4DV5M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv5M02
1N32M 2ZM6M 3T1YM 4JI2M 4LF6M 5ITXA 3VK8A 5FLXS 3U6OA 4YHHM 4JV5M 2UUAM 3U6MA 4DR6M 4DR1M 5BR8M 4DR5M 1PJIA 4X66M 4JI8M 4LF7M 3GQ3A 3GPPA 4DV0M 5ITQA 1I94M 2F5PA 2F5SA 4G4NA 2HKJA 4G4QA 1N33M 3SATA 5ITYA 3U6CA 4OX9M 1N34M 1R2ZA 3OTOM 5A2QS 4G4RA 3SAWA 4JI1M 2UXCM 4DUYM 3T1HM 1XMQM 4JI5M 2UXBM 1Z5CA 3TWLA 1K3XA 1R2YA 5IWAM 1HNXM 4DUZM 2F5QA 1L2CA 3GQ5A 4DR7M 3DOAA 2HHHM 4B3RM 2F4VM 1L2DA 3TWKA 4LF4M 4DR2M 4LF5M 3TWMA 1N36M 2ZBKB 1IBMM 2F5NA 1Z59A 3GPUA 1TDZA 3J80S 3JAMS 3A46A 3SAUA 1HR0M 3U6SA 1Z5AA 4CISA 4B3SM 1PM5A 1PJJA 1XMOM 1Z5BA 2UXDM 2E5LM 1HNZM 2VQFM 3SBJA 4DV7M 5ITTA 3J7AS 4DV3M 2UU9M 1XC8A 1Q39A 3C58A 4LF8M 2OPFA 4DV5M 1NNJA 4DV4M 3U6LA 4JI0M 5ITRA 4DV6M 1MU5A 3GPXA 4DV2M 5ITXE 1FJGM 4LF9M 4K0KM 2XZFA 3U6DA 4ITQA 2VQEM 4NRWA 4B3TM 4PDGA 4GKKM 4NXNM 4JI6M 3A45A 3U6QA 2XZUA 1Q3BA 4DR3M 4PD2A 4X62M 4NXMM 1XNQM 2Q2EB 4PCZA 3SAVA 5LMNM 3A42A 1MX0A 4LFCM 1XNRM 1K3WA 3VK7A 4AQYM 1IBKM 2F5OA 4JI7M 4GKJM 3SASA 1L1ZA 1TDHA 3GPYA 1KFVA 4MB7A 4B3MM 3U6EA 1IBLM 3GP1A 4NRVA 3SARA 1HNWM 4JI3M 3U6PA 4JYAM 2UUCM 4X65M 4DR4M 5ITUA 4KHPM 4X64M 1J5EM 3GQ4A 4DV1M 1EE8A 1K82A 3W0FA 3GO8A 1L1TA 2OQ4A 4YY3M 4JI4M 5IT9S 4PDIA 3J81S 4LFBM 2UUBM 3JR5A 5LMUM 1Q3CA 4LFAM 4G4OA 2EA0A 1L2BA 3JR4A
chains in the Genus database with same CATH superfamily
2CWBA 3E9SA 1N32M 2R46A 4FVMA 4JI2M 4LGMA 5ITXA 3VK8A 5FLXS 3GLFB 4HL4A 2LH0A 2EO2A 2UUAM 4DR6M 1LV7A 1MJGM 2Z8YM 5BR8M 4DR1M 4X66M 1DGGA 4LF7M 1F4IA 2CHQA 2F5SA 1N75A 2HKJA 1TTEA 3U60A 1Q02A 1XHBA 3K9PA 4MGKE 3B7ZA 3FUTA 1QZEA 1CUKA 3TQSA 1QYRA 4OX9M 1N34M 2ZTDA 4G4RA 4IIWA 3SAWA 2VDBB 4DUYM 2XEPA 4LRTA 1XMQM 2UXBM 1Z5CA 1K3XA 3GLGA 1HNXM 1QVRA 5FSWA 3SC3A 5F3WA 2JZ0A 3UZUA 2DKLA 4BB9A 2AHMA 3GQ5A 1NY5A 1C1KA 3E4RA 3FE3A 3C3DA 1XXHE 1L2DA 1VDDA 3DFZA 3QYEA 3FUXA 2DWMA 2Z7JA 3KFUG 3CF0A 4W5WA 4LJ8A 1TDZA 4IBBA 2GNOA 2KA6B 3A46A 2KZSA 3SAUA 5EXXA 3Q8XA 1EFUB 3HHXA 3PNYA 5JI2E 1PM5A 4B3SM 4M0WA 1ZAEA 2DNAA 3FRHA 5KO3A 5EXPA 3KOYE 3HU2A 3SBJA 2O01F 4DV7M 5FTLA 3GLGE 4LZZA 3J7AS 2MGWA 2RKOA 1WHCA 4DV3M 5DNYA 1Q39A 3FUWA 3C58A 1XC8A 4LF8M 4EIWA 3U61B 2OPFA 1NNJA 2JZ1A 3HX3A 2R44A 1BVSA 5E6JA 4UN2B 2R65A 3U6LA 1G41A 3AFHA 5ITRA 1QQWA 3GPXA 2JY5A 3GLIA 1FJGM 3R9XB 1KYIA 1D2NA 4MGIE 3BXWA 1YUBA 4AKIA 4Q7JA 1TH3A 2G5GX 5KQ8A 4ITQA 2QPAA 5EP1A 3FRIA 4IBDA 1DGHB 2DAMA 3LQRA 4AZFA 2R4EA 3FYCA 4X62M 1DGBA 2EJSA 2CV0A 1YE9A 2FFJA 4AKHA 1PJSA 3A42A 1XNRM 2FH0A 1J09A 4M9ZA 1K3WA 3HHWA 3KOZE 1NJGA 4JI7M 2C5RA 2C98A 3KOWE 3IG8A 3IG5A 3TPZA 1QANA 4QNMA 5DYIA 3SASA 3J7BA 2G8LA 2DWZB 2DHYA 2L7HA 1IY0A 4ZPXA 3SARA 2P5TA 3U6PA 1JR3E 4JYAM 3CF2A 3MJ5A 2YQZA 2DHRA 5ITUA 3HY5A 5EP4A 4DV1M 4IBFA 1EE8A 4LRSA 2H1RA 2ZTCA 5KPRA 3GLGB 3M6AA 2O25A 1WJ7A 5JI3E 3AOEC 5IT9S 3J81S 3KDSE 4M0DA 2FE8A 4AI6A 2JXNA 3C9PA 4LG2A 4GC5A 1V92A 1NV8A 2O5RA 4AG6A 3JR4A 1GL7A 2ZM6M 5EP2A 2KHHA 3T1YM 4QHSA 4LF6M 3E21A 2DZNB 3W0LB 3GRRA 2N35A 3QAUA 3QYBA 5KPTA 3SMPA 3GRUA 3VFDA 4DR5M 1SXJB 1JR3A 1PJIA 1E9RA 3FUVA 4WURA 3VDPA 3GLFA 2XH9A 3ZCBB 4GHLA 3HKPA 4FWDA 5ITQA 3RGPA 2VF8A 2FS1A 5DFLA 1FNNA 3SATA 3U6CA 1G8PA 1IY1A 2HCBA 2YR0A 4FCTA 1R2ZA 3OTOM 2UXCM 2KEBA 1I4WA 2D7HA 2NQ8C 2LWXA 2KNAA 3WHKA 3W67A 1R2YA 1WGNA 4L6V6 1NHWC 2VIIA 2WSEF 1ZMUA 1ZQ9A 4NSRA 3SMSA 3VKGA 2DAEA 1L2CA 1KSFX 4B7HA 1QUSA 3DOAA 4WW0A 2K9DA 2L4EA 2X49A 3SHFA 3B7QA 2FOIC 1V33A 1HQCA 2DZOB 2JY8A 1IBMM 2F5NA 1Z59A 1DO2A 2CP8A 2DAGA 4GEWA 4F1IA 4IBIA 3K92A 1IN5A 1NHGC 3U6SA 1X37A 1TR8A 1Z5AA 4BBAA 2LVOC 3T38A 5EXTA 4L15A 3KSXA 3LQQA 2XLJA 1HNZM 4IJFA 4LJ6A 3VDUA 3UMMA 4GH9A 2WSFF 2UU9M 4MM3B 3U5ZB 1QAMA 2J7OA 3AJIB 1E32A 3KP0E 4KO8A 1QDTA 2L09A 4DV5M 3K9OA 4DV4M 4JN6A 1A5TA 4DV6M 1PJQA 3L26A 3KW6A 4DV2M 3ILKA 5C18A 1VDLA 3HZJA 3VLFB 3F92A 2HAKA 4CIZA 7CATA 1V34A 2V1CA 3U6DA 2KNZA 2VQEM 1L8QA 3L28A 2GQFA 1D0MA 1W5TA 4TUWA 1T6OA 