1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity regulating kinase 2
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
3SRVB 2CDZA 3ZCLA 2I6LA 3IHPA 2YABA 3HMIA 3FEGA 4AGCA 3CY3A 4M69B 4P2KA 4DEBA 2XIKA 3MVHA 4L8MA 3WE4A 5A54A 1Z5MA 2HOGA 3F66A 1ZMVA 3OTUA 1VEKA 4MK0A 4Z9LA 3VS1A 4RZVA 4DG2E 4EH9A 3TCPA 5M51A 3ORPA 4U5JA 4WD5A 5EM6A 5LVLA 3R8MA 4IAKA 3ULIA 3NNUA 4JG7A 4PY1A 1YI6A 5A14A 3ZXTA 4EOMA 3RHKA 3NZ0A 4YLJA 2W9FB 3FZRA 1WHCA 5BMMA 4PMMA 1YLAA 3PY3A 3C4EA 4FSYA 2JDSA 2WMRA 4NH1A 4ANMA 5H8GA 3GU5A 3QCYA 4I24A 5I3RA 4IZ5A 3C4WA 2QHMA 4FYOA 4FL3A 5JQ8A 3MY0A 2B3TA 1UV5A 4QP9A 5FG8A 2PVHA 1XH8A 1TQIA 3E3BX 2PYWA 2GCDA 5DRDA 5EM7A 4PTGA 5JGAA 2WGJA 2IVSA 3HLLA 4R1VA 2SRCA 3QGWA 4IXPA 3EQCA 2DENA 4RVKA 3NIEA 4AF3A 5C4KA 1HCKA 3MTFA 3UQFA 4IFCA 4OAVB 3KC3A 5AUZA 3R7YA 4U7ZA 2CN5A 3D9VA 4PTCA 2X39A 5ANDA 3D14A 3SV0A 2W06A 2HAKA 3QCQA 4JX7A 2JFLA 2GMXA 4ZMEA 5AV1A 3LMGA 4CT1A 2OIQA 3L8PA 4GK3A 4JS8A 5EI2A 5IA4A 1LEZA 3NSZA 4KD1A 2GU8A 5ANEA 1E94E 4GT5A 1MUOA 4ITJA 1H24A 4X3JA 4EWHA 1FPUA 1S9JA 1YXSA 2YWPA 3G9NA 3QTXA 5AV3A 3RPYA 4BZDA 3KRXA 1PMUA 2E9NA 2OU7A 5BVEA 2PVFA 3OY3A 1YHSA 3ZS5A 3FSKA 1IEPA 5FDPA 3LFCA 4ID7A 3QRIA 4UALA 3UTOA 5HO7A 3A60A 4YJVA 2R3PA 3MW1A 3OROA 4I6HA 1Y8YA 3ORNA 3O50A 3G6GA 4C0TA 4IVAA 1CKPA 4LV8A 3U9NA 3U87A 4AT4A 5F95A 4JBOA 4FTJA 3WYYA 4O83A 2CKOA 3PJ2A 2IN6A 2UW7A 3HMMA 4F1TA 3KA0A 5AEPA 4QRCA 3NX8A 3MDYA 3IG7A 3OOMA 2ERZE 4YZCA 3IO7A 4H05A 3DB8A 4NCTC 3Q5IA 4GH2A 4GCJA 2JDRA 5DG5A 3QCXA 4G17A 4NUSA 5BMSA 1T43A 2P3GX 2YFXA 3G5DA 4FSMA 4IEBA 4TTHB 3SW4A 3LFNA 4UMQA 3GUBA 3DBDA 4XG6A 2XA4A 4EL9A 3ENHA 3EN9A 2JY6B 2QONA 1IRKA 1ZZ2A 2XK8A 3C4XA 4UWCA 4XBUA 1URWA 4GUBA 3LCUA 4CXAA 5CU0A 4IH8A 1FQ1B 3SOAA 4FEXA 4LGDA 3LQ8A 1KV1A 2XCKA 3MVLA 4FZ6A 2VD5A 3PZHA 3JS2A 3OBJA 4WSYA 5DFPA 5HVJA 5KZ0A 4FEWA 3QRUA 2BAQA 3RTPA 4CKRA 2CNVA 2LVQD 4EOKA 2PVNA 3K3JA 4IAIA 2PVMA 4EC8A 2QR8A 4FK3A 3CLYA 4AE6A 4MXOA 3HRCA 3CP9A 2XK7A 1O6YA 2BZHB 2R7IA 3F3VA 3QZFA 4YJNA 2WMAA 2BRGA 5BYYA 4TWCA 3QTRA 4NK9A 3QKMA 3R9DA 2LGCA 1W82A 2OXDA 4BCMA 4ZSAA 5ETIA 4RJ5A 4CD0A 4EZ3A 2X7OA 4QT1A 3E93A 4CYIA 4LRJA 1XO2B 4GW8A 3RWPA 4O7YA 3LCKA 1OIUA 1G41A 5AFVA 1OKWA 3EFJA 4YJSA 2O0UA 4ZY5A 3E87A 4XV3A 2CJMA 4H1MA 2EJSA 1UVRA 5AR8A 4BWPA 4IBMA 4XP3A 4ACDA 3AC2A 2PMIA 2ZM1A 4UX9A 3KXGA 4BI2A 1ZYCA 4AA4A 5BUEA 2YDIA 2XNMA 1M2QA 3ORMA 3UC4A 2XRUA 4WBOA 2VTMA 4L9IA 4TYHB 5C03A 1OUKA 4O7TA 4L7FA 2QHNA 4FIFA 3PRIA 1CMKE 4KRDA 2EKFA 2XP2A 5JZNA 3ZC5A 4M13A 2GDOA 1IXSA 5DT4A 4BDFA 3WF9A 3ID6C 1GZ8A 2VO7A 4U44A 4L3PA 2F7ZE 3ERKA 1OPLA 4D55A 4YO4A 2BFXA 1PJKA 2C6IA 2UW6A 1V0BA 2BDFA 2XNOA 3ACKA 4L01A 4M66A 4XV2A 4E5AX 1TQPA 3L9NA 3RPRA 3LCOA 3CKXA 3D7TB 4HEOA 4B0GA 5HCYA 5CEMA 3D5WA 5M53A 2OO8X 1ZOGA 4JIKA 2FB8A 2R3HA 2XNBA 4H3BA 3PSDA 4YNEA 5LCJA 2B0QA 3Q52A 3UPXA 3ZO2A 3SW7A 4C37A 3BU3A 4DCEA 4BCPA 4R3CA 3ZO3A 3LAUA 3HZTA 1J7UA 5TO8A 3CSVA 4RFZA 4KIPA 2F2CB 4AP7A 3MMPA 1KE6A 2YDKA 3Q9YA 2Y9QA 5DOSA 3FMEA 4ZSEA 1T6OA 2R3KA 2BWBA 1TKIA 5CT7A 2K0BX 5HBEA 5KUPA 1J7LA 5M55A 2W99B 4O1OA 2HCKA 4LRKA 1MN3A 3GC0A 1SVEA 2ZMCA 4Q2AA 3Q4CA 4Y73A 4BDDA 4IX6A 4HNIA 2PSQA 3OWPA 4MXXA 3BBTB 2FGIA 4JT3A 4BFMA 1PXKA 1J7IA 4BDIA 5CSXA 3FMLA 1NY3A 2W1FA 4JQ7A 4L44A 2ITOA 3FJQE 4BCIA 1FINA 5I0BA 4PNIA 2C5VA 3L9PA 2IZUA 4CFUA 2J51A 3IDBA 3PVWA 4NZWB 1H1SA 2A4LA 3R0TA 4A9RA 4EYMA 2BIYA 1PXOA 2YLEA 3L1SA 3NIZA 4QYGA 5DPVA 2W9ZB 5HLPA 2WD1A 3R7EA 3VULA 2CKPA 3T6PA 5DI1A 3Q32A 5JK3A 2YEXA 5CVFA 1H1PA 2F2UA 4BICA 3BLQA 4UYNA 4AGUA 3SC1A 5FUTA 4ZLYA 5BQ0A 4ALVA 2YZAA 3DAKA 4OTDA 2IVTA 2QLQA 5EW8A 5AAGA 5TT7A 4RC3A 3H4JA 4PL4A 3M42A 3A7HA 3FZ1A 4JDJA 4RX7A 3SDJA 1MQBA 2JGZA 4ZZMA 4GSBA 3ULZA 1MRYA 1W84A 3BHUA 1DV0A 4D5HA 4XEYA 4BCGA 1YHWA 2Q83A 4GYIA 4C4IA 1VEGA 3O51A 1Q24A 5HO8A 2ZVAA 3RJCA 4CLIA 5K3YA 2IW8A 2WFYA 4FNXA 4AA0A 3AT4A 2XCHA 3R28A 1BYGA 3HUCA 4YJUA 4EQCA 5AP5A 3DNEA 4FV9A 4PMSA 2QQ7A 4HGLA 3A2CA 2O65A 3QU0A 4GU9A 4LM5A 4UXQA 3RVGA 2OO9A 2PVJA 4XUFA 3KVWA 4FTLA 2QKRA 2VO0A 3I5NA 3MSSA 4OTFA 3WZJA 4DGLC 3GC7A 5EM8A 5LVNA 4Q7JA 2QC6A 4FKWA 1OBGA 1QPCA 4NYEA 3UQGA 3PXYA 2CWBA 5BVKA 2ITQA 4NU1A 3N4UA 3NLBA 4D28A 1AIPC 4DEAA 3PVBA 3W2OA 3R8ZA 2ONLC 4G3FA 2R3OA 3LMIA 4ZSJA 1U54A 5JI2E 3FL4A 3WIGA 4TZRA 4E20A 3E88A 3IPHA 4MD8E 3AD4A 4F09A 1PMVA 3QYWA 5KE0A 4F6SA 5BNJA 2UZUE 1H08A 4XG4A 5EYCA 3EZRA 4W4YA 5CU3A 4JG6A 4ASDA 4GV1A 3AC1A 4AN3A 4G3CA 1XH5A 3ZSHA 4ZTNA 4EOLA 1RE8A 1Q8UA 4I21A 3BLRA 3D4QA 1GNGA 2G2FA 3FBVA 3T3UA 4AOIA 5HI2A 4MKCA 3PWDA 3E8DA 3VS7A 4F9AA 3P86A 1Q8ZA 1M7NA 4L46A 5L2WA 3DTWA 3D0EA 4QD6A 4W4WA 4HOKA 1NVSA 3PVUA 5JMSA 3QXOA 4P5QA 5DR2A 3G0EA 2PL0A 3E8EA 3MH2A 3PSBA 5CTPA 2LVPC 3D7ZA 5DEYA 2BKKA 4O7RA 4MNEA 4FSTA 1Y6BA 4CRSA 1ND4A 4EEVA 2J2IB 3I6UA 2JUJA 4MD9E 4AZSA 5M4IA 5FTQA 1KE9A 5GJFA 1OUYA 1OL7A 4OTHA 1OL6A 2JBPA 4NKAA 4BKZA 2JFMA 4C4GA 4O38A 4EH2A 4G6LA 1B38A 1H0VA 4KIOA 2W96B 3PRFA 4IADA 3HV7A 4MHAA 4F9CA 4G6NA 4MF0A 5AUVA 3BWFA 2QG5A 1H0WA 4NJDA 3BEAA 5EI6A 3F82A 4OT5A 