1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
1XKKA 3PYYA 2X39A 2NRUA 3UMXA 3N51A 2QOKA 1BUHA 1OAIA 1M17A 5CI6A 1KOBA 4U8ZA 3WZKA 2WNTA 3R7OA 4K2RA 1S9JA 2B1PA 3MIAA 4EK5A 2WOUA 4I24A 4HNIA 3V04A 2UW6A 3N9XA 2QR8A 2G2HA 2ITQA 4FIHA 1ZRZA 3AGLA 3SRVB 3R9DA 4B99A 3C7QA 5L2TA 4KSQA 3HKOA 5EI6A 3PPJA 4FZDB 4IVCA 5KNJA 4JBVA 4EL9A 5ANEA 3GVUA 2ZVAA 5J1VA 2QLUA 2WGJA 2J90A 3A8XA 3LJ0A 4FZ7A 4G5JA 4O22A 5CY3A 4R77A 3ORTA 3F3TA 3KEXA 3P0MA 4PMMA 5K5NA 3BV3A 3R9NA 5JSMA 3AC4A 3OCSA 4MVFA 5J8IA 3P79A 3C9WA 3QXPA 4W9XA 5C8MA 3R22A 2VTRA 4N4SA 2GTNA 1AQ1A 2UW3A 3AT2A 3E8EA 2XYNA 1T43A 1TTEA 3QL8A 3EHAA 1KWPA 3QYWA 4O7YA 4FL1A 2GQSA 4F9BA 3D5VA 5BVKA 4APPA 1J1BA 4WP2A 4R71A 4CFNA 3IGGA 5H3QA 4YNOA 2VTHA 3NUSA 4BYJA 4CVAA 3VUKA 3TNWA 2WB8A 3QXOA 2FO0A 3V5TA 4LUDA 4NEUA 2G3QA 1PXKA 4BCIA 3W2QA 3QQKA 4G3CA 2FH9A 2YM6A 2X7FA 2KHHA 4RSSA 4EJNA 3WBLA 5E8ZA 2XIZA 3DDQA 3ZEPA 4DYMA 2QOFA 5I9ZA 4HNFA 4L6QA 4O0SA 5M55A 4DG0E 4EKKA 1OUKA 1JSTA 5AP3A 4YSJA 5IA4A 4P5ZA 3ZOSA 1XHAA 3R0TA 5CVHA 3VBVA 3C0HA 4AQCA 2YIRA 4DCAA 2FA2A 4QQCA 4IX5A 2OF4A 1ZMUA 3GLGE 1R39A 1VR2A 2I7QA 4L3JA 5HO6A 2F2CB 4RA5A 4TNDA 4OBQA 1JKTA 4Q5EA 3O50A 2X7OA 5FLFA 4C4GA 3QTZA 1OIYA 5DPVA 4GYGA 2OFUA 1ZOGA 2W0JA 2OK1A 5LCJA 3UYTA 3TG1A 5I4NA 3FMDA 4O7VA 2O5KA 4MNEB 1CMKE 3GGFA 3VUGA 3EIDA 1ZYCA 4YZBA 4CCUA 5JFXA 3D5WA 1RE8A 3VJNA 1WBVA 4RX7A 2B9JA 2JKKA 2X6DA 3NIEA 5CF6A 1W84A 2XRUA 3I5ZA 4J1RA 3F3ZA 5CU2A 3COMA 3RHXA 4UZHA 2CLQA 1FMOE 1M2PA 4JJRA 2B0QA 4FGRA 2WTJA 1H25A 5HU3A 3PVUA 4X2NA 2EKKA 3RZFA 4YJTA 5JQ8A 3OROA 4YNEA 5AR8A 2NNWB 2W9FB 3DXPA 4DE4A 4EWQA 4U5JA 4IDVA 3S0OA 4KKEA 5AM7A 3Q53A 4NTSA 4FV0A 4C4EA 4PNKA 2BZJA 5I9XA 3FZTA 2NP8A 4IC7A 4YHFA 5L4QA 4MTAA 2RKUA 3ZZWA 2XNOA 3MY1A 3MY5A 4UN2B 4OTDA 3PJCA 4KD1A 4XUFA 3QC4A 5IPJA 3A4PA 3POZA 4USEA 2J0LA 3UZRA 4ZTQA 4E6AA 5L6WL 4IIRA 3U4WA 3UNKA 5JT2A 3QCQA 5JMSA 2YDIA 3KC3A 4PPAA 4O84A 3PXFA 4U80A 2EB3A 1CTPE 4IH8A 4J97A 3M1SA 4C4FA 5EQPA 2QO9A 3OUNB 4KIQA 2WD1A 3AMYA 2YWVA 2GNFA 2G9XA 4ITJA 4B9DA 4FTIA 2CJMA 1MQBA 4J98A 4U42A 4AS0A 4CQEA 5AAEA 3FWQA 3SA0A 3UOKA 1H1QA 4Y5QA 2PVKA 4J53A 2YLFA 4Y72A 4ZTLA 5JGAA 1OBDA 5CAOA 1E94E 3QWJA 4IQ6A 2VWVA 4MXOA 3NW6A 5EK7A 3RPOA 4DFBA 2ITVA 3G6HA 4AG8A 2UW8A 3F66A 3FXXA 3KCFA 4DGNA 3AD6A 4NU1A 1DI9A 3KULA 4H1JA 2UV2A 2QOHA 3PXYA 2OZAB 3BLHA 3CBLA 5CS6A 2Z60A 3COHA 4WOVA 4XV2A 4CFXA 2WMSA 2C0OA 1J7LA 2R3RA 3TNIA 1IG1A 1A9UA 1ZY4A 4FSWA 4OT5A 4YGAA 3JYAA 2BRMA 3CJFA 2R9SA 2BWBA 4XLIA 5DVRA 4M15A 5F1ZA 3TI1A 4BZDA 4IHPA 2H5XA 1MQ4A 1ZMWA 4ZTMA 1T45A 2IN6A 2P2HA 3DAEA 3QQJA 3VVHA 4AN3A 3OW4A 4ACGA 3OOMA 3DY7A 3DNEA 3MJ2A 3AD5A 1F3MC 5B2LA 4G3GA 4RIWB 4RIYB 2XNGA 4I0TA 4CYIA 2YZAA 4FT5A 1WVWA 4GYIA 3TZ8A 2ZDTA 4O82A 2VNWA 3QD3A 4PDYA 4OUCA 3BYUA 1JKSA 1CSNA 4ZMEA 3EMGA 4F9YA 3DDPA 2XK3A 4PTGA 2X2LA 4X2GA 5HBEA 3TKIA 2PVHA 3GFWA 2Y6MA 3Q96A 5EG3A 3UVPA 2QO7A 3OXTA 3SQQA 5GJDA 2VWBA 4DEAA 4UXLA 4FL3A 3U51A 2FUMA 2HAKA 2XF0A 4EQMA 3BU6A 3RHKA 5IQCA 3BKBA 4Q5HA 3R1QA 5A4QA 2LVQD 1JSUA 3U54A 2B4SB 5KBRA 3E63A 3CS9A 4GH2A 4E5AX 3DQXA 5CI7A 4I93A 4Z3VA 1EFUB 4HZSA 5C8KA 4ZLZA 1M7NA 2BAQA 1IA9A 4R78A 2GHLA 4JS8A 5AV2A 4JLCA 3CY2A 1VYWA 2UW0A 3R01A 3ALNA 3Q5ZA 2BTSA 3UNJA 3VUIA 1P3QQ 3ZUVA 3R7GA 4BHNA 2QC6A 3ZM4A 1FINA 2BR1A 4QQTA 2Y7JA 2H6DA 3LCSA 4GT3A 3ODZX 2R3MA 3UC4A 3OTVA 5T3QA 3ZLYA 3IW8A 5LMKC 4L3LA 2OGVA 4F1IA 1OPJA 3PXQA 4AOIA 3QKLA 4O0UA 1Q99A 3SGCA 3R71A 3REPA 3R8MA 4W8DA 2REIA 4XBUA 2G2FA 5DG5A 5LCKA 2WQNA 4KIKA 4A9TA 5I5ZA 1J7IA 3DK6A 3V5WA 3OWKA 5LVLA 2YJSA 3O17A 3ACJA 4JOAA 3F82A 4UEUA 3LFSA 5CEPA 4ANSA 3ZLWA 3BGZA 3I1AA 3AC2A 1PMVA 4QMMA 2QSFX 2JY7A 4XRJA 1XR1A 2R3QA 4HPTE 4XX9A 5IQFA 5HTBA 2LVOC 5M09A 5E1EA 4IFGA 2XIKA 4C4JA 1W83A 4K11A 2XCKA 4PX6A 3C5IA 4BCPA 4IXPA 4BN1A 1GIIA 3FXWA 4GL9A 4Y8DA 5M06A 4RVMA 2SRCA 3BHUA 1NA7A 3EKKA 3BEAA 3G9NA 2CNQA 3AC5A 3HMMA 2VTMA 2PMOX 3BE9A 4FV9A 4G6NA 4EOMA 4IAAA 4FVPA 5AUZA 1VZOA 2XJ1A 3DPKA 1F5QA 4FTQA 4JAIA 4AN2A 4E6DA 3KCKA 5CANA 1ZYSA 2J0JA 1OB3A 3BRBA 3MH2A 4FIEA 4FKPA 3NRMA 3FZ1A 1A06A 3BYMA 3KFAA 4IZ5A 4QD6A 2C3JA 3K54A 2JBOA 2JLDA 5CNNA 4D0WA 4EZ3A 2DZLA 4FKUA 1UU7A 2VGOA 2W1FA 1SG9A 3BI6A 3OCTA 5EFQA 3LLTA 4ANOA 4D58A 2DUVA 2IZRA 4ACHA 3MVHA 4GU6A 3WF6A 2Z7RA 2UZNA 1XB2B 5CQUA 3TZ7A 1E1XA 4AW1A 4AP7A 3WF5A 2BFYA 3MFSA 5HI2A 2YDKA 3A7IA 3FKLA 5CT0A 4IVBA 1VEKA 4E7WA 4KRCA 4FR4A 5F9EA 1UKHA 4CMUA 4JQEA 3KRLA 2QOCA 4IADA 3H3CA 3ZLXA 4D1XA 1R78A 4L68A 5CAUA 1KYIA 2Y8OA 4PDOA 4MH7A 4N57A 2OO8X 5A14A 4KWPA 3R8VA 1OL6A 1YOLA 2HOGA 1OPLA 3F3UA 4CV9A 5KMLA 4DBXA 3QLFA 4O7SA 5AP1A 1MRVA 2B54A 4C35A 4RIWA 4J71A 4RIYA 2WIHA 3WF9A 1LEZA 2GU8A 5IEXA 3QZIA 5LMBA 5DRBA 4CG8A 3OOGA 3P4KA 1Q3WA 1A48A 2YAAA 1G8SA 4L3PA 2VU3A 3T8OA 1BLXA 5K5XA 2C6EA 2C5VA 3LCKA 3ZCLA 1ATPE 3R1SA 4PV0A 3D4QA 5ANGA 5FEEA 2P33A 3R30A 4I6FA 4O0XA 5A9UA 1QPCA 4PUZA 4R1VA 4FV4A 5EW3A 4ACDA 4CGAA 4RLLA 1AD5A 2QVSE 2ZM4A 1R1WA 5K0KA 2UZDA 1YRPA 5DR6A 3HA8A 4PY1A 5CAVA 3GUBA 1AGWA 2ZB1A 3G9LX 3SXSA 