1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity regulating kinase 2
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
4XOZA 3R22A 5LOHA 2C6KA 3A7FA 4Y72A 3K5UA 4YLJA 5K3YA 3CY3A 1FVVA 3KU2A 1RJBA 4JDJA 3GCUA 4ZJJA 4EKLA 1OMWA 1H24A 2VTIA 4O2ZA 2BKKA 3LMHA 1GY3A 4Y95A 4DFYA 2REIA 4F9AA 4EC9A 2YLFA 3MDYA 3MI9A 4ALVA 4FIFA 4OLIA 4AN2A 1OIYA 3KVWA 3MBLA 4FT7A 2NO3A 2B7AA 2DYLA 4WIHA 4YBKA 1TR8A 3FKOA 3W1FA 3IK3A 4C59A 2J0IA 1UV5A 4FV3A 5DH3A 3RCJA 3DXQA 3CS9A 4UYAA 4ZTNA 3O96A 4YHFA 5C9CA 4F0FA 4HCVA 4D58A 3UOKA 2WB8A 3VF8A 2C30A 2R64A 2DUVA 3QKKA 4IVDA 4OTPA 1RDQE 2DS1A 3CKXA 3F5XA 4RX8A 3DPKA 4L3PA 1W8CA 2HXQA 4F7NA 3NRMA 5KBQA 3FC2A 2PZRA 5IH5A 5JQ8A 1QPCA 3QLFA 3VNTA 4YR8A 4I6BA 4K0YA 4OTHA 3F92A 5ACBC 5CQUA 1NVSA 1HT1E 4IMYA 4AN3A 2DI0A 1QZEA 2XK9A 4IJ9A 4DBGB 2QHNA 3QUEA 4R5YA 1NVQA 4F9WA 4RJ7A 4ASDA 3KY2A 1PMEA 2YCSA 3G9LX 2ETRA 3KMMA 2QODA 3OOGA 5FRIA 4AGDA 3AC8A 3QRUA 2GNLA 4YUQA 3R00A 5DIAA 4G16A 1YXXA 2C69A 2ACXA 1WFCA 3B2TA 3QGYA 4LUEA 5EDPA 4ANQA 3VS3A 3C0HA 2YCFA 3CPBA 1YOJA 3U51A 5ITAA 4PNKA 2PVYA 4YPSA 2GNJA 3AT4A 1FMOE 4G3GA 5EM7A 3ELJA 3DKCA 5AUTA 5L3AA 4ZEGA 4FE2A 4MKCA 3Q9XA 2Z2WA 3OS3A 1J3HA 4L7SA 2PVLA 4XHKB 5EH0A 3MYGA 2XMYA 4RC3A 3DK3A 1XJDA 3ZUUA 2YWPA 2BIKB 3ITZA 2GSFA 3ORKA 4S30A 1PHKA 1NVRA 1YVJA 2G9XA 3TKHA 4EOIA 4BTMA 5DYJA 3H4JA 3QZHA 3C4FA 4IH8A 2WZJA 4KKGA 3FKNA 1KYIA 1DV0A 4NU1A 5B2LA 4FV6A 5EFQA 1Y8YA 3R30A 3Q9YA 5CU4A 2F7XE 3MJ1A 4OTGA 3CC6A 2JDVA 3EL7A 2BUJA 2RFSA 1HCLA 2UZNA 4LOQA 5E8TA 4BZNA 3FLZA 3CLYA 3QTUA 5H8BA 4ZIMA 5EDQA 1H0VA 3RWPA 1Q02A 1H8FA 4FI1A 4FOCA 5K4JA 3BYOA 2VO7A 3HMMA 5AMNA 4QP4A 4LV8A 2QURA 3QQFA 4S2ZA 1TVOA 4UMPA 2Y4IC 1YLAA 3KFAA 5DG5A 3VS7A 4F7JA 3AC1A 4MD9E 5FG8A 1OKSA 5GZ8A 3MB7A 4K6ZA 3RINA 1OAIA 2AC3A 4LG4A 3OUNB 4H39A 2LVPC 2YIWA 4LMUA 5FDPA 3MH3A 5I4NA 3FLWA 1VDLA 4FTKA 5HTIA 2A19B 3GGFA 2V7AA 3BPRA 3EN6A 3T9TA 4FKVA 4XG6A 1IA9A 4A9UA 4CYIA 1ND4A 2VU3A 4U45A 4PNIA 4UMUA 3MS9A 1WR1B 4C61A 2PUUA 4ZTMA 5E8XA 1Y6AA 4MF1A 2IWIA 3LMGA 3PSCA 4O7RA 5BYZA 4ZSJA 4GCJA 3HP2A 1H07A 3W18A 4BGGA 2YZLA 1OKZA 5JFWA 2R3HA 3AQVA 3W55A 4ERWA 2WQBA 5E8ZA 4Z7GA 4LGHA 2UZVA 4JT3A 4O6EA 1ERKA 3R7UA 4A4LA 3RPVA 4FYOA 4QOXA 4X2NA 4EOOA 5L2WA 2O65A 4U9AA 4EEVA 3QHRA 4RX7A 1Q8YA 3TT0A 2FGIA 3NIEA 1XH5A 4O1PA 4AAAA 2P2HA 3NUUA 3H9OA 4WG3A 3TEIA 2JBPA 4ENXA 3QAME 4PPBA 2WTIA 4JIKA 4EH5A 2VTJA 3H9FA 3TNQB 3WYYA 2XA4A 3KRRA 3IGGA 2WPAA 4K77A 4ALUA 4FNXA 5CEPA 4HJOA 3OXTA 3CTQA 2WMRA 5JZNA 4EH7A 1YXUA 4BCMA 4TYHB 5CAUA 3LFNA 2OG8A 3UTOA 1OPKA 2BCJA 3IOPA 3PPKA 1S9IA 2FSTX 1BI7A 3GT8A 3LCOA 3KGAA 2H9VA 4KIKA 3GEQA 3RBWA 2I40A 5EI2A 4D2RA 2VZ6A 4Y8DA 3U4UA 1BYGA 4WSQA 2WQEA 4L45A 4GK3A 3BRBA 4NIFA 5H8GA 3LXKA 2J5FA 3P7CA 5DRDA 2YFXA 3IQ7A 5KBRA 1OL2A 3G90X 4FSRA 5GIPE 1OIRA 4L7FA 3E7VA 3WIKA 3QU0A 4I5PA 4PP7A 3QA0A 4KUJA 4YC8A 4IDVA 3JS2A 2J0LA 5HLNA 5IQGA 4DG3E 4JX3A 4HEOA 4MNEB 3FY2A 2CWBA 3HA8A 2JC6A 3PG3A 4ACHA 3NMUF 4F7SA 5ACKA 4ANNA 4EH3A 4F7LA 4YPDA 4FV9A 1KSWA 2XM9A 3OMVA 4O86A 4O7SA 2SRCA 3AMYA 1W98A 2VAGA 5DVRA 2UZEA 3FY0A 2QO2A 3OROA 4G5JA 2VNYA 2GS7A 1QPJA 3ERKA 2CNVA 3EN5A 4EI4A 2WFYA 1U59A 3MH0A 4P5QA 4FT5A 1B6CB 4GKHA 3JVRA 3CD3A 4G9RA 1FGKA 3C0IA 3HP5A 3BGQA 2BMCA 3QRKA 4AP7A 2IZUA 2Y7JA 5EW8A 3KRLA 5HTBA 3CKWA 4BFMA 4XS2A 5CEKA 2PE2A 4YLLA 2JFLA 4L6QA 1W7HA 3ZLXA 4XLIA 4FKIA 4DTKA 2ZTDA 3RALA 3WZJA 2OJFE 3C4EA 1U54B 2VTOA 5EKNA 4HGLA 4QTDA 4YTFA 4YO6A 3RI1A 4CFNA 2X2KA 3CTHA 5LWMA 3E92A 4LV5A 3RHXA 4RIYB 3QL8A 2V5QA 4AX8A 4C2WA 4QQ5A 3KRXA 4DITA 3C4ZA 2PUPA 2HYYA 4PWNA 5KHWA 4Y73A 4RWKA 3R63A 5DOSA 5CALA 4EQMA 5E7RA 4RWLA 2OLCA 2Q83A 5CENA 3TZMA 4X21A 4GL9A 4IX3A 4J52A 3ZLWA 5L4QA 3R01A 2BWEA 4L68A 1VEBA 3LE6A 2GU8A 3DBCA 4RJ4A 2WGJA 4UZDA 4XNEA 4I23A 5KMMA 3TN8A 1FVRA 1KV1A 4CKRA 3V51A 1JPAA 2XNEA 4PP9A 4D1ZA 3LQ5A 2ITYA 3LFEA 4JL9A 4NCTC 5B0XA 4AT4A 4LMNA 3VQUA 2C5OA 2GPHA 2IN6A 1VYWA 1MRUA 4FNZA 4IFCA 1OPLA 5FEDA 4AU8A 4LRKA 4RJ8A 2X7OA 2VO6A 4FSMA 3NNXA 1H00A 1U4DA 3EFKA 1OL7A 2YN8A 3A7JA 2VTTA 3D7TB 1DO2A 3E87A 1ZYDA 1ATPE 2A0CX 2C68A 2JIUA 3P86A 5M57A 4O84A 2W1ZA 3A8XA 1GOLA 3IO7A 3PJ8A 4D4RA 3MFTA 3PZHA 4BL1A 5BVEA 3ODZX 4ZTHA 5IQFA 1HJPA 2W5HA 3BHTA 3IS5A 2IW9A 4I21A 4I94A 3SXSA 4RVTA 5J8IA 2A4LA 3A60A 1YOLA 3EKNA 4RGJA 4UYNA 3R28A 4D9TA 5T3QA 3QYZA 3NEWA 4ZLZA 3ZMMA 5A46A 5IQEA 4DGOA 3VRYA 3WZUA 3TJCA 3ULIA 1HT2E 3CQUA 3I0OA 4X6QC 1JSUA 3ZEWA 4PX6A 2ITWA 4BYJA 3G9NA 5FEEA 4D55A 3FAAA 4S33A 4C3RA 5ANGA 3ATSA 3PA3A 4BDFA 3F2RA 3PY1A 2EUFB 4KSQA 2PE1A 2QOBA 3OWPA 2Y4PA 2ITXA 4LUDA 2JAVA 4J8MA 4QQCA 5CLPA 3I6WA 4QMQA 2CNQA 4EH9A 2FSOX 3HRCA 5EYKA 4XP2A 4F65A 4X3FA 3I60A 4KIKB 4U3YA 3UVQA 5HORA 2Y0AA 3II5A 2X8EA 3HMPA 5J9ZA 5ANJA 2H8HA 4D4VA 4FEWA 3HV6A 4QQJA 2WEIA 3ZRLA 4I6QA 4AGUA 3RAIA 2LVNC 2PVFA 2CMWA 3C4XA 1SMHA 3OC1A 2XK6A 5C8NA 1YXTA 5AIRA 2QOKA 4DFZE 3FJQE 4QRCA 4GU6A 3HX4A 4O0UA 3JPVA 3MGYA 4UX9A 2YLEA 4D2SA 4AOJA 4PQNA 1ZMUA 3SXFA 3TV4A 4FG7A 4MQ2A 3VAPA 3ZC6A 3A7GA 3POZA 1ZYLA 5JQ5A 4D9UA 2LVOC 