2CHGA 4IBEA 4NXNM 1XXHA 1E9SA 4D82A 1TGUA 4LJ4A 2VF7A 4MGYE 1G71A 1Q3BA 3HWSA 4PD2A 3B74A 3M7GA 4NXMM 4P16A 1IXSB 3HJQA 2JNHA 3MK6A 4LY6A 3R8FA 2A5YB 3LVWA 1XB2B 2R4JA 1E94E 2Y0QA 4FD2A 4QNRA 3IHPA 5H37D 1OAOC 2RRUA 3MMPA 3VK7A 4AKGA 3D8LA 1IBKM 1IY2A 3NWLA 3H4MA 3J2PB 4OU7A 1L1ZA 4S12A 3GPYA 4MB7A 1IN8A 1IXZA 3LVVA 3U6EA 4G6ZA 3D8BA 3GP1A 2R45A 4NRVA 1HT2E 1IN4A 1TF0B 3U5ZA 1HNWM 2CEAA 2M60A 4JI3M 1N78A 2UUCM 1J5EM 1OIZA 5FTMA 1K82A 3W0FA 3GO8A 1IFYA 2Y0TA 1R5LA 2ZAMA 1SXJE 2OQ4A 5EJCA 4JI4M 1JB0F 3NBXX 4PDIA 2M5ZA 1UFZA 3NBIA 4IBJA 2BNKA 5LMUM 3THGA 1Q3CA 1Y8GA 5KPZA 1EIJA 1H6UA 4DR7M 2C9CA 1G59A 3FKEA 1TH2A 4L78A 2LTUA 4MGHA 1TH4A 1T3TA 4GC9A 2QBYA 3PXGA 4R3DA 1PJTA 1IM2A 2W82A 4JV5M 1VG5A 2B3TA 1XXHB 1N77A 3UGJA 1GJTA 2DI0A 3DZDA 3EIHA 4JI8M 2RGHA 3RGSA 3GPPA 3K2LA 2XFSA 4WP2A 4B08A 4G4NA 3GLHE 4G4QA 1N33M 2J7NA 2WZJA 4IBKA 4F2LA 1NV9A 1VEGA 2KZUA 4XK8F 1RU3A 3M0EA 5A2QS 2QCUA 4GITA 4JI1M 4REZA 1AIPC 3LW5F 3K1JA 1QDRA 5EP3A 5IWAM 1GABA 1NSFA 4OVZA 4FCVA 2KW0A 4NOOB 1GO5A 4B3RM 1OIPA 4GRIA 4Z8XA 2LHGA 2XSZA 3PVSA 3TWKA 4LF4M 4DR2M 4KODA 2BWBA 2JY6B 4LF5M 1N36M 4LGYA 2X8AA 3RE8A 2DXIA 2QQ8A 3GPUA 2DWNA 2QHOB 1YSYA 3J80S 3JAMS 4ANRA 3RFWA 1PGYA 2LVQD 4XGIA 4CISA 1DGFA 1IXRC 1LTMA 2MR9A 3IECA 1R4GA 1Z5BA 2UXDM 1OJLA 4RNAA 2VQFM 4MH0E 3A98B 5ITTA 2JWSA 4LJ5A 2DVWB 1GVNA 3LCVB 4LCBA 3ZC7B 1WR1B 3AV0A 2BJWA 1NVMA 1NJFA 2DAKA 4FWHA 3L25A 3SYKA 4JI0M 5GKNA 3B89A 3HJ8A 2Y21A 1WGLA 1SXJC 5ITXE 3FTFA 4K0KM 2QZ4A 3FTCA 2CRUA 3CGWA 2DAIA 4D81A 4NRWA 2KRKA 1IN6A 4GKKM 2DZLA 2CHVA 3KS4A 5E26A 2KXEA 1GL6A 1QAOA 1GKIA 2I7PA 2XZUA 4BLCA 1XNQM 3AL0C 4PCZA 2CV1A 3SAVA 2DENA 2OOAA 1MX0A 3E46A 5LMNM 4LFCM 1J7KA 4GMQA 1GLNA 4QOZC 4AQYM 1MN3A 4II7A 3KSJA 2JA2A 1YLAA 1OTRA 1TDHA 1KFVA 5FTKA 1ORYB 4LJ7A 1IBLM 4HLQA 2ZANA 5EQTA 2D7GA 5FTJA 1VEJA 4KHPM 1Z6TA 3HHYA 8CATA 3FTDA 4X64M 1HJPA 1D0KA 1T43A 3HGIA 3Q8GA 3I51A 1NY6A 4OVZB 4KLNA 4PT5A 2XSZD 4YY3M 4L8RC 3L27A 1NNUC 1QUTA 4RF1A 4HEOA 2Z4SA 4LFBM 5C1BA 4R71A 2UUBM 3JR5A 1OKSA 1UM8A 4RF0A 2XGNA 3QWLA 2YFQA 3BOSA 4LFAM 2HWJA 4P17A 4NL4H 2Z4RA 2EA0A 3KOXE 1L2BA 1ZV1A 3TE6A 1ZMWA 2Y20A 3HU3A 3V76A 3B9PA 3FD9A 3KXEC 4R7GA 4OW0A 3U6OA 3K8ZA 3B7NA 4YHHM 2K47A 3U6MA 2R0IA 1DGHA 3UK6A 2YNMD 2K6BA 4QOSA 4GHAA 4LJ9A 1HQYE 2C96A 3EIEA 3GQ3A 4DV0M 1I94M 2L2DA 2F5PA 4Y28F 2OOBA 3L2AA 4I5SA 2K0BX 2KNVA 5EXSA 2EKFA 2OO9A 5ITYA 3GLIB 2JY7A 2RGOA 2ZAOA 4B7GA 2KRUA 3GRVA 1IQPA 4JI5M 3T1HM 3H4JA 3TWLA 5IREB 3GLIE 1HT1E 1WIVA 2LBCA 1P3QQ 4DUZM 2F5QA 1QZMA 2C99A 2LHCA 5L8RF 2D7EA 3HHZA 2I7NA 1G4AE 2HHHM 5BPVA 2F4VM 2BJVA 1VQ1A 1NO1A 1ZMVA 4M9SA 2QNJA 4MGZE 2V6ZM 2J5YA 2JUJA 3TWMA 1OQYA 3GLFE 2X4AA 1XWIA 5DYGA 2ZBKB 3U60B 4KT0F 2MROB 2LVAA 2L6OA 4L16A 3PNVA 4D80A 4IBCA 1HR0M 3AOGA 4IBGA 2MJ5B 2CV2A 3SFZA 1PRBA 2G3QA 2LNHC 2LVPC 1XMOM 1PJJA 1DV0A 3VKHA 2C9OA 2E5LM 3GLHA 2H5XA 1OAIA 3I4VA 3KVWA 2QBYB 2HL7A 4LJAA 2FNAA 2MH8A 1R6BX 2R6FA 1SG9A 3MHVC 2EUCA 4AG5A 2DWLA 3HJSA 1IN7A 1MU5A 3GRYA 2CUZA 3TL4X 3AKZA 5IZ7D 1JR3D 4LF9M 3CF6E 4FWGA 4G3OA 2QSFX 2XZFA 2XF3A 4B3TM 2L7IA 4PDGA 2EKKA 3I4YA 4I81A 1OFHA 1JQJC 3T15A 4RKUF 3A45A 3I01M 3C3EA 3J27B 4A3VB 3U6QA 4DR3M 4CGYB 4JI6M 1GJSA 1W5SA 2Q2EB 2APLA 4CHTB 1SXJA 4GIPA 3PFIA 1S3SA 3CTWB 4DBGB 3L29A 3LCUA 2BWEA 3FYDA 3I04M 3SYLA 3ZQJA 3U61A 4FCWA 1OFIA 2R18A 4JXJA 3KP1E 4QHTA 2F5OA 2ERCA 5FTNA 4CJ6A 3KS8A 1WXQA 3T6PA 4B7FA 3FUUA 4NSOB 2XFTA 4GKJM 2QP9X 4I8OA 5KQDA 3WHLA 4B3MM 3AOEA 4Z6YA 4XBOA 1SXJD 4FW9A 4LZJA 3LMMA 4L4UA 1DO0A 4IJEA 4M9XA 1IXSA 3SHGB 3W68A 3DA1A 2Z3XA 4X65M 1AUAA 1C7YA 4DR4M 3GLHB 3HU1A 2CFOA 2V1UA 4AW4A 3GQ4A 2LVNC 2QENA 2LXEA 2KDLA 4NC6A 1L1TA 2WSCF 1QAQA 3BBZA 2L4FA 4I4LA 1G3IA 1R7RA 3UJNA 3FTEA 2CE7A 3ZH9B 2R62A 2JP7A 1D0LA 4G4OA 1VEKA
chains in the Genus database with same CATH topology
