1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
3PTGA 5I9WA 4U5JA 5DIAA 5EDRA 5AV0A 3C5UA 4E5WA 5DH3A 4F65A 3NDMA 1Q41A 2VN9A 4DEGA 5K9IA 4J96A 5J9YA 4BGGA 4QOXA 5L2IA 2UUEA 4C4IA 1KWPA 3R7GA 1Q62A 4ZTMA 3DBCA 2VWBA 4F0FA 3GU4A 3BHUA 5C03A 2B52A 4FV4A 4YO4A 2QONA 3QTIA 4LGGA 2VGPA 4IJ9A 3BI6A 4RIWB 3ROCA 5HLNA 4HZSA 4BTKA 4W4XA 4ZZOA 3IW8A 2J9MA 1PXNA 2VO6A 3PIYA 3ZYAA 2C0OA 2EJSA 3UOJA 3R02A 2UW8A 3EKKA 5DEWA 3ULZA 3FI8A 3HA6A 3PA3A 3E21A 4M8TA 1YXVA 2PE2A 4C62A 4EHVA 5D7AA 3VF8A 3AD6A 1JKSA 2IZUA 4XS2A 2FSTX 4EOSA 5IDPA 3CQEA 4QPMA 4QMYA 4L9IA 3F3VA 4DH5A 3IK3A 2J0JA 4UYNA 4S30A 3S4QA 5A4TA 1H00A 3UYSA 2OI4X 4C38A 2PU8A 5J7HA 2HXQA 1PW2A 2O2UA 4QTDA 2B54A 4R1VA 2DYLA 4L52A 4QTAA 4A9RA 3CD8A 1HOWA 2WQOA 3IO7A 3QYWA 3PWDA 5BMSA 1NY3A 3AGLA 5CALA 2H34A 4NL0A 4BCHA 2UW9A 3IW5A 4HVIA 4OTGA 4RVLA 3A4OX 3ANRA 4EYMA 2PSQA 3BLHA 4FV7A 1SNXA 4O0VA 4RSSA 4HEOA 3TDVA 2JGZA 4AOIA 3NUUA 3EQHA 3QKLA 5CT0A 2I0VA 2W06A 3GOKA 3HA8A 3PP1A 2C3KA 4UZHA 4AA0A 3LAUA 4JG8A 1ZY4A 2QOIA 5DR6A 1GNGA 4EH5A 1JWHA 4IDTA 5IQAA 1JSTA 4F9WA 3GB2A 5L2WA 4FSQA 3HAVA 2GQGA 3OG7A 5ACKA 3RCDA 5EOBA 2PL0A 2XK9A 5BVFA 5BVDA 2Y9QA 3ZRLA 4M69A 2OZOA 4NWMA 2I0YA 2WIHA 4RT7A 4QP9A 4UZDA 1WZYA 5CYIA 5B2MA 3K3IA 4K33A 3W2QA 3NVKI 3F88A 1TQIA 5D11A 3NSZA 4X2JA 4FGBA 2QVSE 3LJ2A 3DXQA 2OF2A 4U79A 3BYVA 3SXFA 4GEWA 2X9EA 3SAYA 3FYKX 3RPRA 5EQPA 2YABA 3UIUA 5A4EA 2CJMA 3IOPA 3R7EA 5KX8A 5BYYA 3T9IA 4ITHA 4RA4A 4ORKA 3QQJA 2W1CA 2R3GA 3MVMA 3SOCA 3PPZA 3FYJX 4QP6A 1AGWA 2F4JA 4EKLA 4KA3A 1VG5A 4CT1A 4RC4A 2H9VA 3BLQA 4WOVA 2YM8A 3AMAA 1P5EA 5F4NA 3VO3A 1EH4A 3L9LA 4PTCA 3CY2A 3QXOA 3KXGA 1RE8A 3DJ7A 4K6ZA 4FV8A 2WELA 4K8AA 2W4KA 4ITIA 4JQEA 4EJ7A 4L44A 5EOLA 2HELA 4L43A 4L3PA 4ZTRA 4LYNA 4AA4A 5CF8A 5HCYA 3Q2MA 5M55A 4NCTA 2BHHA 1KSWA 4BICA 4IWDA 1H01A 3RINA 3PXQA 3FQEA 4BKYA 2CPKE 5HI2A 2GFCA 2GMXA 1H0VA 1Q8WA 5D10A 1WGLA 3PFQA 3RM7A 1DM2A 1H4LA 2QCSA 3PVBA 3CEKA 3Q53A 3Q96A 3NMUF 1U46A 3ZXZA 4ZJIA 2E2BA 3POOA 2UW6A 4MKCA 2DI0A 1WBWA 2B4SB 4I6HA 5EDPA 5HEZA 5CEMA 3R0TA 5GNKA 5HO7A 3LLAA 1R1WA 3DA6A 2C5OA 2YM6A 3MESA 2PZRA 4EONA 1M2QA 5BUJA 2C6OA 4I6FA 1JNKA 4KD1A 5CSXA 2UVXA 2P2IA 2ZMDA 3UO4A 4I23A 4X2NA 2PK9A 4JIKA 3T6PA 3F66A 4P4CA 3OY3A 3WYXA 4MD7E 2ESMA 3F69A 2VWWA 5DR2A 4CD0A 4CCUA 3HP2A 4I20A 4QMNA 4QMQA 2BMCA 3MPMA 3JY9A 4WBOA 5M08A 4GG5A 2DENA 3DKCA 4MTAA 5FEQA 4GKHA 3U4UA 5K5XA 3A99A 4ZSAA 3QWKA 3F92A 2OF4A 3UDBA 3LCTA 2WMTA 4BDEA 1URCA 2W1ZA 3GBZA 2QKRA 3AOXA 4H36A 4G3OA 4TWNA 5HG8A 3FMHA 4IHPA 4AGUA 5IA1A 2QG7A 3DPKA 3SVVA 2VZ6A 3MWUA 1XH4A 4BBFA 3W2RA 4DEBA 4XMOA 4RA5A 2R3IA 1WVYA 5E1EA 2WGJA 3GU8A 4G5PA 3Q9ZA 1VDLA 2L2DA 1LR4A 2ITOA 3NCZA 5ETIA 1G3IA 2Z7SA 4TW9A 2HENA 2OXYA 4DFXE 4NZWB 5JGBA 4FTQA 2OIDA 3RNYA 3ORZA 4E6AA 3JR1A 1VR2A 4RPVA 4M68A 5J1VA 5DRBA 2VWZA 3D5VA 4MXCA 2DAGA 2QHNA 3LFBA 3P7CA 3I0QA 1YXSA 4BGQA 2ITQA 1FVTA 5M09A 2VTMA 1ZAOA 3R2BA 2C1BA 4LGHA 1IR3A 4A4OA 3HKOA 3UE4A 4PDSA 3VIDA 2NO3A 3CS9A 4RVKA 4NJDA 3UVRA 3KA0A 1JKLA 2QHOB 1CKPA 4D9UA 3DBDA 5CXZA 4GT5A 4D28A 3BKBA 3F3TA 5A4LA 3QC4A 1DO0A 3QKKA 3PG1A 5HE3A 3UVPA 3CR0A 5H8BA 3TN8A 4A06A 3IW6A 2RRUA 4CCBA 2L4FA 2C6MA 3EZRA 2J5EA 2J5FA 2Z2WA 5CI6A 4DGNA 3E88A 1VYZA 3ZTXA 2DZLA 3UVQA 3A7FA 3B8QA 4U7ZA 4ZTLA 3HDNA 2DKLA 5E8XA 4CMTA 2DAIA 3V51A 1MRYA 1PF8A 3OY1A 4TYIA 2YFXA 1Q3DA 2C0IA 4NKSA 5HU3A 3ITZA 1HQYE 3PY1A 4HYHA 4F08A 5IUHA 3OCTA 4H1MA 3KEXA 4Q9ZA 4ZSEA 1OGUA 3R8VA 3Q2JA 4JDIA 3VS1A 3LCSA 2BZIB 3AT4A 4Q5HA 5AIRA 2J0MB 2JIVA 5AR7A 1K2PA 2PY3A 4L6QA 5KO1A 3QTSA 3POZA 4KKHA 4I4EA 3ZLSA 3PA5A 4E4XA 3SGCA 5DI1A 4FSYA 1PHKA 3QX2A 1GIIA 4M0YA 3MVJA 2FSLX 1GY3A 5ETFA 3TZ8A 3KXXA 3NNWA 3UODA 3I4BA 2JLDA 3Q6UA 4DEHA 4AZWA 2ZVAA 3DDQA 4FT9A 5E90A 5J5TA 4J53A 1U5QA 2DQ7X 3P7BA 3OUNB 5J95A 4F70A 3F7WA 3ZU7A 5CZIA 2XM9A 2R3MA 4DGMA 4GUEA 1WBSA 4FSTA 2P33A 3R2YA 2CN5A 1OKYA 5LJJA 3WARA 3GCVA 3W1FA 4QQCA 1YHWA 4BDGA 1P3QQ 2QSFX 1PMVA 3F2RA 4BZDA 4CNHA 3JS2A 3ODYX 1H1PA 3Q4CA 5TR6A 2HWOA 4JRVA 4XRLA 4MAOA 3U54A 4F6WA 4EHEA 4FV5A 5AUYA 3FZPA 4AOJA 4OBOA 5DT3A 1FQ1B 3GCUA 2BZHB 2OICA 3FMNA 1DI9A 2MGWA 2CLXA 4I4FA 2QR7A 4U3ZA 3BBZA 5IH6A 2W1DA 4KUJA 2Y8OA 5IQDA 3LQ3A 4X6RA 3VBVA 4KIPA 4UY9A 3QX4A 1JR3E 5CAPA 5IA3A 4XV2A 2JBPA 1U54A 4DGOA 4FTIA 3ZC6A 3PWYA 4O22A 4MEDA 4YC8A 3QBNA 2ITWA 2OK1A 4W8EA 3RZBA 5LVPA 4MBIA 4V05A 4BHZA 3C7QA 3D2IA 3RPYA 2WPAA 5HX6A 1OZ1A 1J7IA 3WF8A 3FHRA 3F5GA 5C9CA 5C26A 4QTBA 1PKDA 3FZRA 5B2LA 1OITA 3R9HA 4AFJA 4X0MA 3IDPA 4QP7A 5KMNA 2QHMA 2VTSA 2ERZE 2FSOX 2CMWA 4AU8A 3GI3A 1F5QA 2XBJA 4I41A 1JQHA 4I93A 4QMZA 4PDPA 2QU5A 5DLSA 5A14A 1H8FA 4O7VA 4C4JA 5JFXA 2G9XA 1V0BA 4PF4A 3VS4A 4QTCA 3ALNA 1OL5A 3UZTA 3HV5A 3Q04A 1YRPA 2UZUE 3CCNA 3FKOA 3ZONA 4F09A 3GUBA 2E9VA 2VTIA 1GOLA 2F7EE 4I5HA 4N4SA 5CI7A 5FD2A 3TZMA 3DKGA 5M53A 3RMFA 5IKWA 3ORXA 4YNOA 2EB3A 1PMNA 4UXLA 4NFMA 3S2PA 1J7LA 4YHTA 3TZ7A 1KOBA 3NIZA 1FVRA 1PGYA 5KZ0A 3TJDA 1GIJA 3GC9A 5AR3A 4EJNA 3R73A 1YVJA 4R3RA 4XOYA 5FBOA 4FL1A 1H07A 5A54A 4KBAA 