2WTCA 5IQAA 3MYGA 4K11A 3DXNA 3FLWA 2UVYA 1YQJA 4EKKA 4DTKA 2PTKA 2DKLA 2VTSA 4ONAA 2KTYA 4NKSA 4FV8A 1QMZA 4F0IA 3BU6A 3FWQA 5I9VA 4I92A 4CZTA 2UV2A 3Q2JA 2ZTCA 3SOCA 3AD5A 2P55A 3CTJA 3KULA 4RSSA 4L52A 2DAEA 5DVRA 1G4AE 4LUEA 2O5KA 3F2NA 5G6VA 3CCNA 4CGAA 1P4FA 5IH4A 1YDSE 3DZOA 4EONA 5I9UA 1PYEA 3ZEWA 4L43A 2FA2A 3OXZA 4W4VA 2QLUA 5KBRA 2OIDA 1OB3A 3FMNA 3O8PA 1PXLA 2Y4IC 4YTHA 4L3JA 3W2SA 5HU9A 3Q6UA 3EWHA 4B8LA 3KKVA 5FEEA 3PZEA 3VF8A 4FEVA 3D2IA 3D83A 4ENYA 3D15A 2PULA 4GJ2A 4QMXA 5E7RA 2RFNA 4BIBA 2ZB1A 5EQEA 5KMKA 2B4SB 5HQ0A 3NW7A 4J1RA 3BHVA 5JZJA 5HIBA 5HVKA 3IDCA 2CNQA 2EXEA 2ZV7A 4CV9A 4KABA 4EH8A 2CGWA 4ZK5A 3WILA 5HIEA 4UYAA 1WVWA 4Q5HA 2BZIB 4QP3A 4F4PA 2YM6A 4ZLZA 3CQWA 2C6DA 5DLSA 5DN3A 2OJ9A 3ZLSA 4FG7A 4MEDA 3KRWA 1KE7A 4KA3A 4QNYA 1V0PA 3EQRA 3R63A 3TJDA 4DTAA 4OLIA 5I4NA 4BGQA 5H3QA 2RFEA 1HCLA 4WRSA 4EUTA 2CKQA 4UY9A 3FY2A 3DU8A 3GB2A 4RFMA 2GTNA 5L2QA 4FMQA 4N70A 3QQUA 3HP5A 3QHRA 4MCVA 5JKGA 4QP8A 1GAGA 2WMSA 4LGHA 4QMYA 1PKGA 1FGIA 1UWJA 2J5FA 3AC5A 2C5NA 3KXZA 4YJPA 1E1VA 3C4CA 3H3CA 3OCTA 3NR9A 4L67A 4HVHA 4DT9A 4BCJA 3PP0A 1KE5A 3EH9A 2PHKA 2QD9A 2FO0A 3FC2A 3GT8A 4P4CA 4UXLA 3R30A 4J98A 3VQHA 4IZYA 1G8AA 5AV4A 5HIDA 1BMKA 4EOOA 5DR9A 4D9TA 3MPMA 2OH0E 2VTTA 5AUXA 5J79A 5HEZA 5H8EA 3PA3A 4HVGA 4DEIA 4BTJA 3V8WA 1YRPA 2C5XA 1OGUA 4FKSA 4R78A 2PUPA 4B99A 1XBBA 4GVAA 3QUDA 1AGWA 2C1AA 5D7VA 3RGFA 5DRBA 1KV2A 4NIFB 3SG8A 2IJMA 3OOGA 2ZTDA 4IE9A 4QP7A 4X3FC 2LBCA 4H1JA 5KNJA 3LPBA 4DITA 3E21A 4IWQA 4AFEA 4TNDA 4KUJA 3SGCA 2XIYA 1P5EA 2R7BA 3H9OA 3QX4A 3KQ7A 3WBLA 5FDXA 1K9AA 2YIXA 2BILB 2I40A 4FL1A 2VUWA 3OP5A 4UB7A 5J7BA 2C3IB 1LP4A 3LFFA 3ZZEA 1VEBA 3BYMA 3TIZA 4PPCA 5IMXA 2P33A 3PJ1A 4C34A 4EK8A 3WARA 4YSJA 4O7LA 2XEZA 2BRMA 3OD6X 2C6MA 4W9WA 3RZBA 4EBWA 4GFGA 2C68A 4IANA 5CVGA 3R83A 2PVRA 2GNHA 4F65A 1M52A 4XS2A 4FK6A 5BX0A 3RHXA 5A9UA 2GS2A 2OGVA 5IA0A 4C4JA 4I20A 2WEIA 2EKKA 4ZLOA 2J0JA 3I5ZA 3P7BA 3DKFA 3E92A 5GHVA 1G3IA 1IM2A 4QPMA 3QD2B 4WKQA 3Q6WA 2WOUA 2BROA 2IG7A 5IQBA 1B39A 2J90A 2Y6MA 1JKSA 4G9CA 4FT9A 4YR8A 1SVHA 4IVBA 3HV6A 4DE4A 2CCHA 3I0OA 5DT3A 3EQBA 5AAFA 2Z7LA 4EC9A 5C8NA 2CKEA 2H8HA 4QPSA 5L8JA 4R77A 3ZM9A 4QNAA 2Q0BA 4RMZA 4PDSA 4IWDA 4L53A 5CY3A 1F3MC 2OJGA 3DJ5A 4FT3A 5AM6A 4QTBA 2W4JA 3NUPA 3ZRLA 2ZV8A 3QTWA 4O1PA 3W8QA 3UG1A 1IAJA 4CQEA 2BHEA 3BIZA 3F5PA 1OAIA 2GFSA 3EB0A 4MBIA 1DI9A 3C13A 4IWPA 1RDQE 1OKYA 4AE9A 2OSCA 4QP4A 5HE1A 3RAIA 4FGBA 3QQFA 1VZOA 3CIKA 4IZ7A 4U40A 4DTBA 4XG8A 3TZ9A 2MJ5B 4AWIA 3PY1A 3R1SA 4DEHA 2JBOA 1F4IA 3MFUA 5KHWA 4TXCA 5EYKA 4DFBA 4A4OA 2UW9A 3QKLA 4LL5A 1OBDA 4CZUA 2A1AB 3EIDA 3QGYA 5GJDA 3I79A 2WQEA 4G3OA 4HPUE 3PXQA 5EHLA 4U80A 5CNNA 5J7HA 4C3FA 2I1MA 4CEGA 4O0XA 4FZAB 5LMAA 4PNKA 4BDEA 3LLAA 1H00A 4MQ1A 5EQPA 4WA9A 1XH9A 3TEIA 1XXHE 1WBTA 3O17A 5L2TA 4L3LA 3PXRA 5GZ9A 3U6IA 3FLQA 4O7ZA 5IQEA 1TVOA 4DFZE 2C30A 1H1RA 2WO6A 2YN8A 4DH8A 3MY1A 4MYGA 4O86A 4I0SA 3L9MA 2ZMDA 1APME 1V1KA 2YJSA 3ORLA 5D7AA 3VBXA 4HJOA 3F5GA 3L8VA 2AUHA 3ZFXA 4MWHA 3PSCA 4KNBA 5JRSA 3HUBA 3JVSA 3R71A 4Y46A 2VTQA 1BL7A 5FP6A 3MFRA 4S32A 5EG3A 3KMUA 5J1WA 4PWNA 2X4ZA 3UYSA 3KXNA 4ZJVA 4IX3A 2L4EA 4B4LA 2J0LA 3I60A 5JSMA 4ALWA 1WR1B 4FKRA 1A06A 1ZOEA 4AZEA 4E5WA 3KK8A 3IW5A 3VS6A 3HMOA 2VTLA 4I6FA 3SLSA 5BYLA 2VWXA 4TT7A 4CG9A 2BDJA 2ESMA 4ZZNA 3MV5A 4CT2A 4QO9A 1IASA 1U46A 2J0KA 5DWRA 4NWMA 5CEOA 4HNFA 2C6EA 2YLFA 5HORA 2NPQA 1H4LA 3R1NA 5HX8A 3R7IA 2ZDTA 3QRKA 1PYXA 2GHGA 3SAYA 4FV4A 4PQNA 3MFTA 5K4IA 2MGWA 4JDHA 3V5PA 3I7BA 3O7LB 1OKZA 4YJOA 5B7VA 2DWBA 4RQVA 3PXFA 3ELJA 4YZBA 3PXKA 5LVOA 1SG9A 2YAKA 4KIKA 5H2UA 2IW6A 3COHA 3VUMA 2WMUA 4FUXA 2QOOA 3QF9A 4TYHA 4M69A 4Q5EA 5BVNA 4HVIA 2MR9A 4KS8A 4QMSA 4R6VA 5HTIA 4OUCA 4FKJA 4JRNA 1J1BA 1MRUA 5EOBA 4YSMA 4ORKA 2QURA 4PUZA 2QOBA 4USDA 1JQHA 2QOLA 1OTRA 3F6XA 3QWKA 2QU5A 4RJ8A 4IAAA 3KRJA 4NW6A 3ZMMA 2B52A 5J9LA 5AMNA 4D2PA 2DAMA 3TUBA 3RK9A 2WMBA 5A4TA 4KSPA 4EOJA 5M08A 3UGCA 1O9UA 5DYJA 2I0YA 4MQ2A 4S33A 3PIXA 3WF5A 1GJOA 3TJCA 1YXTA 4ZJIA 5FEQA 4DFLA 4XOZA 3NYXA 4LYNA 1JSTA 5DBXA 5AV2A 4HGEA 3RAHA 4C3RA 5KBQA 1YOLA 4BTMA 1WBPA 4WUAA 2CNUA 4I3ZA 4QQ5A 4IQ6A 1SNXA 3CTQA 2C6TA 3HKOA 3ZLYA 5F1ZA 5CSPA 5CYIA 2CPKE 5FTOA 1Q62A 3DKOA 4M0YA 1ZAOA 4BB4A 3Q4UA 2HW7A 1FVRA 3CD3A 2R3RA 4NM0A 4ZTLA 2WHBA 3BPRA 4WG5A 2HYYA 3KF4A 4YHJA 3RBWA 3VBWA 4ANOA 2VGOA 3T8OA 3M1SA 3R8LA 3IOKA 3LCSA 3UZPA 1SM2A 3FZTA 4IC8A 4RQKA 4DH1A 3OUKA 5JFVA 4N0SA 3NS9A 3QWJA 4PL5A 5K4JA 3HV3A 1O6KA 3K5VA 5LARA 2JZ1A 1GIHA 3RKBA 4BC6A 5IEXA 4ZS4A 3F3WA 5M4UA 1FBNA 1R0EA 3S1HA 4FE2A 5CAVA 3KXMA 4FTTA 5FXSA 1X8BA 2DHYA 3FKNA 4BDBA 3VF9A 4QMWA 2BRBA 2C6OA 1FGKA 1YOJA 1DO0A 3DQWA 4ZP5A 3TZMA 1JAMA 2XYNA 4A4XA 4EH4A 5LWNA 3BYVA 4PX6A 3QC4A 4UN0C 5D1JA 3BEGA 5I9XA 2IPXA 2R4BA 2WQNA 1URCA 3LMHA 3GCSA 1XHAA 3G33A 3LOKA 4J8NA 1Z57A 2BDWA 4CFNA 4OAUC 4O7NA 1PKDA 3OHTA 3E7OA 2BAJA 4WSQA 4TRLA 5DT0A 3O71A 3AT3A 4YP8A 3U4WA 1BI8A 3TZ7A 4I6QA 3GCQA 4II5A 4R7IA 1XBAA 3QTUA 4XG3A 4DA5A 3HNGA 3QX2A 4PL3A 3PWYA 4XOYA 