1N32M 3E9SA 2R46A 4FVMA 4JI2M 4LGMA 5ITXA 3VK8A 5FLXS 3GLFB 4HL4A 2LH0A 2EO2A 2UUAM 4DR6M 1LV7A 4DR1M 5BR8M 4X66M 1DGGA 4LF7M 2CHQA 2F5SA 1N75A 2HKJA 3U60A 1XHBA 4MGKE 3FUTA 3TQSA 4OX9M 1QYRA 1N34M 4G4RA 4IIWA 3SAWA 4DUYM 2XEPA 4LRTA 1XMQM 2UXBM 1Z5CA 1K3XA 3GLGA 1HNXM 1QVRA 5FSWA 3SC3A 5F3WA 3UZUA 4BB9A 2AHMA 3GQ5A 1NY5A 1C1KA 3E4RA 1L2DA 1VDDA 3DFZA 2DWMA 3FUXA 2Z7JA 3KFUG 3CF0A 4W5WA 4LJ8A 1TDZA 4IBBA 2KA6B 3A46A 2KZSA 3SAUA 5EXXA 3Q8XA 3HHXA 3PNYA 5JI2E 1PM5A 4B3SM 4M0WA 1ZAEA 5KO3A 5EXPA 3KOYE 3HU2A 3SBJA 4DV7M 5FTLA 4LZZA 3J7AS 2RKOA 4DV3M 5DNYA 1Q39A 3FUWA 3C58A 1XC8A 4LF8M 4EIWA 3U61B 2OPFA 1NNJA 5E6JA 2R65A 3U6LA 1G41A 3AFHA 5ITRA 1QQWA 3GPXA 3GLIA 1FJGM 3R9XB 1KYIA 1D2NA 4MGIE 4AKIA 1YUBA 1TH3A 2G5GX 5KQ8A 4ITQA 2QPAA 5EP1A 4IBDA 1DGHB 3LQRA 4AZFA 2R4EA 3FYCA 4X62M 1DGBA 2CV0A 1YE9A 2FFJA 4AKHA 3A42A 1XNRM 1J09A 4M9ZA 1K3WA 3HHWA 3KOZE 1NJGA 4JI7M 2C5RA 2C98A 3KOWE 3IG8A 3IG5A 3TPZA 1QANA 4QNMA 5DYIA 3SASA 3J7BA 2G8LA 2DWZB 2L7HA 4ZPXA 1IY0A 3SARA 2P5TA 3U6PA 4JYAM 3CF2A 3MJ5A 2YQZA 2DHRA 5ITUA 5EP4A 4DV1M 4IBFA 1EE8A 4LRSA 2H1RA 5KPRA 3GLGB 3M6AA 5JI3E 3AOEC 5IT9S 3J81S 3KDSE 4M0DA 2FE8A 4AI6A 4LG2A 4GC5A 2O5RA 4AG6A 3JR4A 1GL7A 2ZM6M 5EP2A 3T1YM 4QHSA 4LF6M 2DZNB 3W0LB 3GRRA 3QAUA 5KPTA 3SMPA 3GRUA 3VFDA 4DR5M 1SXJB 1JR3A 1PJIA 1E9RA 3FUVA 4WURA 3VDPA 3GLFA 2XH9A 3ZCBB 4GHLA 3HKPA 4FWDA 5ITQA 3RGPA 3SATA 1FNNA 3U6CA 1G8PA 1IY1A 2HCBA 2YR0A 4FCTA 1R2ZA 3OTOM 2UXCM 2KEBA 1I4WA 2D7HA 2NQ8C 2LWXA 3WHKA 1R2YA 1NHWC 2VIIA 1ZQ9A 4NSRA 3SMSA 3VKGA 1L2CA 1KSFX 4B7HA 3DOAA 4WW0A 2X49A 3SHFA 2FOIC 1HQCA 2DZOB 1IBMM 2F5NA 1Z59A 1DO2A 4IBIA 3K92A 1IN5A 1NHGC 3U6SA 1X37A 1Z5AA 4BBAA 3T38A 5EXTA 4L15A 3KSXA 3LQQA 2XLJA 1HNZM 4IJFA 4LJ6A 3VDUA 3UMMA 4GH9A 2UU9M 4MM3B 3U5ZB 1QAMA 2J7OA 3AJIB 1E32A 3KP0E 4KO8A 2L09A 4DV5M 4DV4M 4JN6A 4DV6M 3L26A 3KW6A 4DV2M 3ILKA 5C18A 3VLFB 7CATA 2V1CA 3U6DA 2VQEM 1L8QA 3L28A 1W5TA 4TUWA 2CHGA 4IBEA 4NXNM 1XXHA 1E9SA 4D82A 1TGUA 4LJ4A 4MGYE 1Q3BA 4NXMM 3HWSA 4PD2A 3M7GA 4P16A 1IXSB 3HJQA 3MK6A 4LY6A 3R8FA 2A5YB 3LVWA 2Y0QA 2R4JA 1E94E 4FD2A 4QNRA 5H37D 3VK7A 4AKGA 3D8LA 1IBKM 1IY2A 3NWLA 3H4MA 3J2PB 4OU7A 1L1ZA 4S12A 3GPYA 4MB7A 1IN8A 1IXZA 3LVVA 3U6EA 4G6ZA 3D8BA 3GP1A 2R45A 4NRVA 1HT2E 1IN4A 1HNWM 3U5ZA 2CEAA 2M60A 4JI3M 1N78A 2UUCM 1J5EM 5FTMA 1K82A 3W0FA 3GO8A 2Y0TA 2ZAMA 1SXJE 2OQ4A 5EJCA 4JI4M 4PDIA 2M5ZA 3NBIA 4IBJA 2BNKA 5LMUM 3THGA 1Q3CA 5KPZA 1H6UA 4DR7M 2C9CA 1G59A 3FKEA 1TH2A 4L78A 4MGHA 1TH4A 1T3TA 4GC9A 2QBYA 3PXGA 4R3DA 1IM2A 2W82A 4JV5M 1XXHB 1N77A 3UGJA 3DZDA 3EIHA 4JI8M 2RGHA 3RGSA 3GPPA 3K2LA 2XFSA 4B08A 4G4NA 4G4QA 1N33M 2J7NA 4IBKA 2KZUA 3M0EA 5A2QS 2QCUA 4GITA 4JI1M 4REZA 3K1JA 5EP3A 5IWAM 1NSFA 4OVZA 4FCVA 2KW0A 4NOOB 4B3RM 4GRIA 4Z8XA 2XSZA 3PVSA 3TWKA 4LF4M 4DR2M 4KODA 4LF5M 1N36M 4LGYA 2X8AA 3RE8A 2DXIA 3GPUA 2DWNA 1YSYA 3J80S 3JAMS 3RFWA 4CISA 4XGIA 1DGFA 1IXRC 1Z5BA 2UXDM 1OJLA 4RNAA 2VQFM 4MH0E 3A98B 5ITTA 4LJ5A 2DVWB 1GVNA 3ZC7B 4LCBA 3AV0A 2BJWA 1NVMA 1NJFA 4FWHA 3L25A 3SYKA 4JI0M 5GKNA 3HJ8A 2Y21A 5ITXE 1SXJC 3FTFA 4K0KM 2QZ4A 3FTCA 4D81A 4NRWA 2KRKA 1IN6A 4GKKM 2CHVA 3KS4A 5E26A 2KXEA 1GL6A 1QAOA 1GKIA 2I7PA 2XZUA 4BLCA 1XNQM 3AL0C 4PCZA 2CV1A 3SAVA 5LMNM 4LFCM 1MX0A 1J7KA 4GMQA 1GLNA 4QOZC 4AQYM 4II7A 3KSJA 2JA2A 1TDHA 1KFVA 5FTKA 1ORYB 4LJ7A 1IBLM 4HLQA 2ZANA 5EQTA 2D7GA 5FTJA 4KHPM 1Z6TA 3HHYA 8CATA 3FTDA 4X64M 3HGIA 3I51A 1NY6A 4OVZB 4KLNA 4PT5A 2XSZD 4YY3M 4L8RC 3L27A 1NNUC 4RF1A 2Z4SA 4LFBM 5C1BA 2UUBM 3JR5A 1UM8A 4RF0A 2XGNA 3QWLA 2YFQA 3BOSA 4LFAM 4NL4H 2Z4RA 2EA0A 3KOXE 1L2BA 3TE6A 2Y20A 3HU3A 3B9PA 3FD9A 3KXEC 4R7GA 4OW0A 3U6OA 3K8ZA 4YHHM 2K47A 3U6MA 1DGHA 3UK6A 2YNMD 4QOSA 4GHAA 4LJ9A 1HQYE 2C96A 3EIEA 3GQ3A 4DV0M 1I94M 2F5PA 3L2AA 4I5SA 5EXSA 5ITYA 3GLIB 2ZAOA 2RGOA 4B7GA 2KRUA 3GRVA 1IQPA 4JI5M 3T1HM 3TWLA 5IREB 1HT1E 4DUZM 2F5QA 1QZMA 2C99A 2D7EA 3HHZA 2I7NA 1G4AE 2HHHM 5BPVA 2F4VM 2BJVA 4M9SA 4MGZE 2V6ZM 3TWMA 2X4AA 1XWIA 5DYGA 