3FHRA 4R3CA 4YZMA 4GIHA 2X8IA 4YHJA 3DNDA 4L53A 3DAJA 3FLQA 3MFRA 4XOYA 4F0GA 4FSZA 1KOAA 2CKPA 5EM6A 4D0XA 3O7LB 3E8NA 3F7ZA 3R1NA 5E91A 4I5CA 5CEMA 2WQMA 4EOPA 4EUUA 3F66A 5CSVA 4FTOA 2LVAA 5KUPA 1JAMA 1MP8A 2JKKA 3FXZA 3UO4A 3V01A 2OFVA 2VWIA 4PDPA 3ZO3A 3CSVA 4JLCA 4C57A 4BBEA 3NUXA 3ZUVA 4F64A 3S0OA 4RFZA 5IQAA 2OFUA 1V92A 3VC4A 1TQPA 5AP7A 2R3JA 3QYWA 1PXKA 2ZM3A 3EQPA 3NW6A 3VRZA 3VS2A 1VEKA 3OCSA 3HUCA 4A4OA 4R7BA 1JKLA 5C8MA 3AD4A 4AW2A 5J5TA 5C01A 4U43A 3A7HA 4CFUA 3C7QA 4YJVA 4RZWA 4FKGA 4PMPA 2JKQA 3UBDA 5HD4A 1KE9A 2JY6B 1T46A 4NTSA 5D7AA 3VN9A 3MY0A 2ITQA 3NZ0A 4FEQA 3LHJA 4K1BA 5EHYA 3F9NA 3NPCA 2JEDA 4FKJA 5DLSA 2WEVA 3SOAA 5HHWA 2BTSA 4JS8A 4O0SA 4ZS4A 2W0JA 4UXLA 1YI4A 3NWWA 2C6EA 4PV0A 3R7YA 5HGIA 2VWUA 2OIQA 4NTTA 3P0MA 4DFLA 4F09A 2GS2A 2H34A 1JR3E 2QHOB 2ZMCA 4KNBA 3RPSA 4RWIA 2W4JA 4JX7A 5DT4A 5CF4A 2R0UA 3SHEA 1CKPA 4ZOGA 3P08A 2ESMA 2F7EE 4BCGA 2IW6A 4CZTA 4UMRA 3DFAA 3ZYAA 3AG9A 3QCSA 5AUYA 3UG2A 1CSNA 2V55A 4IEBA 2JIIA 4LRMA 4J53A 2JDRA 4UZHA 1WAKA 5G1XA 3FYJX 5BVKA 3RNYA 3Q3BA 4JR3A 1OPJA 4CCUA 4G3DA 4BCNA 4R78A 2FO0A 4FEUA 3OZ6A 1GIHA 3BU5A 2WXVA 3FI2A 3HYHA 5H2UA 5E8VA 3UPXA 1NV8A 4O7VA 4HVIA 4DT9A 3VS6A 4JAIA 3K3JA 5FTOA 4TXCA 5HCZA 4D5HA 2YCQA 3RM7A 2CHLA 4XG9A 3JR1A 4Y5QA 4CT2A 1ZOEA 2JP7A 2PVJA 2G2IA 4FTUA 2OJGA 3HEGA 3NLBA 5EHLA 2YJSA 3PIYA 4K9YA 3TKUA 1KOBA 2W9ZB 2EXMA 4WP2A 4UV0A 5CF8A 4E8AA 5BUIA 2WHBA 3OW3A 4X0MA 3Q53A 5F4NA 4F70A 4EBVA 3S1HA 2RG6A 3ZSHA 4EH4A 2J4ZA 2YM4A 3E93A 1UU8A 4IX5A 4BI0A 3ZZEA 3ENHA 2XP2A 5T68A 5JGDA 1JBPE 3EN7A 4P90A 4Y85A 3UP2A 5E8UA 3VJOA 3EFLA 1BUHA 3CY2A 4BDHA 4P4CA 3MW1A 3LQ8A 1WCCA 5E90A 4C0TA 3PLAE 5L2SA 2NNWB 3KREA 5AADA 5M4FA 1PMNA 3MH1A 2YZAA 2O8YA 3F2AA 3RAWA 4QP1A 4DGMA 4ZTRA 3E8CA 4CG9A 4J98A 3GU5A 1YKRA 1UWHA 4U40A 5C03A 2R0IA 1CTPE 3V5TA 1NW1A 4GS6A 4XV1A 3ACJA 4Z16A 5BYYA 5AUXA 3CXWA 4O83A 1PXJA 1PJKA 1UNLA 5FWKK 2JNHA 1H28A 2BRHA 3CJGA 3D5XA 3IECA 4ZMFA 4XV2A 3SQQA 2JDOA 3K3IA 4U79A 4BWKA 1XXHE 4R8QA 4R3RA 1PRYA 1Q4LA 3V5PA 3D94A 1IA8A 3BBTB 4C38A 4FIHA 3HDMA 3CTJA 5CZIA 4DEGA 3FRHA 4GMYA 2VRXA 2HZNA 4FX3A 3F6XA 3PXYA 5HNGA 3PPZA 2QG7A 5ANIA 4AUAA 2PULA 4DH3A 3E8DA 5DI1A 2YDKA 2L4EA 1A9UA 3ORNA 1MRVA 3PVUA 4NKSA 3VJNA 4EQUA 3U87A 5AEPA 5HX6A 3HZTA 3ZOSA 3WOWA 4LOOA 4O91A 5BMMA 5BVNA 2VX3A 5LQFA 1CM8A 1STCE 2PVHA 2J50A 2QOLA 4PY1A 4NEUA 1M2RA 4C4HA 4NM7A 2C0IA 2UVXA 4IM0A 4WUAA 4HGEA 3NYVA 5AUUA 4JDKA 5J1WA 2X9FA 3DDQA 3DV3A 3OTUA 3VHEA 2WTKB 5IUGA 1R0EA 2Y9QA 1OBDA 4FOBA 1URWA 4C37A 4CSVA 3QUPA 4IAZA 3CE3A 2XBJA 3OEFX 4FTCA 3C5IA 3LCSA 4IE9A 3ZUTA 4APCA 2VNWA 4CD0A 4HPUE 4M67A 2XK8A 5C1QB 3EHAA 3QC4A 4LL5A 1GAGA 3COIA 4L44A 4R6VA 3UMWA 1AQ1A 4OBPA 2BDFA 2H6DA 4DHFA 5A6OA 2HIWA 4I1ZA 4AW1A 3QRJA 3FZRA 3OF0A 2BKZA 3KC3A 4GFGA 2UZOA 1VEJA 1JSVA 3HV4A 4BN1A 2CGXA 4K18A 5HBEA 2WU7A 1HOWA 3NUYA 3W8QA 4BWPA 1J91A 2F2UA 4KINA 5KO1A 2I0EA 3QCXA 3WZEA 3TV7A 3NR9A 2FH9A 3GOKA 3OXZA 4FTIA 5AV2A 3G0FA 3TTJA 4I6FA 3VS1A 4PUZA 2CPKE 4ASEA 3ZU7A 5M56A 4MXAA 2EKKA 4BI2A 1CMKE 3Q5IA 4E5AX 2XF0A 2W1FA 3LW0A 3T3UA 3UVRA 3L9NA 3ROCA 2X81A 2XIXA 4F1IA 1QPEA 3R9DA 4ANSA 5HZNA 5CTPA 4ACGA 3OG7A 2PWLA 5L8JA 2YEXA 1OL5A 3OXIA 4JAJA 3S2PA 4I4FA 5EI8A 2HXLA 1P3QQ 2UW7A 5ETFA 2C0TA 3QXOA 4A06A 3F5PA 3NDMA 4JNWA 4PF4A 5DEYA 5CNOA 5HVJA 3VULA 4J1RA 3W2SA 2C3LA 4CMTA 3RP9A 2V22A 5AR3A 4W8DA 3LCUA 2ZB0A 1GZNA 4CCBA 5HICA 4RSSA 5I9UA 1BVSA 3DU8A 4HCTA 1OQYA 4NWMA 4OT5A 3ZSGA 2XNPA 4YBJA 4O21A 4BTJA 4QPSA 5LWNA 4EK4A 2OIBA 4CKJA 5AV4A 2QKWB 5K4IA 1T45A 3KL8A 3IONA 3OWJA 4BBMA 2R2PA 4FUXA 4YLKA 1FGIA 4JBVA 2IG7A 5FP6A 2VTSA 4ITJA 4MCVA 3QX2A 3ZXTA 2HZIA 4FODA 1OKWA 4BDDA 5IA3A 4JG6A 5IEXA 1VEGA 3EQGA 4FKLA 2IO6A 2BIYA 1R1WA 4Y46A 2CN5A 1HQYE 5FM2A 4BKJA 4NCTA 4EORA 2JY8A 5E9EA 4G1WA 4ZP5A 2WO6A 3PXRA 4FG8A 4LGGA 1DI9A 4RIXB 4RX9A 2R7IA 2W17A 4FK3A 3DBDA 3VW6A 4D2PA 1U5QA 3Q6UA 4AOTA 1YRPA 4G2FA 2VTAA 4RPVA 2W96B 5KMIA 4W4XA 3Q6WA 2XH5A 4AA4A 4WA9A 2FUMA 5D11A 3OY3A 3HLLA 4FL1A 3PIZA 5HIBA 5CSWA 2XK3A 5L6PA 4DFBA 2F57A 2IJMA 3ORTA 1XH9A 1FMKA 5AV3A 4O7WA 1H1WA 1XH4A 1Y57A 3D15A 2EVAA 4OBOA 1P14A 4O22A 4HGTA 1XWSA 2NPQA 2XYNA 1NY3A 4YSJA 4GT3A 1F3MC 4IM3A 3NAYA 4CXAA 3I5ZA 4FZ7A 4OR5A 5FEQA 3R1QA 5E8SA 4FZFB 1WIVA 5JI2E 5HLPA 4HVHA 5HCYA 2PHKA 3FLNC 4GH2A 3TWJA 4X3FB 2GDOA 3R6XA 3UO5A 3DQWA 3PDTA 1YDSE 4GT5A 4TYEA 5AP0A 2Z02A 1H08A 2P0CA 3D9VA 3T6PA 1GZKA 4FZ6A 4AZWA 3DBEA 3R8PA 3SRVB 2JY7A 3RK7A 4ZTQA 1P5EA 3I0QA 1OL6A 4ZS0A 3K54A 4BZDA 4GVJA 1S9JA 3MN3A 3D14A 3PA4A 3GFEA 4IZAA 1PGYA 1GNGA 2QHMA 2PSQA 4IB1A 5DRBA 4TWPA 3RKBA 1JLUE 1ZY5A 4HZSA 2BROA 1E1XA 4O0VA 5AM6A 2VGPA 3GU6A 2FSMX 3D2IA 4DEIA 1UNHA 1APME 2XNGA 3QLGA 3VUTA 4E4LA 4HVGA 2UZTA 2GMXA 3R7VA 3MTLA 4K11A 5DFPA 2KTYA 3WYXA 3GFWA 4L8MA 3ULZA 2QNJA 2W1GA 3DQXA 3UC3A 5CSHA 4G9CA 4G6OA 4KWPA 3FZOA 1GIJA 4IWOA 1CDKA 2X6EA 4ANBA 2W06A 5JZJA 3SV0A 3LFQA 4XYFA 1MN3A 2ONLA 5BVDA 3DCVA 5AP4A 2PTKA 4JQ7A 2R5TA 3COHA 5ANKA 4ZSGA 4Z7HA 5IQCA 5F95A 3O23A 1BL7A 2ZM4A 4O0RA 3K2LA 