4OU7A

Crystal structure of dnat84-153-dt10 ssdna complex reveals a novel single-stranded dna binding mode
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
VPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of DnaT84-153-dT10 ssDNA complex reveals a novel single-stranded DNA binding mode.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
molecule keywords Primosomal protein 1
total genus 19
structure length 71
sequence length 71
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1180 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ou7A00
4OU7A
chains in the Genus database with same CATH superfamily
1K3WA 1S3SA 3AOEA 1MX0A 2VDBB 4M9SA 2LVOC 3W0FA 4F1IA 2EKKA 2QCUA 4B7HA 3SBJA 1R2ZA 1SG9A 1QYRA 2K9DA 1W5SA 3U6MA 2Z4SA 3KSXA 4FCVA 4L4UA 1QANA 3QAUA 4QNMA 3GLFE 3W67A 4NSOB 1GJSA 2FE8A 1I4WA 1XB2B 1L2BA 3SHGB 2J7OA 1ZMWA 2O01F 2LVQD 2OPFA 4LF8M 3SYLA 1IXSA 2CEAA 1HT2E 2XSZD 4UN2B 1QAMA 3AKZA 2XZUA 5IZ7D 3LMMA 4M0DA 3GPYA 1HJPA 2C99A 2R62A 4NL4H 2DI0A 2CP8A 2R18A 5EJCA 2CUZA 3HZJA 3GLGB 1HNZM 3L28A 4LF7M 4LCBA 3HHYA 4JI1M 4JI6M 5C1BA 1GL7A 4OVZA 3I01M 4PDIA 3TWMA 3BBZA 3VLFB 4DUYM 4M9XA 1OFIA 4X66M 3FD9A 2BWBA 4JI8M 1QDRA 5EP3A 3KOWE 1XNRM 2HCBA 3FUUA 3U61B 1IFYA 2UUBM 3AOGA 1HQYE 2C98A 1EFUB 2I7NA 4LGYA 4D82A 1BVSA 2LBCA 3DFZA 1YSYA 2WSCF 4JI2M 2DHYA 2X49A 1GO5A 3SMSA 2QP9X 2CRUA 1L2DA 4DR2M 4FD2A 1NJFA 2L4FA 3I51A 4HLQA 1TR8A 1VDLA 2QPAA 2W82A 4IBDA 4MGIE 3TPZA 2JZ1A 2XFSA 1N77A 2JY6B 4OW0A 4X62M 1WGLA 3A45A 2X8AA 3RGPA 2YFQA 1NVMA 3U6LA 3K1JA 3FUWA 2Z4RA 3J80S 1JR3E 2M60A 3KVWA 2XGNA 3RE8A 3QYEA 5A2QS 4JI3M 2G5GX 2J7NA 3E9SA 2ZTCA 5FTNA 5ITXA 1NNUC 4HEOA 2Z3XA 3VFDA 2KNVA 2DWZB 2JNHA 4QHSA 5DFLA 3U6PA 1K3XA 3D8LA 4R3DA 4JI5M 2CHGA 3PNVA 3GP1A 4G4RA 3ZH9B 4GKJM 1GJTA 2KA6B 3VKGA 1X37A 1PJIA 2L09A 3J7AS 1KSFX 5EXSA 2JY5A 1JB0F 2JA2A 4D80A 1XXHB 1QVRA 4G4OA 3SAVA 1PGYA 4I4LA 1IXZA 4R7GA 4G6ZA 1Q39A 4QHTA 2BWEA 8CATA 2UXBM 3T1YM 1IBMM 1QAOA 2FNAA 3LW5F 1HNXM 1OJLA 5L8RF 5FTLA 4DV0M 1J7KA 3SARA 2CFOA 3KSJA 3HU2A 3KDSE 4LF5M 2Y0QA 3KS8A 3JR4A 1W5TA 1WXQA 2R44A 3FUXA 1XHBA 2D7EA 1IN5A 2GQFA 5F3WA 3B9PA 4AKHA 3MK6A 4BB9A 3I04M 4JI4M 3B7NA 3TE6A 1NNJA 1DGGA 3UK6A 3KS4A 1LV7A 3CF0A 4RNAA 3IHPA 3UMMA 2F5OA 4CISA 1IN7A 1FNNA 4XK8F 3HJSA 5GKNA 3RGSA 3WHKA 3R8FA 1PJQA 1OQYA 1N32M 5BR8M 3K2LA 4QOZC 4DV4M 3KXEC 1VG5A 2B3TA 3I4YA 4LJ6A 2KZUA 2LH0A 1Q3BA 2LHCA 2R46A 3AJIB 1XNQM 4Y28F 4NXMM 1V34A 3E4RA 3GLFB 1F4IA 3C3EA 2OOAA 2MJ5B 2LVAA 1PJTA 4NRVA 3IG5A 1RU3A 3GQ5A 1IXSB 4FCWA 3W0LB 3U6DA 2K0BX 1MJGM 2WSEF 3SFZA 1QUSA 2R0IA 3FUTA 3IG8A 4DR1M 2R45A 2R6FA 4W5WA 3Q8XA 3KP0E 3M6AA 3SASA 2EUCA 1IN8A 3J81S 2XEPA 2DXIA 3U5ZB 3LCUA 3FTFA 1IY0A 1QZMA 1N75A 2JXNA 2JZ0A 3KP1E 2APLA 3BXWA 4I81A 4R71A 3GQ4A 4OVZB 2KXEA 4MB7A 3PVSA 4B3MM 2RGOA 2EA0A 2A5YB 3FRIA 2MGWA 3OTOM 2Z8YM 4DV3M 5KQDA 2L2DA 4LJ9A 2VF7A 1YUBA 1WJ7A 2EJSA 3VDPA 5IT9S 1JR3D 2WZJA 3J27B 3QYBA 3HHZA 2Y0TA 4FWDA 1L1ZA 5IWAM 5ITXE 1JQJC 1L2CA 1V92A 1AUAA 2KEBA 3FUVA 4KO8A 3B7QA 5FTMA 2J5YA 1MU5A 4IBFA 3AFHA 1GABA 1DV0A 2K6BA 2VQFM 1VEGA 1FJGM 1SXJD 4L78A 4GHAA 1J09A 4IBIA 3HX3A 4NOOB 1GKIA 2UU9M 3L25A 4IBJA 3K9PA 2QHOB 2QSFX 1XMOM 3A46A 4GC5A 5JI3E 1N36M 4LZZA 1XWIA 4JI0M 3U6EA 4KHPM 4GRIA 1Q02A 4K0KM 4FWHA 3B7ZA 1OKSA 4Q7JA 4G4QA 2XZFA 2RRUA 1PJJA 3B89A 1OIPA 2P5TA 2ZANA 4MGZE 1Z5CA 4NRWA 4DR7M 3CF2A 4PCZA 2EKFA 5KPZA 1KYIA 1H6UA 2R65A 1VEKA 5BPVA 4AQYM 2KDLA 3U6QA 4GITA 5ITRA 1N34M 3NBXX 1K82A 5KPTA 3IECA 5DNYA 1Z59A 2YNMD 1NHGC 3CTWB 2HKJA 1OFHA 5JI2E 4CJ6A 2KNZA 2OOBA 1XC8A 