4OU7A

Crystal structure of dnat84-153-dt10 ssdna complex reveals a novel single-stranded dna binding mode
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
VPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication/dna
molecule keywords Primosomal protein 1
publication title Crystal structure of DnaT84-153-dT10 ssDNA complex reveals a novel single-stranded DNA binding mode.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 71
sequence length 71
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1180 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ou7A00
4OU7A
chains in the Genus database with same CATH superfamily
3SMSA 3KW6A 2I7PA 1Y8GA 3RGSA 4LF4M 2EUCA 2X49A 3J81S 2KNZA 4B08A 1J7KA 4TUWA 4Z6YA 5EJCA 4NOOB 2QBYB 3ZC7B 4RNAA 3JR5A 1OQYA 3UGJA 5FLXS 4DV6M 4JI7M 3ZQJA 1CUKA 2M60A 3GRRA 2FOIC 1C7YA 1WJ7A 5DFLA 2WSFF 2CEAA 2JY6B 1DGGA 1HT2E 1ZAEA 2DZOB 1HNWM 3HGIA 2CRUA 1KSFX 4BB9A 3GP1A 4FW9A 3M7GA 3B7NA 2A5YB 2C9OA 4A3VB 1TH4A 3C9PA 3GQ3A 3C58A 3GLHA 4Z8XA 1Z59A 3B89A 2ZAMA 5ITUA 1G71A 1I4WA 4X66M 3IECA 1E94E 4NRVA 3GRUA 3NBIA 2BWEA 1DGBA 3J7AS 3FUUA 1XHBA 3VKGA 3L29A 3PNYA 3DFZA 4JI6M 2V1CA 1I94M 3CF0A 3FUWA 1L2CA 4M0WA 3B7ZA 1TR8A 4OX9M 1R5LA 4LJ4A 4IIWA 2JA2A 4B3TM 3BOSA 2D7GA 3ILKA 1N36M 4NXMM 4L8RC 1R7RA 2OPFA 4DR3M 3D8BA 3KOZE 4LRSA 1AIPC 2QHOB 4FD2A 4LZZA 3E21A 3LQQA 1KYIA 1YE9A 3GLHB 5FSWA 1OKSA 2CFOA 4L78A 1OJLA 1S3SA 5EXTA 1N75A 2XSZD 3VDUA 2R6FA 2Q2EB 3I4YA 3FTFA 5GKNA 5EP3A 1ORYB 2ZTCA 1L8QA 3LW5F 3GLIE 3EIEA 2JNHA 1XC8A 3GLIA 3U61B 1Z5CA 3PVSA 4GEWA 4QNRA 3U6EA 4GIPA 1D0MA 1NNJA 4B3RM 4AI6A 3A98B 1K3XA 4LJ6A 1UM8A 4IBFA 3H4JA 4DR5M 1R2ZA 3LMMA 2LVAA 3GLFA 4PD2A 2KA6B 1Q39A 4X65M 5BPVA 1TF0B 2C9CA 3FYCA 1QQWA 2XEPA 1NHWC 4G6ZA 4DV7M 4DV2M 1KFVA 1NJGA 1IBKM 1N78A 2CV1A 1IY1A 4QHTA 1PJQA 2Y21A 4F1IA 2QCUA 3SBJA 4QOSA 3CF6E 1GLNA 2XFTA 2Z4RA 2ZTDA 3CF2A 3K9PA 1ZQ9A 2AHMA 4JI3M 5EP1A 3MK6A 2Y20A 2XGNA 3GLIB 4NSOB 2L09A 4DUYM 3UZUA 1IQPA 2BNKA 2YFQA 2DVWB 2EJSA 1PJSA 2G3QA 1R6BX 2XSZA 4F2LA 3U6LA 2DXIA 1IN4A 2GNOA 2CV0A 4M9XA 7CATA 2BJWA 4D80A 4HEOA 2LH0A 1FNNA 2QP9X 2FH0A 4AKHA 1LTMA 3BBZA 3TWLA 3AV0A 5BR8M 4WURA 4I4LA 5A2QS 2Z3XA 3KP1E 2ZAOA 4LGMA 4MGKE 3TWKA 1PJIA 2KRKA 4IJEA 1T43A 3IHPA 3GPXA 4JYAM 2APLA 4P17A 4AW4A 3QYBA 5L8RF 3L25A 3E46A 1E9RA 4LGYA 2CV2A 4LJ8A 5LMUM 3V76A 1IFYA 4W5WA 4ITQA 1MN3A 2LVNC 3MHVC 1D2NA 4AG6A 5ITXE 1DGFA 2H5XA 4GKJM 1DGHA 2JZ1A 5KPRA 1NO1A 3OTOM 1NNUC 1EFUB 3CTWB 2EKKA 4JV5M 2QQ8A 2LVOC 5KO3A 4LF8M 1XB2B 2LHCA 2DHYA 3HZJA 1MX0A 3U6QA 4NSRA 4M9SA 3F92A 1VG5A 2D7EA 1QYRA 3TE6A 1SXJE 2R46A 4MGIE 2FNAA 3SHFA 3HHXA 1OFHA 2MR9A 5E26A 4MM3B 3U6PA 1QDRA 4KO8A 5F3WA 2CHQA 3AL0C 3GRVA 5ITTA 4NL4H 1XNQM 3M6AA 1DGHB 4IBKA 4AQYM 4EIWA 4GHLA 4DR4M 4RKUF 2CHGA 2O25A 2CWBA 3RGPA 3QAUA 2MGWA 5EP2A 1G41A 1PRBA 1VEKA 4MB7A 4HL4A 3L27A 3T1HM 2F5QA 1V33A 4CIZA 4NRWA 1Q02A 1K82A 2HHHM 1SXJB 3J27B 1TTEA 3FKEA 3A45A 3GLHE 1N77A 5ITRA 3FTEA 3LQRA 1QVRA 2HAKA 2F5PA 5JI2E 1VEGA 1J09A 2R4JA 3IG8A 1IXRC 3TWMA 4LG2A 2YNMD 2XF3A 2RKOA 1R4GA 3VFDA 3U6CA 2KRUA 1J5EM 4Y28F 3GQ5A 2KXEA 1GL6A 4CGYB 3R8FA 1HJPA 3I51A 2UUBM 1N32M 4KODA 1VQ1A 4DV0M 4I81A 3KVWA 2DZLA 4FCWA 3FRHA 2ERCA 2Z8YM 1OIZA 2K9DA 2JY5A 4OVZA 4LFBM 2R62A 3TPZA 3B74A 1UFZA 1W5TA 1JR3D 3AOEC 2KNVA 1HR0M 1JQJC 2LNHC 3RFWA 3K1JA 4DV5M 3KFUG 2DHRA 3HU1A 3THGA 4CHTB 1SXJC 8CATA 1QANA 5FTMA 1QZEA 2DAMA 3GLGE 4IBBA 1F4IA 3KSJA 2F5OA 1V92A 3GLGA 1L1TA 4BBAA 4AKIA 4X62M 2EO2A 4JXJA 1L2BA 2L6OA 4GRIA 1TDHA 2O01F 2Z7JA 4DR1M 4B3MM 1HT1E 1NHGC 5ITYA 5DYIA 