4AQCA 4OTWA 4TY1A 4BDJA 4IWQA 3O8TA 4IVCA 4R5SA 2CCHA 4RJ3A 2AYPA 4A9YA 5JEBA 4BR3A 3ID6C 4B0GA 5FUTA 1FOTA 3FL5A 3ZO4A 2VD5A 4LM5A 5E8YA 3DY7A 3I4BA 3LIJA 3QQGA 4FKOA 5D10A 5J95A 4EYMA 2MGWA 3FPMA 4IVBA 5AR2A 3EQBA 2P55A 3FI4A 3HV3A 4FBXA 4FSQA 3V8TA 5IQDA 4Q2AA 4TKSA 4WKQA 5A3XA 1H25A 4AWIA 4IIRA 3HMOA 3EJ1A 4ENYA 4ZTLA 1R39A 4ONAA 2WMQA 4JR7A 5KKRC 1UKHA 2UW8A 3Q4UA 2G15A 4TTHB 3AGMA 3ZRKA 4GU9A 5CAVA 4QP8A 4NM5A 3DB8A 2B4SB 2DNAA 3AMBA 3BE2A 2VTMA 3FRIA 2XM8A 3HRBA 3KXZA 4YSMA 3NCGA 5EQYA 1K3AA 4O7ZA 2OZAA 3R9HA 5AP2A 4QNAA 3IW4A 4PMMA 3KEXA 3C9WA 3LVPA 1TTEA 3JXWA 3NVMB 4FGRA 4NZWB 4MVFA 3SOCA 3O2MA 4CTCA 4DH8A 2X39A 2P4IA 2KULA 4KSPA 3RK5A 3ZFMA 5I9XA 2PMOX 2HW6A 3P7BA 3OTVA 3TNHA 4UN0C 3Q60A 3OWLA 2WOUA 4RZVA 4BCQA 4O7TA 2BDJA 4N6ZA 4JBPA 4G31A 4EUTA 4OAUC 4CG8A 2ZMDA 1YHWA 3P5KA 5HG7A 1UA2A 4H3BA 3LFAA 3WILA 4UY9A 1XR1A 2W4KA 2PMLX 4K2RA 2I1MA 3UNJA 4CLJA 4J8NA 3KF4A 4DGNA 4PL3A 4MHAA 2QR7A 1K9AA 3PJ2A 4GK4A 4E93A 3FZ1A 4EZ3A 3QRTA 2CLXA 2YM8A 3MSSA 3TUBA 2R9SA 1F4IA 3ZO1A 4ALWA 4EHEA 5LMBA 2A27A 4ZAUA 5JN2A 4P5ZA 2OKRA 3L8XA 4OBQA 4R1YA 2P2IA 3R83A 2EJSA 3DJ7A 3KULA 3PRFA 5DFLA 1ZZLA 2PE0A 4P7EA 5HG9A 4B6LA 4WG5A 4KA3A 4DH1A 3FZTA 5EDRA 2HWOA 1Q24A 3EQFA 5DPVA 1QL6A 3ORLA 4O0WA 4E20A 2CLQA 2W9FB 2QLQA 1PYXA 3PVGA 5CU6A 4TNDA 1SNUA 5HI2A 5IUIA 5KZIA 4CKIA 3O0GA 4EOSA 4WOVA 4RT7A 3WF6A 2XKFA 4L67A 5J79A 5DT3A 2XKEA 3NVKI 5HVKA 2VTQA 2JZ0A 3BZ3A 4C7TA 4P2KA 4U8ZA 4B99A 4RFMA 5DN3A 2PY3A 4D5KA 3B2WA 4BZOA 5KNJA 4RIOA 4AW0A 4Q5HA 4C4JA 4NYEA 4RA4A 2LVQD 4WSYA 3MVMA 2K0BX 3HUBA 5J1VA 2WIHA 4K33A 4D4SA 3EB0A 3RCDA 3LJ0A 2G3QA 2YITA 2ZJWA 2J5EA 3R21A 1M17A 4UEUA 2VV9A 4EWHA 2GNIA 5H8EA 2FB8A 4S31A 2B54A 4KRDA 3ROYA 3P9JA 5GHVA 1E1VA 3WARA 5FXSA 3JUHA 1O6KA 4M14A 3NUAA 2C3KA 4C02A 3R73A 2JITA 2BALA 1SVGA 3C1XA 2EB2A 4GFMA 2GNHA 1Q8UA 1ZYSA 3DKGA 4IJPA 3WI6A 1Y6BA 3BYMA 4Z9LA 2QOQA 3PA5A 4E4NA 3BBWA 3D5VA 3QD0A 4R1VA 3R9OA 2ITNA 5FDXA 3ATTA 5DR6A 2ZV7A 3LCDA 4Q5EA 2UZUE 2VTLA 4E1ZA 3BYUA 3LJ2A 3LAUA 3TACA 2OXYA 3QZIA 4F08A 4B4LA 1OGUA 5JRSA 4W4VA 5AP3A 4WHZA 3VBVA 4MF0A 3UYSA 3TUCA 2EKFA 3BCEA 4UALA 3UE4A 4O82A 1FINA 4ACDA 5JFVA 1ZMVA 3DJ5A 4MWHA 5EW9A 4U42A 1PKDA 3ET7A 3UQCA 3LFCA 3SGCA 4F4PA 4A07A 3FL4A 4HVSA 3SC1A 3TDVA 3MB6A 1H1QA 2BTRA 1WHCA 3G5DA 1Q8TA 3KN5A 1G4AE 5CQWA 2ZVAA 1FPUA 2A2AA 3EYGA 2P33A 3ZO2A 5IMEA 2H96A 3T9IA 3DXPA 4FG9A 4AZTA 4FTAA 2WU6A 4QYFA 3SD0A 4C4GA 5C26A 3U54A 2O63A 1I09A 1UNGA 5A54A 1URCA 2OZAB 1E9HA 3PWYA 1YXSA 3A7IA 1JOWB 3OW4A 4FTNA 4IC7A 3I7BA 4CLIA 4Y83A 3ZBFA 4QMYA 4GIIA 3D0EA 1G3IA 4PL5A 1U46A 4IC8A 3RM6A 3S3IA 4S34A 5F1ZA 3UIUA 5LARA 1J7LA 1WVWA 4N4SA 4ACCA 5KMNA 2XNNA 1FQ1B 4YZCA 4AG8A 4IZ7A 4O6LA 4YMJA 5AAEA 2QU6A 3RZBA 2UW6A 4AGWA 1H1PA 2GHGA 5AR8A 4YTCA 3SA0A 1QPDA 3F88A 5G6VA 5CU2A 2ZB1A 2UW5A 3QHWA 2YAKA 4NSTA 3RWQA 3OCTA 5CSXA 4KIPA 3BWFA 3PY0A 4HYIA 4J99A 4UXQA 4C8BA 5IH6A 1WBTA 3HKOA 2JKOA 3SVVA 3UPZA 2XIKA 2GTMA 3B8QA 2PL0A 3FXWA 3ZFYA 5JKGA 3TNPC 5HTCA 3GB2A 2L2DA 4RX5A 2WMVA 4ZZNA 4XUFA 5M55A 4RIYA 4M66A 1T6OA 2BFYA 2OH0E 2ETKA 3QTSA 4CFXA 1H01A 4FKSA 1LR4A 3LFBA 2ERZE 3E63A 5CXZA 1M14A 3UOLA 3EFWA 3QTIA 5J9YA 4B7TA 2C6MA 3BGZA 3KB7A 5B2KA 5CF5A 3QA8A 4AT5A 1LEWA 3QTZA 5HQ0A 3E3PA 1PXNA 4O7NA 3EZVA 4FSUA 1TQIA 2VWVA 1IFYA 2Z7LA 3A4OX 5CZHA 5LJJA 4DFNA 2QOIA 2YWVA 5HEZA 3OCGA 4M8TA 4BWXA 3ALOA 4AA0A 2C3JA 2WQOA 4U97A 3WF8A 3QALE 4IWPA 4E5WA 4N57A 4IZ5A 4I20A 3A4PA 4M3QA 3PYYA 4WD5A 4BC6A 4E6QA 3R8VA 2R3NA 3NIZA 4JBQA 4O1OA 1KV2A 3WF9A 4ZLYA 2F2CB 1AIPC 2ONLC 3RGFA 4D4YA 4KABA 1WVYA 1Q8WA 2PK9A 4HGSA 3HMIA 4FSTA 2G2FA 1MQBA 4UWCA 2GQGA 2RRUA 3EQDA 4OTIA 1Y91A 3ORXA 3Q5ZA 4F6SA 4BDIA 5AA8A 2R3PA 5CT0A 2OW3A 4OW8A 4FUYA 4QTAA 3PJ1A 2VN9A 2OSCA 5DR2A 2B9JA 3KA0A 4Z3VA 5GNKA 4L43A 3SX9A 1R4GA 2J9MA 4A7CA 3VUDA 2RG5A 2OXXA 3QTRA 1ZWSA 2JZ1A 5CYIA 2XNOA 3G0EA 4BDBA 5A9UA 5I9ZA 2BAKA 2VWYA 2XB7A 3RNIA 1AGWA 4YZ9A 1P4OA 3O8UA 4GJ3A 4HYHA 3GLIE 1G5SA 1ZV1A 1X8BA 3DDPA 2OF4A 3C0GA 3T3VA 4PPCA 4AZSA 5CEQA 3NW7A 5F94A 5IU2A 2VX1A 3LM0A 3VS0A 3I6UA 4N0SA 4TYHA 1OUYA 4DH5A 4QTEA 5KMJA 4YU2A 5AR5A 1ZY4A 2YIRA 4ZY4A 4KIQA 2B9HA 3L9MA 4FK6A 3L1SA 3SKCA 3MJ2A 4BB4A 3BHHA 1K2PA 2QI8A 3UOHA 1LEZA 2QU5A 1YQJA 2XCKA 2R3GA 3OFMA 3ZC5A 4QMWA 1M52A 2CP8A 3LLTA 4JVGA 1XQZA 3FMEA 3P4KA 3ENMA 4D1XA 3GBZA 1R78A 4BICA 4ITHA 4LI5A 1DM2A 2BZJA 4TYGA 4YJQA 1J1CA 3PY3A 3ANQA 2VWXA 4LRJA 3CP9A 3EFJA 3Q2MA 3E88A 1PKGA 5CASA 3AC2A 3HL7A 4CT1A 4BDGA 5BQ0A 4MYGA 5FTQA 3HRFA 5HO8A 4CQEA 5LMKC 2DKLA 2G2HA 3FXXA 3VIDA 5KKRB 4E6CA 2JD5A 1JKKA 2R3LA 3HA6A 3GQLA 3QCQA 3DA6A 1OBGA 3G15A 4BY9E 3CGOA 4DBNA 4BIBA 4I5HA 4CFWA 5FP5A 2CSNA 1FVTA 3KXHA 4X2JA 2CKEA 3FQSA 2HWJA 4MBJA 4YTIA 4J96A 2BRBA 2CCIA 2XRWA 5GJFA 1B39A 3QUDA 4JXFA 3V8SA 2YM3A 4F9YA 2O3PA 4H36A 1OI9A 5HIEA 3OCBA 3GLFE 4M69A 3EZRA 3BU3A 5EYDA 5TKDA 4EK5A 2PYWA 1KE6A 4L3JA 3PP1A 4C58A 2CJMA 3HAVA 4GFOA 2RF9A 2ZDTA 3PJCA 2PMIA 4U81A 4FZAB 3VBWA 5HBJA 5LCJA 2WTJA 4RQVA 3IKAA 3WE4A 4EHVA 3U6HA 4QMUA 2V62A 3JVSA 