1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
b'HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
3FLSA 1PXIA 4TWCA 4IAFA 2EXCX 2B7AA 2C1BA 2PE0A 4WRGA 4A9RA 4AXAA 3RAHA 4RIYA 4CMOA 2XEYA 4PDOA 4ZIMA 4OUCA 4TN6A 4TPTA 4EK6A 4IIRA 2SRCA 4GK3A 4MX9A 1V0PA 5FDPA 4D2WA 2WMBA 5CVFA 1XH6A 2F2UA 2BRHA 3D7TA 3KY2A 2X6DA 4JRNA 3SKCA 3DTCA 5K0KA 2HZIA 1RQQA 2CWBA 3FQHA 5H2UA 3M1SA 4FKVA 4IX4A 4HVSA 3HRFA 4Y8DA 2C6OA 4F6WA 1H4LA 4K1BA 3WZEA 4BCFA 1Z9XA 4FA2A 4CQEA 4NCTA 1P4FA 3P5KA 3GCSA 4RFZA 2FH9A 4I5HA 4NTTA 4NM5A 5EM6A 2YJRA 2X8DA 1G8SA 4CFWA 4MBLA 1W8CA 2QO7A 4JBQA 4JLCA 3TV6A 2F7EE 4WKQA 4HVHA 3OT8A 2CKEA 2W1IA 2UZBA 1ZYLA 2JNHA 4AU8A 4GU9A 2YCQA 5HG9A 3HYHA 5EM5A 4BZOA 5BVFA 5A6NA 4TTHB 4AGWA 3TZ7A 2PWLA 4QMTA 5HKMA 3M11A 3VW6A 4HVGA 4LGDA 4RJ7A 4EHEA 4BDEA 2YZAA 4IWQA 5D9HA 3SW7A 3FLYA 4RX5A 5JSMA 2JZ0A 4WO5A 1HOWA 1URCA 2CCIA 5FD2A 2RRUA 3RP9A 3UMXA 1SVGA 3U55A 3IG7A 5HIBA 4M66A 4A4OA 5BYYA 2XIZA 4PUZA 4EYJA 3DPKA 4QNAA 2QOCA 4RWJA 4C7TA 2UW6A 5FLFA 4EOMA 4AT4A 5AX9A 3MVMA 4NUSA 1PMNA 2BFYA 3DK3A 2ITQA 5AAGA 1TQPA 2QOLA 3WE4A 3MSSA 4FG7A 3OXIA 4BDFA 1MRVA 2YHVA 3E8EA 3VS4A 4FKRA 5DLSA 4O0WA 2YA9A 5CAVA 5HVKA 4M0ZA 5DHJA 4CSVA 5JKGA 4LM5A 3I5ZA 1WCCA 2ZM3A 2PVNA 4LGGA 4EC9A 4NJDA 1FINA 4HYIA 2QR8A 4UZHA 2GNJA 4BC6A 4BCPA 1T45A 4R7IA 3ZO4A 2C68A 4W4VA 4WBOA 4X3FA 2QQ7A 3MBLA 4Y95A 5EOBA 5BVKA 3NUAA 4KD1A 3R22A 2VGPA 4OTWA 4UMTA 4ZS0A 4GS6A 4MHAA 3AOXA 4GVAA 3V6RA 2XYUA 3MWUA 2JIVA 1WFCA 2WMVA 2B9JA 3A61A 2B9FA 1VG5A 3F7WA 1F3MC 3R2YA 4UXLA 2XBJA 3NIEA 4RIWB 2Y0AA 4USDA 4JIAA 3U6IA 1Y91A 4YO4A 3R02A 2IW9A 1PXKA 3ROYA 5L2IA 3NNVA 2WTVA 4FBXA 3QA0A 4EHZA 4HGEA 4TNBA 2PZPA 3BQCA 4YZBA 3QTQA 4DAWA 3GCPA 4ERKA 3KXXA 3KA0A 2OU7A 4QYGA 4WHZA 2PVRA 4MD7E 2PZYA 2HY0A 3COMA 3WI6A 5B0XA 3U9CA 4BGQA 1GO5A 3N4UA 1J7IA 4O86A 4AE6A 3F2RA 4JQ8A 3LJ1A 3LFFA 4YLJA 2WNTA 2YCFA 2R3HA 4QP8A 4R3RA 5F4NA 4A4LA 4F6UA 5AR4A 1FGKA 1O6YA 2XA4A 3HV6A 5CZIA 3TTJA 4AGDA 3W2PA 1YDRE 2YM4A 4AQCA 4B4LA 4IM2A 4I21A 4JOAA 5DR2A 4BCGA 5KMKA 2OO9A 4IB0A 3UP2A 3E87A 2WIPA 5EI6A 3P86A 3MVHA 4QPSA 4ANLA 2LTUA 1Q3DA 4QQ5A 3V8TA 3QX2A 4E5AX 5CENA 2YCRA 2W17A 4C8BA 3HRBA 5AUVA 4HNFA 3SXFA 4QMNA 5M56A 4NEUA 3ZRLA 4ZTSA 3R01A 3C51A 4TWPA 2QNJA 2JBPA 1BMKA 3LXKA 3QLFA 3RBWA 4QMYA 5AMNA 2CKPA 4CG8A 3FMLA 4FOCA 4CFNA 2J0JA 4C0TA 5LWNA 4MNEA 2LGCA 1CSNA 4BCMA 2NRYA 4QMQA 2Y9QA 5KMNA 5IH4A 3KMMA 4PPAA 2C0IA 4N6YA 5DBXA 5F94A 4LUEA 1UU7A 1OKSA 5FBOA 4QP9A 3VS5A 5AUTA 2JFLA 2R3GA 4LL5A 4R6VA 3KQ7A 2C4GA 1DS5A 1VEBA 2E9PA 3R1YA 1DAYA 2ZDUA 5L2QA 5AA9A 4I92A 4XRLA 2QG7A 3VUKA 4X2FA 1ZOEA 3RTPA 2QOHA 1NVSA 3QUDA 3BYUA 3F69A 4GVJA 5K5NA 2UW4A 2B55A 3TKIA 2A27A 1V92A 3NYXA 2XM8A 4HW7A 3RKBA 5CASA 3QQUA 3VULA 5BQ0A 2Y8OA 3PY3A 2ZDTA 1YHWA 4XG3A 4CZUA 4OW8A 3PXKA 5CAQA 1H00A 2RG6A 3F9NA 2WPAA 2WQMA 3VRZA 4XMOA 3GU6A 1NVQA 4I22A 2E2BA 2QVSE 3KRRA 4UMRA 4G6OA 5AEPA 5BX0A 1QPDA 4M67A 5A9UA 4TYGA 4IB5A 1JSVA 3CY3A 4XG8A 4FOBA 3QHRA 3QAME 4CTCA 4LRKA 4OTPA 3PIXA 4CD0A 3E5AA 4I23A 5J9LA 5HU3A 4A07A 2HYYA 5CT0A 3EQPA 2JITA 2BAKA 2E9OA 3NAXA 4UEUA 3ALOA 2LBCA 2ZMCA 4PMSA 4RT7A 5AIKA 1PXPA 4AAAA 3F5PA 4FIHA 5CU0A 2WEIA 2CNVA 2OI4X 4QOXA 4NTSA 2XH5A 1O9UA 5E8YA 2OK1A 5IA2A 2GNIA 1WBTA 4HYHA 3A7GA 1G41A 3F3VA 3VQUA 4DEEA 1H08A 4W8DA 4FVPA 2QKRA 5CZHA 3PY0A 3A7IA 5IMEA 4MH7A 4A9TA 4BVUA 4EJNA 3JS2A 3L8XA 4PTGA 3ZDIA 3I6WA 3ZRMA 4EH8A 3D7TB 4PNKA 1XH7A 2WTIA 1TQMA 5HE3A 2WMXA 2CLXA 2VTHA 3KXMA 3TNWA 4EKLA 3Q4TA 2OKRA 4J52A 1XH8A 4C33A 1GZOA 4GYGA 4TY1A 1I09A 3BYVA 2YFXA 3CKXA 3JUHA 3W2OA 4ZXTA 3K9PA 2OO8X 3FZPA 4L3JA 1KYIA 3U4UA 3ZM9A 1WBWA 2I0HA 3IOKA 3KC3A 4ANMA 5DT0A 4BF2A 4R3CA 1M7QA 1J7LA 4FIEA 4O7TA 4JBPA 4JI9A 4AW2A 3DNEA 4J99A 3CC6A 4O7WA 2BRNA 4O6LA 3FV8A 4YHTA 4PTCA 4YPSA 4CZTA 2JDVA 2OIBA 3I5NA 2OJGA 4ZSEA 3TACA 3WF8A 2WQEA 3GOKA 4NKAA 4Q5EA 3MIYA 3GLGE 5HESA 4FEVA 3LFAA 2PMOX 4BKYA 4GSBA 3EFJA 3HECA 3NR9A 5B2KA 3H9OA 3PSBA 5ANKA 4DEDA 2BTSA 4EQUA 5KO1A 1PGYA 2IWIA 3DBFA 2A4LA 3Q9WA 5DRDA 3MMPA 2CKOA 2WAJA 3VHKA 5HTCA 4GRBA 4OT6A 3AMBA 2XRUA 5EQPA 2JDSA 5HBHA 4IMYA 2V62A 3MY0A 4F9BA 3EQRA 3MY1A 3V5LA 3CCNA 5A4EA 4YJPA 3JY9A 1APME 2W4KA 2DQ7X 4BYJA 1XKKA 2X9FA 4EZ7A 1ND4A 4RSSA 3E63A 3ORMA 1UKHA 3BHYA 4UN2B 2VWIA 3O8TA 3ZMMA 5D7AA 3DAEA 4DLJA 3R1NA 1SVHA 4GK4A 4FZDB 4YR8A 3GU7A 2XKFA 3KRXA 5DE2A 2W4OA 2IG7A 1OL6A 3FC2A 3THBA 4FSQA 1JKSA 1VDLA 2X7GA 4LRJA 3NUSA 2VWBA 3G9NA 4D2PA 5CI7A 1MUOA 4QP4A 4YTIA 4ZTNA 4FEQA 5BVDA 3LE6A 5DN3A 3OVVA 4X3FB 4M14A 4MXCA 4MVFA 3FC1X 3S1HA 4ZJJA 5C8MA 1V0OA 3E3BX 3ITZA 1CUKA 2OZOA 3WZDA 4BYIA 1NY3A 2WTJA 4CYIA 4Z9LA 2HZ0A 2WU7A 3QWKA 4GK2A 4IVAA 4L9IA 4P90A 5L8LA 2C5OA 5CSHA 4FV5A 4LUDA 5AUUA 4PMMA 3BQRA 3W8LA 5CEIA 4D1XA 4IZYA 4DA5A 5CU3A 3GQIA 3RPSA 4O2ZA 2XNMA 2X6EA 1PMVA 5EW9A 4ANOA 2ZB0A 4F63A 2XEZA 2A19B 2UW0A 3OF0A 5HNBA 3ZZWA 3GQLA 1HJPA 2KNVA 3CSVA 4O81A 4XG9A 4O38A 2OXXA 3C4ZA 4RJ6A 1PXOA 4X0MA 5IDPA 4GH2A 4AOJA 3U6HA 1TTEA 2OJ9A 2X39A 4FNXA 3UIMA 3CIKA 4QYFA 3O23A 5EFQA 2J2IB 