA 3CF0A 2UXDM 4L78A 3IG8A 3U6CA 3Q8GA 1R4GA 2E5LM 1NHGC 2JY8A 2R18A 2R6FA 5GKNA 1PJJA 2CWBA 2DENA 2V1UA 4AQYM 3AOEC 1HQCA 4IJFA 1E94E 5H37D 3WHKA 2DXIA 1JR3A 4GRIA 1ZMVA 2EO2A 4HL4A 4KLNA 4LF7M 2DWLA 1OQYA 2RKOA 2DAEA 1IN4A 2JP7A 4GIPA 4D82A 1WJ7A 3GLGA 2OPFA 1NJFA 1G71A 2JXNA 3MK6A 3SBJA 3B7ZA 2XF3A 1ZMWA 1FJGM 4F1IA 1SXJC 2YNMD 3CTWB 4EIWA 3A46A 1IBLM 4YHHM 2MJ5B 3U6SA 1TH2A 5DNYA 5BPVA 4LG2A 2NQ8C 1MU5A 4R71A 5FTLA 2UXCM 2KZSA 4CIZA 3BOSA 5FTKA 2XGNA 4IIWA 3DFZA 2JNHA 2DAIA 3J2PB 3AKZA 2A5YB 2DZLA 1XC8A 3D8BA 2VQFM 3GRRA 2KHHA 2CHGA 3CGWA 3KS4A 2DNAA 3C3DA 3AL0C 4GKKM 3HKPA 1TH4A 4W5WA 5EP1A 4QNMA 3I51A 3FRHA 1MX0A 3DA1A 1PGYA 1QZEA 4NRWA 4LJ4A 4OW0A 3PFIA 4G4NA 4LJ7A 1QDTA 3B7NA 5EXPA 1T43A 4DV6M 3ZC7B 1WGNA 1Q3CA 4XK8F 2Y21A 1IFYA 4KT0F 3SAUA 4FVMA 2OO9A 3CF2A 2KZUA 2OOBA 1OAIA 2OOAA 2LVAA 1GKIA 2QBYB 1T3TA 2WSCF 3HX3A 4IBKA 4XGIA 3DZDA 1J09A 3GLGE 2JY6B 4NL4H 1IBMM 2DWNA 4LFAM 3SYKA 3AJIB 4MGIE 4JYAM 3FYDA 5ITXA 3GPUA 1EIJA 1PJQA 2FE8A 2P5TA 3TE6A 2M5ZA 2FNAA 1JR3E 2BJWA 2DAKA 4WP2A 4X65M 1MJGM 1EE8A 1QVRA 3DOAA 2Z8YM 3B7QA 1E9SA 5EXTA 2UUCM 2ZTCA 4GMQA 4L15A 1TF0B 4KO8A 3H4MA 3ZH9B 1NNUC 1XWIA 3SC3A 3FUVA 5FTMA 4DV2M 2MR9A 3SMSA 2WSFF 3TPZA 2LVOC 2CRUA 5EXXA 1N33M 4LF4M 2XSZA 1QAOA 2ZBKB 2H5XA 2CHVA
chains in the Genus database with same CATH topology
1XNRM 3GQ3A 2VIIA 1Z6TA 2L7HA 2XLJA 2R65A 1W5SA 4L16A 3TL4X 2QZ4A 4B7FA 2RGOA 1ORYB 3PNYA 4DV1M 4Z6YA 1NY6A 4AG5A 4G4OA 4GH9A 3GPXA 4M0WA 1N75A 1G8PA 4L4UA 3AOEA 4GKJM 2OQ4A 1N34M 4BBAA 1ZAEA 3KOYE 1I94M 1W5TA 1YSYA 4FCWA 3U60B 4LJ6A 5KQ8A 2CV1A 3J7AS 3KXEC 4DR7M 3RFWA 2CV2A 2XEPA 4IBIA 4LJ9A 2C9OA 1IN6A 4WURA 4RNAA 3U6EA 2YFQA 4NXMM 2Z3XA 4KHPM 4JI6M 3L28A 4X64M 1E9RA 1Q39A 2M60A 1L2BA 3I4YA 2F5SA 2KA6B 3KDSE 1QANA 1TDZA 3FTEA 1QZMA 3U60A 3GPYA 1C1KA 3FUXA 3GRUA 5F3WA 1IBKM 4JI7M 5ITYA 4OVZB 1GL6A 3UZUA 4PT5A 2KW0A 4LY6A 1G41A 4B7GA 3W0FA 1IXRC 1IY1A 2QENA 3FUWA 3FTCA 2JA2A 5ITUA 3GQ5A 2G8LA 4MGYE 1DGGA 2V1CA 3K1JA 3FD9A 4DV7M 5KQDA 4DUYM 1DGHB 3HJSA 1XMQM 5KO3A 3M7GA 4JXJA 4LFBM 2XSZD 3Q8XA 1L8QA 3A42A 3KOWE 4GC5A 4XBOA 1Z5CA 4LZZA 4WW0A 3SFZA 4IJEA 2F4VM 3UMMA 4CGYB 3K8ZA 1S3SA 2DZOB 2I7NA 3SAWA 1R7RA 2ERCA 3THGA 4MGZE 2LXEA 3KVWA 4LCBA 3L27A 1DGHA 3HGIA 3KOXE 3LMMA 3TWMA 1HT1E 4IBFA 2D7EA 2Z4RA 1H6UA 3GLFA 1G59A 2CE7A 4FWDA 4AKGA 4DR5M 4DR6M 1E32A 5E26A 1L1ZA 2DHRA 3OTOM 3GPPA 3FTDA 2HCBA 2F5PA 2ZAMA 1D2NA 3CF6E 2Q2EB 1SXJB 5BR8M 1N32M 1PJIA 2F5QA 2Y0QA 3VKHA 3K92A 1N78A 4G6ZA 2YR0A 4M0DA 3GO8A 1Z5AA 2W82A 3T15A 2X49A 3LVVA 1Z5BA 4B7HA 2C98A 4G4QA 4LF9M 3J7BA 3EIEA 3HU3A 2R46A 4LFCM 4BLCA 4IBBA 1HQYE 4LGYA 4Z8XA 4DV4M 3GQ4A 5KPTA 5E6JA 1NNJA 4RF0A 3GRVA 2KRUA 3HU1A 3NWLA 5IT9S 4DR2M 1IM2A 3J81S 4PDIA 3TWKA 4DUZM 2C5RA 2O5RA 2F5OA 1XMOM 3VDPA 4IBDA 1OFHA 2L6OA 3I4VA 4AG6A 4OU7A 1HT2E 4FCVA 2DVWB 4ZPXA 1WXQA 4K0KM 3TWLA 2X8AA 5LMUM 3U6MA 4I81A 3VDUA 2C99A 3T38A 4M9SA 4CHTB 4GITA 4L8RC 1K3XA 3HJ8A 4FCTA 1NVMA 4JI1M 4II7A 2Y0TA 2HHHM 2EUCA 5FLXS 3FKEA 4LZJA 4AI6A 1QAMA 1VDDA 1R6BX 5KPZA 2CEAA 3SYLA 3SAVA 2HKJA 2CFOA 4MB7A 3SHFA 3KSXA 5EP4A 