3IW8A 3C51A 3TNIA 3IDCA 4FV0A 4BI1A 3BBZA 2X2MA 1DI8A 4TNBA 3FYKX 3DBQA 4WNKA 4L46A 4I0SA 5KMLA 4FYNA 3G6GA 4AN9A 4F1OA 3OD6X 3EH9A 3TIYA 3GCVA 5ICPA 4RLKA 3GU7A 3FC1X 4G5PA 2GCDA 2X7GA 3L8SA 2ITOA 2W05A 4GJ2A 4IX6A 4QMXA 4XH6A 4C62A 4C4EA 5BPYA 1IAHA 4U7ZA 3SDJA 3SW7A 3W2QA 3WF7A 5A6NA 4ANLA 5M08A 3QKMA 3DS6A 5IUHA 3BYSA 5LMAA 2GHLA 3AD6A 5AR7A 4A9SA 4QMOA 3RAHA 1U5RA 2W7XA 2WOTA 2C47A 1ZOGA 2I6LA 3A8WA 4FV8A 5EQPA 3UGCA 4BHNA 1CKIA 2LTUA 2BPMA 4IB0A 2AUHA 1RE8A 2C4GA 4QMTA 4RVLA 5AAFA 5M07A 1BX6A 3ZEPA 5M44A 2B0QA 2BILB 2UZWE 3FV8A 3W33A 3U6JA 5JH6A 4TWCA 3L8PA 2X7FA 3U6IA 3E8EA 2BHEA 3OBJA 2Y4IB 2Z7SA 3P7AA 1YHVA 3SXRA 2CN8A 4GG7A 4BGQA 4DC2A 5IDPA 4I3ZA 3AC5A 4W4YA 3NGAA 3PTGA 3QWJA 4GRBA 5IDNA 1BKXA 3ODYX 4H1MA 3QTWA 4UB7A 2MJ5B 1UWJA 3BWJA 3DT1A 4UWBA 3BELA 4RMZA 2R3IA 4BVUA 5CX9A 4JQ8A 5B2MA 3LJ1A 1SZMA 3LLAA 1RW8A 4FC0A 2HOGA 3DLZA 1NT2A 4FV5A 4FKPA 3ZBXA 4J95A 3O7LD 1AD5A 1YI3A 3JY0A 3PZEA 4QMVA 4FEVA 2WIPA 4RVKA 3SAYA 4KKHA 4LYNA 3VHKA 1REKA 1WBOA 3PSDA 4C4IA 4DEEA 4FIEA 4NJ3A 5CEIA 2BZIB 3FBVA 3KXNA 4XJ0A 3QD3A 3FMHA 3P1AA 2PZYA 1G3NA 4KB8A 2BZKB 4Q9SA 2C6OA 4AZEA 3D4QA 4DLJA 3GXLA 3MPMA 2E9NA 3PPJA 4FTRA 1J1BA 2PUIA 3JY9A 5HD7A 4R77A 2EWAA 4ZJVA 3NUSA 5L2QA 3BKBA 5LVLA 5D7VA 4ZMEA 4FZDB 3IOKA 2QR8A 4DCEA 4BDKA 4LL0A 3DB6A 2QLUA 1IXSA 3GC7A 4O27B 4RJ5A 2BRMA 3GENA 4I22A 5BX0A 1H1RA 3LPBA 3OOMA 2C6TA 3BEAA 2NRUA 3F61A 3FQHA 3EOCA 3IG7A 2WQNA 3QQHA 3OVVA 2B9FA 2OK1A 4TT7A 2HW7A 3P23A 5J9LA 5I9YA 4ASXA 3REPA 5AJQA 2VX0A 4E7WA 1XH6A 3R0TA 1M2PA 3DOGA 2V7OA 3GP0A 5AFVA 2VGOA 3UJGA 4FIGA 5IA2A 4AE6A 2WMAA 4WO5A 3F3WA 3NW5A 3LM5A 1O9UA 5GZ9A 2B53A 2OICA 3KVXA 2OO9A 4ID7A 3PXQA 4F63A 1XH7A 4HNIA 4FTQA 4AS0A 4E73A 3K9OA 1ZZ2A 4WBOA 3R7EA 2XBAA 5FLFA 3TKIA 3UODA 2DENA 2O2UA 4RC2A 2HY0A 2G01A 3NUNA 2RSVA 1SVEA 4DG2E 4TZRA 4YNEA 5CU0A 1GIIA 1UKIA 2AC5A 1Q5KA 2GNFA 2MROB 5K0XA 5GIOE 4G3EA 2C5XA 3CEKA 2W1IA 3MIAA 4MD7E 3U9NA 4F1MA 1IASA 2F9GA 3F2NA 3O71A 2DAMA 5EK7A 4DLIA 4FKRA 3PXFA 3MV5A 4RVMA 3EIDA 4FGBA 3IHPA 2CGUA 1PXIA 4FNWA 4CEGA 1IRKA 3FPQA 4QYHA 3ZDUA 2RGPA 5LMKA 1JNKA 2Q0NA 3D7ZA 3MIYA 2HAKA 5HE2A 4GYIA 2QOOA 4J97A 3QTXA 4USDA 4XX9A 4JQEA 4IXPA 4DA5A 3O17A 3G6HA 3ORMA 4H58A 1UU9A 3I1AA 4IAFA 3ORZA 4MEDA 3RJCA 3ZS5A 4AFEA 3GOPA 2BRGA 4M15A 5HCXA 5BUEA 2GQSA 2ZTCA 2EU9A 2OJ9A 3DFCB 5AP6A 3ZSIA 4EOJA 4NFMA 4H05A 4M7IA 3QBNA 2C1BA 4U5JA 4EJNA 5JRQA 3M2WA 2YCRA 2CKQA 1VG5A 3F3VA 3EKKA 3HV7A 3OP5A 4YJNA 3R04A 2CDZA 4WBBB 1WGLA 4CV9A 3WIGA 3ZZWA 4JG7A 4YJRA 4U44A 1W82A 1WJ7A 2VO0A 4XRLA 3KKVA 1U54A 4MQ1A 4ORKA 2WMSA 5CEOA 4NKAA 3E7OA 3D5UA 3ZXZA 2Z8CA 2XS0A 2K9DA 2VTNA 1OITA 1YDRE 2FSLX 3BHYA 2O25A 2BAJA 2ZDUA 4J71A 4QT1A 4KD1A 3GCPA 5HX8A 3TG1A 5IA0A 4Y5HA 3CCNA 1Q99A 3COKA 4V04A 1H0WA 4OUCA 5LCKA 2WMXA 2XYUA 3EQHA 4HPTE 4XV3A 2GQRA 5KE0A 4TYJA 2OU7A 4ANMA 1H4LA 3M11A 2UVYA 4C35A 5I9WA 5HBHA 1ZYCA 4JRNA 4OTDA 5ANOA 3Q32A 3VUHA 3OEZA 4W9WA 4DFXE 1OTRA 3BQCA 4CFVA 1GZOA 3FZSA 2J2IB 3OUKA 4RWJA 1WGNA 2PZPA 3UIMA 1MUOA 3HGKA 4JIAA 4MNEA 3N4TA 3LQ3A 4XBUA 2QOFA 4BTFA 3UIXA 2IW8A 1EFUB 4DTAA 4RJ6A 4X6RA 4DT8A 3EYHA 2PVNA 1JSTA 3LZBA 2XJ0A 4PL4A 4ZZMA 1ZXEA 4MBLA 2J0KA 2XKCA 3FMMA 4QP9A 5L6WL 3E62A 2X9EA 4QTBA 3MVHA 1ZLTA 4ZY6A 3TI1A 3ZONA 4YO4A 5A4TA 4IB5A 4NIFB 5F9EA 1KE7A 4C36A 2P3GX 4IBMA 3DAEA 5AM7A 2XUUA 5D9HA 5K5XA 2R3KA 3UP7A 5DGZA 3GUBA 3QZGA 5EKOA 4DCAA 3AMAA 2BFXA 2LGCA 3AD5A 3UDBA 3V04A 5IQHA 5HG5A 2BR1A 4XRJA 2R4BA 2DAIA 3R9RA 3ORIA 2ERKA 3I5NA 4IFGA 3R1YA 5HNBA 2WNTA 4QMPA 3ZLYA 1SYKA 2PVMA 3QCYA 3V8WA 3B89A 3TDWA 2G1TA 2FVDA 4NW6A 4M68A 2IZTA 5HOAA 1C7YA 1TKIA 4FSNA 1W0XC 4E6AA 3UYTA 1OM1A 3ALNA 2OGVA 3VO3A 1OIQA 4BDEA 1P2AA 2YM7A 3HV5A 3R2YA 3QTQA 4MBIA 2QO9A 2R3FA 3FUPA 3LFFA 1UU7A 4BIEA 3V6SA 3HNGA 4D2VA 2DAEA 2ITZA 3R1SA 3R8MA 5IEYA 3PG1A 2XNBA 3GI3A 3V6RA 3OY1A 2XK4A 4FA2A 3MY1A 4V05A 4C34A 3QF9A 4RIXA 4UMTA 1VYZA 3VS4A 3TUDA 2UW3A 3CBLA 1IAJA 2WAJA 3FMKA 3OT8A 5FQDC 5LXMA 3KULB 4MAOA 4YJTA 5KHXA 1XHAA 3BGPA 4CZUA 1WBNA 3RK9A 3AC3A 3VVHA 2ITTA 4MXXA 2DAKA 4BCKA 2R3MA 4O0YA 3DNEA 3ZM9A 5HE3A 4GUBA 1SM2A 5CAPA 1LUFA 3KMWA 1UU3A 5HIDA 2YACA 4YGAA 5EG3A 2C1AA 3TNWA 1GJOA 3MY5A 4OTQA 3DLSA 5A14A 3MA3A 2ITPA 4M13A 1DAWA 3EL8A 3W2OA 1KE5A 3FI8A 2LBCA 2YDJA 1YDTE 2C0OA 2YABA 5H9BA 3ZHPC 3K9PA 1JWHA 3QD2B 5GZAA 3GCSA 2X6DA 2JFMA 2E2BA 4MK0A 3C13A 4RC4A 4YJSA 3D7TA 3F5GA 3W2RA 5TE0A 4EOQA 4YURA 1DO0A 3FMJA 2GHMA 3R2BA 4NK9A 3UOJA 2X2LA 5IQIA 3NNWA 3OWKA 3LXLA 3ZFXA 4G6NA 2W1CA 1BMKA 3AC4A 4GEOA 1RQQA 2DQ7X 4TWNA 4WNPA 3VUIA 3EMGA 1KE8A 2HZ0A 3PLSA 4DN5A 5IF1A 4EK6A 2XEZA 3C4WA 3WZKA 3LMIA 4BCOA 2QD9A 4I0TA 3NAXA 3TZ8A 2QG5A 4FV2A 3AT2A 4I92A 4QD6A 1XBCA 4QMLA 3UMXA 4EZ5A 5ETAA 3RVGA 3LXPA 3NX8A 4QP3A 5JSMA 1WBSA 1SNXA 4FF8A 3U55A 4AXAA 4CRSA 3UNKA 2ZM1A 3MWUA 4USFA 5EYCA 2IZSA 3Q04A 1GO5A 4M0YA 4QMSA 3P78A 3O8PA 3H10A 2RIOA 2DWBA 5FGKA 5KCVA 4C33A 2KNAA 4GK2A 4G3CA 4UN2B 2PPQA 1OECA 1V0OA 3FZPA 3FQEA 1F0QA 4JJRA 4NW5A 4EKKA 2B1PA 3NUPA 4FIIA 4KKEA 3ANRA 2C3IB 5EOBA 