4J98A 3WF7A 4BCOA 5BUJA 4EOJA 5D7VA 4GFGA 3TCPA 5JI2E 3IO7A 3QRIA 1FBNA 3FUPA 3RINA 4AA5A 3M42A 4ASXA 4M7IA 3V5PA 3Q2MA 4EH6A 2WMTA 3FRHA 4KRDA 3LFCA 4YJQA 3TKUA 4C35A 2CGXA 3MESA 3RPOA 3VBXA 4D5HA 3PIYA 2IO6A 4RZVA 3AC2A 4XP3A 5TKDA 4E5WA 4EOPA 3MH0A 5IEYA 2O8YA 4MBJA 1PXLA 3UG1A 3TM0A 4DTAA 4W9XA 5HICA 2C47A 4ZY4A 3DKFA 4D4VA 3PP0A 5F20A 3TV4A 4QQTA 4EZ5A 3TNIA 4MNEB 4JJRA 4F1TA 3R1SA 2I6LA 4B0GA 4BDIA 4F0FA 4IHPA 2QSFX 2PHKA 3O7LD 4GIIA 3JY0A 4JVGA 4QTAA 3D5VA 1WBOA 2PMIA 4TRLA 2CKQA 2C3KA 3L9PA 3PWYA 3QC9A 1W0XC 3B2WA 4HYUA 1U5QA 2YLFA 2W1CA 2PVFA 2X1NA 3QTZA 4YBJA 1GJOA 3K9OA 4QMLA 4ZTRA 3QTXA 4DG0E 4H3BA 2XBAA 4BRXA 4GG5A 5DG5A 5M51A 5TF9A 3FLQA 4U44A 2R3NA 4FKQA 1J7UA 2HW7A 5AV2A 2F2CB 4QMZA 5HX8A 2YLEA 3IK3A 3QGYA 2LVAA 3K5UA 5E1EA 3VS6A 4DG2E 4W4XA 1OQYA 1SZMA 3RAWA 1YWRA 3SDJA 3BIZA 4S31A 3FAAA 5KZ0A 3R7OA 4ZJVA 1QPEA 3LCDA 3LFBA 4IW0A 1W98A 4DH1A 2ACXA 4UN0C 2R0UA 1IA8A 2WHBA 4F08A 4RJ3A 3OD6X 4W9WA 4MK0A 4BHZA 3JYAA 3BKBA 4MXYA 4BTFA 2PVLA 3QD0A 3ZXTA 4DFZE 5BVNA 3BHHA 4ITIA 4JAJA 5L6WL 1UV5A 4LOOA 4K77A 3G15A 4C3RA 3OCSA 1MRYA 1QZEA 3EZRA 3LMHA 3O8PA 2P2IA 2C3IB 5ANIA 2RGPA 4DEHA 4QYEA 4OTRA 3GC0A 3KULB 3UC3A 3HKOA 3QRKA 4FTLA 4FTJA 4FTRA 5FWKK 3PXZA 4ZY5A 4YHJA 3SD0A 4OBQA 4UV0A 3TWJA 3ZSIA 4FZAB 1P14A 3R83A 3QALE 4ASZA 3E92A 2ERZE 4FTTA 2ZAZA 2CNUA 1A9UA 3Q04A 5CAOA 1WBNA 1S9IA 2V5QA 3H3CA 1JQHA 2EB3A 4IANA 5E91A 5EYMA 4LMUA 1QCFA 3R2BA 1R0PA 4JXFA 3UO6A 5I3RA 2XUUA 3G33A 1UVRA 4KINA 5DOSA 2PVMA 1WZYA 4CV9A 4O0VA 3R00A 3AXWA 4AGUA 3NRMA 4FNWA 4U81A 3ZUVA 2OIDA 4Q2AA 3ZLYA 1R39A 3FZOA 4D2SA 2QOFA 4FKLA 5E8SA 3QU0A 2B4SB 3LKMA 1OBGA 4KNBA 3LFDA 3TDWA 4CCBA 2HXLA 2XRWA 1H0VA 4Z55A 4G3GA 4JIKA 5DT3A 5DFLA 3ORLA 4EH7A 3KXZA 2NNWB 4RQVA 1LEWA 4IWDA 1P3QQ 2XP2A 3ZBFA 2C5YA 2UZTA 3KF4A 4C2VA 3B8QA 3BZ3A 4YJTA 5GZ9A 1H27A 2XK3A 1J1CA 4DLIA 3LCKA 4XP2A 3LCSA 4HCVA 3RHKA 3RPVA 4E5BA 5ETCA 4R78A 2R0IA 1OKYA 3NUXA 4KABA 3W2QA 4CCUA 2BKKA 1W7HA 4FV0A 1MP8A 2ZV2A 5L2SA 5BYLA 2XMYA 3NIZA 4FR4A 3ZUTA 4YJOA 3ZO1A 1BVSA 2YIYA 1FVVA 3UZTA 4ACDA 3ZC5A 4BI1A 3BU5A 2G2IA 3AGLA 3C4CA 4FL1A 4GJ3A 4JG8A 2AC3A 5HO6A 3VBQA 4CV8A 2VRXA 5GINE 2XIKA 3VQHA 1KE5A 3GCUA 2JZ1A 3Q6UA 2J0IA 2QU6A 3FI8A 3WF6A 2W99B 4QYHA 2BWBA 3I1AA 5HU9A 2YWPA 3RNYA 2F49A 1F0QA 5AUWA 2GFCA 2V7AA 4PDPA 3MYGA 3O96A 2DKLA 3PA4A 5FEEA 4PDYA 4TT7A 3QTRA 4U7ZA 3FE3A 4U5JA 3V01A 4NSTA 5M07A 3BGZA 3LCOA 3LFQA 2YCSA 1WR1B 4FTQA 5DFPA 3EOCA 1YRPA 3VUHA 3UZRA 4TW9A 3ZCLA 2DZLA 5KMOA 1KE6A 3OW4A 4II5A 3ZOSA 5BUEA 2H8HA 5DEYA 3OZ6A 4Z7GA 3G2FA 3NNXA 4U42A 2R9SA 3R8VA 4PMPA 1IAJA 3LCVB 3E8NA 3ACKA 4EK8A 3SX9A 4J95A 5L8JA 3DAJA 5C26A 3NYOA 5IUIA 3VS2A 3BGPA 3L1SA 2JKMA 4I41A 4ZTQA 5A46A 2XIYA 5L4QA 5CTPA 3GOPA 4LV8A 5E8UA 2Y4IB 4BHNA 4F99A 4I93A 4KUJA 4KWPA 2UVXA 2VGOA 2CJMA 3GC8A 2LVQD 4ERWA 2UVYA 1J91A 2PMNX 1Q8TA 5FGKA 4C2WA 4F0GA 3R9RA 4AG8A 1IXSA 4BTMA 3KRJA 5CXZA 4F1OA 4RRVA 1BL7A 1PXNA 5HG5A 4D1ZA 1UWJA 2PMLX 3UNKA 4KSPA 3T9IA 3V8SA 3I79A 3IGOA 1YXTA 2MR9A 2JKQA 4I5CA 5AP4A 3F5GA 3LAUA 3PJCA 3MB6A 3O51A 3ET7A 2P2HA 2JD5A 3G0EA 3GXLA 3OC1A 5CVHA 4K0YA 4NIFA 4TNDA 3OXZA 2F4JA 2IN6A 2BRBA 3BEGA 1BYGA 2OH0E 3FI4A 2BR1A 4BKZA 2YISA 3PJ8A 3OY1A 2FVDA 1H1WA 3EIDA 4FL2A 4XHKB 5GJDA 4BDBA 2YM7A 1XO2B 2GCDA 3D5UA 2GU8A 4PY1A 1JOWB 3ODYX 5I9ZA 4IQ6A 4AOTA 4FVQA 4YP8A 2F7ZE 2XCHA 4PDSA 3RALA 3R30A 2I0YA 3PP1A 1M2RA 3OOMA 2C6IA 4LRMA 2BIYA 5CEOA 1OGUA 4O7RA 4XOYA 2HENA 1IRKA 2YAKA 5JGAA 4O0SA 3DXPA 1Q8ZA 3BI6A 3MN3A 2HK5A 3QC4A 4RX9A 2YZLA 5KZIA 4MQ2A 3OHTA 3FLZA 4RFMA 3N9XA 5IKWA 2QD9A 3H4JA 2QHNA 1VZOA 2DUVA 2X4ZA 3VO3A 5A4QA 2R3OA 2UZLA 2VTLA 1VYZA 1GNGA 3H30A 1UNLA 1BLXA 2Z02A 1M2QA 3ANQA 4UY9A 3AT4A 4I24A 4K18A 1G8AA 4M69A 2XF0A 4PNIA 4ZLOA 2ITOA 4O1PA 3AD4A 4CQGA 4NM7A 4EH4A 1R78A 5E8ZA 4DH8A 4JRVA 5TO8A 3BWFA 2WFYA 4RLKA 3FY0A 5K9IA 3EQGA 3F66A 4KIOA 4G16A 4WT6A 5KCVA 3GLIE 2CCHA 1KV2A 3V5WA 3ORPA 1U54A 1XXHE 3FI3A 3ZU7A 2R3IA 5BNJA 4L45A 4R5YA 1OPKA 4XEYA 1UWHA 1SMHA 4Y5HA 3AC1A 4NKSA 3P0MA 4L8MA 2W05A 4TYHB 5J5TA 4I20A 1ZMUA 1URWA 3FKNA 4MNFA 5AP5A 3SG8A 4ACGA 3NW6A 1KE7A 4J71A 1T6OA 1OM1A 2O65A 1V1KA 4HJOA 4S34A 5FM2A 2VX3A 2WQOA 2QI8A 4Q9ZA 5LMBA 2BTRA 4TKSA 2XYNA 4FV1A 2XNNA 5M55A 4FIIA 3V3VA 4C4FA 4CT1A 4PF4A 4XS2A 4KKGA 4QPAA 4ID7A 4PPCA 2VTPA 4FNYA 4BIEA 3PPJA 5HCYA 5C27A 3HL7A 4C02A 4EC8A 2KTYA 4ZJIA 1KE9A 5FTQA 2JY8A 4GW8A 4WA9A 4RJ4A 5JGDA 2C6LA 2OZAA 3WYXA 1ZYDA 3FHRA 5AP7A 4EL9A 1A5TA 1OL2A 4DFLA 3D4QA 2KHHA 3D5XA 3PVUA 4RPVA 5AR7A 5CF5A 2YERA 3GBZA 2E9NA 3FMEA 3I4BA 5LVOA 2FSTX 3OEZA 2VTRA 4L43A 2O3PA 2FYSA 5D11A 4RVMA 1JR3E 3LLTA 3RHXA 4RLLA 4XV1A 1OAIA 4M12A 4QO9A 3RAKA 2C6KA 5CNOA 5CQUA 1AD5A 5ACBC 3ORZA 4CTBA 1WBSA 4E6DA 1YW2A 4U3ZA 1GZ8A 3MA6A 3MFSA 5EDQA 3R9OA 3R7UA 4DEAA 4QTEA 3Q96A 5CF4A 3HDNA 4D9UA 4M13A 4XBRA 3UOLA 3O0GA 3PLAE 5LMKC 4WG5A 3QA8A 3TJDA 3EH9A 3NCZA 5BMMA 1Q97A 3LM5A 4RA4A 4X7QA 3EQIA 4D2RA 5CAUA 4L42A 4RC3A 1VR2A 4O21A 1U46A 2G3QA 1YDTE 2DYLA 2R3JA 3IPHA 5K5XA 2GPHA 3EFWA 4L00A 