4W9WA 2GTMA 2QOIA 3HL7A 3RK5A 3EN9A 1DV0A 1FMKA 4JBQA 2DAMA 2DQ7X 3ORIA 3W16A 1Z57A 1V92A 5EI2A 4ZSLA 4APCA 4DH7A 1H28A 2ITOA 4ZP5A 3MGYA 1WJ7A 4Y5HA 4BYIA 4JNWA 3ZYAA 2QNJA 4QYFA 4EI4A 5BYLA 4FKJA 4HYSA 4UWBA 1JWHA 4IAIA 4CFWA 2RIOA 4F08A 4KIPA 5A4CA 4CLIA 5HLWA 2BRHA 3HNGA 4QRCA 4UX9A 4U97A 4BDHA 2C6OA 3IGOA 4R7HA 5CU6A 2J6MA 2WOTA 4RIOA 5BQ0A 3NNUA 4QMVA 5CT7A 3F2RA 4DA5A 1I44A 1PXPA 1V0PA 5M08A 4RC2A 3AC3A 3KF7A 3LXPA 3LCOA 4XV1A 5ANJA 4U41A 2F57A 3NUYA 3EQFA 1XH6A 1SVEA 2ETRA 2GFCA 1K2PA 4FG7A 4K9YA 4ZJIA 1CKIA 4PNIA 4PTEA 4AA5A 4K1BA 3ZFYA 3F92A 3KGAA 5F4NA 1OITA 2HK5A 3D15A 2IZTA 2BROA 2XMYA 4E20A 4KABA 4MF1A 2YA9A 4NUSA 3W33A 4CT1A 2G1TA 4QPAA 4O7LA 3U6IA 4NK9A 3ZRMA 4JDIA 2VO0A 4ZZNA 2WMBA 3RK7A 2W17A 4WUAA 3GENA 3RPVA 5I0BA 1RJBA 4I6QA 2I0VA 4XEYA 4YZNA 5HHWA 4CFVA 1OVEA 3EQCA 2CMWA 3QCYA 3AXWA 3OZ6A 4G2FA 2OI4X 4WBBB 5KBQA 3MB7A 5TR6A 4HGLA 4BDAA 4U3ZA 4W8EA 4CKRA 4L7FA 2PZPA 4U3YA 5HX6A 1WR1B 4O0WA 1BMKA 3O71A 4PL5A 1K3AA 5LVMA 4QMYA 2LVNC 3TDWA 3PXRA 2VAGA 3A7GA 2DAGA 2GNJA 3GT8A 4D0XA 3PSDA 1IRKA 4OAUC 4I6BA 3AG9A 1NW1A 3GI3A 4O0TA 2OLCA 2QHMA 4BIDA 3ACKA 4ZY4A 3JR1A 4GK4A 4CT2A 5IMXA 1T46A 1XBCA 3QC9A 3U9CA 2E9OA 5FBOA 2I40A 1Y6AA 5EQEA 4O91A 4XP3A 3JUHA 1PF8A 2L4FA 2QOQA 2R3OA 2CWBA 4FV7A 5M51A 2V22A 4DN5A 1O6LA 4XHKB 5E9EA 2YIXA 3U8WA 2PZIA 4MXZA 2RF9A 2HWOA 3NCZA 3PWDA 4MF0A 4U44A 3VNTA 2GCDA 5DRDA 3E93A 3E8NA 4EOLA 5FDPA 2IZSA 5I9YA 1YQJA 2BDWA 2XZSA 1KE5A 4JX7A 1XBAA 3IS5A 4MBIA 4DGGA 4HVDA 4Y83A 4GKIA 4FBXA 3RGFA 5CXHA 3WZEA 3LFEA 5IISA 5FUTA 4BKYA 3QA0A 4OTRA 4BC6A 4O27B 3PXZA 2P3GX 4J7BA 5GZ9A 4BCJA 4BDDA 2JUJA 1SZMA 5LVNA 3KXHA 5GHVA 3W2CA 4C4IA 3QQGA 4FVQA 2BCJA 5CZHA 2ZV2A 3ZEWA 4BTFA 2R4BA 3AQVA 4MQ1A 3HLLA 4A9YA 3V3VA 2VO3A 4QMNA 3OXIA 4MEDA 2RFSA 3NGAA 4M0YA 1PMEA 5ETIA 4AXAA 3ROCA 3FJQE 3FLQA 3BV2A 3VW8A 3FQSA 4IAFA 2VTTA 3EN4A 3OTUA 5DT4A 5IH6A 3R83A 4EK3A 2XB7A 5J79A 2X9FA 1JAMA 1BI7A 2W4KA 4EYMA 4F9WA 4DFUA 3EQIA 4ANMA 3OVVA 3MA3A 4QP7A 2QHNA 3FMJA 4AGUA 4ERWA 1T6OA 1SVGA 4GJ2A 3PRIA 2RFEA 3C4CA 5D7VA 3ZHPC 3L9MA 3CQUA 2W06A 3R7IA 4Z55A 1ND4A 3VS3A 3BHHA 4I20A 5AX9A 5EYDA 5AR2A 4G17A 2L2DA 2UZWE 3DAKA 2J4ZA 2Q83A 3BYOA 3W32A 4F1TA 4CZUA 3RVGA 1UA2A 4ZXTA 3FLYA 5IUIA 3QTXA 4A9UA 4PDPA 4V04A 4CG9A 2ONLA 1Q8WA 4XS2A 1IAHA 2PL0A 4GIIA 3QUEA 2ZMDA 2NPQA 3NLBA 4A9SA 3IW6A 4PPCA 5IF1A 2DWBA 1IASA 3EZRA 3MFRA 3HV7A 5EDQA 3LVPA 2ITPA 4LI5A 4EOSA 3KL8A 3E62A 3ZFMA 3DFAA 1MUOA 4LGHA 2J2IB 1S9IA 1WVYA 2VWZA 5HLPA 3FEGA 2W05A 3IPHA 5JFSA 1UU9A 2PMNX 3HP2A 2YCRA 5FGKA 5DFLA 2UVZA 4NTTA 5FQDC 3C0IA 5F94A 5BVEA 4QTBA 3OP5A 4LMUA 5KHXA 3QYZA 4B7TA 4F0GA 4TWOA 3QZHA 3C51A 3KU2A 3UOLA 3MFTA 5E8TA 4A7CA 5B7VA 4ACMA 3PZHA 2WMWA 3OBJA 2R0IA 3DBDA 3W2SA 4AGCA 3W8QA 4AGDA 4KINA 2GFSA 2JBPA 1LP4A 1GJOA 3D7ZA 2R3HA 3UPXA 4FEWA 3AMAA 4KAOA 4F0IA 2MR9A 4QP6A 4IANA 4C37A 3BCEA 5IQBA 4TY1A 3BIZA 3CEKA 5AR5A 4BWPA 4AWIA 1Q02A 1VEJA 2IWIA 4F63A 2Q0BA 5HEZA 3PVWA 2DS1A 4IFCA 4M97A 5E92A 5H2UA 3P7CA 4DFNA 2ZYBA 4I92A 4FV6A 5EHYA 4YP8A 5AIKA 5L6PA 5HICA 3P7AA 4TWCA 4KRDA 4Q7JA 4FUYA 5KMIA 3OEFX 3PIZA 1JKKA 3A8WA 2YIQA 4H3PA 5CU3A 4MXYA 4PWNA 4ACCA 3PG3A 4ZK5A 1PKDA 3EFLA 4FNWA 3Q4TA 3KN5A 3VUMA 3RZBA 3QD2B 3NUPA 3KN6A 5FTGA 5HVYA 3IDBA 3UTOA 4AOJA 3W2PA 3OS3A 4M69B 5CEIA 3KRJA 3R1NA 4RFYA 3LMGA 2OH0E 2OJFE 5CF8A 2E9PA 2WIPA 1NV9A 4YJVA 2BKZA 3T6PA 1H08A 3FUPA 1PMNA 2CN5A 2XEYA 1NVSA 2WU6A 3O96A 4B0GA 2DKLA 2JY5A 4X7QA 3UO4A 4GUEA 3LQ8A 3FMNA 3AC1A 4C7TA 3NVKI 3JY9A 2H8HA 3M11A 5AUYA 2FSTX 2JKQA 4AZWA 5BVOA 5KMKA 5BVWA 4P90A 2X0GA 4X0MA 4NFMA 4QT1A 1Q97A 3EL7A 2JDSA 4O21A 4QP8A 5KO1A 3UP2A 2QOLA 1ZOHA 4U81A 2HW6A 2VX0A 3NNWA 3RALA 4NW5A 2LBCA 2Z7LA 5I9VA 5A4TA 3R7VA 2YFXA 5CSVA 2C3IB 4ENXA 2UUEA 2UW5A 4U7ZA 4YC3A 1OL1A 3CPBA 1PXJA 3R8ZA 2NO3A 4F7LA 4DG2E 3WI6A 1XQZA 2GS7A 3LFBA 4QMLA 4EOIA 5HE1A 1B6CB 4EH9A 2PPQA 3L8VA 3QHWA 4IAZA 5L2IA 5KZIA 4O7TA 3Q4ZA 3UIUA 3KXNA 1WGNA 1KUTA 3ZRLA 2ETMA 1L3RE 3HV4A 4FV8A 4MCVA 3FXZA 3QTQA 5IA0A 3UIBA 2MGWA 4S2ZA 2UW7A 3QGWA 1FPUA 5M44A 1ZXEA 4QTEA 3D14A 1DI8A 1IXSA 4MWHA 3QRIA 4IACA 2LAVA 3R63A 3UZPA 1HQYE 3KULB 1Z5MA 3O7LD 2J50A 4XV9A 2ZJWA 4CFMA 5FXQA 4WHZA 3TACA 2BFXA 5K4IA 3MY0A 4F70A 3MPMA 5AV4A 5C9CA 1DAYA 3RTPA 4B8MA 5IDPA 3VF8A 5IA3A 5DR9A 1PJKA 1SNUA 5DEWA 3OF0A 4H3BA 4QNAA 2CKQA 3AMBA 2OJGA 2PYWA 3PJ1A 4QTAA 2FSOX 3R28A 2YIYA 3NWWA 1QCFA 3DKGA 3GC7A 2YISA 4FSNA 4BWXA 2PUNA 3Q60A 3EYGA 2DI0A 5HG7A 4F6SA 2VTSA 1FVTA 5HG9A 2QQ7A 2W1DA 4LRJA 4A07A 3TDVA 2WTKB 2XJ0A 2I0EA 1G3NA 5KMOA 3G33A 4FSMA 1OBGA 3KXZA 4GW8A 5EKOA 3WF7A 4F7SA 5JEBA 2X1NA 3HX4A 1PHKA 1NVRA 3CCNA 2YDJA 1ZLTA 3COIA 3ANRA 3EFWA 1UU3A 3O8TA 1QPEA 1YOJA 3G5DA 3IO7A 4Z7HA 4M7IA 2O3PA 3CKXA 4RWKA 2W5AA 1XWSA 4G3FA 5FP6A 3QCXA 5TKDA 5AR4A 4KIOA 4YJSA 3C4ZA 4ITIA 2W9ZB 2R3FA 4MD8E 4IX4A 4MBJA 3VS7A 5H8EA 4EYJA 4OTFA 3Q9WA 4X2JA 4ASXA 4M69A 1UVRA 2JZ1A 4BB4A 5FEDA 3CPCA 4GCJA 1X8BA 3MVMA 4A06A 3V8WA 4O1OA 4RIXB 1TQPA 2XIXA 3C4XA 3HV5A 5DHJA 5D1JA 4BTJA 3F5UA 