1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity regulating kinase 2
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
4ZXTA 3NCGA 2DUVA 2PVYA 2BZJA 4D9UA 4X6QC 4EH6A 3SXRA 4GH2A 5F95A 5C27A 3U55A 2XK9A 3MDYA 5T6KA 4AZVA 3F5UA 4V0GB 1M7NA 4P4CA 2W1DA 4I92A 2OXXA 3H4JA 2ZYBA 4QMPA 3EQRA 3LQ5A 4KS7A 5HIDA 4RIYA 4QQ5A 4RX5A 2IPXA 2UV2A 3RK7A 4R1YA 5AV4A 4I23A 2PULA 5FWKK 3EB0A 3E7OA 2WEIA 3L1SA 1W84A 4CMTA 1OKSA 2HZNA 1FOTA 1RDQE 3RNIA 4FZFB 5GIOE 1UKIA 4YBKA 2OBJA 4OR5A 5GJDA 4XNEA 3EKKA 1GO5A 3F2AA 3FDNA 3DV3A 3WF8A 1I44A 1YXTA 2SRCA 5A3XA 3GOKA 3UC4A 4XV3A 2O8YA 3QQKA 4FOCA 2JIUA 3PIXA 2I0EA 2JC6A 3EMGA 5EYMA 4ENYA 4NL0A 2C5YA 2A4LA 2B52A 3TKHA 5HHWA 4LQMA 4O84A 4IC8A 5L2SA 5M4UA 4GT3A 2ZDTA 3EN9A 5H9BA 4HVSA 2RG6A 3BHVA 4ALUA 2W1FA 3I60A 2PWLA 2C1BA 2Y8OA 5JGDA 2VWUA 2GFSA 1JSUA 3FI4A 3FMNA 3FZ1A 2VWXA 3GCSA 4R3PA 4IAKA 2ZJWA 4JQEA 4D58A 3BLRA 4R7BA 4N4SA 4FA2A 4IEBA 4G6LA 5IH4A 3VO3A 4BI2A 2R4BA 1V0PA 2WMSA 4Y95A 5IF1A 4EI4A 1XKKA 2ITOA 2GNHA 2IZUA 4DTBA 3OCTA 4C62A 1HCLA 4DGGA 3MFUA 1OAIA 4IJPA 1ZYLA 2OJJA 4QMVA 4RIOA 3UOJA 2C6EA 1C7YA 4EKKA 5EM5A 4I0TA 3ZO3A 5AUVA 3O23A 5TR6A 5DLSA 3ZUUA 4E26A 4ANLA 4GG5A 4EK5A 4BDCA 3RZBA 3DJ5A 3EFLA 4YZBA 5C4KA 4FV6A 3CKWA 4IHPA 5I9WA 4NW6A 3ZFYA 4F9YA 3M42A 3MS9A 5IA5A 5IEVA 3LJ1A 4A06A 2OXDA 2X1NA 2ZB0A 4FUYA 2BRHA 4NZWB 3ZRLA 4QMZA 3AG9A 2QLQA 4PMMA 5HVYA 5LMAA 4I5MA 1J91A 4U7ZA 5DPVA 4EC9A 3T3VA 1O6YA 3F69A 3ZFMA 3HKOA 2JAMA 3R1QA 4RWIA 3CKXA 5GZ9A 1A48A 3QRTA 3ZRMA 4IWPA 4EBWA 3VS1A 2BWEA 1UNGA 4X3FC 4XEYA 3BYUA 3V5LA 1WIVA 5EYDA 5E92A 5BVKA 2HZ0A 5CQUA 4G3FA 4QMUA 2JY5A 5AAGA 4LI5A 4PY1A 4C61A 4DF3A 3VW6A 3DTCA 5M57A 1GNGA 4R7IA 4FV9A 2ETMA 3ORPA 4XOYA 3LCVB 3GC9A 3TI1A 3C1XA 3PRIA 1FMOE 2XZSA 2E9NA 4CYJA 3QTQA 4KB8A 3R22A 4IE9A 4U8ZA 3MV5A 3VHKA 5JKGA 3BKBA 5I9VA 2JDSA 4QRCA 5FDXA 2I0HA 4MWIA 4DFLA 5BMSA 5T3QA 5GJFA 4CFNA 3UIUA 4D1SA 4U97A 3T8OA 3N4TA 1WZYA 2R3JA 2GQSA 3VVHA 3DBQA 4L52A 3R7OA 4MD7E 1XO2B 2WMXA 4JL9A 1G3IA 4ZTHA 3HMMA 1J1BA 3HUCA 3K9PA 2X9EA 4XOZA 4AZWA 4CT1A 4IVAA 1JSTA 3ALNA 4JG8A 4TRLA 2Z02A 3ORXA 5HBHA 2O2UA 5HCYA 5HI2A 4JDIA 4EOMA 4JG6A 5CASA 1P4OA 4FKIA 4JLCA 3DCVA 2OKRA 5BVWA 3TNWA 4WT6A 4ANBA 1UU9A 3ORZA 3SW4A 4AZTA 4G9RA 4RJ4A 2YM7A 3FAAA 5H2UA 4EOJA 3FXWA 3CP9A 3NUYA 1ZMVA 1JQHA 1M17A 1E1XA 4RRVA 3P78A 1YKRA 1Y8YA 2HW7A 2OFUA 2WMBA 3KY2A 3Q5ZA 5DVRA 1Y6BA 2EXCX 4L45A 4ZTSA 5EOBA 3BE9A 4AOJA 1Q3WA 1OM1A 3AD5A 4TWCA 3H30A 4YP8A 3QC4A 2W5AA 4RWJA 4JAIA 2ERKA 3LIJA 1IG1A 4L3PA 3FWQA 2BDJA 5L3AA 4TT7A 5EHLA 2B4SB 3ITZA 4GFGA 4USFA 2WQOA 4UWYA 4E6AA 2PUIA 4BTFA 2WPAA 3ELJA 1AQ1A 3PXFA 2YJRA 3BHUA 1ZOGA 4L6QA 2BRNA 2QO2A 3QA8A 3ZMMA 2W7XA 1P14A 3COHA 3KF4A 4PV0A 2H8HA 4KKEA 3R2YA 2YERA 4N0SA 3VRZA 5GZ8A 4EK8A 5KMJA 4E6DA 3P08A 4JBOA 4NIFA 3NX8A 3II5A 4FIIA 3GNIB 2F7ZE 5AR8A 5BMMA 2DKLA 4G34A 4NJDA 5IQDA 3MFSA 3WE8A 4BZOA 3GQIA 3PLAE 3MPTA 4L68A 2F4JA 5HNIX 3JS2A 4YMJA 3EFJA 4WKQA 2IVVA 3O0GA 4F2LA 4Z7GA 3TV4A 4FL1A 2PVMA 4O96A 4KSQA 2QO9A 2GS2A 4YLKA 3FL5A 3U6HA 2R3KA 2VO7A 3GLHE 2R5TA 4XP2A 2C68A 5CU6A 3O96A 3DOGA 3QTUA 3F5XA 3DLSA 4KIQA 3F3UA 1B6CB 2BCJA 4FTQA 2HYYA 2QHOB 1PXIA 1CKIA 4FICA 4R7HA 4XV9A 4HPUE 1FGIA 4X2NA 5CI6A 4OBPA 3LCSA 4I0SA 2GQRA 5EW8A 4ID7A 4CG9A 1M7QA 2OF2A 1M14A 2VWWA 2PVNA 2LAVA 4KUJA 3Q60A 3IS5A 3VBTA 2UZWE 3KRXA 2BKZA 3MIAA 2CNVA 4ZSAA 1BL6A 2C6KA 3FKLA 5CZHA 5DG5A 4NFNA 2Z7LA 5EOLA 4OTGA 2O63A 2E9VA 3EQGA 3I79A 4IVDA 4L3LA 3P7BA 3FKOA 4Q5HA 4JDJA 5HU3A 2IZSA 4G3CA 4M66A 4HCTA 4ZZMA 2FSTX 5BUJA 1YI6A 1RQQA 4DT8A 2J2IB 1OMWA 3BYVA 3PE2A 4FKVA 4WP2A 3QGYA 4ARKA 1R39A 2IW9A 2ONLC 4X2JA 3ZBXA 3TKUA 3ZOSA 2A0CX 3JY0A 5ANIA 5LVOA 3NW7A 4YC8A 3UDBA 4ASXA 4CLIA 2UVXA 5L2TA 4C4IA 3QAME 5ETFA 4BYJA 2OZAB 5D12A 2I1MA 2YEXA 3LXPA 2GNJA 3B8QA 5E8YA 2X4ZA 3F3TA 5JZNA 4DFNA 2B0QA 3PY0A 2QG7A 5BUEA 3ZH8A 3D5WA 5E1EA 3SXSA 5HESA 4RFMA 3VF9A 4O82A 1OPKA 3QWKA 3ZLYA 4CQEA 4L9IA 5DGZA 2CGVA 4U3YA 2VTAA 4XG7A 1PXKA 4RG0A 4QTDA 2JIIA 4L01A 5K4JA 2WTDA 4WUAA 3FPQA 4PTCA 2QU6A 1IEPA 4PPBA 5E9EA 5HX8A 2B9HA 2Y6MA 3NCZA 2JDVA 3W16A 3KXGA 4I4EA 4J97A 4MHAA 3DB8A 3PVGA 2W1EA 3GC7A 2LVAA 4O0TA 1Q99A 4XP0A 4BWKA 2O5KA 3EQDA 3UBDA 1H0VA 1O6KA 3CTQA 3OCBA 4QMXA 2R7IA 3C50A 5IA1A 3DQWA 2PMLX 3BBZA 4AGCA 3CTHA 2YZAA 3MESA 3R1NA 3DZOA 2ZV9A 3W2CA 3PRFA 1FPUA 4PDOA 3GP0A 2XVDA 1W83A 3FSKA 3NUXA 3O17A 2B7AA 4RX8A 4JVGA 3FSFA 3GXLA 3OS3A 4FKPA 4HZRA 4W4WA 1HCKA 3QALE 5CF4A 4G3EA 5LWNA 2PYWA 2ZVAA 3TL8A 5EI8A 4YTIA 4FKSA 1W7HA 4IFCA 3TKIA 2RF9A 3CPBA 5E8ZA 3VBXA 2PZIA 5BYZA 1OKVA 1PXMA 3VRYA 4BCHA 2HY0A 2WAJA 4BKZA 4DH1A 1JNKA 4NH1A 4U81A 4ZMFA 4QPMA 5KMLA 4V01A 3U4WA 2R3IA 2Z2WA 3OUKA 2G9XA 5FQDC 4UMQA 3QZIA 5FUTA 1XH6A 4FSMA 3IOPA 4PX6A 5CVGA 4J1RA 2C6DA 5KKRC 5EKNA 5A6OA 5HLNA 4DH5A 5CSPA 1H8FA 2XJ0A 2VWYA 2UZNA 3QUPA 4HZSA 4RIWA 3QZFA 5HU9A 1OL6A 5DI1A 4JT3A 1F5QA 2PVLA 3IW4A 1XB2B 2NPQA 3Q9ZA 3ZLWA 1WCCA 1LEWA 2HCKA 4G2FA 3R30A 2W1GA 4IB1A 4EC8A 1K2PA 4OTRA 2FGIA 2G01A 4FTOA 4R3CA 4OT5A 4NM7A 4C2VA 