1WGNA 2UUAM 1V34A 3GLFE 2C99A 3E9SA 3B9PA 3T1YM 4IBJA 4DUZM 1R2YA 3FUVA 4D82A 4I5SA 3J7BA 3U60A 1XWIA 2C5RA 3T15A 1NV8A 3A46A 3SASA 4PT5A 2J7OA 3LVVA 2JP7A 3VKHA 3GLGB 3BXWA 4R3DA 5IT9S 1JR3A 1IM2A 3HKPA 3UK6A 2VDBB 1TDZA 2M5ZA 2H1RA 4L6V6 4LZJA 5C1BA 4UN2B 1NSFA 4JI5M 3HJQA 4JN6A 2FFJA 4REZA 1QUSA 1OAOC 1IN6A 2DAEA 3QYEA 3B7QA 2W82A 4IBGA 1XMQM 1XNRM 4P16A 3UJNA 3SYLA 1L2DA 1G59A 3EIHA 3GPPA 4WW0A 1WHCA 3HX3A 3K92A 3GLFB 1HNZM 2J5YA 3NBXX 5KQDA 1NY5A 2DAGA 4XBOA 4DBGB 1IY0A 3K9OA 2KZSA 2MROB 4OU7A 3VDPA 3FYDA 3KSXA 2DKLA 3HJ8A 5KPTA 4OW0A 2VIIA 1IBMM 2F5NA 2KZUA 1DO2A 4LFCM 2UXBM 5EXSA 3LVWA 2UU9M 1VDLA 2WSEF 4FCVA 4CJ6A 1SG9A 4NC6A 3W67A 3Q8XA 3HHYA 1NVMA 2FS1A 4ZPXA 4L4UA 3R9XB 2DWLA 3PXGA 2G8LA 5FTKA 4ANRA 3GPYA 5LMNM 1QDTA 3FRIA 3VK7A 1QZMA 1AUAA 1BVSA 4LJ7A 4GKKM 4FWGA 3J2PB 2XFSA 1D0LA 4DR7M 2KW0A 4L15A 1IN5A 3WHKA 4QNMA 3HU2A 2K0BX 4YY3M 5FTNA 2WSCF 4G3OA 3SFZA 3FUTA 2RGOA 2JXNA 3FD9A 3A42A 4LCBA 1G8PA 3FTDA 4G4QA 3W68A 2R45A 1P3QQ 2JUJA 1T3TA 3HHZA 2C98A 2ZBKB 4MH0E 5H37D 3PFIA 3NWLA 2R18A 2UXCM 1QAOA 3LCUA 4IBIA 4LF6M 1XMOM 1OFIA 3SATA 5DYGA 3GO8A 2V6ZM 2Z4SA 4B7HA 2FE8A 2LVPC 1G3IA 2ZM6M 2F5SA 1PM5A 3KOXE 2CHVA 1ZMWA 2DNAA 2L4EA 1TH2A 1MU5A 4FWDA 3TL4X 1WXQA 2C96A 3J80S 1G4AE 1Z5BA 3PNVA 4LJ9A 4LJ5A 3DZDA 4S12A 1YSYA 2X8AA 3VK8A 4XGIA 1YUBA 1HQCA 2R4EA 2N35A 2DI0A 2GQFA 1PJTA 2KEBA 4B7GA 1IXSA 3SYKA 4AG5A 5IZ7D 4PDGA 1N33M 4RF0A 4IBDA 2NQ8C 3W0FA 2Y0QA 3QWLA 1E9SA 2HCBA 2KNAA 2X4AA 1WIVA 4KT0F 4MGZE 4AZFA 4JI0M 1QUTA 4WP2A 2QSFX 3FUXA 2EA0A 2B3TA 4JI4M 2CE7A 2MJ5B 2G5GX 5C18A 1NY6A 4L16A 4BLCA 3U6MA 4R7GA 3SAUA 4M9ZA 3MJ5A 1A5TA 3Q8GA 1DO0A 2CUZA 4GH9A 3SHGB 3SARA 2DENA 1VEJA 2DAIA 2RRUA 2Y0TA 2CP8A 3DA1A 3FE3A 4IJFA 4LFAM 5FTLA 2QPAA 3JAMS 5EXPA 1HQYE 5EQTA 2L7HA 1IXSB 2BWBA 2XZUA 3I01M 2R65A 3KS4A 3TQSA 4B7FA 4DR2M 2WZJA 3SAVA 1E32A 1OAIA 2EKFA 2ZANA 1GJSA 3C3DA 5FTJA 4D81A 1D0KA 3KXEC 1FJGM 3HY5A 1QAQA 4GC9A 1T6OA 1Z6TA 4HLQA 3MMPA 3DOAA 4IBCA 1WGLA 4NXNM 3U61A 4DV4M 1IY2A 2DWZB 3VLFB 3KDSE 3GPUA 1QAMA 3SAWA 3KOWE 4OVZB 2DWMA 3U6OA 3SMPA 2KDLA 3AFHA 4X64M 2UXDM 2VQFM 2L4FA 5E6JA 2HL7A 2F4VM 1GVNA 4G4NA 2QZ4A 2LXEA 1ZMVA 2K6BA 3GQ4A 2O5RA 1ZMUA 4QHSA 1MJGM 1ZV1A 2RGHA 4LJAA 4DV1M 2I7NA 2XZFA 3U5ZA 4QOZC 3LCVB 1JR3E 2BJVA 4GITA 2LWXA 2J7NA 2YR0A 3HU3A 4LF5M 4CISA 1GJTA 5IWAM 2JWSA 4G4OA 2OQ4A 4YHHM 1L1ZA 2JY7A 1GABA 1YLAA 2XH9A 1GO5A 2MH8A 4FCTA 2XLJA 1NV9A 1XXHE 3E4RA 1PJJA 3AJIB 3I4VA 4MGHA 3ZH9B 3AOGA 1OTRA 1XXHA 3RE8A 4AKGA 1NJFA 5ITQA 1HNXM 3KP0E 3T38A 4KHPM 3ZCBB 1GL7A 4DV3M 3U60B 3T6PA 4GC5A 1IN8A 1IXZA 2HWJA 1Z5AA 2KHHA 5IREB 4M0DA 3U5ZB 4LRTA 2LHGA 4RF1A 2R44A 4K0KM 3AKZA 3IG5A 2DAKA 2LTUA 1IN7A 3L2AA 4KLNA 4R71A 2VF8A 4B3SM 3HWSA 2OOBA 5KQ8A 3U6SA 2JY8A 1XXHB 2OOAA 4FVMA 4GMQA 2LBCA 4LF9M 2YQZA 2K47A 1RU3A 2R0IA 4LY6A 2V1UA 2DZNB 3W0LB 2QNJA 2L7IA 1JB0F 1Q3CA 4XK8F 1WR1B 1SXJD 3FTCA 3L26A 2P5TA 1W5SA 4LF7M 3KS8A 2DWNA 2VF7A 3L28A 4JI2M 3K2LA 1LV7A 2VQEM 4JI8M 1EE8A 2LVQD 4MGYE 2QENA 3JR4A 3C3EA 3HJSA 1X37A 4Q7JA 1IBLM 4G4RA 4PCZA 3K8ZA 1OIPA 2OO9A 2L2DA 2JZ0A 1VDDA 4IBEA 1TGUA 5EXXA 1DV0A 4I8OA 2HKJA 4II7A 3M0EA 1K3WA 1H6UA 2D7HA 1PGYA 5ITXA 2QBYA 1TH3A 5DNYA 3CGWA 3UMMA 5JI3E 3U6DA 1GKIA 4PDIA 3I04M 4JI1M 2E5LM 3D8LA 1EIJA 3SC3A 3H4MA 3AOEA 1N34M 3HHWA 1C1KA 1Q3BA 5KPZA 3KOYE 4FWHA 2UUCM 3GRYA 3WHLA 4GHAA 4DR6M 5EP4A 1SXJA
chains in the Genus database with same CATH topology