3RPSA 3RCJA 5CASA 2Y4IB 4Y46A 3QLGA 3IHPA 2OKRA 1PY5A 1QPJA 2BAJA 2H34A 2OWBA 4IM3A 5DNRA 4ZY6A 2B9FA 4NWMA 4RFMA 4AAAA 4CTCA 4NCTC 4FK3A 2CPKE 5G6VA 4KIKB 2C6LA 2OIQA 3L8XA 1OPKA 4EZ5A 3OXZA 4H36A 4ZLYA 3ATSA 4UXQA 2BKKA 2UZBA 3FDNA 4OLIA 2V0DA 3D83A 3EWHA 2C47A 1J1CA 4MXCA 4XG6A 2QR7A 3SXFA 2HENA 1O6KA 5BUEA 4FSYA 2EU9A 2KULA 4G9CA 4ZIMA 2QHOB 3E7OA 3ATTA 2ZV7A 4H58A 3A4OX 2WTWA 2J5EA 3VS6A 3FLWA 5EYMA 4JR3A 5FRIA 4ZJVA 1BL6A 5IQGA 3GB2A 4DLIA 3LXLA 5M53A 3BEGA 3E3PA 3G0FA 2CGUA 5ACBC 3RKBA 3ZC5A 2Z02A 2X8IA 2W1HA 5HO7A 3FLSA 2E9VA 2UZLA 3D5UA 3JVSA 3R73A 3BBTB 3O8PA 1REJA 2BALA 3NSZA 4K77A 3ORPA 3TM0A 4ZTSA 2JAMA 2EWAA 3NR9A 5AA8A 2C68A 3SX9A 4BDCA 4IW0A 2EUFB 4U79A 2O0UA 4I23A 2YM8A 3QWKA 4R8QA 3QRTA 2R3GA 2Z7QA 3P23A 4RPVA 5DR2A 4UB7A 1CM8A 2R3PA 4JXFA 3IW5A 4YTHA 3MW1A 4CEGA 2PUUA 5IG1A 1WBOA 4AE9A 2A19B 4MAOA 4BIEA 5D41A 4HJOA 2O2UA 2OZOA 5A46A 1U5RA 4U40A 2OXYA 2X4FA 4FKRA 3F9NA 3LMHA 5ANKA 4OTHA 4D5KA 5EOLA 3MYGA 3EYHA 3F7WA 1J7UA 4IAYA 3LXKA 2XJ2A 3A62A 4XMOA 4GMYA 3VRZA 4CNHA 4O0VA 2HZNA 4X2FA 2Z7SA 4YUQA 1Q3DA 4CSVA 4F6WA 2JDTA 1G8AA 4YSMA 5CAPA 3NYVA 3VN9A 4ANLA 1B38A 2CCIA 2L4EA 2R3LA 5JGBA 3HUBA 4TYJA 5CU4A 4OTPA 2PVYA 3OWPA 2QKWB 1OIUA 3H0YA 5IH4A 1QMZA 3PRFA 4LRKA 2HWPA 2VO6A 4TWNA 4FA2A 3TTJA 4CKJA 4FSZA 2J51A 4F7NA 4IWOA 3EQDA 2IW8A 3ZS5A 3P5KA 5M07A 3DLZA 4D9TA 4EK6A 3SHEA 4F7JA 5M4CA 4UMRA 5A6OA 1PYEA 3NPCA 3FMKA 3H9RA 2WMQA 4ZTHA 2PE1A 4BDFA 1LUFA 3JVRA 4QPMA 4JX3A 3BQRA 3VS5A 3ZO1A 5DI1A 2QD9A 5GZAA 3HMNA 4EOPA 1KOAA 1Y57A 2VTIA 4OTWA 5C26A 2YITA 1XJDA 4BCQA 3PY1A 3DBQA 4J99A 2VN9A 1OQYA 5AUXA 5EM7A 3PG1A 5L2WA 1YWNA 4GK3A 3CGOA 3ZO3A 1LEWA 3TJCA 4WG4A 4W4XA 3TUCA 4MHAA 4QO9A 4Q9ZA 4FT9A 2WTDA 2QU5A 1H01A 3R9RA 4TYHA 5AADA 1WHCA 2CKEA 2B3TA 2IZUA 2ZB0A 1Y91A 1UNHA 4N0SA 3EQBA 4QP3A 2WTCA 5DYJA 2W99B 4G3OA 2C6TA 5HKMA 2WEIA 3UG2A 5GNKA 3RM7A 2YM3A 4ZTRA 2Q0NA 4DGMA 5FBNC 3ZDIA 4RIXA 3PXKA 1HCKA 2XYUA 4E93A 4JBPA 4FEQA 3CTQA 1K9AA 4IZ7A 3VULA 4WO5A 3B2WA 3GBZA 4ARKA 4S31A 2GSFA 3A7HA 1H0WA 3EZVA 4O6EA 4WD5A 3LLAA 2QLQA 5HLNA 3LFNA 4L00A 5AUUA 4RJ8A 4DT9A 5J1WA 1UNGA 1Y8GA 2X8DA 4UALA 4WBOA 4CFFA 3JXWA 4BI0A 4L67A 1JR3E 1WZYA 2JY8A 3DJ7A 3FZSA 4CZTA 2P55A 3VWAA 4BICA 5EQYA 3FBVA 4HVHA 3N4TA 1Y6BA 4KUJA 3TCPA 5KMMA 2YEXA 4I6HA 3L1SA 1EH4A 4FNYA 4OGRA 5J7HA 3HV6A 5M56A 4FKWA 2OIBA 4NJDA 4EZ7A 1ZMVA 3WE8A 2VX1A 4J8MA 4I41A 3RP9A 3WZDA 3H4JA 3GU5A 4UMQA 5KMJA 1OKVA 1TVOA 3ZBFA 4QOXA 3JPVA 3Q52A 2UW9A 3RPRA 2DENA 2OF2A 4IZAA 4PTCA 4O0RA 4UBAA 3TNQB 3QRUA 3GLIE 4ENYA 1YKRA 2BRNA 3MV5A 5AA9A 1M14A 4EH7A 4HOKA 3HEGA 2JFMA 3D94A 3EJ1A 4O1PA 3K9PA 2WTVA 3BQCA 4XG4A 3TZ9A 3HECA 4EUTA 2JITA 3BU5A 4I5PA 4FTCA 3B8QA 2XP2A 3NZ0A 4TRLA 4RFZA 2QOBA 2IVSA 4EWHA 2IVTA 3D2KA 4FX3A 5CYIA 1O6YA 5AWMA 2I0YA 1MRYA 4LRMA 1H1RA 4E6CA 2PUPA 2JNHA 3KMWA 5G1XA 1WGLA 5LJJA 4J96A 3ZO2A 2W4JA 5HVJA 3IDPA 4BBEA 4C38A 5AEPA 1C7YA 2IG7A 2BZKB 1W0XC 4FOBA 2CKPA 2XKFA 1M52A 4FICA 4RMZA 3SC1A 2EXEA 3ZFXA 3E92A 3FAAA 3MS9A 4HGTA 5IQIA 4JDJA 3SXRA 2C3KA 4FTLA 2WZJA 3OT8A 4JVGA 1BL7A 2J5FA 1PXNA 2BTRA 4FODA 2O25A 2QKRA 3L9LA 4JAJA 3HDNA 1YLAA 1PMUA 3GU6A 5AM6A 3QBNA 5ACKA 4WG3A 1Q61A 5J7BA 2G2IA 2A4LA 4R5SA 4U45A 5BX0A 4LYNA 4CLJA 5IQEA 1NT2A 2PE0A 2XK9A 1FOTA 2ZM3A 1ZAOA 3PZEA 4FKIA 3W10A 4EUUA 4C57A 4DG3E 2C4GA 3I5NA 2EKFA 2LVPC 2UZUE 2Z8CA 1YDTE 3NUAA 3NUNA 3FL5A 4G3DA 4KBKA 3WYXA 5E8VA 1OECA 1GY3A 5DWRA 3ERKA 3PPZA 4JG6A 1MP8A 4JQ8A 4E26A 3FI8A 3FI4A 1H1WA 4D2VA 3F5XA 4EH8A 5DH3A 2B9HA 3FY0A 4BCMA 3O23A 4EONA 4BR3A 4I4FA 4BWKA 1Q62A 3LCTA 5BYYA 3RINA 2DHYA 2PMLX 4QMWA 4BBMA 2VZ6A 5CSWA 4AGWA 3EQRA 5KCVA 1BX6A 3NW7A 4UY9A 4AE6A 3ORLA 4C33A 5HIDA 4UMUA 1ZYJA 3JY0A 3CSVA 4YJRA 5HX8A 2FSMX 4RQKA 3ZH8A 3NUXA 4NW6A 4YLJA 4C4HA 3R00A 4UYAA 4HPUE 3COKA 4LGDA 2Y0AA 3UIXA 5HE3A 5EM6A 1R4GA 2C69A 4GFMA 3CXWA 2VUWA 4G31A 3LKMA 3C5UA 4I5CA 3DKOA 2B52A 2C5NA 3D0EA 5GIOE 2YJRA 4BY9E 4AZFA 2XK7A 4E6QA 5IH5A 5DT3A 3PIXA 4FKTA 2A2AA 4BKJA 4EK4A 2O63A 3LJ2A 2WTKC 5ANOA 2J7TA 2VD5A 3BWJA 3DBEA 4WG5A 5AP5A 3FRHA 3GXLA 2OBJA 4I4EA 3RWQA 4CQGA 4EH6A 5HORA 3AT3A 4GVJA 2WMAA 4QTDA 2R7BA 5A4LA 5E8SA 5EOBA 3ENMA 2OH4A 3H0ZA 5EW8A 1Q8YA 3ZONA 4CKIA 4LQMA 2BILB 3LM5A 4GJ3A 3SAYA 3NAXA 2ZTDA 5B0XA 4AT4A 4YTFA 3PIYA 4H05A 4WIHA 4M68A 4I22A 4EHEA 1OGUA 4IWPA 1GNGA 2CCHA 4M12A 5JZJA 1ZOEA 3DS6A 4NT4A 4FTRA 4WNMA 2YABA 1GZOA 3ZSHA 1FGIA 4L52A 2YCQA 4G34A 4XG9A 2ZTCA 4FTNA 1WBTA 4LMNA 5TT7A 5J9YA 3B89A 1JLUE 2JIVA 3JS2A 5HU9A 3O51A 4DEEA 5LVPA 2QO2A 4O0YA 4QQ5A 1SNXA 3GFEA 4DINA 1L8TA 2O8YA 4M13A 5HESA 2WQBA 3W8LA 2HZ4A 3TKHA 3V5JA 5JH6A 3G51A 3KREA 1WCCA 2UVXA 4R6VA 2OJIA 3MIYA 3S95A 3LOKA 2Y4IC 4DCEA 3WARA 1H07A 3ZM9A 1REKA 3HAVA 2XNMA 3P7BA 3D9VA 3TTIA 3VBWA 4BDBA 2JDOA 5HVKA 4DT8A 3A60A 2WO6A 3NIZA 4FYNA 5HNIX 4OTQA 3EN6A 2C6MA 3Q2MA 4BCGA 3DKFA 4BBFA 4RJ6A 2XBAA 3QTWA 3PY0A 2R3IA 4XG8A 3UE4A 4ASZA 2ITXA 3UC3A 2BPMA 2E9UA 4TYGA 4FNZA 1URWA 2G15A 5D7AA 2O65A 5CEQA 1YWVA 3HGKA 3IECA 3R02A 4F9AA 2CGWA 3OHTA 1IA8A 