2VTLA 4MX9A 4U43A 5HBEA 3ALOA 1NA7A 4J95A 3RAKA 2BR1A 3F5PA 2X8IA 5BVNA 3KREA 3D9VA 4YUQA 1M14A 5DWRA 4FIFA 4IQ6A 2JKOA 4FEXA 4IM3A 3V5PA 3ID6C 5C01A 3DK3A 2YEXA 4UBAA 3HMOA 3UMWA 1OVEA 2QOQA 4IWQA 2CKPA 5CS6A 1O6LA 3CJFA 2R3RA 1Q8YA 1WVWA 4LFIA 4DN5A 2IG7A 3ORNA 5KMOA 4JI9A 3QRKA 4ACGA 5CEOA 4CMUA 5IA2A 3D7TB 1YXUA 2W5BA 3DQWA 3OWKA 2W96B 3BWJA 4U97A 5AA8A 1FGKA 3UTOA 2OZAB 3AD4A 4D2SA 3KXNA 3EN6A 2BWEA 4EH3A 4FSMA 5HTIA 4EUTA 5ITAA 4TNDA 4O1OA 4JNWA 3DLSA 3GQIA 3WILA 1U54B 2HZNA 3GOPA 1ZLTA 4OBQA 3EWHA 2XJ2A 3F3UA 3EN4A 3FL4A 4ZXTA 3ZEPA 1YI3A 3NS9A 3DAKA 3NLBA 2C5NA 2X81A 3MFSA 4ITJA 3GC8A 2WO6A 3I81A 4P7EA 5TF9A 4D4RA 3H9OA 4JBVA 4JXFA 2ERKA 2VTHA 3VBWA 1FGIA 5HVJA 1QPJA 3MPTA 4L67A 5AUXA 4BTJA 4N57A 4DFBA 5FEEA 2C47A 3TEIA 3UQGA 3VQHA 5GZ8A 5IU2A 3LMHA 5HE1A 4RBLA 4Q7JA 1REJA 4F7JA 5JFSA 2R7BA 3UBDA 3B2TA 4FIIA 5F9EA 3VC4A 4TWCA 4FKGA 2AUHA 2ONLC 4L8MA 4CRLA 2BWBA 2XJ1A 4HJOA 2KHHA 4A9TA 3KMMA 3QTZA 1YQJA 4F6UA 3RPVA 4W4WA 1L8TA 1YOLA 4BCIA 5KMKA 2PUPA 4FV3A 2B9JA 4M7IA 2QOBA 1PY5A 3Q4ZA 4QMWA 3W32A 2JD5A 4O7TA 4NIFA 3U55A 4ASXA 3GGFA 1UU9A 5L8KA 3RCJA 4F1IA 3MDYA 3JPVA 3QRJA 1A9UA 4DFZE 1BLXA 5ANDA 4NEUA 4MWHA 1Q3WA 4NKAA 2B9HA 3P86A 4OGRA 3HRBA 3PUPA 4IVAA 4A07A 4NJ3A 5LWNA 3MV5A 4IBMA 2F7ZE 3DTCA 4H3BA 4NT4A 5M07A 3GT8A 3BYSA 2YAAA 5EG3A 5C27A 4M15A 2X7FA 2JBOA 3E63A 3MFUA 1O6KA 4O0UA 3S00A 2ITPA 4G9RA 3DJ5A 3V04A 1CM8A 2O65A 2GTMA 4DFUA 3HV6A 3D83A 2OH0E 4USDA 5HNBA 5M4CA 4A9UA 1OKZA 4JG7A 4NTTA 3R9RA 1BX6A 5B2KA 5AM6A 5D41A 3LM5A 1Y8YA 2QOFA 3GXLA 2G2IA 2KNZA 3FE3A 2UZBA 1I44A 4YZMA 3HAMA 2SRCA 4B7TA 5E4HA 3SRVB 5IA0A 3H10A 1OBGA 5EM8A 3ZDIA 4AT4A 3WBLA 3RM6A 4C3RA 3JXWA 4Z7HA 4HVSA 4AGCA 3FLYA 4O2PA 4DGGA 1OAIA 3NUXA 3AT2A 2WU6A 2ZMCA 2BRBA 4TY1A 4O7ZA 3R01A 3BYOA 4FV9A 1ZY5A 4X2FA 3NAXA 4IZYA 4OTHA 3VULA 2JDSA 5JH6A 2GNJA 1JSUA 3I0OA 4UMQA 3R1YA 4OBPA 1BL6A 3D5XA 3QGYA 4S34A 4JDJA 2GDOA 3ZSGA 2VWYA 4USEA 4IAIA 4QYYA 2GNLA 3EN5A 3LMGA 4KAOA 2JEDA 4GEOA 3DGKA 4Z7GA 4DGLC 3QAME 4KINA 1OKSA 2Z8CA 4L68A 5J87A 3AC4A 4X3FB 5JQ5A 2W5AA 4EH6A 5IMEA 1OPLA 3ZOSA 4HGSA 5J1WA 2YITA 3JUHA 2LGCA 2WMBA 2UVYA 4XV3A 3ATTA 4IWOA 4OTIA 2JDVA 4ZSLA 3OTUA 3IG7A 4BBMA 3G33A 3EQBA 3OXTA 4M14A 4QNAA 2PMLX 4Y95A 3TV6A 4FT0A 1MQBA 5JK3A 4AT3A 4OT6A 4RIOA 3FRIA 4RVTA 3ZO4A 2XK4A 3R8MA 1CTPE 2OO8X 4UMUA 4OUCA 5AV4A 5JEBA 2HY0A 3E8EA 5L4QA 4FKTA 1H1QA 4FV2A 4IB5A 3VBQA 4FKPA 3OW3A 5A3XA 1E9HA 5HESA 4WHZA 4ACDA 1TQPA 4FT7A 2UV2A 5K0XA 3NW5A 4FVQA 1QMZA 5DHJA 4HPTE 3A7HA 4QYHA 4FZDB 3TCPA 4ALUA 3OVVA 5F1ZA 2R0IA 3PVUA 1IXSA 4FG7A 3QKMA 4EC9A 4UMPA 4BR3A 4JIAA 4DINA 4NU1A 4BDIA 3VS6A 2J6MA 4RIXB 3DKOA 2XM8A 4OTRA 2VV9A 4Z3VA 3BYUA 3QZHA 4PV0A 2JY8A 3PJCA 2QURA 3PXRA 4XLIA 1MRVA 4GU6A 4O91A 4UYAA 4GJ3A 4WRGA 2E9OA 2YZLA 5LMBA 1KE9A 3A61A 2WD1A 5HICA 5BVOA 1PXMA 4UN2B 1WHCA 5EKNA 4XP3A 4YU2A 2EVAA 5I0BA 4ANSA 3UG1A 2HAKA 3BQRA 3P9JA 3ZM4A 2OOBA 4BL1A 1BUHA 3PE1A 2Y6MA 3IPHA 4ANOA 1Q4LA 3MH3A 3QRUA 5DEYA 2C0TA 3PZEA 4CV9A 2XNPA 4UWCA 2UZNA 4GVAA 3RK5A 1XBCA 3ANQA 1IM2A 5CEKA 3LCUA 3O71A 4G3CA 1JKKA 3QTUA 3QQGA 4JR3A 4I6BA 3P4KA 3KF7A 3BHYA 4RX7A 4BTMA 3F82A 3W18A 2C1AA 3F6XA 5AX9A 2OOAA 2KTYA 4K9YA 2WEIA 2J7TA 2QR8A 3IOKA 3SW7A 5KMLA 2KULA 3LVPA 3VHKA 2ZTCA 4K18A 5GJDA 2XK7A 3DB8A 2ITZA 3QCQA 3VS7A 4AACA 5JMSA 1W98A 4ZP5A 4O82A 2FGIA 1LP4A 3B89A 5F94A 3FWQA 4MXAA 4OW8A 3LOKA 2JY6B 1K3AA 4GK3A 4NH1A 4QD6A 4DFNA 4X2GA 3EN9A 2CKQA 3BEAA 3FMLA 4MXZA 1ZMWA 5DYJA 1XWSA 2W1HA 3MB7A 4JAJA 4WUNA 4Y83A 5JRSA 2IPXA 5CU3A 3T9TA 5TT7A 2C3JA 4B8LA 4DH1A 4ZAUA 5CSVA 4FSZA 5JGAA 4AF3A 3E93A 5HE0A 4C36A 4APCA 3D94A 2BAJA 3MFTA 4P5ZA 4U6RA 2R3NA 3MW1A 4EEVA 3MIYA 4ZSGA 1RQQA 3LIJA 3OHTA 1F3MC 3KK8A 4CRSA 3QQKA 3MY1A 3UNZA 3U51A 2J2IB 4NM0A 5DT4A 4FKOA 4DF3A 2OFVA 3EL8A 4ANMA 4BWPA 5FRIA 3GVUA 3ETAA 4MXOA 4NM3A 2NP8A 4DA5A 1WAKA 2W1EA 3G5DA 2LVNC 4XV1A 3KVWA 4PWNA 3RAWA 3VW6A 5FUTA 2FB8A 3KXHA 3ATSA 5GZ9A 3KMWA 5EHYA 4G5JA 5J9LA 4R6VA 3FZSA 3MPAA 5KMIA 2JIUA 3CLYA 2JAMA 2X8DA 4C61A 4FKUA 3CTJA 1T43A 3DFAA 3ZCLA 4AZSA 2OFUA 2CLQA 4MBLA 4LUEA 2IZTA 4D5HA 3OTVA 2QG5A 2UZVA 4IH8A 4ONAA 4TTHB 4WG4A 5GJGA 4D0XA 3O50A 3FMEA 4L7SA 4D2PA 4X7QA 4LOOA 3RAIA 3NCGA 3OFMA 3QCSA 4KNBA 3LFAA 3RHXA 3OWPA 5EYDA 3QFVA 2GFSA 2B7AA 3EYHA 5IZFA 4XG7A 3PJ1A 2W99B 1DAYA 3I5NA 3W2SA 4DEAA 3HX4A 2V55A 3SA0A 4QNYA 4J8MA 4DH3A 2QOKA 3Q52A 2X4FA 4AOTA 4CFUA 4EUUA 4XG6A 4X2KA 5AP1A 3A8XA 2WMSA 4L45A 3ULIA 4ACHA 2ZV8A 3E7OA 5GIPE 3LQ8A 3JVSA 2YM7A 2J0LA 4YJQA 3MA3A 4R8QA 4UXQA 1IA8A 4AFEA 3EQPA 5TOZA 5BVWA 3T8OA 2GQSA 1UNLA 2ITXA 2W4OA 1H08A 4ZZMA 3SQQA 1QZEA 3VF9A 3UO5A 3HZTA 3AC5A 4J99A 3U6JA 4QP3A 3OUKA 4CFXA 5AP2A 4HCVA 3F9NA 3QRTA 4DEIA 5AR8A 2XUUA 4O27B 4ZEGA 1J1CA 2C6EA 1WIVA 3L8SA 2C6TA 3KQ7A 2PVJA 2YIYA 5ETAA 4DE4A 1OKWA 5B0XA 2IJMA 5BVKA 4C3PA 3HRCA 1TKIA 2W9FB 5HHWA 2F2UA 1Y91A 4JAIA 3ZEWA 4ZS0A 4BCJA 1UFZA 2C4GA 4O2ZA 1ZYCA 3RAHA 4CZYB 3OCSA 5EHLA 1JKTA 2K0BX 2R64A 3G9NA 3TV7A 2ITNA 3HLLA 4YZNA 2BFYA 4G17A 1Q24A 4C4FA 