2EB2A 3IW7A 3MB6A 3O8UA 4HYHA 4HW7A 1OM1A 4ANLA 3CD8A 2LVNC 5ANGA 3LFAA 2WQBA 3A7GA 4TPTA 1JLUE 3NWWA 4D2WA 4QMQA 4OTQA 3RM6A 2OF4A 4LL0A 4MD7E 4NT4A 4EOPA 1IFYA 3ET7A 4HVSA 2R3FA 4Z3VA 4DH5A 3S00A 2WMWA 4F6WA 4F99A 3LXKA 1PXNA 2UZBA 3GI3A 2Z60A 4UMRA 5AIRA 2YIYA 2X6EA 1H1QA 1UNLA 2UW4A 2UUEA 4IC7A 1U5QA 2Y4IB 3EJ1A 2PMNX 3S2PA 3QTZA 3NUUA 1MQ4A 4FF8A 3GLHE 2XB7A 3CEKA 2OBJA 2X8DA 1OPKA 3ATSA 2ITXA 3DBQA 5HX6A 3OXTA 2DYLA 4FTAA 3N9XA 4DAWA 3GGFA 3QUEA 4ZS0A 5M56A 3A62A 3VW8A 2Y0AA 4EJ7A 2WMXA 4UMUA 3KXHA 5L8LA 3OCBA 5IQHA 4I23A 3DBCA 5EKNA 1VDLA 4ANQA 4FSRA 2VNWA 1R78A 3UP2A 3WOWA 5DHJA 2VX1A 2XK9A 4ZAUA 4FNZA 2HENA 4RJ6A 4ZTHA 2QVSE 1QPDA 2VU3A 3R21A 1OQYA 1WAKA 4G3EA 4UBAA 5J8IA 3G9LX 2KHHA 5AP4A 2ZDUA 3S0OA 4XP2A 5CAOA 4DHFA 4AN9A 5DMZA 4FIGA 1WBNA 2FYSA 4NM7A 3P9JA 3LM5A 5CQUA 3WIKA 3RK5A 2XIZA 1VEJA 4GYGA 5AV0A 3UO4A 4AW1A 2W1ZA 3NEWA 4JXFA 1XJDA 3V5TA 3FAAA 4DYMA 3VRYA 5IQDA 2R64A 3KEXA 3MA3A 4IX5A 4AFJA 3U54A 5D10A 1PHKA 4RBLA 3TNQB 2PK9A 1Q41A 3HEGA 4AGWA 4E5BA 1RW8A 4ZY4A 5CANA 5CX9A 4BGHA 3FZOA 4AACA 4RT7A 3HDMA 5CXHA 3TIYA 5IDPA 4E4NA 4RIWB 3QA0A 4F9BA 2AYPA 1CUKA 3FDNA 5BPYA 2WOTA 1KOBA 4ALUA 3D7TA 3VUDA 1YDRE 2NO3A 4MAOA 2ZM3A 1WZYA 4FVPA 3ENMA 3MIAA 4EOIA 4F63A 2OKRA 3TV7A 3HX4A 4I5PA 1IA9A 1ZYLA 3TKHA 4E6CA 4D58A 4RVLA 3T9TA 4BCNA 4H58A 4QYFA 3AC8A 3POOA 3REPA 1JWHA 1H26A 4ERWA 3R9OA 3UNJA 3MA6A 3Q5ZA 4QTCA 4XLVA 4A06A 4AUAA 3LXLA 5C01A 4MX9A 4ARKA 4GIIA 5M57A 1Q3DA 1FVTA 4ZSGA 3EN5A 3ORIA 2OJIA 4X7QA 4YHTA 5FGKA 3C0IA 3FPQA 3UODA 2K9DA 2JKKA 4BTFA 3BE2A 3QD0A 4ZSLA 3U4UA 3UC3A 4NTSA 4ZTSA 4YZDA 3OW3A 5L4QA 3RNYA 3QZHA 4BDCA 3MS9A 3JY0A 2B9FA 2UZWE 2W1CA 5DR6A 5HG7A 2X1NA 4GKHA 5KCVA 2E9VA 4AA5A 1DI8A 3HV5A 2Z2WA 5HD4A 3QTIA 4O7VA 3EZVA 3SXSA 5IQFA 4BI0A 4C61A 3GC8A 4YZMA 4XJ0A 4FZFB 4AZFA 3I1AA 5J87A 4D0XA 3R7GA 1CSNA 1ZRZA 2YAAA 3FYJX 3LJ2A 4X6QC 4EK6A 2R0UA 4C62A 3VO3A 3E64A 1H28A 2W1DA 2DAKA 1VYWA 2IO6A 5FP5A 5E8YA 4V01A 4ASEA 1BL6A 3UVPA 3Q3BA 3W18A 4I5HA 2O3PA 1RJBA 5C8MA 4JJRA 1JPAA 4KKHA 4KBCA 4KAOA 2CLQA 4L68A 1J3HA 2HZNA 2VTOA 2FSLX 3DV3A 1ZYSA 3NYNA 4O27B 3Q9XA 1V92A 2WB8A 5TKDA 4U45A 4EK4A 5JRQA 4YMJA 4LRMA 4IB1A 3RM7A 4XRJA 2C3JA 4KBKA 1FMOE 3N4VA 2CSNA 3CY2A 3NAYA 4NM5A 3OS3A 4LGGA 4BY9E 4W9XA 5A46A 5ANIA 3PLAE 2J4ZA 5T68A 3C0HA 1UU3A 3ZLWA 2BVAA 2PZPA 2YCQA 2ERKA 4D4SA 3ZXZA 3P1AA 2XNEA 4EJNA 4C4HA 4M12A 1AQ1A 2VWWA 2CGXA 3Q2MA 4U81A 4ACHA 4IM2A 3OWLA 5J9ZA 4DF3A 4TL0A 1M2RA 4RJ7A 4R7BA 1YXUA 2YM8A 2QSFX 4I93A 3VHKA 3DAJA 3BQCA 4XG2A 3B8RA 3A61A 4U43A 2W1IA 5JT2A 1BVSA 2DZLA 2JNHA 3D5XA 2YHVA 5CENA 3UMWA 1YWVA 4C36A 3P7AA 2O64A 2X81A 3ALOA 1ZMWA 1SVGA 3FLZA 3I81A 3HDNA 3CPCA 3Q60A 3MN3A 3BBWA 3ZEPA 2CHLA 1M2PA 3JPVA 4P90A 3FMKA 4AW5A 4C38A 4DN5A 3NVMB 2O25A 1TR8A 4O96A 4Y5QA 1NT2A 2E2BA 3ANQA 5JQ5A 1M14A 5AP1A 5AX9A 5E8ZA 3ETAA 3TL8A 4NTTA 2DNAA 3VS2A 3DKCA 2OLCA 4F9WA 4OTWA 1Y8GA 3VBQA 4R8QA 4EYJA 2BALA 4RJ3A 3VAPA 3GU6A 4J95A 2QOIA 5CZIA 3KGAA 3ROYA 4FI1A 1PXMA 4A9TA 4TYIA 4Y95A 5IMEA 3R1QA 4JG8A 1KUTA 5AA8A 3VNTA 3RPVA 2BFYA 4IB0A 2W7XA 5E4HA 2EXCX 4AT5A 5FTGA 4Z7GA 3V6RA 4DEGA 4UMPA 1ZOHA 3ALNA 4BI1A 2GNLA 4MNEB 4YJRA 4C33A 2PMOX 1BKXA 3FL5A 2J5EA 1NVRA 5HNBA 3C7QA 3UP7A 4MVFA 2WMVA 4E26A 3PJ3A 2P0CA 3T9IA 1M17A 2ZM4A 2ITWA 2FH9A 4BR3A 4RWKA 4K0YA 4RVMA 3F3TA 2B53A 3WZKA 1A9UA 5BUJA 2WTJA 3GFWA 2C47A 3CJGA 4X21A 4QPAA 4F1OA 5KKRB 4LOOA 5JGBA 1YVJA 2R3GA 1K3AA 2JAMA 4L45A 4MF1A 2BHHA 5AR5A 3LQ3A 3FI8A 3ZBFA 1J91A 3TKIA 4FTUA 3ZFYA 3NUNA 4EZ7A 4LG4A 2DAIA 3QZGA 5FLFA 4O81A 3U55A 5DEWA 4IB3A 3ROCA 3R8VA 3F3UA 2Z7RA 2LAVA 1H8FA 2J6MA 3DA6A 5K5XA 4BCHA 4EZ5A 3PIZA 3S95A 4BKYA 5A6NA 3QC9A 4Y72A 2VTAA 1XH7A 2VTRA 2B9IA 2JLDA 3O96A 4X0MA 2JIUA 4JIAA 4GEOA 4A07A 5CF5A 3DLSA 2C3LA 5HICA 5HG9A 3LM0A 3GLGE 1Y91A 2PVYA 3U9CA 3QLGA 3DTCA 3LCDA 4W4XA 4WIHA 4O82A 3DBEA 3DQXA 3DDQA 2FSTX 3QL8A 3R7VA 4RX8A 3ZU7A 2GTMA 2GS6A 4TN6A 3ZFMA 2L2DA 3NRMA 4G16A 3SVVA 3W2RA 4W8DA 3FI4A 2XRWA 3RCDA 5B2MA 4AXAA 2OZAB 4S34A 4CSVA 5KMMA 4J52A 2EB3A 1QZEA 2OH4A 2VO6A 3E62A 2YITA 4DH7A 1WGNA 5FM3A 2W4OA 4ANBA 4F1MA 5HTCA 2JY7A 1HT2E 5CU2A 2XBJA 4GK2A 3I7CA 4GT3A 3C9WA 3L8SA 3DJ6A 4Y83A 4FA2A 3NW5A 5HTBA 4IAZA 2WMTA 3BHHA 3R6XA 4K9YA 4V04A 4V05A 3NPCA 3OT8A 5CVHA 2WQOA 4BBFA 4AN2A 1XB2B 2RGPA 4QMZA 4E7WA 4UWYA 1DO2A 4IM3A 1BUHA 4M67A 1A5TA 5L2IA 4E8AA 3HA8A 1Z9XA 4D1ZA 1PXJA 3GLFE 2J0MB 3NNVA 2BZJA 3ZHPC 1VQ1A 3A4PA 4GJ3A 3VS5A 5EH0A 2OF2A 3KY2A 4ZMFA 2F7EE 2R3MA 4U8ZA 4DLIA 2W5BA 3F2RA 3IK3A 3MI9A 3EL8A 3V5QA 4Y5HA 5CZHA 5M07A 4I1ZA 5JFWA 1LUFA 4FIJA 4TWPA 3N51A 2W5HA 3IDPA 3ZC6A 3EQDA 5C1QB 5IEVA 3OBGA 4IIRA 3SXRA 2ETMA 2RF9A 3CQEA 3UG2A 1Q61A 5AR3A 3MY5A 3S3IA 2GQGA 2C69A 1HJPA 4JBVA 4I0TA 3VS3A 2FSOX 2OI4X 3P7CA 4KKEA 4MTAA 4RA4A 1PF8A 2WTIA 3UZRA 3PJCA 1XKKA 3LXPA 5IQIA 3AOXA 4BF2A 3RNIA 2JKOA 2V7AA 4QYYA 5JEBA 4G3DA 4DFUA 3OF0A 2GS7A 3PPJA 1L8TA 2IZRA 4MXYA 4J97A 3V5JA 1BX6A 4JR3A 5LVMA 4J7BA 2VTIA 3SD0A 4CFMA 4NIFA 3DAEA 4W8EA 2JD5A 3RPOA 3GCPA 4AT3A 4IVDA 1S9IA 