5CZIA 2PULA 2CDZA 1V0OA 3QFVA 4TN6A 2C1AA 2XM9A 1APME 5CX9A 4EHGA 2JIUA 2GS6A 2GPHA 3ORZA 1YHVA 4D2TA 1STCE 5HCZA 2PMIA 3OMVA 4O6LA 4IEBA 2JP7A 3U6JA 2ACXA 2ITZA 5DLSA 4CMOA 4LUEA 4I5HA 4DH3A 4YJNA 5CXZA 3MN3A 5TOZA 5C1QB 2C6IA 3TXOA 4RC3A 1URCA 3KVXA 4YHJA 1JBPE 2A1AB 4G6LA 2OG8A 3HVCA 3MI9A 3PFQA 4CRSA 3DQWA 3OWJA 1F0QA 4H39A 4RLKA 4L53A 4EJ7A 1HJPA 5HG5A 3VO3A 5H8GA 3MVLA 2Y6OA 4O96A 3T9TA 3VW6A 1ZWSA 2W1CA 2XUUA 3OT3A 1YW2A 2BRBA 4D28A 3QKKA 4DGOA 3UQGA 4DTAA 2IJMA 1TR8A 1M2RA 4NM7A 4DEDA 4WNKA 4V0GA 4C62A 4FE2A 4GFOA 2PVNA 1OM1A 4YJPA 4M14A 3SVVA 2YHVA 4O2ZA 2DAIA 2JZ0A 2OOBA 3Q04A 3PDTA 2C5YA 4ANNA 3LHJA 4DH8A 2WQMA 3C4FA 3GCSA 3QQFA 5TE0A 3UVQA 4F1OA 3HRBA 4D4YA 4XG7A 3TEIA 3BYVA 4AA0A 2ZM1A 5CSXA 5HBHA 4FTKA 3NUUA 3Q5IA 3CTJA 4RT7A 2XNEA 2WFYA 2LVAA 4C59A 4HYUA 4KS7A 4QMSA 4QMQA 4QYEA 5E1SA 2JEDA 3GCPA 5EHOA 5HBJA 3P78A 3UYSA 5DEYA 1UKIA 2X2MA 4D9UA 2C6DA 4FF8A 3RNYA 2FVDA 4TYIA 1A5TA 2X81A 3NS9A 3WZJA 2PU8A 1FVVA 3GU7A 2ZAZA 3UO6A 2OOAA 2F4JA 2ZV9A 1OTRA 4XG2A 4EOQA 4BGGA 3FC2A 3PJ2A 3R7EA 4B6LA 4YZ9A 1XO2B 3T3VA 2GNGA 4NIFA 5GJFA 3BHTA 4FSQA 4BCNA 2GQRA 1U54A 5IUHA 3D7TA 4U43A 4WKQA 2KNZA 5HTCA 2E9NA 4FKVA 2ESMA 3KF4A 4GSBA 4AX8A 2WPAA 1UWJA 3K9OA 4E4NA 5CNOA 2VWYA 3F5PA 5CTPA 3ZBXA 4BL1A 4D4RA 4P4CA 4BHZA 3C4EA 3KK8A 4S30A 5BMSA 4R1YA 3BU3A 3UMWA 4JR7A 4EK8A 4MBLA 4R5YA 5J95A 4YO6A 2OFVA 4AFJA 4XYFA 3KMMA 4WNPA 5C4KA 5BUIA 4F99A 2VWUA 4KNBA 3D5XA 3I7BA 3CY3A 4M84A 2PZ5A 2Z2WA 4C3FA 4YZMA 3QCSA 1UWHA 2PWLA 3U87A 1WAKA 3C0GA 5CEKA 4USFA 2AC5A 1OKZA 4M8TA 4C34A 4E5BA 3VBTA 4L46A 4AOTA 1SYKA 3OCBA 3SOCA 4M67A 5CF4A 1YVJA 2VWWA 3WIKA 1G5SA 4X21A 4A4LA 4E3CA 4AN9A 3SW7A 2YAKA 2CHLA 4RGJA 3FSFA 3U6HA 1GO5A 4I21A 5EDPA 4PMSA 3EB0A 1PXMA 4Y73A 3UVRA 4E1ZA 4I3ZA 3SKCA 3NYOA 2CP8A 3S1HA 5D11A 1QZEA 5CVGA 4HVGA 5IQHA 4RA4A 5HGIA 3LXNA 4PP9A 3VUDA 1XH9A 4IM0A 4FKSA 4R7IA 4JIAA 3NYXA 4JRVA 3PA3A 3QX4A 4RWJA 4BDKA 3FLNC 2R3KA 1P2AA 4YJOA 2CKOA 3R9OA 4V01A 5AV0A 4CZYB 3IOKA 4LOOA 4C3PA 4QMTA 3FRIA 2J9MA 2VTNA 2QI8A 4RVLA 4ZEGA 4W4WA 2V62A 2JKMA 1WVXA 3NNVA 3RAHA 4FEUA 1H8FA 3GC9A 3KRXA 4GT5A 4EQCA 5HIEA 4RWIA 4TTHB 4EHVA 2BRGA 1RW8A 3FZOA 3HUCA 4IWQA 4IAKA 2GHMA 3LFQA 3MH1A 3O8UA 5I9WA 5K4JA 4MYGA 4D1SA 2I0HA 3I0QA 2AC3A 4ID7A 2VTLA 4DAWA 1WBWA 5HD4A 4QNYA 2GNHA 2C0IA 2XIRA 3EQHA 4DEIA 5JI2E 1MRUA 4DTBA 3BYSA 3P1AA 4FMQA 2F2UA 3HV3A 3LAUA 2PUIA 4EBWA 2IPXA 1PGYA 2XEZA 3CC6A 3FPQA 2BIYA 2WQOA 5JRQA 4HCVA 5HE2A 4BCHA 4EHZA 1TKIA 1DM2A 1IEPA 4FT0A 4L01A 3W2OA 4F1MA 2JDRA 5E91A 3I60A 2IW9A 3E87A 4E8AA 1I09A 2F7EE 3R21A 3QF9A 3ORXA 5IKWA 4ZSAA 2PZRA 2C1BA 2KNAA 5IA2A 2HZ0A 4PRJA 2PZYA 2XA4A 4USDA 4X6RA 4G16A 1MN3A 3CE3A 4IDTA 3TT0A 3CTHA 4NSTA 4FTTA 4ZS0A 2PY3A 4ASDA 3ZC6A 4A4XA 1SMHA 4WSYA 5HE0A 2QOOA 2OSCA 2PHKA 3EKNA 3FY2A 4FSTA 3CGFA 3K3IA 4HCTA 1SVHA 3PPKA 4AA4A 5J5TA 3VF9A 3R1YA 1OKSA 2OJJA 2VNYA 2O64A 5IZFA 4ZZMA 3DA6A 3UP7A 2QONA 2BWEA 4NH1A 3VQHA 5D12A 5E8WA 4BTMA 5J9ZA 3CR0A 3W1FA 3QTIA 4O7ZA 2ERZE 2JKOA 3KB7A 3NCGA 4IB0A 5L3AA 4YC8A 3W55A 4FNXA 3CQEA 4GEWA 4LL5A 2JC6A 4TPTA 2X6EA 5CSPA 1V1KA 1VQ1A 3DZQA 3OD6X 3V6RA 2X9EA 2XKCA 2WKMA 4JG7A 5T6KA 1G3IA 4BVUA 1BVSA 4YMJA 4MD7E 4WRGA 1YXSA 5FEQA 3TZMA 3VS0A 4TYEA 2PK9A 1FGKA 2XCHA 3KMUA 3T9IA 3OUKA 4AZSA 3OFMA 2MROB 4MXXA 4QQJA 5KHWA 3CLYA 3SG8A 3PY3A 4UWYA 4Y85A 4GIHA 5CSHA 1Q8ZA 1VG5A 4NKSA 4BCOA 5JGDA 4X3FB 4XP0A 3KXMA 2Y9QA 3ZUUA 2XK6A 4DFXE 3PVBA 3F2AA 3BBZA 5FD2A 5HNBA 3MESA 3UOHA 4AFEA 2QURA 3IDCA 4ZLOA 5AAGA 4QMOA 2OJ9A 2RL5A 3R2BA 2VTQA 2JY6B 2XNNA 5EI8A 5LMKA 3RMFA 4ASEA 2CGVA 5ANIA 4UMTA 3ET7A 4NM3A 4XRLA 4YZDA 2ONLC 3MVJA 4KA3A 4RX8A 4C58A 3F61A 4NZWB 4GEOA 1Y8YA 1VEBA 1OIRA 3HRCA 5AJQA 4RJ3A 4HYIA 4AW2A 4DC2A 5K0XA 3DFCB 1TQIA 4GVAA 2FB8A 4IMYA 1Q8UA 3QA8A 5BVNA 3QZGA 4A4OA 5J5SA 1JKLA 3FQEA 3HZTA 3PE1A 4O83A 4RJ5A 4O2PA 1P4OA 3SW4A 4TYHB 4NM0A 4PMPA 2J0MB 4FKLA 1H27A 4MXAA 3SV0A 4ZMFA 4TW9A 5EM8A 1W7HA 3DXQA 1OMWA 2PVRA 4K0YA 3FMHA 3BBWA 1KE8A 2P4IA 1CKPA 5B2MA 4ZTNA 5HZNA 2QG5A 2ITWA 4I5MA 4CD0A 1YWRA 4TXCA 3TN8A 3VC4A 4BRXA 3QTRA 5HTIA 3GQLA 3ULZA 3MTFA 3KXGA 3VBYA 3NEWA 3PA5A 3VJOA 5IUGA 4A9RA 1XH8A 5A3XA 1H1SA 1CKJA 1YXVA 4DEBA 3DGKA 4L45A 4AF3A 3VAPA 4FV2A 3TIYA 5IU2A 4F6UA 4PDSA 4JG8A 1KE7A 1CDKA 3F5GA 4JT3A 4D2WA 3DKCA 1RDQE 3VBXA 2YM5A 3GLFE 5J87A 3MSSA 1ZZLA 3R04A 4D4VA 4KBCA 3A2CA 5AAFA 2FSLX 4QP4A 3TIZA 4C2WA 5E8YA 1NVQA 4XBRA 2W1GA 4IBMA 1FBNA 3DBCA 3B8RA 4FG9A 2IVUA 1WBSA 2GNLA 2YM4A 1W8CA 2CN8A 4CV8A 4MK0A 5L6OA 2OIDA 3KY2A 3ORNA 3FHIA 3IOPA 4G6OA 3FKNA 1H26A 2V5QA 3FYJX 4X6QC 4FUXA 1KSWA 5IDNA 4OTIA 5AP4A 5FM3A 2UZVA 1R3CA 5DN3A 5LWMA 3BE2A 5LQFA 1BKXA 5GINE 5I9UA 4F2LA 5EYCA 5FTOA 3DT1A 5BVFA 4WUNA 2GNIA 1HCLA 3FC1X 1G41A 2IO6A 3ZXTA 3LFFA 4KSPA 1HOWA 5DE2A 3F88A 3FMMA 4B4LA 4JDHA 3TUBA 1H0VA 1V0BA 2UZOA 4G9RA 4Q9SA 4XG3A 4YR8A 5KKRB 4U6RA 4DLJA 4KS8A 3FMEA 2OU7A 4BFMA 1ZY5A 2NRYA 5CU0A 3HP5A 2YCSA 3DV3A 4RBLA 5JFVA 3THBA 2BDJA 4L44A 5HIBA 5KZ0A 2IW6A 3H9OA 4YLKA 1IM2A 4L9IA 2WEVA 