3QX4A 1VQ1A 5D1JA 3GU4A 2UW0A 3E21A 2J0JA 4YTHA 2JDSA 5D41A 5A4QA 4HYUA 2BAQA 3BLQA 4LFIA 1NV9A 4H3QA 5JMSA 2E9PA 5M4UA 2Z7RA 5DWRA 4BCHA 3TZ7A 4QYGA 4GVAA 4F9CA 4ZSLA 4L3LA 4Q9ZA 4FL2A 1Q8ZA 4QTCA 2J6MA 4GV1A 4X3JA 3GLHE 5M4IA 2FA2A 4W4WA 4WRGA 2JKMA 1JKSA 1PXMA 5H3QA 3R7IA 4EOKA 4C2VA 3SG9A 2W4OA 2YDIA 4YZBA 3VBQA 4CFMA 2XVDA 4Q7JA 5DHJA 4IW0A 4DEHA 2XZSA 2V0DA 4FIJA 4BBFA 4MXOA 4DG0E 1WBPA 2GS6A 5C8KA 2IZRA 1Z57A 2OJIA 5CI6A 4G17A 4B8MA 1NXKA 3UO6A 5AUZA 4EONA 2EB3A 4R7IA 4EL9A 3I7CA 3EN4A 1B38A 3MPAA 3S00A 5HLWA 2YHVA 4D28A 5IKWA 3H3CA 5IA4A 3FWQA 4GT4A 4BCJA 3U9CA 4IAKA 4ZLOA 4ZY5A 1ZARA 4XEYA 5DMZA 5M09A 2WTCA 4F1TA 1WBVA 2W1DA 1W84A 4YJOA 3VW8A 2YIYA 1WVXA 2OOAA 2ZV2A 4ZTSA 4G6LA 4BDAA 2HELA 5EOLA 5CNNA 4IM2A 5JT2A 4MH7A 3H0ZA 4TYIA 4EH6A 4YZDA 2C5YA 3HECA 3TCPA 4FTLA 4GSBA 4O96A 4V0GA 4A9RA 4CFFA 4DEAA 5CXHA 4GG5A 5BVFA 3NNVA 2ZV9A 4QMZA 2QCSA 4FKTA 4LOPA 3DK6A 4MXZA 3R7OA 1IG1A 5I3OA 5A4LA 3FDNA 2ITVA 2JUJA 3F82A 4RBLA 4YHTA 3WZDA 3E5AA 4OTRA 3TJDA 4L52A 3A61A 2YISA 4JOAA 4AT3A 4O0TA 4EHGA 2QKRA 3KXXA 3HDNA 3S95A 4GEWA 5M06A 4U6RA 5AWMA 4QYYA 2GNGA 4LQMA 4YC6A 4U3ZA 4HCUA 1L8TA 3CGFA 3FSFA 1YWVA 4WG4A 4U41A 3FEGA 4KIOA 2PVRA 3A62A 3KCKA 5HG8A 3V5QA 3FHIA 5HESA 4UWYA 4QPMA 4BHZA 1FBNA 1Q97A 3NNUA 3IPHA 3BQRA 3N4UA 5IQBA 2OOBA 1XBBA 4F9BA 3Q4ZA 4TWOA 5J7HA 1BL6A 4ITIA 3Q4CA 2J90A 2EXEA 2RKUA 4U80A 4FVRA 2WELA 3GC8A 4BTKA 2O0UA 4A4XA 3VUKA 2JDTA 4RG0A 4JRVA 4O7YA 2VWZA 4KS7A 4X2GA 4ZZOA 2XIZA 3VBYA 2UUEA 2CGVA 2IVTA 4WRSA 4ASZA 4EH2A 4L01A 5CI7A 5HO6A 3QFVA 5K5NA 2XRUA 1XH8A 3EWHA 4FVQA 4EZ7A 3G51A 4HVDA 4NH1A 4DE4A 2HZ4A 2B52A 4QNYA 2UW4A 5EM5A 5IA5A 2F49A 3ZM4A 5JFXA 3W2CA 3GC9A 2E9OA 2Y8OA 5L2IA 4X3FC 1XBAA 3H30A 1PXOA 4NUSA 3R7GA 3KQ7A 3PJ3A 3GLGE 4IAAA 3A2CA 4OTFA 4U0IA 1QCFA 1P4FA 2J0MB 5CANA 3OT3A 2DAGA 2R7BA 3F5UA 3UVPA 3VUGA 3TM0A 1H1SA 2YIQA 4TW9A 5TO8A 2EXCX 4QP2A 4W8EA 4G3FA 3BE9A 3VUMA 4TL0A 5DR9A 3DKFA 5BNJA 1A5TA 4AOIA 4ANOA 4EOMA 4H3PA 4PPAA 3BU6A 2DHYA 4FT9A 4FMQA 4E26A 1QMZA 1E94E 1W83A 3L9LA 4G34A 4C3FA 2XJ2A 4GUEA 5FXRA 1I44A 4E6DA 1Z5MA 5DNRA 4XP3A 5L6OA 4EJ7A 4M69B 4IB3A 5M51A 4M84A 4RFYA 3WE8A 3VWAA 5I9VA 2MR9A 3IGOA 2H5XA 2YM6A 4XMOA 3N9XA 3FLSA 3VBTA 4E4XA 5E4HA 3PFQA 2HENA 2YERA 4XG3A 4EK8A 3F3TA 4EC8A 2OZOA 3DTWA 3IDPA 3LFDA 5HNIX 3BLRA 3QQUA 5HKMA 5DT0A 3MFUA 5IMXA 3F7WA 4X2FA 4AGCA 2WKMA 2Y6OA 4QP7A 4NJDA 3ZRMA 5DEWA 4PDYA 4I6HA 5CAQA 3PWDA 3L9PA 5KMKA 2R3RA 2J51A 3Q4TA 4E3CA 2UZBA 4PRJA 5AIKA 3PSBA 2VUWA 3RPYA 3E46A 2E9VA 1PMUA 4NT4A 4XG2A 4MNFA 2IVUA 5T6KA 1NA7A 4R7HA 3Q9ZA 4AACA 1ZRZA 1JVPP 1OIUA 2VTHA 1DAYA 5BVWA 3ZDIA 4DAWA 5JFSA 3KCFA 3W32A 5FBNC 3PRIA 4UBAA 3IW5A 4RIWA 5BMSA 1A06A 1H27A 1ZOHA 1OUKA 5A4CA 3A99A 3V5WA 5EW3A 2XIRA 5CU3A 3OBGA 1MRYA 4I24A 1XKKA 2W1HA 1JQHA 3DBFA 4KBCA 4PMTA 3RAKA 2QOHA 5HU3A 1WZYA 1HCKA 4DBXA 3H0YA 1H26A 2WTWA 3NYNA 3OHTA 3QGWA 4BCIA 4DTBA 3CJFA 3ZLSA 5ETCA 4W9XA 3V5JA 4X2KA 3WF5A 2A1AB 1Q3DA 4YC3A 1G41A 1YI6A 4V0GB 4D1SA 5CVFA 5AUVA 2BHHA 2HCKA 5AP1A 4FL3A 1YHSA 4BKZA 1ZAOA 3QRIA 4FR4A 3KF7A 1TQMA 2VO3A 4F6UA 3AGLA 3MA6A 2OO8X 4II5A 1R3CA 5M4CA 2CKOA 2QC6A 3MFSA 5AP5A 4BYIA 1OKVA 4EYJA 4DF3A 2QVSE 5EM8A 2X1NA 1OVEA 4X7QA 4R71A 3RTPA 3UZPA 3EQRA 3PE2A 2HY81 1L3RE 4KBKA 3CQWA 5EHOA 1J7IA 2X0GA 3PVWA 4ARKA 3D5WA 3U8WA 2IPXA 1Q62A 5AAGA 3MTFA 4PTCA 4GYGA 2C6DA 4RQKA 1DS5A 4MTAA 2GFSA 2JIVA 4QYEA 2VWBA 4EQCA 3M1SA 2WMWA 3TL8A 3FI3A 3FMLA 2PUNA 1YOMA 2BVAA 4LGDA 1SG9A 1CKJA 5AV0A 4FV4A 3BI6A 4HNFA 2BZHB 3RMFA 5F20A 2CNUA 5FM3A 4CMUA 4K8AA 4APPA 3CIKA 3NYOA 5CAOA 3N51A 3W16A 5IEVA 4QPAA 3LOKA 4MXYA 3TTIA 4OAVB 3F3UA 5DBXA 2OJJA 3EQIA 5CWZA 4F6WA 3GQIA 5IA1A 1UVRA 5L8LA 1OB3A 1LPUA 4B8LA 5JGBA 2XJ1A 4DEBA 4WNMA 2XKDA 3MESA 4D0WA 3WBLA 2XIYA 1Q61A 4XG7A 3HAMA 1PXPA 3G2FA 4RLLA 2O64A 3K5VA 1V1KA 3HVCA 4PDSA 4CGAA 4DINA 2W1EA 4GW8A 2X4ZA 5C27A 3ACKA 4YNOA 2BWBA 5TT7A 2R3QA 2RFDA 1UFZA 3FMNA 3GCQA 2YIXA 3ZH8A 3D2KA 4CYJA 3Q96A 4JI9A 2UW9A 2Q0BA 4I41A 3CPCA 2IVVA 4N6YA 5AR4A 4OGRA 2NRYA 4H1JA 3GC0A 4V01A 4CMOA 4PMSA 2KNZA 4S32A 4WNOA 5CT7A 3VBXA 4BCPA 2VTRA 5BUJA 3BX5A 3UZTA 2F4JA 4XG4A 3L8VA 3PXKA 3S4QA 4BKYA 3I79A 4QMMA 4AW5A 1PF8A 1PXLA 1R0PA 1WBWA 3GNIB 3IW7A 5ANEA 3EQCA 4ZK5A 5L2TA 2YA9A 2GFCA 1IEPA 5TF9A 5DE2A 4HW7A 5CVHA 2I7QA 1PW2A 3QZFA 2JAMA 4IWDA 5J87A 1Y8GA 5EI6A 2BDWA 2PZ5A 4XP0A 5J5SA 4PTEA 3GU8A 4FV1A 4HYSA 4IACA 1OKYA 3IW6A 4D2TA 4DGGA 4EK3A 2PU8A 2ITUA 1M7NA 3FMDA 4XBRA 5J7BA 1KUTA 4BIDA 2I0VA 5IH4A 4ACMA 2UVZA 2IVSA 3SW4A 3BIZA 2B55A 2C6IA 3FE3A 1J7UA 4FV7A 5HVYA 4DFUA 3PP0A 4JDHA 3THBA 2VWWA 2B3TA 3QQJA 1M7QA 4Z55A 4EBWA 1Q3WA 4EOLA 3BHVA 2W5AA 5FBOA 3UQGA 4E4MA 4FKWA 3KN6A 4XG8A 4NL0A 4KAOA 1PMVA 3HMNA 5ANDA 3R8ZA 3SRVA 5FTGA 5IPJA 3MH2A 1T43A 1O6YA 5CSPA 2XCHA 4XV9A 3TZ9A 3MVLA 2ETMA 1ZMWA 2LAVA 1V0PA 3FKLA 3LCTA 5GJDA 5AX3A 3C5UA 4I93A 4CTBA 3LKMA 3FLYA 4BF2A 4CV8A 1BLXA 3DGKA 2HK5A 2YAAA 2WTDA 3ZCLA 4BGHA 1EH4A 4DYMA 1WMKA 2I0YA 3VQHA 4C3PA 3Q9WA 3B8RA 2WD1A 3KRWA 4PDOA 3M42A 3ETAA 