3Q3BA 4JX7A 4BCMA 4D0WA 4K77A 5J7BA 2PYWA 4I24A 3E5AA 3GCPA 4F0IA 2XA4A 2WHBA 1ZXEA 5DMZA 1NVQA 1Q97A 3FAAA 4H1JA 1UWHA 4RZWA 1SNUA 3CIKA 4YBJA 3FSFA 4WSYA 2W1GA 2WMWA 2XKEA 3ZBXA 1UNHA 1XH6A 4R3PA 2CNVA 3OBJA 4IC8A 3VS0A 1SZMA 2HZ0A 3P23A 4G2FA 4M12A 3PZHA 3FI3A 4AZFA 4ENXA 3IECA 4J98A 1V0OA 1QPEA 1VEBA 1OB3A 3QUDA 4DH7A 1JVPP 1YOMA 3I79A 4WO5A 5T3QA 3UNJA 1U59A 3FZOA 4EYJA 4BDCA 3QLFA 2C69A 2OO9A 2CCIA 2OJIA 2XJ0A 3N9XA 4PMSA 4D55A 5KUPA 1WJ7A 5KCVA 3AMBA 1B39A 2Y7JA 1FVVA 2ITVA 2JDOA 4ZK5A 3ZSHA 5JT2A 3DBFA 4H05A 4FTJA 4EOQA 2H96A 2IN6A 4BCKA 3CD3A 2W7XA 3H9RA 3EL7A 5HGIA 5KHWA 2PHKA 2WMUA 5M57A 3UQFA 5CF6A 4O0SA 5AEPA 4PTGA 1JLUE 4O21A 5HD7A 4J52A 5HNIX 2QD9A 3C4ZA 1GIHA 3G51A 5HTCA 2XNBA 2CKEA 5M51A 4O7YA 2C5XA 2FUMA 5E7RA 2EXEA 2PVMA 4HOKA 4DG0E 3ZSIA 2G3QA 4DLIA 3KU2A 2Y0AA 4Z16A 3VBYA 4N70A 2HYYA 2NRUA 2XIXA 3EQRA 4GG7A 4QMMA 3QHRA 2VO3A 1UVRA 4S32A 5AMNA 5H2UA 1H1RA 4JT3A 3ZXTA 1HT2E 1UU3A 4WNPA 4FEWA 2O25A 2UW3A 4EH4A 4ZOGA 4DTKA 3HMIA 5AAGA 4IZ5A 4W9WA 3L9MA 3R7VA 3OT8A 5BYZA 4FA2A 1RDQE 4X3FC 2PVHA 4IX3A 4WG5A 3LXLA 3QZFA 4Y8DA 4L7FA 3NZ0A 1YOJA 3CE3A 4EOKA 3UGCA 3OMVA 1Z5MA 2RG5A 4NK9A 4TYHB 2Z7LA 1JPAA 3OXZA 4X21A 5HG5A 4BZNA 4KB8A 4BWKA 5CEPA 1OIQA 3C51A 3S95A 3CTHA 5HZNA 3GEQA 4IMYA 4N6YA 1IASA 5IG1A 3PVWA 5CU0A 2DAMA 4BN1A 2HWJA 3M2WA 1T46A 5FQDC 4GIHA 2I1MA 4FZ7A 2Z60A 4DLJA 5A6NA 3QTXA 3QC9A 4I0RA 5AUWA 3UG2A 4D5KA 2R4BA 1PXPA 2YIXA 4YC3A 3V5QA 4AGDA 4JQ7A 1EFUB 2X1NA 4ANNA 3C13A 5EW8A 3EN7A 3O96A 3OZ6A 2YJSA 5LWMA 2E9NA 3LQ5A 4GK2A 4LL5A 3R7UA 3E7VA 3MH1A 3Q5IA 3MBLA 2PZIA 4PL5A 4YTCA 1M52A 4RX9A 4DC2A 1NT2A 3FL5A 4AUAA 3PLAE 2CGVA 2HW7A 4E4NA 4A4XA 4FKWA 3HGKA 4FUYA 4BDKA 3Q4TA 3OEFX 5JSMA 5CU6A 4JDKA 2XNOA 3KMUA 4Z55A 3OBGA 3NX8A 1OL2A 4FTUA 4DBXA 3D7ZA 1OL1A 2AC3A 4FR4A 5I9YA 3TT0A 2UZDA 3CY3A 4LGDA 4LV8A 3D0EA 3VQUA 3CKWA 5E8TA 4WD5A 4FG8A 1WBVA 4IVBA 3Q4UA 2C30A 4FF8A 4I3ZA 4UB7A 2VAGA 3C1XA 5KZIA 5M4UA 2UZLA 3A7JA 3S3IA 2RSVA 4Q2AA 4ZJJA 3FMDA 4CZUA 1IAHA 3L8VA 4BI2A 4B0GA 3TNHA 4FIEA 1JBPE 4V01A 2JDRA 4MQ2A 5CX9A 3WZEA 3D15A 3VW8A 3NEWA 3MH0A 5HNGA 1KV2A 4CTCA 3NYXA 5HBHA 2VGOA 2UW0A 2XIKA 4F1MA 3DQXA 4PL4A 1URWA 1YI6A 4IJPA 1MQ4A 3KN5A 1NVSA 4D58A 4M66A 4FEVA 3NUNA 3U6IA 4AAAA 4O96A 2BZJA 5FGKA 2OBJA 2QO9A 1XH7A 3PVGA 3BEGA 4QPAA 4YHJA 3F5XA 3LCOA 3R7OA 3VBTA 5E8YA 4BBEA 5DE2A 2QI8A 3HMPA 3BU6A 4U0IA 4DT8A 3GC7A 3NW6A 4MK0A 1J91A 3C4FA 3DKFA 3UP7A 2P4IA 3CQUA 2YM3A 1XBAA 3D7TA 3ELJA 4A4LA 3BE9A 4W4VA 5ANKA 1YHSA 4PUZA 5D12A 5AAEA 5M4FA 3R9NA 4YJVA 4FSUA 3FRHA 5EW9A 2BRMA 5CANA 4G6LA 5E8WA 4DG3E 4ZS4A 2OZAA 4XNEA 4ANBA 3AC3A 2QOCA 4G6OA 2PMOX 4KS8A 3FEGA 3AD5A 2Y4PA 3EFLA 4JBOA 4QO9A 4FV6A 4GMYA 2GPHA 3RVGA 4OTDA 5HU9A 2ZB0A 3FY0A 1OM1A 2XNNA 4WKQA 1GJOA 3RTPA 4D2RA 3O51A 3ORMA 1ZARA 2CWBA 4X6QC 3VJNA 3FY2A 1T45A 3QCXA 4H58A 3VUMA 3WZJA 3QU0A 4H3QA 4ZLOA 3DS6A 4CVAA 4AXAA 4K2RA 3L8XA 2HW6A 3BHVA 3GQLA 4XOZA 5K0KA 4HYUA 2YLFA 4PQNA 4RLLA 1W84A 2WOUA 3BIZA 5CSWA 5IF1A 4IANA 4RWJA 5IQGA 4PMTA 3L9NA 3DZQA 2HZ4A 4QMXA 5J8IA 3ZUTA 4TT7A 4CTBA 2XRWA 4E1ZA 4FKVA 1S9JA 4DEDA 3DAEA 4BKJA 3DFCB 3Q5ZA 4QP2A 2QO7A 3NNUA 4L01A 2CGWA 4EBVA 1H26A 3FXZA 1F4IA 2B9IA 2BAQA 3BZ3A 4EHZA 4Y46A 2WTIA 2DS1A 2VTPA 4B8MA 4GCJA 2ETMA 3LFSA 2CSNA 3W55A 1R78A 4MXYA 4RFYA 3FLWA 4FOCA 4MF1A 4B99A 1H25A 3MJ2A 3PG3A 3MSSA 2WTWA 2VX0A 4E5AX 5CVHA 2YISA 3HMNA 2J51A 3VAPA 1XB2B 3DXNA 3NNXA 3VUDA 5DBXA 5IQBA 4GT3A 5AR5A 3EKNA 4IVCA 3UIBA 2BRHA 4M3QA 2VO7A 4ZY6A 2OLCA 4IX5A 3ZH8A 2NNWB 4FVRA 5CQWA 2K9DA 2WQBA 4BIBA 5I9UA 2WTCA 2ZM3A 3CBLA 4IIRA 4C33A 5EQYA 2PWLA 3R8LA 5IQFA 3MYGA 4JL9A 1FMOE 4CGAA 3VVHA 4MBJA 3V8WA 4F1OA 2DUVA 3FPMA 4BCQA 3OXIA 2DWBA 2YIWA 3PXZA 4HNFA 4MCVA 5DNRA 1KE6A 3FHIA 4G31A 4ERKA 2CN8A 3FSKA 4HCUA 4CKIA 2C68A 5C4KA 2QLUA 3LPBA 3R22A 3SRVA 4BCOA 3CPCA 3ZFMA 2XK8A 3TIZA 4D1SA 4LQMA 2PUIA 2XNMA 2OJ9A 2WTJA 5CSHA 4RVMA 4IZ7A 5LXMA 3BQCA 4OLIA 2GHGA 3HECA 4F7SA 1PXKA 4F7LA 4YJPA 2F2CB 3O0GA 4O7LA 3ZFYA 1GAGA 5I9VA 2VX3A 4FSRA 5ANOA 1XJDA 1YWRA 1SVHA 5EI6A 4U9AA 4S31A 5HBJA 2R7IA 2V7OA 4PY1A 4CQEA 2BALA 2HK5A 1W7HA 4TRLA 4AN3A 1MN3A 4X3FA 1U4DA 2OG8A 4YGAA 4BI0A 1W0XC 2C3IB 5D9HA 3GENA 4QP1A 3SKCA 5GJFA 3N4UA 3ZUUA 1ERKA 3ZLYA 3O8TA 3PLSA 4FNYA 5EHOA 5FG8A 3LCDA 4EH7A 3HUBA 3T3UA 3GP0A 3WZDA 5BVEA 2XKDA 4D2VA 3NYNA 3P5KA 1PJKA 2EUFB 4XJ0A 4EK8A 5I9XA 1DI8A 3QALE 2V0DA 1YKRA 4BDDA 1SMHA 1IRKA 1UKIA 5CNOA 2CNQA 2YN8A 3NUAA 2BRNA 4YSJA 1KE5A 3JVRA 4PP7A 2AYPA 4WG3A 2YM4A 5AP7A 4D9TA 2OJFE 1SG9A 3D4QA 3V5WA 1UWJA 3SHEA 2C6IA 2C5VA 3DAJA 4MYGA 1LUFA 1M2PA 4U41A 4YZ9A 5KBRA 2XK6A 5CASA 3OOGA 3I6UA 4BDHA 4IM2A 4G34A 2G2HA 3BV3A 3COMA 4HGTA 3LM0A 5CTPA 5HVKA 3C0GA 2YDIA 4FTNA 1GZKA 5JFWA 5E8SA 2GNFA 4IWPA 2X8EA 1X8BA 4MQ1A 4O0TA 1H1WA 5EKOA 2ITTA 2FVDA 2I0HA 3BRBA 4BY9E 4EH2A 4YJSA 3BGZA 3ENMA 4FUXA 4JJRA 4RIXA 3R28A 5L3AA 2A27A 3D5UA 1TTEA 2PPQA 2VD5A 4GUBA 1XXHE 3VUHA 4AZTA 2YCRA 3LFEA 3HDMA 3PIXA 4A9YA 5L6OA 4BFMA 3HV3A 2RFNA 2GCDA 3FMMA 3FC1X 2QOHA 2JAVA 