1OITA 4B7TA 4EH3A 4WNOA 4YC8A 4JOAA 4C02A 2Y6OA 4YJQA 4M84A 2VTPA 1H01A 3UNZA 4YBJA 2CGVA 3M2WA 4IFGA 3AG9A 3UNKA 2EWAA 4NSTA 5IU2A 3NW6A 3T3VA 1QL6A 3GFEA 3LHJA 3VS4A 2IZTA 3GU4A 2QI8A 4J71A 1UKIA 2VZ6A 4QTAA 3EN6A 5FXRA 3JY9A 3OT3A 4KSQA 2LVAA 2JKMA 3FXZA 3EYGA 3QZIA 4YU2A 3GOPA 3V3VA 4BIDA 4CKJA 4Q9ZA 2UVXA 4LUDA 2IW9A 2WELA 4AZWA 3HMNA 3FI3A 4ZEGA 5JFXA 2YA9A 2VWZA 2HY0A 2XUUA 2UZLA 3F5XA 3KN5A 4FEQA 4L00A 1IR3A 3U6JA 3TDWA 3IS5A 4I0RA 3C1XA 3R00A 3AQVA 4FNYA 4IJ9A 4F08A 3LFBA 3ZM4A 4D4YA 4DEDA 5IF1A 5JGDA 1KE8A 4E4LA 4UZDA 5A4CA 4H36A 4HYIA 3KRLA 4NL0A 5EW3A 4FSWA 1E9HA 4I5CA 5J1VA 5EQYA 2F7XE 2VWBA 4FTKA 4JQ8A 5EM5A 1MP8A 4DBXA 4N57A 3FE3A 4M97A 3VW6A 1TTEA 5TF9A 4FT7A 4BYIA 4RFYA 4J96A 4LMNA 2XVDA 5EW9A 2ITUA 2X0GA 3LW0A 4O6EA 4I4EA 1UKHA 2QO2A 2Y4PA 3PXZA 4AOJA 3HAMA 3PPKA 3G15A 2WMQA 1JSUA 3AGLA 1P4OA 4FKVA 2DQ7X 2HZ0A 3KVXA 3EL7A 3R7UA 4FIEA 4BZOA 5AA9A 2R3JA 2W4KA 3CGFA 3QHWA 2VTHA 4K18A 1CDKA 1Q8TA 3FI2A 3L8XA 3OWKA 3W8LA 3Q53A 2WTKB 5L6WL 3Q96A 5CT0A 3QTSA 3C5UA 4R7HA 5H8BA 2ITTA 4IW0A 1F5QA 4ITHA 5CI6A 4F64A 3NVKI 5H9BA 2JP7A 2OJFE 3OG7A 4WRGA 4FGRA 4E4XA 4EQUA 1UNHA 3KCKA 5AJQA 5B0XA 4PMTA 4FKPA 4WNKA 4FKQA 3MTLA 1PXPA 5BUIA 4D2SA 5EKOA 1Q3WA 5IG1A 3L9LA 1OL1A 3CTHA 2H96A 2DUVA 4M7IA 4O0SA 3PVGA 5CQWA 1R39A 5HO6A 3QALE 4A9UA 4AU8A 4ENXA 4M8TA 3CPBA 3DPKA 2X2KA 1PMNA 4RG0A 5HOAA 5A6OA 3ODZX 3TUCA 4YC6A 3LE6A 4EK5A 5AM7A 4TYEA 3WF6A 3KULB 4XX9A 4TYGA 3PLSA 3R02A 4J53A 4TW9A 3PUPA 4JLCA 4D2VA 3D2KA 1G3NA 2X7GA 3DFAA 4FG8A 2JKQA 4G3GA 4CFXA 5ACBC 4XCUA 3BGQA 3OCGA 1XR1A 4CLJA 5IA1A 1UFZA 4LMUA 4ZY6A 5L8KA 5I3OA 3A4OX 3SRVA 5ETFA 3W2PA 2HZ4A 3V8SA 4OTIA 2XMYA 5CSVA 4FKUA 2WAJA 3UYTA 5HKMA 3UIXA 5J9YA 1W0XC 4QQTA 4U9AA 2X8IA 4GU6A 5ANJA 4DINA 2PUIA 2G15A 3U51A 2XKCA 3VWAA 3ZYAA 3DZQA 3GOKA 3GENA 3HA6A 5HCZA 1WVXA 2BCJA 2X9FA 4GRBA 3V8TA 3BV3A 4OTRA 3E46A 1U5RA 2J0IA 4FTCA 4EI4A 2JZ0A 3TNPC 3FZPA 2OFVA 3MPAA 5HHWA 2JDOA 4JNWA 5BVWA 5IDNA 5DNRA 4D0WA 3ZLXA 1REKA 4FYNA 5LMKC 3F61A 3TG1A 3FMJA 4QMMA 1PW2A 4QYEA 3IW8A 3PIYA 2B55A 5M4CA 4R1YA 4U3YA 2HW6A 3WE8A 5L6PA 4BKJA 1NXKA 2PU8A 5EK7A 2PPQA 5DH3A 3FHIA 3EOCA 2R5TA 3ZSIA 4DBGB 3A99A 3G0FA 4EOSA 4QMLA 4GT4A 3QTQA 2WPAA 1NW1A 4FKOA 4QP2A 2UW0A 4DT8A 5EYMA 3DNDA 5HGIA 1YDTE 2IWIA 4EK3A 1W98A 2RKUA 5ITAA 2C5YA 3PY0A 4IB5A 1PGYA 1OZ1A 3FPMA 4C2WA 3JR1A 2I0EA 4ZZOA 2WNTA 4WG4A 3TTJA 1P2AA 4FV7A 2R0IA 4JVGA 4F9YA 1DS5A 4FODA 4GIHA 4U42A 5E9EA 4FNWA 1LR4A 2IZSA 3A8WA 3SA0A 3EQFA 5CEIA 1YWNA 4QMOA 5FWKK 3RK7A 5E91A 2CMWA 4CFWA 3LIJA 4WP2A 1IG1A 2VN9A 5FD2A 4FTNA 1Q8WA 4FVQA 4NW5A 5HLWA 5FM2A 2RIOA 3GP0A 5AUUA 3ZSGA 3TDVA 3AD6A 3POZA 3UVRA 2VWYA 3E63A 4GK4A 4D2RA 2XZSA 3GCVA 4FSNA 3GNIB 4QMNA 5KO1A 1ZYDA 2C6KA 4RZWA 4CTBA 5B2LA 4JRVA 3O0GA 4Q9SA 3VUTA 4CFVA 4XP0A 4RWJA 4O22A 2R2PA 1GY3A 1WBWA 3GLIE 2HWPA 4USFA 5LVPA 2PVKA 3RCJA 5J5SA 4WO5A 1WIVA 4EHEA 3P08A 2CN8A 5HCXA 3E5AA 3KMMA 2XJ2A 2ITZA 3F9NA 3FLYA 5AP0A 4YLKA 2BZKB 2EXMA 2CCIA 3FKLA 1STCE 2XKFA 4K2RA 4B6LA 1CKJA 2XK3A 4U3ZA 5CEKA 1YXVA 5GNKA 1O6LA 4XV9A 1E1XA 1LPUA 3F88A 5F9EA 5CSHA 2W1EA 3II5A 4L42A 3W1FA 4JDIA 3K54A 4J8MA 3UIMA 4JBPA 4QTEA 5IZFA 4CMUA 4ASXA 5GINE 5EHOA 3NDMA 4D5KA 2PWLA 3D5VA 4FC0A 3TNIA 2QOCA 3FSFA 4KIQA 2VX3A 5IA2A 3RALA 4R5YA 4C58A 5HU3A 4C59A 5L3AA 5AR2A 1DM2A 1GZNA 3E8CA 3TNHA 1AD5A 4FV5A 2BRHA 2G2HA 2JAVA 4BDKA 2AC3A 5CALA 2B9HA 3BE9A 4IDTA 2XM9A 4FKTA 3FV8A 1I09A 2L4FA 2HZIA 2OFUA 4QQCA 4TYJA 2UW8A 4RGJA 5IPJA 4EQMA 2XM8A 4UN2B 5FQDC 4CCBA 5D11A 5IA3A 4U97A 2CP8A 3R9HA 3OZ6A 4BDHA 5AP2A 4G9RA 3LJ1A 2CGUA 3HL7A 2QKWB 5KMNA 2JEDA 1REJA 5A3XA 5CF4A 1UNGA 3OC1A 3UOHA 4B9DA 3IKAA 2OIBA 4C4EA 3P4KA 4DGGA 4RC2A 1BLXA 3BGPA 2HIWA 3SX9A 5LOHA 3NNXA 3QQJA 4L6QA 5E1EA 2WQMA 5E8UA 5I9ZA 3DK7A 2ZOQA 4O6LA 2XJ0A 2C0TA 3G90X 4QMTA 2VAGA 5K5NA 1XQZA 2YIWA 3LQ5A 5E8VA 2ONLA 3RWQA 5HG5A 1JKKA 2QU6A 3HYHA 3ORKA 2ZYBA 4I6BA 5CXZA 4GKIA 3W2CA 1XH6A 2ETKA 4FOCA 4QTDA 5A4EA 4JAJA 4GMYA 1YXXA 4FR4A 5HD7A 3V51A 1W7HA 4I4FA 1KSWA 4DBNA 3FQHA 4LOPA 4A7CA 5C27A 1QCFA 5E8XA 3V01A 4I5MA 3BLHA 4FVRA 3R1YA 4FTRA 2ZJWA 3HRBA 4D9UA 4DFYA 4RJ4A 4DFXE 5T3QA 3VBVA 3CS9A 3MFSA 3P5KA 1YHVA 4I22A 2G9XA 2PZIA 2DI0A 2GHMA 4YPDA 2F49A 4AQCA 4RIWA 4HCVA 3ZRMA 5E8SA 4NFNA 4XG7A 4KB8A 1ZZLA 1WGLA 1XBCA 4PP7A 4YGAA 3BBZA 4C4FA 2MROB 4DGOA 4MNFA 4YZNA 2KNAA 2ACXA 4F7JA 3AMYA 3IONA 5DFLA 1Q02A 2O8YA 3MH3A 3NUXA 3OUNB 4LI5A 4APCA 4EHZA 1CM8A 3ZH8A 3BELA 3QYZA 4F2LA 4RIXB 4RVTA 2PZ5A 3GVUA 4TWNA 1FOTA 3CGOA 3C0GA 5D9HA 3ZO1A 2C6LA 3HECA 3R8UA 5KKRC 3AC4A 4FTMA 3AMAA 3ZZWA 4O91A 4FV1A 2YCRA 3CE3A 3GEQA 4CNHA 3HGKA 4BDJA 2WZJA 4YURA 1C7YA 3E8NA 2UW3A 4OT6A 1SYKA 1JBPE 5J5TA 1H27A 2GFCA 4K6ZA 2FUMA 4QQJA 4QMPA 3RP9A 5GZAA 1PY5A 5LMBA 4LQMA 3QFVA 5F4NA 3SXFA 3LVPA 4EH5A 3V6SA 2Y7JA 3DJ7A 3RAKA 1JSVA 4FV0A 2C4GA 2UZVA 3FHRA 3QQGA 3OTVA 4KS7A 4K77A 1XWSA 2BAKA 4AS0A 4BWXA 1YKRA 3OY1A 5JFSA 4QOXA 2H6DA 3JYAA 2W17A 4FIHA 4OGRA 4NJ3A 4F7NA 3ORTA 4N6YA 2BWEA 4O0UA 1UU7A 3MIYA 3H0YA 1TQMA 3KK9A 4EHGA 