4HZRA 3ZTXA 2DZLA 2C5VA 3NSZA 1GZ8A 3POOA 5TOZA 3RPOA 2Z7QA 4F2LA 1MQ4A 3H9RA 3U4WA 4IANA 3O51A 3R71A 4CZYB 4XLVA 3I81A 3NYXA 4RIWB 4KRCA 3PVBA 5AUWA 2KHHA 4BDCA 2R3OA 2QONA 3PUPA 4UMQA 4AF3A 3RHKA 3QQLA 5HO7A 4HOKA 4JBOA 3RPRA 4IDTA 1LP4A 4RRVA 5M53A 2ZOQA 3QQKA 4NM3A 5AA9A 2O5KA 5GJGA 1G8AA 2ZV8A 2J7TA 1XO2B 4OT6A 3T8OA 2QO7A 4ZSAA 5I5ZA 5K9IA 4QQTA 4A9TA 5EQEA 1G8SA 3KK8A 4AA5A 1IR3A 3PE1A 2F7ZE 4TRLA 2GTNA 5EYMA 1A48A 4L9IA 1KWPA 1XB2B 4FICA 2OBJA 3Q52A 4N70A 2PVKA 2QOCA 5LVMA 5A4EA 5FXQA 3ORPA 4IAYA 5CVGA 1Z9XA 4WUNA 4AFJA 5DA3A 4BRXA 5B7VA 4JG8A 4ERKA 1VZOA 3LCKA 5E92A 4IQ6A 5KMOA 1VJYA 3AOXA 4FNYA 3O50A 4NM0A 4GKIA 4FSYA 1YW2A 3UZRA 2FYSA 4TN6A 2W5BA 4MXCA 3DXNA 3MVJA 4L00A 3V3VA 2RFEA 4JDIA 5LVOA 1ZYJA 2XNMA 3QD4A 1SVHA 2X8DA 3BV3A 3E64A 4YZNA 4ZJIA 2W99B 3MMPA 4IZYA 5AV1A 2YJRA 4RA5A 2JY5A 5E1EA 1PYEA 3NS9A 1BI8A 3R8UA 3TV6A 4QMNA 5BYLA 3G33A 2QSFX 3UQFA 3R02A 1CUKA 2RFNA 2OF2A 3CD8A 4CQGA 3KK9A 2QQ7A 3KXMA 4I5MA 5TR6A 4D2WA 1YXVA 4YJPA 5IISA 1V0BA 5AX9A 4QP6A 3UG1A 5BVOA 2PZIA 3UC4A 4IADA 2WTKC 3DJ6A 3AT3A 4KBAA 4C4FA 4KS8A 3LCVB 4MWIA 4CNHA 4F0IA 4J7BA 4TPTA 3SG8A 2JBOA 4I4EA 2YM5A 4AZVA 2JLDA 1M2QA 4ZXTA 3KXGA 3MPTA 3VF9A 5KZ0A 4EHZA 5E8WA 5JGAA 4CVAA 3DK7A 4PTGA 2WMUA 4B9DA 2KNVA 4FSWA 3VS5A 2CGWA 3EN9A 5LVPA 4M0ZA 4MX9A 1PY5A 3DTCA 5IG1A 3AXWA 2C5NA 2VTPA 1OL1A 4M97A 5CY3A 5K0KA 3CR0A 2WTVA 4FTTA 4O2PA 4FT0A 3BEGA 5E1SA 3RZFA 5FD2A 3QXPA 3W8LA 3NCZA 3LFSA 2JGZA 4F99A 3C50A 1F5QA 4EWQA 4FTMA 3TIZA 5ETIA 4FVPA 4MD8E 1Q41A 3N4VA 3KRJA 3COMA 3BV2A 3E3BX 3PXZA 1YWRA 2UZDA 3BYVA 5D12A 4R3PA 3R8LA 2Y6MA 4O0XA 4WT6A 1O6LA 3BLHA 3IDBA 4DH7A 5GINE 4M12A 5HU9A 3SLSA 2OI4X 3W2PA 2Z60A 2UV2A 4IAIA 2NP8A 2ZYBA 3QWKA 5IZFA 4NFNA 5I0BA 4XCUA 5C4KA 4AE9A 4ZSEA 5HE0A 4YJUA 1YWNA 3DZQA 3DZOA 3PIXA 4YP8A 2I0HA 3Q2JA 4EH8A 5JK3A 3UNZA 4I0RA 4CRLA 4FT3A 2C6LA 3V5LA 5CF6A 5KX8A 4G3OA 2WMBA 3QC9A 2PMNX 3FSKA 3DAKA 2RL5A 5L8KA 5HE1A 3P79A 3W10A 1REJA 4USEA 2L4FA 4FKUA 3LXNA 3QKLA 2BRNA 3CQEA 3TXOA 5LVNA 1OZ1A 1VR2A 2XEYA 4FTJA 2OWBA 2OIDA 3R9NA 4E5BA 2XK7A 4FEXA 4O7LA 4DEDA 5C4LA 2WMTA 2X4FA 3DKOA 3JYAA 5CS6A 1IM2A 4IHPA 5I3RA 4L42A 4O38A 2HWPA 2B9IA 4DGLC 3F3ZA 2OH4A 4QO9A 3KMUA 2UZLA 2OXDA 3F69A 3C4CA 3D83A 4IVAA 4BCFA 2ZAZA 2E9UA 4FKQA 3GVUA 4IX4A 3BHUA 4O81A 1JKTA 3UIBA 4AZFA
chains in the Genus database with same CATH superfamily
4XOZA 3R22A 5LOHA 2N35A 2C6KA 3A7FA 4Y72A 3VK7A 3K5UA 4YLJA 5K3YA 3W8LA 3CY3A 1FVVA 3KU2A 1RJBA 4JDJA 3GCUA 3PXGA 4ZJJA 1OMWA 1H24A 1V34A 2VTIA 4O2ZA 2BKKA 1GY3A 4Y95A 4DFYA 3LMHA 2REIA 4F9AA 4EC9A 2YLFA 3MDYA 3MI9A 4ALVA 4FIFA 3BLAA 2KEBA 4OLIA 4AN2A 3KVWA 1TF0B 1OIYA 3MBLA 2XEPA 2NO3A 4FT7A 2B7AA 3HZJA 2DYLA 4WIHA 4YBKA 2RGHA 1TR8A 3FKOA 3W1FA 3IK3A 4C59A 2J0IA 1UV5A 4FV3A 5DH3A 3RCJA 3DXQA 3CS9A 4UYAA 4ZTNA 3O96A 4YHFA 1NY6A 5C9CA 4F0FA 4HCVA 3CF2A 4D58A 3UOKA 2WB8A 3VF8A 4DR3M 2C30A 2R64A 4KHPM 2DUVA 3QKKA 4IVDA 1RDQE 2DS1A 3CKXA 3F5XA 4OTPA 3TQSA 4RX8A 4QDVA 3DPKA 4L3PA 1W8CA 2HXQA 4F7NA 3J80S 3NRMA 5KBQA 3FC2A 2PZRA 5IH5A 5JQ8A 1QPCA 3QLFA 3VNTA 4YR8A 4I6BA 4K0YA 4OTHA 3F92A 5ACBC 5CQUA 1NVSA 4XK8F 1HT1E 4IMYA 4AN3A 2DI0A 1IBLM 1QZEA 2XK9A 4IJ9A 4DBGB 2QHNA 3QUEA 4R5YA 1NVQA 4F9WA 4RJ7A 4ASDA 3J81S 1PMEA 2YCSA 3G9LX 2ETRA 3KMMA 2QODA 3KY2A 3OOGA 5FRIA 4AGDA 3AC8A 3QRUA 3GPXA 2GNLA 4YUQA 3R00A 5DIAA 4G16A 3IG8A 5ITYA 1YXXA 1IN5A 1WFCA 2ACXA 2C69A 4W5WA 3B2TA 3QGYA 4LUEA 4ANQA 3VS3A 3C0HA 2YCFA 3CPBA 3U6OA 2UUCM 1YOJA 3U51A 5ITAA 4JI2M 1XXHA 4MGZE 3IG5A 4PNKA 1W5TA 2PVYA 4M9XA 3QYEA 4YPSA 2GNJA 3AT4A 1FMOE 4G3GA 5EM7A 3ELJA 3DKCA 5AUTA 5L3AA 4ZEGA 4FE2A 4MKCA 3Q9XA 4GKKM 2Z2WA 3OS3A 1J3HA 4L7SA 2PVLA 4XHKB 5EH0A 3MYGA 2XMYA 4RC3A 3DK3A 1XJDA 3ZUUA 2YWPA 2BIKB 3ITZA 2GSFA 3ORKA 4S30A 1PHKA 1NVRA 1YVJA 2G9XA 3TKHA 4EOIA 4BTMA 5DYJA 3H4JA 3QZHA 3C4FA 4IH8A 2WZJA 4KKGA 3FKNA 1KYIA 1DV0A 4NU1A 5B2LA 4FV6A 3PNVA 5EFQA 2LWXA 1Y8YA 3R30A 1N75A 3Q9YA 5CU4A 2F7XE 3MJ1A 4OTGA 3DFZA 3CC6A 3W0PA 2JDVA 3EL7A 2BUJA 2RFSA 1HCLA 2UZNA 4LOQA 5E8TA 4BZNA 3FLZA 1ST4A 3CLYA 3QTUA 5H8BA 4ZIMA 5EDQA 1H0VA 3RWPA 1Q02A 1H8FA 4FI1A 4FOCA 5K4JA 3BYOA 2VO7A 3HMMA 5AMNA 4QP4A 4LV8A 2QURA 3QQFA 4S2ZA 4CISA 1TVOA 4UMPA 2Y4IC 1YLAA 3KFAA 5DG5A 3AL0C 3VS7A 3AC1A 4MD9E 5FG8A 1OKSA 4F7JA 3MB7A 5GZ8A 4K6ZA 3RINA 1OAIA 2AC3A 4LG4A 3OUNB 4H39A 2LVPC 2YIWA 4LMUA 5FDPA 4JI5M 3MH3A 5I4NA 3FLWA 1VDLA 4FTKA 5HTIA 3PFYA 2OPFA 2A19B 3GGFA 2V7AA 3L26A 3BPRA 3EN6A 3T9TA 4FKVA 4XG6A 1IA9A 4A9UA 4CYIA 1ND4A 2VU3A 4U45A 4PNIA 1G71A 3MS9A 1WR1B 4UMUA 4DDIA 1TH3A 3MHVC 4C61A 2PUUA 4ZTMA 5E8XA 1Y6AA 4MF1A 2IWIA 3LMGA 3PSCA 4O7RA 5BYZA 4ZSJA 4GCJA 3HP2A 1H07A 3GRYA 4CIZA 3W18A 4BGGA 2YZLA 1OKZA 4DHZA 5JFWA 2R3HA 3AQVA 1N33M 4Z6YA 3W55A 4ERWA 2WQBA 5E8ZA 4Z7GA 4LGHA 2UZVA 4JT3A 4O6EA 1ERKA 3R7UA 4A4LA 3RPVA 4FYOA 4QOXA 4X2NA 4EOOA 5L2WA 2O65A 4U9AA 4EEVA 3QHRA 4RX7A 1Q8YA 3GLGA 2FGIA 3TT0A 3NIEA 1XH5A 4O1PA 2OQ4A 4AAAA 2P2HA 3NUUA 3H9OA 4WG3A 3TEIA 2JBPA 5A4TA 4ENXA 3QAME 4PPBA 2WTIA 4JIKA 3HGIA 2VTJA 