3HP5A 3O7LD 4O0XA 4F64A 3AXWA 3HYHA 1KE7A 5DA3A 2XP2A 3ZRMA 2OSCA 5AWMA 2I7QA 4YJRA 4U40A 4V04A 1H1SA 3E8DA 4I5CA 4YHFA 4YC6A 2BTRA 3SW4A 1O6YA 4FK6A 4CFVA 5L6WL 1OBDA 2G01A 2ZV2A 1E94E 2WQNA 4GVJA 1R3CA 5EM7A 5IEYA 3NUPA 4G1WA 1HJPA 2UZTA 5L2SA 3QD2B 5FLFA 2OU7A 3GCQA 4OAVB 4JR7A 3THBA 2XEYA 4TWOA 3M42A 4EZ7A 4EOPA 4RRVA 5J9ZA 3TI1A 5E92A 4IC7A 3BPRA 3S0OA 2HCKA 4KKGA 4YJUA 3HMMA 2BVAA 2IW8A 1W83A 4IAKA 4AE9A 4ZTHA 2WEVA 4GFMA 3V8TA 5C8NA 2HXLA 2BZKB 5HIBA 4FZFB 2Z02A 1F0QA 3MFRA 4II5A 4TXCA 4EHGA 4XP2A 3DK7A 1ZWSA 4J97A 3U9NA 2PVKA 4GFOA 3QRIA 4BIEA 2IO6A 2IZSA 1Y57A 1PYXA 4FNXA 4FSNA 4IFCA 5E9EA 3KFAA 2BKZA 4JVGA 3D2KA 3ZBFA 4O7NA 3AC1A 4EL9A 4BYJA 5I3RA 3EJ1A 2OGVA 4C4HA 4CSVA 1SYKA 2WTKB 3FMJA 1MP8A 3ZDUA 4JBPA 2QOLA 4BZOA 2ZM4A 2X9FA 2P0CA 1ATPE 2RL5A 3PPKA 1YDRE 1CKJA 2BROA 3QTRA 4O83A 5ICPA 3ZO3A 2RFEA 2OXXA 4GW8A 1VEGA 4GS6A 3K9PA 4F99A 5ACBC 3SC1A 4YZCA 4ZLYA 3TG1A 4PP9A 3A7GA 4G3FA 3P1AA 4E4MA 2DAEA 4O6EA 5L8JA 3MI9A 5ETCA 4FTAA 4J71A 5LVMA 3TKUA 3LW0A 3TNQB 3PXFA 1M17A 4CT2A 2QU6A 4IM0A 4Y5QA 3C9WA 4DITA 4YR8A 3SG8A 3PE2A 3QQHA 4NSTA 5IA4A 2I0EA 1XO2B 3FLZA 3V5TA 3N4VA 4EK5A 3KULB 3ZUVA 3Q9YA 2W1FA 3IS5A 4MNEA 1DAWA 2VU3A 2FO0A 3GU5A 2BIKB 3BHHA 4XEYA 5LOHA 2RIOA 1VEJA 1OKVA 2RFSA 3FLNC 4ZLZA 5JKGA 2QODA 2X0GA 3KCKA 4DTBA 2OH4A 4TWPA 5IH5A 3FQSA 5ANGA 4WA9A 3R1NA 4BCNA 5CAUA 3P78A 3V5LA 4DBNA 5FDXA 3FZ1A 4HVGA 3F2AA 5EFQA 4LL0A 3UIMA 3MJ1A 3CP9A 4KSPA 1PKGA 5AX3A 4F63A 3BHTA 2IW6A 1R0EA 2DAKA 1CSNA 2XEZA 3Q9XA 5FXQA 5IEVA 4JOAA 2NPQA 5L6PA 3IQ7A 2YIRA 4E93A 4C7TA 4TYEA 1Z9XA 2PVFA 2PVRA 4CG9A 2EKKA 5AP3A 4WP2A 3UZPA 1VJYA 3TZ9A 1BVSA 1LEZA 3KN6A 1GO5A 1PXLA 2WQMA 3U8WA 2HWPA 3KCFA 3KF4A 4KWPA 4EOOA 4OT5A 4HVHA 4R5SA 2PZPA 4MHAA 3NNVA 5AA9A 2VWIA 2JUJA 3W8QA 4QMSA 4PNKA 4L3LA 4O86A 1DO2A 3FPQA 4BCPA 1AD5A 4NFNA 2WTVA 1VYWA 4YPDA 5DG5A 3OWJA 4ZY4A 1J3HA 4IXPA 4NM5A 1OPJA 1ND4A 1NXKA 2C5YA 4XRJA 4GFGA 4OTWA 5IA5A 3TUDA 4YP8A 3MH2A 4UWBA 4UV0A 2VTAA 3CQWA 3EQGA 5DRDA 5L2TA 2F9GA 3TKHA 4EQMA 1AIPC 5J79A 3QHWA 4L3JA 4R7IA 5EQEA 5HIDA 3DZOA 5I3OA 2XK3A 3R83A 2X39A 4MD9E 1A48A 4FKQA 4CEGA 2YLEA 4IEBA 5HVYA 5I4NA 3CJGA 3I7CA 4W8DA 4AQCA 3TACA 3NUSA 3KXZA 4IAFA 5CXHA 4TL0A 1YDTE 3TNPC 4IACA 4QTEA 2XB7A 3KVXA 4PTEA 4MH7A 3H0ZA 3WZKA 2Z7RA 4WNMA 3C4XA 1G4AE 1OIRA 2V5QA 2XNEA 4BRXA 4CXAA 3DXPA 4O0YA 3PPJA 1REKA 3IDCA 3W8LA 3U87A 2R3LA 4EWQA 2JC6A 4XBUA 1VEKA 3F3WA 5HKMA 1IG1A 3IGOA 4CFNA 1YLAA 2KNVA 4YLKA 5C4LA 4P2KA 5B7VA 3C0IA 3FLSA 2YA9A 5D1JA 2C6DA 2PVNA 2BDWA 2X6DA 4LOPA 1V1KA 3FBVA 4HCTA 2ACXA 3QQUA 4ENYA 2EKFA 4LRJA 4EQCA 5M56A 4LUDA 2IZRA 1QL6A 4F2LA 1XH9A 3KXMA 3F2NA 3PIZA 1CKIA 3RNIA 1YWVA 3MTLA 2VO0A 5DOSA 3TNIA 5EI8A 4BDJA 2ONLA 5AAFA 4V0GA 4J1RA 2CGUA 4ALVA 1P2AA 2GTNA 3HV4A 4LOQA 2CNUA 2B53A 1UU8A 5HE2A 4AX8A 2R3QA 4MNEB 5LQFA 2LVOC 5ANJA 4R71A 4ZSJA 3CC6A 2B55A 4AWIA 2PUUA 3AGMA 5KBQA 4I6QA 4CLJA 3U9CA 5IQHA 5I9ZA 5FEDA 3WYYA 4CMOA 5IQIA 2Q0NA 4FL2A 1XH8A 3EYGA 4HYIA 4EK4A 1A5TA 3OCBA 4FYOA 4CQGA 5EI2A 2W1IA 1P14A 3MB6A 4D4YA 5K3YA 5G6VA 3EOCA 2FH9A 1FPUA 3LXNA 3E92A 4QQ5A 4ZZNA 4FV0A 3ET7A 2WB8A 1OI9A 5EYKA 4FMQA 4EKKA 1OPKA 3KRJA 2ZM1A 5IMXA 5GINE 2F49A 3GCSA 4NW6A 1G3NA 4D1XA 4YO6A 5AM7A 1Q02A 4DYMA 3FKNA 3V6RA 2W5HA 4DAWA 2IVTA 1OL7A 2W17A 2VTJA 3PJ3A 4EQUA 1WMKA 5AP5A 3EHAA 4E6DA 3NPCA 2XCKA 3OD6X 4H3PA 4YLLA 2BDFA 3QD3A 5CVGA 4BTFA 1V92A 3ORTA 4ZTSA 4A9SA 4FBXA 3VUKA 2WQEA 1W82A 5CLPA 1YW2A 5LMKC 4TYGA 2GU8A 1ZV1A 2XVDA 3IW7A 4GRBA 1TQMA 2PE1A 4YLJA 3E64A 4CKJA 2WMAA 3B2WA 1S9IA 2G2FA 3EFJA 3EZVA 3UIXA 4QMOA 4C59A 5LVOA 2R3HA 3NYVA 4KIKB 4BCFA 2GQRA 3BE2A 5L8LA 3RP9A 4ASEA 1BYGA 1H28A 3K3JA 3LCVB 2J0KA 4XYFA 4XH6A 3K2LA 5LARA 1WBOA 4EOJA 5T68A 2EXMA 5T6KA 3UYTA 2QLQA 3WF7A 3TTJA 2R5TA 3MN3A 4FK3A 4QYGA 3MY0A 3R7YA 1I09A 3RHKA 4UALA 4JRNA 5EYCA 5J5SA 4JBQA 4TYHA 4J7BA 1PYEA 4S2ZA 5CY3A 3BBTB 4BHNA 2H8HA 4F1TA 4L53A 4PPAA 1ZOEA 4ACCA 4FZAB 5F95A 2PUNA 4ZY5A 2GS2A 5HLPA 4PMMA 3ZHPC 4K0YA 4IDVA 4KBKA 3F5UA 3O8UA 1OTRA 3ORIA 5KE0A 1LPUA 1QPDA 4RJ7A 3UO6A 4I21A 3E46A 3F3ZA 1PXOA 4V0GB 2YIQA 5JZJA 4RX5A 2MROB 3ZO2A 1Q99A 2J50A 5GZAA 3FXWA 3R9DA 1R4GA 3PY3A 1WBNA 5E8ZA 4U44A 3HNGA 3RK9A 4O1PA 3CGOA 2YDKA 4XP0A 2LAVA 5KKRC 3KRRA 3VN9A 2OJJA 3I1AA 2VTNA 2YERA 4YSMA 5DPVA 5FWKK 4BCGA 2NRYA 1KUTA 4D1ZA 1PRYA 3DDPA 4U42A 3VJOA 3R8ZA 4FE2A 4O7WA 3QWJA 2HZIA 3DU8A 4X3JA 1HT1E 2G1TA 3NWWA 2GNIA 4CV8A 1PXIA 2HOGA 3UMXA 2VTRA 5A6OA 3O8PA 4C3FA 2P2HA 5HO8A 4Q9SA 1IA9A 4C37A 3ZC5A 3WE8A 2WNTA 4WRSA 4FIHA 3EIDA 3W2OA 3DOGA 5AADA 5M4IA 4RWIA 3WZUA 2BILB 2GS6A 5AV1A 3C4CA 4QMLA 2P3GX 3G15A 5HCZA 1PXJA 2BDJA 4AS0A 3V8SA 4AW2A 3QZIA 4B4LA 2MJ5B 4OTPA 2F7XE 3OP5A 3OT3A 4M84A 4QYFA 5D7VA 5FTQA 1B6CB 2YZAA 2A4LA 3OW4A 1XH5A 3Q6WA 4PDOA 4USFA 3N51A 1RW8A 3ORLA 4LI5A 3MVHA 3BX5A 3Q9WA 3QL8A 4L42A 3QXPA 2J0IA 4A7CA 4C57A 4CZTA 5EYMA 3GLGE 3MMPA 3KL8A 3LZBA 3Q32A 4PL3A 4RFMA 3WOWA 4EC8A 3ZMMA 4BF2A 1YI4A 5H8GA 4R7HA 3R8UA 4DCAA 3ORPA 3FUPA 4BWXA 1STCE 1BKXA 3HEGA 5H8EA 