4MF1A 3NPCA 2QHOB 1F4IA 3RK7A 1W82A 1BUHA 3ENHA 4HCUA 5M06A 3ORXA 4FK3A 4LYNA 4O0RA 3WZJA 5B7VA 4CKJA 3HMMA 2ESMA 3QUPA 2QKWB 1BI8A 1DM2A 2C30A 4D0XA 4IX5A 5TOZA 3AT2A 1AIPC 1ZWSA 3K3JA 2Z8CA 3U87A 4DTKA 3L8VA 2EJSA 2YIQA 2HELA 2IPXA 3EN5A 4LMNA 2W1HA 4F7JA 2WU6A 2VO3A 4MXZA 4ZMFA 4HGTA 2VO7A 4RWLA 4BGHA 5IF1A 3FRIA 1HQYE 4A9YA 4FSUA 4E7WA 2ZYBA 2JEDA 5KHWA 1W84A 3ULIA 2VNWA 5EK7A 2IVUA 5ANOA 3KVXA 3QQGA 1OI9A 5CSVA 5BMSA 2Z7RA 3OUNB 3I6UA 5ANEA 4FKOA 3RMFA 4EH3A 1X8BA 3MPAA 3VWAA 1W83A 2VO0A 1WIVA 2G1TA 4E1ZA 4U6RA 2WKMA 2YDJA 3I60A 5HVYA 3T6PA 3UOJA 4JDHA 4U0IA 3E64A 4FKWA 2XCKA 3NX8A 2IZTA 1VQ1A 1JNKA 3FPQA 3WZUA 5A3XA 3LJ2A 4ANSA 5KKRB 3IHPA 4Y85A 3IW4A 1XH9A 5IA0A 1HT2E 5DH3A 1PW2A 5HGIA 2VWVA 3QRTA 4KBCA 3REPA 2PVHA 2VNYA 4EONA 3E62A 1R3CA 5KMIA 1T43A 1OL7A 1CKPA 1JSTA 2ZMDA 4ENYA 5JQ8A 2J90A 2OJJA 3KGAA 1YXVA 4RVTA 4R7BA 4ZTLA 3G90X 4NK9A 3PVWA 4JNWA 2OWBA 1QMZA 1UKIA 2VTSA 3GI3A 3ACJA 5J87A 3KN5A 3WYYA 3BCEA 4Y72A 2WOTA 4ZMEA 3ELJA 3RGFA 3HX4A 3PZHA 3ZTXA 3OBJA 3QKKA 4G6NA 4Z3VA 5A14A 5M4FA 5FG8A 5KNJA 3QCQA 2B53A 4IAIA 4DH3A 2VTQA 4Y73A 2WMSA 4PL5A 5JK3A 2VZ6A 2YJSA 4KRCA 4RBLA 2L4EA 3LPBA 4J8NA 4PX6A 5TE0A 3VS1A 1H1QA 2VWUA 3NAYA 3NNUA 3QTUA 4PMTA 4AX8A 2VX0A 4E93A 5DRBA 4EK3A 4D4RA 4C34A 3QZGA 3WF9A 3ZLSA 2X4FA 5IA4A 4EHVA 3GEQA 4AA0A 3MFUA 2ETKA 4I0RA 3V51A 4UBAA 3POOA 2WEVA 4ZLZA 4E6QA 3LXNA 3TV7A 2DAGA 1E9HA 3F3ZA 2CGVA 4BCHA 5KBQA 1DO0A 4QMSA 3LFSA 4IM0A 5I3OA 3LXPA 3MVJA 4FTNA 4PWNA 3A62A 3A4PA 5CI6A 4ZSJA 3ZC6A 2JC6A 4NJ3A 2B3TA 3MGYA 3Q4CA 4BZNA 5KE0A 4YZ9A 4AZFA 1OIUA 3DQWA 4DN5A 5FTGA 2R3QA 2ZB1A 5IQEA 5FP6A 5DGZA 3VAPA 1C7YA 2QCSA 3JVSA 2XZSA 4FTMA 2AYPA 3COIA 3NWWA 4M69B 4H58A 2C6EA 2CLQA 3FSKA 5AADA 2RL5A 4IWPA 4EUTA 5HLPA 2WMQA 4ZP5A 1R4GA 5AP6A 2R3KA 2OXDA 3UPZA 5EYKA 3A99A 1LR4A 4YJNA 3PE2A 3C4FA 1U54B 3F2AA 4FTKA 3ZO3A 3KK9A 1P4OA 4DG3E 5K4IA 5C4KA 4FC0A 4FT5A 4AN3A 3UC4A 1ZLTA 2OF2A 4CMUA 4EOQA 2Q0NA 4KKHA 5FXRA 1PY5A 2F57A 3FI2A 3UIXA 3NLBA 3LCTA 3G6GA 3NUNA 2R2PA 3AT3A 3D15A 3GNIB 3QQJA 4USEA 3UO5A 3ATSA 4EWQA 5CYIA 3P7CA 2IW8A 5EQYA 4HNIA 2JDOA 3F2NA 3UOHA 3UYSA 2BRGA 4EOLA 3BGQA 1LEZA 3RVGA 4EH9A 3SG9A 2GHGA 3EKKA 3HV3A 4R1VA 3R7EA 3MH3A 2Y6MA 5EDPA 4RIYB 3D94A 3OCGA 1JLUE 3ZEWA 1GZKA 4L3PA 3VUDA 3L9NA 3FKOA 3UPXA 4O27B 5C8NA 1NW1A 5J8IA 3GGFA 4XV9A 2QOKA 1UU8A 2VTNA 1AQ1A 4PTEA 4PL4A 5E90A 3KREA 3R7YA 1BL6A 1ZXEA 4AN2A 5LVMA 2A1AB 3LVPA 5CLPA 2OICA 2VWYA 2AUHA 3COKA 3P7BA 1YWVA 2FSOX 4F7SA 3HUBA 4YSJA 5I9VA 1HCKA 2XK4A 5HO7A 5IQAA 5M4CA 3R63A 4XRJA 4BWXA 2VUWA 3GP0A 3GENA 3KRLA 1DV0A 3QKMA 5BVOA 3U6JA 4G5PA 3KMUA 3NS9A 4FI1A 2DS1A 4L67A 4IZAA 4DEIA 4CFUA 3HA6A 3AD6A 4OTDA 4TXCA 4GEOA 5ITAA 4DCEA 4YC8A 2IZRA 3FXXA 2DAEA 2FO0A 3BYOA 3EQBA 3PA5A 3QRUA 3QCXA 3IS5A 4FV6A 3OEFX 4GIHA 2WQNA 5E4HA 3QGWA 2ITWA 4QRCA 3V5QA 5F9EA 4AZEA 4TWNA 5DA3A 3LQ5A 4E4LA 5HD4A 2C6MA 2BAQA 2PK9A 4FTAA 2PUNA 3ANRA 3ZSHA 4F7LA 1P2AA 2QLQA 1Q99A 4JDIA 3OS3A 4GUEA 4DFYA 1UNGA 2XKEA 3SQQA 3MA3A 4XG7A 5HNGA 4H36A 4XLVA 5EM8A 4F65A 4IJ9A 3ORKA 3UNJA 5E8TA 4FKJA 3U4WA 4L01A 2H5XA 2JIUA 3EN9A 3QQKA 4ORKA 3W55A 4NYEA 4FTCA 4IAAA 5E7RA 3HUCA 3DJ7A 4JX7A 3W2SA 3R6XA 5CS6A 5IG1A 5EKOA 5FTOA 5CY3A 4BDCA 4NWMA 5BPYA 3R21A 4H1JA 4BDDA 3KXNA 2YDIA 4LI5A 3F3TA 5HCXA 5LOHA 2B52A 3PFQA 2YDKA 4JL9A 5GNKA 4EK5A 2ONLA 1DI8A 4W4WA 5I5ZA 1OUKA 2ITTA 2JFMA 3FZSA 4FV7A 4L7SA 3PA3A 4G3DA 5AAEA 2BMCA 4LL0A 1G4AE 4O0UA 4BTKA 3FXWA 2W4JA 4U40A 5A54A 2Z7SA 3BELA 3DS6A 4G6LA 5A4CA 5ANDA 4YZDA 3BU3A 3TUCA 3OOGA 4O7NA 4MXAA 4XOZA 2GTMA 1YOMA 5I9UA 1G3NA 2Y7JA 3U9NA 1Y6BA 1UA2A 4D9TA 3N4VA 5HZNA 2YM5A 1XJDA 2DENA 1YI3A 2FB8A 2NP8A 5D1JA 3D2KA 3ALNA 4X3FC 2JIIA 4O7YA 5K0XA 4C4EA 5FEDA 2XK9A 3FMMA 2OSCA 4IC7A 1UNHA 4I6FA 4BDKA 4J97A 2CPKE 4FIGA 3FLWA 3MFTA 3E8DA 4EHGA 1BX6A 2QLUA 4D2VA 1JAMA 5M4IA 4NFMA 4QMOA 3VS0A 1H07A 5M08A 2HWOA 4FYOA 4G1WA 5HNIX 2AC5A 2J0LA 3T3UA 5JQ5A 4F2LA 4AWIA 5AV1A 2R3PA 3MY5A 4QMMA 4M97A 5AUYA 1VEGA 4N70A 4TYIA 4BICA 2G15A 3ZM4A 2ETMA 4YNEA 4XG2A 4NM3A 3F61A 1Y8GA 3H0ZA 4XNEA 2LVPC 3R8PA 5C8KA 1KSWA 3OCTA 1WMKA 4WG3A 3LM0A 2H96A 1VEKA 3TZMA 2GTNA 4OR5A 3NDMA 2XNGA 3CBLA 4MD8E 5KX8A 2B0QA 3LLAA 4FICA 5AR5A 3SOCA 3RCJA 1H8FA 4C57A 4UWCA 3MW1A 1U59A 4E6AA 3UNZA 2XKCA 5JMSA 1SYKA 3IOPA 5T6KA 5AA8A 2RF9A 4Q7JA 1B6CB 2ITUA 2OOBA 3GUBA 4GFMA 4O22A 5EI2A 4YGAA 1MRUA 1JKTA 5HORA 5L2WA 2Z2WA 4O91A 2HOGA 3NCGA 1G3IA 2HY81 2QURA 2W96B 5HX6A 3ZXZA 3T8OA 4QMXA 2BHHA 3DK6A 5LXMA 4UZDA 4B7TA 3KFAA 4WOVA 4UXQA 1XHAA 5DR9A 3O71A 3DKOA 5ETFA 1Q02A 5LVNA 3R9DA 4KSQA 5EH0A 4ITJA 4XYFA 4D1SA 4HVDA 2CMWA 1OECA 4X21A 3FL5A 3OWKA 2CN8A 4IEBA 3MI9A 4IVDA 4IZ7A 1H1SA 4TWOA 4ALUA 5FUTA 3SA0A 2ITNA 3R8LA 1IA9A 3MH2A 1SVEA 4C3FA 2KNZA 3HA8A 1OPLA 4AZWA 4HPTE 4J7BA 4O83A 4BBMA 4D2TA 1J1BA 4X3JA 1GOLA 5IZFA 2XB7A 4U43A 5IQFA 2PSQA 2QOIA 3O7LB 3ENMA 3HP5A 4G5JA 4GCJA 1GAGA 4BDGA 3C0HA 5AUZA 3SLSA 4CZYB 4LV5A 4ALVA 2WOUA 2HXQA 3SRVA 4G3OA 2C3LA 3QD3A 3R28A 4DGMA 4O7LA 2OIQA 4DTBA 2R3FA 3MPTA 4GYIA 