3SMSA 3KW6A 2I7PA 3RGSA 4LF4M 2EUCA 2X49A 3J81S 4B08A 1J7KA 4TUWA 4Z6YA 5EJCA 4NOOB 2QBYB 3ZC7B 4RNAA 3JR5A 3UGJA 5FLXS 4DV6M 4JI7M 2M60A 3GRRA 2FOIC 2CEAA 1DGGA 1HT2E 1ZAEA 2DZOB 1HNWM 3HGIA 1KSFX 4BB9A 3GP1A 4FW9A 3M7GA 2A5YB 2C9OA 4A3VB 1TH4A 3GQ3A 3C58A 3GLHA 4Z8XA 1Z59A 2ZAMA 5ITUA 1I4WA 4X66M 1E94E 4NRVA 3GRUA 3NBIA 3J7AS 1DGBA 3FUUA 1XHBA 3VKGA 3L29A 3PNYA 3DFZA 4JI6M 2V1CA 1I94M 3CF0A 3FUWA 1L2CA 4M0WA 4OX9M 4LJ4A 4IIWA 2JA2A 3BOSA 2D7GA 3ILKA 1N36M 4NXMM 4L8RC 1R7RA 2OPFA 4DR3M 3D8BA 3KOZE 4LRSA 4FD2A 4LZZA 3LQQA 1KYIA 1YE9A 3GLHB 5FSWA 2CFOA 4L78A 1OJLA 1S3SA 5EXTA 1N75A 2XSZD 3VDUA 2Q2EB 3I4YA 3FTFA 5GKNA 5EP3A 1ORYB 1L8QA 3EIEA 1XC8A 3GLIA 3U61B 1Z5CA 3PVSA 4QNRA 3U6EA 4GIPA 1NNJA 4B3RM 4AI6A 3A98B 1K3XA 4LJ6A 1UM8A 4IBFA 4DR5M 1R2ZA 3LMMA 3GLFA 4PD2A 1Q39A 2KA6B 4X65M 5BPVA 2C9CA 3FYCA 4G6ZA 1QQWA 2XEPA 1NHWC 4DV7M 1KFVA 4DV2M 1NJGA 1IBKM 1N78A 2CV1A 1IY1A 4QHTA 2Y21A 2QCUA 3SBJA 4QOSA 3CF6E 1GLNA 2XFTA 2Z4RA 3CF2A 2F5PA 4B3TM 1ZQ9A 2AHMA 4JI3M 5EP1A 3MK6A 2Y20A 2XGNA 3GLIB 4NSOB 2L09A 4DUYM 3UZUA 1IQPA 2BNKA 2YFQA 2DVWB 1R6BX 2XSZA 3U6LA 2DXIA 1IN4A 2CV0A 4M9XA 7CATA 2BJWA 4D80A 2LH0A 1FNNA 2QP9X 4AKHA 3TWLA 3AV0A 5BR8M 4WURA 4I4LA 5A2QS 2Z3XA 3KP1E 2ZAOA 4LGMA 4MGKE 3TWKA 1PJIA 2KRKA 4IJEA 3GPXA 4JYAM 4AW4A 3L25A 1E9RA 4LGYA 2CV2A 4LJ8A 5LMUM 4W5WA 4ITQA 3MHVC 1D2NA 4AG6A 5ITXE 1DGFA 4GKJM 1DGHA 5KPRA 3OTOM 1NNUC 3CTWB 4JV5M 5KO3A 4LF8M 1MX0A 3U6QA 4NSRA 4M9SA 2D7EA 1QYRA 3TE6A 1SXJE 2R46A 4MGIE 2FNAA 3SHFA 3HHXA 1OFHA 5E26A 4MM3B 3U6PA 4KO8A 5F3WA 2CHQA 3AL0C 3GRVA 5ITTA 4NL4H 1XNQM 3M6AA 1DGHB 4IBKA 4AQYM 4EIWA 4GHLA 4DR4M 2CHGA 3RGPA 3QAUA 5EP2A 1G41A 4MB7A 4HL4A 3L27A 3T1HM 2F5QA 4NRWA 1K82A 2HHHM 1SXJB 3J27B 3FKEA 3A45A 1N77A 5ITRA 3FTEA 3LQRA 1QVRA 5JI2E 1J09A 2R4JA 3IG8A 1IXRC 3TWMA 4LG2A 2YNMD 2XF3A 2RKOA 3VFDA 3U6CA 2KRUA 1J5EM 3GQ5A 2KXEA 1GL6A 4CGYB 3R8FA 2UUBM 3I51A 1N32M 4KODA 4DV0M 4I81A 3KVWA 4FCWA 2ERCA 4OVZA 4LFBM 2R62A 3TPZA 1W5TA 1JR3D 3AOEC 1HR0M 1JQJC 2LNHC 3RFWA 3K1JA 4DV5M 3KFUG 2DHRA 3HU1A 3THGA 4CHTB 1SXJC 8CATA 1QANA 5FTMA 4IBBA 3KSJA 2F5OA 3GLGA 1L1TA 4BBAA 4AKIA 4X62M 2EO2A 4JXJA 1L2BA 2L6OA 4GRIA 1TDHA 2Z7JA 4DR1M 4B3MM 1HT1E 1NHGC 5ITYA 5DYIA 2UUAM 2C99A 3E9SA 3B9PA 3T1YM 4IBJA 4DUZM 1R2YA 3FUVA 4D82A 4I5SA 3J7BA 3U60A 1XWIA 2C5RA 3T15A 3A46A 3SASA 4PT5A 2J7OA 3LVVA 3VKHA 3GLGB 5IT9S 4R3DA 1JR3A 1IM2A 3HKPA 3UK6A 1TDZA 2M5ZA 2H1RA 4LZJA 5C1BA 1NSFA 4JI5M 3HJQA 4JN6A 2FFJA 4REZA 4IBGA 1IN6A 1XNRM 1XMQM 2W82A 4P16A 3UJNA 3SYLA 1L2DA 1G59A 3EIHA 3GPPA 4WW0A 3GLFB 3K92A 1HNZM 5KQDA 1NY5A 4XBOA 1IY0A 2KZSA 4OU7A 3VDPA 3FYDA 3KSXA 3HJ8A 5KPTA 4OW0A 2VIIA 1IBMM 2F5NA 2KZUA 1DO2A 4LFCM 2UXBM 5EXSA 3LVWA 2UU9M 4FCVA 3Q8XA 3HHYA 1NVMA 4ZPXA 4L4UA 3R9XB 2DWLA 3PXGA 2G8LA 5FTKA 3GPYA 5LMNM 3VK7A 1QZMA 4LJ7A 4GKKM 4FWGA 3J2PB 2XFSA 4DR7M 2KW0A 4L15A 1IN5A 3WHKA 4QNMA 3HU2A 4YY3M 5FTNA 3SFZA 3FUTA 2RGOA 3FD9A 3A42A 4LCBA 1G8PA 3FTDA 4G4QA 2R45A 3HHZA 1T3TA 2C98A 2ZBKB 4MH0E 5H37D 3PFIA 3NWLA 2R18A 2UXCM 1QAOA 4IBIA 4LF6M 1XMOM 1OFIA 3SATA 5DYGA 3GO8A 2V6ZM 2Z4SA 4B7HA 2FE8A 1G3IA 2ZM6M 2F5SA 1PM5A 3KOXE 2CHVA 1TH2A 1MU5A 4FWDA 3TL4X 1WXQA 2C96A 3J80S 1G4AE 1Z5BA 3PNVA 4LJ9A 4LJ5A 3DZDA 4S12A 1YSYA 2X8AA 3VK8A 4XGIA 1YUBA 1HQCA 2R4EA 2KEBA 4PDGA 4B7GA 3SYKA 4AG5A 5IZ7D 1N33M 4RF0A 4IBDA 2NQ8C 3W0FA 2Y0QA 3QWLA 1E9SA 2HCBA 2X4AA 4AZFA 4MGZE 4JI0M 3FUXA 2EA0A 4JI4M 2CE7A 2G5GX 5C18A 1NY6A 4L16A 4BLCA 3U6MA 4R7GA 3SAUA 4M9ZA 3MJ5A 1DO0A 2CUZA 4GH9A 3SHGB 3SARA 2Y0TA 4IJFA 3DA1A 4LFAM 5FTLA 2QPAA 3JAMS 5EXPA 1HQYE 5EQTA 2L7HA 1IXSB 2XZUA 2R65A 3KS4A 3TQSA 4B7FA 4DR2M 3SAVA 1E32A 2ZANA 5FTJA 4D81A 3KXEC 1FJGM 4GC9A 1QAQA 4HLQA 1Z6TA 3DOAA 