5ITXE 2UUBM 4D81A 2C96A 3U6DA 2YQZA 4YY3M 1N36M 4M9ZA 4OVZA 1IY0A 1GLNA 3T1HM 3HJQA 4B3MM 2ZAOA 4CISA 2H1RA 2DWZB 3QWLA 4LJ5A 4DV3M 4JI5M 3E4RA 4DR3M 3KFUG 3HHXA 3SMPA 1YUBA 1SXJD 1SXJA 3U6OA 2D7GA 2Y20A 3VK8A 2QBYA 7CATA 1XXHB 1TGUA 2L09A 1PM5A 3KS8A 4IBEA 5IREB 5FSWA 3UJNA 4LJ8A 5LMNM 4MGKE 3PNVA 1Q3BA 3HWSA 1SXJE 2D7HA 4LF5M 5FTJA 3FTFA 4JI3M 1NSFA 4AKIA 3RE8A 1ZQ9A 2K47A 1IN5A 4R7GA 1QAQA 4LJAA 3UGJA 2J7OA 1J5EM 3GLIA 4LGMA 1DGFA 2UUAM 4KODA 3QAUA 4P16A 2CUZA 3TQSA 3L26A 1GL7A 5IZ7D 3LQRA 3M6AA 3JR4A 1K82A 5DYIA 2XZUA 3RGPA 3HHZA 4PDGA 2EA0A 2I7PA 4JI0M 4D80A 3KP0E 3PVSA 1GVNA 2Z7JA 2QPAA 5C18A 2ZANA 3SHGB 3KOZE 3VLFB 3D8LA 2AHMA 3W0LB 2CV0A 2DZNB 1DO0A 3U6QA 1Z59A 4LRSA 4JV5M 3GLGB 1OFIA 2KRKA 4QOZC 3R8FA 5ITTA 3WHLA 2KEBA 3MHVC 1L2DA 3R9XB 4AZFA 3T1YM 1LV7A 2ZM6M 2DWMA 5C1BA 3B9PA 4I4LA 3FUTA 4AKHA 2LH0A 3C58A 4FW9A 4X62M 3GRYA 3E9SA 3GLHA 1NY5A 1XHBA 2HL7A 5EXSA 4NOOB 1NJGA 4IBJA 4PD2A 1OJLA 5JI3E 5EJCA 3ILKA 4G4RA 3PXGA 3LVWA 4I5SA 5JI2E 3LQQA 4R3DA 4B3SM 4MGHA 1UM8A 4BB9A 1K3WA 2FFJA 2Z4SA 1DGBA 3MJ5A 4AW4A 4ITQA 4DR4M 3ZCBB 5FTNA 1IN7A 2BJVA 5A2QS 5ITQA 4B3TM 1G3IA 2LWXA 5EP3A 3GLHB 4HLQA 2G5GX 1HNWM 4MM3B 1QYRA 3J80S 3FUUA 4M9XA 4I8OA 1J7KA 3L29A 1IN8A 2CHQA 3VKGA 4QOSA 1N77A 4JN6A 3RGSA 4DR1M 3SARA 2J7NA 3HU2A 5DYGA 4B3RM 4OX9M 2C9CA 2R4EA 3L2AA 3JAMS 1L2CA 4NRVA 3A45A 3U6LA 4GHLA 5IWAM 2XZFA 4LF8M 1NHWC 1I4WA 1XNQM 2LNHC 2BNKA 4NSRA 3NBIA 2XFTA 4RF1A 4QHTA 1IXSB 3K2LA 4FWGA 1QQWA 4X66M 5ITRA 3U5ZB 4GHAA 3HHYA 3EIHA 3U5ZA 1XXHA 3A98B 3IG5A 5KPRA 1HNZM 4MH0E 1KYIA 4JI2M 2QCUA 3GLFB 4GC9A 3J27B 5EP2A 2V6ZM 1X37A 2XH9A 4REZA 2UU9M 3KSJA 8CATA 1HR0M 3KW6A 1IQPA 2R45A 1TDHA 2F5NA 1IXZA 4IBCA 3U6PA 1L1TA 4B08A 3JR5A 4FD2A 4JI4M 2UXBM 2X4AA 4IBGA 1DO2A 3U61B 1G4AE 5EQTA 3HHWA 3SASA 2KXEA 2RGHA 3AFHA 3AV0A 4LF6M 2XFSA 1JR3D 2R62A 4LRTA 1TH3A 4TUWA 3GP1A 4JI8M 1IY2A 1KSFX 1R2ZA 1FNNA 4QHSA 3M0EA 2FOIC 4NSOB 1R2YA 3L25A 4QNRA 4A3VB 2VQEM 1KFVA 3VFDA 2L7IA 2R4JA 4NXNM 1YE9A 3FYCA 4FWHA 2QP9X 3SATA 3U61A 1JQJC 4S12A 4DV0M 3GLIB 3UK6A 4PCZA 4DV5M 3VK7A 1HNXM 3KP1E 3AOGA 3CF0A 2UXDM 4L78A 3IG8A 3U6CA 2E5LM 1NHGC 5GKNA 2R18A 1PJJA 2V1UA 4AQYM 3AOEC 1HQCA 4IJFA 1E94E 5H37D 3WHKA 2DXIA 1JR3A 4GRIA 2EO2A 4HL4A 4LF7M 4KLNA 2DWLA 2RKOA 4D82A 1IN4A 4GIPA 3GLGA 2OPFA 1NJFA 3MK6A 3SBJA 2XF3A 1FJGM 1SXJC 2YNMD 3CTWB 4EIWA 3A46A 1IBLM 4YHHM 3U6SA 1TH2A 5DNYA 5BPVA 4LG2A 2NQ8C 1MU5A 2UXCM 5FTLA 2KZSA 3BOSA 5FTKA 2XGNA 4IIWA 3DFZA 3J2PB 3AKZA 2A5YB 1XC8A 3D8BA 2VQFM 3GRRA 2CHGA 3KS4A 3AL0C 4GKKM 3HKPA 1TH4A 4W5WA 5EP1A 4QNMA 3I51A 1MX0A 3DA1A 4NRWA 4LJ4A 4OW0A 3PFIA 4G4NA 4LJ7A 5EXPA 4DV6M 3ZC7B 1Q3CA 2Y21A 3SAUA 4FVMA 3CF2A 2KZUA 1GKIA 2QBYB 1T3TA 4IBKA 4XGIA 3DZDA 1J09A 1IBMM 4NL4H 2DWNA 4LFAM 3SYKA 3AJIB 4MGIE 4JYAM 3FYDA 5ITXA 3GPUA 2FE8A 2P5TA 3TE6A 2FNAA 2BJWA 2M5ZA 4X65M 5EXTA 1EE8A 1QVRA 3DOAA 2UUCM 1E9SA 4GMQA 4L15A 3ZH9B 4KO8A 3H4MA 1NNUC 1XWIA 3SC3A 3FUVA 5FTMA 4DV2M 3SMSA 3TPZA 5EXXA 1N33M 4LF4M 2XSZA 1QAOA 2ZBKB 2CHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E M;  1XNR M;  3GQ3 A;  