3SHEA 4J96A 1VYWA 1FPUA 3Q4UA 2JY7A 4XCUA 4JR7A 5DPVA 2PE1A 2RFNA 5EDRA 4E6CA 4YU2A 3IECA 4IAYA 4FT3A 4P5QA 4CNHA 4FG8A 4EOIA 2GNHA 4N0SA 5CF6A 1IASA 3PJ1A 3W33A 4IJPA 3EN4A 2OXYA 4CFVA 1QPJA 3DZQA 1OKVA 2ZTDA 4DT9A 4RZWA 4AT5A 3FQSA 1OIRA 4BCKA 1Q61A 2EUFB 5JFXA 5HLNA 3F92A 4A7CA 2X9EA 4FKTA 4U9AA 5ETAA 5I9XA 5J1WA 4PL3A 3I7CA 5EYCA 5IQHA 3W32A 3W18A 2DAKA 5F1ZA 3RK5A 4BCQA 4FZ6A 5DWRA 2VX1A 4DITA 4OAUC 2PZ5A 1EFUB 4YNOA 3ZDUA 5I4NA 2PPQA 2GNGA 4RIOA 3QTSA 4D0WA 4U79A 3E8CA 2JP7A 4EBVA 3WILA 3A8XA 3ODZX 3CQWA 4ZTMA 2REIA 3DFCB 3FKLA 4L46A 4OTGA 3GU4A 5LVPA 3PIZA 2E9UA 1OKWA 2GSFA 4QNYA 1BI7A 1LP4A 3A8WA 4YLLA 2V55A 4IFCA 4H1MA 4IAZA 2W5HA 5EYDA 1MN3A 5A4LA 4GJ2A 4YTCA 3AG9A 5AP1A 3C0IA 3Q2JA 3QFVA 1WHCA 3SVVA 3EWHA 1UFZA 3CQEA 4JQEA 3FMJA 3PVGA 2BDWA 1H26A 5AM7A 1Q8WA 2CSNA 4IXPA 4D28A 2GHLA 2WTWA 3C50A 4TYJA 5FM3A 2VO6A 4CFFA 3OTVA 3DDQA 4E4NA 1O6LA 4I6QA 1XR1A 2HZ4A 4L3LA 3OFMA 1QPCA 5FDXA 3ZFXA 4YJRA 5IUGA 1KUTA 4FEUA 4DBXA 3BLQA 4S30A 2UW7A 2UVZA 2Y4PA 4FEWA 4B8MA 4JG7A 3S0OA 3R9HA 3DT1A 1B38A 2DAIA 2IVVA 3CD8A 2WTKB 2PUPA 4CGAA 2PUUA 1NVRA 3A7FA 3LQ8A 4CEGA 3LMGA 4K33A 4IM3A 1YKRA 1OKZA 4S2ZA 3TZ8A 4YJVA 4F9AA 2R7BA 3KRWA 3C5UA 3PXRA 5FRIA 4UYNA 2RG5A 4UWYA 4V01A 4MXOA 3CTHA 5HIDA 3TNPC 3F6XA 3QYZA 5CU4A 2BUJA 3WBLA 4EBWA 4F6SA 4UX9A 5LWMA 1UU3A 3FMDA 2UZNA 2W9FB 2A0CX 3FWQA 4I94A 3R8MA 3KMWA 5IEXA 4W8EA 4AS0A 1OTRA 4QQCA 4C59A 2LAVA 3R1QA 3U51A 3VUMA 3FJQE 1SNUA 2YITA 1JSUA 2ITZA 2YM6A 3TXOA 4F9WA 3LCUA 5KUPA 4G2FA 4JDKA 2X0GA 3NZ0A 1PMEA 1UU9A 4FIJA 5M53A 2R5TA 5HE2A 3CR0A 2F7XE 3L8SA 5HQ0A 5FQDC 4FGBA 2BILB 5C03A 2BIKB 5HHWA 5EHOA 3UMWA 2WXVA 4WNMA 3SAYA 5HE0A 3PUPA 4KIKA 3DKCA 3G51A 3CPBA 3OXTA 4KAOA 4KS7A 2W1EA 4R71A 5AP2A 4CMTA 1WBVA 2W9ZB 3V8WA 2Y4IC 3WARA 2G9XA 2HWJA 3NW5A 2UW3A 2C6TA 3NW7A 4CFXA 4AOIA 3QCYA 1ZY5A 1HT1E 3RPYA 4EEVA 1GZNA 4ZTHA 3QX4A 4UYAA 4AFJA 1PF8A 4RIWA 4D58A 2EWAA 1XWSA 4L7FA 3COHA 2P33A 1DI9A 1YQJA 2W0JA 2B1PA 3EN7A 2XM9A 2VTAA 4U97A 1CMKE 1FGIA 3R7GA 3P23A 3BLHA 4QTBA 3GT8A 4GV1A 4C4JA 2OOAA 5JGBA 1RDQE 2GQRA 3GB2A 1FMOE 3VBVA 4IDVA 4CRLA 1H24A 4GL9A 3ZS5A 3RPRA 3TL8A 2FSMX 3WE8A 5J9ZA 5E1SA 4FSMA 5IH6A 3DXQA 1Y8YA 4NT4A 4ANNA 1ERKA 3UOKA 4YTFA 3EQCA 3F88A 4GUBA 5JFVA 5EG3A 1QL6A 4BDJA 3HMIA 3O50A 1IG1A 3Q60A 4MXXA 3IGGA 2BZKB 5B2LA 4R5SA 3VF9A 4IX6A 3WIGA 4I4FA 2EKKA 3CPCA 4DFXE 3MH1A 5IISA 3PRIA 2UZVA 1WJ7A 4QP2A 5H9BA 4B6LA 3P9JA 3CKWA 2EVAA 4H39A 4AZSA 4DFNA 4H3PA 3VIDA 4MWHA 4IFGA 3C13A 3ETAA 2IVTA 3E93A 4MD9E 2QO2A 4RWIA 1A48A 1ZY4A 1V0BA 2X2LA 2W06A 4P4CA 5LMAA 4AN9A 4FKUA 3HV4A 4G3CA 1YOJA 2HZNA 5GJFA 4G17A 2XK7A 3MFRA 2OJIA 3E7VA 5EW8A 3PPZA 4X2KA 4M68A 3RAIA 5H8GA 3VS7A 2VTOA 4USFA 2YM8A 5KMMA 1XB2B 3ERKA 5JEBA 2WELA 3HMNA 5HG7A 4GT3A 1WVXA 4BGGA 2Q83A 5AAFA 3UP7A 2G2HA 3KCFA 4JQ7A 3TUDA 4YTHA 4E8AA 4RA5A 2C6DA 2CNQA 2O5KA 3KEXA 2W1DA 5CEQA 4NW6A 3QL8A 4ZEGA 4FZFB 1FVRA 3VRYA 3DB8A 2K9DA 3FEGA 3P08A 2YEXA 4CYJA 1BKXA 4UWBA 5IMXA 4I4EA 4IACA 2VWXA 3NUPA 4LOQA 4FKIA 5GZAA 1M17A 2UW8A 4IE9A 5C1QB 1Q5KA 5CU6A 1Z57A 3PG1A 2UZOA 3EFLA 5FBNC 3ZZEA 4BFMA 2EU9A 4PRJA 5DR6A 3MTFA 3PZEA 4AP7A 4M3QA 5JFSA 2XK6A 4GMYA 4KIPA 4RX7A 3MB7A 5LCJA 1LUFA 2ZM4A 5CX9A 4RVKA 2BALA 5CVGA 4OAVB 1IFYA 3KB7A 5CANA 2PTKA 1Z5MA 4A4XA 4IC8A 5IA3A 4FEXA 1JKKA 4JS8A 3WIKA 3MIAA 3ORNA 3QTIA 4N4SA 2BFXA 4IBMA 2R3MA 1CDKA 3PG3A 5AR3A 2BZHB 4D4YA 4FUXA 4CFMA 2J51A 3UZPA 1H01A 3HEGA 2JDTA 3GC7A 3LHJA 3QLGA 3W10A 5JFWA 3E21A 5J95A 2JY6B 3D0EA 3IW6A 3R0TA 4O7VA 2BPMA 3Q5ZA 4FZ7A 4R1YA 4JDJA 4BZDA 2PVKA 4M15A 3W2CA 4FG9A 3DJ6A 1JWHA 3FPMA 4QMWA 5IQIA 2OH4A 3QBNA 5IEVA 4FV4A 1OITA 4FTUA 4FNZA 4EOSA 5EKNA 2GMXA 5IPJA 5KBRA 2PZIA 4C62A 2XNBA 3DDPA 4FT7A 3GU5A 3UIUA 3ZUUA 5HI2A 4LFIA 3QD2B 4R77A 4D5KA 4OTQA 5LVLA 2VN9A 3B89A 2ZV9A 2GHMA 2JGZA 4AZVA 5B2MA 2QONA 5K4JA 4E4XA 3UQCA 1L8TA 1ZV1A 5IUHA 3E46A 1VJYA 3U8WA 3ZLWA 3NYNA 2ZV8A 5IDNA 3B8RA 3EFKA 4UB7A 4FGRA 1OIQA 4A9SA 2RFEA 2X8EA 4FT9A 3NGAA 3HGKA 5IQGA 2BWEA 5LARA 1GIIA 4C58A 1HCLA 1WGNA 3SXRA 3R04A 4WRSA 3ZEPA 4FF8A 4DF3A 2L4FA 3EYGA 2XNPA 2W5BA 4I1ZA 4G9CA 4DGGA 5L6PA 2WTDA 4I0TA 3C4XA 5J9YA 2O63A 5HOAA 4TZRA 3DY7A 3HRCA 1PXMA 3QZIA 1Y57A 2FUMA 2GS7A 3CD3A 4FV8A 1H0WA 2GNFA 3RM7A 5JH6A 5IA1A 2R64A 4E4MA 1YXUA 4AZTA 5JT2A 1CKJA 2V7OA 2WQBA 1REKA 4G34A 3AD5A 2YIRA 3LIJA 5BUIA 1KE8A 1YXXA 1H28A 1YVJA 2WIHA 5HO8A 3QF9A 1OZ1A 2X2MA 3W8QA 1G5SA 3OUKA 4J53A 4CRSA 3TDVA 2P3GX 5I9WA 3KL8A 3BU6A 3DKGA 3TEIA 3ZONA 4RG0A 3NUYA 5CSWA 2CP8A 2BROA 4CXAA 2YWVA 4C38A 5CALA 2WD1A 2Z7QA 3CJGA 4HGLA 5GHVA 3GLHE 4FT0A 5K3YA 3G9LX 4F0IA 3QQLA 2WZJA 4IDTA 4AT3A 2G01A 4L6QA 2LVNC 5TT7A 5KKRC 4KIKB 3A7JA 3DJ5A 4V05A 1U4DA 4LQMA 1PHKA 4EKKA 2CHLA 2H6DA 3KKVA 3VC4A 5DVRA 3NEWA 4C4GA 4FMQA 2NPQA 3N4TA 5KHXA 5DEWA 3OMVA 2I0VA 5EQEA 4EZ3A 3PY1A 4EOOA 4Y46A 3IDCA 3BV2A 3D5WA 2BZIB 4YJSA 4NIFB 2J7TA 4YO6A 4DEBA 3N51A 3Q6WA 3R7IA 3ZBXA 1ATPE 3I7BA 5JRSA 4KBKA 3DNDA 2EB2A 4YZCA 2C5NA 3TZ9A 4Q9SA 5DT4A 4MWIA 1LPUA 1MQBA 4YHFA 3RCDA 4PP7A 4O7ZA 