3H9FA 3TNQB 3WYYA 2XA4A 3T38A 3IGGA 2WPAA 3KRRA 4K77A 4FNXA 4ALUA 4HJOA 3OXTA 3CTQA 1QAQA 2WMRA 5JZNA 1YXUA 4EH7A 4DDGA 4BCMA 4TYHB 2O01F 5CAUA 3LFNA 5KQ8A 2OG8A 3UTOA 1OPKA 2BCJA 3HJSA 3IOPA 5EXXA 1S9IA 3PPKA 2FSTX 1BI7A 3GT8A 3LCOA 3KGAA 2H9VA 4LF5M 3GEQA 4KIKA 3RBWA 4G4OA 2XZUA 2I40A 5EI2A 3RNIA 4D2RA 2VZ6A 4Y8DA 4BJJA 3U4UA 4ITQA 1BYGA 4WSQA 2WQEA 5DYIA 4L45A 4GK3A 3BRBA 4NIFA 5H8GA 3LXKA 2J5FA 3P7CA 5DRDA 2YFXA 4KLNA 3IQ7A 5KBRA 1OL2A 3G90X 4FSRA 2F5OA 5GIPE 1OIRA 4L7FA 3E7VA 3WIKA 2UXBM 3QU0A 4I5PA 3QA0A 4PP7A 4YC8A 4IDVA 4KUJA 3JS2A 2J0LA 5HLNA 4LJAA 1HR0M 5IQGA 3JR4A 4DG3E 4JX3A 4HEOA 4MNEB 3T1HM 3FY2A 2CWBA 3HA8A 2JC6A 3PG3A 4ACHA 3NMUF 5K5XA 4LFBM 5ACKA 4ANNA 4EH3A 4F7LA 4YPDA 4F7SA 4FV9A 1KSWA 2XM9A 3OMVA 4O86A 4O7SA 2SRCA 1W98A 2VAGA 3AMYA 3HHWA 5DVRA 2UZEA 3FY0A 2QO2A 3OROA 4G5JA 2VNYA 2GS7A 2V1UA 1QPJA 3ERKA 3EN5A 4EI4A 2WFYA 1U59A 2CNVA 3MH0A 4P5QA 4FT5A 1B6CB 4GKHA 3JVRA 5KPZA 3VK8A 3CD3A 3GQ4A 4G9RA 1FGKA 3C0IA 3HP5A 2BMCA 3BGQA 3QRKA 4AP7A 2IZUA 2Y7JA 5EW8A 3KRLA 5HTBA 3CKWA 4BFMA 4XS2A 5CEKA 2PE2A 4YLLA 2JFLA 4L6QA 1W7HA 3ZLXA 4XLIA 4FKIA 4DTKA 2ZTDA 1NJFA 3RALA 3WZJA 4B7GA 2OJFE 1U54B 3C4EA 2VTOA 5EKNA 4HGLA 1YSYA 4QTDA 4YTFA 4YO6A 3RI1A 4CFNA 2X2KA 3CTHA 5LWMA 3E92A 3WHLA 4LV5A 2YNMD 3RHXA 4IBCA 3QL8A 4RIYB 4CGYB 2V5QA 4AX8A 4C2WA 4QQ5A 3KRXA 4DITA 3C4ZA 2PUPA 4AAYA 2HYYA 4PWNA 5KHWA 4LGYA 4Y73A 4RWKA 3R63A 5DOSA 5CALA 4EQMA 5E7RA 4RWLA 3LQQA 2OLCA 5CENA 2Q83A 3TZMA 4X21A 1OFIA 4GL9A 1QVRA 4IX3A 4J52A 2KRUA 3ZLWA 5L4QA 3R01A 2NQ8C 3UK6A 2BWEA 4L68A 1VEBA 3LE6A 2GU8A 3DBCA 5EXPA 2WGJA 4RJ4A 4UZDA 4XNEA 4I23A 4NL4H 5KMMA 1GL7A 1FVRA 3TN8A 3FUUA 1KV1A 4CKRA 3HX3A 1JPAA 2XNEA 3V51A 1X37A 4PP9A 3LQ5A 4D1ZA 2ITYA 4GH9A 3LFEA 4JL9A 4NCTC 4DUYM 5B0XA 4AT4A 4LMNA 3VQUA 2C5OA 2GPHA 2H1RA 1VYWA 2Z4SA 1MRUA 2IN6A 4FNZA 4IFCA 1OPLA 3UGJA 5FEDA 4AU8A 4LRKA 4RJ8A 3ZQJA 2X7OA 2VO6A 4FSMA 3NNXA 2UXCM 1H00A 1U4DA 1OL7A 2YN8A 3A7JA 2VTTA 3D7TB 1DO2A 3E87A 1ZYDA 1ATPE 2A0CX 2C68A 2JIUA 1IY2A 1NHWC 3P86A 5M57A 4O84A 2W1ZA 3A8XA 1HQCA 1GOLA 3IO7A 3PJ8A 4D4RA 3MFTA 3PZHA 4BL1A 5BVEA 1SXJB 2C9OA 3ODZX 4ZTHA 5IQFA 1HJPA 2W5HA 3BHTA 3IS5A 2IW9A 4I21A 4I94A 3SXSA 3UDSA 4RVTA 5J8IA 2A4LA 4R3DA 3A60A 1YOLA 3EKNA 4RGJA 4AKGA 3R28A 4UYNA 4D9TA 5T3QA 3QYZA 3NEWA 3QWLA 3ZMMA 4ZLZA 5A46A 4DGOA 3VRYA 3WZUA 3TJCA 5IQEA 3ULIA 1HT2E 1HNZM 3CQUA 3I0OA 1JSUA 4X6QC 3ZEWA 4PX6A 2ITWA 4BYJA 3G9NA 5FEEA 4D55A 3FAAA 4S33A 4C3RA 5ANGA 3ATSA 2R45A 3PA3A 4BDFA 3F2RA 3PY1A 2EUFB 4LJ4A 2PE1A 2QOBA 3OWPA 2Y4PA 2ITXA 4KSQA 2JAVA 4J8MA 4LUDA 4QQCA 3I6WA 5CLPA 4QMQA 2CNQA 4EH9A 2FSOX 3HRCA 5EYKA 4XP2A 4F65A 4X3FA 3I60A 2CHQA 4KIKB 4U3YA 3UVQA 5HORA 3W0MA 2Y0AA 3II5A 3FTDA 2X8EA 1XMQM 3HMPA 2XALA 5J9ZA 5ANJA 2H8HA 4D4VA 2QQ8A 4FEWA 3HV6A 4QQJA 2WEIA 3ZRLA 4I6QA 4AGUA 3RAIA 2LVNC 2PVFA 2CMWA 3C4XA 1SMHA 3OC1A 2XK6A 5C8NA 1YXTA 5AIRA 2QOKA 4GC9A 4DFZE 3FJQE 4WW0A 4GU6A 3HX4A 4QRCA 2Z4RA 5EP3A 3GLGB 5F3WA 3JPVA 3MGYA 2YLEA 4O0UA 4D2SA 4UX9A 5EQPA 3E9SA 4AOJA 4PQNA 1ZMUA 3SXFA 3TV4A 4FG7A 4MQ2A 3VAPA 3ZC6A 4EKLA 3A7GA 3POZA 1ZYLA 5JQ5A 4X66M 4D9UA 2LVOC 3FHRA 4R3CA 4YZMA 4GIHA 2X8IA 4YHJA 3DNDA 4L53A 3DAJA 3FLQA 3MFRA 4XOYA 4F0GA 2A98A 4FSZA 4NYEA 2Y0TA 1KOAA 2CKPA 5EM6A 2JXNA 3GRRA 3E8NA 3F7ZA 3O7LB 3R1NA 5E91A 4D0XA 4I5CA 5CEMA 2WQMA 4EOPA 4EUUA 3F66A 5CSVA 4FTOA 2LVAA 5KUPA 2V1CA 1JAMA 1MP8A 2D7GA 2JKKA 3FXZA 3UO4A 3V01A 2OFVA 2VWIA 4PDPA 1EE8A 3ZO3A 3CSVA 4JLCA 4C57A 5E6JA 1PRBA 4BBEA 3NUXA 3ZUVA 4F64A 3S0OA 4RFZA 5IQAA 2OFUA 1V92A 3VC4A 3AKZA 1TQPA 2R3JA 3QYWA 5AP7A 1PXKA 2KZUA 4XBOA 2ZM3A 3EQPA 3NW6A 3VRZA 1OGYA 3VS2A 3LMMA 1VEKA 3OCSA 3HUCA 4A4OA 4R7BA 1JKLA 5C8MA 3AD4A 4AW2A 5J5TA 5C01A 4U43A 3A7HA 4CFUA 4KT0F 3C7QA 4YJVA 4RZWA 4FKGA 4PMPA 2JKQA 4G4RA 3UBDA 5HD4A 1KE9A 2JY6B 4RF0A 1T46A 1TH2A 4NTSA 5D7AA 3VN9A 3MY0A 2ITQA 5EQTA 3NZ0A 3LHJA 4FEQA 4K1BA 3F9NA 1NO1A 2XSZD 3NPCA 2JEDA 4FKJA 5DLSA 5EHYA 2WEVA 3SOAA 5HHWA 2BTSA 4JS8A 4O0SA 4ZS4A 3QAUA 2W0JA 1YI4A 4UXLA 4LJ6A 4LZJA 3NWWA 2C6EA 4PD2A 4PV0A 5HGIA 3R7YA 2VWUA 2OIQA 1RU3A 4NTTA 3P0MA 4DFLA 4F09A 3AKLA 2GS2A 2H34A 1JR3E 2QHOB 2ZMCA 4OX9M 4KNBA 4RWIA 2W4JA 4JX7A 5DT4A 3RPSA 5CF4A 2P5TA 4ZPXA 2R0UA 3SHEA 1CKPA 4ZOGA 3P08A 5BV3A 2ESMA 2F7EE 4BCGA 3MJ5A 2IW6A 4CZTA 4UMRA 3DFAA 3ZYAA 3AG9A 3QCSA 5AUYA 2MH8A 3GLHA 1CSNA 2V55A 2JIIA 4IEBA 4J53A 7CATA 2JDRA 1WAKA 4LRMA 3FYJX 5G1XA 5BVKA 3Q3BA 4JR3A 1OPJA 3RNYA 4CCUA 4G3DA 4FD2A 4BCNA 4R78A 2FO0A 4FEUA 3OZ6A 1GIHA 3BU5A 2WXVA 3FI2A 3HYHA 5H2UA 5E8VA 3UPXA 1NV8A 4O7VA 4HVIA 4DT9A 3VS6A 4AXFA 4JAIA 3K3JA 5FTOA 4TXCA 5HCZA 4D5HA 2DWZB 2YCQA 3RM7A 2CHLA 4XG9A 3JR1A 4Y5QA 4CT2A 1ZOEA 2JP7A 2PVJA 2G2IA 4FTUA 1JR3A 4S12A 2OJGA 3HEGA 5KQDA 2YJSA 3NLBA 5EHLA 4E73A 3PIYA 4K9YA 3TKUA 1KOBA 2W9ZB 2EXMA 4WP2A 4UV0A 5CF8A 4E8AA 5BUIA 2WHBA 3OW3A 4X0MA 3Q53A 5F4NA 4F70A 4DR2M 4EBVA 3S1HA 2RG6A 3ZSHA 4EH4A 2J4ZA 2YM4A 3E93A 1UU8A 4IX5A 2X4AA 3ZZEA 3ENHA 1NY5A 2XP2A 4FWGA 5T68A 1JBPE 3EN7A 4P90A 5JGDA 3KS8A 4Y85A 3UP2A 