3DXQA 2KNVA 4IX4A 3WYXA 4HVDA 4RIXA 3KU2A 3TV6A 2NNWB 3PA5A 3TACA 1XH4A 3A7IA 3MH0A 4TWOA 4YBKA 5I9YA 2B1PA 5LQFA 4E3CA 1WFCA 5FRIA 3UIBA 1GZKA 3GQLA 5KHXA 5DIAA 4K8AA 4M15A 4BIEA 3CC6A 3KFAA 2GSFA 3NCGA 4FTIA 3WI6A 2XNGA 2OJJA 4AZVA 4WUNA 4XYFA 2VTJA 3V5LA 2UVZA 4EH7A 4BRXA 4AOTA 3G6HA 3VC4A 3BYOA 1P3QQ 2VWIA 4IM0A 4FL2A 4JDKA 1QPJA 2HWOA 3BRBA 3KN6A 4NFMA 2OOBA 3KB7A 3F92A 2OXXA 3PFQA 2NP8A 1U4DA 2A2AA 3VUKA 3DKGA 4RC4A 1NA7A 2V5QA 2H5XA 3R7OA 4FV6A 4K33A 3LKMA 1OI9A 4K1BA 3NUYA 2XH5A 3PE2A 5KZIA 5C8KA 3MJ2A 4NEUA 3KF7A 3MPTA 4RLKA 1T45A 3H9RA 5KMIA 4A4LA 2GNJA 2WTWA 2XIRA 5FEDA 2VRXA 4EORA 3BX5A 2XJ1A 2O2UA 3BCEA 3EKKA 3FQEA 5ACKA 3EKNA 3AMBA 3MH1A 5HVYA 5AWMA 3BZ3A 4EHVA 4R3PA 3OW4A 4CTCA 3IGGA 2YM7A 4NM3A 4XV1A 5E8TA 4ZJJA 3EQIA 5IISA 3AXWA 4PP9A 1ZMUA 5LJJA 4HGTA 2PZYA 4XRLA 2GHLA 3TXOA 4ACMA 4BZNA 1DAWA 2YISA 1WVYA 3FC1X 4EWQA 3PG3A 3ATTA 2C0IA 4H39A 4EUUA 1PMEA 2RG6A 3A8XA 4G1WA 2YM5A 2XYUA 3IGOA 4GL9A 4PMPA 4MXAA 2QODA 4RX9A 3ANRA 4BTKA 5ETCA 3P79A 4X2KA 4AX8A 4KWPA 4BCFA 2V22A 4Y8DA 3LLTA 4FKIA 2VGPA 3SKCA 1DAYA 4XG9A 5CSWA 3V04A 2WTKC 1EFUB 3I6WA 3SG9A 2OW3A 3AGMA 3RI1A 3FMHA 1VG5A 2ITNA 4WG3A 4FEUA 3LFEA 2QHOB 3HRFA 4O0YA 3B8QA 3FMDA 4FTQA 3TV4A 3LZBA 5KMJA 4HYSA 5IKWA 1PXIA 3DLZA 2YIRA 3UIUA 4U6RA 3QRTA 3I0QA 2R3QA 2ITYA 1A48A 3CQUA 3RPSA 3NUAA 3B2TA 3QQHA 3OFMA 2XK6A 3OCSA 3C4ZA 4L7SA 3DFCB 3JXWA 5AUWA 3BKBA 4BCKA 3F3ZA 3P0MA 2OXYA 3VUGA 5IUIA 2RFSA 3A7JA 5HE2A 2ITPA 3Q9WA 4HPTE 3F2AA 2DAGA 4JI9A 4MH7A 4Y85A 4CRLA 3RAWA 3UOKA 4UV0A 2DS1A 4CFFA 4M68A 5TE0A 2FVDA 2BUJA 5L6OA 2CLXA 3VUHA 3JVRA 3FY0A 5CLPA 1WJ7A 4U41A 1OMWA 4G2FA 4RLLA 3R73A 3VUIA 1L3RE 2W1HA 3QD3A 3H0ZA 4GG5A 5HESA 4QP1A 4MBJA 4TKSA 4HYUA 3O23A 4M14A 2W0JA 2RFDA 4O2ZA 3VBTA 5C26A 3FKOA 2J7TA 1OIQA 3QQLA 3WZDA 5HNGA 5GZ8A 3UO5A 3BU5A 1OIRA 4QYHA 4FT5A 2A27A 2W1GA 3DDPA 2UZEA 3NYVA 4ZTQA 3GCUA 2J50A 3QLFA 3U6HA 5CU4A 5HBJA 3PDTA 4M3QA 2G2IA 3MGYA 4OBPA 5HLNA 4F7LA 4C35A 2B9JA 4MWIA 4FUYA 3NUSA 3EMGA 2WTVA 2X2MA 3NYOA 2FSMX 3VJNA 2OWBA 2QR7A 3FRHA 3FMMA 2WU7A 4ZOGA 3FUPA 4FICA 1FMKA 1U59A 1QPEA 3VIDA 4OBQA 2G3QA 5KX8A 2BR1A 2QOHA 3FRIA 2J9MA 3VS0A 3Q4ZA 4R71A 4O0RA 4FSQA 3QBNA 4LOQA 4DC2A 5CU6A 3F7ZA 2LVOC 3B89A 3ORXA 3GU7A 2P2HA 5GJGA 3WZUA 4E1ZA 5AP6A 3KCFA 2R3NA 4KKGA 1SZMA 5BYZA 3VBYA 4GEWA 2IVVA 1GOLA 3R9NA 2NRUA 5FBOA 1WBOA 3ZBXA 4BVUA 3KMWA 3MWUA 3PE1A 3AT2A 2WTDA 3R2YA 2V7OA 4HZSA 5TR6A 2WU6A 3C51A 3I4BA 3W32A 3F69A 3V5WA 3ZDIA 4BCOA 4PRJA 3WZEA 4CCUA 3IW6A 1GO5A 2PVLA 5E92A 4MBLA 5IH5A 5HBHA 5IEYA 2E9OA 1OIYA 4IWOA 4PPBA 2C1BA 4YJTA 2HK5A 1OL2A 5HG8A 4AZTA 3AC3A 2KNZA 2GPHA 1VYZA 2RL5A 3F5UA 4DH3A 3N4TA 2PY3A 4CQGA 2X6DA 4ERKA 2PE0A 5CAPA 4OR5A 4FIIA 3BWJA 4M0ZA 3MJ1A 1OECA 5IUHA 4IZAA 1GIIA 3Q04A 2BRNA 4YZ9A 1IA8A 3H30A 1UA2A 3LFDA 4IACA 4ZXTA 2JIIA 3D5UA 4OTPA 2Z02A 3TZ8A 4FZ7A 4G6OA 2XBAA 5EYDA 2YIQA 4DG0E 1OKVA 4GG7A 4Z16A 4S2ZA 2OICA 2PUUA 2V55A 4JR7A 2OK1A 4ZTRA 5A4QA 5DGZA 3MESA 2PUNA 1ZARA 1GIJA 3UQCA 4FTOA 2VX0A 2XK4A 3B2WA 2LTUA 3UVQA 4FG9A 3E3PA 5DA3A 2NRYA 2YCSA 3HMPA 5FBNC 5LCKA 3HAVA 4PDYA 2JY5A 3PYYA 3TTIA 3RMFA 4BCQA 2BTRA 4BBMA 5CEPA 3HP2A 2WEVA 2R9SA 5AUYA 2HXQA 4FOBA 4O21A 2C5OA 2C3KA 2EUFB 4O2PA 5F20A 4FSZA 2AC5A 4IHPA 5F94A 4ZIMA 3UMXA 3BV2A 2QOFA 3EQGA 4GS6A 4AGDA 1YW2A 1ATPE 3TN8A 4X2FA 4UMTA 1JOWB 1R1WA 4JAIA 4PPAA 2XF0A 4QMVA 2OZOA 2HXLA 4USEA 4IAYA 3W33A 4B8MA 3UOJA 2EU9A 2A0CX 4HCTA 1BI7A 4Z7HA 5C4LA 1Q8YA 5IH6A 2RG5A 2VTNA 3MBLA 3GC9A 3O2MA 5CI7A 1OKSA 1OPJA 4N4SA 5HE0A 2XEYA 3VVHA 4I41A 1KOAA 3MVMA 3K2LA 3EFWA 3TI1A 4C3PA 4X3FA 3FXWA 2QOQA 4G5PA 2ETRA 2P2IA 5IA5A 2UZTA 4RIYA 1ZY4A 2B7AA 2YZLA 4BGGA 2X7FA 2F9GA 4UWBA 4RWIA 3UO6A 4IDVA 4CKIA 4E93A 3BHYA 4OTGA 4DGMA 4A9YA 4BHNA 5CASA 3ZUUA 3U8WA 5I9WA 1SNUA 3GU8A 1NV8A 1B6CB 3DS6A 3M11A 4FX3A 4P5ZA 3ZTXA 5CF8A 3ORZA 4RPVA 5E90A 5E1SA 5K9IA 5IUGA 4O84A 5AIKA 3NGAA 2GQRA 3R9RA 4WBBB 1VR2A 2BKZA 2VWUA 2WIHA 3K9PA 2GNGA 1P14A 3W55A 2IVUA 3BYSA 5T6KA 3O7LD 1F0QA 5EHYA 5HE3A 5M44A 3PG1A 4PF4A 2OOAA 2WXVA 4DLJA 3BGZA 4S31A 5G1XA 4FKGA 4U79A 2B54A 2GNIA 3R04A 2X8EA 4APPA 3O8TA 5EOLA 1JKTA 5CWZA 2V62A 3NCZA 1JR3E 2QNJA 4FV3A 3WF7A 1I44A 1ZYJA 4D1SA 5LXMA 2UZOA 5GIOE 2JDVA 4U0IA 3G51A 4JL9A 2ZV2A 3EYHA 1ZV1A 1Y6AA 2XKEA 4PDPA 4X2JA 5EFQA 5J95A 4WNPA 1Q5KA 3MB7A 1K2PA 4RIYB 4I94A 4YTFA 5M09A 1Q97A 2JY8A 2VV9A 4JBQA 4RA5A 2Y8OA 3BQRA 3QA8A 3VJOA 4ASZA 1IAHA 4FT0A 3NMUF 3C5IA 5EDPA 4BL1A 4F6UA 3DXPA 1UU9A 1UU8A 3CBLA 4N6ZA 4C8BA 4D2TA 5K0KA 1CKIA 4DEEA 1J1CA 1WBVA 5BVOA 3R01A 2VNYA 3R8PA 5JN2A 2YWVA 3IOPA 5HZNA 4E6DA 4MXCA 3QXPA 4WNMA 4O7SA 2UZDA 4PTEA 4UEUA 2QO9A 3OEZA 3K3IA 4S30A 4A9SA 5BVFA 5BVDA 2BIKB 4X6RA 4ACGA 2F4JA 3JUHA 3OWJA 2P4IA 1ERKA 2BMCA 2HY81 3COIA 5EDRA 3TM0A 5IQCA 4AW0A 5K0XA 2BTSA 2ZV9A 2R3IA 3EN4A 3DK3A 4JQEA 5AAEA 1H1WA 5TOZA 4BWKA 3LCVB 5CF6A 2EVAA 3UPZA 4NCTA 4O7WA 4YO6A 4C2VA 2Q0NA 2A19B 1VJYA 4TNBA 3C50A 2Z8CA 4FZDB 3QAME 1JVPP 2X4FA 2X9EA 4G5JA 5DE2A 2JC6A 2QCSA 1OVEA 3TNWA 4C7TA 4E73A 2OZAA 