1ZAOA 2VTSA 3NYXA 4AAAA 2UZOA 2GTNA 3P0MA 4BRXA 5C26A 2ZTCA 3W2SA 4RIWB 3QTRA 3TNPC 5A4LA 3WOWA 3DPKA 4D4RA 2B9JA 4JOAA 4FIFA 4BCFA 4USEA 1FVVA 2BFYA 2FSMX 4YJRA 4AUAA 4O7WA 2PVKA 2J50A 4BICA 3CPCA 4H36A 5M44A 4K6ZA 5CY3A 3UE4A 2WIPA 3C5UA 5ETAA 4RJ3A 5CF5A 3PG3A 2UZBA 2YAKA 5CALA 3NNVA 4R71A 3UG1A 1OPLA 3MTFA 4AGDA 2NRYA 4ZSJA 2ETRA 4FNYA 5KUPA 1Q8WA 5LARA 5EQYA 2JY7A 3HDNA 2F2CB 4M13A 4LYNA 3V5QA 2IZRA 4Q5EA 3CJGA 3W1FA 4WUNA 1OBDA 4UV0A 5CEKA 4II5A 2XRWA 3QQGA 3KVXA 3ODZX 4LOPA 3VQUA 5K4IA 4RMZA 1Y6AA 4O1OA 2YM3A 3QXPA 3ZC5A 4I6HA 2W99B 4QP2A 1GOLA 4V0GA 5E8WA 2JD5A 3L9PA 2V5QA 2JZ0A 2QOKA 3C0GA 3O7LB 2DNAA 3KN6A 1OKWA 2WMQA 3IGOA 2JY8A 3N9XA 4FT9A 1XQZA 4M8TA 3FMHA 3GBZA 5LVMA 4JNWA 1NW1A 3L8VA 4DG2E 3NYOA 4EOSA 4LG4A 3BWJA 4U44A 3UO6A 1G8SA 3DK3A 2JBOA 4QTAA 4TYGA 4L8MA 3EN5A 4RZVA 3BBWA 3CJFA 2YM4A 2C47A 4ZMEA 5K0KA 2F57A 4O2ZA 3PJ3A 4HVHA 2VTJA 1BX6A 3DT1A 3DAJA 3NUSA 4IBMA 2ACXA 2GFCA 3R21A 1NT2A 4C8BA 5CT7A 2R3MA 5CVHA 4EQUA 4BCJA 1ERKA 4BTMA 4MQ1A 3ZO1A 1K3AA 3WZEA 2VTIA 4CRLA 3GU7A 3WI6A 2BUJA 4JX7A 4QP6A 4Y5HA 4MXYA 4F70A 3KQ7A 3VQHA 2W06A 1PXOA 5K9IA 4D9TA 5IH5A 3QQHA 4W9WA 3QLGA 1SZMA 3WF5A 4OBOA 3UYSA 4UN0C 3R6XA 5FXSA 4XBRA 4D1XA 1Q62A 4LUDA 2JGZA 2UZVA 3BRBA 3WE4A 4G3GA 4MBJA 3SOAA 3K3IA 4R3RA 2W9ZB 4IADA 3LAUA 2GU8A 4FVPA 4CV9A 4PL4A 4PP7A 3PPKA 3A62A 5CLPA 3I81A 1L3RE 1OL2A 2PE2A 4ZAUA 3PP1A 2QC6A 3RAIA 1LR4A 2UW3A 1YOLA 2C6LA 3HA6A 4FTRA 4MYGA 3TTJA 4YHFA 5ANJA 3U6IA 4O0UA 3CXWA 3H9FA 4F1TA 5HD4A 5CAPA 2AYPA 4IM0A 2QR8A 5EQPA 3ORIA 5AIRA 3NW6A 3V5WA 5AV0A 3PVBA 2XBJA 4E5AX 5FDPA 2GHLA 4ZJVA 5I4NA 4IIRA 3NUPA 4PNIA 3FMKA 2VV9A 2ZV8A 3T6PA 2QCSA 3G51A 4IM3A 4MXZA 4ZTLA 4GMYA 3V8WA 1Q8ZA 3F9NA 2QHMA 4FZAB 2Y6OA 1JPAA 4ASDA 4H3QA 2R3GA 3LQ3A 1PXJA 1YDTE 4BL1A 2G1TA 4BZDA 3OBGA 5E91A 3R9RA 4PUZA 1GIIA 5EG3A 5LQFA 4DFBA 1HQYE 3A8WA 3M2WA 4KNBA 4ZOGA 2VNYA 4NEUA 5CF8A 5EM7A 3R8UA 2OIQA 3QCYA 4XLVA 5AEPA 2GNLA 2EKKA 3QHRA 5CAOA 3R8MA 5I9YA 3R73A 5D1JA 4GKHA 4I21A 4D4VA 2X8IA 5CQWA 3CY2A 4I24A 4BN1A 5L4QA 3OTUA 2XKDA 3FC1X 3MPMA 1UV5A 2ZV2A 4IQ6A 5LCKA 4FV2A 1V0OA 2I40A 2JDOA 4FMQA 4UYAA 3NYVA 5D11A 3I6WA 4FTUA 3QHWA 5KE0A 2Q0BA 4XHKB 4IWOA 5LJJA 3HV3A 2XEZA 3W2OA 3CD3A 1J3HA 2HWJA 5EHYA 4W4VA 2GPHA 5AV3A 3GENA 4FKTA 5HVKA 3UC3A 4H3PA 2C3KA 4DEEA 3FMDA 4IZ5A 5CI7A 3VBYA 3R9OA 3M11A 4FL3A 4PMSA 3MY0A 3QQUA 2CGXA 2P3GX 4Z16A 1DS5A 2I0YA 3MJ2A 3OWJA 4G1WA 4I5PA 4UWCA 1XJDA 1HJPA 2WMRA 5D41A 3UPZA 1YVJA 4YJPA 3UODA 3EN7A 1Q24A 1PRYA 3M1SA 4A9YA 2EKFA 3NZ0A 4QP3A 5AUZA 3E46A 3BBTB 4J71A 3LM0A 4FIHA 3RP9A 4ZS4A 3DKFA 4BY9E 2W96B 3BHYA 5TKDA 4MF0A 2WQNA 1S9JA 5E8VA 4GEOA 3C0IA 4MTAA 2NP8A 4L42A 3GQLA 5E90A 2WFYA 3NS9A 3SG8A 4U3ZA 3OVVA 3QCQA 4L44A 4RX9A 4CFUA 3SOCA 5DHJA 4IAFA 5I9XA 4QMQA 1JKLA 4EYMA 5IQHA 4RT7A 3PJ8A 5IA0A 2JZ1A 4H39A 1IRKA 5EW9A 4A07A 5KMNA 5J8IA 4CFVA 2QQ7A 1H1PA 3FLQA 1WHCA 4MQ2A 3G90X 3UOKA 3TJCA 3IHPA 1R0EA 2ITNA 4QNYA 3EZVA 2EXEA 3REPA 4ZLYA 1IFYA 4ANOA 5HLWA 4EOPA 4QP4A 1YHWA 4QTCA 2PE0A 3BEAA 4F6UA 4F7JA 4F6WA 5F9EA 4FBXA 3FRIA 3DAKA 4JI9A 4YO4A 4NM0A 4YTFA 5I3RA 3HGKA 4B8LA 2GNGA 1VEJA 4AE6A 4C4FA 1J7LA 2WTJA 5AP4A 4XYFA 4FG7A 5A4TA 2RFEA 4EK3A 2QR7A 2WOTA 1ZV1A 1UU8A 2XJ2A 2EB3A 3DGKA 5F94A 4QQTA 5GZAA 5JQ5A 4OTIA 3BEGA 3TEIA 4B99A 4LRMA 3K5VA 5J79A 2J5EA 3ZO2A 1KE9A 3N4UA 1VEKA 1V1KA 1CKPA 2V22A 2QSFX 3DNEA 4WG3A 3GB2A 2KNAA 3QGWA 3RK5A 5IQEA 3Q6UA 4XBUA 4AACA 2PUNA 4UN2B 3W8LA 3TACA 4AW1A 2C0TA 3O50A 4B9DA 4FKLA 5IA2A 4ZTMA 3SLSA 3JVRA 2X7FA 3FUPA 2UW5A 3PXQA 4K11A 4KBAA 3UZPA 1KYIA 1JKSA 5DE2A 4W4XA 4N6YA 3U4UA 5EI6A 5EK7A 2CN8A 3NIEA 1J7UA 4C7TA 4XS2A 5EYKA 4ASZA 4GT5A 3GLGE 2ERZE 2DZLA 1ATPE 1NY3A 2WTCA 2LGCA 2QOLA 3OXIA 4TWNA 4TYEA 5CEQA 3NGAA 2IG7A 3TDWA 2RFDA 3PWYA 3BV2A 4E1ZA 2YISA 2VRXA 5CWZA 1YXVA 2HZIA 2W1ZA 3L8PA 1FMKA 1P2AA 2YA9A 4GIHA 4C58A 4FGRA 2OIDA 5CEPA 1OB3A 1UNHA 3E64A 5CTPA 3OT8A 4BDJA 4BCMA 2LVOC 4S32A 3DAEA 4F64A 4RC2A 5T68A 3VJNA 4PL3A 4BCNA 4E4XA 5CSVA 1URCA 4HYIA 3G15A 3D7TA 4AT5A 4AW5A 5CYIA 2XBAA 3KCFA 1AD5A 1E9HA 1VEBA 2RIOA 2E9OA 3QTSA 4D1ZA 2DAKA 2YLEA 4AT3A 3WIGA 2R3HA 3PY1A 4OBQA 3BV3A 2J0JA 3F5PA 3Q5IA 5IQFA 2W4OA 4B0GA 3VS2A 4D55A 2YN8A 4DGOA 1SVHA 3VULA 5KHXA 3U9NA 3EWHA 4IFGA 1B39A 3P86A 4CFXA 4M14A 1FINA 2X8DA 3O71A 5IUIA 4UZDA 4I22A 4YSJA 4RSSA 4EL9A 1Q61A 3EQFA 4MVFA 4AA0A 4BZNA 4EZ3A 3FJQE 2WD1A 4LOOA 3COIA 5FBOA 3ZSGA 3ATTA 3QYWA 4XLIA 5JZJA 4EEVA 2X6DA 2BKKA 4CD0A 5A46A 3TJDA 3AC3A 4ALVA 3IW5A 3AD4A 3DTWA 4K8AA 5D7AA 2CNUA 3Q6WA 3FI3A 3Q4ZA 4KKHA 2FSOX 4CGAA 2VWVA 2IVUA 3D7TB 4U0IA 3IW7A 4DBGB 4YSMA 3T3UA 3A7IA 5AJQA 2WNTA 4W8DA 2UZDA 3Q9YA 3ZFXA 2VGOA 4EZ5A 2CKEA 1OITA 2ITZA 4H58A 3EQHA 4Q9SA 4BCQA 2XH5A 4NUSA 4YJVA 2LVPC 3LFNA 4J53A 2G2HA 2Z8CA 4JBQA 5I3OA 2BRGA 3PJCA 1QPDA 1CSNA 4FSTA 5DR9A 3V5JA 2Q0NA 2QOFA 2W1IA 4I5HA 5ETIA 1PMVA 3A99A 4EQCA 2MJ5B 2ITTA 2DHYA 3HV6A 3HMPA 5IG1A 4Y72A 4G17A 3S95A 4PMPA 5LOHA 2YIRA 3OG7A 3SDJA 4MNFA 3MGYA 3F2NA 3NDMA 3DFCB 4M84A 2P4IA 4NKAA 3FI8A 5JFVA 5ACBC 