1UU8A 2VTAA 5BPYA 2I6LA 2WMUA 3TNPC 3G0EA 5C8NA 3I6WA 3G15A 2A0CX 1J3HA 3C50A 3ITZA 3N4VA 3LM0A 4J95A 3TV7A 4Z9LA 2GHGA 5EW9A 4GKHA 3RAKA 3S00A 4AT5A 3SRVA 1RQQA 1OZ1A 4FTUA 3WYYA 1GOLA 4O38A 3HRFA 3DTCA 3W18A 5BNJA 5AP2A 2EXMA 1H00A 3O2MA 2VO7A 2WQEA 3EN7A 3KA0A 5JN2A 3R8LA 2DAKA 1H4LA 4FKQA 3QQLA 4FVRA 4U0IA 3TJDA 3MH3A 4C02A 2X8EA 4W4YA 4CRLA 2AUHA 3EQPA 4X3FA 4YZCA 4PPBA 3RAWA 4ITHA 3ZO4A 4CCBA 5CALA 4GT4A 5HOAA 1NV8A 3ZRKA 3C13A 2PVFA 1P4FA 3F2NA 2ITUA 2JD5A 5FXRA 3DJ6A 4I1ZA 4IX3A 3BGQA 3CP9A 4BZOA 2X4ZA 4EH5A 4BDGA 4B8LA 4J8NA 3R7YA 2WAJA 1YI4A 3DK3A 4LOPA 4ALWA 3HA6A 3SG9A 3UOJA 2UZEA 4EORA 3PP0A 4IJ9A 3WIGA 3RI1A 4NYEA 4BKZA 4FTAA 4AT3A 5ICPA 3QD0A 3MH0A 3BHVA 3Q9ZA 3EOCA 3LQ3A 1DO0A 4FTMA 4IVDA 5GZ8A 5AUVA 2YN8A 2BUJA 4QMXA 5CQWA 2RSVA 3R9HA 5ETCA 3ULIA 3UODA 5CF5A 5DBXA 4RJ7A 3FPMA 3H9FA 1TQMA 5F95A 3ZXZA 5DT0A 2HY81 5HG8A 1XH7A 1UV5A 4DTKA 3L9NA 5LVOA 1XBBA 5BYZA 4RZWA 3L9PA 3MTLA 3LW0A 3OY3A 3RBWA 4NM5A 3IKAA 1YI3A 3CKWA 4GS6A 3L8PA 4P2KA 5AP7A 4AU8A 3U4UA 4XV3A 3QU0A 3ANQA 3FLZA 3P9JA 4OR5A 2PVLA 3BHYA 5HQ0A 2R2PA 2WMRA 4FZAB 1VYZA 2JAVA 2P2IA 3P86A 3CQWA 4L8MA 4R3RA 3OBGA 4D2PA 2BVAA 2UZTA 1U5QA 3LE6A 5KE0A 4ORKA 5AV3A 5JK3A 4UV0A 4IB5A 2YM7A 4BI1A 4O7WA 4F9CA 3KRWA 4LOQA 4MNEA 2MJ5B 1P5EA 2R7IA 4ZAUA 1PYXA 2XIYA 1QL6A 1UFZA 3A7JA 4L7SA 4ZSGA 3WF8A 4M66A 3ZMMA 3VQUA 3PA4A 4QTCA 3C4WA 4D1ZA 1ZYDA 1W82A 2XKDA 3HMOA 3ORMA 4BGHA 5F20A 3F3WA 5AUWA 4FYOA 4UZDA 3I7CA 2YERA 5DFPA 3QHRA 5L8LA 3I4BA 5BMMA 3QD4A 2EVAA 5EM5A 3GCUA 5I3OA 4TL0A 2B53A 4JQ7A 5L8JA 5CAQA 3TKUA 3EL8A 3KVWA 5L2QA 3ALOA 4H1MA 4C36A 5LOHA 5ITAA 4GG7A 4XOYA 5HNGA 5IA1A 3Q6UA 3K3JA 5FXSA 1Q8TA 4RVKA 5FG8A 3ROYA 2R3JA 1G4AE 2PVJA 1ZV1A 3BX5A 3MMPA 4KKGA 3QAME 1O9UA 4JDKA 3QGYA 3R6XA 4FL2A 3V8TA 3GLHE 4D2SA 4P7EA 3R7UA 2OXDA 4HYHA 4OT6A 4IZYA 3ZLSA 3Q2JA 4UYNA 4YLLA 4QYGA 5TO8A 4CTBA 5ETFA 2GMXA 2YACA 5CVFA 2JIIA 3DAJA 4PQNA 2LTUA 5AMNA 3E21A 3LCVB 4BTKA 5EKNA 4U9AA 4YU2A 1IR3A 4JL9A 2RFNA 3PUPA 3MFUA 3V5QA 2W1IA 3A61A 1LPUA 3ZUTA 5I3RA 3ODYX 3G2FA 5C27A 5L8KA 3DU8A 3RPYA 4EH4A 2WXVA 1JPAA 4IVAA 4K6ZA 3QQUA 4MKCA 4QMPA 3UNZA 2VX3A 5HD7A 2PTKA 1OUYA 3K2LA 1WMKA 3G6GA 3MWUA 3Q32A 4IWDA 2ZV8A 3VRYA 3WE4A 4ANBA 3N4UA 5IQAA 4Z16A 1GIHA 3QRKA 4G1WA 2K9DA 4X2KA 1QPDA 3QTSA 3GOPA 3QUPA 1WIVA 2HCKA 3OG7A 4YBKA 2BAKA 3VUTA 4ONAA 4YJUA 3LJ1A 4NKAA 4DBGB 2G01A 3QRJA 4BZNA 2R3NA 2YCFA 2V7OA 1U59A 4R3CA 2OZAA 3OC1A 4FKGA 3PLAE 4RJ4A 3MDYA 3O7LB 3ZDUA 4JI9A 2VV9A 4FTJA 4DH5A 4IJPA 4E73A 1JOWB 3ELJA 1M2QA 4BCKA 1PRYA 4HGEA 4CXAA 3I0OA 2GS2A 4FEVA 1XXHE 4DH1A 2VWXA 2C5XA 3L8SA 2W5BA 4GRBA 5CWZA 3RAIA 5C4LA 3IW4A 3BWFA 2JGZA 3VHEA 1DAWA 5KX8A 3FE3A 2XH5A 1PW2A 4TKSA 5E8XA 3EH9A 2PSQA 4E4XA 4JRNA 4FV3A 1HT2E 5E8UA 2YLEA 4AUAA 4EKLA 2X7GA 1DS5A 2I1MA 3Q9XA 4IB1A 3NNXA 4F09A 2QG7A 2C5OA 2QODA 3KXXA 5A54A 2F7XE 3NMUF 2OW3A 3FMLA 4LGGA 2BIKB 2H9VA 2ZDUA 4LM5A 4V0GB 2XRWA 5AIRA 5JZNA 3F7ZA 1GZNA 3V51A 2B9IA 4YTIA 5AR7A 4D4SA 3GP0A 2J0IA 2DNAA 2UW4A 3A99A 5IEYA 1VEGA 1JQHA 3VHKA 5C01A 3NDMA 4GUBA 5IEVA 2CGXA 3SLSA 1YXTA 2ERKA 3TUDA 1IAJA 3QKMA 4ZZOA 4F65A 3MPTA 5CEOA 3OWLA 4F64A 1ZZ2A 4O86A 2E2BA 3IONA 4GK2A 4K8AA 3TV6A 4BI2A 4O7NA 3ORKA 2HZIA 3S2PA 2V7AA 1IFYA 1U46A 2C30A 4EOOA 1VJYA 2RRUA 4X3FC 4K18A 4E4MA 4XLVA 4R3PA 2DAEA 1WBPA 4FIFA 4OTGA 2FYSA 1YXUA 2VTPA 2CSNA 2AYPA 5DA3A 4FSUA 1Z9XA 2HY0A 2BHHA 4ZOGA 3NYNA 1ERKA 3QUDA 4HEOA 1JNKA 2RG5A 4H3QA 3RCDA 5LXMA 4BGQA 5A4EA 1XH5A 3DCVA 1KE6A 4MQ2A 4YTCA 1KV2A 5K3YA 2QU6A 3LQ5A 3PE2A 4FOCA 4NIFB 2W5HA 4QYHA 3NVMB 4Q2AA 3H10A 4G5PA 1U54B 4QMZA 3D7TB 3DB6A 1JSVA 1YHSA 4MNFA 5AUTA 1CUKA 4AZEA 2XBJA 4PP7A 5IA5A 5D10A 5HCYA 4YC6A 3MPAA 3PTGA 2V55A 2DYLA 4XCUA 5JRSA 4F0FA 4LV8A 3R8UA 4C8BA 3S4QA 1J91A 4KBAA 5HO8A 4FEXA 4YPDA 4F4PA 3O0GA 4FV1A 1BYGA 4AZTA 4C0TA 3RK9A 1R0PA 3CIKA 3DNDA 3I81A 4WT6A 2X2KA 4XJ0A 1SM2A 3IW7A 3LFCA 3ZTXA 4EH3A 4I0RA 4QPSA 3QZFA 4Y95A 3VIDA 4TNBA 4UWCA 4ALVA 4FTOA 4EC9A 5L2SA 3U55A 4BDEA 2YWPA 3AOXA 4AACA 4PF4A 1R0EA 4RVTA 5IMEA 5KUPA 2F49A 1GZ8A 1KV1A 3UPZA 3KK9A 3WOWA 3IK3A 3UBDA 2VTJA 2XKEA 4D5HA 4II5A 3UG1A 4EC8A 4KKHA 4P5QA 5ANDA 5GIPE 2XNBA 3GCVA 1KE9A 4HCUA 3KQ7A 4XH6A 5EH0A 4DGLC 3GNIB 4Z7GA 3RWPA 5M4FA 2F9GA 1OKYA 4PL3A 1UNLA 3ENHA 3Q9YA 5AP6A 2LGCA 5LWNA 3A7FA 5BVDA 4FK6A 5TF9A 1YOMA 1F4IA 1B39A 5FDXA 4FIJA 5J9LA 3UJGA 4C2VA 2P0CA 4FZ6A 5AV1A 4DITA 2RFDA 4K33A 3FYKX 4RQVA 1PXIA 4ZJJA 5EDRA 4C3RA 4ZS4A 5ETAA 3PLSA 2XNPA 4RX9A 4RX5A 4E4LA 3PJ8A 5CLPA 4AZVA 4I94A 1OKWA 5AP0A 2FGIA 3EFJA 5K9IA 3AGMA 1GZKA 2ITYA 3VS1A 2BZHB 5LMAA 3ZU7A 4YJQA 1YHWA 2VRXA 4KB8A 3GC8A 1H24A 3ZZEA 3PVGA 2BDFA 1E1VA 3ZSGA 1H1PA 2XM8A 4XOZA 1GAGA 4RRVA 1DO2A 2WMXA 3RNIA 3TL8A 5KKRC 3UO5A 3I6UA 2EB2A 4AW5A 2F7ZE 2YIWA 5AR3A 5JQ5A 4DEHA 1P14A 2ITTA 3B2TA 3EFKA 3PSCA 2EXCX 3NAYA 3SD0A 3V6SA 4WSQA 3V8SA 4JIKA 3VS2A 2XS0A 5C03A 3UQCA 3DZOA 5A6NA 2ITNA 1Q24A 3GQIA 2RG6A 3E8DA 2R0UA 3E3BX 3M2WA 1OL7A 5T68A 3TV4A 3LMIA 1YI6A 4JBOA 2WMTA 3LZBA 3FKOA 4NFNA 4PMTA 4X3JA 