2A1AB 1J7UA 4QMUA 3GLFE 4FIGA 4FTMA 5EM6A 4QYEA 5H9BA 5CSPA 4AG8A 4UN0C 2BIYA 1Y6BA 5DGZA 2XMYA 2VTOA 3MGYA 3LKMA 3LXPA 4JDHA 3IKAA 1H27A 2PE0A 5AR2A 3HUCA 3COHA 2V22A 3UOLA 2UZEA 4BKZA 2QOOA 2DHYA 1CDKA 5CAOA 4GH2A 2ZOQA 4TNBA 4FEQA 2OWBA 4CKRA 3A60A 1C7YA 4AN2A 2WTKC 3EH9A 3KB7A 2BTSA 4FOBA 2R3JA 2UVZA 3EMGA 3E3BX 3LHJA 2C3LA 3PXKA 5CAVA 1P4OA 1JSVA 4DH8A 3ZS5A 3QTQA 5FXRA 3COKA 4I5MA 2YHVA 4C4GA 5FP6A 2JDTA 4BGHA 5A4QA 4FYNA 5JZNA 4EZ3A 2ZB1A 3EB0A 4M69B 4QRCA 3VRYA 4MWIA 1BMKA 5AJQA 4ANLA 3LMIA 4FX3A 3C4WA 4AN9A 3PRFA 2UW7A 1TR8A 1U5RA 4RQVA 4IVDA 4M67A 4WBBB 2XS0A 3KRXA 5HG7A 5KNJA 2HY81 4W9XA 1ZMUA 4I0TA 4YTIA 3CTQA 4TZRA 2V62A 3M11A 4EZ5A 2KNAA 3PSBA 4EBWA 5ANEA 1DS5A 2YJRA 3DB6A 3UPZA 2ZTDA 5LVLA 5DR9A 1Q8UA 1Q8ZA 3P7AA 4QMVA 2Y4IC 4FTRA 3P0MA 3F7ZA 3OF0A 1OQYA 2JZ1A 4AW5A 2CCHA 4LV5A 4YURA 2VWUA 2GNHA 5LCJA 5BYLA 3AQVA 3L9PA 1MUOA 3L1SA 3FI2A 3PP0A 4E4LA 4D4SA 4E6CA 3KK9A 1ZYDA 1SVGA 4KRDA 4UEUA 4OTQA 3DJ6A 1VZOA 3DBQA 3LJ0A 3VWAA 4E26A 4Y85A 3FMKA 3QA8A 3IHPA 3G6GA 5AP0A 3U4WA 2YCSA 3ROYA 4G3DA 2X6EA 4LMUA 3A8WA 4NUSA 3TTIA 5EH0A 3EQFA 3QD0A 4XG8A 4Q5EA 4FICA 4RJ6A 5TE0A 4G3EA 2ETKA 5M06A 4IE9A 4W4YA 4UMRA 3JY0A 4F0GA 3K9OA 4FKSA 3VUTA 5CWZA 3LE6A 4GL9A 2JP7A 2RKUA 4RIYA 2J4ZA 2O0UA 5FTOA 3TXOA 3ORKA 3VRZA 2X2LA 4JX3A 2UW5A 2XCHA 4FC0A 3LFFA 5AUZA 1ZYJA 4ZIMA 2A2AA 3R04A 2ITYA 4FV1A 4FKRA 2IWIA 4DBGB 5G1XA 3BWFA 4E3CA 4EOMA 1IAJA 3O17A 4E7WA 4YZDA 3BBWA 4IX6A 1PMEA 4DCEA 4EORA 3MS9A 4LM5A 4RWLA 4FKLA 5FM3A 4PDYA 5AV3A 1TVOA 4D4VA 5IEXA 4E5BA 4UWYA 4R3CA 4FL3A 5BQ0A 3M1SA 2XH5A 3FI4A 2VTTA 2YACA 3ACJA 3KGAA 5AFVA 3TM0A 3UNKA 2QQ7A 3NVMB 4F4PA 1G8SA 5HQ0A 3ZM9A 3Q60A 3NR9A 3ZO1A 3GNIB 3P08A 1Q61A 2YCFA 2WZJA 1YDSE 1L3RE 2HIWA 3DNEA 4WT6A 2MR9A 2GSFA 3R1SA 5LMKA 2JFLA 3SXRA 5EK7A 4PPCA 5CEIA 1XHAA 3UOKA 1IEPA 1V0PA 3LLTA 3RI1A 2VWVA 4RX8A 4B9DA 4BYIA 1OL6A 5FP5A 2UZWE 1SM2A 3V01A 3CXWA 2PMIA 2YDJA 4P90A 3E8NA 3W2PA 3PY0A 2R3FA 4D2TA 3DBEA 2LTUA 1OIYA 2VTQA 4I1ZA 4F9YA 5A46A 4I94A 5TO8A 4BB4A 1APME 5CAQA 4PPBA 1WBTA 2Q0BA 4DEEA 3VBXA 4QQTA 2FSMX 4NTSA 3KRWA 3R21A 5HTBA 5HD4A 3FZTA 4O6LA 2XZSA 4YJOA 2R3OA 1H0WA 4PRJA 3AC8A 3UJGA 2A0CX 2WXVA 3PDTA 2RF9A 3MY5A 5CENA 3PYYA 4ERWA 1ZMVA 3BYMA 3NW7A 3TV4A 3R30A 3NYOA 5A9UA 5JFVA 4G9CA 3ACKA 4R1YA 2Z7QA 5AP6A 3A7IA 3R71A 4GYGA 5K4IA 3VUGA 3AC2A 4NW5A 3DLZA 2FA2A 3BLRA 2X2MA 3KC3A 2EB2A 4I0SA 2QKWB 3QF9A 4RMZA 3K5UA 3R7IA 3ZZWA 4BDFA 3ODZX 2UZOA 3QTWA 2PTKA 2PVYA 4DFYA 4FNZA 4FTTA 3DV3A 4AZVA 5A4CA 5CZHA 2J90A 5CVFA 4EWHA 4XG2A 2H6DA 3COIA 4GV1A 4MVFA 3PJ8A 1ZRZA 3GLIE 3RALA 1FINA 2X7GA 3RPSA 3GU6A 4JLCA 2IW9A 2RG6A 2ZDUA 5AUVA 4PMPA 3UOHA 4F7NA 4L00A 4N6ZA 4RIYB 2WIPA 3BCEA 4ZTQA 4CYIA 5E91A 3P79A 2UW4A 4M13A 3OC1A 1KE8A 2WMVA 5HIEA 2W9ZB 4FT5A 3RKBA 1Y8GA 5H3QA 3R1QA 2QNJA 4YJTA 5C8MA 3SD0A 3UC4A 2VRXA 4QQJA 5E8VA 2GHMA 2CP8A 4EOIA 3UQCA 4HW7A 4DTAA 1ZOGA 1ZZLA 3IDBA 5KHXA 4L46A 4XG3A 4Y73A 4U45A 3QCYA 3G6HA 4HVDA 4NM7A 4IAZA 1OIUA 4P5QA 3FQHA 2R2PA 1ZOHA 1BI7A 1FBNA 3QLGA 4RFZA 5CF5A 2V7AA 3E62A 4KSQA 4DHFA 3DK6A 4IB3A 2BHEA 2OW3A 3EQDA 3FC2A 5KMJA 5AUTA 5IH4A 3BELA 1YHVA 2YCQA 5JI2E 4AE6A 4R77A 4C8BA 2XIZA 4DT9A 5C1QB 3RGFA 4LRKA 5DFLA 3BGPA 2JITA 3REPA 4C02A 2OXDA 2GNGA 2R3PA 5I5ZA 1LEWA 2Y6OA 1WR1B 3VS3A 5IUGA 3E8CA 4YNEA 2ZV9A 5BMMA 4OAUC 4CFFA 4U8ZA 5AR4A 4ZTNA 3G9LX 4E73A 3D14A 4M0ZA 2XIRA 4HGEA 3QD4A 1UU7A 2W4JA 3ZLWA 5HX8A 1A06A 1UV5A 5FTGA 3HRFA 2LVPC 4GT4A 2E9UA 2PZ5A 4XX9A 4MD8E 3SV0A 5IDNA 1VQ1A 2H5XA 4TPTA 5IUIA 1CUKA 2FYSA 5CU2A 5EW3A 3EFKA 4YBKA 3ZRKA 3TDWA 2YAKA 1WCCA 2WMQA 3BV2A 4RWKA 4MNFA 4RJ4A 2XIYA 1BL7A 1QPCA 1M2RA 3TUCA 4YMJA 1G41A 5FDPA 3KKVA 4Y72A 5CQUA 4M97A 3WF6A 3QA0A 4HZRA 3LFNA 4F6SA 3CPBA 4C4EA 2AC5A 3SXSA 4FKJA 4IAAA 2XRUA 3LFCA 4B6LA 1BI8A 3LXKA 3N4TA 3O7LB 1XKKA 2CDZA 3CGFA 4AW0A 2DNAA 2ZDTA 5HCXA 4WUAA 2XF0A 1YXTA 4YJNA 3ZZEA 3LFQA 5KKRB 4ZMFA 2WMRA 1DV0A 2WTDA 4QMTA 5EM5A 4WSQA 4HGLA 2CGXA 2JKMA 2JZ0A 4WNOA 4FKIA 2LVQD 4EK3A 3KULA 4EK6A 1T6OA 4IADA 2YM5A 3GFEA 4O7RA 1FMKA 5F20A 3WF5A 1M7NA 3O23A 2EWAA 3RWQA 3W10A 5C8KA 2B0QA 4RC2A 3EQIA 4GIIA 4ASDA 3H9FA 1ZZ2A 2IVUA 3NRMA 1NVRA 4RJ3A 3A4PA 1JAMA 4OTFA 2PMNX 4YZBA 3LJ1A 5L2QA 5AIKA 3PRIA 2JKKA 3DY7A 3V3VA 2G15A 1HCKA 4LMNA 4XCUA 3H0YA 1Q8TA 3GC0A 3GU7A 3TUBA 3UZRA 3MVLA 1QCFA 3AG9A 4AW1A 4E20A 5LVNA 3SG9A 2JIIA 1YWNA 4FIJA 3K5VA 3LFDA 4FG9A 4GJ2A 3WF9A 1WBPA 4I92A 3TKIA 2WFYA 2VNWA 3NGAA 4FZ6A 5DT0A 5K5NA 3C50A 3RPOA 3WIGA 4ASZA 5BPYA 1G5SA 1P4FA 3MIAA 1GZOA 4GKIA 4G3GA 4XLVA 4XBRA 4S33A 3TIYA 5BUIA 1NW1A 4BDAA 4K1BA 2O64A 3PXYA 3T3VA 2ZAZA 1R39A 2OKRA 2VNYA 5CNNA 3QYZA 2BCJA 3BU5A 4QMPA 2ETRA 3FV8A 4C2WA 4FTCA 4ZJVA 4XG9A 3R63A 2LBCA 4LG4A 2JFMA 3BU3A 3F61A 5ANIA 3WI6A 1E1VA 1GZ8A 3B8RA 3DNDA 4FSWA 1Z57A 4KS7A 3K54A 4AP7A 3OCGA 4IX4A 5CEQA 2WAJA 2YWPA 4XG4A 3R6XA 3RK7A 4FVPA 4O81A 3AT3A 3A2CA 1OUYA 3PJ2A 5JGDA 4K11A 5HLWA 4FT3A 3D5WA 1NV8A 1OMWA 4FODA 4U3YA 3OEZA 3WE4A 3AMYA 4DFLA 5HORA 4MF0A 4QP4A 3TWJA 4CLIA 1WGNA 2ZV7A 5AV2A 