3DK7A 5GIPE 2H5XA 2VD5A 2VTRA 3D2KA 4EOIA 3NWWA 5CF6A 3E3BX 3VBWA 4BGQA 3F3VA 4FKWA 4RIYB 5J9LA 1UU7A 4FNWA 3RM7A 3EYHA 4ANNA 3BX5A 5FGKA 4F7NA 3IECA 3FKNA 4QT1A 2WIHA 3RINA 3HMNA 4S31A 4EOLA 1PXLA 1CM8A 3BGPA 5CZIA 4BCIA 2F2UA 2V55A 3GC0A 4P5QA 5I9ZA 2QOOA 4R1VA 4AN3A 3FXXA 4NSTA 4A4XA 4FEXA 2XNEA 2Y4PA 3ALOA 3BYSA 3V8TA 2DENA 4MBIA 5B2LA 2YDJA 3SQQA 4AF3A 5JEBA 2Y4IB 5K5NA 4FTCA 3E63A 4TTHB 2EU9A 3HDMA 3PXKA 3R04A 4APPA 5JI2E 5AA9A 4R77A 3OEZA 1VYWA 2FYSA 3P1AA 3QA0A 4D5HA 2V62A 2IVTA 1XXHE 1WBSA 4DH8A 4ZZNA 2ZMCA 1YOMA 3GCUA 3I7CA 4TYJA 4JIAA 2P2IA 4ACDA 3H9OA 2VTPA 2WEVA 3GC8A 4G31A 5B2KA 3F3ZA 4BIBA 1STCE 1BLXA 2VTQA 2Y4IC 2YIYA 3PLSA 2JKKA 4RWKA 2VGPA 1NVSA 3U9CA 2BTRA 2CCIA 3VUMA 3WBLA 2X81A 3WF7A 5HNBA 4BB4A 2QNJA 2R2PA 4FT5A 4M69B 5EI2A 5IKWA 4A9SA 4O6EA 1AGWA 2PMIA 3E7VA 4DEHA 5AP6A 5IEYA 4FKGA 4AN9A 4E73A 3Q4TA 1WVXA 5CU4A 1BKXA 5IEXA 1DO0A 3DDPA 4XJ0A 4FODA 3RPOA 4HGEA 5EH0A 1TR8A 1LEZA 1XBCA 4IANA 3ANQA 2QKRA 4IWDA 2O64A 4RA5A 4ACCA 5TE0A 4ZLZA 5J5TA 4ANMA 1JBPE 3HV7A 2YHVA 4G16A 3E8DA 2R3RA 4OTWA 4ZS0A 4UMPA 4L53A 2ZTDA 5EM6A 2XUUA 5AM6A 3EFKA 3E87A 4NTTA 5KNJA 4Q7JA 5CSHA 3A4OX 4LFIA 1CUKA 2RKUA 3EOCA 3MN3A 1H1WA 2JBPA 2CSNA 2XK3A 2C4GA 2J4ZA 1BMKA 4EH8A 3DLZA 3DBCA 4FV3A 4AS0A 4C34A 1WBPA 4G6OA 4E6QA 4NCTA 4F63A 3DJ6A 1P5EA 2C1AA 3KMWA 3TTIA 2XEYA 5ANDA 4ALWA 4PDSA 5E8TA 2C6IA 3G0EA 2OJGA 3FMJA 3LFFA 1Y57A 4QMMA 2OW3A 4FV4A 1ZOHA 3VUGA 3WIKA 3QYZA 4J98A 4EWQA 4F9WA 4MXOA 4RA4A 3P7CA 2Z7RA 3DJ7A 5HIBA 4RJ6A 1KSWA 3NAXA 1UNLA 1ZZ2A 3SKCA 2C3LA 2PTKA 3PIYA 5KBRA 4IB3A 3PZHA 1XH9A 3BHHA 1PW2A 4IM2A 3PZEA 3E21A 4CFMA 3C0HA 3OUNB 2XNBA 3D7ZA 2A19B 3WF6A 3NUAA 3R7VA 2NNWB 2HOGA 3FHIA 4ACHA 3HRCA 4BGHA 5BVFA 3E8CA 2P55A 2CKQA 3EKNA 1KUTA 3G6GA 1NV8A 2GHMA 2YM5A 3G9LX 4XRJA 4E5BA 3Q53A 5FTGA 3C5IA 3HMOA 2VWZA 2GCDA 3UNKA 5E7RA 3SHEA 4APCA 3KULB 1WVWA 4B6LA 5A6NA 4RVTA 4EORA 4BCGA 3CBLA 1PXNA 1XH8A 1GZOA 5IU2A 1GIJA 3CQUA 3CQEA 4Y46A 2X4FA 4GK4A 3BQRA 2ITXA 5FD2A 5JSMA 3QKMA 4BVUA 2X7OA 4C0TA 2QI8A 4EH7A 5JT2A 3LXKA 2F7EE 2WTWA 4D2TA 4FSYA 4FF8A 4RC4A 5HE2A 2RG5A 5CEMA 3HA8A 4HNIA 4C2WA 5F4NA 2QONA 5M56A 4IACA 4MH7A 3ZS5A 1H27A 2BFXA 2VTNA 3QCSA 5BVOA 5JFXA 3C7QA 4UWBA 5GHVA 5B0XA 2BILB 4DFUA 3GU6A 2WKMA 4CSVA 2J90A 2UW4A 4MXAA 3BQCA 4EOQA 3HX4A 2YLFA 1ZY5A 4YZNA 1JLUE 4J8NA 3LMGA 4MF1A 2YCFA 5LCJA 5IQBA 4U9AA 4O83A 5J1VA 4FKUA 4WRGA 3VNTA 2BAJA 4TNBA 2V7AA 4IAZA 2WTVA 1SG9A 5HO8A 4BDFA 2JAVA 4EK6A 5GJGA 2BR1A 3BZ3A 1ZMWA 4O1PA 5LXMA 1Q97A 1YI3A 5JN2A 4U40A 4X7QA 4QPSA 3HNGA 4O22A 3VJOA 3UNJA 4OTFA 1JKKA 3HYHA 3ATSA 5H8BA 2GNFA 3Q9XA 3U8WA 4FKOA 2HW6A 4U80A 4ZK5A 3K54A 3RI1A 3C4XA 2ZMDA 2WMAA 3KK8A 4JXFA 2EVAA 1F4IA 2BIYA 4GT4A 4UMTA 5CS6A 4BR3A 4FC0A 2WU7A 3FLYA 3JXWA 4RC3A 4ZSGA 2RSVA 2XIXA 3FQSA 2W1HA 3E8EA 3KRJA 4YNOA 5G1XA 4CXAA 4K0YA 4CZTA 3FEGA 3DXNA 5G6VA 2CLXA 5C01A 4M15A 5AM7A 2HAKA 3QQLA 2BHHA 5A4CA 3OY1A 1OIYA 3A7HA 4GCJA 4RIXA 4LOQA 4Z3VA 3EH9A 3IOKA 1GZKA 4M3QA 1BI8A 1RE8A 4AZFA 2W5HA 4RGJA 1GZ8A 4XG3A 1WBNA 1PGYA 3QKLA 3RHXA 4WRSA 3HAMA 2PUUA 3DBEA 4KD1A 3U87A 5BVDA 4D2PA 2XP2A 2B53A 3VF8A 4G5JA 3W2RA 3S00A 2C6OA 3A60A 2UW0A 2WTIA 5EKOA 3LCTA 4EUTA 3OOMA 4CZYB 2XKFA 4CTCA 4ZJIA 4BTKA 3AT2A 3ORTA 2JEDA 2XIKA 3FC2A 3PIZA 2XNMA 1NV9A 4JRNA 1WAKA 4YHTA 4XX9A 5IQAA 2IW6A 4PF4A 3I6UA 4XG9A 4YZDA 1DAWA 2BVAA 1X8BA 4CFWA 3SA0A 3HRBA 4ZSLA 5BQ0A 1H24A 1XBAA 4AFEA 3ZZWA 1H25A 3OF0A 4AN2A 3KGAA 3B2WA 3F61A 5KKRB 2L4EA 3U54A 3KA0A 4JBVA 5HE3A 3VS6A 4C33A 3N51A 2IW8A 2XKEA 2OO8X 1TVOA 2OZOA 3HEGA 2JP7A 3VS3A 4Z9LA 1F3MC 4KIKB 2J0KA 4NK9A 1Q41A 5JQ8A 1PKDA 3RM6A 3ZONA 2FUMA 5L8JA 4FEVA 3G33A 5KZ0A 2DAGA 5AP1A 4AP7A 2VTMA 4GFOA 3FL4A 4IZYA 3H10A 4GU9A 3FLWA 4DFZE 4S30A 3LFEA 3MTLA 5AUUA 3H9RA 3RCDA 3AGMA 4RPVA 1Q8TA 3FHRA 3IW6A 3KC3A 4GJ3A 1ZXEA 4J95A 3H0YA 4OTDA 4WA9A 4DGLC 1MP8A 4RQVA 2QD9A 1YDRE 2WQBA 3O8PA 3CGFA 3KK9A 3K2LA 2DI0A 4FV0A 4GVJA 4ACGA 4MK0A 2PZYA 3HL7A 4H1JA 2DQ7X 2PHKA 5J7HA 5C4LA 2DAIA 4WBOA 4V05A 3FZRA 5AUWA 5CEIA 4O86A 5M55A 3KXXA 4E7WA 3LOKA 1ZRZA 1JAMA 1MQBA 4IMYA 3KEXA 4C57A 4XG4A 3OFMA 4KRCA 3R8ZA 5A54A 3E88A 2DYLA 3RGFA 3PXYA 3FV8A 1Z9XA 1W0XC 5DR6A 3RK9A 3T9IA 3JR1A 2YIQA 3PYYA 4XG6A 2OIBA 4TWPA 5HCZA 3ZU7A 3ZSHA 2GNIA 3UVQA 4KIOA 3OHTA 2QU5A 3E8NA 3Q96A 3RWQA 3W18A 3QBNA 3W2PA 1R78A 3OMVA 4W8EA 4EH3A 4EHZA 2FH9A 4PTEA 3LVPA 4CCBA 1B38A 1YRPA 3C51A 4LRJA 3RPRA 4GUBA 3TIZA 3VUTA 2HIWA 1WGLA 2UVZA 2PVJA 4FOBA 3BHTA 3WF9A 5DBXA 1PYXA 4H3BA 4HPTE 4EUUA 3MA3A 3EN4A 4YZ9A 3AC1A 5KMMA 3TUBA 3VBQA 5BVEA 3MPAA 3JYAA 2IN6A 5AP7A 5FXRA 4EJNA 3C4ZA 5IISA 4ORKA 1UKHA 3NIZA 2JITA 4HGTA 2CDZA 2I0VA 3TNIA 4CG8A 3L8SA 2PU8A 4EHEA 1JVPP 4A9RA 5BPYA 3TUDA 3B2TA 2RRUA 1SVEA 4PWNA 2NO3A 3COMA 2J0IA 2EB2A 3FXZA 5DRBA 4AGUA 1W8CA 2OSCA 3CY3A 3UGCA 4YURA 5E1SA 1T6OA 3C4WA 3QZGA 4O6LA 2O65A 1F0QA 4ITHA 2BPMA 4FTJA 3MVHA 1R3CA 5HZNA 2WTKB 1UU3A 3CD8A 4D0XA 3NW5A 3KF7A 2XYUA 3IONA 1REKA 3FBVA 3AD6A 3CLYA 4C3FA 1WMKA 4IX4A 3VBVA 3ZHPC 3HUBA 3P23A 5HG7A 3R01A 3A4PA 