3K5UA 3BLQA 4RZVA 2GDOA 5H8BA 4ZY5A 4HVIA 3VUHA 4BF2A 3HAMA 4IB3A 3GU4A 3RM6A 1OIQA 3QX2A 2OICA 3DJ5A 4M3QA 4V05A 2KNVA 2RGPA 3LPBA 4FZFB 4LFIA 3AC8A 1JVPP 3OW3A 4XNEA 3PSBA 3S3IA 3U9NA 3UDBA 5DMZA 1PXLA 2W7XA 3GCQA 2J0KA 5DIAA 2CNUA 3E5AA 3QALE 3R2YA 4BDJA 4IE9A 2PE2A 3FZPA 5CEMA 5M4UA 4DF3A 2OO9A 4FI1A 5FTQA 3KRRA 4ALUA 3FQHA 4EOKA 4EQUA 4NJ3A 4O81A 1Q5KA 5D9HA 3R8PA 3OY1A 2W4OA 3SOAA 3VS4A 2HXQA 3BELA 4YURA 3MB6A 3NX8A 4QP1A 4OAVB 3LFAA 4GU9A 3H30A 4MD9E 3LCDA 3BZ3A 3PJ3A 2BZIB 2HIWA 4I0SA 4TT7A 4DFZE 4E5WA 5E7RA 3UQFA 2HYYA 3QQHA 4FG8A 5KMNA 3FV8A 3SDJA 3CD8A 3GU8A 4YHTA 4N6ZA 1PKGA 4HGSA 3I79A 3K5VA 1ZARA 3P08A 3PP1A 2KTYA 2OXXA 3LIJA 3QTUA 4G3EA 4WRSA 4DFLA 4DBNA 5M4IA 1U4DA 3TWJA 2IVVA 4CFUA 3W2RA 1FQ1B 2HWJA 4BDIA 4EH2A 4NL0A 4W4VA 3ID6C 3WZUA 4D55A 4QMUA 3FSKA 3ETAA 2YZLA 1OL5A 4EOJA 2W1ZA 4HZRA 3V5PA 1ZYLA 3KKVA 3II5A 2Y4PA 3IQ7A 1XH4A 2HW7A 3RJCA 4CMTA 4TZRA 4BCFA 1YDSE 2JDVA 4YBJA 3T3UA 5AFVA 3F3VA 4ERKA 4FT7A 4FV5A 4QP9A 4OBOA 5AX3A 1NY3A 5EYKA 5EHLA 1Q4LA 4R7BA 3Q4CA 2XVDA 3BLRA 2WELA 3E7VA 3BGPA 3MA6A 4QP2A 4WNOA 3V01A 3DB8A 3FL4A 4L42A 2C0TA 5FM2A 5E4HA 4ANQA 4NCTA 2C6KA 1YDRE 2XK4A 4LV5A 4RWLA 5FP5A 2H96A 3AD4A 5E90A 4PL4A 3IG7A 4FT3A 3POOA 2PVMA 3OCGA 4D2RA 3E88A 4GG5A 2W96B 1AIPC 1PXOA 3E46A 2HELA 2VGPA 3NW5A 5BUJA 3OEZA 4N70A 4EBVA 3Q4UA 4ZSEA 1NXKA 4FIGA 3M42A 3F69A 3GEQA 4LG4A 4ZSJA 2K0BX 4BIBA 2WMVA 2VWIA 4S33A 3UZTA 5JFWA 2UVYA 2CNVA 2WTIA 3DK7A 3E64A 3MBLA 3DTWA 4HVSA 3TNHA 5H9BA 2B7AA 4IX6A 4O7RA 2B55A 3V5LA 4CYJA 4EEVA 2VTOA 3PWYA 3DOGA 3LCUA 3FZRA 5JKGA 1WFCA 5HCXA 3F6XA 1HT1E 4FGBA 4FIIA 2R5TA 4YPSA 5CENA 1YXXA 1VDLA 4RC4A 4RG0A 2C3LA 3CD3A 3D2IA 4QYYA 3UGCA 4DFYA 4FSRA 1WBNA 3DLSA 5IQDA 4N6YA 1E9HA 4S34A 3G90X 1GIJA 4C61A 3DBFA 3VBQA 3DXNA 3FI3A 3WILA 2EJSA 1FVRA 3HDMA 1W98A 2ZOQA 4MWIA 4HW7A 1M7QA 2JFLA 2CLXA 2WHBA 3E8CA 3MJ1A 3HYHA 5LARA 1Q41A 2HXLA 2ZMCA 3FHRA 3AT4A 3Q6WA 2BMCA 4OBPA 3GOKA 4IC8A 4M0ZA 4J52A 3EN5A 3HMPA 4GV1A 3CJGA 1BI8A 5GJGA 4TWPA 2QCSA 5M57A 1LR4A 2ETKA 4IM2A 4MX9A 4GFGA 4DHFA 2R64A 3C1XA 3UIMA 3BPRA 3LFDA 2A27A 3Q3BA 3ZSIA 3GC0A 3FI2A 3HMIA 4L43A 4OW8A 4UN0C 1OL2A 4FKOA 4DEGA 1OI9A 2GQGA 5FWKK 4AW0A 2W1EA 5DOSA 2BHEA 5DGZA 4LL0A 2XK8A 4WA9A 5B2KA 4XP2A 2WU7A 3EQGA 4FC0A 4UMPA 4S32A 4YO4A
chains in the Genus database with same CATH superfamily
2NRUA 1KOBA 1L1TA 2WNTA 7CATA 4K2RA 3MIAA 2WOUA 2LNHC 2G2HA 3AGLA 3SRVB 3R9DA 4B99A 5KNJA 3GVUA 2ZVAA 5J1VA 4R77A 2VIIA 3ORTA 3P0MA 3BV3A 3R9NA 4MVFA 5C8MA 3P79A 3C9WA 3QXPA 4W9XA 4DHIB 1S3SA 1AQ1A 2UW3A 1TTEA 3EHAA 3T15A 2GQSA 1J1BA 5H3QA 2G8LA 2FO0A 4BCIA 4RSSA 4EJNA 4EKKA 4L6QA 5IA4A 4P5ZA 3VBVA 1Z5AA 4QQCA 2V6ZM 4IX5A 2OF4A 1VR2A 3U61B 4L3JA 5HO6A 3UK6A 3AV0A 2VF8A 1JKTA 3O50A 5FLFA 3QTZA 4L78A 4GYGA 2OFUA 1ZOGA 3HJ8A 3TG1A 3GGFA 3VUGA 4YZBA 3D5WA 2B9JA 2JKKA 2X6DA 4J1RA 4FGRA 1M2PA 4JJRA 2B0QA 3RZFA 3OROA 3S0OA 4FWGA 4NTSA 2BZJA 3ZZWA 2XNOA 3MY5A 4UN2B 4XUFA 1Z5CA 5L6WL 3U4WA 3UNKA 5JT2A 5JMSA 2YDIA 4U80A 4QOSA 4B3RM 4JI0M 2QO9A 2YWVA 2GNFA 2QBYB 4U42A 3FWQA 3UOKA 1H1QA 2VWVA 3NW6A 2BJWA 3FXXA 3AD6A 2UV2A 2DHRA 3CBLA 2Z60A 2R3RA 3TNIA 1IG1A 1ZY4A 4OT5A 4YGAA 3JYAA 2BRMA 3THGA 5I9VA 3TI1A 1ZMWA 1T45A 2IN6A 3NFFB 1JQJC 3DNEA 2ZDTA 4OUCA 4PTGA 2Y6MA 2QO7A 3SQQA 4DEAA 4FL3A 2HAKA 4EQMA 5FTMA 4QNMA 1EFUB 4HZSA 3GP1A 1VYWA 3R01A 3WHLA 1QUTA 3VUIA 1P3QQ 4PCZA 3GLGB 3LCSA 4GT3A 2R3MA 4F1IA 1OPJA 3PXQA 3QKLA 3B9PA 5LCKA 2WQNA 4A9TA 4JI2M 3V5WA 4UEUA 4ANSA 3ZLWA 3BGZA 3AC2A 1PMVA 2JY7A 2R3QA 5HTBA 5M09A 5E1EA 4IFGA 4C4JA 1W83A 4PX6A 3VLFB 4IXPA 1GIIA 1R2YA 3EKKA 2VTMA 2PMOX 3BE9A 3HU1A 4IAAA 4FJVA 1VZOA 2P5TA 1OB3A 4FIEA 4DLJA 4EZ3A 1UU7A 2IZRA 3WF6A 2UZNA 1E1XA 2BFYA 4IVBA 3KRLA 2QOCA 3ZLXA 1R78A 2Y8OA 4MH7A 4CV9A 5AP1A 3W0PA 5IEXA 1LEZA 3OOGA 1Q3WA 1A48A 3FTDA 1G8SA 4L3PA 5K5XA 2C5VA 1ATPE 5FEEA 3R30A 4I6FA 5A9UA 1QPCA 3PFYA 4LJ5A 1I4WA 5K0KA 4JN6A 2QOIA 3ORIA 2DQ7X 1LTMA 4DH7A 3AOEA 4GITA 4EI4A 4JNWA 5BYLA 3L28A 4FKJA 2RIOA 4F08A 2QQ8A 2BRHA 4BDHA 1YSYA 4QMVA 5CT7A 4B7GA 4U41A 3EQFA 1XH6A 1SVEA 4FG7A 4ZJIA 4PTEA 2HK5A 2BROA 5ITTA 4MF1A 4O7LA 3ZRMA 4ZZNA 3RK7A 3GENA 1RJBA 4G2FA 2OI4X 4WBBB 5KBQA 4CKRA 2CRUA 2C98A 3TE6A 4PL5A 3WHKA 5LVMA 4QMYA 2LVNC 3PXRA 3A7GA 2DAGA 4D0XA 1IRKA 4OAUC 5IMXA 1T46A 3QC9A 2E9OA 2XF3A 5EQEA 3JUHA 1E32A 4DN5A 3TQSA 1O6LA 1W2DA 2PZIA 4MXZA 4MF0A 5FDPA 2IZSA 2BDWA 4JX7A 1KE5A 1XBAA 3IS5A 4O4CA 3MHVC 3RGFA 5CXHA 4BKYA 4O27B 3PXZA 4J7BA 4BCJA 2JUJA 2VQEM 1SZMA 5LVNA 5GHVA 4FVQA 3V3VA 2BJVA 2VTTA 4EK3A 3AL0C 1BI7A 4EYMA 4F9WA 3OVVA 4QP7A 4ERWA 5FTLA 3C4CA 3ZHPC 3CQUA 2W06A 4Z55A 3VS3A 5EYDA 2Q83A 2APLA 4CZUA 3QTXA 4A9UA 1QYRA 4PDPA 4V04A 1Q8WA 2PL0A 3QUEA 3EZRA 1D0KA 4BLCA 4LI5A 1MUOA 4LGHA 1S9IA 5JFSA 2PMNX 3HP2A 4JI3M 2UVZA 3C0IA 5F94A 4LMUA 4B7TA 1JR3A 4A7CA 2WMWA 3AOEC 2R0IA 4KINA 2GFSA 2XZFA 3D7ZA 2R3HA 4QP6A 4IANA 3BCEA 5AR5A 4BWPA 4B3MM 4DFNA 3P7AA 5KMIA 4FUYA 1JKKA 2YIQA 5CU3A 1YUBA 3W2PA 3OS3A 4M69B 4RFYA 5CF8A 2E9PA 4IBGA 2CN5A 2XEYA 4GUEA 