3VUIA 3SLSA 4KKEA 5CU4A 3U6HA 3RJCA 2XNGA 2REIA 3QGWA 4KRCA 3KY2A 4KABA 1H24A 1XBBA 4RJ5A 4ACMA 3QUPA 3PA4A 4RGJA 2XBAA 3G2FA 4E6QA 4EI4A 1HCLA 4EOLA 2VX1A 3OROA 1G8AA 2QC6A 3UC3A 3W33A 4FGRA 3R9OA 3QQFA 2QO2A 2I40A 2R3KA 3IONA 4RQKA 4TN6A 4CFMA 4GU9A 4YPSA 4IAYA 2ITUA 1ZYLA 5HOAA 1K9AA 3G0FA 3SDJA 3TJCA 3W2CA 4TYJA 2PVLA 3OWLA 3S1HA 2E9PA 2XKCA 2GS7A 5HG9A 3II5A 5DVRA 4BVUA 5JRQA 4FTKA 5IQCA 2ZYBA 4G6NA 4O0WA 2IVSA 3MA6A 3A62A 2Y4IB 4OR5A 2CHLA 4FNWA 2X2KA 3H4JA 4I22A 4O7SA 3IGGA 1FOTA 2EU9A 3FXXA 2XYNA 4NIFB 4NCTC 1AQ1A 2BPMA 3RWPA 4HNIA 3HL7A 3VHEA 4Y5HA 5BNJA 5IPJA 3R8PA 5K4JA 1ZYSA 4RG0A 2OJGA 3L8PA 4E8AA 2VWXA 4KBCA 1MRUA 1RJBA 1SVEA 5DFPA 2C6LA 4IB0A 2XYUA 1XR1A 3DTWA 3KRLA 4HPUE 2O8YA 5LMAA 3ZLXA 4AZEA 5BX0A 5LCKA 4ZMEA 5FXSA 4F9CA 1KOAA 3VS5A 3E3PA 1Q5KA 3BGQA 5E1SA 4BIDA 3I60A 3WIKA 4G16A 4WNKA 3SX9A 3HV7A 2BAKA 3FDNA 2W0JA 2BFXA 4D2WA 3C4EA 5AP4A 3UPXA 2O5KA 3G90X 4HYSA 4R7BA 3I5ZA 4KIOA 4RZVA 1YXXA 4YTFA 2WKMA 5FM2A 1CMKE 4PX6A 4ARKA 1R0PA 3QZGA 4RIWA 5TKDA 4IZAA 3UP2A 1W8CA 2B1PA 2JY5A 4FTOA 1J1BA 1WFCA 5GHVA 3VS2A 3NUYA 1M7QA 3H3CA 1B38A 4GK4A 4N0SA 1XQZA 2EXCX 2VUWA 4C2VA 5IQEA 4BC6A 1UA2A 2CKOA 4F9AA 2W05A 4RLKA 4XV9A 4APPA 2JY7A 1UNGA 2P55A 3PSCA 4GSBA 4C34A 5JQ8A 5IISA 4R5YA 3I7BA 2PZYA 2XKFA 2PULA 3MTFA 4FTLA 2B9FA 1KYIA 2C6KA 1WVXA 4KIKA 3V6SA 1IFYA 4KIQA 3ZFXA 4JS8A 4ANQA 4ALWA 3H30A 4I5PA 5CF4A 3DCVA 5M44A 4XUFA 4FEUA 2X4ZA 4AGWA 4Z9LA 3TL8A 2LVAA 4U80A 4C35A 5AUUA 5BUEA 2IVVA 1PMUA 2R0UA 3OS3A 4PNIA 3JYAA 3EFWA 4IB1A 2Q83A 2OIQA 5DN3A 2X7OA 3HVCA 4MXXA 4QT1A 3IW4A 2JNHA 2L4EA 1OECA 2JKQA 2WMXA 3DT1A 3O2MA 4O38A 4DG2E 4R78A 3EQCA 3C0HA 2O63A 5HO6A 1Y6AA 2BUJA 4J8NA 5CT7A 3VNTA 2F57A 4BDBA 1JOWB 3ERKA 3FJQE 3GFWA 4TKSA 4XHKB 4NYEA 3FKLA 5KMMA 3R00A 4YTHA 3RBWA 4C58A 4H39A 4AA5A 2BRGA 4EH9A 4JQ8A 4UX9A 3G0EA 3E87A 5GIOE 1O9UA 1OUKA 3SOAA 4C0TA 3CSVA 3C5IA 4CG8A 4CFWA 3NIEA 5E8UA 2RFDA 2ZJWA 4QP8A 3PSDA 4F9BA 1GZNA 4IW0A 4UMTA 4WIHA 2BKKA 3LCKA 3ENHA 4LRMA 3TNWA 3W16A 4EH8A 2YWVA 2O3PA 4BI1A 4FI1A 2WOTA 4IFGA 2RGPA 3NAYA 3V5JA 1NV9A 4RC3A 4AT5A 1KV1A 2WU7A 3CKXA 2A19B 3FLQA 4RJ8A 5EDQA 5FBNC 4CYJA 2OIBA 3GLHE 1E1XA 2R9SA 4JG6A 4QPSA 4U81A 4O0RA 5JN2A 4GYIA 3QQLA 2B3TA 3QUEA 1UKHA 3I6WA 4O84A 3OOMA 4ID7A 2GHLA 2I6LA 3RZFA
chains in the Genus database with same CATH superfamily
3PTGA 5I9WA 5DIAA 5EDRA 4DEGA 5K9IA 3GPXA 4C4IA 2VWBA 3M6AA 3BHUA 4LGGA 4IJ9A 4HZSA 4W4XA 4MGYE 4KT0F 2J9MA 2VO6A 3PIYA 3UOJA 3R02A 2UW8A 3ULZA 1ST4A 1YXVA 3VF8A 3KOXE 3AD6A 2FSTX 5IDPA 4QPMA 4QMYA 2JWSA 4DH5A 4S30A 3S4QA 5A4TA 3UYSA 2OI4X 4A9RA 3PWDA 5CALA 2UXBM 4BCHA 2UW9A 3IW5A 4HVIA 3ANRA 3O5AA 2QPAA 4HEOA 5CT0A 2W06A 4DUYM 1ZY4A 1JWHA 4IDTA 1JSTA 5L2WA 2QCUA 4FSQA 2GQGA 5ACKA 5EOBA 4M69A 2OZOA 2WIHA 5CYIA 1TQIA 3NSZA 3GQ4A 4G6ZA 3VKGA 5EQPA 2YABA 3UIUA 3IOPA 3AKJA 3T9IA 2W1CA 3FYJX 4EKLA 4RC4A 1XNQM 1P5EA 4PTCA 3CY2A 3QXOA 3KXGA 1RE8A 3DJ7A 4K6ZA 4ITIA 4EJ7A 4L43A 4R3DA 5M55A 4BKYA 2GFCA 5D10A 3RM7A 3PVBA 3Q96A 3NMUF 3ZXZA 2DI0A 4I6HA 5EDPA 5HEZA 5CEMA 5HO7A 3MESA 4EONA 4I6FA 4KD1A 2ZMDA 3UO4A 4JIKA 3F66A 3WYXA 3OY3A 5DR2A 4CD0A 4QMNA 1D2NA 4GG5A 5FEQA 4ZSAA 3LCTA 3GBZA 1JR3A 4G3OA 4TWNA 5IA1A 4TUWA 3W2RA 5FLXS 1WVYA 1LR4A 2CHQA 2OXYA 2HENA 5JGBA 3ORZA 5J1VA 3GPUA 4BGQA 2VTMA 2C1BA 4LGHA 3UE4A 2NO3A 7CATA 3DBDA 3BKBA 3QC4A 5LMUM 3UVPA 4A06A 3IW6A 2RRUA 2L4FA 3EZRA 2J5FA 5CI6A 3E88A 2DZLA 3UVQA 3A7FA 3B8QA 1PF8A 3OY1A 2YFXA 2C0IA 2CE7A 3ITZA 5IUHA 4Q9ZA 3Q2JA 3VS1A 5AIRA 2J0MB 2PY3A 4I4EA 4E4XA 3QX2A 3Q6UA 1U5QA 2DQ7X 5J95A 3ZU7A 2XM9A 5LJJA 4BDGA 4HLQA 4MAOA 2OICA 1DI9A 2CLXA 4KUJA 2W1DA 3LQ3A 4X6RA 3QX4A 5CAPA 4FTIA 4MEDA 3QBNA 4V05A 3C7QA 2WPAA 5HX6A 1OZ1A 4DR6M 4R7GA 1OITA 4AU8A 1F5QA 4I41A 4QMZA 1XMOM 3AKZA 5JFXA 4AKGA 3UZTA 1OL5A 4F09A 3GUBA 4N4SA 1GOLA 3RMFA 2D7EA 4QEBA 2F5NA 1QVRA 5KZ0A 3GC9A 4EJNA 1H07A 2VTLA 4J95A 5BVNA 3D9VA 4YUQA 4IQ6A 4DUZM 2JKOA 4IM3A 3HMOA 3UMWA 1OVEA 4DR5M 1WVWA 4LFIA 3ORNA 3QRKA 4ACGA 4CMUA 2W5BA 3DQWA 3OWKA 1FGKA 4D2SA 1U54B 1MX0A 4OBQA 4ZXTA 1YI3A 3DAKA 2LNHC 2WO6A 1QZMA 4JBVA 4MGZE 4BTJA 5HVJA 1QPJA 3MPTA 5AUXA 4N57A 3IG5A 3VQHA 4RBLA 4Q7JA 2R7BA 2AUHA 4CRLA 3RPVA 4W4WA 4BCIA 5KMKA 2B9JA 4M7IA 3KOYE 3Q4ZA 4QMWA 4O7TA 5L8KA 1A9UA 4OGRA 3PUPA 1IY1A 3MV5A 4IBMA 3DTCA 4NT4A 5M07A 3BYSA 5EG3A 3S00A 3D83A 4USDA 1OKZA 5B2KA 1Y8YA 3FE3A 3WBLA 1G8JA 4O2PA 3NUXA 3AT2A 2GNJA 1BL6A 3D5XA 3ZSGA 2GNLA 4Z7GA 3C3DA 5JQ5A 3ZOSA 3JUHA 2UVYA 4B7FA 3OTUA 4BBMA 3OXTA 4FT0A 4OT6A 2XK4A 4UMUA 1IXZA 4LFBM 4IB5A 2XANA 5A3XA 2UV2A 4QHTA 3SATA 3A7HA 4FZDB 5F1ZA 1IXSA 4EC9A 4BR3A 4DINA 3VS6A 2J6MA 3DKOA 4OTRA 2VV9A 3QZHA 2JY8A 3PXRA 1MRVA 4GU6A 4UYAA 4GJ3A 1KE9A 4WURA 4UN2B 4XP3A 4CISA 3BQRA 4BL1A 1BUHA 3PE1A 2Y6MA 3MH3A 1QYRA 5DEYA 2C0TA 4CV9A 4UWCA 4GVAA 3ANQA 3LCUA 3QQGA 3P4KA 3F82A 2C1AA 3F6XA 5AX9A 2J7TA 2ZTCA 4K18A 1G8KA 4ZP5A 4O82A 2FGIA 4MXAA 2JY6B 1K3AA 4QD6A 1L1TA 3VLFB 3FMLA 3MB7A 4JAJA 4Y83A 5TT7A 5JGAA 4APCA 2R3NA 4XBOA 4ZSGA 1RQQA 3LIJA 