4IBCA 4NXNM 3U61A 4DV4M 1IY2A 2DWZB 3VLFB 3KDSE 3GPUA 1QAMA 3SAWA 3KOWE 4OVZB 2DWMA 3U6OA 3SMPA 3AFHA 4X64M 2UXDM 2VQFM 2F4VM 5E6JA 2HL7A 1GVNA 4G4NA 2QZ4A 2LXEA 3GQ4A 2O5RA 4QHSA 2RGHA 4LJAA 4DV1M 2I7NA 2XZFA 3U5ZA 4QOZC 2BJVA 4GITA 2LWXA 2J7NA 2YR0A 3HU3A 4LF5M 4CISA 5IWAM 4G4OA 2OQ4A 4YHHM 1L1ZA 2XH9A 4FCTA 2XLJA 1PJJA 3E4RA 3AJIB 3I4VA 4MGHA 3ZH9B 3AOGA 1XXHA 3RE8A 4AKGA 1NJFA 5ITQA 1HNXM 3KP0E 3T38A 4KHPM 3ZCBB 1GL7A 4DV3M 3U60B 4GC5A 1IN8A 1IXZA 1Z5AA 5IREB 4M0DA 3U5ZB 4LRTA 4RF1A 4K0KM 3AKZA 3IG5A 4KLNA 1IN7A 3L2AA 4B3SM 3HWSA 5KQ8A 3U6SA 1XXHB 4FVMA 4GMQA 4LF9M 2YQZA 2K47A 4LY6A 2V1UA 2DZNB 3W0LB 2L7IA 1Q3CA 1SXJD 3FTCA 3L26A 2P5TA 1W5SA 4LF7M 3KS8A 2DWNA 3L28A 4JI2M 3K2LA 1LV7A 2VQEM 4JI8M 1EE8A 4MGYE 2QENA 3JR4A 3HJSA 1X37A 1IBLM 4G4RA 4PCZA 3K8ZA 1VDDA 4IBEA 1TGUA 5EXXA 4I8OA 2HKJA 4II7A 3M0EA 1K3WA 1H6UA 2D7HA 5ITXA 2QBYA 1TH3A 5DNYA 3UMMA 5JI3E 3U6DA 1GKIA 4PDIA 4JI1M 2E5LM 3D8LA 3SC3A 3H4MA 3AOEA 1N34M 3HHWA 1C1KA 1Q3BA 5KPZA 3KOYE 4FWHA 2UUCM 3GRYA 3WHLA 4GHAA 4DR6M 5EP4A 1SXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OU7 A; 
#chains in the Genus database with same CATH topology
 3SMS A;  3KW6 A;  2I7P A;  1Y8G A;  3RGS A;  4LF4 M;  2EUC A;  2X49 A;  3J81 S;  2KNZ A;  4B08 A;  1J7K A;  4TUW A;  4Z6Y A;  5EJC A;  4NOO B;  2QBY B;  3ZC7 B;  4RNA A;  3JR5 A;  1OQY A;  3UGJ A;  5FLX S;  4DV6 M;  4JI7 M;  3ZQJ A;  1CUK A;  2M60 A;  3GRR A;  2FOI C;  1C7Y A;  1WJ7 A;  5DFL A;  2WSF F;  2CEA A;  2JY6 B;  1DGG A;  1HT2 E;  1ZAE A;  2DZO B;  1HNW M;  3HGI A;  2CRU A;  1KSF X;  4BB9 A;  3GP1 A;  4FW9 A;  3M7G A;  3B7N A;  2A5Y B;  2C9O A;  4A3V B;  1TH4 A;  3C9P A;  3GQ3 A;  3C58 A;  3GLH A;  4Z8X A;  1Z59 A;  3B89 A;  2ZAM A;  5ITU A;  1G71 A;  1I4W A;  4X66 M;  3IEC A;  1E94 E;  4NRV A;  3GRU A;  3NBI A;  2BWE A;  1DGB A;  3J7A S;  3FUU A;  1XHB A;  3VKG A;  3L29 A;  3PNY A;  3DFZ A;  4JI6 M;  2V1C A;  1I94 M;  3CF0 A;  3FUW A;  1L2C A;  4M0W A;  3B7Z A;  1TR8 A;  4OX9 M;  1R5L A;  4LJ4 A;  4IIW A;  2JA2 A;  4B3T M;  3BOS A;  2D7G A;  3ILK A;  1N36 M;  4NXM M;  4L8R C;  1R7R A;  2OPF A;  4DR3 M;  3D8B A;  3KOZ E;  4LRS A;  1AIP C;  2QHO B;  4FD2 A;  4LZZ A;  3E21 A;  3LQQ A;  1KYI A;  1YE9 A;  3GLH B;  5FSW A;  1OKS A;  2CFO A;  4L78 A;  1OJL A;  1S3S A;  5EXT A;  1N75 A;  2XSZ D;  3VDU A;  2R6F A;  2Q2E B;  3I4Y A;  3FTF A;  5GKN A;  5EP3 A;  1ORY B;  2ZTC A;  1L8Q A;  3LW5 F;  3GLI E;  3EIE A;  2JNH A;  1XC8 A;  3GLI A;  3U61 B;  1Z5C A;  3PVS A;  4GEW A;  4QNR A;  3U6E A;  4GIP A;  1D0M A;  1NNJ A;  4B3R M;  4AI6 A;  3A98 B;  1K3X A;  4LJ6 A;  1UM8 A;  4IBF A;  3H4J A;  4DR5 M;  1R2Z A;  3LMM A;  2LVA A;  3GLF A;  4PD2 A;  2KA6 B;  1Q39 A;  4X65 M;  5BPV A;  1TF0 B;  2C9C A;  3FYC A;  1QQW A;  2XEP A;  1NHW C;  4G6Z A;  4DV7 M;  4DV2 M;  1KFV A;  1NJG A;  1IBK M;  1N78 A;  2CV1 A;  1IY1 A;  4QHT A;  1PJQ A;  2Y21 A;  4F1I A;  2QCU A;  3SBJ A;  4QOS A;  3CF6 E;  1GLN A;  2XFT A;  2Z4R A;  2ZTD A;  3CF2 A;  3K9P A;  1ZQ9 A;  2AHM A;  4JI3 M;  5EP1 A;  3MK6 A;  2Y20 A;  2XGN A;  3GLI B;  4NSO B;  2L09 A;  4DUY M;  3UZU A;  1IQP A;  2BNK A;  2YFQ A;  2DVW B;  2EJS A;  1PJS A;  2G3Q A;  1R6B X;  2XSZ A;  4F2L A;  3U6L A;  2DXI A;  1IN4 A;  2GNO A;  2CV0 A;  4M9X A;  7CAT A;  2BJW A;  4D80 A;  4HEO A;  2LH0 A;  1FNN A;  2QP9 X;  2FH0 A;  4AKH A;  1LTM A;  3BBZ A;  3TWL A;  3AV0 A;  5BR8 M;  4WUR A;  4I4L A;  5A2Q S;  2Z3X A;  3KP1 E;  2ZAO A;  4LGM A;  4MGK E;  3TWK A;  1PJI A;  2KRK A;  4IJE A;  1T43 A;  3IHP A;  3GPX