1VEJA 3PFIA 1J5EM 4B7GA 1NHWC 5FLXS 3E46A 2DWLA 2UUCM 1EE8A 1HT1E 1I94M 4FW9A 4YY3M 3SC3A 3KOXE 2DNAA 3SHFA 2BJVA 3LCVB 3FKEA 5ITTA 2XLJA 1ZV1A 5EXPA 4L8RC 1L1TA 4M0WA 3LVWA 3K8ZA 2QZ4A 5DYIA 1G3IA 3GLHB 3GRRA 2DKLA 3PNYA 3A42A 4L6V6 2QNJA 4AW4A 4PDGA 2JWSA 1IY2A 1PJSA 3UZUA 3GPXA 5E26A 2GNOA 2KNAA 4G3OA 2DHRA 4M9ZA 4AG6A 5ITYA 1NV9A 3HWSA 3SAWA 4IBCA 2L6OA 4GC9A 3AV0A 4OU7A 1NJGA 4IBGA 3GLFA 3VK8A 2CV0A 4EIWA 2CV2A 3GQ3A 1QQWA 2LTUA 4P16A 4JI7M 1DGHA 4B3SM 2WSFF 5FTJA 3GLHE 1NV8A 1CUKA 1GVNA 1TDZA 1IBLM 3L26A 1D2NA 2MR9A 4DV5M 2LXEA 3GO8A 5FSWA 3FYDA 2Y20A 2F5SA 2AHMA 4DUZM 1Z5BA 1HQCA 1TH2A 4DV7M 4B3TM 3D8BA 2HAKA 4ANRA 1C1KA 3TWKA 3U5ZA 3GRUA 3L2AA 2R4EA 4LJ4A 3WHLA 4DR5M 1TH4A 3GRYA 1Z5AA 3K92A 4LRSA 1OTRA 2KW0A 1G8PA 3C3DA 3TWLA 4F2LA 4FCTA 3ZCBB 1Y8GA 4XBOA 2G8LA 2OO9A 2JP7A 1WIVA 1R6BX 2G3QA 3H4MA 1ZAEA 3HHXA 2ZAOA 3HJQA 2C96A 3LVVA 3L29A 4LJ5A 4GEWA 4MGYE 4LFAM 3W68A 2VF8A 3FTCA 2DAKA 3HHWA 1N78A 3J7BA 4QOSA 3B74A 1E94E 5KPRA 1G41A 3AOEC 1C7YA 3LQQA 1SXJB 5EXTA 1SXJC 2C9CA 3F92A 2YR0A 1R5LA 2DZOB 4QNRA 3U6SA 4LFBM 4LJAA 2H1RA 2QBYA 4LZJA 1DO2A 4L15A 4LJ8A 2D7GA 1AIPC 4DV2M 2JUJA 4WURA 3NBIA 3PXGA 4LF4M 1PRBA 4DR6M 2FOIC 2XSZA 2LVNC 5C18A 3K9OA 3T6PA 1R4GA 2HL7A 2LWXA 4G4NA 4GIPA 4LFCM 4KODA 3CGWA 4I8OA 4DR3M 4OX9M 1QUTA 4JN6A 3T38A 4FWGA 3MMPA 1IN6A 4MM3B 3C58A 3MHVC 4IIWA 4HL4A 3GLIE 3HJ8A 5DYGA 3FRHA 1IBKM 3ZQJA 2DWMA 4JXJA 2F4VM 1TTEA 2FS1A 3FTDA 1PM5A 1OAOC 3J2PB 4GH9A 1TH3A 3FE3A 4A3VB 4Z6YA 1G59A 1L8QA 2NQ8C 4LF6M 1WGNA 4GMQA 2N35A 1T6OA 3ZC7B 1UM8A 2DWNA 4RF1A 4P17A 3GPUA 3U6CA 3H4JA 1N33M 2I7PA 2QQ8A 1A5TA 1ZMUA 2XH9A 2O25A 1QZEA 4LRTA 3U60A 3GLIA 3NWLA 1GLNA 2HWJA 2X4AA 1WHCA 3RFWA 1NY6A 2JY7A 3THGA 1IQPA 1R2YA 4ITQA 2CHVA 1YLAA 1D0LA 2C5RA 5KQ8A 3FYCA 1QDTA 3TQSA 3GLHA 2ZAMA 3FTEA 3AL0C 3BOSA 3SAUA 4IJEA 2UXDM 3MJ5A 2L7IA 3DOAA 5IREB 5LMUM 2V1CA 1MN3A 4IBKA 1IM2A 4BBAA 4I5SA 1E9RA 4AI6A 2V6ZM 3KOYE 1XMQM 3TL4X 5EXXA 3GLGE 3QWLA 1DGFA 4BLCA 3GPPA 2Z7JA 2UUAM 5LMNM 2ZTDA 2O5RA 4DR4M 1TGUA 1HR0M 1DGHB 1UFZA 2KRUA 3KFUG 4YHHM 4DV1M 2LHGA 2YQZA 4NSRA 2R4JA 4NC6A 1WR1B 2L4EA 3LQRA 4PT5A 2C9OA 4IBBA 4RF0A 2CWBA 5E6JA 2CV1A 4REZA 3VKHA 2DAGA 2KRKA 3GRVA 1ZMVA 1ORYB 3GLGA 4ZPXA 2F5PA 1HNWM 1NSFA 3SMPA 4IJFA 4KLNA 1SXJE 3M7GA 1D0KA 1TF0B 1Z6TA 1T43A 2KHHA 3JR5A 3M0EA 4MH0E 5EQTA 3T15A 1TDHA 4LJ7A 4LG2A 2FH0A 4DBGB 4L16A 3U61A 3VK7A 4RKUF 4JYAM 1JR3A 2D7HA 4AKIA 1G4AE 4WP2A 1DGBA 3UJNA 2H5XA 2QENA 4CIZA 4II7A 4KT0F 5ITUA 3V76A 1KFVA 3EIHA 2HHHM 2RKOA 3KW6A 1SXJA 5ITQA 2L7HA 2MH8A 2JY8A 3DA1A 2RGHA 4CHTB 3E21A 4LF9M 2UXCM 1IXRC 2QBYB 1Q3CA 2LVPC 3EIEA 1XXHE 2DAIA 4LY6A 4MGKE 3JAMS 3SATA 4B3RM 4B08A 4D81A 2F5NA 1NY5A 3DZDA 5EP1A 2DVWB 5KO3A 3Q8GA 2DZNB 3HKPA 2DENA 2CE7A 3KOZE 1P3QQ 1E32A 3T1HM 2XFTA 2OQ4A 4Z8XA 2BJWA 1T3TA 2ZBKB 1QAQA 4NXNM 2FFJA 1OIZA 4WW0A 4LGMA 4AZFA 4S12A 2VQEM 1VDDA 2VIIA 2ZM6M 1EIJA 2E5LM 1DO0A 3A98B 1IN4A 2EO2A 4FVMA 1VQ1A 1XXHA 3L27A 2K47A 2XF3A 4X65M 3R9XB 1E9SA 1R7RA 1GL6A 2M5ZA 3CF6E 2F5QA 4X64M 2DAEA 2LNHC 2ERCA 4AKGA 3C9PA 2DAMA 4IBEA 1NO1A 2BNKA 4CGYB 5FTKA 4JV5M 4PD2A 2DZLA 1OAIA 1D0MA 3U6OA 1V33A 1IY1A 2CHQA 2MROB 5EP2A 4B7FA 1G71A 3I4VA 3ILKA 3SYKA 3VDUA 7CATA 5H37D 4DV6M 2KZSA 4AG5A 3UGJA 4TUWA 3U60B 3GLIB 4GKKM 1LTMA 4MGHA 3HU1A 3HGIA 3HY5A 1ZQ9A 2Q2EB 4XGIA 2V1UA 4GHLA 5EP4A 1YE9A 3HU3A 2Y21A
chains in the Genus database with same CATH topology