3KRRA 3NNWA 5E8WA 3ZDUA 4WOVA 3BHTA 2JDTA 1PRYA 4OBOA 1NVQA 3SQQA 4C57A 2XNPA 2BPMA 2E9PA 4XMOA 4CMOA 1HT1E 3NAXA 4ACCA 4E6QA 5HNIX 5ICPA 3PJ8A 3TUDA 3BYUA 3DCVA 4KBAA 3H10A 3VRZA 3CJFA 5ANKA 5AP3A 1ZY5A 3PA4A 4F1IA 3QD4A 4GFMA 4PV0A 4ANSA 5LWMA 3EQHA 1H25A 4RWLA 4XBRA 3D94A 4YNOA 2KULA 4X2GA 5ETAA 1YI3A 2PE1A 3IW4A 3TT0A 2QO7A 2E9UA 3Q9ZA 3P78A 4QP6A 4QMUA 2PZRA 1GZOA 1UWHA 4CG8A 3QKKA 4IJPA 4XLIA 5EDQA 2XS0A 3P23A 3COKA 4YLLA 5I5ZA 2WIPA 4YUQA 4YC3A 3DB6A 4YTIA 5KMLA 3EFKA 1U54B 2JITA 4CV8A 3F7WA 2C0OA 4GVJA 5IQGA 3WF8A 3ZOSA 4ITIA 3DY7A 3FLSA 5AR4A 2VO3A 5AP7A 4BBEA 4F0FA 1HQYE 4D4RA 3Q4TA 4BHZA 5CAUA 3QRJA 1W83A 3A7FA 4Z55A 2I0VA 2HELA 2JIVA 4GFOA 4UZHA 4X3FB 3UBDA 4XH6A 2G01A 2F57A 3QCSA 1R3CA 3C4FA 1V0OA 3LCTA 3RZFA 4RX5A 1NV9A 4EBVA 4ZTMA 4ANNA 2YCFA 3E7VA 4AAAA 3OVVA 4G34A 1HOWA 1WCCA 3RINA 3CKWA 3VN9A 4MXZA 4RRVA 4WT6A 4CYJA 4DG3E 1YOMA 1ZLTA 4EOQA 4O0WA 4F7SA 1W8CA 4BN1A 2X2LA 3VHEA 5CS6A 2Z7QA 3FXXA 1Y57A 3EN7A 3OXIA 3H9FA 2GQSA 4JX3A 2UW5A 3GBZA 4OW8A 2RSVA 3CR0A 3TWJA 1G8SA 1CTPE 3PPZA 3DBFA 4J99A 3ITZA 4F70A 4YTCA 3KXXA 3ODYX 3FLNC 3W16A 3ZUVA 3GXLA 4BDGA 1RQQA 5D41A 2RRUA 3GQIA 4DFNA 4YHFA 2YM4A 3TKUA 2UZNA 3LFQA 4P7EA 2ZB0A 4HCUA 4H3PA 3OEFX 4D1XA 1R0PA 3ZONA 4HZRA 3UZTA 2HWJA 3DT1A 3IECA 5JH6A 4LFIA 3QQKA 5EI8A 2ZAZA 5B2KA 4EH6A 4X2NA 2QG7A 5GIPE 4FV2A 1EH4A 4R3RA 5M4FA 3DOGA 4IVCA 3R22A 2PE2A 5CAQA 3W2QA 3DK6A 1OL5A 2XIXA 3FQSA 3UE4A 5L2SA 1R4GA 2R3LA 4EKLA 4H3QA 1Q4LA 4TY1A 2I7QA 1YWRA 3ZUTA 1SMHA 1M7QA 1YI4A 2ITVA 4FBXA 5AX3A 3KREA 4BYJA 5CNOA 2YACA 3ACJA 1T46A 1WMKA 3MVJA 1KWPA 3R2BA 2I0HA 4IAFA 3UJGA 3EFLA 3VQUA 5KMOA 4V0GA 4WHZA 2H34A 2REIA 5CEQA 3W10A 4CZYB 1G5SA 4CMTA 4DGNA 4CVAA 3LJ0A 2YJRA 4F0GA 4BDAA 5ANOA 2GNFA 3SHEA 2XNNA 1ZWSA 2G1TA 3EQPA 4O0TA 3EHAA 2H9VA 4XHKB 5C9CA 4FKLA 4AW2A 5AUTA 5LMKA 3G2FA 3OMVA 3PTGA 2W05A 3COMA 3IQ7A 5M06A 4GUEA 5AR7A 4LV5A 4G31A 4KRCA 3K9OA 1FVVA 3HVCA 2QOKA 4AG8A 1JNKA 3K5UA 4HGSA 2OG8A 1MRVA 5FXQA 1LEWA 5AADA 3HV4A 2Z7SA 3FZSA 4IMYA 2YM3A 1Q99A 2YDJA 4XNEA 2VWVA 2XKDA 3QUPA 4DCAA 4O0VA 2V0DA 4RIOA 3PP1A 4E6AA 2WKMA 5D12A 3S4QA 4R5SA 5A4LA 1KYIA 3DGKA 2YERA 3KL8A 4YPSA 4KIKB 3UDBA 3LXNA 3UOLA 4D4VA 4KINA 2PMLX 1WBSA 3CXWA 4PDOA 4FSUA 1ZXEA 1JKLA 4V0GB 3LFSA 3ZO4A 3ZRKA 2O63A 3BI6A 4E4MA 3THBA 1H07A 3FYKX 2W5AA
chains in the Genus database with same CATH superfamily
4OX9M 3SRVB 2CDZA 3ZCLA 2I6LA 3IHPA 4LF5M 2YABA 3HMIA 3FEGA 4BBAA 4AGCA 4GRIA 3CY3A 4M69B 2CRUA 4P2KA 4DEBA 1IBLM 2XIKA 3MVHA 4L8MA 3WE4A 5A54A 1Z5MA 2HOGA 3F66A 1ZMVA 3OTUA 1VEKA 4MK0A 4Z9LA 3VS1A 4RZVA 4DG2E 4NC6A 3TCPA 4EH9A 5M51A 3ORPA 4U5JA 4WD5A 5EM6A 1DGFA 5LVLA 3R8MA 4IAKA 3ULIA 3NNUA 4JG7A 4PY1A 1YI6A 5A14A 3ZXTA 4EOMA 3RHKA 1Q3BA 3RFWA 3NZ0A 4YLJA 2W9FB 3FZRA 1WHCA 5BMMA 1NHGC 4PMMA 1YLAA 3PY3A 3C4EA 4FSYA 4NOOB 2XH9A 3O5AA 2JDSA 2WMRA 4NH1A 4ANMA 4LDTA 5H8GA 3GU5A 1IY1A 3QCYA 4I24A 4D80A 5I3RA 4IZ5A 3C4WA 2QHMA 2C9OA 3R9XB 4FYOA 4FL3A 5EP1A 5JQ8A 2KW0A 3MY0A 2B3TA 1UV5A 4QP9A 5FG8A 3J81S 2PVHA 1XH8A 1TQIA 3E3BX 4M9ZA 2GCDA 2PYWA 5DRDA 5EM7A 4PTGA 5JGAA 3LVVA 2WGJA 2IVSA 3HLLA 4R1VA 2SRCA 2P5TA 3QGWA 4LJAA 4IXPA 2HCBA 2DENA 2Z8YM 3EQCA 3NIEA 4RVKA 4AF3A 5C4KA 1HCKA 3MTFA 3UQFA 4IFCA 4OAVB 3KC3A 5AUZA 3R7YA 4U7ZA 2CN5A 3D9VA 4PTCA 2X39A 5ANDA 3D14A 4PDIA 3SV0A 2W06A 2HAKA 3QCQA 4JX7A 2JFLA 2GMXA 4ZMEA 5AV1A 3AL0C 3LMGA 4CT1A 2OIQA 3L8PA 4GK3A 4JS8A 5EI2A 1N34M 3AKZA 5IA4A 1XHBA 1LEZA 3I04M 3NSZA 4KD1A 2GU8A 5ANEA 1E94E 4CHTB 4GT5A 1MUOA 4ITJA 1L2BA 1H24A 4X3JA 4EWHA 2C98A 1FPUA 1S9JA 1YXSA 2YWPA 3G9NA 3QTXA 5AV3A 3RPYA 4BZDA 3KRXA 1H6UA 1PMUA 2E9NA 2OU7A 2PVFA 3OY3A 1YHSA 5BVEA 3ZS5A 4LJ8A 3FSKA 1IEPA 2RKOA 5FDPA 3LFCA 4ID7A 3QRIA 4UALA 3UTOA 5HO7A 3A60A 4YJVA 3W68A 3GPXA 1NJGA 2R3PA 3MW1A 3OROA 4X65M 4I6HA 1Y8YA 3ORNA 3O50A 3V76A 3G6GA 4C0TA 4IVAA 1CKPA 4LV8A 3U9NA 3U87A 4AT4A 5F95A 4JBOA 4FTJA 3WYYA 4O83A 2CKOA 3PJ2A 2IN6A 2UW7A 3HMMA 4F1TA 3KA0A 5AEPA 4QRCA 4CVAA 3NX8A 3MDYA 3IG7A 3OOMA 2ERZE 4YZCA 1XWIA 3IO7A 4H05A 1IBKM 3DB8A 4NCTC 3W0SA 4JI1M 3Q5IA 4GCJA 4GH2A 2CHGA 2JDRA 5DG5A 3QCXA 4G17A 4NUSA 5BMSA 1T43A 3Q8GA 2P3GX 4LRSA 2YFXA 3G5DA 4FSMA 4IEBA 4TTHB 3LFNA 4UMQA 3SW4A 3GUBA 3DBDA 4XG6A 2XA4A 4EL9A 3ENHA 3EN9A 2JY6B 2QONA 1IRKA 1ZZ2A 2XK8A 3C4XA 4UWCA 4XBUA 1URWA 4GUBA 3LCUA 4CXAA 5CU0A 4IH8A 3QAUA 1FQ1B 3SOAA 4LGDA 4FEXA 3LQ8A 2O5RA 1Z6TA 1KV1A 2XCKA 3MVLA 4FZ6A 2VD5A 2QBYA 3JS2A 3OBJA 3PZHA 4WSYA 5DFPA 5HVJA 5KZ0A 4FEWA 3QRUA 2BAQA 3CTWB 3RTPA 4CKRA 2CNVA 2LVQD 4EOKA 2PVNA 3K3JA 4IAIA 2PVMA 4EC8A 2QR8A 4FK3A 3CLYA 4AE6A 3U6QA 3HRCA 2JA2A 3CP9A 4MXOA 2XK7A 1O6YA 2BZHB 2R7IA 3F3VA 3QZFA 4YJNA 2WMAA 2BRGA 3VDPA 4TWCA 2DZNB 1NJFA 3QTRA 5BYYA 4NK9A 3KDSE 3TL4X 3QKMA 3R9DA 2LGCA 3U5ZA 1W82A 2OXDA 4BCMA 1NNUC 5ETIA 4ZSAA 4RJ5A 4CD0A 4EZ3A 2X7OA 4QT1A 3E93A 4CYIA 4LRJA 1XO2B 2HHHM 4GW8A 3RWPA 3LCKA 3ZQJA 1OIUA 1G41A 3TJDA 4AKIA 1OKWA 3EFJA 4YJSA 2O0UA 4ZY5A 3E87A 4XV3A 2CJMA 4H1MA 5A2QS 2EJSA 2KZSA 4CGYB 2QPAA 1UVRA 1G8JA 2J7NA 5AR8A 4BWPA 