2ZBKB 3U60B 4D80A 2L6OA 4L16A 3PNVA 4IBCA 1HR0M 3AOGA 4IBGA 2CV2A 3SFZA 1PJJA 2LNHC 1XMOM 3VKHA 2C9OA 2E5LM 3GLHA 3I4VA 3KVWA 2QBYB 2HL7A 4LJAA 2FNAA 1R6BX 3MHVC 2EUCA 4AG5A 2DWLA 3HJSA 1IN7A 1MU5A 3GRYA 2CUZA 3TL4X 3AKZA 5IZ7D 1JR3D 4LF9M 3CF6E 4FWGA 2XZFA 2XF3A 4B3TM 2L7IA 4PDGA 3I4YA 4I81A 1OFHA 1JQJC 3T15A 4JI6M 3A45A 3U6QA 3J27B 4A3VB 4DR3M 4CGYB 1W5SA 2Q2EB 4CHTB 1SXJA 4GIPA 3PFIA 1S3SA 3CTWB 3L29A 3SYLA 3FYDA 3U61A 4FCWA 1OFIA 2R18A 4JXJA 3KP1E 4QHTA 2F5OA 2ERCA 5FTNA 3KS8A 1WXQA 4B7FA 3FUUA 4NSOB 2XFTA 4GKJM 2QP9X 4I8OA 5KQDA 3WHLA 4B3MM 3AOEA 4Z6YA 4XBOA 1SXJD 4FW9A 4LZJA 3LMMA 4L4UA 1DO0A 4IJEA 4M9XA 3SHGB 2Z3XA 3DA1A 4DR4M 4X65M 3GLHB 3HU1A 2CFOA 2V1UA 4AW4A 3GQ4A 2QENA 2LXEA 1L1TA 1QAQA 4I4LA 1G3IA 1R7RA 3UJNA 3FTEA 2CE7A 3ZH9B 2R62A 4G4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 M;  2ZM6 M;  3T1Y M;  4JI2 M;  4LF6 M;  5ITX A;  3VK8 A;  5FLX S;  3U6O A;  4YHH M;  4JV5 M;  2UUA M;  3U6M A;  4DR6 M;  4DR1 M;  5BR8 M;  4DR5 M;  1PJI A;  4X66 M;  4JI8 M;  4LF7 M;  3GQ3 A;  3GPP A;  4DV0 M;  5ITQ A;  1I94 M;  2F5P A;  2F5S A;  4G4N A;  2HKJ A;  4G4Q A;  1N33 M;  3SAT A;  5ITY A;  3U6C A;  4OX9 M;  1N34 M;  1R2Z A;  3OTO M;  5A2Q S;  4G4R A;  3SAW A;  4JI1 M;  2UXC M;  4DUY M;  3T1H M;  1XMQ M;  4JI5 M;  2UXB M;  1Z5C A;  3TWL A;  1K3X A;  1R2Y A;  5IWA M;  1HNX M;  4DUZ M;  2F5Q A;  1L2C A;  3GQ5 A;  4DR7 M;  3DOA A;  2HHH M;  4B3R M;  2F4V M;  1L2D A;  3TWK A;  4LF4 M;  4DR2 M;  4LF5 M;  3TWM A;  1N36 M;  2ZBK B;  1IBM M;  2F5N A;  1Z59 A;  3GPU A;  1TDZ A;  3J80 S;  3JAM S;  3A46 A;  3SAU A;  1HR0 M;  3U6S A;  1Z5A A;  4CIS A;  4B3S M;  1PM5 A;  1PJJ A;  1XMO M;  1Z5B A;  2UXD M;  2E5L M;  1HNZ M;  2VQF M;  3SBJ A;  4DV7 M;  5ITT A;  3J7A S;  4DV3 M;  2UU9 M;  1XC8 A;  1Q39 A;  3C58 A;  4LF8 M;  2OPF A;  4DV5 M;  1NNJ A;  4DV4 M;  3U6L A;  4JI0 M;  5ITR A;  4DV6 M;  1MU5 A;  3GPX A;  4DV2 M;  5ITX E;  1FJG M;  4LF9 M;  4K0K M;  2XZF A;  3U6D A;  4ITQ A;  2VQE M;  4NRW A;  4B3T M;  4PDG A;  4GKK M;  4NXN M;  4JI6 M;  3A45 A;  3U6Q A;  2XZU A;  1Q3B A;  4DR3 M;  4PD2 A;  4X62 M;  4NXM M;  1XNQ M;  2Q2E B;  4PCZ A;  3SAV A;  5LMN M;  3A42 A;  1MX0 A;  4LFC M;  1XNR M;  1K3W A;  3VK7 A;  4AQY M;  1IBK M;  2F5O A;  4JI7 M;  4GKJ M;  3SAS A;  1L1Z A;  1TDH A;  3GPY A;  1KFV A;  4MB7 A;  4B3M M;  3U6E A;  1IBL M;  3GP1 A;  4NRV A;  3SAR A;  1HNW M;  4JI3 M;  3U6P A;  4JYA M;  2UUC M;  4X65 M;  4DR4 M;  5ITU A;  4KHP M;  4X64 M;  1J5E M;  3GQ4 A;  4DV1 M;  1EE8 A;  1K82 A;  3W0F A;  3GO8 A;  1L1T A;  2OQ4 A;  4YY3 M;  4JI4 M;  5IT9 S;  4PDI A;  3J81 S;  4LFB M;  2UUB M;  3JR5 A;  5LMU M;  1Q3C A;  4LFA M;  4G4O A;  2EA0 A;  1L2B A;  3JR4 A; 
#chains in the Genus database with same CATH topology
 2CWB A;  3E9S A;  1N32 M;  2R46 A;  4FVM A;  4JI2 M;  4LGM A;  5ITX A;  3VK8 A;  5FLX S;  3GLF B;  4HL4 A;  2LH0 A;  2EO2 A;  2UUA M;  4DR6 M;  1LV7 A;  1MJG M;  2Z8Y M;  5BR8 M;  4DR1 M;  4X66 M;  1DGG A;  4LF7 M;  1F4I A;  2CHQ A;  2F5S A;  1N75 A;  2HKJ A;  1TTE A;  3U60 A;  1Q02 A;  1XHB A;  3K9P A;  4MGK E;  3B7Z A;  3FUT A;  1QZE A;  1CUK A;  3TQS A;  1QYR A;  4OX9 M;  1N34 M;  2ZTD A;  4G4R A;  4IIW A;  3SAW A;  2VDB B;  4DUY M;  2XEP A;  4LRT A;  1XMQ M;  2UXB M;  1Z5C A;  1K3X A;  3GLG A;  1HNX M;  1QVR A;  5FSW A;  3SC3 A;  5F3W A;  2JZ0 A;  3UZU A;  2DKL A;  4BB9 A;  2AHM A;  3GQ5 A;  1NY5 A;  1C1K A;  3E4R A;  3FE3 A;  3C3D A;  1XXH E;  1L2D A;  1VDD A;  3DFZ A;  3QYE A;  3FUX A;  2DWM A;  2Z7J A;  3KFU G;  3CF0 A;  4W5W A;  4LJ8 A;  1TDZ A;  4IBB A;  2GNO A;  2KA6 B;  3A46 A;  2KZS A;  3SAU A;  5EXX A;  3Q8X A;  1EFU B;  3HHX A;  3PNY A;  5JI2 E;  1PM5 A;  4B3S M;  4M0W A;  1ZAE A;  2DNA A;  3FRH A;  5KO3 A;  5EXP A;  3KOY E;  3HU2 A;  3SBJ A;  2O01 F;  4DV7 M;  5FTL A;  3GLG E;  4LZZ A;  3J7A S;  2MGW A;  2RKO A;  