1J7IA 5HNGA 3ZUVA 3KFAA 3LFDA 4G3OA 3B8RA 2X7GA 4FZDB 4U41A 4W4YA 4BWXA 3ZXTA 4DG0E 2HWPA 2R9SA 2G2FA 4DEGA 2KNVA 3KRLA 2UW9A 3MB6A 3TZ8A 5L2WA 4F0GA 1CTPE 5BYLA 4ACMA 3D9VA 3ZZEA 3ETAA 1A06A 2XF0A 1WFCA 1U5QA 1WVYA 3F6XA 1DM2A 4FIGA 4G9CA 4C02A 4DH3A 1ZARA 4RLKA 4F6SA 5CEOA 5M53A 1FBNA 4S2ZA 4L67A 2O0UA 4RQKA 5AIKA 3EQPA 2RFSA 4QP7A 4F9AA 2X39A 4BDKA 4EH5A 3L9MA 3PFQA 4FNXA 5D7VA 3VN9A 4HVGA 3DXQA 5C9CA 2OI4X 4L7FA 2ITVA 5TT7A 2WTKC 4H1MA 3NAYA 3UQGA 4CLJA 3WARA 2BALA 2PVRA 2W4JA 3KU2A 3VS4A 4ANQA 4BWPA 5ICPA 5AP5A 3NPCA 4IWQA 2WMWA 3GFWA 3U6JA 4FTNA 4UALA 4Y85A 4O2PA 3E62A 2ETKA 3ZSIA 4I1ZA 4S33A 4O0VA 2UZLA 4Y8DA 4QYEA 5TF9A 3UIXA 3NRMA 2C3JA 3LXLA 4YO6A 3VWAA 5HX6A 4DEDA 3PVWA 3EJ1A 5HO7A 4RVMA 1ZYCA 5K0XA 4OTHA 5M4IA 3ZDUA 5IQIA 5L6PA 5IA3A 4I93A 1OPJA 1OQYA 3F82A 5AAEA 5HTBA 5KX8A 3HVCA 3LLTA 3ZBFA 3TCPA 1I09A 5AV1A 1XWSA 4E8AA 2Z60A 3L8XA 4FEQA 4BDAA 2LVQD 1OL5A 4U6RA 4BBMA 3UIBA 1GJOA 1FQ1B 1V92A 3KRRA 1JWHA 1E1VA 3PJ1A 4ITJA 5AV2A 1OL7A 3RTPA 3F3WA 3S2PA 4CVAA 2H6DA 4DN5A 5HIEA 3CS9A 4FV1A 4LGDA 3LFAA 2OJFE 3IGGA 1XHAA 4DCAA 4XMOA 4IC7A 4UXQA 4YJNA 4FV5A 4GL9A 3SX9A 5LWMA 4DCEA 2F49A 5M09A 3W32A 1M2PA 4FVRA 4QO9A 1OL1A 1OKZA 4UXLA 3FLNC 4NCTC 3NNUA 2VWBA 4BFMA 5M4FA 4W9XA 3T9TA 3VHEA 3IW8A 2QOCA 1TQPA 2YITA 2XCKA 3HECA 1U5RA 2F9GA 4HYHA 4NKSA 3SRVA 3SV0A 4F09A 4XCUA 2XJ1A 4QD6A 5HORA 1XH7A 4K18A 1FVTA 2W4KA 4NM3A 2CCHA 1M52A 4LL5A 3ZRKA 3AMAA 3R63A 1H08A 2OGVA 1UVRA 3DK6A 1NA7A 2VX1A 4NTSA 2R64A 3R7EA 5JFWA 4A4OA 4I41A 4IAYA 3CIKA 3P9JA 2C69A 3DKGA 4HEOA 2CPKE 5FG8A 4BYIA 2NRUA 2YCRA 4O7ZA 3NNWA 4ANSA 2L4FA 4GK2A 2CWBA 3GCPA 3MH3A 4E20A 3HZTA 5GNKA 1Z57A 1W82A 5CU2A 3HLLA 4E4LA 1JR3E 5CXZA 4D4SA 1PXPA 3UYTA 3MY5A 3Q3BA 4BF2A 1BUHA 1IAHA 2REIA 2A1AB 3O51A 5M51A 4NU1A 4X0MA 5IUGA 4ZTRA 2WMTA 2XIRA 1QMZA 3GI3A 3FYKX 4E4MA 4E5WA 1DV0A 4U5JA 3EL7A 4IDVA 3TT0A 2CKPA 3BWFA 4UMRA 4FSQA 3DBFA 4OW8A 4CCUA 2GS7A 4DEBA 4I20A 5JRQA 4B4LA 4OAUC 3QUEA 3E93A 3NMUF 3GU8A 4FX3A 3C4EA 2FA2A 4I4FA 1UWHA 1YDSE 4FTMA 5AR7A 3ZXZA 4C4HA 1PMNA 3MI9A 2KHHA 2JFLA 1XH4A 4XG8A 1Q02A 3RVGA 3PXZA 4YNEA 4J99A 4R5SA 1H1QA 3D83A 3AC5A 3R0TA 2BZKB 4D0WA 4NM5A 4A9TA 5TO8A 3MW1A 3DFAA 3NUUA 2RFNA 3AC4A 3LMHA 4EH9A 4NT4A 2CHLA 1DI9A 4IVCA 4JQ8A 2ITQA 3KCKA 3LW0A 1PY5A 3QU0A 4GW8A 1XH5A 2WMVA 3D5UA 4YJUA 4KAOA 4LMUA 4AG8A 4IX5A 3DQXA 3LJ2A 4BIEA 3KVWA 2OJ9A 2W17A 4KBKA 5AP2A 2JFMA 5EDQA 4FEWA 4I6FA 2YDKA 3G2FA 3GOPA 5M08A 5HCXA 2LVNC 4HYUA 4IX6A 2V7OA 4RJ7A 5L6WL 4PMTA 1KE7A 2CNQA 5KO1A 2WXVA 2PZPA 3W33A 3FQHA 4FSZA 1MQ4A 3D0EA 2VX3A 3I0OA 4JAJA 3LZBA 1MUOA 4YTHA 4JQ7A 4YTCA 3EIDA 3MSSA 3BE2A 4KINA 1HT2E 4BBEA 2KTYA 4FYNA 4ZEGA 1PMEA 4BDEA 4GKIA 4DBXA 4ZSEA 4IB0A 4OT6A 3RWPA 4O7TA 1JOWB 2DAMA 2WGJA 4BCOA 2OK1A 5EFQA 3GLFE 3R8VA 3IG7A 5J9ZA 4U45A 2OJIA 5L2IA 3FMEA 4BHZA 2RL5A 3ZUTA 3R1SA 3Q4CA 4YLLA 3WZJA 5EM8A 3JY9A 2X0GA 4HNFA 4EBVA 5BYYA 4YR8A 4CRSA 4RLLA 3D94A 4KS8A 1KOBA 3N4VA 2CP8A 4U43A 3TXOA 3MVLA 3V51A 3QRJA 2WU6A 1NVRA 3AGLA 4GG7A 1H0WA 5FLFA 2YACA 2C0IA 2WB8A 4I0RA 2R3QA 1A9UA 3GFEA 1YW2A 4O7YA 5FEDA 1R4GA 4QYGA 2ITUA 3HAVA 2BDFA 1S9IA 4IDTA 5L6OA 4LMNA 1IA9A 3KMUA 3ODYX 4ITIA 4L46A 5AUYA 3BU3A 1BVSA 3OWLA 4AT4A 3FMLA 2BIKB 3IDBA 3PSDA 4QP8A 4O7NA 4WBBB 3BLQA 2G3QA 3IK3A 4KIKA 4MXXA 4O91A 4H05A 2IO6A 3PDTA 3SRVB 5CU0A 4C4GA 2HY81 4WIHA 4DLIA 3MFTA 4DFYA 1TQIA 1YWNA 4KA3A 4ZTQA 2PL0A 5CSWA 4P2KA 4EK4A 4EONA 5ETCA 1KE6A 3KKVA 2PVFA 3PG1A 1SM2A 4CTBA 5IMXA 3IDPA 3ZEWA 2AC5A 4BC6A 1QPCA 1U54B 3QXOA 3ENHA 5HOAA 2X6EA 2JKOA 2W9FB 4KABA 4YPDA 5JGAA 1Q4LA 2ZAZA 4LRKA 3MYGA 4TPTA 3CTJA 2FVDA 4FTTA 4IB5A 3CR0A 4L00A 4BDHA 4CNHA 3SG9A 3RBWA 2VUWA 3WZDA 3SVVA 1V0BA 5LMBA 4WSQA 4QMSA 3R83A 4FVQA 4FZ6A 2CMWA 2YFXA 3AT4A 2ZM4A 3PSCA 3GLIE 3GVUA 3O2MA 4HYSA 3V3VA 4PDYA 4FV8A 1QZEA 2PY3A 4O0XA 5EQEA 2QHNA 3FMMA 4BKYA 2FSLX 4UZHA 3HP2A 3UVPA 3D4QA 2MGWA 3BYOA 5J9YA 3I0QA 4EH4A 4EH2A 4R8QA 3TIYA 2E9PA 4RBLA 1FVRA 4C35A 2LTUA 3I1AA 5DT0A 3Q2MA 4ZTNA 2HXLA 2HENA 4BGGA 3GU5A 2E9UA 5KZIA 3VUKA 5HQ0A 3QTIA 1EH4A 2HXQA 1H07A 2X2LA 1HOWA 3GGFA 1H4LA 3Q4UA 2JUJA 4DE4A 3E92A 4A9UA 5JGBA 3MIYA 4TKSA 4D5KA 4E6CA 3OWKA 4E3CA 1G3NA 2PZ5A 1YOJA 3WZKA 4EKLA 3F2RA 1JKTA 1DAYA 2G15A 3R8LA 3TG1A 2QLUA 4R5YA 3THBA 4AE9A 3KN5A 1KWPA 4FR4A 4KWPA 2O25A 3RCJA 4GSBA 5A4QA 3UVRA 2KNZA 3AMBA 4ONAA 3R9NA 5B2MA 4AOIA 5HE1A 1U59A 1VG5A 4MKCA 3GCVA 5H8EA 5LMKC 4BDBA 5DNRA 2BROA 2R0IA 2JDRA 3DA6A 4MD9E 5AR4A 2C6TA 3VS7A 3EHAA 5ITAA 2VWIA 4O38A 2K0BX 4QMOA 2YABA 4GU6A 3ORMA 4DFXE 1OUYA 3TZ7A 5CNOA 2R3LA 5HD7A 4E93A 5EDRA 4F7SA 5M06A 4ZY4A 2Y9QA 5JMSA 3BU6A 2ITWA 4UYNA 3GU4A 3MMPA 3QCXA 3FQEA 3H0ZA 4CT2A 2OLCA 3EQBA 3VUHA 1ZYDA 4IJ9A 3GEQA 2X8EA 4O7VA 2J6MA 4J8MA 4G3DA 3ZDIA 5A9UA 4BKJA 3Q32A 1MRUA 2ZB1A 2C0OA 3R00A 2XKCA 3LFCA 3UP2A 3ZYAA 4C3RA 1YWVA 3A7GA 3D15A 3CCNA 5AUTA 2VZ6A 4AOTA 2OOAA 3VC4A 4QTEA 2J51A 2JIVA 1IM2A 1SVGA 2KULA 3DU8A 4G5PA 4IZ7A 3DKCA 5H8GA 3CSVA 3OW3A 3UO4A 5DWRA 2PSQA 4F9BA 4C59A 3S4QA 4YGAA 5EHOA 2JNHA 4GFMA 3ORKA 