4MKCA 1YDSE 3ZLXA 3VHEA 5IH5A 3JXWA 4IX3A 1PXJA 2NRUA 4UALA 3OWJA 3UIBA 4F64A 2QODA 5E8XA 4RQKA 4E3CA 4S33A 4WNKA 5CXHA 2XJ1A 2PVYA 2J5FA 4DGLC 4ZSAA 3K2LA 5AM6A 3PPKA 2C5XA 3BBZA 4WBBB 5AR8A 5HBEA 5KMLA 4EYMA 5C01A 5AX3A 2IZSA 3TN8A 2HIWA 3HMPA 1PKGA 1I44A 3DCVA 2W1ZA 4IVBA 3W1FA 2MROB 3D2IA 5HD7A 1PYEA 3BHUA 4WG4A 2DAMA 2W7XA 4G9RA 3AC3A 4BR3A 5AWMA 3VJOA 3OP5A 3UODA 1WVWA 3V5JA 1KV1A 2PY3A 2ZVAA 4GU6A 3GFWA 1IEPA 3DA6A 4Q5HA 4L44A 3UVRA 4AFEA 2XNEA 4X2JA 3C4EA 2W1GA 4QMPA 1ZZLA 2OW3A 1R1WA 2WMWA 3LOKA 3MJ2A 3QKLA 2C3JA 5CAPA 3BX5A 3SV0A 4AE9A 2UW5A 2XIRA 2DI0A 4J1RA 5J7HA 4O2PA 3QTWA 3LMIA 2Z60A 4U8ZA 5GZ8A 4QTCA 3CY2A 3MDYA 4IZ5A 4WD5A 4WP2A 1F5QA 1Q24A 2ERKA 4NM0A 5BVEA 2JUJA 2I40A 3IKAA 4RC2A 3UG2A 4PQNA 4CLIA 3FDNA 3W16A 5FXQA 2DWBA 5L8KA 3PLSA 3DBDA 4APPA 4NU1A 1Y6AA 4ZSGA 4C61A 3VJNA 2BRMA 3KCKA 3BRBA 3FBVA 1KOBA 5ANGA 1M14A 3QQFA 2B54A 3NSZA 4YJUA 2LVOC 4P2KA 4I6BA 3M2WA 1WGLA 4FTIA 3II5A 3ULZA 1TR8A 3UVQA 4HZRA 4YURA 3SOAA 4FSYA 3C4WA 2XKDA 3NNWA 4EQCA 4ITHA 2I1MA 2VV9A 3VBYA 4HZSA 1NA7A 3IDBA 5AV0A 5IQDA 4CKIA 3ID6C 3UDBA 3CGOA 3DK7A 1JVPP 4QP3A 3RZBA 4BIBA 3P79A 3C1XA 4O82A 5HCZA 4HVIA 4YZNA 2PVJA 2WO6A 3DAKA 3BBTB 3Q9XA 2OZAB 1SNXA 4NFNA 3BHVA 4FODA 3FL4A 4BIDA 4NL0A 2PYWA 1CM8A 4ZOGA 3TUBA 3CQUA 4MBIA 1STCE 5AIRA 3MPMA 4F09A 5CEMA 3SGCA 5GIOE 3D14A 4BBEA 2QOQA 3EQFA 3QZHA 2P0CA 3Q9ZA 4OTIA 5AUXA 1E94E 3KULA 1OUYA 3A4OX 3MTLA 4GG7A 4BY9E 2VTJA 4YBKA 1M52A 4DT8A 4XG6A 3TG1A 4OGRA 5AP3A 1AGWA 5JZJA 3GLFE 2B9HA 2JKKA 1MQ4A 4WNOA 3E88A 5HG8A 4N57A 3ROCA 1Q4LA 4K2RA 2X81A 3WZKA 3FZRA 5C4LA 2QU5A 4DH7A 5GJGA 4R7HA 4XH6A 4C4IA 4F4PA 4KS8A 5M09A 3SC1A 4AUAA 4JG6A 4GFOA 2IJMA 3IW7A 3OROA 4CG9A 2BDFA 2J0MB 4F9CA 3FMNA 3KK8A 4BN1A 3EB0A 4NCTC 4BI2A 4V0GA 3UVPA 1OL1A 3F5XA 4FX3A 2WMUA 4ENXA 1OVEA 2IZUA 3V6SA 4ALWA 3QYWA 5M44A 3IONA 2OFUA 2WB8A 3CXWA 1A06A 4BCNA 4BKJA 5I0BA 3BYMA 3NVKI 1NV8A 4OLIA 3QRJA 4F9YA 1EH4A 5JRQA 2YM3A 3OG7A 4PV0A 2NO3A 3EQDA 2W1FA 3JPVA 1YHVA 3Q5IA 4XJ0A 1ZMWA 3EL7A 4RJ5A 3AGMA 3L8PA 2XNOA 5FXSA 4O96A 1PJKA 4E73A 3PDTA 3V5TA 4L53A 1WBPA 2PULA 1H1RA 3UBDA 2BCJA 4O7SA 3O2MA 5GIPE 1K9AA 3VBWA 5D41A 2GQSA 2QR7A 2KNAA 1OMWA 4QMVA 3RWQA 3KF7A 3VUTA 4GT5A 3DLZA 3P4KA 4B9DA 2FA2A 3S3IA 3ZFYA 3DTWA 4JT3A 3MVLA 1Q8UA 2JY5A 2WTCA 5EW3A 3LJ0A 3GC9A 4FVRA 2HCKA 4DBNA 5J5SA 2X8IA 5HTIA 3I0QA 2J50A 2VTIA 4ONAA 4FV3A 4ACHA 4EUUA 1E1VA 5L2TA 5H8EA 3BYSA 4EJ7A 2ZM1A 1YLAA 2ITVA 1IR3A 3CS9A 3R71A 2EXMA 4BL1A 4YUQA 3PVBA 1YI6A 5L6OA 4QYYA 4X2GA 2UZEA 4QTDA 5E8VA 2O0UA 2RFDA 5CSXA 4EK4A 2RSVA 4WSYA 5HTBA 4XUFA 3R7VA 5HIEA 4HOKA 3IDPA 3QCSA 4D4SA 1SM2A 5A4TA 1GY3A 3EMGA 3LFNA 4FUYA 5I9YA 4XV2A 4WSQA 4IADA 4W4YA 3DLSA 3S4QA 3ZYAA 3CEKA 1YWNA 3EKNA 5G1XA 3Q52A 4IB1A 2GFSA 3DQXA 4ZZNA 1OIYA 5IU2A 2R3RA 4DHFA 1FOTA 2XK8A 4K8AA 3AC8A 2UUEA 5G6VA 3FYKX 4C37A 3TNHA 2YIWA 3FZTA 5CSPA 3OCBA 5LJJA 4RGJA 3PXYA 3DOGA 4J8MA 4K6ZA 3NMUF 4KKEA 2VWZA 3AC5A 3I0OA 4RIXA 5CWZA 4CT2A 2MJ5B 1XBCA 3K5VA 4KBAA 3IQ7A 2C1AA 4R8QA 4PP9A 3RJCA 3UQGA 5FP5A 3SW4A 3VS3A 1K3AA 4G3FA 3QWJA 4I5PA 4DYMA 3MS9A 2XIXA 2EKFA 4CKRA 2I0EA 3QQHA 1YHSA 1ZAOA 2CDZA 3EHAA 4WUNA 4EH2A 3Q32A 1Q62A 3TT0A 3U54A 2XVDA 3PJ3A 3C7QA 1YXSA 2YACA 2K0BX 5CEPA 2IW6A 5CNNA 4EH5A 4EQMA 3ZHPC 2ITYA 3CLYA 4QQJA 3GCQA 4RFYA 4O84A 4RMZA 1M7NA 5AP0A 3T3VA 1L3RE 3C0GA 4JAIA 3KVWA 3DFAA 4LOPA 1P5EA 1FVTA 2VU3A 2ZV7A 4E20A 3D7ZA 3F5UA 4FKPA 3L9MA 2JLDA 5EI8A 4TL0A 2MGWA 5DMZA 3HAMA 1JPAA 3D9VA 3F7ZA 3F3WA 4ZZOA 4RJ8A 3LW0A 3KN6A 4D55A 4U80A 3EYHA 4O0XA 3IW5A 1RW8A 4IVCA 2X7OA 3BEAA 4FSNA 4F7NA 4IB3A 4L52A 4WUAA 3GVUA 2J4ZA 2QG5A 4IH8A 4FKGA 4A06A 4Z16A 2BVAA 1YOLA 1ZARA 3S95A 2L2DA 2PL0A 3VN9A 3H9FA 1FQ1B 2ZTCA 3PTGA 1R0EA 3CJFA 2CGWA 3HLLA 3ORIA 4ANQA 4DFUA 3PSDA 1YI4A 3I81A 1TVOA 3CE3A 4OTFA 5IA5A 4DC2A 4RVLA 1TQIA 5IQBA 3ATTA 4H3QA 4ANBA 3AC4A 1T46A 1WVYA 3DBQA 3OT3A 4N6ZA 4X6RA 5M4UA 2VWWA 4MF0A 4APCA 1Q3WA 5EM7A 4XP0A 2QO9A 2VTTA 4M84A 3V04A 5A6OA 5D12A 4V04A 3NYVA 3OW3A 5AR2A 2H9VA 3PXFA 4BWPA 4KIQA 1OL5A 3DGKA 2A2AA 1NT2A 4EI4A 1RJBA 5ICPA 4P7EA 1OB3A 2YABA 3BPRA 4O6EA 2C69A 4BWKA 4F1MA 4JX3A 4ZAUA 1ZOHA 2J0KA 3JR1A 4G3EA 3P1AA 1H1PA 4ZSLA 3VUIA 5J7BA 1JBPE 3IW8A 4KA3A 2HAKA 4U41A 4TYHA 4S32A 3UGCA 5C9CA 4RC4A 4BB4A 4FE2A 3ORTA 1RE8A 2QOOA 4P5ZA 4G31A 3HP2A 4HGSA 2JAMA 4DGOA 3SXSA 4BBFA 2WMRA 4QT1A 3AMAA 3BBWA 1PKDA 3L9LA 4FSWA 3FZ1A 4JR3A 4ACMA 3HDMA 3UYTA 4C4HA 4AW5A 2FGIA 5M57A 4X2NA 3DZOA 4MQ1A 4GKIA 3K54A 2F9GA 4CVAA 3TTIA 4ACCA 5CU2A 3RWPA 4K9YA 4WNPA 3VVHA 5IQCA 2GNLA 4QP7A 4YPDA 3K3IA 3H9RA 1ZYCA 3EL8A 3BE2A 1NXKA 3PE1A 3GFEA 4MAOA 3OBGA 1XQZA 1ZYJA 3DU8A 3R73A 3O17A 5KMJA 5LMKA 5D10A 2XJ2A 3MV5A 5H8BA 5DYJA 3G6HA 1OPJA 4ZY6A 2R3LA 4M8TA 5AV3A 2XS0A 2ITPA 5EHLA 4FL3A 4QP1A 3HVCA 4V0GB 3BV3A 4YZMA 3UO4A 3CTJA 4RWKA 4U45A 2G2FA 5CQWA 1IAHA 4XBUA 4ZZMA 4AGCA 3A2CA 4HPUE 4XLIA 3WOWA 2CGUA 2ITXA 3FSFA 2BDJA 3E3PA 3VW8A 4MCVA 3P78A 5HBJA 3C9WA 3DBEA 3NUUA 5F95A 3DXNA 1FMKA 2PU8A 4GKHA 4ZS4A 4TYEA 3POZA 5ANJA 3Q4ZA 