1WHC A;  4DV3 M;  5DNY A;  1Q39 A;  3FUW A;  3C58 A;  1XC8 A;  4LF8 M;  4EIW A;  3U61 B;  2OPF A;  1NNJ A;  2JZ1 A;  3HX3 A;  2R44 A;  1BVS A;  5E6J A;  4UN2 B;  2R65 A;  3U6L A;  1G41 A;  3AFH A;  5ITR A;  1QQW A;  3GPX A;  2JY5 A;  3GLI A;  1FJG M;  3R9X B;  1KYI A;  1D2N A;  4MGI E;  3BXW A;  1YUB A;  4AKI A;  4Q7J A;  1TH3 A;  2G5G X;  5KQ8 A;  4ITQ A;  2QPA A;  5EP1 A;  3FRI A;  4IBD A;  1DGH B;  2DAM A;  3LQR A;  4AZF A;  2R4E A;  3FYC A;  4X62 M;  1DGB A;  2EJS A;  2CV0 A;  1YE9 A;  2FFJ A;  4AKH A;  1PJS A;  3A42 A;  1XNR M;  2FH0 A;  1J09 A;  4M9Z A;  1K3W A;  3HHW A;  3KOZ E;  1NJG A;  4JI7 M;  2C5R A;  2C98 A;  3KOW E;  3IG8 A;  3IG5 A;  3TPZ A;  1QAN A;  4QNM A;  5DYI A;  3SAS A;  3J7B A;  2G8L A;  2DWZ B;  2DHY A;  2L7H A;  1IY0 A;  4ZPX A;  3SAR A;  2P5T A;  3U6P A;  1JR3 E;  4JYA M;  3CF2 A;  3MJ5 A;  2YQZ A;  2DHR A;  5ITU A;  3HY5 A;  5EP4 A;  4DV1 M;  4IBF A;  1EE8 A;  4LRS A;  2H1R A;  2ZTC A;  5KPR A;  3GLG B;  3M6A A;  2O25 A;  1WJ7 A;  5JI3 E;  3AOE C;  5IT9 S;  3J81 S;  3KDS E;  4M0D A;  2FE8 A;  4AI6 A;  2JXN A;  3C9P A;  4LG2 A;  4GC5 A;  1V92 A;  1NV8 A;  2O5R A;  4AG6 A;  3JR4 A;  1GL7 A;  2ZM6 M;  5EP2 A;  2KHH A;  3T1Y M;  4QHS A;  4LF6 M;  3E21 A;  2DZN B;  3W0L B;  3GRR A;  2N35 A;  3QAU A;  3QYB A;  5KPT A;  3SMP A;  3GRU A;  3VFD A;  4DR5 M;  1SXJ B;  1JR3 A;  1PJI A;  1E9R A;  3FUV A;  4WUR A;  3VDP A;  3GLF A;  2XH9 A;  3ZCB B;  4GHL A;  3HKP A;  4FWD A;  5ITQ A;  3RGP A;  2VF8 A;  2FS1 A;  5DFL A;  1FNN A;  3SAT A;  3U6C A;  1G8P A;  1IY1 A;  2HCB A;  2YR0 A;  4FCT A;  1R2Z A;  3OTO M;  2UXC M;  2KEB A;  1I4W A;  2D7H A;  2NQ8 C;  2LWX A;  2KNA A;  3WHK A;  3W67 A;  1R2Y A;  1WGN A;  4L6V 6;  1NHW C;  2VII A;  2WSE F;  1ZMU A;  1ZQ9 A;  4NSR A;  3SMS A;  3VKG A;  2DAE A;  1L2C A;  1KSF X;  4B7H A;  1QUS A;  3DOA A;  4WW0 A;  2K9D A;  2L4E A;  2X49 A;  3SHF A;  3B7Q A;  2FOI C;  1V33 A;  1HQC A;  2DZO B;  2JY8 A;  1IBM M;  2F5N A;  1Z59 A;  1DO2 A;  2CP8 A;  2DAG A;  4GEW A;  4F1I A;  4IBI A;  3K92 A;  1IN5 A;  1NHG C;  3U6S A;  1X37 A;  1TR8 A;  1Z5A A;  4BBA A;  2LVO C;  3T38 A;  5EXT A;  4L15 A;  3KSX A;  3LQQ A;  2XLJ A;  1HNZ M;  4IJF A;  4LJ6 A;  3VDU A;  3UMM A;  4GH9 A;  2WSF F;  2UU9 M;  4MM3 B;  3U5Z B;  1QAM A;  2J7O A;  3AJI B;  1E32 A;  3KP0 E;  4KO8 A;  1QDT A;  2L09 A;  4DV5 M;  3K9O A;  4DV4 M;  4JN6 A;  1A5T A;  4DV6 M;  1PJQ A;  3L26 A;  3KW6 A;  4DV2 M;  3ILK A;  5C18 A;  1VDL A;  3HZJ A;  3VLF B;  3F92 A;  2HAK A;  4CIZ A;  7CAT A;  1V34 A;  2V1C A;  3U6D A;  2KNZ A;  2VQE M;  1L8Q A;  3L28 A;  2GQF A;  1D0M A;  1W5T A;  4TUW A;  1T6O A;  2CHG A;  4IBE A;  4NXN M;  1XXH A;  1E9S A;  4D82 A;  1TGU A;  4LJ4 A;  2VF7 A;  4MGY E;  1G71 A;  1Q3B A;  3HWS A;  4PD2 A;  3B74 A;  3M7G A;  4NXM M;  4P16 A;  1IXS B;  3HJQ A;  2JNH A;  3MK6 A;  4LY6 A;  3R8F A;  2A5Y B;  3LVW A;  1XB2 B;  2R4J A;  1E94 E;  2Y0Q A;  4FD2 A;  4QNR A;  3IHP A;  5H37 D;  1OAO C;  2RRU A;  3MMP A;  3VK7 A;  4AKG A;  3D8L A;  1IBK M;  1IY2 A;  3NWL A;  3H4M A;  3J2P B;  4OU7 A;  1L1Z A;  4S12 A;  3GPY A;  4MB7 A;  1IN8 A;  1IXZ A;  3LVV A;  3U6E A;  4G6Z A;  3D8B A;  3GP1 A;  2R45 A;  4NRV A;  1HT2 E;  1IN4 A;  1TF0 B;  3U5Z A;  1HNW M;  2CEA A;  2M60 A;  4JI3 M;  1N78 A;  2UUC M;  1J5E M;  1OIZ A;  5FTM A;  1K82 A;  3W0F A;  3GO8 A;  1IFY A;  2Y0T A;  1R5L A;  2ZAM A;  1SXJ E;  2OQ4 A;  5EJC A;  4JI4 M;  1JB0 F;  3NBX X;  4PDI A;  2M5Z A;  1UFZ A;  3NBI A;  4IBJ A;  2BNK A;  5LMU M;  3THG A;  1Q3C A;  1Y8G A;  5KPZ A;  1EIJ A;  1H6U A;  4DR7 M;  2C9C A;  1G59 A;  3FKE A;  1TH2 A;  4L78 A;  2LTU A;  4MGH A;  1TH4 A;  1T3T A;  4GC9 A;  2QBY A;  3PXG A;  4R3D A;  1PJT A;  1IM2 A;  2W82 A;  4JV5 M;  1VG5 A;  2B3T A;  1XXH B;  1N77 A;  3UGJ A;  1GJT A;  2DI0 A;  3DZD A;  3EIH A;  4JI8 M;  2RGH A;  3RGS A;  3GPP A;  3K2L