A;  4JYA M;  2APL A;  4P17 A;  4AW4 A;  3QYB A;  5L8R F;  3L25 A;  3E46 A;  1E9R A;  4LGY A;  2CV2 A;  4LJ8 A;  5LMU M;  3V76 A;  1IFY A;  4W5W A;  4ITQ A;  1MN3 A;  2LVN C;  3MHV C;  1D2N A;  4AG6 A;  5ITX E;  1DGF A;  2H5X A;  4GKJ M;  1DGH A;  2JZ1 A;  5KPR A;  1NO1 A;  3OTO M;  1NNU C;  1EFU B;  3CTW B;  2EKK A;  4JV5 M;  2QQ8 A;  2LVO C;  5KO3 A;  4LF8 M;  1XB2 B;  2LHC A;  2DHY A;  3HZJ A;  1MX0 A;  3U6Q A;  4NSR A;  4M9S A;  3F92 A;  1VG5 A;  2D7E A;  1QYR A;  3TE6 A;  1SXJ E;  2R46 A;  4MGI E;  2FNA A;  3SHF A;  3HHX A;  1OFH A;  2MR9 A;  5E26 A;  4MM3 B;  3U6P A;  1QDR A;  4KO8 A;  5F3W A;  2CHQ A;  3AL0 C;  3GRV A;  5ITT A;  4NL4 H;  1XNQ M;  3M6A A;  1DGH B;  4IBK A;  4AQY M;  4EIW A;  4GHL A;  4DR4 M;  4RKU F;  2CHG A;  2O25 A;  2CWB A;  3RGP A;  3QAU A;  2MGW A;  5EP2 A;  1G41 A;  1PRB A;  1VEK A;  4MB7 A;  4HL4 A;  3L27 A;  3T1H M;  2F5Q A;  1V33 A;  4CIZ A;  4NRW A;  1Q02 A;  1K82 A;  2HHH M;  1SXJ B;  3J27 B;  1TTE A;  3FKE A;  3A45 A;  3GLH E;  1N77 A;  5ITR A;  3FTE A;  3LQR A;  1QVR A;  2HAK A;  2F5P A;  5JI2 E;  1VEG A;  1J09 A;  2R4J A;  3IG8 A;  1IXR C;  3TWM A;  4LG2 A;  2YNM D;  2XF3 A;  2RKO A;  1R4G A;  3VFD A;  3U6C A;  2KRU A;  1J5E M;  4Y28 F;  3GQ5 A;  2KXE A;  1GL6 A;  4CGY B;  3R8F A;  1HJP A;  3I51 A;  2UUB M;  1N32 M;  4KOD A;  1VQ1 A;  4DV0 M;  4I81 A;  3KVW A;  2DZL A;  4FCW A;  3FRH A;  2ERC A;  2Z8Y M;  1OIZ A;  2K9D A;  2JY5 A;  4OVZ A;  4LFB M;  2R62 A;  3TPZ A;  3B74 A;  1UFZ A;  1W5T A;  1JR3 D;  3AOE C;  2KNV A;  1HR0 M;  1JQJ C;  2LNH C;  3RFW A;  3K1J A;  4DV5 M;  3KFU G;  2DHR A;  3HU1 A;  3THG A;  4CHT B;  1SXJ C;  8CAT A;  1QAN A;  5FTM A;  1QZE A;  2DAM A;  3GLG E;  4IBB A;  1F4I A;  3KSJ A;  2F5O A;  1V92 A;  3GLG A;  1L1T A;  4BBA A;  4AKI A;  4X62 M;  2EO2 A;  4JXJ A;  1L2B A;  2L6O A;  4GRI A;  1TDH A;  2O01 F;  2Z7J A;  4DR1 M;  4B3M M;  1HT1 E;  1NHG C;  5ITY A;  5DYI A;  1WGN A;  2UUA M;  1V34 A;  3GLF E;  2C99 A;  3E9S A;  3B9P A;  3T1Y M;  4IBJ A;  4DUZ M;  1R2Y A;  3FUV A;  4D82 A;  4I5S A;  3J7B A;  3U60 A;  1XWI A;  2C5R A;  3T15 A;  1NV8 A;  3A46 A;  3SAS A;  4PT5 A;  2J7O A;  3LVV A;  2JP7 A;  3VKH A;  3GLG B;  3BXW A;  4R3D A;  5IT9 S;  1JR3 A;  1IM2 A;  3HKP A;  3UK6 A;  2VDB B;  1TDZ A;  2M5Z A;  2H1R A;  4L6V 6;  4LZJ A;  5C1B A;  4UN2 B;  1NSF A;  4JI5 M;  3HJQ A;  4JN6 A;  2FFJ A;  4REZ A;  1QUS A;  1OAO C;  1IN6 A;  2DAE A;  3QYE A;  3B7Q A;  2W82 A;  4IBG A;  1XMQ M;  1XNR M;  4P16 A;  3UJN A;  3SYL A;  1L2D A;  1G59 A;  3EIH A;  3GPP A;  4WW0 A;  1WHC A;  3HX3 A;  3K92 A;  3GLF B;  1HNZ M;  2J5Y A;  3NBX X;  5KQD A;  1NY5 A;  2DAG A;  4XBO A;  4DBG B;  1IY0 A;  3K9O A;  2KZS A;  2MRO B;  4OU7 A;  3VDP A;  3FYD A;  3KSX A;  2DKL A;  3HJ8 A;  5KPT A;  4OW0 A;  2VII A;  1IBM M;  2F5N A;  2KZU A;  1DO2 A;  4LFC M;  2UXB M;  5EXS A;  3LVW A;  2UU9 M;  1VDL A;  2WSE F;  4FCV A;  4CJ6 A;  1SG9 A;  4NC6 A;  3W67 A;  3Q8X A;  3HHY A;  1NVM A;  2FS1 A;  4ZPX A;  4L4U A;  3R9X B;  2DWL A;  3PXG A;  2G8L A;  5FTK A;  4ANR A;  3GPY A;  5LMN M;  1QDT A;  3FRI A;  3VK7 A;  1QZM A;  1AUA A;  1BVS A;  4LJ7 A;  4GKK M;  4FWG A;  3J2P B;  2XFS A;  1D0L A;  4DR7 M;  2KW0 A;  4L15 A;  1IN5 A;  3WHK A;  4QNM A;  3HU2 A;  2K0B X;  4YY3 M;  5FTN A;  2WSC F;  4G3O A;  3SFZ A;  3FUT A;  2RGO A;  2JXN A;  3FD9 A;  3A42 A;  4LCB A;  1G8P A;  3FTD A;  4G4Q A;  3W68 A;  2R45 A;  1P3Q Q;  2JUJ A;  1T3T A;  3HHZ A;  2C98 A;  2ZBK B;  4MH0 E;  5H37 D;  3PFI A;  3NWL A;  2R18 A;  2UXC M;  1QAO