2HKJA 5E8UA 3KSXA 3VJOA 4XGIA 2QBYB 1BUHA 3CY2A 3EFLA 4BDHA 4P4CA 3MW1A 3LQ8A 1WCCA 1NVMA 5E90A 4C0TA 3PLAE 5L2SA 2NNWB 3KREA 5AADA 5M4FA 2DWMA 4JN6A 1PMNA 3MH1A 2YZAA 2O8YA 3F2AA 3RAWA 4QP1A 4DGMA 4ZTRA 4DR6M 3E8CA 4CG9A 4J98A 3GU5A 1YKRA 1UWHA 4U40A 5C03A 2R0IA 1CTPE 3V5TA 3DA1A 4GS6A 1NW1A 4XV1A 4DHIB 3ACJA 4Z16A 5BYYA 5AUXA 3CXWA 4O83A 3FUWA 1PXJA 1PJKA 1UNLA 5FWKK 2JNHA 1H28A 2BRHA 3CJGA 3D5XA 3IECA 4ZMFA 4GITA 4XV2A 3SQQA 2JDOA 3K3IA 4U79A 4BWKA 1XXHE 4R8QA 4R3RA 1PRYA 1Q4LA 1QUTA 3GLFA 1IA8A 3D94A 3V5PA 2AEGA 3BBTB 4C38A 4FIHA 3A42A 3HDMA 3CTJA 1JQJC 5CZIA 4DEGA 3FRHA 4GMYA 2G5GX 2AQXA 2HZNA 2VF8A 2VRXA 4FX3A 3F6XA 3PXYA 5HNGA 4M9SA 3PPZA 2QG7A 5ANIA 4AUAA 2PULA 1XNQM 3E8DA 5DI1A 2YDKA 2L4EA 1A9UA 3ORNA 1MRVA 3PVUA 4NKSA 3VJNA 4EQUA 3U87A 5AEPA 2VQFM 5HX6A 3HZTA 3ZOSA 3WOWA 2XANA 4LOOA 4O91A 5BMMA 5BVNA 2VX3A 5LQFA 1CM8A 1STCE 2PVHA 2J50A 2QOLA 4PY1A 3C9PA 1M2RA 4NEUA 4NM7A 4C4HA 2C0IA 2UVXA 3EFKA 4IM0A 4WUAA 4NXMM 4NRVA 4HGEA 3NYVA 5AUUA 2R44A 4JDKA 5J1WA 2X9FA 3DDQA 2J7NA 3DV3A 3OTUA 3VHEA 2WTKB 5IUGA 1R0EA 1UM8A 2Y9QA 1OBDA 4FOBA 1URWA 3FKEA 4C37A 4IBDA 3QUPA 4IAZA 4CSVA 4DV7M 2XBJA 2Y21A 3CE3A 3OEFX 4FTCA 3C5IA 3LCSA 3D8LA 4IE9A 2QZ4A 1L1ZA 2VNWA 3ZUTA 4HPUE 4M67A 4APCA 4CD0A 2XK8A 5C1QB 3EHAA 3QC4A 4M9ZA 4LL5A 1GAGA 3COIA 4L44A 1GJSA 4R6VA 1AQ1A 4OBPA 4QNRA 2BDFA 2H6DA 3UMWA 2HIWA 4I1ZA 4AW1A 4DHFA 5A6OA 3QRJA 3U60A 3FZRA 2BKZA 3FYCA 1DGFA 3KC3A 3OF0A 4GFGA 2UZOA 1VEJA 1JSVA 3HV4A 4BN1A 2CGXA 4K18A 5HBEA 2WU7A 1HOWA 3NUYA 3W8QA 4BWPA 4MB7A 1J91A 2F2UA 4KINA 5KO1A 2I0EA 3QCXA 3WZEA 3TV7A 3NR9A 2FH9A 3GOKA 3OXZA 5JI3E 4FTIA 5AV2A 3G0FA 3L27A 3TTJA 4I6FA 3VS1A 4PUZA 3ML1A 2CPKE 4ASEA 3ZU7A 5M56A 4MXAA 2EKKA 4BI2A 4NXNM 1CMKE 3Q5IA 2XF0A 4E5AX 4AXDA 2W1FA 3LW0A 3T3UA 3UVRA 1K3XA 3L9NA 2X81A 2G8LA 4F1IA 1G59A 1QPEA 1GVNA 2XIXA 5CTPA 3R9DA 4ANSA 5HZNA 4ACGA 3OG7A 2PWLA 5L8JA 2YEXA 1OL5A 3OXIA 2HL7A 4JAJA 3S2PA 4I4FA 1QDTA 4LF9M 2HXLA 1P3QQ 2UW7A 5EI8A 5ETFA 1NNUC 5FTMA 4X64M 2C0TA 3QXOA 4A06A 3F5PA 3NDMA 4JNWA 4PF4A 5DEYA 5CNOA 5HVJA 3VULA 4J1RA 3W2SA 2C3LA 1G8PA 3TMOA 4CMTA 3RP9A 3W68A 2V22A 5AR3A 4W8DA 3LCUA 1IBKM 3U6MA 1GZNA 2F4VM 2ZB0A 4CCBA 5HICA 4RSSA 5I9UA 1IN7A 1BVSA 3DU8A 4HCTA 1OQYA 5DNYA 4NWMA 3HU2A 4OT5A 3ZSGA 2XNPA 4YBJA 4O21A 4BTJA 4QPSA 5LWNA 4LGMA 4EK4A 2OIBA 3U61A 2CHVA 3U5ZA 2QKWB 5AV4A 1T45A 1IN4A 2C99A 3IONA 3KL8A 3OWJA 4BBMA 2R2PA 4FUXA 4YLKA 5LMUM 1FGIA 4JBVA 5FP6A 3THGA 2VTSA 4ITJA 2IG7A 4MCVA 3QX2A 3ZXTA 2HZIA 4FODA 3BL9A 1OKWA 4BDDA 5IA3A 4MUQA 4FCTA 4JG6A 5IEXA 1VEGA 4BBAA 3EQGA 2IO6A 4FKLA 2BIYA 1R1WA 4Y46A 2CN5A 1HQYE 5FM2A 4BKJA 4NCTA 4EORA 2JY8A 1K82A 2NYAA 5E9EA 4G1WA 4ZP5A 2KA6B 2WO6A 4JI8M 3PXRA 4FG8A 1DI9A 4LGGA 4RIXB 2R7IA 2W17A 2YQZA 4RX9A 4FK3A 3DBDA 3VW6A 4D2PA 1PJJA 1U5QA 3Q6UA 3L2AA 4AOTA 1YRPA 4G2FA 2VTAA 4RPVA 2W96B 1C1KA 2XGNA 5KMIA 4W4XA 3Q6WA 3GP1A 2XH5A 4AA4A 4WA9A 2FUMA 4FWHA 5D11A 3OY3A 2Z3XA 3HLLA 4FL1A 3PIZA 5HIBA 4REZA 5CSWA 2XK3A 1GLNA 5L6PA 4DFBA 2F57A 2IJMA 3ORTA 1XH9A 1FMKA 5AV3A 1Z5CA 4O7WA 5EP4A 2EUCA 1H1WA 1XH4A 1Y57A 2XFSA 3D15A 4JXJA 2EVAA 4OBOA 1P14A 4O22A 3I4VA 4HGTA 1XWSA 2NPQA 2XYNA 4ANRA 1NY3A 4JI1M 4GT3A 4YSJA 1F3MC 4IM3A 3NAYA 4CXAA 3I5ZA 4FZ7A 4OR5A 5FEQA 3R1QA 5E8SA 4FZFB 1WIVA 5JI2E 5HLPA 4HVHA 3M7GA 2VF7A 2PHKA 5HCYA 3FLNC 4GH2A 3TWJA 4X3FB 2GDOA 3R6XA 3UO5A 3DQWA 3PDTA 1Q3CA 1OJLA 4PDIA 1YDSE 4GT5A 4TYEA 5AP0A 2Z02A 1H08A 2P0CA 3D9VA 3T6PA 3FTEA 1GZKA 4FZ6A 4AZWA 3DBEA 3R8PA 3SRVB 2JY7A 1IN6A 4X62M 3RK7A 4ZTQA 1P5EA 3I0QA 5CEPA 1OL6A 4ZS0A 3K54A 4BZDA 4GVJA 1S9JA 3MN3A 5FSWA 3D14A 1XMMA 3PA4A 4MGIE 3GFEA 3I01M 1PGYA 1GNGA 5ITUA 2PSQA 2QHMA 4IB1A 4IZAA 4TWPA 2E5LM 5DRBA 4QNMA 3ATTA 3RKBA 3TE6A 3UMMA 1JLUE 1ZY5A 4HZSA 1OIZA 1E1XA 2BROA 4O0VA 5AM6A 2VGPA 3GU6A 3SATA 2FSMX 3D2IA 4DEIA 4BB9A 3TL4X 1APME 1UNHA 2XNGA 3QLGA 3VUTA 4E4LA 3FUTA 4HVGA 2UZTA 2GMXA 3R7VA 3MTLA 4K11A 5DFPA 2KTYA 3WYXA 3GFWA 4L8MA 1ST0A 3ULZA 2QNJA 2W1GA 3DQXA 3UC3A 5CSHA 4G9CA 4G6OA 4KWPA 3FZOA 1GIJA 4IWOA 1CDKA 2X6EA 4ANBA 1XHBA 3RGPA 2W06A 4LFAM 5JZJA 4IBBA 3SV0A 3LFQA 4XYFA 1MN3A 2ONLA 5BVDA 3DCVA 5AP4A 2PTKA 4JQ7A 2R5TA 3COHA 5ANKA 4ZSGA 4Z7HA 5IQCA 5F95A 3O23A 1BL7A 2QENA 2ZM4A 4O0RA 3K2LA 4AQCA 4OTWA 4TY1A 4BDJA 4IWQA 3O8TA 4JI7M 4IVCA 1MX0A 4R5SA 2CCHA 4RJ3A 2AYPA 4A9YA 5JEBA 4BR3A 3ID6C 4B0GA 3E4RA 5FUTA 2ZM6M 1FOTA 3FL5A 3ZO4A 2VD5A 4LM5A 5E8YA 3DY7A 3I4BA 3LIJA 3QQGA 4FKOA 5D10A 5J95A 4EYMA 2MGWA 3FPMA 4IVBA 5AR2A 3EQBA 2P55A 1LV7A 1OIPA 3FI4A 3HV3A 4FBXA 4FSQA 3ROCA 3V8TA 5IQDA 4Q2AA 4TKSA 4WKQA 5A3XA 1H25A 4AWIA 4IIRA 3HMOA 3EJ1A 4ENYA 2APLA 4ZTLA 4DR4M 1R39A 4ONAA 2WMQA 4JR7A 5KKRC 1UKHA 4LF7M 2UW8A 1HNWM 3Q4UA 2G15A 4TTHB 3AGMA 3ZRKA 4GU9A 5CAVA 4QP8A 4NM5A 3DB8A 2B4SB 2DNAA 3AMBA 3BE2A 3U6EA 3FRIA 2VTMA 2XM8A 3HRBA 3KXZA 2DXIA 3NCGA 4YSMA 5EQYA 1K3AA 4O7ZA 2OZAA 3R9HA 5AP2A 4QNAA 3IW4A 4PMMA 3KEXA 3TWLA 3C9WA 1TTEA 3SARA 3JXWA 3LVPA 3NVMB 4NZWB 4MVFA 3SOCA 3O2MA 4CTCA 4FGRA 4DH8A 2X39A 2P4IA 2KULA 4KSPA 3RK5A