2XMYA 2BZHB 4PQNA 4MEDA 5K3YA 5BVNA 4CYIA 3BGQA 4NW5A 3UMWA 5CT0A 3RAKA 4EWHA 5F1ZA 3DS6A 1L8TA 2GQGA 4RX7A 4UB7A 3NVMB 1YQJA 2EJSA 4C37A 3FY2A 1K9AA 3R9HA 5FM2A 3ZCLA 2IVSA 2UZTA 3LCKA 4JBPA 1FGKA 4YC3A 1PKGA 2J5FA 4CFFA 1YXUA 5DYJA 3A7FA 1YHVA 4HCUA 1LUFA 3UG2A 2OH0E 1YHSA 4QQCA 1BI7A 3R7YA 3NLBA 1ZYJA 4PRJA 3U51A 5LMKA 2J7TA 2BDWA 2VTTA 3ET7A 4J96A 1HT1E 2XK8A 5J87A 3EYGA 2P33A 3C4CA 4K2RA 5IZFA 3UQCA 3F92A 2FO0A 4UBAA 4WD5A 3SXFA 3VS0A 4RJ8A 1PYEA 4OLIA 5J5SA 1Q8YA 2OF4A 3QD2B 3FI2A 3UZTA 1VJYA 2WELA 3R7GA 1KV1A 4FKJA 3FLSA 2R3OA 1ZY4A 3FZPA 1M2QA 1SMHA 3BGZA 3IKAA 4MCVA 4USDA 2XYNA 3OXTA 2OOBA 3NVKI 4CKIA 4Z55A 4YJTA 4TWOA 4ZY5A 3QQJA 2B3TA 3BI6A 4UMUA 3LFSA 3LXNA 2HZ4A 1APME 3ZC6A 3F66A 5FBNC 4K33A 3V5TA 5B7VA 5JH6A 2BHEA 2IZTA 3EN6A 4DITA 2QURA 5AMNA 3MJ1A 3V5PA 3ULZA 3I4BA 3MBLA 4M7IA 4J7BA 4DA5A 4OAVB 5I5ZA 1U54A 4HVIA 3VUIA 1QPJA 3LMIA 1M2RA 4K1BA 1CDKA 3G0FA 2PPQA 4FT0A 2J9MA 3EFWA 3F5GA 4M69A 4Q2AA 2LBCA 4GK3A 2ITYA 3OP5A 5I9UA 4JDKA 5KCVA 2A27A 5DRDA 4HCVA 4L7SA 1Q3DA 2ESMA 3OZ6A 2B1PA 4AWIA 3Q52A 4BI0A 1T46A 2XNOA 4C3PA 4MWHA 3LCOA 3TWJA 4IAIA 4N6ZA 5FM3A 3V04A 3V8SA 2PZRA 3SAYA 4YHJA 5AUXA 3QRKA 1OZ1A 3D14A 4J52A 1TTEA 5J7BA 2JKMA 1TQMA 2YDIA 2F7XE 3K3JA 2YIWA 3QX2A 3Q2JA 3UOHA 5LVNA 2BMCA 3ANRA 4BHNA 2WMUA 4P5ZA 3I5ZA 1BYGA 5CVFA 3TZ9A 4X2KA 3KXNA 4M0YA 2DWBA 3QD3A 4AQCA 4CKJA 2AC3A 2R7BA 1ZOEA 4L3JA 4B7TA 2I7QA 3DBDA 4RFYA 1YXSA 3KXMA 5M07A 4XV1A 1NVQA 3C13A 4WNOA 4YC6A 4AW0A 1P4FA 2V0DA 5DR2A 3R9DA 4GV1A 5ANEA 2W0JA 3LE6A 2YWPA 3MA6A 1G4AE 1H01A 4F1MA 2YAAA 4JG7A 5L8LA 4EYJA 2GMXA 3OD6X 4R78A 4MXCA 4S34A 4GRBA 3UP7A 4DYMA 2G2IA 3MFRA 2L2DA 3PXRA 5H3QA 1MN3A 5FEQA 5D9HA 4ERKA 4PDPA 1Z5MA 2RGPA 3P5KA 2H96A 3POZA 2B55A 5HO6A 1OIRA 3MWUA 3ZTXA 2B9IA 4AXAA 3HMIA 3S3IA 3SGCA 3E5AA 2DS1A 3QLFA 2YM6A 1MRYA 1PMUA 4X6RA 4FT7A 4MNEA 4DAWA 5DEYA 2QO7A 3EQCA 4F08A 4TL0A 5DEWA 1VQ1A 1G41A 5DIAA 3LCUA 4K77A 5TOZA 1T43A 3HV5A 3FYJX 5AP3A 4O0WA 4N57A 3TM0A 1E94E 3KULA 4FTKA 4FTAA 2W1CA 3RPVA 1WJ7A 3BLHA 2EUFB 3KMMA 1OIQA 5CAQA 3UJGA 2XIYA 2CN5A 3AOXA 4RFZA 5AR5A 2DAEA 2JY6B 3RALA 3V6RA 3ERKA 5IA4A 2VNWA 4C4JA 3PA4A 4ZLOA 4AX8A 1OVEA 4ASEA 3KXZA 2CGWA 3TNQB 2C5XA 1O9UA 3HV4A 2QG5A 3O8UA 3R28A 4FKQA 5CXHA 5C1QB 1P3QQ 5DT4A 3RAHA 4HJOA 1GAGA 2HK5A 3FRHA 2YCSA 2QOBA 2YM8A 1PHKA 3QRIA 5KBQA 4QYHA 3OCSA 1OTRA 2B9FA 3QL8A 1UA2A 3OBJA 2XS0A 2QKWB 3OY3A 3NEWA 2YZLA 4UEUA 4TW9A 4YJQA 4CMUA 4FG8A 4FG9A 4QNAA 1REJA 4YPSA 3WYYA 3VUDA 3C9WA 5F20A 1U46A 4YBJA 2BRBA 3ORLA 3QTWA 3LPBA 4PPCA 4TZRA 4YZCA 3MB7A 4DT9A 3HRFA 1OGUA 4MBLA 4F4PA 3P7AA 5HTIA 2ZOQA 4U79A 5AP0A 5CANA 4BBFA 4QP1A 3PPJA 3UPXA 1Y91A 4U42A 3G9NA 3PJ2A 2WQEA 3NUNA 3IDCA 3FY0A 4GVAA 3PUPA 4WNPA 4DEAA 1KE5A 4QTBA 2XA4A 2VX0A 1U4DA 3QWJA 4JRVA 2BAQA 4XV2A 4O21A 3SW7A 2PMOX 3OC1A 1CMKE 2MROB 3JUHA 3VIDA 5AX3A 5KMKA 4O81A 3C4FA 2QOHA 5IMEA 4EOOA 1ZZLA 1RJBA 3KREA 2OO9A 3QX4A 1G8AA 2R3FA 2IWIA 4O0YA 3LKMA 4GJ2A 5HG9A 3RHKA 4C36A 2PVHA 4CZUA 2CLQA 3L9LA 4GEWA 3MH0A 4QYFA 3A2CA 5FXQA 3RPSA 4BDGA 2C5OA 4FSNA 4PPAA 4BCPA 3FLZA 2ZDUA 3K5UA 4JIKA 2BAKA 4X3FB 5C8KA 5HE0A 3IQ7A 3MH1A 1IAJA 1OBGA 3LFBA 3QFVA 4QMLA 4WO5A 2J0LA 4OGRA 4AA5A 4Z7HA 2W5BA 5HG8A 3R2BA 5KHWA 4FNZA 2VTHA 4D4YA 3UZRA 5EYCA 2ZM1A 4ZY6A 4EJ7A 1MRVA 1YLAA 2GHGA 1VEGA 2R3PA 4F1IA 3R02A 4XP3A 3H3CA 4KKGA 2YJSA 3GUBA 4M0ZA 4EOKA 2X2KA 4FT3A 4AGWA 4RVLA 4BDIA 3A61A 2WHBA 5HICA 5HTCA 1GZNA 1JSVA 2VTOA 3UOLA 5L8KA 2JKQA 2BWBA 4Y83A 3LLAA 3ROYA 5DN3A 1WBWA 2ONLA 2XNGA 3O8TA 5ANKA 5AR3A 2BTSA 2QODA 1H00A 1YXXA 3TV7A 3ZLSA 3CQWA 4MNEB 4QQJA 4NJ3A 4DGNA 4ENXA 5KMIA 5LVPA 4DTAA 5E8XA 2VO0A 4JR3A 3V01A 4ERWA 3RPYA 1SYKA 2UZUE 3PA3A 3DZQA 4HW7A 3R71A 5KMOA 2GSFA 4M68A 4LL0A 3UNZA 3A8XA 1O6LA 1W98A 1KV2A 3Q9WA 4D28A 4ZZOA 3ZLXA 4O0RA 1A5TA 3OEFX 4WNMA 5CU3A 1ZWSA 1H28A 3AQVA 4D2RA 3UTOA 2WO6A 4I6BA 3TZMA 4F0IA 3AMYA 1URWA 4I94A 4F7LA 3RMFA 4A7CA 4FZ7A 3QTZA 3UO5A 5IQGA 3TNHA 2H34A 5AADA 2AUHA 2XM8A 3D2IA 3EZRA 2VO3A 3AXWA 3BYMA 4X3JA 2VU3A 3DXPA 2MR9A 3R7UA 4TN6A 3W55A 3WYXA 4AW2A 3PY3A 3PVUA 3QRUA 2PE1A 2UW6A 1YWRA 3S1HA 4O0SA 4HVDA 3CEKA 2UW8A 1T45A 5ANOA 2BZIB 1SNXA 4UY9A 3ROCA 4TYIA 4LV8A 4FK3A 5IDNA 2K9DA 2VAGA 1WR1B 4TYHA 2Q83A 1OI9A 3JPVA 4X2FA 2C5VA 1VDLA 2A2AA 4Y73A 2C5NA 4WNKA 2OXYA 3RZFA 3WILA 3MVMA 4Y5QA 4DHFA 1DO2A 3B89A 3PA5A 4LGGA 4XH6A 2WZJA 5A4EA 3GCQA 4IX3A 1ND4A 5DOSA 4B8MA 3A7JA 5HKMA 3MY1A 1UFZA 4LUEA 3NNXA 4TNDA 3FZSA 4NWMA 4C4EA 4QMTA 1H1SA 3BELA 4M97A 4PL5A 4O27B 5M4CA 4I6QA 5JRSA 1H26A 4F9CA 5E8SA 4G6NA 2VO6A 3VS5A 3QUDA 2HELA 3D5XA 4AA4A 5BNJA 3NYNA 2OICA 5AR2A 4NYEA 4YZMA 2E2BA 3K9OA 2X2MA 1IXSA 2JLDA 5BUIA 4AZSA 1GY3A 1XBBA 4FTIA 3IPHA 4ZP5A 3ACJA 2XRUA 2Z7SA 4FIEA 2GDOA 5L2QA 4DEIA 3JVSA 4WOVA 3OCGA 4YJSA 4CV8A 3NR9A 4HGLA 3SC1A 2Y0AA 4M12A 3VW8A 4JX3A 2H9VA 5DMZA 1XR1A 2ZV7A 4BDDA 5CAVA 1CKJA 4RVKA 5HLPA 1Q8UA 3LQ8A 4YJOA 1PF8A 5EDPA 2P0CA 3F7ZA 1OECA 1PJKA 4PTGA 1UWJA 2OG8A 4FSRA 2GS6A 2UW7A 5AAFA 4EZ7A 2X9FA 4FL2A 2XK7A 3CC6A 4CMOA 4JS8A 