3AC1A 4C7TA 5AUYA 2JKQA 4QT1A 2JDSA 2QOLA 4U81A 3RALA 5A4TA 2UUEA 1PXJA 3R8ZA 1IN7A 1XQZA 4EOIA 2VDBB 5HE1A 4EH9A 2PPQA 5L2IA 3Q4ZA 3KXNA 1KUTA 4FV8A 3UIBA 5M44A 1ZXEA 4IACA 2ZJWA 3RTPA 5IDPA 4QEBA 5IA3A 2CKQA 3R28A 1QCFA 2YISA 2KZSA 2DI0A 1FVTA 4LRJA 4A07A 2XJ0A 1ZQ9A 1G3NA 4FSMA 4GW8A 3WF7A 5JEBA 3HX4A 3CCNA 1XNQM 4G3FA 2O5RA 4YJSA 2Q2EB 4MD8E 3FUTA 4X2JA 4BB4A 4M69A 1UVRA 1X8BA 5DHJA 3RPSA 4Y46A 2OKRA 3W0SA 4LF8M 2B9FA 4AAAA 4CTCA 1OPKA 4UXQA 1SXJD 3EWHA 3EIEA 3ATTA 2WTWA 5FRIA 4DLIA 4M9XA 3G0FA 3RKBA 3FLSA 3O8PA 3ORPA 3TM0A 2JAMA 2EWAA 5AA8A 2LH0A 4GIPA 2Z7QA 2R3PA 4AG6A 3IW5A 4YTHA 2A19B 2O2UA 4XMOA 2HZNA 5CAPA 3NYVA 2LHGA 2CCIA 5JGBA 4TYJA 2PVYA 1OIUA 5IH4A 1XMOM 3BOSA 3TTJA 2J51A 3EQDA 3ZS5A 4F7JA 3SHEA 5A6OA 2WMQA 1LUFA 3JVRA 5GZAA 2YITA 5AUXA 5L2WA 1LEWA 3TJCA 4FT9A 1WHCA 2CKEA 2B3TA 2ZB0A 1UNHA 4QP3A 2C6TA 5HKMA 5GNKA 2YM3A 4DGMA 3PXKA 4LJ8A 5EP4A 4FCTA 4ARKA 4S31A 3SARA 3A7HA 5AUUA 4CFFA 1JR3E 1WZYA 3VWAA 4BICA 3N4TA 3TCPA 1EH4A 5M56A 5J7HA 3HV6A 4FKWA 2OIBA 3WE8A 1AUAA 3WZDA 2CHQA 1TVOA 3GO8A 3JPVA 3QRUA 4ENYA 1YKRA 3MV5A 5AA9A 4JI5M 4I5PA 4TRLA 2QOBA 4B3SM 1MRYA 4E6CA 1WGLA 2W4JA 5HVJA 5AEPA 4BBEA 4C38A 1C7YA 2BZKB 4FOBA 2CKPA 2XKFA 3SC1A 4LY6A 3E92A 3JAMS 3MS9A 5IQIA 4DDGA 1BL7A 3L9LA 1YLAA 1QQWA 1Q61A 4CLJA 1FOTA 2A5YB 4EUUA 4C57A 2C4GA 3NUAA 3FL5A 3WYXA 1OECA 3PPZA 1MP8A 3FI4A 4D2VA 1Q62A 4BBMA 2VZ6A 1ZYJA 4RQKA 3ZH8A 4NW6A 4YLJA 1OJLA 4GFMA 3PIXA 4EK4A 2O63A 5ANOA 5AP5A 4CQGA 4I4EA 2YR0A 4GVJA 3PVSA 5E8SA 3HX3A 5EW8A 1Q8YA 3ZONA 3LM5A 4GJ3A 2ZTDA 4H05A 4EHEA 1NJFA 3DS6A 4FTRA 4WNMA 2YCQA 5TT7A 1WBTA 1SNXA 3GFEA 1L8TA 2WQBA 2HZ4A 3TKHA 5JH6A 1WCCA 4R6VA 4LJ9A 3LOKA 3D9VA 3VBWA 2JDOA 2WO6A 2NQ8C 4XG8A 4ASZA 2O65A 2XARA 1YWVA 3HGKA 4F9AA 3QFVA 4IBDA 3W0LB 2GPHA 3ORZA 5HCZA 3OMVA 2ITZA 5CXZA 2H1RA 3PFQA 1F0QA 3TL4X 1YW2A 5KQ8A 4DGOA 4DTAA 4NM7A 3K1JA 4V0GA 1OFHA 3SVVA 4YJPA 3Q04A 2OOBA 3LHJA 3C4FA 3QQFA 4D4YA 4FTKA 4RT7A 4HYUA 4KS7A 3HGIA 2JEDA 3GCPA 3JR5A 4KO8A 2FVDA 4TYIA 3J2PB 1FVVA 3UO6A 4XG2A 2GNGA 3BHTA 2GQRA 4WKQA 2KNZA 5HTCA 3KF4A 4GSBA 5CNOA 5CTPA 4BL1A 4JR7A 4AFJA 2OFVA 4XYFA 1EE8A 5BUIA 3CGWA 4F99A 2VWUA 4KNBA 3D5XA 3I7BA 3CY3A 2PZ5A 2Z2WA 4C3FA 3SYKA 3QCSA 1UWHA 4WW0A 3U87A 4AOTA 3OCBA 4M67A 2VWWA 1GO5A 4I21A 3UVRA 4E1ZA 4Y73A 3SKCA 3NYOA 2CP8A 3S1HA 5D11A 1QZEA 5CVGA 5HGIA 3A46A 4PP9A 4IM0A 3QX4A 3IOKA 4QMTA 2R44A 3RAHA 5HIEA 4EQCA 4IWQA 3MH1A 5FLXS 2AC3A 5HD4A 3LW5F 4QNYA 1XXHA 4NRVA 2F2UA 2WQOA 1TKIA 2IW9A 3I60A 1W2CA 3R21A 5IA2A 2CFOA 2XA4A 4USDA 4G16A 3TT0A 2PY3A 3ZC6A 4WSYA 2PHKA 3EKNA 3FY2A 1SVHA 5J5TA 2VNYA 2BWEA 2CUZA 5E8WA 2JKOA 5L3AA 1PJQA 2JC6A 1V1KA 5T6KA 4BVUA 1BVSA 4WRGA 3TZMA 5FEQA 3VS0A 4TYEA 2XCHA 1FGKA 4UWYA 4Y85A 5CSHA 1VG5A 4NKSA 4X3FB 3ZUUA 3F2AA 3UOHA 2QURA 4QMOA 3SAWA 2VTQA 2XNNA 5LMKA 3ET7A 4XRLA 2ONLC 2XAMA 5AJQA 4DC2A 5K0XA 3DFCB 1TQIA 5J5SA 4IMYA 3PE1A 4O83A 4KHPM 3SW4A 4FKLA 1H27A 3SV0A 5EM8A 3DXQA 3FMHA 3BBWA 2P4IA 3GPPA 3DFZA 1NVMA 4ZTNA 2QG5A 2ITWA 4CD0A 1YWRA 3MTFA 3VJOA 3NEWA 5A3XA 4AF3A 1KE7A 1CDKA 3MSSA 3KP1E 1ZZLA 3A2CA 4C2WA 1NVQA 4XBRA 2W1GA 4FG9A 2IVUA 4CV8A 3KY2A 3ORNA 4FUXA 4OTIA 4X66M 5FM3A 1R3CA 5DN3A 1BKXA 4MGKE 3DT1A 2GNIA 1G41A 2K6BA 5DE2A 3TUBA 4YR8A 3FMEA 3B7NA 4L44A 1PM5A 2VTAA 3G0EA 3G15A 2A0CX 4J95A 4GKHA 3NBXX 1RQQA 3WYYA 1GOLA 5BNJA 2EXMA 2WQEA 5JN2A 3MH3A 4W4YA 4X3FA 4CCBA 4ITHA 5CALA 4GT4A 1TH4A 1NV8A 5ITRA 2PVFA 3UDZA 1TZDA 4LOPA 4EORA 3WIGA 3RI1A 5ITYA 4FTAA 3ML1A 3Q9ZA 1DO0A 5GZ8A 5AUVA 4LV7A 2YN8A 3R9HA 3ULIA 3UODA 5DBXA 1UV5A 4DTKA 3L9NA 4LF4M 1XBBA 3L9PA 1G71A 3MTLA 4NM5A 4GS6A 5KPZA 4AU8A 4XV3A 3QU0A 2PVLA 2R2PA 4L8MA 3P86A 4ORKA 2BVAA 4UV0A 4IB5A 1PYXA 2XIYA 3ZMMA 3PA4A 2XKDA 3QD4A 2B53A 3KVWA 4H1MA 4PDIA 4RVKA 3UZUA 3ROYA 1G4AE 2PVJA 1ZV1A 3MMPA 4KKGA 3QAME 4JDKA 3QGYA 3V8TA 2XEPA 3SATA 2O01F 5JI3E 5L4QA 5CVFA 4YU2A 3V5QA 3A61A 5I3RA 3ODYX 5C27A 3RPYA 4K6ZA 4QMPA 4MKCA 2VX3A 5IQAA 3Q32A 4ANBA 3QRKA 3QUPA 1WIVA 2HCKA 3VUTA 3LJ1A 2G01A 2F4VM 2OZAA 4RF0A 4RJ4A 2VV9A 4DH5A 4HGEA 1XXHE 3RAIA 3FTCA 3IW4A 3BWFA 3VHEA 1DAWA 3U60A 2XH5A 3A98B 2PSQA 4JRNA 5E8UA 4EKLA 4CGYB 4IB1A 2QODA 3KXXA 2F7XE 3FMLA 4LGGA 4LM5A 2B9IA 5AR7A 4D4SA 3GP0A 5IEYA 1JQHA 4MB7A 3NDMA 3MPTA 5CEOA 3OWLA 2E2BA 4GK2A 4O7NA 1IFYA 2RRUA 4X3FC 4XLVA 1WBPA 2FYSA 4FSUA 3B7ZA 2RG5A 3DCVA 2QU6A 3NVMB 4PP7A 5HCYA 2D7GA 2V55A 4XCUA 1SXJB 2FOIC 4YPDA 4F4PA 1MJGM 4FV1A 4D82A 4D81A 1W5SA 3CIKA 2X2KA 3LFCA 3QZFA 4Y95A 4TNBA 3DZDA 4BDEA 2YWPA 3AOXA 3KK9A 4P5QA 5ANDA 4HCUA 2CV2A 5M4FA 3HKPA 5AP6A 3ENHA 1YOMA 4C2VA 4MUQA 2RFDA 4RQVA 3GPYA 4ZJJA 3KXEC 4ZS4A 2XNPA 4RX9A 4RX5A 3PJ8A 5CLPA 4I81A 5AP0A 3ZU7A 1YHWA 4KB8A 3ZZEA 3PVGA 4P16A 1GAGA 1DO2A 3I6UA 5AR3A 2ITTA 3B2TA 3EFKA 3PSCA 2EXCX 3V8SA 3VS2A 2XS0A 3L25A 3D8LA 2R0UA 3E3BX 3M2WA 2WMTA 3FKOA 3K5UA 2GDOA 5H8BA 4HVIA 5BPVA 4XNEA 3OW3A 3U9NA 2W7XA 5DIAA 3QALE 4DF3A 4FI1A 3KRRA 4NJ3A 4O81A 1Q5KA 3R8PA 3OY1A 4OAVB 3MB6A 3PJ3A 4AKIA 1N32M 3U6QA 4DFZE 4E5WA 5E7RA 3UQFA 4FG8A 