3KK8A 3QQKA 2J2IB 5DT4A 4FKOA 3EL8A 4ANMA 5GZ9A 4I5SA 2JAMA 2X8DA 3CTJA 1T43A 3ZCLA 3NFGB 4TTHB 3O50A 4D2PA 3QCSA 4FRFA 3LFAA 3RHXA 2GFSA 3EYHA 4XG7A 2W99B 3HX4A 2V55A 3SA0A 4DH3A 5IWAM 4EUUA 2WMSA 3J7BA 3LQ8A 3JVSA 4R8QA 3EQPA 5TOZA 2GQSA 1UNLA 2ITXA 3SQQA 3HHWA 4J99A 4HCVA 3F9NA 3QRTA 5AR8A 1J1CA 3L8SA 2C6TA 3KQ7A 1N36M 2F2UA 4ZS0A 1ZYCA 3RAHA 3OCSA 1JKTA 4YZNA 1Q24A 4RZWA 1SNUA 1OIZA 3FSFA 4WSYA 2UU9M 2XKEA 4R3PA 3LQQA 2CNVA 4M12A 3PZHA 1V0OA 1QPEA 4DH7A 3UNJA 4LJ9A 5T3QA 4EYJA 1SXJA 2CCIA 4D55A 1WJ7A 2QZ4A 1B39A 3EL7A 5KHWA 3GLGB 4B3TM 5M51A 4XGIA 2PVMA 1D0MA 3ZSIA 2ZM6M 2ZAMA 4N70A 2XIXA 3EQRA 5H2UA 4WNPA 3HMIA 5AAGA 3L9MA 4FA2A 4X3FC 4IX3A 3UGCA 1Z5MA 4NK9A 4BWKA 3CTHA 3GEQA 4N6YA 1Z6TA 2VDBB 2KZSA 1IY2A 2Z60A 2G5GX 3QC9A 4QDEA 5EW8A 3EN7A 5LWMA 3MH1A 2PZIA 1NT2A 3FL5A 4AUAA 4A4XA 1GJTA 1OL2A 4FTUA 5I9YA 4LV8A 3D0EA 4WD5A 4JI3M 2VAGA 5M4UA 3A7JA 3S3IA 2RSVA 3FMDA 4I8OA 4CZUA 1IAHA 4BJJA 3TNHA 3FTDA 5CX9A 3VW8A 5HNGA 4CTCA 3NYXA 5HBHA 1MQ4A 3KN5A 1NVSA 4M66A 3J80S 5EXSA 5FGKA 2OBJA 4YHJA 2XEPA 3NW6A 4MK0A 3DKFA 4GH9A 4CGYB 5ANKA 5D12A 5M4FA 4FSUA 3FRHA 5E8WA 4ZS4A 3AC3A 4FV6A 4OTDA 3RTPA 3O51A 1T45A 4H58A 2R65A 4H3QA 4ZLOA 5EQTA 3BHVA 5K0KA 4HYUA 2YLFA 4PQNA 2WOUA 4IANA 3B9PA 1R7RA 4L16A 3ZUTA 3ZH9B 1S9JA 3Q5ZA 3NNUA 4KO8A 2FS1A 3FXZA 2BAQA 1Q3BA 4GCJA 3LFSA 2CSNA 3W55A 1XXHA 3MJ2A 2VX0A 2J51A 3NNXA 5IQBA 4GT3A 3UIBA 4IX5A 3ZH8A 4FVRA 2WTCA 5IQFA 4MBJA 3OXIA 4MCVA 4G31A 4ERKA 4CKIA 3CPCA 3HU2A 2R45A 4LQMA 2XNMA 1OIPA 4F7LA 4YJPA 2R7IA 2BALA 2J7OA 2VQEM 4BI0A 1W0XC 4LG2A 1ERKA 5FG8A 5EHOA 4EH7A 3HUBA 2XKDA 2YM4A 3V5WA 3SHEA 4U41A 4YZ9A 2XK6A 3I6UA 3COMA 3HU1A 4IWPA 1X8BA 2X8EA 1H1WA 2FVDA 4BY9E 4YJSA 5L3AA 2A27A 3PIXA 2V1UA 3HDMA 2GCDA 3HP5A 3HYHA 3ZRMA 4CFVA 3SW4A 4YC6A 4NSOB 1OBDA 2ZV2A 4GVJA 2WQNA 5IUGA 3NUPA 5FLFA 2OU7A 2XEYA 4TWOA 4EZ7A 4EOPA 4RRVA 1TH3A 4IC7A 3HMMA 2IW8A 3LQRA 4ZTHA 4LJ7A 3V8TA 2BZKB 2Z02A 3J81S 4TXCA 4XP2A 3DK7A 2UXCM 1ZWSA 4J97A 2PVKA 2IO6A 3KFAA 4JVGA 3ZBFA 4EL9A 4DDIA 3FMJA 3ZDUA 4LFAM 4BZOA 2ZM4A 2X9FA 2P0CA 1ATPE 1H6UA 3PPKA 1CKJA 2BROA 3QTRA 4O83A 2RFEA 3K9PA 4ZLYA 3TG1A 3P1AA 2DAEA 4J71A 5LVMA 1W2FA 4YR8A 3SG8A 4AXEA 4L15A 5EXTA 3PE2A 3QQHA 4NSTA 5IA4A 2I0EA 3KULB 3ZUVA 2W1FA 1DAWA 3BHHA 1XMQM 5LOHA 1OKVA 5JKGA 2QODA 4DTBA 2OH4A 4TWPA 5ANGA 4BCNA 4WA9A 3V5LA 4O7WA 5FDXA 3FZ1A 4HVGA 3U55A 3MJ1A 4KSPA 4F63A 3BHTA 3IQ7A 2YIRA 4ANRA 4L6V6 2EKKA 5AP3A 1VJYA 3KN6A 1GO5A 2WQMA 4KWPA 3KF4A 3W8QA 4PNKA 1AD5A 5DG5A 3OWJA 1J3HA 4IXPA 4NM5A 1OPJA 3TUDA 5IA5A 4UWBA 3TKHA 4R7IA 3DZOA 2XK3A 2X39A 4CEGA 2YLEA 5I4NA 3CJGA 4AQCA 3TACA 1R5LA 4PTEA 3WZKA 3C4XA 1OIRA 4O0YA 4EWQA 2R3LA 2JC6A 3JR4A 4P2KA 2PVNA 2X6DA 2BDWA 4LUDA 1CKIA 3RNIA 5DOSA 5EI8A 4BDJA 2ONLA 5AAFA 4X62M 2CGUA 1P2AA 5LQFA 4PD2A 3KS4A 4NRVA 4I6QA 3U9CA 3WYYA 3BL7A 4CMOA 5IQIA 4HYIA 4EK4A 2W1IA 3EOCA 3E92A 1OFIA 3GLGA 3ET7A 4FMQA 5GINE 2F49A 4D1XA 4YO6A 4DYMA 4DAWA 2W17A 3EHAA 3NPCA 5CVGA 4M0WA 3B2WA 5LVOA 4QMOA 4BCFA 5L8LA 1BYGA 2J0KA 3K2LA 5LARA 4EOJA 2R46A 4FK3A 2EUCA 3SYKA 4J7BA 1PYEA 4F1TA 5HLPA 3ZHPC 1OTRA 5KE0A 3UJNA 4RX5A 5GZAA 3R9DA 4O1PA 3CGOA 2LAVA 3I1AA 4JI2M 2VTNA 2YERA 5DPVA 5FWKK 4D1ZA 3VJOA 4FE2A 4M9XA 1HT1E 5A6OA 4C37A 4FCWA 2Z3XA 3WE8A 4WRSA 2BILB 2P3GX 5HCZA 4AS0A 4AW2A 2MJ5B 5FTQA 4M84A 2YZAA 4PDOA 3N51A 1RW8A 3VK8A 3QXPA 2J0IA 1QDRA 3MMPA 3LZBA 3Q32A 4BF2A 5H8EA 4QMUA 4FIGA 4QYEA 5DGZA 1KFVA 2VTOA 4JDHA 3TPZA 2HKJA 3HUCA 2DHYA 4GH2A 4TNBA 4FEQA 2KA6B 4CKRA 2WTKC 3EH9A 1E9RA 4FOBA 2R3JA 3LHJA 3ZS5A 4C4GA 4BGHA 4EZ3A 2ZB1A 4QRCA 3VRYA 1BMKA 4AN9A 1U5RA 4WBBB 1PJTA 3KRXA 5HG7A 1ZMUA 4EZ5A 4EBWA 5DR9A 3OF0A 2JZ1A 4AW5A 2CCHA 5BYLA 3L9PA 1SVGA 3DJ6A 3DBQA 3LJ0A 3VWAA 4E26A 4Y85A 4XG8A 3AKKA 5EJCA 4UMRA 3DFZA 3JY0A 3LE6A 2JP7A 2RKUA 2O0UA 3ORKA 4P16A 4JX3A 4LF4M 2UW5A 2XCHA 4FC0A 1IAJA 4RWLA 4FKLA 1TVOA 4R3CA 5BQ0A 3FI4A 3LVVA 5AFVA 5FTJA 4F4PA 5HQ0A 3P08A 4BBAA 2WZJA 2GSFA 3R1SA 2JFLA 3SXRA 5EK7A 1XHAA 1IEPA 1OL6A 4G4NA 3W2PA 4D2TA 3DBEA 2LTUA 1OIYA 2VTQA 2NYAA 4DEEA 3R21A 3RFWA 1JR3D 4PRJA 4AKHA 3TV4A 1TF0B 1XMMA 3NYOA 5A9UA 3ACKA 4R1YA 2Z7QA 3R71A 4GYGA 4I0SA 1Q3CA 3ZCBB 3K5UA 3R7IA 4IBFA 5A4CA 4AZVA 3C3EA 3WHLA 2X0OA 4YHHM 3GLIE 2RG6A 2ZDUA 4F7NA 4CYIA 2N35A 4GITA 4M13A 5HIEA 2W9ZB 4FT5A 3RKBA 2QNJA 4YJTA 1GABA 5C8MA 3UC4A 5E8VA 1ZZLA 1QUSA 1GLNA 3QCYA 1OIUA 2V7AA 4AQKA 4IB3A 2OW3A 3EQDA 4AE6A 5DFLA 2GNGA 2R3PA 2Y6OA 3VS3A 2ZV9A 3G9LX 2XIRA 4HGEA 2W4JA 3ZLWA 5HX8A 3RE8A 1UV5A 4MD8E 1TZDA 2ZAOA 5IUIA 3TDWA 3EFKA 3ZRKA 4RWKA 2XIYA 1L8QA 4M97A 4HZRA 4F6SA 2Z8YM 3GPPA 3LFCA 1XKKA 3CGFA 2DNAA 2ZDTA 2XF0A 1YXTA 3ZZEA 3LFQA 4ZMFA 2WMRA 4WSQA 2C99A 4B7GA 3K8ZA 3KULA 3GFEA 1FMKA 2DWMA 5C8KA 1ZZ2A 2HHHM 5AIKA 2G15A 4LMNA 4XCUA 3H0YA 3GC0A 3MVLA 1QCFA 4AW1A 1YWNA 4I92A 3TKIA 2WFYA 3NGAA 4FZ6A 3AV0A 3MIAA 1GZOA 3TIYA 4BDAA 4K1BA 3T3VA 1HNZM 2ZAZA 2OKRA 5CNNA 4KLNA 1GJSA 3F61A 3WI6A 1Z57A 1TGUA 5A2QS 4FVPA 3PJ2A 3A2CA 5JGDA 4K11A 4FT3A 3WE4A 2ZV7A 5CU4A 3RJCA 2REIA 4ACMA 3HKPA 