3SAS A;  2UUA M;  4LF6 M;  3GO8 A;  3GP1 A;  4JI8 M;  1Z5A A;  3JR4 A;  1R2Z A;  1K82 A;  4DV1 M;  2XZU A;  1R2Y A;  4PDG A;  2EA0 A;  4G4O A;  1Z5B A;  4JI0 M;  2VQE M;  1KFV A;  3GPX A;  4G4Q A;  4LF9 M;  4NXN M;  4GKJ M;  2OQ4 A;  1N34 M;  4LFC M;  1I94 M;  3SAT A;  3U6Q A;  1Z59 A;  4JV5 M;  4DV4 M;  4DV0 M;  3GQ4 A;  4PCZ A;  5ITT A;  1NNJ A;  4DV5 M;  3VK7 A;  1L2D A;  1HNX M;  2UXD M;  3J7A S;  3T1Y M;  2ZM6 M;  3U6C A;  4DR7 M;  5IT9 S;  4DR2 M;  1PJJ A;  2E5L M;  3C58 A;  3J81 S;  3U6E A;  4PDI A;  4X62 M;  3TWK A;  4DUZ M;  4AQY M;  4NXM M;  2F5O A;  1XMO M;  4KHP M;  4JI6 M;  4X64 M;  1Q39 A;  4PD2 A;  1L2B A;  4LF7 M;  2F5S A;  1TDZ A;  4G4R A;  3GPY A;  2OPF A;  4K0K M;  3TWL A;  3SBJ A;  5LMU M;  3U6M A;  4B3S M;  1IBK M;  1FJG M;  3A46 A;  1IBL M;  5ITY A;  4JI7 M;  4YHH M;  1K3W A;  3U6S A;  4ITQ A;  1K3X A;  4DR4 M;  1MU5 A;  2UXC M;  4JI1 M;  5A2Q S;  5ITQ A;  4B3T M;  2HHH M;  5FLX S;  3W0F A;  1HNW M;  1XC8 A;  3J80 S;  5ITU A;  3GQ5 A;  2VQF M;  4DV7 M;  3SAV A;  4GKK M;  2HKJ A;  4MB7 A;  5ITX E;  4DUY M;  1MX0 A;  1XMQ M;  4DR1 M;  2UUB M;  3SAR A;  4B3R M;  4LFB M;  3U6D A;  4YY3 M;  1N36 M;  4NRW A;  4G4N A;  4OX9 M;  3T1H M;  3A42 A;  3JAM S;  1L2C A;  2Q2E B;  4DV6 M;  4NRV A;  3A45 A;  4B3M M;  1Z5C A;  1Q3C A;  5IWA M;  3U6L A;  4CIS A;  2XZF A;  4LF8 M;  4DV3 M;  3SAU A;  1XNQ M;  2F4V M;  4JI5 M;  4DR3 M;  3SAW A;  3U6O A;  5ITR A;  3VK8 A;  4X66 M;  1IBM M;  1PM5 A;  4LFA M;  4JYA M;  1HNZ M;  5ITX A;  3GPU A;  4JI2 M;  3TWM A;  5LMN M;  1Q3B A;  4X65 M;  1EE8 A;  3DOA A;  2UUC M;  2UU9 M;  4LF5 M;  1HR0 M;  4DR5 M;  4JI3 M;  4DR6 M;  1TDH A;  2F5N A;  1L1Z A;  4DV2 M;  3OTO M;  3GPP A;  1N32 M;  3U6P A;  1L1T A;  1N33 M;  4LF4 M;  2F5P A;  3JR5 A;  2UXB M;  4JI4 M;  5BR8 M;  2ZBK B;  1PJI A;  2F5Q A; 
#chains in the Genus database with same CATH topology
 1XNR M;  2L4F A;  3GQ3 A;  2VII A;  1Z6T A;  2L7H A;  2XLJ A;  2R65 A;  1W5S A;  4L16 A;  3TL4 X;  2QZ4 A;  4B7F A;  2RGO A;  1ORY B;  3PNY A;  4DV1 M;  2QNJ A;  4Z6Y A;  1NY6 A;  4AG5 A;  4G4O A;  2DAM A;  2LVP C;  4GH9 A;  1VEJ A;  1NO1 A;  2GQF A;  4M0W A;  1N75 A;  1G8P A;  3GPX A;  3GLI E;  4L4U A;  3AOE A;  4GKJ M;  2OQ4 A;  1N34 M;  1HJP A;  4BBA A;  1ZAE A;  3KOY E;  1I94 M;  1W5T A;  2L4E A;  1YSY A;  4FCW A;  2JY5 A;  3U60 B;  3I01 M;  4LJ6 A;  5KQ8 A;  2CV1 A;  3J7A S;  3NBX X;  3KXE C;  4DR7 M;  3RFW A;  2CV2 A;  2XEP A;  4IBI A;  4LJ9 A;  1TR8 A;  2C9O A;  1IN6 A;  4HEO A;  4WUR A;  3LW5 F;  2QSF X;  4RNA A;  3U6E A;  2YFQ A;  4NXM M;  2Z3X A;  4KHP M;  1D0M A;  4JI6 M;  3L28 A;  4X64 M;  2CP8 A;  1E9R A;  1Q39 A;  2M60 A;  2JZ1 A;  1L2B A;  1OTR A;  3I4Y A;  2F5S A;  2RRU A;  2KA6 B;  3KDS E;  1QAN A;  1TDZ A;  3FTE A;  1QZM A;  3U60 A;  3GPY A;  1C1K A;  3FUX A;  3GRU A;  1XB2 B;  1AIP C;  5F3W A;  1IBK M;  1OKS A;  5ITY A;  4JI7 M;  3LCU A;  4OVZ B;  4P17 A;  1GL6 A;  2O25 A;  1QUS A;  3UZU A;  4PT5 A;  2KW0 A;  4LY6 A;  1G41 A;  1V33 A;  4B7G A;  4G3O A;  3W0F A;  1IXR C;  1IY1 A;  2QEN A;  