5KMNA 2DWZB 3CD8A 4N6ZA 4HGSA 3PP1A 1ZARA 3QTUA 2OXXA 4WRSA 5M4IA 3E9SA 4BDIA 3ID6C 2YZLA 3ETAA 1XH4A 3RJCA 4CMTA 4ERKA 4FV5A 4QP9A 4OBOA 5AX3A 5EHLA 2XVDA 3BLRA 2WELA 2QP9X 3BGPA 3MA6A 4QP2A 3P5JC 4L42A 2C0TA 4L4UA 4NCTA 3AFHA 4X65M 1YDRE 4RWLA 4M9ZA 3POOA 2PVMA 4IIWA 1AIPC 2HELA 3NW5A 1IQPA 3OEZA 4N70A 1K3WA 3M42A 4ZSJA 2WMVA 2VWIA 3UZTA 3DTWA 3TNHA 5H9BA 4KT0F 2B55A 4EEVA 2VTOA 3LCUA 5IREB 5JKGA 5HCXA 1YXXA 2C3LA 4DFYA 1WBNA 4IBJA 3DXNA 3E8CA 3HYHA 1Q41A 2ZMCA 5IZ7D 3EN5A 4TWPA 5M57A 4IM2A 4GFGA 3U5ZB 2R64A 3LFDA 3GC0A 2BNKA 1OI9A 2GQGA 5FWKK 5DOSA 5DGZA 5B2KA 2WU7A 1QAMA 3ZC7B 4YO4A 3KOXE 3UMXA 3N51A 3I04M 3J7AS 2B1PA 3GPXA 4EK5A 3V04A 4FIHA 3C7QA 5EI6A 4EL9A 4LRTA 3A8XA 2J90A 3LJ0A 4PMMA 5K5NA 5JSMA 3OCSA 5J8IA 3R22A 3QL8A 2JWSA 2XYNA 1T43A 1KWPA 4F9BA 5BVKA 4APPA 4RKUF 1W2FA 3SYLA 2VTHA 4CVAA 3QXOA 3VDUA 3I4YA 2XIZA 2QOFA 4HNFA 4YSJA 1XHAA 3DA1A 4AQCA 2YIRA 4DCAA 5DPVA 5LCJA 3FMDA 4O7VA 2O5KA 1ZYCA 3TWLA 4CCUA 5JFXA 4RX7A 3NIEA 3F3ZA 4UZHA 2CLQA 2WTJA 1H25A 5L8RF 2W9FB 3DXPA 5E6JA 4PNKA 5I9XA 3FZTA 4YHFA 4MTAA 3PJCA 3A4PA 4USEA 2J0LA 2EB3A 4IH8A 4J97A 3M1SA 4C4FA 5EQPA 3AMYA 1IN5A 2G9XA 4O4EA 1MQBA 5AAEA 2EA0A 3SA0A 4J53A 4Y72A 5JGAA 1E94E 3QWJA 3G6HA 3KCFA 5BV3A 2J7NA 1DI9A 5CS6A 3COHA 4WOVA 2WMSA 4FSWA 3CJFA 4IBFA 4XLIA 4ZTMA 3L29A 4IHPA 3MJ5A 3VVHA 4ACGA 3OOMA 1V33A 3MJ2A 4G3GA 3LQRA 2XNGA 4CYIA 2YZAA 3TZ8A 2VNWA 3BYUA 4ZMEA 2XK3A 5BR8M 3TKIA 3UVPA 4FCWA 1L2BA 3RHKA 3R1QA 3E63A 4Z3VA 4R78A 5AV2A 2UW0A 3ALNA 3UNJA 1L1ZA 1DGHA 4BHNA 1FINA 3OTVA 3D8BA 2Y0QA 2CEAA 3SGCA 3REPA 3R8MA 4XBUA 3OWKA 2YJSA 3O17A 3ACJA 3F82A 3W67A 5CEPA 4XX9A 5IQFA 4G6ZA 4K11A 4BN1A 3FXWA 3BEAA 3HMMA 4FVPA 5AUZA 4AN2A 3KCKA 2J0JA 4EOMA 3MH2A 3NRMA 4IZ5A 3OTOM 2C3JA 4D0WA 3KDSE 3OCTA 2VGOA 3PNVA 3BI6A 3LLTA 2DUVA 4ACHA 2K47A 5CQUA 3WF5A 3A7IA 2EO2A 4KRCA 4FR4A 1UKHA 3FTEA 4L68A 4PDOA 2OO8X 3R8VA 1YOLA 3F3UA 1OPLA 4DBXA 5KMLA 4O7SA 3AKLA 3QZIA 1YE9A 3C3EA 3T8OA 4PV0A 2P33A 4O0XA 4ACDA 4RLLA 1YRPA 5DR6A 3HA8A 4PY1A 4WURA 4B3TM 3SXSA 1Z57A 4ZSLA 1H28A 2ITOA 1WJ7A 2QNJA 4QYFA 1JWHA 4KIPA 4CLIA 3HNGA 4QRCA 5BQ0A 5CU6A 2WOTA 3F2RA 4DA5A 3AC3A 1OAOC 2I7NA 4MGIE 4LGMA 2ETRA 2GFCA 1K2PA 1CKIA 4PNIA 3ZFYA 1OITA 3D15A 4CT1A 2G1TA 2AHMA 2WMBA 4WUAA 5I0BA 3RPVA 2I0VA 1OVEA 2CMWA 1WXQA 3VK8A 5TR6A 4HGLA 4BDAA 4U3ZA 4W8EA 2PZPA 1TH3A 4O0WA 1BMKA 4IJEA 2GNJA 1TFFA 4I6BA 1NW1A 2OLCA 2QHMA 4ITQA 1PF8A 2L4FA 2R3OA 2CWBA 5E9EA 3HY5A 2UUAM 2HWOA 3VNTA 3E93A 4EOLA 3LMMA 4HVDA 4Y83A 4GKIA 1GABA 4FBXA 5GZ9A 3W2CA 2BCJA 5CZHA 2ZV2A 3HLLA 4A9YA 2VO3A 4QMNA 3OXIA 4AXAA 3ROCA 1XMMA 3EN4A 5DT4A 1NY6A 3R83A 2W4KA 4DFUA 3EQIA 3MA3A 2RFEA 5D7VA 4I20A 3BYOA 3W32A 5E26A 4A9SA 2DWBA 3HV7A 4EOSA 3SASA 5HLPA 3FEGA 2W05A 3PUFC 2YCRA 5FGKA 5DFLA 5BVEA 3OP5A 1G8JA 4F0GA 4TWOA 3MFTA 5E8TA 5B7VA 4ACMA 3PZHA 3UPXA 1GJOA 2MR9A 2ZANA 5FSWA 5IQBA 4AWIA 1Q02A 1VEJA 2IWIA 4F63A 3GLIA 4I92A 5EHYA 4HLQA 4YP8A 5AIKA 2QZ4A 4TWCA 4Q7JA 2HKJA 4PWNA 3U6EA 3ILKA 3KN5A 3QD2B 5HVYA 3UTOA 4M0DA 1NHWC 2OH0E 2OJFE 1XNRM 2WIPA 2BKZA 3T6PA 1PMNA 1NVSA 2WU6A 3O96A 4B0GA 2DKLA 2JY5A 4I5SA 1GJSA 5KMKA 4P90A 4G4OA 2X0GA 4X0MA 4NFMA 1Q97A 2DWMA 4QP8A 5KO1A 3UP2A 1ZOHA 4NW5A 2Z7LA 3R7VA 2C3IB 4ENXA 1OL1A 3CPBA 4DG2E 3WI6A 1B6CB 3UIUA 4QNRA 2EUCA 2ETMA 3J7BA 3QRIA 3R63A 1HQYE 3KULB 3O7LD 2J50A 4XV9A 1XC8A 5FXQA 3KFUG 4II7A 2QCUA 4B8MA 3VF8A 3U6CA 4H3BA 4QNAA 2PYWA 2FSOX 3NWWA 4BWXA 5HG7A 4F6SA 2VTSA 2WTKB 3KXZA 1PHKA 3ANRA 3G5DA 4KIOA 3C4ZA 2W9ZB 4MBJA 4OTFA 3Q9WA 4ASXA 5FEDA 4A06A 3V8WA 4RIXB 1TQPA 3HV5A 5D1JA 4OVZB 2Y4IB 1TF0B 3QLGA 3IHPA 1QPJA 2H34A 2OWBA 4NWMA 5G6VA 4KIKB 4EZ5A 2BKKA 2UZBA 2V0DA 3D83A 1J1CA 4XG6A 4FSYA 2KULA 4ZIMA 3E7OA 4G4QA 3A4OX 2J5EA 5EYMA 4ZJVA 5IQGA 5M53A 3L26A 2Z02A 2X8IA 3CTWB 3BBTB 3NSZA 4K77A 3SX9A 3KS8A 4BDCA 2O0UA 2QPAA 4I23A 2YM8A 4R8QA 1IY2A 1NSFA 3P23A 5DR2A 4UB7A 5IG1A 1WBOA 4AE9A 4BIEA 4HJOA 2OZOA 1U5RA 4U40A 2OXYA 4FKRA 1J7UA 3F7WA 2XJ2A 4GMYA 4CNHA 4X2FA 1G8AA 4F6WA 2JDTA 4ANLA 3HUBA 4OTPA 3H0YA 5EXXA 3PRFA 4FA2A 4LRKA 4TWNA 4CKJA 4FSZA 4F7NA 3P5KA 4D9TA 1PYEA 3NPCA 3FMKA 4CFXA 4QPMA 3BQRA 4DR3M 4BCQA 3U6LA 3PG1A 4GK3A 2L6OA 3CGOA 4W4XA 3QWLA 4Q9ZA 2QU5A 4TYHA 3Q8XA 3EQBA 4G3OA 3RM7A 4ZTRA 2Q0NA 4RIXA 1HCKA 4E93A 4JBPA 4IZ7A 3GBZA 4OVZA 2GSFA 1H0WA 4EIWA 3EZVA 3LLAA 4L00A 4RJ8A 4DT9A 5J1WA 1UNGA 1Y8GA 3J27B 3JXWA 4BI0A 3FZSA 4LZJA 5EQYA 4KUJA 4I6HA 4NJDA 2VX1A 4I41A 1IN6A 4QOXA 2UW9A 3RPRA 3CF2A 2C5RA 4DR2M 3TNQB 3GLIE 4EH7A 3HEGA 4BJJA 2JFMA 3D94A 3GRYA 3EJ1A 2DWLA 4DDIA 2JITA 4FTCA 3B8QA 2IVSA 5CYIA 3FUWA 2I0YA 4LRMA 1H1RA 3KMWA 5LJJA 4J96A 1W0XC 3KOZE 1M52A 4RMZA 3FAAA 4HGTA 4JDJA 4YY3M 2BTRA 4FODA 4JAJA 4U45A 4LYNA 2ZM3A 1ZAOA 4FKIA 2X4AA 2EKFA 2LVPC 2Z8CA 1YDTE 3FUXA 3F5XA 5DH3A 3KSJA 2B9HA 3FY0A 4DV7M 3RINA 2DHYA 3NW7A 4C33A 3ORLA 5HIDA 2GQFA 3JY0A 4GKJM 5HX8A 2FSMX 2C69A 2C9CA 2B52A 4BY9E 2XK7A 4FKTA 3HJSA 3LJ2A 2WTKC 3BWJA 3DBEA 2OBJA 1VLRA 3VKHA 4AT4A 3PIYA 4M68A 1OGUA 4I6LA 3ZSHA 1FGIA 2ZTCA 3B89A 1JLU