1K3WA 1S3SA 3AOEA 1MX0A 4M9SA 3W0FA 2QCUA 4B7HA 1R2ZA 3SBJA 1QYRA 1W5SA 3U6MA 2Z4SA 3KSXA 4FCVA 4L4UA 1QANA 3QAUA 4QNMA 4NSOB 2FE8A 1I4WA 1L2BA 3SHGB 2J7OA 2OPFA 4LF8M 3SYLA 2CEAA 1HT2E 2XSZD 1QAMA 3AKZA 2XZUA 5IZ7D 3LMMA 4M0DA 3GPYA 2R62A 2C99A 4NL4H 2R18A 5EJCA 2CUZA 3GLGB 1HNZM 3L28A 4LF7M 4LCBA 3HHYA 4JI1M 4JI6M 5C1BA 1GL7A 4OVZA 4PDIA 3TWMA 3VLFB 4DUYM 4M9XA 1OFIA 4X66M 3FD9A 4JI8M 5EP3A 1XNRM 3KOWE 2HCBA 3FUUA 3U61B 2UUBM 3AOGA 1HQYE 2C98A 2I7NA 4LGYA 4D82A 3DFZA 1YSYA 4JI2M 2X49A 3SMSA 2QP9X 1L2DA 4DR2M 4FD2A 1NJFA 4HLQA 3I51A 2QPAA 2W82A 4IBDA 4MGIE 3TPZA 2XFSA 1N77A 4OW0A 4X62M 3A45A 2X8AA 3RGPA 2YFQA 1NVMA 3U6LA 3K1JA 3FUWA 2Z4RA 3J80S 2M60A 3KVWA 2XGNA 3RE8A 5A2QS 4JI3M 2G5GX 2J7NA 3E9SA 5FTNA 5ITXA 1NNUC 2Z3XA 3VFDA 2DWZB 4QHSA 3U6PA 1K3XA 3D8LA 4R3DA 4JI5M 2CHGA 3PNVA 3GP1A 4G4RA 3ZH9B 4GKJM 2KA6B 3VKGA 1X37A 1PJIA 2L09A 3J7AS 1KSFX 5EXSA 2JA2A 4D80A 1XXHB 1QVRA 4G4OA 3SAVA 4I4LA 1IXZA 4R7GA 4G6ZA 1Q39A 4QHTA 8CATA 2UXBM 3T1YM 1IBMM 1QAOA 2FNAA 1HNXM 1OJLA 5FTLA 4DV0M 1J7KA 3SARA 2CFOA 3KSJA 3HU2A 3KDSE 4LF5M 2Y0QA 3KS8A 3JR4A 1W5TA 1WXQA 3FUXA 1XHBA 2D7EA 1IN5A 5F3WA 3B9PA 4AKHA 3MK6A 4BB9A 4JI4M 1NNJA 3TE6A 1DGGA 3UK6A 3KS4A 1LV7A 3CF0A 4RNAA 2F5OA 3UMMA 4CISA 1IN7A 1FNNA 3HJSA 5GKNA 3RGSA 3WHKA 3R8FA 1N32M 5BR8M 3K2LA 4QOZC 4DV4M 3KXEC 4LJ6A 3I4YA 2KZUA 2LH0A 1Q3BA 3AJIB 2R46A 1XNQM 4NXMM 3E4RA 3GLFB 4NRVA 3IG5A 3GQ5A 1IXSB 4FCWA 3W0LB 3U6DA 3SFZA 3FUTA 3IG8A 4DR1M 2R45A 4W5WA 3Q8XA 3KP0E 3M6AA 3SASA 2EUCA 1IN8A 3J81S 2XEPA 2DXIA 3U5ZB 3FTFA 1IY0A 1QZMA 1N75A 3KP1E 4I81A 3GQ4A 4OVZB 2KXEA 4MB7A 3PVSA 4B3MM 2RGOA 2EA0A 2A5YB 4DV3M 3OTOM 5KQDA 4LJ9A 1YUBA 5IT9S 3VDPA 1JR3D 3J27B 3HHZA 2Y0TA 4FWDA 1L1ZA 5IWAM 5ITXE 1JQJC 1L2CA 4KO8A 2KEBA 3FUVA 5FTMA 1MU5A 4IBFA 3AFHA 2VQFM 1FJGM 1SXJD 4L78A 4GHAA 1J09A 4IBIA 4NOOB 1GKIA 2UU9M 3L25A 4IBJA 1XMOM 3A46A 4GC5A 5JI3E 1N36M 4LZZA 1XWIA 4JI0M 3U6EA 4KHPM 4GRIA 4K0KM 4FWHA 4G4QA 1PJJA 2XZFA 2P5TA 2ZANA 4MGZE 1Z5CA 4NRWA 4DR7M 3CF2A 4PCZA 5KPZA 1KYIA 1H6UA 2R65A 5BPVA 4AQYM 1N34M 3U6QA 4GITA 5ITRA 1K82A 5KPTA 5DNYA 1Z59A 2YNMD 1NHGC 3CTWB 2HKJA 1OFHA 5JI2E 1XC8A 3PFIA 1J5EM 4B7GA 1NHWC 5FLXS 2DWLA 2UUCM 1EE8A 1HT1E 1I94M 4FW9A 4YY3M 3SC3A 3KOXE 3SHFA 2BJVA 5ITTA 3FKEA 2XLJA 4L8RC 5EXPA 1L1TA 4M0WA 3LVWA 3K8ZA 2QZ4A 5DYIA 3GLHB 3GRRA 3PNYA 1G3IA 3A42A 4PDGA 1IY2A 3UZUA 3GPXA 5E26A 2DHRA 4M9ZA 4AG6A 5ITYA 3HWSA 3SAWA 4IBCA 2L6OA 4GC9A 3AV0A 4OU7A 1NJGA 4IBGA 3GLFA 3VK8A 2CV0A 4EIWA 2CV2A 3GQ3A 1QQWA 4P16A 4JI7M 1DGHA 4B3SM 5FTJA 1GVNA 1TDZA 1IBLM 3L26A 1D2NA 2F5SA 4DV5M 2LXEA 3GO8A 5FSWA 3FYDA 2Y20A 2AHMA 4DUZM 1Z5BA 1HQCA 1TH2A 4DV7M 4B3TM 3D8BA 1C1KA 3TWKA 3U5ZA 3GRUA 3L2AA 2R4EA 4LJ4A 3WHLA 4DR5M 1TH4A 3GRYA 1Z5AA 3K92A 4LRSA 2KW0A 1G8PA 3TWLA 4FCTA 3ZCBB 4XBOA 2G8LA 3LVVA 1R6BX 3H4MA 1ZAEA 3HHXA 2ZAOA 3HJQA 2C96A 4LJ5A 3L29A 4MGYE 4LFAM 4AW4A 3U6SA 3FTCA 3HHWA 1N78A 3J7BA 4QOSA 1E94E 5KPRA 1G41A 3AOEC 3LQQA 1SXJB 5EXTA 1SXJC 2C9CA 4QNRA 2YR0A 4LFBM 2DZOB 4LJAA 2H1RA 2QBYA 4LZJA 1DO2A 4L15A 4LJ8A 2D7GA 4DV2M 4WURA 3NBIA 3PXGA 4LF4M 4DR6M 2FOIC 2XSZA 5C18A 4LFCM 2HL7A 2LWXA 4G4NA 4GIPA 4KODA 4OX9M 4I8OA 4DR3M 4JN6A 3T38A 4FWGA 1IN6A 4MM3B 3C58A 3MHVC 4IIWA 4HL4A 3HJ8A 5DYGA 1IBKM 2DWMA 4JXJA 2F4VM 1PM5A 3FTDA 3J2PB 4GH9A 1TH3A 4A3VB 4Z6YA 1G59A 1L8QA 2NQ8C 4LF6M 4GMQA 3ZC7B 1UM8A 2DWNA 4RF1A 3GPUA 3U6CA 1N33M 2I7PA 2XH9A 4LRTA 3U60A 3GLIA 3NWLA 1GLNA 3RFWA 2X4AA 1R2YA 4ITQA 1NY6A 3THGA 1IQPA 2CHVA 2C5RA 5KQ8A 3FYCA 3TQSA 3GLHA 2ZAMA 3FTEA 3AL0C 3BOSA 3SAUA 4IJEA 2UXDM 3MJ5A 2L7IA 3DOAA 5IREB 5LMUM 2V1CA 4IBKA 1IM2A 4BBAA 4I5SA 1E9RA 4AI6A 2V6ZM 3KOYE 1XMQM 3TL4X 5EXXA 3QWLA 1DGFA 4BLCA 3GPPA 2Z7JA 2UUAM 5LMNM 2O5RA 4DR4M 