A;  3LCU A;  4IBI A;  4LF6 M;  1XMO M;  1OFI A;  3SAT A;  5DYG A;  3GO8 A;  2V6Z M;  2Z4S A;  4B7H A;  2FE8 A;  2LVP C;  1G3I A;  2ZM6 M;  2F5S A;  1PM5 A;  3KOX E;  2CHV A;  1ZMW A;  2DNA A;  2L4E A;  1TH2 A;  1MU5 A;  4FWD A;  3TL4 X;  1WXQ A;  2C96 A;  3J80 S;  1G4A E;  1Z5B A;  3PNV A;  4LJ9 A;  4LJ5 A;  3DZD A;  4S12 A;  1YSY A;  2X8A A;  3VK8 A;  4XGI A;  1YUB A;  1HQC A;  2R4E A;  2N35 A;  2DI0 A;  2GQF A;  1PJT A;  2KEB A;  4B7G A;  1IXS A;  3SYK A;  4AG5 A;  5IZ7 D;  4PDG A;  1N33 M;  4RF0 A;  4IBD A;  2NQ8 C;  3W0F A;  2Y0Q A;  3QWL A;  1E9S A;  2HCB A;  2KNA A;  2X4A A;  1WIV A;  4KT0 F;  4MGZ E;  4AZF A;  4JI0 M;  1QUT A;  4WP2 A;  2QSF X;  3FUX A;  2EA0 A;  2B3T A;  4JI4 M;  2CE7 A;  2MJ5 B;  2G5G X;  5C18 A;  1NY6 A;  4L16 A;  4BLC A;  3U6M A;  4R7G A;  3SAU A;  4M9Z A;  3MJ5 A;  1A5T A;  3Q8G A;  1DO0 A;  2CUZ A;  4GH9 A;  3SHG B;  3SAR A;  2DEN A;  1VEJ A;  2DAI A;  2RRU A;  2Y0T A;  2CP8 A;  3DA1 A;  3FE3 A;  4IJF A;  4LFA M;  5FTL A;  2QPA A;  3JAM S;  5EXP A;  1HQY E;  5EQT A;  2L7H A;  1IXS B;  2BWB A;  2XZU A;  3I01 M;  2R65 A;  3KS4 A;  3TQS A;  4B7F A;  4DR2 M;  2WZJ A;  3SAV A;  1E32 A;  1OAI A;  2EKF A;  2ZAN A;  1GJS A;  3C3D A;  5FTJ A;  4D81 A;  1D0K A;  3KXE C;  1FJG M;  3HY5 A;  1QAQ A;  4GC9 A;  1T6O A;  1Z6T A;  4HLQ A;  3MMP A;  3DOA A;  4IBC A;  1WGL A;  4NXN M;  3U61 A;  4DV4 M;  1IY2 A;  2DWZ B;  3VLF B;  3KDS E;  3GPU A;  1QAM A;  3SAW A;  3KOW E;  4OVZ B;  2DWM A;  3U6O A;  3SMP A;  2KDL A;  3AFH A;  4X64 M;  2UXD M;  2VQF M;  2L4F A;  5E6J A;  2HL7 A;  2F4V M;  1GVN A;  4G4N A;  2QZ4 A;  2LXE A;  1ZMV A;  2K6B A;  3GQ4 A;  2O5R A;  1ZMU A;  4QHS A;  1MJG M;  1ZV1 A;  2RGH A;  4LJA A;  4DV1 M;  2I7N A;  2XZF A;  3U5Z A;  4QOZ C;  3LCV B;  1JR3 E;  2BJV A;  4GIT A;  2LWX A;  2J7N A;  2YR0 A;  3HU3 A;  4LF5 M;  4CIS A;  1GJT A;  5IWA M;  2JWS A;  4G4O A;  2OQ4 A;  4YHH M;  1L1Z A;  2JY7 A;  1GAB A;  1YLA A;  2XH9 A;  1GO5 A;  2MH8 A;  4FCT A;  2XLJ A;  1NV9 A;  1XXH E;  3E4R A;  1PJJ A;  3AJI B;  3I4V A;  4MGH A;  3ZH9 B;  3AOG A;  1OTR A;  1XXH A;  3RE8 A;  4AKG A;  1NJF A;  5ITQ A;  1HNX M;  3KP0 E;  3T38 A;  4KHP M;  3ZCB B;  1GL7 A;  4DV3 M;  3U60 B;  3T6P A;  4GC5 A;  1IN8 A;  1IXZ A;  2HWJ A;  1Z5A A;  2KHH A;  5IRE B;  4M0D A;  3U5Z B;  4LRT A;  2LHG A;  4RF1 A;  2R44 A;  4K0K M;  3AKZ A;  3IG5 A;  2DAK A;  2LTU A;  1IN7 A;  3L2A A;  4KLN A;  4R71 A;  2VF8 A;  4B3S M;  3HWS A;  2OOB A;  5KQ8 A;  3U6S A;  2JY8 A;  1XXH B;  2OOA A;  4FVM A;  4GMQ A;  2LBC A;  4LF9 M;  2YQZ A;  2K47 A;  1RU3 A;  2R0I A;  4LY6 A;  2V1U A;  2DZN B;  3W0L B;  2QNJ A;  2L7I A;  1JB0 F;  1Q3C A;  4XK8 F;  1WR1 B;  1SXJ D;  3FTC A;  3L26 A;  2P5T A;  1W5S A;  4LF7 M;  3KS8 A;  2DWN A;  2VF7 A;  3L28 A;  4JI2 M;  3K2L A;  1LV7 A;  2VQE M;  4JI8 M;  1EE8 A;  2LVQ D;  4MGY E;  2QEN A;  3JR4 A;  3C3E A;  3HJS A;  1X37 A;  4Q7J A;  1IBL M;  4G4R A;  4PCZ A;  3K8Z A;  1OIP A;  2OO9 A;  2L2D A;  2JZ0 A;  1VDD A;  4IBE A;  1TGU A;  5EXX A;  1DV0 A;  4I8O A;  2HKJ A;  4II7 A;  3M0E A;  1K3W A;  1H6U A;  2D7H A;  1PGY A;  5ITX A;  2QBY A;  1TH3 A;  5DNY A;  3CGW A;  3UMM A;  5JI3 E;  3U6D A;  1GKI A;  4PDI A;  3I04 M;  4JI1 M;  2E5L M;  3D8L A;  1EIJ A;  3SC3 A;  3H4M A;  3AOE A;  1N34 M;  3HHW A;  1C1K A;  1Q3B A;  5KPZ A;  3KOY E;  4FWH A;  2UUC M;  3GRY A;  3WHL A;  4GHA A;  4DR6 M;  5EP4 A;  1SXJ A; 
#chains in the Genus database with same CATH homology