3FUW A;  3FTC A;  2JA2 A;  5ITU A;  3GQ5 A;  1IXS A;  2G8L A;  4CJ6 A;  4MGY E;  1DGG A;  2V1C A;  3K1J A;  3FD9 A;  4RKU F;  4DV7 M;  5KQD A;  1TTE A;  3HY5 A;  1DGH B;  4DUY M;  2LHG A;  3HJS A;  1XMQ M;  5KO3 A;  1OIP A;  2EKF A;  3M7G A;  4JXJ A;  4LFB M;  2XSZ D;  3Q8X A;  1L8Q A;  2QQ8 A;  3BBZ A;  3A42 A;  1VQ1 A;  3KOW E;  4GC5 A;  4XBO A;  1Z5C A;  1AUA A;  2K6B A;  4LZZ A;  1YLA A;  4WW0 A;  3SFZ A;  4IJE A;  1LTM A;  2EJS A;  2F4V M;  3UMM A;  4CGY B;  3K8Z A;  2I7N A;  1S3S A;  2DZO B;  3K9P A;  3SAW A;  1R7R A;  1QDR A;  2ERC A;  2GNO A;  3THG A;  4MGZ E;  2LXE A;  2JY7 A;  1UFZ A;  3KVW A;  4LCB A;  4F2L A;  3L27 A;  1DGH A;  3HGI A;  3KOX E;  3LMM A;  3TWM A;  1HT1 E;  4IBF A;  1VDL A;  2D7E A;  2Z4R A;  2HWJ A;  1H6U A;  3GLF A;  1G59 A;  2CE7 A;  4FWD A;  4AKG A;  2WSE F;  4DR5 M;  4DBG B;  2JWS A;  4DR6 M;  1E32 A;  5E26 A;  1L1Z A;  2DHR A;  3OTO M;  2MH8 A;  3GPP A;  3FTD A;  2HCB A;  4UN2 B;  2VDB B;  2ZAM A;  2F5P A;  1D2N A;  2Q2E B;  3CF6 E;  2BWE A;  1SXJ B;  3T6P A;  5BR8 M;  1PJI A;  2Y0Q A;  2F5Q A;  1N32 M;  1F4I A;  3VKH A;  3K92 A;  1N78 A;  4G6Z A;  2LVQ D;  2YR0 A;  2R0I A;  4M0D A;  3GO8 A;  1Z5A A;  2W82 A;  3T15 A;  2X49 A;  3LVV A;  1A5T A;  1Z5B A;  1ZMU A;  3QYE A;  4NC6 A;  4B7H A;  2C98 A;  4G4Q A;  4LF9 M;  3J7B A;  3EIE A;  1MN3 A;  3HU3 A;  2R46 A;  1PRB A;  4LFC M;  4BLC A;  4IBB A;  1C7Y A;  1HQY E;  4LGY A;  4Z8X A;  5L8R F;  1JB0 F;  4DV4 M;  3GQ4 A;  5KPT A;  5E6J A;  1NNJ A;  4RF0 A;  1EFU B;  3GRV A;  1OIZ A;  2KRU A;  3HU1 A;  3NWL A;  5IT9 S;  4DR2 M;  1IM2 A;  3J81 S;  4PDI A;  3TWK A;  4DUZ M;  2C5R A;  2O5R A;  3IEC A;  1T6O A;  2F5O A;  1XMO M;  3VDP A;  4IBD A;  3C9P A;  1OFH A;  2L6O A;  3I4V A;  4AG6 A;  4OU7 A;  1HT2 E;  3BXW A;  4FCV A;  2DVW B;  2LBC A;  4ZPX A;  1WXQ A;  4K0K M;  3TWL A;  2X8A A;  5LMU M;  2DKL A;  3U6M A;  4I81 A;  3VDU A;  2C99 A;  3HZJ A;  3T38 A;  3IHP A;  4M9S A;  4CHT B;  2VF8 A;  4GIT A;  3C3E A;  1K3X A;  1WGL A;  2JZ0 A;  3HJ8 A;  4FCT A;  4L8R C;  1NVM A;  4JI1 M;  4II7 A;  1RU3 A;  2Y0T A;  2B3T A;  2HHH M;  2EUC A;  5FLX S;  3FKE A;  1CUK A;  4LZJ A;  4AI6 A;  1QAM A;  3W68 A;  1VDD A;  1R6B X;  5KPZ A;  2CEA A;  2KNV A;  2WZJ A;  3SYL A;  2EKK A;  1VEK A;  3SAV A;  2HKJ A;  2CFO A;  4MB7 A;  3SHF A;  3KSX A;  5EP4 A;  5ITX E;  2UUB M;  3K9O A;  4D81 A;  2C96 A;  1PJS A;  3U6D A;  2YQZ A;  4YY3 M;  1N36 M;  4M9Z A;  4OVZ A;  1IY0 A;  1GLN A;  3T1H M;  2FS1 A;  3HJQ A;  4B3M M;  2DAG A;  2ZAO A;  4CIS A;  2H1R A;  2DWZ B;  3QWL A;  4LJ5 A;  2DI0 A;  4DV3 M;  4JI5 M;  3E4R A;  4DR3 M;  3KFU G;  2MRO B;  3HHX A;  3SMP A;  1YUB A;  1SXJ D;  1SXJ A;  3U6O A;  2D7G A;  2Y20 A;  3VK8 A;  2QBY A;  7CAT A;  1XXH B;  1TGU A;  2L09 A;  2JUJ A;  1XXH E;  1PM5 A;  3KS8 A;  4IBE A;  5IRE B;  5FSW A;  3UJN A;  4LJ8 A;  5LMN M;  4MGK E;  3PNV A;  1Q3B A;  3HWS A;  1SXJ E;  1OAO C;  2D7H A;  4LF5 M;  5FTJ A;  3FTF A;  4JI3 M;  1NSF A;  4L6V 6;  4AKI A;  3RE8 A;  1ZQ9 A;  2K47 A;  2MGW A;  1IN5 A;  4R7G A;  3GLH E;  