1TGUA 1HR0M 1DGHB 2KRUA 3KFUG 4YHHM 4DV1M 2YQZA 4NSRA 2R4JA 3LQRA 4PT5A 2C9OA 4IBBA 4RF0A 2CV1A 5E6JA 3VKHA 4REZA 2KRKA 3GRVA 3GLGA 1ORYB 4ZPXA 2F5PA 1HNWM 1NSFA 3SMPA 4IJFA 4KLNA 1SXJE 3M7GA 1Z6TA 3JR5A 3M0EA 4MH0E 5EQTA 3T15A 1TDHA 4LJ7A 4LG2A 4L16A 3U61A 3VK7A 4JYAM 1JR3A 2D7HA 4AKIA 1G4AE 1DGBA 3UJNA 2QENA 5ITUA 4II7A 1KFVA 3EIHA 2HHHM 2RKOA 3KW6A 1SXJA 5ITQA 2L7HA 3DA1A 4CHTB 2UXCM 2RGHA 4LF9M 1IXRC 2QBYB 1Q3CA 3EIEA 4LY6A 4MGKE 3SATA 3JAMS 4B3RM 4B08A 4D81A 2F5NA 1NY5A 3DZDA 5EP1A 2DVWB 5KO3A 2DZNB 3HKPA 2CE7A 3KOZE 1E32A 3T1HM 2XFTA 2OQ4A 4Z8XA 2BJWA 1T3TA 2ZBKB 1QAQA 4NXNM 2FFJA 4WW0A 4LGMA 4AZFA 4S12A 2VQEM 1VDDA 2VIIA 2ZM6M 2E5LM 1DO0A 3A98B 1IN4A 2EO2A 4FVMA 1XXHA 3L27A 2K47A 2XF3A 4X65M 3R9XB 1E9SA 3CF6E 1GL6A 1R7RA 2M5ZA 2F5QA 4X64M 4AKGA 2LNHC 2ERCA 4IBEA 2BNKA 4CGYB 5FTKA 4JV5M 4PD2A 3U6OA 1IY1A 2CHQA 5EP2A 4B7FA 7CATA 3I4VA 3ILKA 3SYKA 3VDUA 5H37D 4DV6M 2KZSA 4AG5A 3UGJA 4TUWA 3U60B 3GLIB 4GKKM 4MGHA 3HU1A 3HGIA 1ZQ9A 2Q2EB 4XGIA 2V1UA 4GHLA 5EP4A 1YE9A 3HU3A 2Y21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OU7 A; 
#chains in the Genus database with same CATH topology
 1K3W A;  1S3S A;  3AOE A;  1MX0 A;  2VDB B;  4M9S A;  2LVO C;  3W0F A;  4F1I A;  2EKK A;  2QCU A;  4B7H A;  3SBJ A;  1R2Z A;  1SG9 A;  1QYR A;  2K9D A;  1W5S A;  3U6M A;  2Z4S A;  3KSX A;  4FCV A;  4L4U A;  1QAN A;  3QAU A;  4QNM A;  3GLF E;  3W67 A;  4NSO B;  1GJS A;  2FE8 A;  1I4W A;  1XB2 B;  1L2B A;  3SHG B;  2J7O A;  1ZMW A;  2O01 F;  2LVQ D;  2OPF A;  4LF8 M;  3SYL A;  1IXS A;  2CEA A;  1HT2 E;  2XSZ D;  4UN2 B;  1QAM A;  3AKZ A;  2XZU A;  5IZ7 D;  3LMM A;  4M0D A;  3GPY A;  1HJP A;  2C99 A;  2R62 A;  4NL4 H;  2DI0 A;  2CP8 A;  2R18 A;  5EJC A;  2CUZ A;  3HZJ A;  3GLG B;  1HNZ M;  3L28 A;  4LF7 M;  4LCB A;  3HHY A;  4JI1 M;  4JI6 M;  5C1B A;  1GL7 A;  4OVZ A;  3I01 M;  4PDI A;  3TWM A;  3BBZ A;  3VLF B;  4DUY M;  4M9X A;  1OFI A;  4X66 M;  3FD9 A;  2BWB A;  4JI8 M;  1QDR A;  5EP3 A;  3KOW E;  1XNR M;  2HCB A;  3FUU A;  3U61 B;  1IFY A;  2UUB M;  3AOG A;  1HQY E;  2C98 A;  1EFU B;  2I7N A;  4LGY A;  4D82 A;  1BVS A;  2LBC A;  3DFZ A;  1YSY A;  2WSC F;  4JI2 M;  2DHY A;  2X49 A;  1GO5 A;  3SMS A;  2QP9 X;  2CRU A;  1L2D A;  4DR2 M;  4FD2 A;  1NJF A;  2L4F A;  3I51 A;  4HLQ A;  1TR8 A;  1VDL A;  2QPA A;  2W82 A;  4IBD A;  4MGI E;  3TPZ A;  2JZ1 A;  2XFS A;  1N77 A;  2JY6 B;  4OW0 A;  4X62 M;  1WGL A;  3A45 A;  2X8A A;  3RGP A;  2YFQ A;  1NVM A;  3U6L A;  3K1J A;  3FUW A;  2Z4R A;  3J80 S;  1JR3 E;  2M60 A;  3KVW A;  2XGN A;  3RE8 A;  3QYE A;  5A2Q S;  4JI3 M;  2G5G X;  2J7N A;  3E9S A;  2ZTC A;  5FTN A;  5ITX A;  1NNU C;  4HEO A;  2Z3X A;  3VFD A;  2KNV A;  2DWZ B;  2JNH A;  4QHS A;  5DFL A;  3U6P A;  1K3X A;  3D8L A;  4R3D A;  4JI5 M;  2CHG A;  3PNV A;  3GP1 A;  4G4R A;  3ZH9 B;  4GKJ M;  1GJT A;  2KA6 B;  3VKG A;  1X37 A;  1PJI A;  2L09 A;  3J7A S;  1KSF X;  5EXS A;  2JY5 A;  1JB0 F;  2JA2 A;  4D80 A;  1XXH B;  1QVR A;  4G4O A;  3SAV A;  1PGY A;  4I4L A;  1IXZ A;  4R7G A;  4G6Z A;  1Q39 A;  4QHT A;  2BWE A;  8CAT A;  2UXB M;  3T1Y M;  1IBM M;  1QAO A;  2FNA A;  3LW5 F;  1HNX M;  1OJL A;  5L8R F;  5FTL A;  4DV0 M;  1J7K A;  3SAR A;  2CFO A;  3KSJ A;  3HU2 A;  3KDS E;  4LF5 M;  2Y0Q A;  3KS8 A;  3JR4 A;  1W5T A;  1WXQ A;  2R44 A;  3FUX A;  1XHB A;  2D7E A;  1IN5 A;  2GQF A;  5F3W A;  3B9P A;  4AKH A;  3MK6 A;  4BB9 A;  3I04 M;  4JI4 M;  3B7N A;  3TE6 A;  1NNJ A;  1DGG A;  3UK6 A;  3KS4 A;  1LV7 A;  3CF0 A;  4RNA A;  3IHP A;  3UMM A;  2F5O