5J1VA 4BI0A 3BE9A 4NW5A 2W5AA 4FTOA 5DNRA 2O64A 2DNAA 5AFVA 4YSMA 4UMUA 3PXQA 3KU2A 3LQ3A 3HZTA 1XBBA 1REJA 4UMQA 3FY2A 4F70A 4I3ZA 2QHMA 2I7QA 1B39A 4C3PA 2HWPA 4BCIA 5HLWA 3R9NA 3DB6A 3DV3A 2X7FA 5E8WA 4CLJA 3QHWA 5HEZA 5E92A 2DHYA 4DINA 2UZWE 3W2RA 2GS6A 2QOBA 4DBGB 3WF5A 4GT4A 2OLCA 4Y5QA 3H10A 4IAKA 3HV7A 3VUGA 2B9IA 3QXOA 4EORA 4JBOA 4I5MA 4DCAA 2WTKC 2BZJA 5T3QA 1TKIA 3QXPA 2ETRA 2FSLX 4FKSA 3GCVA 1PYXA 4FK6A 2YAAA 3KXHA 3PSCA 3FMHA 2KULA 5JZNA 3UQFA 3JVRA 4NZWB 5DIAA 4XX9A 4E26A 2ONLC 3ZRKA 2JBOA 1K2PA 3GU8A 4KB8A 2GQGA 1ZMVA 2RKUA 3LZBA 3E7OA 5AJQA 3CGFA 4DE4A 1Q8YA 3EJ1A 1IM2A 2H34A 1GIHA 2R4BA 2VD5A 1CTPE 2C5VA 3AMYA 3P7AA 3RI1A 3EN6A 4Y83A 5CF8A 3VBTA 2O2UA 3RK9A 5E9EA 4FIFA 2IVSA 5BYZA 4OTHA 2XJ0A 1OBDA 4HCTA 4QP6A 2PUIA 5T68A 3FYJX 4BDHA 4H05A 2J5EA 4LGHA 3CP9A 4QMUA 3O8UA 4A9UA 2RIOA 4B8LA 3Q3BA 1PMUA 1NV9A 3B2TA 2YN8A 4HYSA 4R3PA 3TJCA 1S9JA 3TIZA 5LQFA 3C5IA 3R8ZA 4ASEA 4O0YA 4ARKA 4B99A 2UV2A 2P55A 2R7IA 3HNGA 4FSTA 2Y6OA 4BCJA 2O25A 3KXGA 3FXZA 4RIXB 2Q0BA 3F82A 2UZUE 3S00A 3TKHA 2JKOA 4FYNA 5HE1A 3PJ2A 5FEQA 2JAVA 2OBJA 4FV2A 4O1OA 4DGNA 2V22A 1ZOGA 4OBOA 2ZOQA 3D83A 2VTMA 4MTAA 4M0YA 2UW9A 1WAKA 4YC3A 1O6KA 4AW1A 4AACA 3VF8A 3Q53A 4LG4A 1XBAA 2X2KA 2WMAA 3BWJA 4DH5A 3LXLA 2EXEA 2BAJA 2OFVA 2HW6A 3EQHA 4FSZA 3QD4A 2E9VA 2V0DA 2P4IA 2BKZA 5AV4A 3OWLA 3MJ1A 5HVJA 3VNTA 3T9TA 3UTOA 4BTJA 2OGVA 1CKIA 4FV9A 4QPMA 4ZK5A 4YMJA 5CEKA 2PZRA 3HV5A 5ACKA 1PRYA 4I0SA 3AQVA 4MEDA 3G5DA 3QZFA 4JBVA 3ZH8A 2ZJWA 3ZO2A 2OG8A 4MYGA 4Z7HA 4YC6A 4K11A 3S2PA 3HMOA 4O0TA 4ZLYA 1U5RA 2RFSA 3A7HA 2WGJA 3ZFMA 4BDAA 4RX8A 2BHEA 1KWPA 3TI1A 3FMKA 3RM6A 3HAVA 3BHTA 3FHIA 4PPBA 3OTUA 5ETIA 5EOLA 3TIYA 3R8UA 3UJGA 2YIXA 3A60A 4DEGA 2QC6A 3Q9YA 4YLKA 5H3QA 2VAGA 3DBCA 4XV3A 5BVWA 4WIHA 5DI1A 1JKLA 1SG9A 5CT7A 1GIJA 3QUEA 1XH4A 3F3UA 1M2PA 4OT5A 4QD6A 3PWDA 3UE4A 4EOKA 3CTQA 5J79A 3PYYA 4L68A 2GDOA 1ZZ2A 1ZRZA 4U3YA 2OJFE 3SRVB 1E1XA 5L3AA 2J6MA 4NH1A 4F1IA 4XG4A 3FQEA 3G0FA 3TNQB 4AW0A 2GS2A 4I6HA 3H0YA 2Z7LA 4EWHA 1DO2A 2JDRA 1J3HA 4AA4A 2C0TA 2UZDA 4DFBA 4FSRA 4OBPA 1Q41A 1DAWA 4HEOA 2CN5A 4X6QC 4IWOA 5LCKA 4UMPA 3NVMB 1VEJA 1XH5A 3RZFA 3ZSGA 2PE2A 1KOAA 2J9MA 3OY3A 3RNIA 3EZVA 5TR6A 3OWPA 4C36A 4ASDA 5JN2A 2C0OA 2OF4A 3LFEA 1H25A 3BLRA 5EHYA 3PRFA 4GEWA 4AF3A 1ZYSA 3FLNC
chains in the Genus database with same CATH superfamily
4IAFA 2EXCX 2C1BA 1G8PA 4RIYA 4TN6A 4IIRA 4GK3A 4MX9A 1N33M 1V0PA 5LMUM 2XANA 3D7TA 4JRNA 5K0KA 2CWBA 4XBOA 4Y8DA 1Z9XA 2R45A 1QVRA 5EM6A 2X8DA 4JBQA 3TV6A 2F7EE 4WKQA 2W1IA 2UZBA 4GU9A 2YCQA 3HYHA 5BVFA 2PWLA 4REZA 4EHEA 5D9HA 3D8LA 3MJ5A 2CCIA 5BYYA 2UW6A 4EOMA 3MVMA 3U6OA 3OXIA 4O0WA 2YA9A 5CAVA 4JI0M 4CSVA 5JKGA 2QR8A 2GNJA 1T45A 4R7IA 3ZO4A 4W4VA 4WBOA 4KD1A 2VGPA 4MHAA 3AOXA 3V6RA 1WFCA 2XBJA 4LFBM 3NIEA 4RIWB 3UDSA 4YO4A 3ROYA 4FBXA 4EHZA 3BQCA 4ERKA 2OU7A 1X37A 4MD7E 1GO5A 4WW0A 3LFFA 1FGKA 1O6YA 3HV6A 5CZIA 4AGDA 4B4LA 1IXZA 1YDRE 5KMKA 4IB0A 3UP2A 2LTUA 3QX2A 2YCRA 5M56A 3ZRLA 3R01A 3LXKA 2CKPA 4CG8A 4CFNA 5LWNA 1CSNA 2NRYA 4QMQA 2Y9QA 5IH4A 5F94A 4N6YA 3U6QA 2JFLA 2ZDUA 4GVJA 2B55A 3TKIA 1V92A 3PXKA 2WPAA 3GU6A 5JI3E 4I22A 2E2BA 2QVSE 4UMRA 4M67A 1GL6A 4XG8A 4OVZA 3QHRA 4CTCA 4OTPA 3E5AA 4DHJA 4PMSA 5CU0A 1JR3D 2CNVA 2OI4X 2XH5A 1O9UA 2OK1A 2GNIA 4HYHA 4DEEA 3F3VA 3VQUA 3B7ZA 2QKRA 5CZHA 4A9TA 4EJNA 3JS2A 3L8XA 3D7TB 1XH8A 2X8AA 1GZOA 4GYGA 4TY1A 3SHGB 3K9PA 4JI1M 5DT0A 3VONA 4GRIA 4O7TA 3VKHA 3DNEA 4J99A 4IBKA 4ZSEA 3WF8A 3I5NA 1AUAA 3H9OA 4EQUA 2BTSA 2IWIA 3Q9WA 3VHKA 1NY6A 2XRUA 2JDSA 2V62A 3I4YA 2W4KA 1ND4A 3E63A 2C96A 4II7A 2VWIA 5D7AA 4DLJA 3GU7A 1OL6A 3FC2A 4FSQA 1JKSA 1VDLA 2X7GA 5BVDA 3LE6A 5DN3A 2RGHA 4MXCA 3FYDA 3FC1X 3ITZA 1CUKA 3WZDA 2WU7A 4IVAA 3VFDA 4PMMA 3BXWA 4DA5A 3GQIA 2A19B 3ZZWA 1HJPA 4O81A 4O38A 3U6HA 3KS8A 3UIMA 5BUJA 1FBNA 5D7VA 3GQ3A 5JI2E 3M42A 3HJQA 4EH6A 3FRHA 4C35A 3MH0A 1PXLA 4DTAA 4D4VA 5F20A 3TMOA 4BDIA 2PHKA 4QTAA 4TRLA 3L9PA 3PWYA 3QC9A 2YLFA 2PVFA 2X1NA 1GJOA 3K9OA 3QTXA 4BRXA 5M51A 5DG5A 5TF9A 1J7UA 5AV2A 3VS6A 3K5UA 5E1EA 2A5YB 1SZMA 3BIZA 4S31A 5KZ0A 4IW0A 2R0UA 4RJ3A 3OD6X 4W9WA 4BHZA 3JYAA 5BVNA 4JAJA 3O8PA 2P2IA 2RGPA 3UC3A 1XMOM 3TWJA 3ZSIA 2EA0A 2ERZE 1WBNA 4IANA 3H3CA 3G33A 5DOSA 4CV9A 3R00A 2OIDA 2QOFA 5E8SA 3QU0A 4EH7A 3KXZA 4RQVA 4Z6YA 3KF4A 3B8QA 3LCKA 4XP2A 3RPVA 4R78A 4D82A 3U61B 4P16A 4CCUA 2BKKA 1W7HA 4QOSA 3NIZA 3ZUTA 3UZTA 3C4CA 2G2IA 4FL1A 4Z8XA 1KE5A 3GCUA 3Q6UA 2J0IA 3WF6A 2W99B 4QYHA 2YWPA 5AUWA 5FEEA 3PA4A 2DKLA 3FE3A 3V01A 2YCSA 1WR1B 4LFCM 1YRPA 3ZCLA 2R6FA 1H6UA 2H8HA 4Z7GA 3NNXA 4X62M 1IAJA 3NYOA 5A46A 3BGPA 2C99A 3HWSA 4I93A 1SXJD 4KUJA 3T15A 4ERWA 2UVYA 2PMNX 3K92A 3SAWA 1PXNA 4DV2M 1UWJA 4KSPA 3T9IA 3IGOA 3LAUA 3O51A 4NIFA 3OXZA 3BEGA 1SXJC 1BYGA 3FI4A 4BKZA 4GKJM 3D5UA 2GU8A 4YP8A 2XCHA 1OGUA 4O7RA 2YAKA 3BLAA 3DXPA 2YZLA 2HK5A 5C18A 2UZLA 2VDBB 3C3DA 4UY9A 1G8AA 1T3TA 2ITOA 1R78A 2WFYA 5K9IA 3F66A 5KCVA 4WT6A 3ZU7A 4L45A 1UWHA 4Y5HA 4L8MA 1ZMUA 4MNFA 5AP5A 2XARA 4HJOA 1V1KA 