1QAQ A;  2VF7 A;  1Y8G A;  4LJA A;  3UGJ A;  2J7O A;  2K0B X;  1J5E M;  3GLI A;  4LGM A;  1DGF A;  2UUA M;  4KOD A;  3QAU A;  4P16 A;  2CUZ A;  3TQS A;  3L26 A;  1GL7 A;  5IZ7 D;  3LQR A;  3M6A A;  3JR4 A;  1K82 A;  2DHY A;  5DYI A;  2XZU A;  3RGP A;  3HHZ A;  4PDG A;  2EA0 A;  2I7P A;  4JI0 M;  4D80 A;  1PJT A;  3KP0 E;  3PVS A;  1GVN A;  2Z7J A;  4Y28 F;  2LVN C;  2QPA A;  5C18 A;  2ZAN A;  3SHG B;  3KOZ E;  3VLF B;  3D8L A;  2AHM A;  3W0L B;  2CV0 A;  2DZN B;  3E21 A;  1DO0 A;  3U6Q A;  1Z59 A;  1V92 A;  4LRS A;  2K9D A;  2FH0 A;  2R44 A;  4ANR A;  1OFI A;  2KRK A;  3GLG B;  4JV5 M;  4QOZ C;  3R8F A;  5ITT A;  1P3Q Q;  2KNZ A;  2KEB A;  3WHL A;  3MHV C;  1L2D A;  3R9X B;  1BVS A;  4AZF A;  3T1Y M;  1LV7 A;  2ZM6 M;  2DWM A;  5C1B A;  3B9P A;  4I4L A;  3FUT A;  4AKH A;  2LH0 A;  3C58 A;  2KNA A;  4FW9 A;  4X62 M;  3GRY A;  3E9S A;  3GLH A;  1NY5 A;  1XHB A;  2HL7 A;  3H4J A;  5EXS A;  4NOO B;  1NJG A;  4IBJ A;  4PD2 A;  2BWB A;  1OJL A;  5JI3 E;  1ZV1 A;  1VG5 A;  5EJC A;  1GAB A;  3ILK A;  4G4R A;  3PXG A;  3LVW A;  4I5S A;  2G3Q A;  1R5L A;  5JI2 E;  3LQQ A;  4R3D A;  4B3S M;  2LTU A;  4MGH A;  3QYB A;  1UM8 A;  3I04 M;  4BB9 A;  2FFJ A;  2Z4S A;  1DGB A;  2L2D A;  2HAK A;  3MJ5 A;  4AW4 A;  1K3W A;  4ITQ A;  4DR4 M;  3ZCB B;  5FTN A;  1IN7 A;  1WHC A;  2BJV A;  5A2Q S;  5ITQ A;  4B3T M;  1G3I A;  2LWX A;  5EP3 A;  3GLH B;  4HLQ A;  2G5G X;  2LHC A;  1HNW M;  4MM3 B;  1QYR A;  3J80 S;  3MMP A;  3FUU A;  4M9X A;  3B89 A;  1QUT A;  1J7K A;  4I8O A;  1WIV A;  3L29 A;  1IN8 A;  2CHQ A;  3VKG A;  4QOS A;  1N77 A;  4JN6 A;  3RGS A;  4DR1 M;  3SAR A;  2J7N A;  3HU2 A;  5DYG A;  4B3R M;  2O01 F;  4OX9 M;  2C9C A;  2R4E A;  3L2A A;  2KDL A;  3JAM S;  1L2C A;  4NRV A;  5DFL A;  3A45 A;  1GJS A;  3U6L A;  4GHL A;  5IWA M;  2XZF A;  4LF8 M;  1NHW C;  1I4W A;  1XNQ M;  2LNH C;  2BNK A;  4NSR A;  3NBI A;  2XFT A;  4RF1 A;  3GLF E;  1NV9 A;  4QHT A;  1IXS B;  3K2L A;  4FWG A;  1QQW A;  4X66 M;  5ITR A;  3U5Z B;  4GHA A;  3HHY A;  1V34 A;  3EIH A;  3U5Z A;  3FRI A;  2N35 A;  1XXH A;  3A98 B;  3IG5 A;  1Q02 A;  5KPR A;  4MH0 E;  1KYI A;  1HNZ M;  4JI2 M;  2QCU A;  3GLF B;  4GC9 A;  1VEG A;  3J27 B;  5EP2 A;  2V6Z M;  1X37 A;  2XH9 A;  4REZ A;  2UU9 M;  3ZQJ A;  3KSJ A;  8CAT A;  1HR0 M;  1SG9 A;  3KW6 A;  1IQP A;  2R45 A;  1TDH A;  2F5N A;  1IXZ A;  3V76 A;  4IBC A;  1GO5 A;  3U6P A;  1L1T A;  4B08 A;  3LCV B;  3JR5 A;  4FD2 A;  4JI4 M;  2UXB M;  2X4A A;  4IBG A;  1DO2 A;  3U61 B;  1G4A E;  4Q7J A;  5EQT A;  3HHW A;  3SAS A;  2KXE A;  2RGH A;  3AFH A;  3AV0 A;  4LF6 M;  2XFS A;  1JR3 D;  2R62 A;  4LRT A;  1TH3 A;  4TUW A;  2ZTD A;  3GP1 A;  1IY2 A;  1KSF X;  1R2Z A;  4JI8 M;  1FNN A;  1GJT A;  4QHS A;  1DV0 A;  3M0E A;  2FOI C;  4NSO B;  4GEW A;  3E46 A;  1R2Y A;  3L25 A;  1NV8 A;  4QNR A;  1D0K A;  4A3V B;  2J5Y A;  2VQE M;  3B74 A;  3VFD A;  3FE3 A;  1KFV A;  2L7I A;  2R4J A;  4NXN M;  2QHO B;  1YE9 A;  3FYC A;  4FWH A;  2APL A;  3F92 A;  2QP9 X;  3SAT A;  1WR1 B;  3W67 A;  3U61 A;  1JQJ C;  4S12 A;  4DV0 M;  3GLI B;  1D0L A;  3UK6 A;  4PCZ A;  4DV5 M;  3VK7 A;  1HNX M;  3KP1 E;  3AOG A;  3CF0 A;  2UXD M;  4L78 A;  3IG8 A;  3U6C A;  3Q8G A;  1R4G A;  2E5L M;  1NHG C;  2JY8 A;  2R18 A;  2R6F A;  5GKN A;  1PJJ A;  2CWB A;  2DEN A;  2V1U A;  4AQY M;  3AOE C;  1HQC A;  4IJF A;  1E94 E;  5H37 D;  3WHK A;  2DXI A;  1JR3 A;  4GRI A;  1ZMV A;  2EO2 A;  4HL4 A;  4KLN A;  4LF7 M;  2DWL A;  1OQY A;  2RKO A;  2DAE A;  1IN4 A;  2JP7 A;  4GIP A;  4D82 A;  1WJ7 A;  3GLG A;  2OPF A;  1NJF A;  1G71 A;  2JXN A;  3MK6 A;  3SBJ A;  3B7Z A;  2XF3 A;  1ZMW A;  1FJG M;  4F1I A;  1SXJ C;  2YNM D;  3CTW B;  4EIW A;  3A46 A;  1IBL M;  4YHH M;  2MJ5 B;  3U6S A;  1TH2 A;  5DNY A;  5BPV A;  4LG2 A;  2NQ8 C;  1MU5 A;  4R71 A;  5FTL A;  2UXC M;  2KZS A;  4CIZ A;  3BOS A;  5FTK A;  2XGN A;  4IIW A;  3DFZ A;  2JNH A;  2DAI A;  3J2P B;  3AKZ A;  2A5Y B;  2DZL A;  1XC8 A;  3D8B A;  2VQF M;  3GRR A;  2KHH A;  2CHG A;  3CGW A;  3KS4 A;  2DNA A;  3C3D A;  3AL0 C;  4GKK M;  3HKP A;  1TH4 A;  4W5W A;  5EP1 A;  4QNM A;  3I51 A;  3FRH A;  1MX0 A;  3DA1 A;  1PGY A;  1QZE A;  4NRW A;  4LJ4 A;  4OW0 A;  3PFI A;  4G4N A;  4LJ7 A;  1QDT A;  3B7N A;  5EXP A;  1T43 A;  4DV6 M;  3ZC7 B;  1WGN A;  1Q3C A;  4XK8 F;  2Y21 A;  1IFY A;  4KT0 F;  3SAU A;  4FVM A;  2OO9 A;  3CF2 A;  2KZU A;  2OOB A;  1OAI A;  2OOA A;  2LVA A;  1GKI A;  2QBY B;  1T3T A;  2WSC F;  3HX3 A;  4IBK A;  4XGI A;  3DZD A;  1J09 A;  3GLG E;  2JY6 B;  4NL4 H;  1IBM M;  2DWN A;  4LFA M;  3SYK A;  3AJI B;  4MGI E;  4JYA M;  3FYD A;  5ITX A;  3GPU A;  1EIJ A;  1PJQ A;  2FE8 A;  2P5T A;  3TE6 A;  2M5Z A;  2FNA A;  1JR3 E;  2BJW A;  2DAK A;  4WP2 A;  4X65 M;  1MJG M;  1EE8 A;  1QVR A;  3DOA A;  2Z8Y M;  3B7Q A;  1E9S A;  5EXT A;  2UUC M;  2ZTC A;  4GMQ A;  4L15 A;  1TF0 B;  4KO8 A;  3H4M A;  3ZH9 B;  1NNU C;  1XWI A;  3SC3 A;  3FUV A;  5FTM A;  4DV2 M;  2MR9 A;  3SMS A;  2WSF F;  3TPZ A;  2LVO C;  2CRU A;  5EXX A;  1N33 M;  4LF4 M;  2XSZ A;  1QAO A;  2ZBK B;  2H5X A;  2CHV A; 
#chains in the Genus database with same CATH homology
 1XNR M;  3GQ3 A;  2VII A;  1Z6T A;  2L7H A;  2XLJ A;  2R65 A;  1W5S A;  4L16 A;  3TL4 X;  2QZ4 A;  4B7F A;  2RGO A;  1ORY B;  3PNY A;  4DV1 M;  4Z6Y A;  1NY6 A;  4AG5 A;  4G4O A;  4GH9 A;  3GPX A;  4M0W A;  1N75 A;  1G8P A;  4L4U A;  3AOE A;  4GKJ M;  2OQ4 A;  1N34 M;  4BBA A;  1ZAE A;  3KOY E;  1I94 M;  1W5T A;  1YSY A;  4FCW A;  3U60 B;  4LJ6 A;  5KQ8 A;  2CV1 A;  3J7A S;  3KXE C;  4DR7 M;  3RFW A;  2CV2 A;  2XEP A;  4IBI A;  4LJ9 A;  2C9O A;  1IN6 A;  4WUR A;  4RNA A;  3U6E A;  2YFQ A;  4NXM M;  2Z3X A;  4KHP M;  4JI6 M;  3L28 A;  4X64 M;  1E9R A;  1Q39 A;  2M60 A;  1L2B A;  3I4Y A;  2F5S A;  2KA6 B;  3KDS E;  1QAN A;  1TDZ A;  3FTE A;  1QZM A;  3U60 A;  3GPY A;  1C1K A;  3FUX A;  3GRU A;  5F3W A;  1IBK M;  4JI7 M;  5ITY A;  4OVZ B;  1GL6 A;  3UZU A;  4PT5 A;  2KW0 A;  4LY6 A;  1G41 A;  4B7G A;  3W0F A;  1IXR C;  1IY1 A;  2QEN A;  3FUW A;  3FTC A;  2JA2 A;  5ITU A;  3GQ5 A;  2G8L A;  4MGY E;  1DGG A;  2V1C A;  3K1J A;  3FD9 A;  4DV7 M;  5KQD A;  