A;  4CIS A;  1IN7 A;  1FNN A;  4XK8 F;  3HJS A;  5GKN A;  3RGS A;  3WHK A;  3R8F A;  1PJQ A;  1OQY A;  1N32 M;  5BR8 M;  3K2L A;  4QOZ C;  4DV4 M;  3KXE C;  1VG5 A;  2B3T A;  3I4Y A;  4LJ6 A;  2KZU A;  2LH0 A;  1Q3B A;  2LHC A;  2R46 A;  3AJI B;  1XNQ M;  4Y28 F;  4NXM M;  1V34 A;  3E4R A;  3GLF B;  1F4I A;  3C3E A;  2OOA A;  2MJ5 B;  2LVA A;  1PJT A;  4NRV A;  3IG5 A;  1RU3 A;  3GQ5 A;  1IXS B;  4FCW A;  3W0L B;  3U6D A;  2K0B X;  1MJG M;  2WSE F;  3SFZ A;  1QUS A;  2R0I A;  3FUT A;  3IG8 A;  4DR1 M;  2R45 A;  2R6F A;  4W5W A;  3Q8X A;  3KP0 E;  3M6A A;  3SAS A;  2EUC A;  1IN8 A;  3J81 S;  2XEP A;  2DXI A;  3U5Z B;  3LCU A;  3FTF A;  1IY0 A;  1QZM A;  1N75 A;  2JXN A;  2JZ0 A;  3KP1 E;  2APL A;  3BXW A;  4I81 A;  4R71 A;  3GQ4 A;  4OVZ B;  2KXE A;  4MB7 A;  3PVS A;  4B3M M;  2RGO A;  2EA0 A;  2A5Y B;  3FRI A;  2MGW A;  3OTO M;  2Z8Y M;  4DV3 M;  5KQD A;  2L2D A;  4LJ9 A;  2VF7 A;  1YUB A;  1WJ7 A;  2EJS A;  3VDP A;  5IT9 S;  1JR3 D;  2WZJ A;  3J27 B;  3QYB A;  3HHZ A;  2Y0T A;  4FWD A;  1L1Z A;  5IWA M;  5ITX E;  1JQJ C;  1L2C A;  1V92 A;  1AUA A;  2KEB A;  3FUV A;  4KO8 A;  3B7Q A;  5FTM A;  2J5Y A;  1MU5 A;  4IBF A;  3AFH A;  1GAB A;  1DV0 A;  2K6B A;  2VQF M;  1VEG A;  1FJG M;  1SXJ D;  4L78 A;  4GHA A;  1J09 A;  4IBI A;  3HX3 A;  4NOO B;  1GKI A;  2UU9 M;  3L25 A;  4IBJ A;  3K9P A;  2QHO B;  2QSF X;  1XMO M;  3A46 A;  4GC5 A;  5JI3 E;  1N36 M;  4LZZ A;  1XWI A;  4JI0 M;  3U6E A;  4KHP M;  4GRI A;  1Q02 A;  4K0K M;  4FWH A;  3B7Z A;  1OKS A;  4Q7J A;  4G4Q A;  2XZF A;  2RRU A;  1PJJ A;  3B89 A;  1OIP A;  2P5T A;  2ZAN A;  4MGZ E;  1Z5C A;  4NRW A;  4DR7 M;  3CF2 A;  4PCZ A;  2EKF A;  5KPZ A;  1KYI A;  1H6U A;  2R65 A;  1VEK A;  5BPV A;  4AQY M;  2KDL A;  3U6Q A;  4GIT A;  5ITR A;  1N34 M;  3NBX X;  1K82 A;  5KPT A;  3IEC A;  5DNY A;  1Z59 A;  2YNM D;  1NHG C;  3CTW B;  2HKJ A;  1OFH A;  5JI2 E;  4CJ6 A;  2KNZ A;  2OOB A;  1XC8 A;  1VEJ A;  3PFI A;  1J5E M;  4B7G A;  1NHW C;  5FLX S;  3E46 A;  2DWL A;  2UUC M;  1EE8 A;  1HT1 E;  1I94 M;  4FW9 A;  4YY3 M;  3SC3 A;  3KOX E;  2DNA A;  3SHF A;  2BJV A;  3LCV B;  3FKE A;  5ITT A;  2XLJ A;  1ZV1 A;  5EXP A;  4L8R C;  1L1T A;  4M0W A;  3LVW A;  3K8Z A;  2QZ4 A;  5DYI A;  1G3I A;  3GLH B;  3GRR A;  2DKL A;  3PNY A;  3A42 A;  4L6V 6;  2QNJ A;  4AW4 A;  4PDG A;  2JWS A;  1IY2 A;  1PJS A;  3UZU A;  3GPX A;  5E26 A;  2GNO A;  2KNA A;  4G3O A;  2DHR A;  4M9Z A;  4AG6 A;  5ITY A;  1NV9 A;  3HWS A;  3SAW A;  4IBC A;  2L6O A;  4GC9 A;  3AV0 A;  4OU7 A;  1NJG A;  4IBG A;  3GLF A;  3VK8 A;  2CV0 A;  4EIW A;  2CV2 A;  3GQ3 A;  1QQW A;  2LTU A;  4P16 A;  4JI7 M;  1DGH A;  4B3S M;  2WSF F;  5FTJ A;  3GLH E;  1NV8 A;  1CUK A;  1GVN A;  1TDZ A;  1IBL M;  3L26 A;  1D2N A;  2MR9 A;  4DV5 M;  2LXE A;  3GO8 A;  5FSW A;  3FYD A;  2Y20 A;  2F5S A;  2AHM A;  4DUZ M;  1Z5B A;  1HQC A;  1TH2 A;  4DV7 M;  4B3T M;  3D8B A;  2HAK A;  4ANR A;  1C1K A;  3TWK A;  3U5Z A;  3GRU A;  3L2A A;  2R4E A;  4LJ4 A;  3WHL A;  4DR5 M;  1TH4 A;  3GRY A;  1Z5A A;  3K92 A;  4LRS A;  1OTR A;  2KW0 A;  1G8P A;  3C3D A;  3TWL A;  4F2L A;  4FCT A;  3ZCB B;  1Y8G A;  4XBO A;  2G8L A;  2OO9 A;  2JP7 A;  1WIV A;  1R6B X;  2G3Q A;  3H4M A;  1ZAE A;  3HHX A;  2ZAO A;  3HJQ A;  2C96 A;  3LVV A;  3L29 A;  4LJ5 A;  4GEW A;  4MGY E;  4LFA M;  3W68 A;  2VF8 A;  3FTC A;  2DAK A;  3HHW A;  1N78 A;  3J7B A;  4QOS A;  3B74 A;  1E94 E;  5KPR A;  1G41 A;  3AOE C;  1C7Y A;  3LQQ A;  1SXJ B;  5EXT A;  1SXJ C;  2C9C A;  3F92 A;  2YR0 A;  1R5L A;  