A;  2XFS A;  4WP2 A;  4B08 A;  4G4N A;  3GLH E;  4G4Q A;  1N33 M;  2J7N A;  2WZJ A;  4IBK A;  4F2L A;  1NV9 A;  1VEG A;  2KZU A;  4XK8 F;  1RU3 A;  3M0E A;  5A2Q S;  2QCU A;  4GIT A;  4JI1 M;  4REZ A;  1AIP C;  3LW5 F;  3K1J A;  1QDR A;  5EP3 A;  5IWA M;  1GAB A;  1NSF A;  4OVZ A;  4FCV A;  2KW0 A;  4NOO B;  1GO5 A;  4B3R M;  1OIP A;  4GRI A;  4Z8X A;  2LHG A;  2XSZ A;  3PVS A;  3TWK A;  4LF4 M;  4DR2 M;  4KOD A;  2BWB A;  2JY6 B;  4LF5 M;  1N36 M;  4LGY A;  2X8A A;  3RE8 A;  2DXI A;  2QQ8 A;  3GPU A;  2DWN A;  2QHO B;  1YSY A;  3J80 S;  3JAM S;  4ANR A;  3RFW A;  1PGY A;  2LVQ D;  4XGI A;  4CIS A;  1DGF A;  1IXR C;  1LTM A;  2MR9 A;  3IEC A;  1R4G A;  1Z5B A;  2UXD M;  1OJL A;  4RNA A;  2VQF M;  4MH0 E;  3A98 B;  5ITT A;  2JWS A;  4LJ5 A;  2DVW B;  1GVN A;  3LCV B;  4LCB A;  3ZC7 B;  1WR1 B;  3AV0 A;  2BJW A;  1NVM A;  1NJF A;  2DAK A;  4FWH A;  3L25 A;  3SYK A;  4JI0 M;  5GKN A;  3B89 A;  3HJ8 A;  2Y21 A;  1WGL A;  1SXJ C;  5ITX E;  3FTF A;  4K0K M;  2QZ4 A;  3FTC A;  2CRU A;  3CGW A;  2DAI A;  4D81 A;  4NRW A;  2KRK A;  1IN6 A;  4GKK M;  2DZL A;  2CHV A;  3KS4 A;  5E26 A;  2KXE A;  1GL6 A;  1QAO A;  1GKI A;  2I7P A;  2XZU A;  4BLC A;  1XNQ M;  3AL0 C;  4PCZ A;  2CV1 A;  3SAV A;  2DEN A;  2OOA A;  1MX0 A;  3E46 A;  5LMN M;  4LFC M;  1J7K A;  4GMQ A;  1GLN A;  4QOZ C;  4AQY M;  1MN3 A;  4II7 A;  3KSJ A;  2JA2 A;  1YLA A;  1OTR A;  1TDH A;  1KFV A;  5FTK A;  1ORY B;  4LJ7 A;  1IBL M;  4HLQ A;  2ZAN A;  5EQT A;  2D7G A;  5FTJ A;  1VEJ A;  4KHP M;  1Z6T A;  3HHY A;  8CAT A;  3FTD A;  4X64 M;  1HJP A;  1D0K A;  1T43 A;  3HGI A;  3Q8G A;  3I51 A;  1NY6 A;  4OVZ B;  4KLN A;  4PT5 A;  2XSZ D;  4YY3 M;  4L8R C;  3L27 A;  1NNU C;  1QUT A;  4RF1 A;  4HEO A;  2Z4S A;  4LFB M;  5C1B A;  4R71 A;  2UUB M;  3JR5 A;  1OKS A;  1UM8 A;  4RF0 A;  2XGN A;  3QWL A;  2YFQ A;  3BOS A;  4LFA M;  2HWJ A;  4P17 A;  4NL4 H;  2Z4R A;  2EA0 A;  3KOX E;  1L2B A;  1ZV1 A;  3TE6 A;  1ZMW A;  2Y20 A;  3HU3 A;  3V76 A;  3B9P A;  3FD9 A;  3KXE C;  4R7G A;  4OW0 A;  3U6O A;  3K8Z A;  3B7N A;  4YHH M;  2K47 A;  3U6M A;  2R0I A;  1DGH A;  3UK6 A;  2YNM D;  2K6B A;  4QOS A;  4GHA A;  4LJ9 A;  1HQY E;  2C96 A;  3EIE A;  3GQ3 A;  4DV0 M;  1I94 M;  2L2D A;  2F5P A;  4Y28 F;  2OOB A;  3L2A A;  4I5S A;  2K0B X;  2KNV A;  5EXS A;  2EKF A;  2OO9 A;  5ITY A;  3GLI B;  2JY7 A;  2RGO A;  2ZAO A;  4B7G A;  2KRU A;  3GRV A;  1IQP A;  4JI5 M;  3T1H M;  3H4J A;  3TWL A;  5IRE B;  3GLI E;  1HT1 E;  1WIV A;  2LBC A;  1P3Q Q;  4DUZ M;  2F5Q A;  1QZM A;  2C99 A;  2LHC A;  5L8R F;  2D7E A;  3HHZ A;  2I7N A;  1G4A E;  2HHH M;  5BPV A;  2F4V M;  2BJV A;  1VQ1 A;  1NO1 A;  1ZMV A;  4M9S A;  2QNJ A;  4MGZ E;  2V6Z M;  2J5Y A;  2JUJ A;  3TWM A;  1OQY A;  3GLF E;  2X4A A;  1XWI A;  5DYG A;  2ZBK B;  3U60 B;  4KT0 F;  2MRO B;  2LVA A;  2L6O A;  4L16 A;  3PNV A;  4D80 A;  4IBC A;  1HR0 M;  3AOG A;  4IBG A;  2MJ5 B;  2CV2 A;  3SFZ A;  1PRB A;  2G3Q A;  2LNH C;  2LVP C;  1XMO M;  1PJJ A;  1DV0 A;  3VKH A;  2C9O A;  2E5L M;  3GLH A;  2H5X A;  1OAI A;  3I4V A;  3KVW A;  2QBY B;  2HL7 A;  4LJA A;  2FNA A;  2MH8 A;  1R6B X;  2R6F A;  1SG9 A;  3MHV C;  2EUC A;  4AG5 A;  2DWL A;  3HJS A;  1IN7 A;  1MU5 A;  3GRY A;  2CUZ A;  3TL4 X;  3AKZ A;  5IZ7 D;  1JR3 D;  4LF9 M;  3CF6 E;  4FWG A;  4G3O A;  2QSF X;  2XZF A;  2XF3 A;  4B3T M;  2L7I A;  4PDG A;  2EKK A;  3I4Y A;  4I81 A;  1OFH A;  1JQJ C;  3T15 A;  4RKU F;  3A45 A;  3I01 M;  3C3E A;  3J27 B;  4A3V B;  3U6Q A;  4DR3 M;  4CGY B;  4JI6 M;  1GJS A;  1W5S A;  2Q2E B;  2APL A;  4CHT B;  1SXJ A;  4GIP A;  3PFI A;  1S3S A;  3CTW B;  4DBG B;  3L29 A;  3LCU A;  2BWE A;  3FYD A;  3I04 M;  3SYL A;  3ZQJ A;  3U61 A;  4FCW A;  1OFI A;  2R18 A;  4JXJ A;  3KP1 E;  4QHT A;  2F5O A;  2ERC A;  5FTN A;  4CJ6 A;  3KS8 A;  1WXQ A;  3T6P A;  4B7F A;  3FUU A;  4NSO B;  2XFT A;  4GKJ M;  2QP9 X;  4I8O A;  5KQD A;  3WHL A;  4B3M M;  3AOE A;  4Z6Y A;  4XBO A;  1SXJ D;  4FW9 A;  4LZJ A;  3LMM A;  4L4U A;  1DO0 A;  4IJE A;  4M9X A;  1IXS A;  3SHG B;  3W68 A;  3DA1 A;  2Z3X A;  4X65 M;  1AUA A;  1C7Y A;  4DR4 M;  3GLH B;  3HU1 A;  2CFO A;  2V1U A;  4AW4 A;  3GQ4 A;  2LVN C;  2QEN A;  2LXE A;  2KDL A;  4NC6 A;  1L1T A;  2WSC F;  1QAQ A;  3BBZ A;  2L4F A;  4I4L A;  1G3I A;  1R7R A;  3UJN A;  3FTE A;  2CE7 A;  3ZH9 B;  2R62 A;  2JP7 A;  1D0L A;  4G4O A;  1VEK A; 