4DUY M;  1DGH B;  3HJS A;  1XMQ M;  5KO3 A;  3M7G A;  4JXJ A;  4LFB M;  2XSZ D;  3Q8X A;  1L8Q A;  3A42 A;  3KOW E;  4GC5 A;  4XBO A;  1Z5C A;  4LZZ A;  4WW0 A;  3SFZ A;  4IJE A;  2F4V M;  3UMM A;  4CGY B;  3K8Z A;  1S3S A;  2DZO B;  2I7N A;  3SAW A;  1R7R A;  2ERC A;  3THG A;  4MGZ E;  2LXE A;  3KVW A;  4LCB A;  3L27 A;  1DGH A;  3HGI A;  3KOX E;  3LMM A;  3TWM A;  1HT1 E;  4IBF A;  2D7E A;  2Z4R A;  1H6U A;  3GLF A;  1G59 A;  2CE7 A;  4FWD A;  4AKG A;  4DR5 M;  4DR6 M;  1E32 A;  5E26 A;  1L1Z A;  2DHR A;  3OTO M;  3GPP A;  3FTD A;  2HCB A;  2F5P A;  2ZAM A;  1D2N A;  3CF6 E;  2Q2E B;  1SXJ B;  5BR8 M;  1N32 M;  1PJI A;  2F5Q A;  2Y0Q A;  3VKH A;  3K92 A;  1N78 A;  4G6Z A;  2YR0 A;  4M0D A;  3GO8 A;  1Z5A A;  2W82 A;  3T15 A;  2X49 A;  3LVV A;  1Z5B A;  4B7H A;  2C98 A;  4G4Q A;  4LF9 M;  3J7B A;  3EIE A;  3HU3 A;  2R46 A;  4LFC M;  4BLC A;  4IBB A;  1HQY E;  4LGY A;  4Z8X A;  4DV4 M;  3GQ4 A;  5KPT A;  5E6J A;  1NNJ A;  4RF0 A;  3GRV A;  2KRU A;  3HU1 A;  3NWL A;  5IT9 S;  4DR2 M;  1IM2 A;  3J81 S;  4PDI A;  3TWK A;  4DUZ M;  2C5R A;  2O5R A;  2F5O A;  1XMO M;  3VDP A;  4IBD A;  1OFH A;  2L6O A;  3I4V A;  4AG6 A;  4OU7 A;  1HT2 E;  4FCV A;  2DVW B;  4ZPX A;  1WXQ A;  4K0K M;  3TWL A;  2X8A A;  5LMU M;  3U6M A;  4I81 A;  3VDU A;  2C99 A;  3T38 A;  4M9S A;  4CHT B;  4GIT A;  4L8R C;  1K3X A;  3HJ8 A;  4FCT A;  1NVM A;  4JI1 M;  4II7 A;  2Y0T A;  2HHH M;  2EUC A;  5FLX S;  3FKE A;  4LZJ A;  4AI6 A;  1QAM A;  1VDD A;  1R6B X;  5KPZ A;  2CEA A;  3SYL A;  3SAV A;  2HKJ A;  2CFO A;  4MB7 A;  3SHF A;  3KSX A;  5EP4 A;  5ITX E;  2UUB M;  4D81 A;  2C96 A;  3U6D A;  2YQZ A;  4YY3 M;  1N36 M;  4M9Z A;  4OVZ A;  1IY0 A;  1GLN A;  3T1H M;  3HJQ A;  4B3M M;  2ZAO A;  4CIS A;  2H1R A;  2DWZ B;  3QWL A;  4LJ5 A;  4DV3 M;  4JI5 M;  3E4R A;  4DR3 M;  3KFU G;  3HHX A;  3SMP A;  1YUB A;  1SXJ D;  1SXJ A;  3U6O A;  2D7G A;  2Y20 A;  3VK8 A;  2QBY A;  7CAT A;  1XXH B;  1TGU A;  2L09 A;  1PM5 A;  3KS8 A;  4IBE A;  5IRE B;  5FSW A;  3UJN A;  4LJ8 A;  5LMN M;  4MGK E;  3PNV A;  1Q3B A;  3HWS A;  1SXJ E;  2D7H A;  4LF5 M;  5FTJ A;  3FTF A;  4JI3 M;  1NSF A;  4AKI A;  3RE8 A;  1ZQ9 A;  2K47 A;  1IN5 A;  4R7G A;  1QAQ A;  4LJA A;  3UGJ A;  2J7O A;  1J5E M;  3GLI A;  4LGM A;  1DGF A;  2UUA M;  4KOD A;  3QAU A;  4P16 A;  2CUZ A;  3TQS A;  3L26 A;  1GL7 A;  5IZ7 D;  3LQR A;  3M6A A;  3JR4 A;  1K82 A;  5DYI A;  2XZU A;  3RGP A;  3HHZ A;  4PDG A;  2EA0 A;  2I7P A;  4JI0 M;  4D80 A;  3KP0 E;  3PVS A;  1GVN A;  2Z7J A;  2QPA A;  5C18 A;  2ZAN A;  3SHG B;  3KOZ E;  3VLF B;  3D8L A;  2AHM A;  3W0L B;  2CV0 A;  2DZN B;  1DO0 A;  3U6Q A;  1Z59 A;  4LRS A;  4JV5 M;  3GLG B;  1OFI A;  2KRK A;  4QOZ C;  3R8F A;  5ITT A;  3WHL A;  2KEB A;  3MHV C;  1L2D A;  3R9X B;  4AZF A;  3T1Y M;  1LV7 A;  2ZM6 M;  2DWM A;  5C1B A;  3B9P A;  4I4L A;  3FUT A;  4AKH A;  2LH0 A;  3C58 A;  4FW9 A;  4X62 M;  3GRY A;  3E9S A;  3GLH A;  1NY5 A;  1XHB A;  2HL7 A;  5EXS A;  4NOO B;  1NJG A;  4IBJ A;  4PD2 A;  1OJL A;  5JI3 E;  5EJC A;  3ILK A;  4G4R A;  3PXG