2DZO B;  4QNR A;  3U6S A;  4LFB M;  4LJA A;  2H1R A;  2QBY A;  4LZJ A;  1DO2 A;  4L15 A;  4LJ8 A;  2D7G A;  1AIP C;  4DV2 M;  2JUJ A;  4WUR A;  3NBI A;  3PXG A;  4LF4 M;  1PRB A;  4DR6 M;  2FOI C;  2XSZ A;  2LVN C;  5C18 A;  3K9O A;  3T6P A;  1R4G A;  2HL7 A;  2LWX A;  4G4N A;  4GIP A;  4LFC M;  4KOD A;  3CGW A;  4I8O A;  4DR3 M;  4OX9 M;  1QUT A;  4JN6 A;  3T38 A;  4FWG A;  3MMP A;  1IN6 A;  4MM3 B;  3C58 A;  3MHV C;  4IIW A;  4HL4 A;  3GLI E;  3HJ8 A;  5DYG A;  3FRH A;  1IBK M;  3ZQJ A;  2DWM A;  4JXJ A;  2F4V M;  1TTE A;  2FS1 A;  3FTD A;  1PM5 A;  1OAO C;  3J2P B;  4GH9 A;  1TH3 A;  3FE3 A;  4A3V B;  4Z6Y A;  1G59 A;  1L8Q A;  2NQ8 C;  4LF6 M;  1WGN A;  4GMQ A;  2N35 A;  1T6O A;  3ZC7 B;  1UM8 A;  2DWN A;  4RF1 A;  4P17 A;  3GPU A;  3U6C A;  3H4J A;  1N33 M;  2I7P A;  2QQ8 A;  1A5T A;  1ZMU A;  2XH9 A;  2O25 A;  1QZE A;  4LRT A;  3U60 A;  3GLI A;  3NWL A;  1GLN A;  2HWJ A;  2X4A A;  1WHC A;  3RFW A;  1NY6 A;  2JY7 A;  3THG A;  1IQP A;  1R2Y A;  4ITQ A;  2CHV A;  1YLA A;  1D0L A;  2C5R A;  5KQ8 A;  3FYC A;  1QDT A;  3TQS A;  3GLH A;  2ZAM A;  3FTE A;  3AL0 C;  3BOS A;  3SAU A;  4IJE A;  2UXD M;  3MJ5 A;  2L7I A;  3DOA A;  5IRE B;  5LMU M;  2V1C A;  1MN3 A;  4IBK A;  1IM2 A;  4BBA A;  4I5S A;  1E9R A;  4AI6 A;  2V6Z M;  3KOY E;  1XMQ M;  3TL4 X;  5EXX A;  3GLG E;  3QWL A;  1DGF A;  4BLC A;  3GPP A;  2Z7J A;  2UUA M;  5LMN M;  2ZTD A;  2O5R A;  4DR4 M;  1TGU A;  1HR0 M;  1DGH B;  1UFZ A;  2KRU A;  3KFU G;  4YHH M;  4DV1 M;  2LHG A;  2YQZ A;  4NSR A;  2R4J A;  4NC6 A;  1WR1 B;  2L4E A;  3LQR A;  4PT5 A;  2C9O A;  4IBB A;  4RF0 A;  2CWB A;  5E6J A;  2CV1 A;  4REZ A;  3VKH A;  2DAG A;  2KRK A;  3GRV A;  1ZMV A;  1ORY B;  3GLG A;  4ZPX A;  2F5P A;  1HNW M;  1NSF A;  3SMP A;  4IJF A;  4KLN A;  1SXJ E;  3M7G A;  1D0K A;  1TF0 B;  1Z6T A;  1T43 A;  2KHH A;  3JR5 A;  3M0E A;  4MH0 E;  5EQT A;  3T15 A;  1TDH A;  4LJ7 A;  4LG2 A;  2FH0 A;  4DBG B;  4L16 A;  3U61 A;  3VK7 A;  4RKU F;  4JYA M;  1JR3 A;  2D7H A;  4AKI A;  1G4A E;  4WP2 A;  1DGB A;  3UJN A;  2H5X A;  2QEN A;  4CIZ A;  4II7 A;  4KT0 F;  5ITU A;  3V76 A;  1KFV A;  3EIH A;  2HHH M;  2RKO A;  3KW6 A;  1SXJ A;  5ITQ A;  2L7H A;  2MH8 A;  2JY8 A;  3DA1 A;  2RGH A;  4CHT B;  3E21 A;  4LF9 M;  2UXC M;  1IXR C;  2QBY B;  1Q3C A;  2LVP C;  3EIE A;  1XXH E;  2DAI A;  4LY6 A;  4MGK E;  3JAM S;  3SAT A;  4B3R M;  4B08 A;  4D81 A;  2F5N A;  1NY5 A;  3DZD A;  5EP1 A;  2DVW B;  5KO3 A;  3Q8G A;  2DZN B;  3HKP A;  2DEN A;  2CE7 A;  3KOZ E;  1P3Q Q;  1E32 A;  3T1H M;  2XFT A;  2OQ4 A;  4Z8X A;  2BJW A;  1T3T A;  2ZBK B;  1QAQ A;  4NXN M;  2FFJ A;  1OIZ A;  4WW0 A;  4LGM A;  4AZF A;  4S12 A;  2VQE M;  1VDD A;  2VII A;  2ZM6 M;  1EIJ A;  2E5L M;  1DO0 A;  3A98 B;  1IN4 A;  2EO2 A;  4FVM A;  1VQ1 A;  1XXH A;  3L27 A;  2K47 A;  2XF3 A;  4X65 M;  3R9X B;  1E9S A;  1R7R A;  1GL6 A;  2M5Z A;  3CF6 E;  2F5Q A;  4X64 M;  2DAE A;  2LNH C;  2ERC A;  4AKG A;  3C9P A;  2DAM A;  4IBE A;  1NO1 A;  2BNK A;  4CGY B;  5FTK A;  4JV5 M;  4PD2 A;  2DZL A;  1OAI A;  1D0M A;  3U6O A;  1V33 A;  1IY1 A;  2CHQ A;  2MRO B;  5EP2 A;  4B7F A;  1G71 A;  3I4V A;  3ILK A;  3SYK A;  3VDU A;  7CAT A;  5H37 D;  4DV6 M;  2KZS A;  4AG5 A;  3UGJ A;  4TUW A;  3U60 B;  3GLI B;  4GKK M;  1LTM A;  4MGH A;  3HU1 A;  3HGI A;  3HY5 A;  1ZQ9 A;  2Q2E B;  4XGI A;  2V1U A;  4GHL A;  5EP4 A;  1YE9 A;  3HU3 A;  2Y21 A; 
#chains in the Genus database with same CATH homology