5FM2A 2VX3A 5LMBA 4FV1A 4CT1A 2WSEF 2VTPA 3EIEA 2JY8A 5JGDA 4GHAA 2C6LA 3WYXA 2KHHA 3PVUA 5LVOA 4RPVA 3GBZA 4RVMA 3RHXA 4RLLA 4IBJA 1AD5A 1QDRA 1YW2A 3MFSA 3M7GA 1XMQM 2W82A 3QA8A 3TJDA 4L42A 4RC3A 1U46A 1YDTE 2R3JA 3NPCA 3RK7A 1W82A 3ENHA 4HCUA 5M06A 4CKJA 3HMMA 2UXCM 1ZWSA 3U87A 2Y0QA 3L8VA 2IPXA 2HELA 4LMNA 2VO3A 1DGHA 4A9YA 4FSUA 2JEDA 1W84A 5EK7A 2Z4RA 5CSVA 3MPAA 3VWAA 1W83A 1QAMA 1WIVA 3SAVA 3I60A 5HVYA 3AKZA 3T6PA 3UOJA 2IZTA 1VQ1A 5KKRB 4Y85A 1XH9A 1PW2A 2VNYA 1JSTA 4CIZA 3KGAA 4ZTLA 5FTNA 4JNWA 2VTSA 1PJIA 3ACJA 3WYYA 3PVSA 3BCEA 3ELJA 4Z3VA 3QCQA 2WMSA 5JK3A 1OIPA 3RE8A 5TE0A 5ITXA 2VX0A 4C34A 3QZGA 3WF9A 3GEQA 4UBAA 2WEVA 4D80A 4ZLZA 2FOIC 4E6QA 1PJJA 2NQ8C 1E9HA 3F3ZA 4QMSA 3P5JC 5I3OA 3LXPA 4PWNA 3A62A 3A4PA 1OIUA 2VIIA 3VAPA 1C7YA 2QCSA 2WMQA 4YJNA 5IREB 1P4OA 1ZLTA 4EOQA 5FXRA 3UIXA 3D15A 1XXHB 3P7CA 5C1BA 2JDOA 4EOLA 4EH9A 2GHGA 4R1VA 3R7EA 3MH3A 5EDPA 3ZEWA 1GZKA 1IQPA 4FCVA 2QOKA 2VTNA 5LVMA 2AUHA 1YWVA 3HUBA 5I9VA 2XK4A 3GENA 1PRBA 4G5PA 3KMUA 2DS1A 4DEIA 5ITAA 4GEOA 5KPTA 3FXXA 3EQBA 2ITWA 3FKEA 1P2AA 1Q99A 4DFYA 5HNGA 4H36A 4XLVA 5EM8A 2H5XA 3EN9A 4NYEA 5FTOA 4BDCA 4NWMA 5BPYA 5HCXA 3F3TA 2YDKA 4JL9A 2WSCF 5I5ZA 2JFMA 3FZSA 4FV7A 4L7SA 2BMCA 1G4AE 4O0UA 4BTKA 3BELA 3DS6A 5ANDA 4YZDA 4XOZA 2GTMA 1YOMA 1G3NA 3U9NA 1UA2A 4D9TA 3N4VA 5HZNA 4M0DA 1XJDA 3L2AA 5D1JA 3D2KA 4X3FC 5K0XA 2OSCA 2C9CA 3FLWA 3MFTA 2AC5A 5DYIA 4QMMA 4TYIA 4BICA 4YNEA 4NM3A 3H0ZA 3R8PA 1WMKA 3LM0A 1VEKA 3TZMA 3VK8A 4FICA 1H8FA 4E6AA 2Y20A 2RF9A 2OOBA 4GFMA 5EI2A 2Z2WA 4O91A 2QURA 2BHHA 3C3EA 4UZDA 2UU9M 3R9DA 4HVDA 4D1SA 1OECA 4X21A 4ALUA 3SA0A 3R8LA 4C3FA 2KNZA 1OPLA 4O83A 1QYRA 1J1BA 2QBYA 5IQFA 1IBLM 3O7LB 3DA1A 4ALVA 4LJAA 3SRVA 2D7EA 4DTBA 2OIQA 2R3FA 2ZM6M 4GYIA 3SHEA 4J96A 4XCUA 4JR7A 5EDRA 4E6CA 4IAYA 4FG8A 4EOIA 4CFVA 1QPJA 4AT5A 1OIRA 3F92A 4U9AA 5J1WA 4PL3A 4DITA 1QDTA 4JI4M 4D0WA 2Z7JA 2ZBKB 4U79A 2JP7A 2REIA 4OTGA 5LVPA 3PIZA 2GSFA 1BI7A 2V55A 5A4LA 5EYDA 4GJ2A 2HL7A 1WHCA 3PVGA 2BDWA 5AM7A 2CSNA 4TYJA 2VO6A 4CFFA 3OTVA 1O6LA 1XR1A 3V76A 4O4BB 4JG7A 3S0OA 3DT1A 2DAIA 2IVVA 3LQ8A 4FWDA 4EOOA 3C5UA 4UYNA 4V01A 2D7HA 4UWYA 3F6XA 2BUJA 5LWMA 5BPVA 2UZNA 2W9FB 2A0CX 3KMWA 3M0EA 2YITA 1JSUA 3TXOA 5KUPA 3NZ0A 4X65M 2F7XE 3L8SA 5FQDC 2BILB 4FCTA 5HHWA 5EHOA 4WNMA 3SAYA 5HE0A 3DKCA 3CPBA 1WBVA 3WARA 4I6LA 2G9XA 3NW5A 1XNQM 3QCYA 1HT1E 3RPYA 4ZTHA 4D58A 2EWAA 2W0JA 2XM9A 2VTAA 1CMKE 2CV1A 3GT8A 4GV1A 2OOAA 4GL9A 3ZS5A 3RPRA 4ANNA 1ERKA 3EQCA 3UZUA 4MXXA 2KDLA 5B2LA 3W67A 4R5SA 4PD2A 3CPCA 5IISA 2UZVA 4LZJA 3P9JA 4AZSA 3C13A 3ILKA 3E93A 2QO2A 1ZY4A 4AN9A 4FKUA 5GJFA 2OJIA 3RAIA 5H8GA 2VTOA 2LWXA 1XB2B 3ERKA 5HG7A 1WVXA 4E8AA 4NW6A 4FZFB 3VRYA 2YEXA 4CYJA 4I4EA 4FKIA 4B3SM 5C1QB 1Q5KA 5CU6A 5FBNC 5DR6A 5FTMA 4GMYA 5LCJA 4RVKA 2BALA 1IFYA 3QTIA 4N4SA 2BFXA 5AR3A 2JDTA 3LHJA 3E21A 1OJLA 4PT5A 4FZ7A 4JI3M 4BZDA 4FW9A 2PVKA 1JWHA 1OITA 4EOSA 3J7AS 4NSOB 2XNBA 3ZUUA 3UIUA 2E5LM 2VN9A 3B89A 3E46A 2RFEA 2X8EA 2BWEA 5LARA 3SYKA 3SXRA 3R04A 4WRSA 4FF8A 4B7GA 4I1ZA 4G9CA 3WHKA 4G4RA 3C4XA 5J9YA 4TZRA 1PXMA 3QZIA 2C5RA 5JH6A 5IA1A 4AZTA 1CKJA 2WQBA 4G34A 2Y21A 2YIRA 1YVJA 5CSWA 2BROA 2YWVA 4C38A 5CALA 3CJGA 3QQLA 4O4DA 4AT3A 3HU1A 1PHKA 5DVRA 4LCBA 5DEWA 4Y46A 3IDCA 3BV2A 5ITXE 3N51A 3R7IA 3I7BA 3TZ9A 4MWIA 4YHFA 4O7ZA 4UALA 3OWJA 3UIBA 4RQKA 2XJ1A 3K2LA 2C5XA 5AX3A 3HMPA 1PKGA 4JN6A 3LVWA 2X0PA 5AWMA 3V5JA 1WVWA 3PUFC 1KV1A 1IEPA 3UVRA 2W1GA 4QMPA 1ZZLA 2OW3A 2WMWA 3QKLA 2C3JA 2DI0A 2XIRA 3CY2A 2I40A 3IKAA 3UG2A 4FWHA 3SARA 4NU1A 3VJNA 3KCKA 1KOBA 4P2KA 3UVQA 3C4WA 4ITHA 2VV9A 4CKIA 3ID6C 3UDBA 3CGOA 3RZBA 3P79A 3C1XA 4HVIA 3BBTB 4NFNA 4K0KM 4ZOGA 3RGSA 1STCE 2QOQA 4OTIA 3KULA 4GG7A 4BY9E 4OGRA 1AGWA 3E88A 3ROCA 1Q4LA 4K2RA 4GIPA 3GRRA 5C4LA 4DH7A 4KS8A 4AUAA 3HU2A 2IJMA 3OROA 2J0MB 4F9CA 1W2DA 1IY0A 3V6SA 3QYWA 2OFUA 2WB8A 4BCNA 1A06A 4QHSA 3NVKI 2YM3A 3EQDA 3JPVA 3EL7A 3V5TA 4L53A 1WBPA 2BCJA 3VBWA 5D41A 3UK6A 3KF7A 3P4KA 3S3IA 3ZFYA 4JT3A 2WTCA 1GVNA 3AL0C 3UGJA 3I0QA 5HTIA 1E1VA 5L2TA 1EE8A 3BYSA 2EXMA 1YI6A 4X2GA 4QTDA 4R3DA 2O0UA 5HTBA 4EK4A 4WSYA 3R7VA 3IDPA 3QCSA 4D4SA 3EMGA 3LFNA 5I9YA 4WSQA 3DLSA 3ZYAA 3OTOM 4DDIA 5G1XA 4IB1A 1N36M 3DQXA 5IU2A 2R3RA 2XK8A 5G6VA 3FYKX 2YIWA 5LJJA 4J8MA 3DOGA 3AC5A 1XBCA 3ZQJA 4KBAA 3RJCA 4B7FA 2BJVA 3PJ3A 3C7QA 2IF8A 2IW6A 5CNNA 4EH5A 2ITYA 2DZOB 4QQJA 2EO2A 2ERCA 2HHHM 4JAIA 4MGKE 4TL0A 3L9MA 2JLDA 2MGWA 3D9VA 4RJ8A 3LW0A 4D55A 4U80A 3IW5A 1NNJA 4FSNA 4L52A 4IH8A 2BVAA 1YOLA 2L2DA 2ZTCA 3PTGA 1R0EA 1NSFA 3ORIA 4ANQA 1TVOA 5IQBA 3ATTA 3AC4A 1WVYA 3DBQA 5M4UA 1Q3WA 5EM7A 2QO9A 4O4EA 3OW3A 5AR2A 3PXFA 1OL5A 2D7GA 2A2AA 4G4OA 1OB3A 2YABA 3BPRA 3JR1A 4B7HA 3P1AA 5J7BA 1JBPE 4U41A 2X4AA 4S32A 1G8KA 2QOOA 4G31A 2QQ8A 2WMRA 4QT1A 4JR3A 4ACMA 3FZ1A 3HDMA 4C4HA 5M57A 4X2NA 4QP7A 1ZYCA 1NXKA 3PE1A 1D0MA 5DYJA 2XJ2A 1IY2A 2ITPA 3CTJA 1IN6A 4XBUA 4AGCA 2CGUA 2ITXA 3FSFA 3I4VA 3E3PA 3C9WA 4TYEA 3POZA 3Q4ZA 4BI0A 4FTOA 5DNRA 3LQ3A 3HZTA 1B39A 4BCIA 3R9NA 