4IBMA 4XP3A 4ACDA 3AJIB 3AC2A 2PMIA 2ZM1A 4UX9A 3KXGA 4BI2A 3KOZE 1ZYCA 4AA4A 5BUEA 2YDIA 2XNMA 1M2QA 3ORMA 3UC4A 4AI6A 2XRUA 4WBOA 3GO8A 2VTMA 4L9IA 4TYHB 1OUKA 5C03A 4O7TA 4L7FA 2QHNA 4FIFA 3PRIA 1CMKE 4KRDA 2EKFA 2XP2A 5JZNA 4GHAA 4M13A 2GDOA 1IXSA 5DT4A 3ZC5A 3WF9A 4BDFA 3ID6C 1GZ8A 3W67A 2VO7A 4L3PA 4U44A 2F7ZE 3ERKA 1OPLA 4D55A 4YO4A 2BFXA 1PJKA 2C6IA 2UW6A 1V0BA 2BDFA 2XNOA 3ACKA 4L01A 4M66A 4XV2A 4E5AX 2UUCM 1TQPA 3L9NA 3RPRA 3LCOA 3CKXA 3D7TB 4HEOA 2L6OA 4B0GA 5HCYA 1L1TA 5CEMA 3D5WA 5M53A 2OO8X 1ZOGA 4JIKA 2FB8A 2R3HA 2XNBA 4H3BA 3PSDA 4YNEA 5LCJA 2B0QA 3NFGB 3Q52A 3UPXA 3ZO2A 1OGYA 3SW7A 4K0KM 3BU3A 4C37A 3SC3A 4W5WA 4DCEA 4BCPA 4R3CA 3ZO3A 3LAUA 5ITYA 3HZTA 5TO8A 1J7UA 3CSVA 4RFZA 4KIPA 2F2CB 3FKEA 4AP7A 3MMPA 1KE6A 2UUBM 2YDKA 3Q9YA 2Y9QA 5DOSA 3FMEA 4ZSEA 1T6OA 2R3KA 2BWBA 1TKIA 5CT7A 2K0BX 5HBEA 5KUPA 1J7LA 5M55A 5H37D 2W99B 2HCKA 4LRKA 1MN3A 3GC0A 1SVEA 2ZMCA 4O1OA 3Q4CA 2XAOA 4Y73A 3LQQA 4M9SA 4IX6A 4HNIA 4BDDA 2PSQA 3OWPA 4MXXA 3BBTB 2FGIA 4JT3A 4BFMA 1PXKA 1J7IA 4BDIA 5CSXA 3FMLA 1NY3A 2W1FA 4JQ7A 4L44A 2ITOA 3FJQE 4BCIA 1FINA 5I0BA 2YR0A 2EUCA 1XC8A 2C5VA 2XFTA 3L9PA 4PNIA 2IZUA 4CFUA 2J51A 3IDBA 3PVWA 4NZWB 1H1SA 2A4LA 3R0TA 1W5SA 4A9RA 2BIYA 1PXOA 2YLEA 2KZUA 3L1SA 3NIZA 4QYGA 2W9ZB 5DPVA 2WD1A 5HLPA 3R7EA 3VULA 3T6PA 2CKPA 1ZQ9A 5DI1A 3Q32A 5JK3A 2YEXA 5CVFA 1H1PA 2F2UA 3FUXA 4BICA 2VF8A 3BLQA 4UYNA 4AGUA 3FTDA 3SC1A 5FUTA 4AKHA 4ZLYA 5BQ0A 4ALVA 2YZAA 1W2DA 3DAKA 4OTDA 2IVTA 2QLQA 5EW8A 5AAGA 5TT7A 4RC3A 3H4JA 4PL4A 3M42A 3A7HA 3FZ1A 4JDJA 4RX7A 3SDJA 1MQBA 2JGZA 4I81A 4GSBA 4ZZMA 4JI8M 1MRYA 1W84A 3ULZA 4QHSA 1DV0A 3BHUA 4XEYA 4BCGA 4D5HA 1YHWA 2Q83A 1IY2A 4GYIA 4C4IA 1VEGA 3O51A 1Q24A 5HO8A 2ZVAA 3RJCA 4CLIA 5K3YA 2IW8A 2WFYA 4FNXA 2RGOA 4WW0A 2XCHA 3AT4A 3SMSA 1BYGA 3R28A 4AA0A 3HUCA 4YJUA 4EQCA 5AP5A 1IY0A 1X37A 3DNEA 4FV9A 2QQ7A 4PMSA 4HGLA 3A2CA 4LJ6A 2O65A 3QU0A 4GU9A 4LM5A 4UXQA 3RVGA 2OO9A 2PVJA 4XUFA 3KVWA 3SYKA 2QKRA 2VO0A 3I5NA 2DHRA 3MSSA 4FTLA 4OTFA 3GC7A 5EM8A 5LVNA 4Q7JA 2QC6A 4FKWA 1OBGA 3LKMA 1QPCA 4MUQA 4NYEA 3UQGA 1R2YA 3PXYA 2CWBA 5BVKA 2ITQA 1DGHB 3GPYA 2EO2A 3U5ZB 3NLBA 4NU1A 3N4UA 3ML1A 4D28A 1AIPC 4DEAA 3PVBA 1JB0F 3W2OA 3R8ZA 2W82A 2ONLC 4G3FA 2R3OA 3LMIA 4ZSJA 1U54A 5JI2E 3FL4A 3WIGA 4TZRA 4E20A 3E88A 4DV4M 3IPHA 4MD8E 3AD4A 4F09A 1PMVA 3QYWA 5KE0A 4F6SA 5BNJA 2UZUE 1H08A 4XG4A 5EYCA 3HZJA 3EZRA 4W4YA 1GABA 5CU3A 4JG6A 4ASDA 4DV3M 4GV1A 5KPRA 3AC1A 4AN3A 3J2PB 4G3CA 1XH5A 3ZSHA 4ZTNA 4EOLA 4I8OA 1RE8A 1Q8UA 2IF8A 4I21A 3BLRA 3D4QA 4Z8XA 1GNGA 2CEAA 2G2FA 3FBVA 3T3UA 4AOIA 5HI2A 4MKCA 3PWDA 3E8DA 3VS7A 4F9AA 3P86A 1Q8ZA 1M7NA 3A98B 3H4MA 3DTWA 3D0EA 4L46A 4QD6A 4W4WA 5L2WA 4HOKA 1NVSA 2QQ8A 3PVUA 5JMSA 3QXOA 4P5QA 5DR2A 4REZA 3SAUA 3G0EA 3VKGA 2PL0A 3E8EA 3MH2A 3PSBA 5CTPA 2LVPC 3D7ZA 5DEYA 2BKKA 4O7RA 4MNEA 4FSTA 1DGHA 1Y6BA 4CRSA 1ND4A 4EEVA 2J2IB 3I6UA 2JUJA 4MD9E 3UJNA 4AZSA 5FTQA 4G4OA 1KE9A 1OUYA 5GJFA 1OL7A 4OTHA 1OL6A 2JBPA 4NKAA 4BKZA 2JFMA 4C4GA 4O38A 4EH2A 3KFUG 4G6LA 1B38A 1H0VA 4KIOA 2W96B 3PRFA 4IADA 3HV7A 4MHAA 3BOSA 4F9CA 4G6NA 4MF0A 4O4FA 3I01M 5AUVA 5EXSA 2QG5A 2Z7JA 1H0WA 3BWFA 4NJDA 3BEAA 5EI6A 3F82A 4OT5A 2WTCA 5IQAA 3MYGA 4K11A 3DXNA 3FLWA 2L7HA 2UVYA 1SXJE 1YQJA 4EKKA 4DTKA 2PTKA 2DKLA 2VTSA 3CGWA 4ONAA 2KTYA 3U6LA 4NKSA 4FV8A 1QMZA 3NBXX 4F0IA 3BU6A 3FWQA 5I9VA 4I92A 4CZTA 2UV2A 3Q2JA 2ZTCA 3SOCA 3AD5A 2P55A 3SATA 3CTJA 3KULA 4L52A 2DAEA 4RSSA 1G4AE 4LUEA 2O5KA 3KOXE 3F2NA 3CCNA 4CGAA 1P4FA 5IH4A 1YDSE 4KT0F 3DZOA 1JR3A 4EONA 4FD2A 1PYEA 5I9UA 3ZEWA 1S3SA 2FA2A 4L43A 1E32A 3OXZA 4W4VA 2QLUA 5KBRA 2UUAM 2OIDA 1OB3A 3FMNA 3O8PA 1PXLA 2Y4IC 4YTHA 4L3JA 4DFLA 3W2SA 5HU9A 3Q6UA 3EWHA 4B8LA 3KKVA 5FEEA 3PZEA 3VF8A 4FEVA 3D2IA 3D83A 4ENYA 3D15A 2PULA 4GJ2A 4QMXA 5E7RA 2RFNA 4BIBA 2ZB1A 4B3MM 4GC5A 5EQEA 5KMKA 2B4SB 5HQ0A 3NW7A 4J1RA 3BHVA 5JZJA 5HIBA 5HVKA 3IDCA 2CNQA 2EXEA 2ZV7A 4CV9A 4KABA 4EH8A 2CGWA 4ZK5A 4DR1M 3WILA 5HIEA 4LY6A 4UYAA 1WVWA 4Q5HA 2BZIB 3EIHA 4QP3A 2YM6A 4F4PA 4ZLZA 2FE8A 3CQWA 5DYIA 2LNHC 3L26A 2C6DA 5DLSA 5DN3A 2OJ9A 3ZLSA 4FG7A 4MEDA 3KRWA 1KE7A 4KA3A 4QNYA 1V0PA 3PXGA 3EQRA 3R63A 4IBDA 4OLIA 5I4NA 4DTAA 4BGQA 1R2ZA 5H3QA 2RFEA 1HCLA 4WRSA 4EUTA 2CKQA 2NYAA 4UY9A 3FY2A 4QNRA 3DU8A 3GB2A 4RFMA 2GTNA 5L2QA 4FMQA 4N70A 3QQUA 3HP5A 3QHRA 4L16A 4MCVA 3HJSA 4QP8A 1GAGA 5JKGA 2WMSA 4LGHA 4IBGA 3U61B 1FGIA 1UWJA 1PKGA 2J5FA 2C5NA 3AC5A 3KXZA 1E1VA 3C4CA 3H3CA 4YJPA 3OCTA 3NR9A 4L67A 4HVHA 4DT9A 4BCJA 3PP0A 1KE5A 3EH9A 2PHKA 2C9CA 2FO0A 2I7PA 2QD9A 3FC2A 3GT8A 3R30A 4J98A 4P4CA 4UXLA 3VQHA 4IZYA 1G8AA 5AV4A 5HIDA 1BMKA 4EOOA 5DR9A 4D9TA 3MPMA 2OH0E 2VTTA 5AUXA 5J79A 5HEZA 5H8EA 3PA3A 3UK6A 4HVGA 4DEIA 4CJ6A 2KDLA 4BTJA 3V8WA 1YRPA 2C5XA 1OGUA 4FKSA 3N4TA 4R78A 2PUPA 4B99A 1XBBA 4GVAA 1L2DA 1AGWA 2C1AA 3QUDA 5D7VA 3RGFA 5DRBA 1KV2A 4NIFB 3SG8A 2IJMA 3OOGA 2ZTDA 4IE9A 4QP7A 3BXWA 4X3FC 2LBCA 4H1JA 5KNJA 3LPBA 4DITA 3E21A 4IWQA 2XF3A 4AFEA 4TNDA 4KUJA 3SGCA 2XIYA 4LJ5A 1P5EA 2R7BA 3H9OA 3KQ7A 