 1K3W A;  1S3S A;  3AOE A;  1MX0 A;  4M9S A;  3W0F A;  2QCU A;  4B7H A;  1R2Z A;  3SBJ A;  1QYR A;  1W5S A;  3U6M A;  2Z4S A;  3KSX A;  4FCV A;  4L4U A;  1QAN A;  3QAU A;  4QNM A;  4NSO B;  2FE8 A;  1I4W A;  1L2B A;  3SHG B;  2J7O A;  2OPF A;  4LF8 M;  3SYL A;  2CEA A;  1HT2 E;  2XSZ D;  1QAM A;  3AKZ A;  2XZU A;  5IZ7 D;  3LMM A;  4M0D A;  3GPY A;  2R62 A;  2C99 A;  4NL4 H;  2R18 A;  5EJC A;  2CUZ A;  3GLG B;  1HNZ M;  3L28 A;  4LF7 M;  4LCB A;  3HHY A;  4JI1 M;  4JI6 M;  5C1B A;  1GL7 A;  4OVZ A;  4PDI A;  3TWM A;  3VLF B;  4DUY M;  4M9X A;  1OFI A;  4X66 M;  3FD9 A;  4JI8 M;  5EP3 A;  1XNR M;  3KOW E;  2HCB A;  3FUU A;  3U61 B;  2UUB M;  3AOG A;  1HQY E;  2C98 A;  2I7N A;  4LGY A;  4D82 A;  3DFZ A;  1YSY A;  4JI2 M;  2X49 A;  3SMS A;  2QP9 X;  1L2D A;  4DR2 M;  4FD2 A;  1NJF A;  4HLQ A;  3I51 A;  2QPA A;  2W82 A;  4IBD A;  4MGI E;  3TPZ A;  2XFS A;  1N77 A;  4OW0 A;  4X62 M;  3A45 A;  2X8A A;  3RGP A;  2YFQ A;  1NVM A;  3U6L A;  3K1J A;  3FUW A;  2Z4R A;  3J80 S;  2M60 A;  3KVW A;  2XGN A;  3RE8 A;  5A2Q S;  4JI3 M;  2G5G X;  2J7N A;  3E9S A;  5FTN A;  5ITX A;  1NNU C;  2Z3X A;  3VFD A;  2DWZ B;  4QHS A;  3U6P A;  1K3X A;  3D8L A;  4R3D A;  4JI5 M;  2CHG A;  3PNV A;  3GP1 A;  4G4R A;  3ZH9 B;  4GKJ M;  2KA6 B;  3VKG A;  1X37 A;  1PJI A;  2L09 A;  3J7A S;  1KSF X;  5EXS A;  2JA2 A;  4D80 A;  1XXH B;  1QVR A;  4G4O A;  3SAV A;  4I4L A;  1IXZ A;  4R7G A;  4G6Z A;  1Q39 A;  4QHT A;  8CAT A;  2UXB M;  3T1Y M;  1IBM M;  1QAO A;  2FNA A;  1HNX M;  1OJL A;  5FTL A;  4DV0 M;  1J7K A;  3SAR A;  2CFO A;  3KSJ A;  3HU2 A;  3KDS E;  4LF5 M;  2Y0Q A;  3KS8 A;  3JR4 A;  1W5T A;  1WXQ A;  3FUX A;  1XHB A;  2D7E A;  1IN5 A;  5F3W A;  3B9P A;  4AKH A;  3MK6 A;  4BB9 A;  4JI4 M;  1NNJ A;  3TE6 A;  1DGG A;  3UK6 A;  3KS4 A;  1LV7 A;  3CF0 A;  4RNA A;  2F5O A;  3UMM A;  4CIS A;  1IN7 A;  1FNN A;  3HJS A;  5GKN A;  3RGS A;  3WHK A;  3R8F A;  1N32 M;  5BR8 M;  3K2L A;  4QOZ C;  4DV4 M;  3KXE C;  4LJ6 A;  3I4Y A;  2KZU A;  2LH0 A;  1Q3B A;  3AJI B;  2R46 A;  1XNQ M;  4NXM M;  3E4R A;  3GLF B;  4NRV A;  3IG5 A;  3GQ5 A;  1IXS B;  4FCW A;  3W0L B;  3U6D A;  3SFZ A;  3FUT A;  3IG8 A;  4DR1 M;  2R45 A;  4W5W A;  3Q8X A;  3KP0 E;  3M6A A;  3SAS A;  2EUC A;  1IN8 A;  3J81 S;  2XEP A;  2DXI A;  3U5Z B;  3FTF A;  1IY0 A;  1QZM A;  1N75 A;  3KP1 E;  4I81 A;  3GQ4 A;  4OVZ B;  2KXE A;  4MB7 A;  3PVS A;  4B3M M;  2RGO A;  2EA0 A;  2A5Y B;  4DV3 M;  3OTO M;  5KQD A;  4LJ9 A;  1YUB A;  5IT9 S;  3VDP A;  1JR3 D;  3J27 B;  3HHZ A;  2Y0T A;  4FWD A;  1L1Z A;  5IWA M;  5ITX E;  1JQJ C;  1L2C A;  4KO8 A;  2KEB A;  3FUV A;  5FTM A;  1MU5 A;  4IBF A;  3AFH A;  2VQF M;  1FJG M;  1SXJ D;  4L78 A;  4GHA A;  1J09 A;  4IBI A;  4NOO B;  1GKI A;  2UU9 M;  3L25 A;  4IBJ A;  1XMO M;  3A46 A;  4GC5 A;  5JI3 E;  1N36 M;  4LZZ A;  1XWI A;  4JI0 M;  3U6E A;  4KHP M;  4GRI A;  4K0K M;  4FWH A;  4G4Q A;  1PJJ A;  2XZF A;  2P5T A;  2ZAN A;  4MGZ E;  1Z5C A;  4NRW A;  4DR7 M;  3CF2 A;  4PCZ A;  5KPZ A;  1KYI A;  1H6U A;  2R65 A;  5BPV A;  4AQY M;  1N34 M;  3U6Q A;  4GIT A;  5ITR A;  1K82 A;  5KPT A;  5DNY A;  1Z59 A;  2YNM D;  1NHG C;  3CTW B;  2HKJ A;  1OFH A;  5JI2 E;  1XC8 A;  3PFI A;  1J5E M;  4B7G A;  1NHW C;  5FLX S;  2DWL A;  2UUC M;  1EE8 A;  1HT1 E;  1I94 M;  4FW9 A;  4YY3 M;  3SC3 A;  3KOX E;  3SHF A;  2BJV A;  5ITT A;  3FKE A;  2XLJ A;  4L8R C;  5EXP A;  1L1T A;  4M0W A;  3LVW A;  3K8Z A;  2QZ4 A;  5DYI A;  3GLH B;  3GRR A;  3PNY A;  1G3I A;  3A42 A;  4PDG A;  1IY2 A;  3UZU A;  3GPX A;  5E26 A;  2DHR A;  4M9Z A;  4AG6 A;  5ITY A;  3HWS A;  3SAW A;  