 3SMS A;  3KW6 A;  2I7P A;  3RGS A;  4LF4 M;  2EUC A;  2X49 A;  3J81 S;  4B08 A;  1J7K A;  4TUW A;  4Z6Y A;  5EJC A;  4NOO B;  2QBY B;  3ZC7 B;  4RNA A;  3JR5 A;  3UGJ A;  5FLX S;  4DV6 M;  4JI7 M;  2M60 A;  3GRR A;  2FOI C;  2CEA A;  1DGG A;  1HT2 E;  1ZAE A;  2DZO B;  1HNW M;  3HGI A;  1KSF X;  4BB9 A;  3GP1 A;  4FW9 A;  3M7G A;  2A5Y B;  2C9O A;  4A3V B;  1TH4 A;  3GQ3 A;  3C58 A;  3GLH A;  4Z8X A;  1Z59 A;  2ZAM A;  5ITU A;  1I4W A;  4X66 M;  1E94 E;  4NRV A;  3GRU A;  3NBI A;  3J7A S;  1DGB A;  3FUU A;  1XHB A;  3VKG A;  3L29 A;  3PNY A;  3DFZ A;  4JI6 M;  2V1C A;  1I94 M;  3CF0 A;  3FUW A;  1L2C A;  4M0W A;  4OX9 M;  4LJ4 A;  4IIW A;  2JA2 A;  3BOS A;  2D7G A;  3ILK A;  1N36 M;  4NXM M;  4L8R C;  1R7R A;  2OPF A;  4DR3 M;  3D8B A;  3KOZ E;  4LRS A;  4FD2 A;  4LZZ A;  3LQQ A;  1KYI A;  1YE9 A;  3GLH B;  5FSW A;  2CFO A;  4L78 A;  1OJL A;  1S3S A;  5EXT A;  1N75 A;  2XSZ D;  3VDU A;  2Q2E B;  3I4Y A;  3FTF A;  5GKN A;  5EP3 A;  1ORY B;  1L8Q A;  3EIE A;  1XC8 A;  3GLI A;  3U61 B;  1Z5C A;  3PVS A;  4QNR A;  3U6E A;  4GIP A;  1NNJ A;  4B3R M;  4AI6 A;  3A98 B;  1K3X A;  4LJ6 A;  1UM8 A;  4IBF A;  4DR5 M;  1R2Z A;  3LMM A;  3GLF A;  4PD2 A;  1Q39 A;  2KA6 B;  4X65 M;  5BPV A;  2C9C A;  3FYC A;  4G6Z A;  1QQW A;  2XEP A;  1NHW C;  4DV7 M;  1KFV A;  4DV2 M;  1NJG A;  1IBK M;  1N78 A;  2CV1 A;  1IY1 A;  4QHT A;  2Y21 A;  2QCU A;  3SBJ A;  4QOS A;  3CF6 E;  1GLN A;  2XFT A;  2Z4R A;  3CF2 A;  2F5P A;  4B3T M;  1ZQ9 A;  2AHM A;  4JI3 M;  5EP1 A;  3MK6 A;  2Y20 A;  2XGN A;  3GLI B;  4NSO B;  2L09 A;  4DUY M;  3UZU A;  1IQP A;  2BNK A;  2YFQ A;  2DVW B;  1R6B X;  2XSZ A;  3U6L A;  2DXI A;  1IN4 A;  2CV0 A;  4M9X A;  7CAT A;  2BJW A;  4D80 A;  2LH0 A;  1FNN A;  2QP9 X;  4AKH A;  3TWL A;  3AV0 A;  5BR8 M;  4WUR A;  4I4L A;  5A2Q S;  2Z3X A;  3KP1 E;  2ZAO A;  4LGM A;  4MGK E;  3TWK A;  1PJI A;  2KRK A;  4IJE A;  3GPX A;  4JYA M;  4AW4 A;  3L25 A;  1E9R A;  4LGY A;  2CV2 A;  4LJ8 A;  5LMU M;  4W5W A;  4ITQ A;  3MHV C;  1D2N A;  4AG6 A;  5ITX E;  1DGF A;  4GKJ M;  1DGH A;  5KPR A;  3OTO M;  1NNU C;  3CTW B;  4JV5 M;  5KO3 A;  4LF8 M;  1MX0 A;  3U6Q A;  4NSR A;  4M9S A;  2D7E A;  1QYR A;  3TE6 A;  1SXJ E;  2R46 A;  4MGI E;  2FNA A;  3SHF A;  3HHX A;  1OFH A;  5E26 A;  4MM3 B;  3U6P A;  4KO8 A;  5F3W A;  2CHQ A;  3AL0 C;  3GRV A;  5ITT A;  4NL4 H;  1XNQ M;  3M6A A;  1DGH B;  4IBK A;  4AQY M;  4EIW A;  4GHL A;  4DR4 M;  2CHG A;  3RGP A;  3QAU A;  5EP2 A;  1G41 A;  4MB7 A;  4HL4 A;  3L27 A;  3T1H M;  2F5Q A;  4NRW A;  1K82 A;  2HHH M;  1SXJ B;  3J27 B;  3FKE A;  3A45 A;  1N77 A;  5ITR A;  3FTE A;  3LQR A;  1QVR A;  5JI2 E;  1J09 A;  2R4J A;  3IG8 A;  1IXR C;  3TWM A;  4LG2 A;  2YNM D;  2XF3 A;  2RKO A;  3VFD A;  3U6C A;  2KRU A;  1J5E M;  3GQ5 A;  2KXE A;  1GL6 A;  4CGY B;  3R8F A;  2UUB M;  3I51 A;  1N32 M;  4KOD A;  4DV0 M;  4I81 A;  3KVW A;  4FCW A;  2ERC A;  4OVZ A;  4LFB M;  2R62 A;  3TPZ A;  1W5T A;  1JR3 D;  3AOE C;  1HR0 M;  1JQJ C;  2LNH C;  3RFW A;  3K1J A;  4DV5 M;  3KFU G;  2DHR A;  3HU1 A;  3THG A;  4CHT B;  1SXJ C;  8CAT A;  1QAN A;  5FTM A;  4IBB A;  3KSJ A;  2F5O A;  3GLG A;  1L1T A;  4BBA A;  4AKI A;  4X62 M;  2EO2 A;  4JXJ A;  1L2B A;  2L6O A;  4GRI A;  1TDH A;  2Z7J A;  4DR1 M;  4B3M M;  1HT1 E;  1NHG C;  5ITY A;  5DYI A;  2UUA M;  2C99 A;  3E9S A;  3B9P A;  3T1Y M;  4IBJ A;  4DUZ M;  1R2Y A;  3FUV A;  4D82 A;  4I5S A;  3J7B A;  3U60 A;  1XWI A;  2C5R A;  3T15 A;  3A46 A;  3SAS A;  4PT5 A;  2J7O A;  3LVV A;  3VKH A;  3GLG B;  5IT9 S;  4R3D A;  1JR3 A;  1IM2 A;  3HKP A;  3UK6 A;  1TDZ A;  2M5Z