3QX4A 3WBLA 5FDXA 4GKKM 1K9AA 2YIXA 4QDEA 3GRVA 2BILB 2I40A 4O0YA 4FL1A 4BCOA 2VUWA 3OP5A 1N77A 4UB7A 5J7BA 3SMPA 3LQRA 2C3IB 3UDSA 1LP4A 3LFFA 3ZZEA 1VEBA 3BYMA 3TIZA 4PPCA 5IMXA 2P33A 3PJ1A 4C34A 4EK8A 3WARA 2WSCF 4YSJA 4O7LA 2XEZA 2BRMA 3GLFB 2C6MA 3OD6X 4W9WA 3RZBA 4EBWA 4GFGA 2C68A 4IANA 5CVGA 3R83A 2GNHA 2PVRA 4F65A 1M52A 1NVMA 1QVRA 4XS2A 4FK6A 3PNYA 5BX0A 3RHXA 5A9UA 3TWLA 2GS2A 2OGVA 5IA0A 4C4JA 4I20A 2EKKA 2WEIA 4IBIA 2XEPA 2J0JA 3I5ZA 3P7BA 3DKFA 3E92A 4ZLOA 1W2CA 5GHVA 1G3IA 1IM2A 4QPMA 3QD2B 4WKQA 3Q6WA 2WOUA 2BROA 2IG7A 3FUUA 5IQBA 1B39A 2J90A 3UMMA 1JKSA 2Y6MA 4FT9A 4G9CA 4YR8A 1SVHA 4IVBA 3HV6A 4DE4A 2CCHA 3I0OA 5DT3A 3EQBA 5AAFA 2Z7LA 4YHHM 4EC9A 3U6CA 5C8NA 2CKEA 2H8HA 4QPSA 5L8JA 4R77A 3ZM9A 4QNAA 2Q0BA 4RMZA 4PDSA 4IWDA 4L53A 2UXBM 5DYGA 5CY3A 4X66M 3AFHA 1F3MC 2OJGA 3DJ5A 4FT3A 1QDTA 2L09A 2W4JA 3NUPA 4QTBA 5AM6A 3ZRLA 2ZV8A 3QTWA 4O1PA 3W8QA 1QUTA 5L8RF 3UG1A 3KP1E 5ITRA 2BHEA 4CQEA 5CASA 1IAJA 4FVMA 3BIZA 1OAIA 2GFSA 3I4VA 3EB0A 1DI9A 3C13A 3F5PA 1RDQE 4IWPA 1OKYA 4MBIA 4AE9A 2OSCA 4QP4A 5HE1A 3RAIA 1J7KA 4FGBA 3QQFA 1VZOA 3CIKA 4IZ7A 4U40A 5HTCA 4XG8A 2VQEM 2MJ5B 3TZ9A 3PY1A 3M0EA 3R1SA 2JBOA 3SFZA 1F4IA 4AWIA 3MFUA 5ITXE 4BLCA 5KHWA 5IZ7D 3U60A 4TXCA 5EYKA 4DFBA 4A4OA 2UW9A 3QKLA 2AEGA 4LL5A 1OBDA 4CZUA 2A1AB 3EIDA 3QGYA 5GJDA 3I79A 2WQEA 4G3OA 4HPUE 3PXQA 5EHLA 5EXTA 4U80A 5CNNA 4C3FA 2I1MA 4CEGA 5J7HA 4O0XA 4FZAB 5LMAA 4PNKA 4BDEA 3LLAA 1H00A 4MQ1A 5EQPA 4WA9A 3B7ZA 5E26A 1XH9A 3TEIA 4LJ4A 1XXHE 4II7A 1WBTA 3O17A 5L2TA 4L3LA 3PXRA 3FD9A 5GZ9A 3FLQA 3U6IA 4O7ZA 5IQEA 1TVOA 4DFZE 2C30A 2Z4RA 1H1RA 2WO6A 2YN8A 4DH8A 3MY1A 4MYGA 4LF4M 4O86A 2VQFM 4I0SA 3L9MA 2ZMDA 1I94M 1APME 1V1KA 2YJSA 3ORLA 5D7AA 4HJOA 3AOEC 3F5GA 3Q8XA 3L8VA 3VBXA 3ZCBB 4B7GA 2AUHA 3ZFXA 2XANA 4MWHA 4GKJM 3PSCA 4KNBA 5JRSA 3HUBA 3JVSA 3R71A 4NXMM 1Z5BA 4Y46A 2VTQA 1BL7A 5FP6A 3MFRA 2L7IA 4S32A 5EG3A 3KMUA 5J1WA 4PWNA 2X4ZA 3UYSA 3KXNA 4ZJVA 4IX3A 2L4EA 4B4LA 2J0LA 3I60A 2R18A 4ALWA 1WR1B 4FKRA 1A06A 1ZOEA 4AZEA 4E5WA 3KK8A 4JI0M 3IW5A 3HMOA 2VTLA 4I6FA 4LFCM 3VS6A 3SLSA 5BYLA 2VWXA 4TT7A 4CG9A 2BDJA 2ESMA 4ZZNA 1G8KA 3MV5A 4CT2A 4QO9A 1IASA 1U46A 2J0KA 5DWRA 4NWMA 5CEOA 4HNFA 2C6EA 2YLFA 5HORA 2NPQA 1H4LA 3R1NA 5HX8A 3R7IA 2ZDTA 3QRKA 1PYXA 2GHGA 3SAYA 4FV4A 4PQNA 3MFTA 5K4IA 2MGWA 4JDHA 3V5PA 3I7BA 3O7LB 1OKZA 4YJOA 4MGKE 5B7VA 3LMHA 2DWBA 4RQVA 3PXFA 4LZJA 3ELJA 3PXKA 4YZBA 1SG9A 5LVOA 3UDTA 4DV1M 2YAKA 4KIKA 5H2UA 2LHGA 2IW6A 3COHA 3VUMA 4AXCA 2WMUA 4FUXA 2QOOA 3QF9A 4TYHA 4M69A 4Q5EA 5BVNA 3LVWA 2MR9A 4MB7A 4KS8A 4HVIA 4QMSA 4R6VA 5HTIA 4OUCA 4O4DA 3PFIA 4LJ7A 4FKJA 4JRNA 3VK8A 1J1BA 1MRUA 5EOBA 4YSMA 4ORKA 4X62M 2QURA 4PUZA 2M60A 2QOBA 4USDA 1JQHA 1FJGM 1OTRA 2QOLA 3F6XA 2QU5A 3QWKA 4IAAA 1AUAA 3KRJA 4NW6A 4RJ8A 2B52A 3ZMMA 5AMNA 4D2PA 5J9LA 2DAMA 3TUBA 3RK9A 2WMBA 5A4TA 3KS8A 4KSPA 4EOJA 5M08A 2Z3XA 3UGCA 1O9UA 5DYJA 2I0YA 4MQ2A 4S33A 3PIXA 5BPVA 3WF5A 3DOAA 1GJOA 3KP0E 3TJCA 1IN6A 1YXTA 4ZJIA 3AKLA 5FEQA 2Y21A 4XOZA 3NYXA 4LYNA 4JI3M 1JSTA 5DBXA 4HGEA 5AV2A 3RAHA 4C3RA 5KBQA 1YOLA 4BTMA 1WBPA 4WUAA 2CNUA 4I3ZA 1L8QA 4QQ5A 4IQ6A 3TMOA 1SNXA 4IBFA 4MGHA 4JYAM 3CTQA 3KXEC 1TF0B 2C6TA 3HKOA 1YUBA 3ZLYA 5F1ZA 5CSPA 5CYIA 2CPKE 5FTOA 1Q62A 3T1YM 3DKOA 1ZAOA 4M0YA 4BB4A 3Q4UA 2HW7A 1FVRA 3CD3A 2R3RA 4NM0A 4NSOB 3TQSA 2WHBA 3BPRA 4WG5A 2HYYA 3KF4A 4YHJA 3RBWA 3VBWA 4ANOA 2VGOA 3T8OA 3M1SA 3R8LA 4F78A 3IOKA 3LCSA 3UZPA 1SM2A 3FZTA 4IC8A 4RQKA 4DH1A 3OUKA 5JFVA 4N0SA 3NS9A 3QWJA 1G59A 4PL5A 5K4JA 3HV3A 1O6KA 3K5VA 5LARA 2JZ1A 1GIHA 1NHWC 3RKBA 4BC6A 5IEXA 4ZS4A 3F3WA 5M4UA 1FBNA 1R0EA 3S1HA 4FE2A 5CAVA 3KXMA 4FTTA 1MU5A 1X8BA 2DHYA 3FKNA 1G71A 5FXSA 3VF9A 4QMWA 4BDBA 2BRBA 5AFVA 2C6OA 1N33M 1FGKA 1YOJA 1DO0A 3DQWA 4ZP5A 3TZMA 1JAMA 2XYNA 4A4XA 4EH4A 5LWNA 3BYVA 4PX6A 3QC4A 4UN0C 5D1JA 3BEGA 5I9XA 2IPXA 2R4BA 2WQNA 3VFDA 3SBJA 1URCA 1XHAA 3G33A 3GCSA 3LOKA 4J8NA 4DDIA 1R7RA 1Z57A 2BDWA 4CFNA 4OAUC 1PKDA 4O7NA 3OHTA 3E7OA 2BAJA 4WSQA 4TRLA 5DT0A 3O71A 4B3RM 3PUFC 3AT3A 4YP8A 2X4AA 3U4WA 1BI8A 5EXXA 5FTLA 4I6QA 3TZ7A 3GCQA 4II5A 4R7IA 2CUZA 4GH9A 3J7AS 1XBAA 3QTUA 4XG3A 3GRYA 3R8FA 3HNGA 4DA5A 3QX2A 4PL3A 3PWYA 4XOYA 2EB2A 3IW7A 3MB6A 3K92A 3O8UA 4HYHA 1OM1A 4HW7A 1OFHA 4A3VB 4ANLA 1OFIA 4FWDA 3CD8A 2LVNC 5ANGA 2F5OA 3LFAA 2WQBA 3A7GA 4TPTA 1JLUE 3NWWA 4D2WA 4QMQA 4OTQA 3RM6A 2OF4A 4LL0A 4MD7E 4QOZC 4NT4A 1IFYA 3ET7A 4EOPA 4HVSA 2R3FA 4Z3VA 2XSZD 4DH5A 3S00A 2WMWA 4IBKA 4F6WA 4F99A 3LXKA 1PXNA 2V1CA 2UZBA 3GI3A 2Z60A 4UMRA 5AIRA 4FCTA 2YIYA 2X6EA 1H1QA 1UNLA 2UW4A 2UUEA 4IC7A 1U5QA 2Y4IB 3EJ1A 4DR3M 2PMNX 3S2PA 3QTZA 3NUUA 1MQ4A 4FF8A 3GLHE 2OBJA 5ITUA 2XB7A 4JI4M 1OPKA 2X8DA 3CEKA 2ITXA 3ATSA 3DBQA 5HX6A 3OXTA 2DYLA 4FTAA 4I6LA 3N9XA 4DAWA 3W0FA 3GGFA 3QUEA 4ZS0A 4AXFA 1Z5AA 3A62A 4FRFA 5M56A 1TGUA 3VW8A 2Y0AA 4EJ7A 4FWGA 2WMXA 4UMUA 4JI6M 1VDDA 3KXHA 5L8LA 2ZANA 4DGLC 3OCBA 5IQHA 4I23A 3DBCA 5EKNA 2JWSA 1VDLA 4ANQA 4FSRA 3HU3A 2VNWA 2DWLA 1R78A 3UP2A 3WOWA 5DHJA 2VX1A 2XK9A 3FYDA