4IBC A;  2L6O A;  4GC9 A;  3AV0 A;  4OU7 A;  1NJG A;  4IBG A;  3GLF A;  3VK8 A;  2CV0 A;  4EIW A;  2CV2 A;  3GQ3 A;  1QQW A;  4P16 A;  4JI7 M;  1DGH A;  4B3S M;  5FTJ A;  1GVN A;  1TDZ A;  1IBL M;  3L26 A;  1D2N A;  2F5S A;  4DV5 M;  2LXE A;  3GO8 A;  5FSW A;  3FYD A;  2Y20 A;  2AHM A;  4DUZ M;  1Z5B A;  1HQC A;  1TH2 A;  4DV7 M;  4B3T M;  3D8B A;  1C1K A;  3TWK A;  3U5Z A;  3GRU A;  3L2A A;  2R4E A;  4LJ4 A;  3WHL A;  4DR5 M;  1TH4 A;  3GRY A;  1Z5A A;  3K92 A;  4LRS A;  2KW0 A;  1G8P A;  3TWL A;  4FCT A;  3ZCB B;  4XBO A;  2G8L A;  3LVV A;  1R6B X;  3H4M A;  1ZAE A;  3HHX A;  2ZAO A;  3HJQ A;  2C96 A;  4LJ5 A;  3L29 A;  4MGY E;  4LFA M;  4AW4 A;  3U6S A;  3FTC A;  3HHW A;  1N78 A;  3J7B A;  4QOS A;  1E94 E;  5KPR A;  1G41 A;  3AOE C;  3LQQ A;  1SXJ B;  5EXT A;  1SXJ C;  2C9C A;  4QNR A;  2YR0 A;  4LFB M;  2DZO B;  4LJA A;  2H1R A;  2QBY A;  4LZJ A;  1DO2 A;  4L15 A;  4LJ8 A;  2D7G A;  4DV2 M;  4WUR A;  3NBI A;  3PXG A;  4LF4 M;  4DR6 M;  2FOI C;  2XSZ A;  5C18 A;  4LFC M;  2HL7 A;  2LWX A;  4G4N A;  4GIP A;  4KOD A;  4OX9 M;  4I8O A;  4DR3 M;  4JN6 A;  3T38 A;  4FWG A;  1IN6 A;  4MM3 B;  3C58 A;  3MHV C;  4IIW A;  4HL4 A;  3HJ8 A;  5DYG A;  1IBK M;  2DWM A;  4JXJ A;  2F4V M;  1PM5 A;  3FTD A;  3J2P B;  4GH9 A;  1TH3 A;  4A3V B;  4Z6Y A;  1G59 A;  1L8Q A;  2NQ8 C;  4LF6 M;  4GMQ A;  3ZC7 B;  1UM8 A;  2DWN A;  4RF1 A;  3GPU A;  3U6C A;  1N33 M;  2I7P A;  2XH9 A;  4LRT A;  3U60 A;  3GLI A;  3NWL A;  1GLN A;  3RFW A;  2X4A A;  1R2Y A;  4ITQ A;  1NY6 A;  3THG A;  1IQP A;  2CHV A;  2C5R A;  5KQ8 A;  3FYC A;  3TQS A;  3GLH A;  2ZAM A;  3FTE A;  3AL0 C;  3BOS A;  3SAU A;  4IJE A;  2UXD M;  3MJ5 A;  2L7I A;  3DOA A;  5IRE B;  5LMU M;  2V1C A;  4IBK A;  1IM2 A;  4BBA A;  4I5S A;  1E9R A;  4AI6 A;  2V6Z M;  3KOY E;  1XMQ M;  3TL4 X;  5EXX A;  3QWL A;  1DGF A;  4BLC A;  3GPP A;  2Z7J A;  2UUA M;  5LMN M;  2O5R A;  4DR4 M;  1TGU A;  1HR0 M;  1DGH B;  2KRU A;  3KFU G;  4YHH M;  4DV1 M;  2YQZ A;  4NSR A;  2R4J A;  3LQR A;  4PT5 A;  2C9O A;  4IBB A;  4RF0 A;  2CV1 A;  5E6J A;  3VKH A;  4REZ A;  2KRK A;  3GRV A;  3GLG A;  1ORY B;  4ZPX A;  2F5P A;  1HNW M;  1NSF A;  3SMP A;  4IJF A;  4KLN A;  1SXJ E;  3M7G A;  1Z6T A;  3JR5 A;  3M0E A;  4MH0 E;  5EQT A;  3T15 A;  1TDH A;  4LJ7 A;  4LG2 A;  4L16 A;  3U61 A;  3VK7 A;  4JYA M;  1JR3 A;  2D7H A;  4AKI A;  1G4A E;  1DGB A;  3UJN A;  2QEN A;  5ITU A;  4II7 A;  1KFV A;  3EIH A;  2HHH M;  2RKO A;  3KW6 A;  1SXJ A;  5ITQ A;  2L7H A;  3DA1 A;  4CHT B;  2UXC M;  2RGH A;  4LF9 M;  1IXR C;  2QBY B;  1Q3C A;  3EIE A;  4LY6 A;  4MGK E;  3SAT A;  3JAM S;  4B3R M;  4B08 A;  4D81 A;  2F5N A;  1NY5 A;  3DZD A;  5EP1 A;  2DVW B;  5KO3 A;  2DZN B;  3HKP A;  2CE7 A;  3KOZ E;  1E32 A;  3T1H M;  2XFT A;  2OQ4 A;  4Z8X A;  2BJW A;  1T3T A;  2ZBK B;  1QAQ A;  4NXN M;  2FFJ A;  4WW0 A;  4LGM A;  4AZF A;  4S12 A;  2VQE M;  1VDD A;  2VII A;  2ZM6 M;  2E5L M;  1DO0 A;  3A98 B;  1IN4 A;  2EO2 A;  4FVM A;  1XXH A;  3L27 A;  2K47 A;  2XF3 A;  4X65 M;  3R9X B;  1E9S A;  3CF6 E;  1GL6 A;  1R7R A;  2M5Z A;  2F5Q A;  4X64 M;  4AKG A;  2LNH C;  2ERC A;  4IBE A;  2BNK A;  4CGY B;  5FTK A;  4JV5 M;  4PD2 A;  3U6O A;  1IY1 A;  2CHQ A;  5EP2 A;  4B7F A;  7CAT A;  3I4V A;  3ILK A;  3SYK A;  3VDU A;  5H37 D;  4DV6 M;  2KZS A;  4AG5 A;  3UGJ A;  4TUW A;  3U60 B;  3GLI B;  4GKK M;  4MGH A;  3HU1 A;  3HGI A;  1ZQ9 A;  2Q2E B;  4XGI A;  2V1U A;  4GHL A;  5EP4 A;  1YE9 A;  3HU3 A;  2Y21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...