#chains in the Genus database with same CATH homology
 1N32 M;  3E9S A;  2R46 A;  4FVM A;  4JI2 M;  4LGM A;  5ITX A;  3VK8 A;  5FLX S;  3GLF B;  4HL4 A;  2LH0 A;  2EO2 A;  2UUA M;  4DR6 M;  1LV7 A;  4DR1 M;  5BR8 M;  4X66 M;  1DGG A;  4LF7 M;  2CHQ A;  2F5S A;  1N75 A;  2HKJ A;  3U60 A;  1XHB A;  4MGK E;  3FUT A;  3TQS A;  4OX9 M;  1QYR A;  1N34 M;  4G4R A;  4IIW A;  3SAW A;  4DUY M;  2XEP A;  4LRT A;  1XMQ M;  2UXB M;  1Z5C A;  1K3X A;  3GLG A;  1HNX M;  1QVR A;  5FSW A;  3SC3 A;  5F3W A;  3UZU A;  4BB9 A;  2AHM A;  3GQ5 A;  1NY5 A;  1C1K A;  3E4R A;  1L2D A;  1VDD A;  3DFZ A;  2DWM A;  3FUX A;  2Z7J A;  3KFU G;  3CF0 A;  4W5W A;  4LJ8 A;  1TDZ A;  4IBB A;  2KA6 B;  3A46 A;  2KZS A;  3SAU A;  5EXX A;  3Q8X A;  3HHX A;  3PNY A;  5JI2 E;  1PM5 A;  4B3S M;  4M0W A;  1ZAE A;  5KO3 A;  5EXP A;  3KOY E;  3HU2 A;  3SBJ A;  4DV7 M;  5FTL A;  4LZZ A;  3J7A S;  2RKO A;  4DV3 M;  5DNY A;  1Q39 A;  3FUW A;  3C58 A;  1XC8 A;  4LF8 M;  4EIW A;  3U61 B;  2OPF A;  1NNJ A;  5E6J A;  2R65 A;  3U6L A;  1G41 A;  3AFH A;  5ITR A;  1QQW A;  3GPX A;  3GLI A;  1FJG M;  3R9X B;  1KYI A;  1D2N A;  4MGI E;  4AKI A;  1YUB A;  1TH3 A;  2G5G X;  5KQ8 A;  4ITQ A;  2QPA A;  5EP1 A;  4IBD A;  1DGH B;  3LQR A;  4AZF A;  2R4E A;  3FYC A;  4X62 M;  1DGB A;  2CV0 A;  1YE9 A;  2FFJ A;  4AKH A;  3A42 A;  1XNR M;  1J09 A;  4M9Z A;  1K3W A;  3HHW A;  3KOZ E;  1NJG A;  4JI7 M;  2C5R A;  2C98 A;  3KOW E;  3IG8 A;  3IG5 A;  3TPZ A;  1QAN A;  4QNM A;  5DYI A;  3SAS A;  3J7B A;  2G8L A;  2DWZ B;  2L7H A;  4ZPX A;  1IY0 A;  3SAR A;  2P5T A;  3U6P A;  4JYA M;  3CF2 A;  3MJ5 A;  2YQZ A;  2DHR A;  5ITU A;  5EP4 A;  4DV1 M;  4IBF A;  1EE8 A;  4LRS A;  2H1R A;  5KPR A;  3GLG B;  3M6A A;  5JI3 E;  3AOE C;  5IT9 S;  3J81 S;  3KDS E;  4M0D A;  2FE8 A;  4AI6 A;  4LG2 A;  4GC5 A;  2O5R A;  4AG6 A;  3JR4 A;  1GL7 A;  2ZM6 M;  5EP2 A;  3T1Y M;  4QHS A;  4LF6 M;  2DZN B;  3W0L B;  3GRR A;  3QAU A;  5KPT A;  3SMP A;  3GRU A;  3VFD A;  4DR5 M;  1SXJ B;  1JR3 A;  1PJI A;  1E9R A;  3FUV A;  4WUR A;  3VDP A;  3GLF A;  2XH9 A;  3ZCB B;  4GHL A;  3HKP A;  4FWD A;  5ITQ A;  3RGP A;  3SAT A;  1FNN A;  3U6C A;  1G8P A;  1IY1 A;  2HCB A;  2YR0 A;  4FCT A;  1R2Z A;  3OTO M;  2UXC M;  2KEB A;  1I4W A;  2D7H A;  2NQ8 C;  2LWX A;  3WHK A;  1R2Y A;  1NHW C;  2VII A;  1ZQ9 A;  4NSR A;  3SMS A;  3VKG A;  1L2C A;  1KSF X;  4B7H A;  3DOA A;  4WW0 A;  2X49 A;  3SHF A;  2FOI C;  1HQC A;  2DZO B;  1IBM M;  2F5N A;  1Z59 A;  1DO2 A;  4IBI A;  3K92 A;  1IN5 A;  1NHG C;  3U6S A;  1X37 A;  1Z5A A;  4BBA A;  3T38 A;  5EXT A;  4L15 A;  3KSX A;  3LQQ A;  2XLJ A;  1HNZ M;  4IJF A;  4LJ6 A;  3VDU A;  3UMM A;  4GH9 A;  2UU9 M;  4MM3 B;  3U5Z B;  1QAM A;  2J7O A;  3AJI B;  1E32 A;  3KP0 E;  4KO8 A;  2L09 A;  4DV5 M;  4DV4 M;  4JN6 A;  4DV6 M;  3L26 A;  3KW6 A;  4DV2 M;  3ILK A;  5C18 A;  3VLF B;  7CAT A;  2V1C A;  3U6D A;  2VQE M;  1L8Q A;  3L28 A;  1W5T A;  4TUW A;  2CHG A;  4IBE A;  4NXN M;  1XXH A;  1E9S A;  4D82 A;  1TGU A;  4LJ4 A;  4MGY E;  1Q3B A;  4NXM M;  3HWS A;  4PD2 A;  3M7G A;  4P16 A;  1IXS B;  3HJQ A;  3MK6 A;  4LY6 A;  3R8F A;  2A5Y B;  3LVW A;  2Y0Q A;  2R4J A;  1E94 E;  4FD2 A;  4QNR A;  5H37 D;  3VK7 A;  4AKG A;  3D8L A;  1IBK M;  1IY2 A;  3NWL A;  3H4M A;  3J2P B;  4OU7 A;  1L1Z A;  4S12 A;  3GPY A;  4MB7 A;  1IN8 A;  1IXZ A;  3LVV A;  3U6E A;  4G6Z A;  3D8B A;  3GP1 A;  2R45 A;  4NRV A;  1HT2 E;  1IN4 A;  1HNW M;  3U5Z A;  2CEA A;  2M60 A;  4JI3 M;  1N78 A;  2UUC M;  1J5E M;  5FTM A;  1K82 A;  3W0F A;  3GO8 A;  2Y0T A;  2ZAM A;  1SXJ E;  2OQ4 A;  5EJC A;  4JI4 M;  4PDI A;  2M5Z A;  3NBI A;  4IBJ A;  2BNK A;  5LMU M;  3THG A;  1Q3C A;  5KPZ A;  1H6U A;  4DR7 M;  2C9C A;  1G59 A;  3FKE A;  1TH2 A;  4L78 A;  4MGH A;  1TH4 A;  1T3T A;  4GC9 A;  2QBY A;  3PXG A;  4R3D A;  1IM2 A;  2W82 A;  4JV5 M;  1XXH B;  1N77 A;  3UGJ A;  3DZD A;  3EIH A;  4JI8 M;  2RGH A;  3RGS A;  3GPP A;  3K2L A;  2XFS A;  4B08 A;  4G4N A;  4G4Q A;  1N33 M;  2J7N A;  4IBK A;  2KZU A;  3M0E A;  5A2Q S;  2QCU A;  4GIT A;  4JI1 M;  4REZ A;  3K1J A;  5EP3 A;  5IWA M;  1NSF A;  4OVZ A;  4FCV A;  2KW0 A;  4NOO B;  4B3R M;  4GRI A;  4Z8X A;  2XSZ A;  3PVS A;  3TWK A;  4LF4 M;  4DR2 M;  4KOD A;  4LF5 M;  1N36 M;  4LGY A;  2X8A A;  3RE8 A;  2DXI A;  3GPU A;  2DWN A;  1YSY A;  3J80 S;  3JAM S;  3RFW A;  4CIS A;  4XGI A;  1DGF A;  1IXR C;  1Z5B A;  2UXD M;  1OJL A;  4RNA A;  2VQF M;  4MH0 E;  3A98 B;  5ITT A;  4LJ5 A;  2DVW B;  1GVN A;  3ZC7 B;  4LCB A;  3AV0 A;  2BJW A;  1NVM A;  1NJF A;  4FWH A;  3L25 A;  3SYK A;  4JI0 M;  5GKN A;  3HJ8 A;  2Y21 A;  5ITX E;  1SXJ C;  3FTF A;  4K0K M;  2QZ4 A;  3FTC A;  4D81 A;  4NRW A;  2KRK A;  1IN6 A;  4GKK M;  2CHV A;  3KS4 A;  5E26 A;  2KXE A;  1GL6 A;  1QAO A;  1GKI A;  2I7P A;  2XZU A;  4BLC A;  1XNQ M;  3AL0 C;  4PCZ A;  2CV1 A;  3SAV A;  5LMN M;  4LFC M;  1MX0 A;  1J7K A;  4GMQ A;  1GLN A;  4QOZ C;  4AQY M;  4II7 A;  3KSJ A;  2JA2 A;  1TDH A;  1KFV A;  5FTK A;  1ORY B;  4LJ7 A;  1IBL M;  4HLQ A;  2ZAN A;  5EQT A;  2D7G A;  5FTJ A;  4KHP M;  1Z6T A;  3HHY A;  8CAT A;  3FTD A;  4X64 M;  3HGI A;  3I51 A;  1NY6 A;  4OVZ B;  4KLN A;  4PT5 A;  2XSZ D;  4YY3 M;  4L8R C;  3L27 A;  1NNU C;  4RF1 A;  2Z4S A;  4LFB M;  5C1B A;  2UUB M;  3JR5 A;  1UM8 A;  4RF0 A;  2XGN A;  3QWL A;  2YFQ A;  3BOS A;  4LFA M;  4NL4 H;  2Z4R A;  2EA0 A;  3KOX E;  1L2B A;  3TE6 A;  2Y20 A;  3HU3 A;  3B9P A;  3FD9 A;  3KXE C;  4R7G A;  4OW0 A;  3U6O A;  3K8Z A;  4YHH M;  2K47 A;  3U6M A;  1DGH A;  3UK6 A;  2YNM D;  4QOS A;  4GHA A;  4LJ9 A;  1HQY E;  2C96 A;  3EIE A;  3GQ3 A;  4DV0 M;  1I94 M;  2F5P A;  3L2A A;  4I5S A;  5EXS A;  5ITY A;  3GLI B;  2ZAO A;  2RGO A;  4B7G A;  2KRU A;  3GRV A;  1IQP A;  4JI5 M;  3T1H M;  3TWL A;  5IRE B;  1HT1 E;  4DUZ M;  2F5Q A;  1QZM A;  2C99 A;  2D7E A;  3HHZ A;  2I7N A;  1G4A E;  2HHH M;  5BPV A;  2F4V M;  2BJV A;  4M9S A;  4MGZ E;  2V6Z M;  3TWM A;  2X4A A;  1XWI A;  5DYG A;  2ZBK B;  3U60 B;  4D80 A;  2L6O A;  4L16 A;  3PNV A;  4IBC A;  1HR0 M;  3AOG A;  4IBG A;  2CV2 A;  3SFZ A;  1PJJ A;  2LNH C;  1XMO M;  3VKH A;  2C9O A;  2E5L M;  3GLH A;  3I4V A;  3KVW A;  2QBY B;  2HL7 A;  4LJA A;  2FNA A;  1R6B X;  3MHV C;  2EUC A;  4AG5 A;  2DWL A;  3HJS A;  1IN7 A;  1MU5 A;  3GRY A;  2CUZ A;  3TL4 X;  3AKZ A;  5IZ7 D;  1JR3 D;  4LF9 M;  3CF6 E;  4FWG A;  2XZF A;  2XF3 A;  4B3T M;  2L7I A;  4PDG A;  3I4Y A;  4I81 A;  1OFH A;  1JQJ C;  3T15 A;  4JI6 M;  3A45 A;  3U6Q A;  3J27 B;  4A3V B;  4DR3 M;  4CGY B;  1W5S A;  2Q2E B;  4CHT B;  1SXJ A;  4GIP A;  3PFI A;  1S3S A;  3CTW B;  3L29 A;  3SYL A;  3FYD A;  3U61 A;  4FCW A;  1OFI A;  2R18 A;  4JXJ A;  3KP1 E;  4QHT A;  2F5O A;  2ERC A;  5FTN A;  3KS8 A;  1WXQ A;  4B7F A;  3FUU A;  4NSO B;  2XFT A;  4GKJ M;  2QP9 X;  4I8O A;  5KQD A;  3WHL A;  4B3M M;  3AOE A;  4Z6Y A;  4XBO A;  1SXJ D;  4FW9 A;  4LZJ A;  3LMM A;  4L4U A;  1DO0 A;  4IJE A;  4M9X A;  3SHG B;  2Z3X A;  3DA1 A;  4DR4 M;  4X65 M;  3GLH B;  3HU1 A;  2CFO A;  2V1U A;  4AW4 A;  3GQ4 A;  2QEN A;  2LXE A;  1L1T A;  1QAQ A;  4I4L A;  1G3I A;  1R7R A;  3UJN A;  3FTE A;  2CE7 A;  3ZH9 B;  2R62 A;  4G4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...