A;  2H1R A;  4LZJ A;  5C1B A;  1NSF A;  4JI5 M;  3HJQ A;  4JN6 A;  2FFJ A;  4REZ A;  4IBG A;  1IN6 A;  1XNR M;  1XMQ M;  2W82 A;  4P16 A;  3UJN A;  3SYL A;  1L2D A;  1G59 A;  3EIH A;  3GPP A;  4WW0 A;  3GLF B;  3K92 A;  1HNZ M;  5KQD A;  1NY5 A;  4XBO A;  1IY0 A;  2KZS A;  4OU7 A;  3VDP A;  3FYD A;  3KSX A;  3HJ8 A;  5KPT A;  4OW0 A;  2VII A;  1IBM M;  2F5N A;  2KZU A;  1DO2 A;  4LFC M;  2UXB M;  5EXS A;  3LVW A;  2UU9 M;  4FCV A;  3Q8X A;  3HHY A;  1NVM A;  4ZPX A;  4L4U A;  3R9X B;  2DWL A;  3PXG A;  2G8L A;  5FTK A;  3GPY A;  5LMN M;  3VK7 A;  1QZM A;  4LJ7 A;  4GKK M;  4FWG A;  3J2P B;  2XFS A;  4DR7 M;  2KW0 A;  4L15 A;  1IN5 A;  3WHK A;  4QNM A;  3HU2 A;  4YY3 M;  5FTN A;  3SFZ A;  3FUT A;  2RGO A;  3FD9 A;  3A42 A;  4LCB A;  1G8P A;  3FTD A;  4G4Q A;  2R45 A;  3HHZ A;  1T3T A;  2C98 A;  2ZBK B;  4MH0 E;  5H37 D;  3PFI A;  3NWL A;  2R18 A;  2UXC M;  1QAO A;  4IBI A;  4LF6 M;  1XMO M;  1OFI A;  3SAT A;  5DYG A;  3GO8 A;  2V6Z M;  2Z4S A;  4B7H A;  2FE8 A;  1G3I A;  2ZM6 M;  2F5S A;  1PM5 A;  3KOX E;  2CHV A;  1TH2 A;  1MU5 A;  4FWD A;  3TL4 X;  1WXQ A;  2C96 A;  3J80 S;  1G4A E;  1Z5B A;  3PNV A;  4LJ9 A;  4LJ5 A;  3DZD A;  4S12 A;  1YSY A;  2X8A A;  3VK8 A;  4XGI A;  1YUB A;  1HQC A;  2R4E A;  2KEB A;  4PDG A;  4B7G A;  3SYK A;  4AG5 A;  5IZ7 D;  1N33 M;  4RF0 A;  4IBD A;  2NQ8 C;  3W0F A;  2Y0Q A;  3QWL A;  1E9S A;  2HCB A;  2X4A A;  4AZF A;  4MGZ E;  4JI0 M;  3FUX A;  2EA0 A;  4JI4 M;  2CE7 A;  2G5G X;  5C18 A;  1NY6 A;  4L16 A;  4BLC A;  3U6M A;  4R7G A;  3SAU A;  4M9Z A;  3MJ5 A;  1DO0 A;  2CUZ A;  4GH9 A;  3SHG B;  3SAR A;  2Y0T A;  4IJF A;  3DA1 A;  4LFA M;  5FTL A;  2QPA A;  3JAM S;  5EXP A;  1HQY E;  5EQT A;  2L7H A;  1IXS B;  2XZU A;  2R65 A;  3KS4 A;  3TQS A;  4B7F A;  4DR2 M;  3SAV A;  1E32 A;  2ZAN A;  5FTJ A;  4D81 A;  3KXE C;  1FJG M;  4GC9 A;  1QAQ A;  4HLQ A;  1Z6T A;  3DOA A;  4IBC A;  4NXN M;  3U61 A;  4DV4 M;  1IY2 A;  2DWZ B;  3VLF B;  3KDS E;  3GPU A;  1QAM A;  3SAW A;  3KOW E;  4OVZ B;  2DWM A;  3U6O A;  3SMP A;  3AFH A;  4X64 M;  2UXD M;  2VQF M;  2F4V M;  5E6J A;  2HL7 A;  1GVN A;  4G4N A;  2QZ4 A;  2LXE A;  3GQ4 A;  2O5R A;  4QHS A;  2RGH A;  4LJA A;  4DV1 M;  2I7N A;  2XZF A;  3U5Z A;  4QOZ C;  2BJV A;  4GIT A;  2LWX A;  2J7N A;  2YR0 A;  3HU3 A;  4LF5 M;  4CIS A;  5IWA M;  4G4O A;  2OQ4 A;  4YHH M;  1L1Z A;  2XH9 A;  4FCT A;  2XLJ A;  1PJJ A;  3E4R A;  3AJI B;  3I4V A;  4MGH A;  3ZH9 B;  3AOG A;  1XXH A;  3RE8 A;  4AKG A;  1NJF A;  5ITQ A;  1HNX M;  3KP0 E;  3T38 A;  4KHP M;  3ZCB B;  1GL7 A;  4DV3 M;  3U60 B;  4GC5 A;  1IN8 A;  1IXZ A;  1Z5A A;  5IRE B;  4M0D A;  3U5Z B;  4LRT A;  4RF1 A;  4K0K M;  3AKZ A;  3IG5 A;  4KLN A;  1IN7 A;  3L2A A;  4B3S M;  3HWS A;  5KQ8 A;  3U6S A;  1XXH B;  4FVM A;  4GMQ A;  4LF9 M;  2YQZ A;  2K47 A;  4LY6 A;  2V1U A;  2DZN B;  3W0L B;  2L7I A;  1Q3C A;  1SXJ D;  3FTC A;  3L26 A;  2P5T A;  1W5S A;  4LF7 M;  3KS8 A;  2DWN A;  3L28 A;  4JI2 M;  3K2L A;  1LV7 A;  2VQE M;  4JI8 M;  1EE8 A;  4MGY E;  2QEN A;  3JR4 A;  3HJS A;  1X37 A;  1IBL M;  4G4R A;  4PCZ A;  3K8Z A;  1VDD A;  4IBE A;  1TGU A;  5EXX A;  4I8O A;  2HKJ A;  4II7 A;  3M0E A;  1K3W A;  1H6U A;  2D7H A;  5ITX A;  2QBY A;  1TH3 A;  5DNY A;  3UMM A;  5JI3 E;  3U6D A;  1GKI A;  4PDI A;  4JI1 M;  2E5L M;  3D8L A;  3SC3 A;  3H4M A;  3AOE A;  1N34 M;  3HHW A;  1C1K A;  1Q3B A;  5KPZ A;  3KOY E;  4FWH A;  2UUC M;  3GRY A;  3WHL A;  4GHA A;  4DR6 M;  5EP4 A;  1SXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...