A;  3LVW A;  4I5S A;  5JI2 E;  3LQQ A;  4R3D A;  4B3S M;  4MGH A;  1UM8 A;  4BB9 A;  1K3W A;  2FFJ A;  2Z4S A;  1DGB A;  3MJ5 A;  4AW4 A;  4ITQ A;  4DR4 M;  3ZCB B;  5FTN A;  1IN7 A;  2BJV A;  5A2Q S;  5ITQ A;  4B3T M;  1G3I A;  2LWX A;  5EP3 A;  3GLH B;  4HLQ A;  2G5G X;  1HNW M;  4MM3 B;  1QYR A;  3J80 S;  3FUU A;  4M9X A;  4I8O A;  1J7K A;  3L29 A;  1IN8 A;  2CHQ A;  3VKG A;  4QOS A;  1N77 A;  4JN6 A;  3RGS A;  4DR1 M;  3SAR A;  2J7N A;  3HU2 A;  5DYG A;  4B3R M;  4OX9 M;  2C9C A;  2R4E A;  3L2A A;  3JAM S;  1L2C A;  4NRV A;  3A45 A;  3U6L A;  4GHL A;  5IWA M;  2XZF A;  4LF8 M;  1NHW C;  1I4W A;  1XNQ M;  2LNH C;  2BNK A;  4NSR A;  3NBI A;  2XFT A;  4RF1 A;  4QHT A;  1IXS B;  3K2L A;  4FWG A;  1QQW A;  4X66 M;  5ITR A;  3U5Z B;  4GHA A;  3HHY A;  3EIH A;  3U5Z A;  1XXH A;  3A98 B;  3IG5 A;  5KPR A;  1HNZ M;  4MH0 E;  1KYI A;  4JI2 M;  2QCU A;  3GLF B;  4GC9 A;  3J27 B;  5EP2 A;  2V6Z M;  1X37 A;  2XH9 A;  4REZ A;  2UU9 M;  3KSJ A;  8CAT A;  1HR0 M;  3KW6 A;  1IQP A;  2R45 A;  1TDH A;  2F5N A;  1IXZ A;  4IBC A;  3U6P A;  1L1T A;  4B08 A;  3JR5 A;  4FD2 A;  4JI4 M;  2UXB M;  2X4A A;  4IBG A;  1DO2 A;  3U61 B;  1G4A E;  5EQT A;  3HHW A;  3SAS A;  2KXE A;  2RGH A;  3AFH A;  3AV0 A;  4LF6 M;  2XFS A;  1JR3 D;  2R62 A;  4LRT A;  1TH3 A;  4TUW A;  3GP1 A;  4JI8 M;  1IY2 A;  1KSF X;  1R2Z A;  1FNN A;  4QHS A;  3M0E A;  2FOI C;  4NSO B;  1R2Y A;  3L25 A;  4QNR A;  4A3V B;  2VQE M;  1KFV A;  3VFD A;  2L7I A;  2R4J A;  4NXN M;  1YE9 A;  3FYC A;  4FWH A;  2QP9 X;  3SAT A;  3U61 A;  1JQJ C;  4S12 A;  4DV0 M;  3GLI B;  3UK6 A;  4PCZ A;  4DV5 M;  3VK7 A;  1HNX M;  3KP1 E;  3AOG A;  3CF0 A;  2UXD M;  4L78 A;  3IG8 A;  3U6C A;  2E5L M;  1NHG C;  5GKN A;  2R18 A;  1PJJ A;  2V1U A;  4AQY M;  3AOE C;  1HQC A;  4IJF A;  1E94 E;  5H37 D;  3WHK A;  2DXI A;  1JR3 A;  4GRI A;  2EO2 A;  4HL4 A;  4LF7 M;  4KLN A;  2DWL A;  2RKO A;  4D82 A;  1IN4 A;  4GIP A;  3GLG A;  2OPF A;  1NJF A;  3MK6 A;  3SBJ A;  2XF3 A;  1FJG M;  1SXJ C;  2YNM D;  3CTW B;  4EIW A;  3A46 A;  1IBL M;  4YHH M;  3U6S A;  1TH2 A;  5DNY A;  5BPV A;  4LG2 A;  2NQ8 C;  1MU5 A;  2UXC M;  5FTL A;  2KZS A;  3BOS A;  5FTK A;  2XGN A;  4IIW A;  3DFZ A;  3J2P B;  3AKZ A;  2A5Y B;  1XC8 A;  3D8B A;  2VQF M;  3GRR A;  2CHG A;  3KS4 A;  3AL0 C;  4GKK M;  3HKP A;  1TH4 A;  4W5W A;  5EP1 A;  4QNM A;  3I51 A;  1MX0 A;  3DA1 A;  4NRW A;  4LJ4 A;  4OW0 A;  3PFI A;  4G4N A;  4LJ7 A;  5EXP A;  4DV6 M;  3ZC7 B;  1Q3C A;  2Y21 A;  3SAU A;  4FVM A;  3CF2 A;  2KZU A;  1GKI A;  2QBY B;  1T3T A;  4IBK A;  4XGI A;  3DZD A;  1J09 A;  1IBM M;  4NL4 H;  2DWN A;  4LFA M;  3SYK A;  3AJI B;  4MGI E;  4JYA M;  3FYD A;  5ITX A;  3GPU A;  2FE8 A;  2P5T A;  3TE6 A;  2FNA A;  2BJW A;  2M5Z A;  4X65 M;  5EXT A;  1EE8 A;  1QVR A;  3DOA A;  2UUC M;  1E9S A;  4GMQ A;  4L15 A;  3ZH9 B;  4KO8 A;  3H4M A;  1NNU C;  1XWI A;  3SC3 A;  3FUV A;  5FTM A;  4DV2 M;  3SMS A;  3TPZ A;  5EXX A;  1N33 M;  4LF4 M;  2XSZ A;  1QAO A;  2ZBK B;  2CHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...