4DV5M 2GS6A 4GT4A 2OLCA 4Y5QA 3H10A 4EIWA 4JBOA 4I5MA 4FK6A 2KULA 4DV7M 1ZMVA 1I94M 2VD5A 2O2UA 3RK9A 2IVSA 1OBDA 4QP6A 5T68A 3FYJX 4BDHA 2J5EA 4LGHA 4DV6M 3Q8XA 1PMUA 3B2TA 2YN8A 4R3PA 3C5IA 2FE8A 2WSFF 4O0YA 4B99A 2UV2A 3HNGA 1PM5A 3KXGA 3TKHA 5FEQA 2OBJA 2V22A 2ZOQA 3D83A 4BB9A 1O6KA 5H37D 1XBAA 2X2KA 3E9SA 3TWMA 4FSZA 2V0DA 3OWLA 1CKIA 3HV5A 1PRYA 4JI2M 4MYGA 4YC6A 3S2PA 1U5RA 5FTKA 3A7HA 4BDAA 2BHEA 3BHTA 3FHIA 3UJGA 3R8UA 2YIXA 3Q9YA 4YLKA 3DBCA 4WIHA 5CT7A 1GIJA 3QUEA 3F3UA 4QD6A 3UE4A 4EOKA 3CTQA 5J79A 2OJFE 2JDRA 3B74A 4DFBA 4HEOA 3NVMB 5LCKA 3RZFA 2PE2A 2J9MA 5TR6A 5JN2A 2OF4A 1H25A 5EHYA 4AF3A 4TWCA 4AXAA 4CMOA 4PDOA 4OUCA 3W68A 3UDTA 5FDPA 4D2WA 5CVFA 1XH6A 2F2UA 3KY2A 3SKCA 3DTCA 3FQHA 3M1SA 4IX4A 3HRFA 1H4LA 4K1BA 3WZEA 4BCFA 1KSFX 3P5KA 3GCSA 4RFZA 2FH9A 1G8SA 1JR3A 1W8CA 2QO7A 4JLCA 2DWZB 1GKIA 2JNHA 5EM5A 1L8QA 4AGWA 4RJ7A 4RX5A 2JZ0A 4WO5A 5FD2A 3RP9A 3GQ5A 1SVGA 4YHHM 3IG7A 4A4OA 4M66A 2QOCA 4RWJA 2BFYA 5AAGA 3MSSA 1IN8A 5DLSA 4GITA 5HVKA 4M0ZA 1GJTA 2ZM3A 4LGGA 1FINA 4Y95A 4UMTA 2XYUA 3MWUA 2WMVA 2Y0AA 2V1UA 3R02A 2IW9A 3NNVA 3QTQA 3KXXA 3KA0A 4WHZA 2PZYA 4BGQA 4AE6A 4JQ8A 4AXEA 4MGYE 4YLJA 2WNTA 4QP8A 4A4LA 2XA4A 2YM4A 4BCGA 3E87A 2WIPA 5EI6A 3MVHA 4ANLA 3HJSA 1Q3DA 3V8TA 4QQ5A 3LMMA 5AUVA 3SXFA 4QMNA 3RBWA 3QLFA 1NJGA 3FMLA 2J0JA 4C0TA 5DBXA 4PPAA 5AUTA 1UU7A 5FBOA 1VEBA 2E9PA 5AA9A 4XRLA 2ZFYA 1NVSA 3BYUA 5CASA 2ZDTA 4IBIA 2Z4SA 3F9NA 4XMOA 5BX0A 5AEPA 1QPDA 5A9UA 2XGNA 4FOBA 3QAME 4LRKA 3PIXA 4CD0A 4A07A 2HYYA 5LMNM 3EQPA 5CT0A 4QDEA 2BAKA 3ALOA 3I01M 1WBTA 1H08A 4FVPA 5IMEA 3I6WA 3TNWA 1QUTA 4C33A 3BYVA 4ZXTA 2I0HA 4ANMA 4R3CA 4FIEA 1HNXM 4JBPA 4JI9A 3CC6A 4O7WA 3FV8A 4YHTA 3AKKA 4NKAA 5HESA 4FEVA 3LFAA 4BKYA 3HECA 2DVWB 5KO1A 2A4LA 2CKOA 2WAJA 5HTCA 4OT6A 3AMBA 5EQPA 3GLGA 2BNKA 3V5LA 5A4EA 3U60A 4UN2B 3ZMMA 4GK4A 1SVHA 2F5PA 2IG7A 2W4OA 3THBA 3G9NA 5CI7A 4QHTA 4FEQA 3OVVA 5C8MA 1V0OA 2OZOA 3AOEC 3U6PA 5IZ7D 4Z9LA 3KOYE 4P90A 2C5OA 2QENA 5CEIA 2F5OA 4O2ZA 2X6EA 4F63A 2UW0A 2OXXA 4RJ6A 5EQTA 4GH2A 4AOJA 2OJ9A 2X39A 4FNXA 3WF7A 4BCOA 3CIKA 2J2IB 4EOJA 4GFGA 3FUPA 4ASXA 4M7IA 3V5PA 3Q2MA 2WMTA 2CGXA 3RPOA 2F4VM 2IO6A 4XP3A 2O8YA 3UG1A 4W9XA 4LRSA 5HICA 4EZ5A 3O7LD 1WBOA 2PMIA 2XFTA 4HYUA 1U5QA 2W1CA 4QMLA 4H3BA 1GABA 3FLQA 4DG2E 2LVAA 4W4XA 5FTLA 3RAWA 3LFBA 1W98A 4DH1A 4UN0C 4F08A 3TYKA 4BTFA 2PVLA 4ITQA 3QD0A 4DFZE 2X0OA 3G15A 4K77A 3JR5A 1QZEA 3EZRA 2C3IB 4DEHA 3QRKA 4FTLA 4FTJA 4FTRA 4ZY5A 4YHJA 4OBQA 4FZAB 1P14A 3R83A 3QALE 2ZAZA 4AG5A 1S9IA 2KRKA 2V5QA 1JQHA 5EYMA 3U6MA 2DZNB 1QUSA 1WZYA 4O4FA 4AGUA 3ZUVA 4FNWA 4Q2AA 4G4QA 1OBGA 3LFDA 3TDWA 4CCBA 3ORLA 2NNWB 4IWDA 2XP2A 4C2VA 2XK3A 4DLIA 4HCVA 4LG2A 4E5BA 4KABA 3TWLA 1MP8A 2XMYA 4YJOA 3B7NA 1BVSA 2YIYA 3BU5A 4CV8A 2VRXA 3L28A 2Q2EB 2BWBA 2F49A 1F0QA 3QTRA 3AOGA 5M07A 3GPUA 3UZRA 5DFPA 3VUHA 5DEYA 3ACKA 4J95A 5L8JA 3VS2A 2JKMA 2XIYA 5CTPA 4LV8A 5E8UA 1TGUA 4F99A 1Q8TA 5FGKA 3KRJA 5HG5A 4D1ZA 3V8SA 3I79A 2JKQA 4I5CA 5AP4A 3F5GA 3PJCA 3MB6A 3G0EA 3GXLA 4TNDA 3OY1A 4FL2A 5GJDA 1XO2B 5I9ZA 4FVQA 1TH2A 3R30A 2I0YA 3PP1A 4FWGA 4RX9A 4RFMA 3N9XA 5IKWA 1VZOA 2VTLA 1VYZA 3H30A 3HY5A 1M2QA 3ANQA 3AT4A 4I24A 4K18A 3AD4A 4RLKA 3FY0A 3EQGA 4G16A 3ORPA 1U54A 4R5YA 4BJJB 1SMHA 4TYHB 4W5WA 3GLIA 2QI8A 2BTRA 5M55A 2XYNA 4C4FA 4FIIA 4I4LA 3GPPA 3MK6A 5C27A 2KTYA 4GW8A 4WA9A 4RJ4A 2OZAA 5AP7A 1A5TA 2CV0A 3D4QA 1WXQA 2YERA 3FMEA 3I4BA 2O3PA 1JR3E 3LLTA 4I8OA 1OAIA 4XV1A 4M12A 4QO9A 3R7UA 4QTEA 5CF4A 4DR7M 3UOLA 3O0GA 5LMKC 4RA4A 3LM5A 3KSJA 1L1ZA 5K5XA 2GPHA 4L00A 3ORXA 3WZJA 2ESMA 4D0XA 5TOZA 3AT2A 1AIPC 2EJSA 4F7JA 4JV5M 4LF9M 3FRIA 1HQYE 2VNWA 2IVUA 5ANOA 3I6UA 3NWLA 4EH3A 1X8BA 2G1TA 4E1ZA 3WZUA 3IHPA 3IW4A 3C58A 1HT2E 5DH3A 2FS1A 4EONA 1R3CA 5KMIA 1OL7A 1CKPA 2J90A 1YXVA 4R7BA 2OWBA 1QMZA 2LH0A 4Y72A 4ZMEA 3OBJA 5A14A 5M4FA 5FG8A 2B53A 4IAIA 4DH3A 3THGA 4Y73A 2VZ6A 2YJSA 4KRCA 2L4EA 4J8NA 1H1QA 3NNUA 3QTUA 4AX8A 3ZLSA 1E9SA 3LXNA 3TV7A 2DAGA 1FNNA 2CGVA 4IM0A 3ZC6A 3Q4CA 5IQEA 2R3QA 2XZSA 2AYPA 4H58A 3FSKA 5AADA 2RL5A 4IWPA 4EUTA 5HLPA 1J09A 8CATA 4ZP5A 3A99A 1U54B 5K4IA 4FC0A 4CMUA 3UC4A 3KS4A 4X66M 3G6GA 3AT3A 3ATSA 3GLIB 1IN7A 4HNIA 3A98B 2BRGA 3RVGA 2Z3XA 4PDIA 1JLUE 3L9NA 1NY5A 4O27B 1NW1A 5J8IA 3GGFA 1JQJC 3KREA 3R7YA 1ZXEA 3LVPA 5CLPA 3COKA 5HO7A 5M4CA 3R63A 3QKMA 3HA6A 3AD6A 4OTDA 2FO0A 3IS5A 3OEFX 4QRCA 2C6MA 2PK9A 4FTAA 4JDIA 3L25A 1UNGA 2XKEA 4IJ9A 3UNJA 4FKJA 2JIUA 3QQKA 3W55A 4IAAA 5E7RA 3W2SA 3U6CA 4R7GA 4RNAA 3KXNA 2YDIA 4LI5A 5GNKA 2ONLA 4W4WA 1C1KA 4LL0A 2W4JA 4U40A 3EIHA 3OOGA 4O7NA 1FJGM 1Y6BA 2YM5A 2DENA 4C4EA 5E26A 1G8JA 2CPKE 2R62A 2XZUA 4EHGA 1BX6A 1JAMA 4NFMA 4G1WA 2J0LA 4F2LA 5AV1A 2R3PA 5EP3A 3HHYA 4N70A 2G15A 1Y8GA 5C8KA 2H96A 3NDMA 3CBLA 3I51A 2R4EA 3GRUA 1MRUA 5L2WA 5HX6A 3ZXZA 4MGIE 5LXMA 4B7TA 3KFAA 2RKOA 4UXQA 5DR9A 5LVNA 5ETFA 4PCZA 2DWMA 3FL5A 3OWKA 4TWOA 4IZ7A 1SVEA 4AZWA 4J7BA 1DGFA 4X3JA 1GOLA 2XB7A 2PSQA 4WURA 4GCJA 4BDGA 4G5JA 1GAGA 3C0HA 1TFFA 3W0OA 2WOUA 4G3OA 2C3LA