2Y21A 3G2FA 4EOLA 2VX1A 1G8AA 3W33A 3W68A 4TN6A 4GU9A 4YPSA 4IAYA 3G0FA 4DR2M 2E9PA 2W82A 5HG9A 4OR5A 2Y4IB 4O7SA 3H4JA 3IGGA 3FXXA 4NIFB 1AQ1A 4HNIA 5K4JA 4O4CA 1ZYSA 4RG0A 4E8AA 2VWXA 2C6LA 4IB0A 2XYUA 4HPUE 3DTWA 3KRLA 4ZMEA 4AZEA 3PFIA 5LCKA 3VS5A 5E1SA 4BIDA 4WNKA 3SX9A 3FDNA 4HYSA 4R7BA 4KIOA 3GQ3A 4YTFA 2WKMA 1CMKE 3QZGA 3H3CA 1B38A 1N32M 1XQZA 4C2VA 5IQEA 2V1CA 4XV9A 2P55A 3PSCA 4GSBA 3I7BA 2C6KA 4ANQA 4I5PA 4FEUA 2X4ZA 3TL8A 2R0UA 4PNIA 1Z5AA 3FTFA 2X7OA 3HVCA 2JNHA 4D81A 2O63A 1Y6AA 3VNTA 2F57A 4BDBA 1JOWB 5FTKA 4XHKB 5KMMA 4YTHA 2J5YA 3GLHB 2UUCM 2BRGA 4EH9A 4JQ8A 3G0EA 1OUKA 3SOAA 3CSVA 4CG8A 4CFWA 2RFDA 2ZJWA 4F9BA 1G59A 3ENHA 3VDPA 4BI1A 4NRWA 4RC3A 1KV1A 3FLQA 4F70A 2R9SA 4JG6A 3VKHA 4GHAA 3QUEA 4O0VA 4ID7A 3SC3A 4BGGA 3U60B 4QOXA 5L2IA 2UUEA 3R7GA 1Q62A 1NNUC 5C03A 2B52A 4FV4A 4YO4A 3QTIA 3BI6A 3ROCA 5HLNA 4BTKA 4ZZOA 2C0OA 4Z8XA 3PA3A 4C62A 2PE2A 1JKSA 4XS2A 4C38A 2HXQA 4R1VA 4L52A 3CD8A 5BMSA 3FUXA 4RVLA 3BLHA 1SNXA 3NUUA 3QKLA 3PP1A 2C3KA 3T1YM 1PJJA 3LAUA 1GNGA 3GB2A 2PL0A 2XK9A 3HGIA 3ZRLA 4X64M 4NWMA 4ITQA 2I0YA 4RT7A 5B2MA 3NVKI 3F88A 5D11A 2QVSE 3DXQA 2R6FA 2X9EA 3SAYA 3FYKX 3RPRA 2CJMA 4RA4A 3QQJA 2R3GA 3SOCA 3PPZA 1AGWA 3K92A 4FV8A 2WELA 4K8AA 2W4KA 4JQEA 2HELA 2O01F 4ZTRA 5HCYA 2X0PA 4NCTA 4IWDA 3RINA 1WGLA 3PFQA 2QCSA 3Q53A 2O5RA 3CEKA 3POOA 1TFFA 2UUBM 3R0TA 1R1WA 2YM6A 2PZRA 5BUJA 2P2IA 4I23A 2PK9A 3PVSA 3NWLA 3JY9A 4WBOA 5M08A 5K5XA 2OF4A 2QKRA 4H36A 4AGUA 1Q39A 3FMHA 4XMOA 4AKIA 5E1EA 1NJFA 4G5PA 1VDLA 2L2DA 3MHVC 3NCZA 1G3IA 4TW9A 4DFXE 4FTQA 4E6AA 1VR2A 2QHNA 3LFBA 3SMSA 3R2BA 4NJDA 1JKLA 2QHOB 3CF0A 5HE3A 3TN8A 2YR0A 2C6MA 1ORYB 4CMTA 3V51A 1MRYA 4TYIA 1Q3DA 4NKSA 4HYHA 4MB7A 5KPZA 4H1MA 4ZSEA 3R8VA 3LCSA 2BZIB 2JIVA 1K2PA 5KO1A 4KKHA 1GIIA 1SXJD 3UODA 3I4BA 4DEHA 1NY6A 5J5TA 4FSTA 2ZBKB 3ODYX 1H1PA 3U54A 3SAVA 4F6WA 4AOJA 4I4FA 4U3ZA 3PWYA 2VIIA 3D2IA 2JXNA 1J7IA 3FHRA 5C26A 4AFJA 2FSOX 1JQHA 4I93A 5DLSA 5A14A 4C4JA 2CUZA 4QTCA 1YRPA 5CI7A 5FD2A 3DKGA 4RF0A 4UXLA 3NIZA 1PGYA 3TJDA 5AR3A 4IJEA 1MJGM 3R73A 4R3RA 4FL1A 4MX9A 5HBEA 3ALOA 3F5PA 1PRBA 1M14A 4FIFA 4Z6YA 3V5PA 2YEXA 4UBAA 2QOQA 1O6LA 1Q8YA 2XFTA 3D7TB 1YXUA 4B3SM 3KXNA 4AXDA 5HTIA 4EUTA 4TNDA 3GOPA 2XJ2A 3FL4A 3EN4A 4DV2M 3NS9A 3NLBA 4D4RA 2AEGA 3W0QA 1FGIA 4L67A 4DFBA 3TEIA 3LMHA 5ITQA 1VLRA 5HE1A 5JFSA 1REJA 4HJOA 2KHHA 4A9TA 3TL4X 4FV3A 3W32A 4NIFA 1UU9A 4LZJA 3MDYA 3JPVA 3QRJA 5ANDA 1Q3WA 2B9HA 5LWNA 4NJ3A 4CJ6A 3GT8A 2YAAA 5C27A 2JBOA 3E63A 3DJ5A 2OH0E 5M4CA 4A9UA 4JG7A 4NTTA 3GXLA 2UZBA 3B7NA 5H37D 5E4HA 5FTMA 5IT9S 1OBGA 5EM8A 3A42A 4B3RM 3FLYA 2WU6A 1IXRC 3BYOA 3R01A 1L2CA 4IZYA 2VWYA 4IAIA 3LMGA 3EN5A 3FUTA 4GEOA 3DGKA 3QAME 5J87A 3AC4A 4EH6A 5J1WA 4MH0E 3ATTA 2R44A 2UXDM 2PMLX 3GLHA 4RIOA 4RVTA 3R8MA 2HY0A 4FKTA 1OAOC 1E9HA 1SXJC 1QMZA 5DHJA 2XF3A 4QYHA 2R0IA 4FG7A 3QKMA 4UMPA 3EIEA 4NU1A 2XM8A 3BYUA 2ZANA 3PJCA 3U60A 2QURA 4O91A 4WRGA 4DV1M 2WD1A 4YU2A 5I0BA 3UG1A 2OOBA 3NBIA 4ANOA 3PZEA 1IM2A 4IIWA 1JKKA 3QTUA 2I7PA 4JR3A 3KOWE 3BHYA 4BTMA 4DV7M 5KMLA 3VHKA 5GJDA 2XK7A 3DB8A 3QCQA 1W98A 1LP4A 3FWQA 4DFNA 4NH1A 4GK3A 2CKQA 5DYJA 1XWSA 2W1HA 5JRSA 5CU3A 3KP0E 5CSVA 1FJGM 1K82A 3E93A 5HE0A 4C36A 3MFTA 4P5ZA 3MIYA 3MY1A 3U51A 2OFVA 4BB9A 4LF6M 3GVUA 4DA5A 4MXOA 4NM3A 2NP8A 4L78A 2LVNC 4XV1A 5FUTA 2FB8A 5KMIA 4AZSA 2OFUA 2XZFA 4MBLA 2IZTA 4FWHA 4D5HA 2QG5A 4ONAA 4IH8A 2XALA 4WG4A 1IN4A 3L2AA 4L7SA 3NCGA 3OFMA 3OWPA 3PJ1A 3I5NA 1IBLM 3Q52A 4AOTA 4CFUA 4L8RC 2YM7A 4YJQA 3MA3A 4UXQA 4AFEA 2XZUA 2W4OA 3VF9A 1QZEA 3U6JA 4CFXA 5AP2A 2XUUA 2C6EA 2PVJA 5ETAA 4AXFA 1OKWA 5BVKA 4JI1M 3GRVA 3PXGA 1TKIA 3HRCA 5HHWA 4NSRA 5L8RF 1Y91A 3ZEWA 2K6BA 4CZYB 3G9NA 3DA1A 4G17A 5F3WA 4JX7A 4BCMA 4D0WA 5J7BA 2XA4A 1Q97A 2W1GA 1PJSA 1XH6A 3OBJA 4IC8A 2HZ0A 2V6ZM 4J98A 3I79A 4WO5A 3FZOA 2C69A 2OJIA 4PMSA 5KUPA 5KCVA 3ZSHA 5ITXE 4EOQA 2IN6A 5HGIA 5M57A 3UQFA 5JI3E 4O21A 1GIHA 3FYCA 2CKEA 2FUMA 2EXEA 4DG0E 4CHTB 4DLIA 3KU2A 3VBYA 2XSZA 1QDTA 4JT3A 1UU3A 4FEWA 2O25A 4DTKA 3OT8A 5BYZA 3QZFA 3FYDA 1YOJA 3OMVA 2RG5A 4TYHB 3OXZA 4BZNA 5HG5A 4KB8A 5CEPA 5HZNA 1OIQA 3C51A 4IMYA 3PVWA 2DAMA 4BN1A 1T46A 1YE9A 2I1MA 4FZ7A 4DLJA 3W0SA 3UG2A 1PXPA 4AGDA 4JQ7A 3ZQJA 2AQXA 3R7UA 3MBLA 4YTCA 4RX9A 2LXEA 3CGWA 3PLAE 4FKWA 4FUYA 3Q4TA 5JSMA 4Z55A 4IBGA 3OBGA 3NX8A 4DBXA 3VQUA 4FF8A 3C1XA 4Q2AA 4FIEA 2WSCF 1JBPE 4MQ2A 3D15A 1KV2A 4FW9A 2XIKA 4F1MA 2BZJA 1NHGC 3PVGA 3BEGA 4QPAA 5E8YA 5DE2A 3GC7A 3C4FA 3UP7A 3PNVA 2P4IA 3C58A 1XBAA 3D7TA 3ELJA 4A4LA 4W4VA 1YHSA 3R9NA 2BRMA 4DG3E 4ANBA 2QOCA 3D8BA 2Y4PA 4QO9A 2ZB0A 3FY0A 4B3MM 4XOZA 1W84A 3BIZA 5IF1A 4RWJA 1K3WA 3L9NA 2QQ8A 4TT7A 4CTBA 4QP2A 4DHZA 4Y46A 2DS1A 3GLIB 4B8MA 4B08A 1R78A 4FOCA 4E5AX 1IN7A 4AW4A 3HMNA 5AR5A 3EKNA 4M3QA 4ZY6A 4I6LA 2NNWB 5CQWA 2K9DA 2WQBA 4IIRA 3FD9A 3R8LA 3VVHA 4F1OA 2DUVA 4BCQA 2Y0QA 2DWBA 5DNRA 4JXJA 2CN8A 2C68A 3R22A 2XK8A 3GRRA 2OJ9A 2WTJA 5CSHA 3BQCA 4OLIA 2GHGA 4F7SA 1PXKA 2F2CB 2A98A 2VX3A 4PY1A 4CQEA 2MH8A 4G4QA 1MN3A