4DINA 4LGHA 3BPRA 4XUFA 5A14A 1Q5KA 3PE1A 2YIXA 4R6VA 4EQMA 2P2HA 5HEZA 4O7LA 1OIUA 2OFVA 3PWDA 4LV5A 5DT3A 4MD8E 3TUCA 3ZM9A 4F1OA 3OW4A 1IASA 2JDTA 3LHJA 4CQGA 4V04A 5E4HA 3QTXA 4I5CA 2VN9A 3TN8A 3DDQA 4FUXA 5FP6A 4YU2A 1VYZA 3EQIA 3IO7A 4IXPA 3W2QA 5GINE 1OKYA 2XIZA 3D5VA 4C38A 1R1WA 3HP5A 4TY1A 4IW0A 5EW3A 2XK6A 1YI4A 1DI8A 3KB7A 4FGBA 4OUCA 1NXKA 4CEGA 1TKIA 4FTLA 3CGOA 4HOKA 4MX9A 3AC8A 3R1YA 4QMYA 5D10A 3DNDA 3VAPA 4QPAA 4JR7A 4Q9ZA 4QMNA 4A4LA 2UVYA 2O3PA 4D2SA 1QL6A 4EHGA 3RJCA 3MH2A 3POOA 5AFVA 1J1CA 2XK4A 2ZM3A 4I3ZA 2BRMA 4N70A 5ACKA 3KL8A 1IR3A 2OZAA 3OOGA 4P7EA 4BI1A 4F99A 3TV6A 3W8QA 3G5DA 2QOQA 1KE8A 3Q04A 4KSPA 4X3FA 5J1WA 4FEUA 5HBJA 4WG4A 3PTGA 3UMXA 5IPJA 3ID6C 5AA8A 3OXZA 4RIXB 4IVBA 4PP9A 2WOUA 4GS6A 3FPMA 5I0BA 3OWPA 3NSZA 3R8PA 2OWBA 3QD0A 4TXCA 5CAUA 4KBCA 5JFSA 2OU7A 3QQFA 1EFUB 3P4KA 2ITPA 4YUQA 2OH4A 2XM9A 3RNYA 4DGMA 4FK6A 4QYYA 3TDVA 5IDPA 4DH7A 4MAOA 2IJMA 3OT3A 3ZEPA 3FZOA 4FSWA 1KOAA 3BU5A 4XG2A 5C8NA 4JDHA 3QZHA 1LP4A 2YCQA 4E4NA 4AFJA 4BTJA 4RZWA 3G6HA 3F7WA 4UX9A 1VR2A 3W10A 2XCHA 3DY7A 1QCFA 4KRDA 1VZOA 3F88A 4NFMA 3S0OA 3MVJA 1AIPC 4IAAA 4GIIA 2CGUA 2WQMA 5DA3A 2Y7JA 4FSUA 5C8MA 3QC9A 4M67A 4QOXA 2C30A 4L43A 2W05A 3UQFA 4FIJA 2HWOA 3FE3A 5FTOA 2FB8A 5FTQA 4BCKA 5HVJA 4KIPA 4O7RA 5IQCA 4QP9A 5HG5A 1LPUA 2YWVA 4FKRA 5DFLA 4WSYA 5E8UA 2B54A 4D2VA 2XB7A 2PUPA 4FI1A 2EWAA 4WG5A 3QD4A 4EHVA 4F65A 5CENA 1Y8GA 1G5SA 1BL7A 3AT3A 5ANGA 4BIDA 3GT8A 4XRLA 3LJ0A 4GUEA 4IH8A 5DFPA 2R3NA 4D2WA 4DG3E 1WBVA 4AU8A 4DBNA 5AX9A 4DLJA 3EL8A 2C3IB 4DTKA 5AWMA 1ZYSA 3LFQA 4RWLA 5IUHA 3DKOA 4X2GA 1R0PA 1QPEA 3SD0A 3BIZA 3RKBA 4FYOA 4K9YA 4IZAA 4TYHB 4HGSA 3KXHA 2CJMA 5CNNA 4YLJA 4X21A 5CX9A 3FZTA 1SNUA 4CKRA 5IH6A 3QKKA 3ULIA 4OTQA 5J95A 3ORNA 4ZIMA 2C6MA 5FP5A 4GYIA 4F0FA 3O7LD 1IA8A 2I6LA 1H1RA 3LM5A 3PPZA 4GYGA 3WZUA 5DH3A 2QVSE 4RJ5A 2PK9A 5FRIA 1WBTA 4LM5A 2XNNA 3I5NA 5HBEA 4FE2A 3I7BA 4AZEA 3L9NA 5BX0A 2UZEA 1RW8A 2R0UA 1GIHA 2EXMA 3COKA 3V6SA 3RAWA 4OTPA 1ZLTA 3KRWA 4QMWA 3OROA 2GTMA 3E3PA 3ZM4A 3DB6A 5HGIA 3R7IA 3PSBA 2XNPA 1ZMUA 4FV7A 4DC2A 2J0MB 2PMNX 4JJRA 3QF9A 4PNKA 5JK3A 3AC2A 3BCEA 1WBOA 5CSXA 4WHZA 2VTLA 2CKOA 2QOIA 3LCDA 3PP0A 4P90A 3ZO4A 5K5XA 2UUEA 1OUKA 3ENMA 3P79A 1WGNA 3ACKA 5LVLA 3CE3A 3OTVA 4O7SA 4NIFB 5FEEA 5C03A 4ZJJA 2Z7QA 3UIMA
chains in the Genus database with same CATH superfamily
4ZXTA 3NCGA 2DUVA 2PVYA 3U5ZB 2BZJA 1UM8A 4D9UA 4X6QC 4EH6A 3SXRA 4GH2A 5F95A 5C27A 3U55A 2XK9A 3MDYA 5T6KA 4AZVA 3F5UA 2JXNA 4V0GB 1M7NA 4P4CA 2W1DA 4I92A 2OXXA 3H4JA 2ZYBA 4QMPA 3EQRA 3LQ5A 4KS7A 3K92A 4RIYA 4NSOB 4QQ5A 5HIDA 4RX5A 2UV2A 2CFOA 3RK7A 4R1YA 5AV4A 4IBCA 1R5LA 4I23A 2PULA 4WURA 5FWKK 3EB0A 3E7OA 1KFVA 2WEIA 3L1SA 1W84A 4ZTSA 4CMTA 1OKSA 2HZNA 1FOTA 1RDQE 3RNIA 2LH0A 4FZFB 5GIOE 1KSFX 1UKIA 4YBKA 3FD9A 2OBJA 4OR5A 5GJDA 4XNEA 5AR3A 3EKKA 1GO5A 1IQPA 3F2AA 3FDNA 3DV3A 3WF8A 1I44A 2QBYB 1YXTA 2SRCA 5A3XA 3CF0A 1SXJC 3AL0C 3GOKA 4XV3A 3UC4A 1TGUA 4RNAA 2O8YA 3QQKA 4FOCA 3J2PB 2JIUA 3PIXA 2I0EA 2JC6A 3EMGA 5EYMA 4ENYA 4NL0A 2C5YA 2A4LA 4DHJA 1IY0A 2B52A 3TKHA 5HHWA 4LQMA 4O84A 4IC8A 5L2SA 4NOOB 5M4UA 4GT3A 2EA0A 4G4OA 2ZDTA 3EN9A 5H9BA 4HVSA 2RG6A 3BHVA 4ALUA 2W1FA 3I60A 2PWLA 2C1BA 2Y8OA 5JGDA 2DZOB 2VWUA 1LTMA 2GFSA 1JSUA 3FI4A 3FMNA 3FZ1A 2VWXA 3GCSA 4NC6A 4IAKA 2ZJWA 4JQEA 4R3PA 3BLRA 2V1UA 4D58A 4N4SA 4FA2A 4IEBA 4G6LA 5IH4A 2IPXA 3VO3A 3ILKA 4BI2A 3D8LA 2R4BA 1V0PA 2WMSA 4Y95A 5IF1A 4EI4A 1XKKA 2VDBB 3KP1E 4BB9A 2GNHA 2ITOA 2IZUA 4DTBA 4S12A 3OCTA 4C62A 1HCLA 4DGGA 3MFUA 1OAIA 4IJPA 1ZYLA 2OJJA 4QMVA 4RIOA 3UOJA 4I8OA 2C6EA 1C7YA 4EKKA 5EM5A 4I0TA 3ZO3A 5AUVA 3O23A 5TR6A 4FWHA 5DLSA 3PFIA 3ZUUA 4ANLA 4E26A 4GG5A 4EK5A 2FFJA 4BDCA 3RZBA 3DJ5A 3B74A 3EFLA 4YZBA 5C4KA 4FV6A 3CKWA 3HU3A 4Z8XA 4IHPA 5I9WA 2C5RA 4NW6A 3ZFYA 4F9YA 4B7HA 3M42A 3BLAA 3MS9A 5IA5A 5IEVA 3LJ1A 4A06A 2OXDA 2X1NA 2ZB0A 4FUYA 2BRHA 4NZWB 3ZRLA 4QMZA 4LDTA 4JXJA 4LJ5A 2QLQA 3AG9A 4PMMA 5HVYA 5LMAA 4I5MA 1J91A 4U7ZA 5DPVA 4EC9A 4MGYE 1O6YA 3F69A 3T3VA 3ZFMA 3HKOA 2JAMA 3R1QA 4RWIA 3CKXA 5GZ9A 1A48A 2DWNA 3QRTA 3ZRMA 4IWPA 4EBWA 3VS1A 2BWEA 1UNGA 3GLFA 4X3FC 4XEYA 3BYUA 3V5LA 1WIVA 5EYDA 5E92A 5BVKA 2HZ0A 5CQUA 4G3FA 4QMUA 3VLFB 2JY5A 5AAGA 4LI5A 4PY1A 4C61A 4DF3A 3VW6A 3DTCA 5M57A 1GNGA 4R7IA 2XAMA 4FV9A 2ETMA 3ORPA 4XOYA 3AV0A 3LCVB 4JYAM 3GC9A 3TI1A 4AQKA 3C1XA 3PRIA 1FMOE 2XZSA 2E9NA 4CYJA 3QTQA 4KB8A 3R22A 4IE9A 3RE8A 3MV5A 3RGPA 4U8ZA 3BKBA 3VHKA 5I9VA 5JKGA 3W0SA 3HHYA 2JDSA 4QRCA 2OPFA 5JI3E 5FDXA 2I0HA 4GKJM 4MWIA 4DFLA 1W5TA 5BMSA 5T3QA 5GJFA 4CFNA 3UIUA 4D1SA 4U97A 3T8OA 1TFFA 3N4TA 1WZYA 2R3JA 3M6AA 2GQSA 3VVHA 4DV7M 3DBQA 4L52A 3TPZA 3R7OA 4MD7E 1QAQA 1XO2B 2WMXA 4JL9A 1G3IA 4ZTHA 3HMMA 3HJSA 5C1BA 4YY3M 1J1BA 3HUCA 3K9PA 2X9EA 4XOZA 4AZWA 4CT1A 4IVAA 5LMNM 1JSTA 3ALNA 4JG8A 4MGIE 4TRLA 3ORXA 5HBHA 2Z02A 2O2UA 5HCYA 5HI2A 4JDIA 4EOMA 4JG6A 5CASA 1P4OA 4FKIA 4JLCA 3DCVA 2OKRA 1Q39A 5BVWA 3TNWA 2FS1A 4WT6A 4ANBA 4GC5A 4ACDA 1UU9A 3ORZA 3SW4A 4AZTA 4G9RA 4RJ4A 3SHFA 2YM7A 3FAAA 5H2UA 4EOJA 3FXWA 3CP9A 3NUYA 1ZMVA 1JQHA 1M17A 3T1HM 1E1XA 4RRVA 3P78A 2UXBM 1Y8YA 2K6BA 2XZFA 1YKRA 2HW7A 2OFUA 2WMBA 1Y6BA 2APLA 2EXCX 3Q5ZA 4L45A 3BE9A 2R4JA 5EOBA 1Q3WA 1OM1A 3AD5A 2Z8YM 4TWCA 3H30A 4YP8A 3QC4A 2W5AA 4RWJA 4JAIA 3GLIA 2ERKA 3LIJA 1IG1A 1GL6A 4L3PA 3FWQA 2BDJA 5L3AA 4TT7A 5EHLA 4XK8F 2B4SB 3ITZA 5FTMA 4GFGA 4USFA 2WQOA 3C3DA 2LHCA 4UWYA 4E6AA 2PUIA 1NNJA 4BTFA 1GJTA 2WPAA 3ELJA 1AQ1A 3PXFA 2YJRA 3BHUA 1ZOGA 4L6QA 2BRNA 2QO2A 3QA8A 3ZMMA 1Z59A 1P14A 2W7XA 3COHA 1JR3D 3KF4A 4PV0A 2H8HA 4KKEA 3R2YA 2YERA 4N0SA 2HHHM 3VRZA 4EK8A 5GZ8A 4E6DA 3P08A 2AQXA 5KMJA 4JBOA 4NIFA 3NX8A 4QDVA 3II5A 4FIIA 3GNIB 2F7ZE 5AR8A 4M9XA 5BMMA 2DKLA 4G34A 4NJDA 5IQDA 3MFSA 3WE8A 4BZOA 4L78A 3GQIA 3MPTA 4L68A 2F4JA 5HNIX 3JS2A 4YMJA 3PLAE 3EFJA 4WKQA 2IVVA 4JMQA 3O0GA 4F2LA 4Z7GA 3TV4A 4FL1A 2PVMA 4O96A 4KSQA 3VFDA 2GS2A 3U60B 2QO9A 3FL5A 4YLKA 3U6HA 3I51A 2R3KA 3GLHE 3HHXA 5A2QS 2VO7A 2R5TA 4XP2A 5EJCA 2C68A 3O96A 5CU6A 3DOGA 3QTUA 3U61A 3F5XA 3DLSA 4KIQA 4BBAA 3F3UA 2BJWA 1B6CB 3W0LB 3GPYA 1XMQM 2BCJA 4AW4A 4FTQA 2HYYA 2QHOB 1PXIA 2XSZA 1CKIA 4FICA 4R7HA 4XV9A 4HPUE 4DR3M 1FGIA 4X2NA 5CI6A 4OBPA 3LCSA 4I0SA 5FTKA 2GQRA 5EW8A 4ID7A 4CG9A 1M7QA 2OF2A 1M14A 2VWWA 2PVNA 2LAVA 4AKGA 4KUJA 5L8RF 3Q60A 4B08A 3IS5A 3VBTA 2UZWE 3KRXA 2BKZA 3MIAA 2CNVA 4ZSAA 1BL6A 1HNZM 2C6KA 3FKLA 5CZHA 1PJIA 5DG5A 4NFNA 2Z7LA 5EOLA 2EUCA 2O63A 4M9ZA 2QPAA 4OTGA 2E9VA 3EQGA 3I79A 4IVDA 4L3LA 3P7BA 3FKOA 4Q5HA 4JDJA 5HU3A 2IZSA 5FTLA 3A46A 4G3CA 4M66A 3Q8GA 4HCTA 2FSTX 4ZZMA 5BUJA 1YI6A 5BPVA 1RQQA 4DT8A 1D0KA 2J2IB 1OMWA 3BYVA 1X37A 3PE2A 4FKVA 4WP2A 3QGYA 4ARKA 5DVRA 1R39A 2IW9A 2ONLC 4X2JA 3ZBXA 3TKUA 1MX0A 2A0CX 3ZOSA 3JY0A 5ANIA 2XSZD 3NW7A 5LVOA 4YC8A 4D80A 3UDBA 5BR8M 4ASXA 2UVXA 4CLIA 5L2TA 4C4IA 1ST0A 1Z5AA 3QAME 5ETFA 4BYJA 2OZAB 5D12A 2I1MA 2YEXA 3LXPA 4QNRA 2GNJA 3B8QA 5E8YA 2X4ZA 1IN8A 3F3TA 5JZNA 4DFNA 3PY0A 2B0QA 5BUEA 3ZH8A 3D5WA 5E1EA 5EXTA 3SXSA 5HESA 4RFMA 3VF9A 4O82A 1OPKA 3QWKA 3ZLYA 4CQEA 4L9IA 5DGZA 2CGVA 4U3YA 2VTAA 4XG7A 1PXKA 4RG0A 4QTDA 2JIIA 4DHZA 4L01A 5K4JA 5DYIA 3R9XB 1NVMA 3QWLA 2Y0QA 2WTDA 4WUAA 2R46A 4PTCA 2QU6A 3FPQA 1IEPA 3TMOA 4PPBA 5E9EA 5HX8A 3FUXA 3SBJA 2B9HA 2Y6MA 3NCZA 2JDVA 3W16A 3KXGA 4I4EA 4J97A 4MHAA 3DB8A 3PVGA 2W1EA 3GC7A 2LVAA 4O0TA 1Q99A 4XP0A 3TWMA 2O5KA 3EQDA 4BWKA 3UBDA 1H0VA 1O6KA 3CTQA 3JR5A 3OCBA 4QMXA 2R7IA 3C50A 5IA1A 3DQWA 5EP1A 2PMLX 3BBZA 4AGCA 3AOEC 3CTHA 2YZAA 3MESA 3R1NA 3C9PA 5LMUM 3DZOA 2ZV9A 3W2CA 3PRFA 2Q83A 1FPUA 4PDOA 3GP0A 2XVDA 1W83A 3FSKA 3NUXA 3O17A 2B7AA 4IBIA 4JVGA 4RX8A 3FSFA 3GXLA 3OS3A 4FKPA 4HZRA 4W4WA 2G8LA 1HCKA 3QALE 5CF4A 4G3EA 3LQRA 5LWNA 2PYWA 2ZVAA 2YR0A 4D81A 5EI8A 4YTIA 4FKSA 1NJFA 3TL8A 1W7HA 4IFCA 3TKIA 2RF9A 3CPBA 5E8ZA 3VBXA 2PZIA 5BYZA 1OKVA 1PXMA 3VRYA 4BCHA 2HY0A 2WAJA 4BKZA 4DH1A 1JNKA 4NH1A 4U81A 4ZMFA 4QPMA 5KMLA 4V01A 3U4WA 2R3IA 2Z2WA 4CJ6A 2X4AA 2G9XA 3OUKA 5DYGA 5FQDC 4UMQA 3QZIA 5FUTA 1ORYB 1XH6A 4FSMA 3IOPA 4PX6A 5CVGA 4J1RA 2C6DA 5KKRC 5EKNA 7CATA 5A6OA 4DH5A 5CSPA 1H8FA 5HLNA 2XJ0A 4DR4M 2VWYA 2UZNA 4I6LA 3QUPA 4HZSA 4RIWA 3QZFA 5HU9A 1OL6A 5DI1A 4JT3A 1F5QA 2PVLA 4JI6M 3IW4A 1XB2B 2NPQA 3Q9ZA 3ZLWA 1WCCA 1LEWA 2HCKA 4G2FA 3R30A 2W1GA 4IB1A 4EC8A 1K2PA 4OTRA 2FGIA 2G01A 4FTOA 4I4LA 3GQ5A 4OT5A 4NM7A 4R3CA 4C2VA 5GKNA 1ZAOA 2VTSA 3NYXA 3A42A 4AAAA 3LMMA 2UZOA 2GTNA 3P0MA 4BRXA 5C26A 2ZTCA 3W2SA 4RIWB 3QTRA 3TNPC 3SMSA 3SAVA 5A4LA 3WOWA 1SXJD 3DPKA 4D4RA 2B9JA 4JOAA 3GLGB 4FIFA 4BCFA 4HL4A 3BOSA 4USEA 1FVVA 4AXEA 4Z6YA 2BFYA 2FSMX 4YJRA 4AUAA 4O7WA 2PVKA 2J50A 2XLJA 4BICA 3CPCA 4H36A 1QQWA 4K6ZA 5M44A 3KY2A 5CY3A 3UE4A 2WIPA 3C5UA 5ETAA 2XANA 4RJ3A 5CF5A 3PG3A 2UZBA 2YAKA 5CALA 1C1KA 4O7RA 3U60A 3NNVA 4R71A 3UG1A 1OPLA 3MTFA 4AGDA 3GO8A 2NRYA 2ETRA 4FNYA 4ZSJA 1Q8WA 2X0PA 5LARA 5KUPA 5EQYA 2JY7A 2DWZB 2F2CB 3HDNA 4LYNA 4M13A 3V5QA 2IZRA 4Q5EA 3CJGA 3W1FA 4WUNA 1OBDA 2X8AA 4UV0A 5CEKA 4II5A 2XRWA 3QQGA 3KVXA 3ODZX 4LOPA 3VQUA 5K4IA 1JR3A 2BJVA 4G4QA 3U6OA 4RMZA 1Y6AA 2IEWA 4O1OA 2YM3A 3QXPA 3ZC5A 4I6HA 2W99B 4QP2A 1GOLA 2XFSA 4AG5A 4V0GA 2JD5A 3L9PA 2V5QA 5E8WA 2JZ0A 2QOKA 3C0GA 3O7LB 2DNAA 2J7NA 4LJ9A 1TH3A 3KN6A 1OKWA 2WMQA 3IGOA 2JY8A 3N9XA 4FT9A 1XQZA 4M8TA 3FMHA 3GBZA 5LVMA 3PFYA 4JNWA 1NW1A 3L8VA 4DG2E 3NYOA 4EOSA 4IIWA 4LG4A 3BWJA 4U44A 3UO6A 1G8SA 3DK3A 2JBOA 4QTAA 4TYGA 2V6ZM 4L8MA 3EN5A 4RZVA 3BBWA 3CJFA 2YM4A 1N34M 2C47A 1G8PA 1G8JA 4ZMEA 5K0KA 2F57A 4O2ZA 3PJ3A 2VF7A 2VTJA 1BX6A 3DT1A 4HVHA 3DAJA 4I81A 3NUSA 2FH0A 2JA2A 4M0WA 2ACXA 2GFCA 3R21A 4IBMA 5CT7A 2R3MA 5CVHA 4C8BA 4EQUA 1NT2A 4BCJA 1ERKA 4BTMA 4MQ1A 3ZO1A 1K3AA 3WZEA 2VTIA 4CRLA 3GU7A 2UUAM 3WI6A 3LVVA 2BUJA 4JX7A 4QP6A 4Y5HA 4MXYA 4P16A 3U6CA 3KQ7A 3VQHA 4F70A 2W06A 1PXOA 5K9IA 4D9TA 5IH5A 3QQHA 4W9WA 3QLGA 1SZMA 3WF5A 3B9PA 4M9SA 4OBOA 3UYSA 4UN0C 3R6XA 5FXSA 4XBRA 4D1XA 1Q62A 4LUDA 2JGZA 4DV0M 3DOAA 2UZVA 3BRBA 4NL4H 3WE4A 4KT0F 1QANA 4G3GA 2R62A 4MBJA 3K3IA 3SOAA 1I4WA 4R3RA 2W9ZB 5EXSA 4IBBA 4IADA 3LAUA 2R44A 2GU8A 4FVPA 5ITRA 3HHZA 4PL4A 4CV9A 4PP7A 3PPKA 3PVSA 3A62A 5CLPA 3I81A 1L3RE 1OL2A 2PE2A 4ZAUA 3PP1A 2QC6A 1XHBA 1IN5A 2DVWB 1Q3BA 1LR4A 3RAIA 2UW3A 1YOLA 2C6LA 3HA6A 4FTRA 1GVNA 4MYGA 3TTJA 4YHFA 5ANJA 3U6IA 2M60A 3CXWA 3H9FA 4O0UA 4F1TA 2VIIA 2AYPA 5CAPA 4IM0A 2QR8A 5HD4A 5EQPA 3ORIA 5AIRA 3NW6A 3V5WA 3UK6A 1K3WA 3K8ZA 3PVBA 5AV0A 2XBJA 4E5AX 5FDPA 2GHLA 4ZJVA 5I4NA 3UZUA 4IIRA 3J81S 3NUPA 1IBMM 2VV9A 2ZV8A 3T6PA 1PJSA 2QCSA 3FMKA 3G51A 4IM3A 4MXZA 4GMYA 4AXDA 3V8WA 1Q8ZA 4B3TM 3F9NA 2QHMA 4FZAB 2Y6OA 1JPAA 4ASDA 4F78A 1D0LA 4H3QA 2R3GA 3LQ3A 1PXJA 1YDTE 4BL1A 2G1TA 4BZDA 3OBGA 5E91A 3R9RA 4PUZA 1GIIA 5EG3A 5LQFA 4DFBA 1HQYE 3A8WA 3M2WA 4LCBA 4KNBA 4ZOGA 2VNYA 4NEUA 5CF8A 5EM7A 3R8UA 2BNKA 2OIQA 3QCYA 4XLVA 5FSWA 4DHIB 5AEPA 2GNLA 2EKKA 1SXJB 3QHRA 5CAOA 3R8MA 5I9YA 3R73A 5D1JA 4GKHA 4I21A 4D4VA 2X8IA 5CQWA 3CY2A 4I24A 4BN1A 5L4QA 4CHTB 2XKDA 3OTUA 3FC1X 3MPMA 3FTFA 3VKGA 1UV5A 4LF8M 2ZV2A 3J7AS 1DGGA 4IQ6A 5LCKA 4FV2A 1V0OA 2I40A 2JDOA 4FMQA 4UYAA 3NYVA 5D11A 1QVRA 3GRRA 3I6WA 4LZZA 4FTUA 3QHWA 5KE0A 1IY2A 2Q0BA 4XHKB 4IWOA 2F5PA 5LJJA 3HV3A 1MU5A 2XEZA 4DV6M 3CD3A 1J3HA 2HWJA 2Y20A 4W4VA 5EHYA 3W2OA 2R65A 2GPHA 5AV3A 3GENA 4FKTA 5HVKA 3UC3A 5IT9S 1SXJA 4H3PA 2C3KA 3IG8A 3B7ZA 2NQ8C 3T1YM 3FMDA 4DEEA 4IZ5A 5CI7A 3VBYA 3R9OA 3M11A 4FL3A 4PMSA 3MY0A 3QQUA 2CGXA 2P3GX 4Z16A 1DS5A 2I0YA 3MJ2A 3OWJA 4G1WA 4I5PA 4UWCA 1XJDA 1HJPA 2WMRA 5D41A 3UPZA 1YVJA 4YJPA 3UODA 3EN7A 4QEBA 1Q24A 1PRYA 3M1SA 4A9YA 3U6MA 2EKFA 3NZ0A 4QP3A 5AUZA 3E46A 3BBTB 4J71A 3LM0A 5C8KA 4FIHA 3RP9A 4ZS4A 3DKFA 5KQDA 2W96B 3T38A 3BHYA 5TKDA 4MF0A 2WQNA 1S9JA 5E8VA 4GEOA 3C0IA 4MTAA 2NP8A 4L42A 3GQLA 5E90A 2WFYA 3JAMS 3NS9A 3SG8A 4U3ZA 3OVVA 3QCQA 4L44A 4RX9A 4CFUA 3K1JA 3SOCA 5DHJA 4IAFA 5I9XA 4CGYB 2C9OA 4QMQA 2HL7A 1JKLA 4EYMA 5IQHA 4RT7A 3PJ8A 5IA0A 2JZ1A 4H39A 1IRKA 5EW9A 4A07A 5KMNA 5J8IA 1SXJE 4CFVA 2QQ7A 1H1PA 3FLQA 1WHCA 4MQ2A 3G90X 4PDGA 3UOKA 3TJCA 3IHPA 1R0EA 3AKJA 2ITNA 4QNYA 3EZVA 2EXEA 3REPA 4ZLYA 1IFYA 4ANOA 2ZBKB 4EOPA 4QP4A 5HLWA 1YHWA 4QTCA 2PE0A 3BEAA 4F6UA 4F7JA 4F6WA 1JB0F 4FBXA 3FRIA 3DAKA 4JI9A 4YO4A 5F9EA 1NHWC 4NM0A 4YTFA 3HGKA 5EXXA 2GNGA 1VEJA 4AE6A 4B8LA 2XGNA 4C4FA 5I3RA 2WTJA 5AP4A 4IBFA 4XYFA 4FG7A 5A4TA 2RFEA 2KZUA 2QR7A 2WOTA 4EK3A 1ZV1A 1UU8A 2XJ2A 3GRYA 2EB3A 3DGKA 5F94A 4QQTA 5GZAA 5JQ5A 2CUZA 4OTIA 2DWLA 3BEGA 3TEIA 4LJ6A 4LRMA 4B99A 3K5VA 5J79A 2J5EA 3ZO2A 1KE9A 3N4UA 1VEKA 1V1KA 1CKPA 2V22A 2QSFX 3DNEA 4WG3A 3GB2A 2KNAA 3QGWA 3RK5A 3W0MA 3Q6UA 4XBUA 4AACA 3FTDA 5IQEA 2PUNA 4UN2B 4MB7A 3W8LA 3TACA 4AW1A 2C0TA 3O50A 4B9DA 3W0OA 4FKLA 5IA2A 4ZTMA 3NWLA 5FTJA 1IN6A 3SLSA 3JVRA 3AFHA 2X7FA 2UW5A 3FUPA 1DGHB 3PXQA 4K11A 1KYIA 4KBAA 1JKSA 3UZPA 3ML1A 5DE2A 4W4XA 4N6YA 3OTOM 3KS4A 1QYRA 3U4UA 5EI6A 5EK7A 2CN8A 3NIEA 1J7UA 4LF7M 4C7TA 4XS2A 5EYKA 4ASZA 4GT5A 3GLGE 2ERZE 2DZLA 1ATPE 1NY3A 2WTCA 2LGCA 2QOLA 3OXIA 4TWNA 4TYEA 5CEQA 3NGAA 2IG7A 4OW0A 3TDWA 2RFDA 4GH9A 3PWYA 3AOEA 4GRIA 3BV2A 4E1ZA 1GLNA 2YISA 2VRXA 5CWZA 1YXVA 2HZIA 2W1ZA 3L8PA 1FMKA 1P2AA 3GLFB 1VDDA 2YA9A 4GIHA 2OIDA 4C58A 4FGRA 5CEPA 1OB3A 1UNHA 3E64A 5CTPA 3OT8A 4X65M 4BDJA 2LVOC 4BCMA 4S32A 3DAEA 3UDTA 4F64A 4RC2A 2WSCF 5T68A 4PL3A 3VJNA 4BCNA 4E4XA 5CSVA 1URCA 4HYIA 3GQ4A 3G15A 3D7TA 2K47A 3LW5F 4AT5A 1NHGC 5CYIA 2XBAA 4AW5A 3KCFA 1AD5A 3H4MA 3RGSA 1E9HA 1VEBA 2E9OA 2RIOA 3QTSA 4D1ZA 2DAKA 4KHPM 2YLEA 4AT3A 3WIGA 4FJVA 2R3HA 3PY1A 4OBQA 2N35A 2J0JA 3BV3A 3F5PA 3Q5IA 5IQFA 2W4OA 4B0GA 4JN6A 3VS2A 4D55A 2YN8A 3GLGA 1SVHA 3VULA 4DGOA 1QDTA 5KHXA 4LRSA 3U9NA 3QYEA 3EWHA 4IFGA 1B39A 3P86A 4CFXA 4M14A 3HWSA 1FINA 2X8DA 3O71A 5IUIA 2ZAMA 4UZDA 4I22A 4YSJA 4RSSA 3TE6A 4EL9A 1Q61A 3EQFA 4FCVA 3SYKA 4MVFA 4AA0A 3FJQE 4BZNA 2WD1A 4EZ3A 4LOOA 3COIA 5FBOA 3ZSGA 2WSFF 3ATTA 1OBGA 3QYWA 4XLIA 5JZJA 1DGFA 4EEVA 2X6DA 2BKKA 2GNOA 4CD0A 3TJDA 3AC3A 4ALVA 5A46A 3IW5A 3AD4A 3DTWA 1K82A 4K8AA 5D7AA 5EP4A 2CNUA 3Q6WA 3FI3A 3Q4ZA 4KKHA 2FSOX 4CGAA 2VWVA 2IVUA 3D7TB 4U0IA 3IW7A 4DBGB 4FW9A 4YSMA 3T3UA 3SYLA 3A7IA 3SMPA 2WNTA 5AJQA 4W8DA 2UZDA 3Q9YA 3ZFXA 2VGOA 4EZ5A 2CKEA 3SAUA 1OITA 2ITZA 4H58A 3EQHA 4Q9SA 4BCQA 2XH5A 4NUSA 4YJVA 2LVPC 4M0DA 3LFNA 4J53A 4LJ8A 2G2HA 2Z8CA 4JBQA 5I3OA 2BRGA 3PJCA 1QPDA 1CSNA 3W68A 4FSTA 5DR9A 2Q0NA 3V5JA 4AS0A 2QOFA 2W1IA 4I5HA 5ETIA 1PMVA 3A99A 4EQCA 2MJ5B 2ITTA 2DHYA 3HV6A 3HMPA 5IG1A 4Y72A 4G17A 3S95A 4PMPA 5LOHA 3FKEA 2YIRA 3OG7A 3SDJA 1HQCA 4LGMA 3MGYA 3F2NA 3NDMA 3DFCB 4M84A 2P4IA 4MNFA 4NKAA 1OGYA 5JFVA 3FI8A 5ACBC 3DK7A 5GIPE 2H5XA 2VD5A 3HU1A 2VTRA 3D2KA 4EOIA 3NWWA 5CF6A 3E3BX 3VBWA 4BGQA 3F3VA 4FKWA 4RIYB 5J9LA 1UU7A 4FNWA 3RM7A 3EYHA 4ANNA 3BX5A 5FGKA 4F7NA 3IECA 3FKNA 4QT1A 4FCTA 2WIHA 3RINA 3HMNA 4S31A 4EOLA 1PXLA 1CM8A 3BGPA 5CZIA 4BCIA 2OQ4A 2C9CA 2F2UA 2V55A 3GC0A 4P5QA 5I9ZA 2QOOA 4R1VA 4G4RA 4AN3A 3FXXA 4NSTA 4A4XA 4FVMA 3BL7A 2XNEA 2Y4PA 3ALOA 3BYSA 3V8TA 1PRBA 2DENA 4MBIA 2YDJA 3SQQA 4AF3A 5B2LA 5JEBA 2Y4IB 1Z5BA 3CTWB 5K5NA 4FTCA 3E63A 4TTHB 2EU9A 3HDMA 3PXKA 3R04A