1ZMWA

Catalytic and ubiqutin-associated domains of mark2/par-1: t208a/s212a inactive double mutant
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 97
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmwA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmwA01
3GVUA 4II5A 3I60A 4PDPA 3C4CA 3CCNA 5TE0A 2JDVA 2OICA 4OT6A 2CGVA 3KCKA 4EQMA 3AMBA 3HA8A 5HNBA 3Q32A 3RZBA 4B7TA 3OW3A 4EL9A 3MWUA 1YWNA 5F20A 1HCLA 2ETMA 4IAAA 2BWBA 2MROB 3Q53A 4YZBA 2BHHA 4GSBA 2W1EA 3IGGA 4RMZA 1OPJA 4MX9A 4O84A 2C68A 5CF4A 3FXZA 5DEYA 5DRDA 2QU5A 3SXSA 4GG7A 3DAJA 3KVWA 3CE3A 4OLIA 1XQZA 4O96A 1CSNA 1WBVA 2X4FA 5DVRA 3R7EA 3TJDA 4R8QA 5AWMA 5BMSA 1ERKA 4M67A 3QL8A 4DFLA 1CUKA 1E1VA 3G33A 4YTCA 2XEZA 3O17A 5HGIA 3SDJA 4ACGA 3T9TA 1UVRA 3E92A 1ZWSA 3QFVA 4IX6A 2YDKA 3FMEA 4BN1A 5CSPA 4KAOA 3I5NA 1YI6A 3OHTA 3PIZA 4MBJA 4AWIA 4U40A 3C4EA 3MIAA 4EH4A 4CG9A 4BBFA 5F94A 3EFWA 2GS2A 3FRHA 4BGHA 3R8LA 3LLTA 4IVBA 5C4LA 3C5IA 4XBUA 5CX9A 2FH9A 4RX9A 3C0HA 3NDMA 4GT5A 4NJ3A 4GUEA 4AW1A 2RIOA 2CLXA 3ZFMA 4XP3A 2ZOQA 2W4KA 3VHEA 3ORPA 3BU6A 4BICA 1JBPE 3IPHA 3GLFE 2XIXA 4GJ3A 4P5ZA 2J4ZA 1ZXEA 2EXMA 4R7HA 2JIUA 4W9WA 3H4JA 5EH0A 4F7JA 1HJPA 3A61A 2HAKA 4UMUA 4RZVA 2QR8A 3GQIA 3CQEA 2WTKC 3QZFA 2RKUA 3VBYA 3EFJA 4D2VA 5JFSA 2W99B 4WKQA 2HWPA 2QOQA 4FG8A 4TYJA 2VWUA 2RG5A 5CU3A 1WZYA 3W2OA 4X0MA 2ONLC 3VJNA 2JY6B 3E93A 3HNGA 2DAKA 4HYSA 4GU6A 3OY3A 4MEDA 1URCA 4E4LA 4EYMA 3I0QA 2OJFE 2EJSA 4JOAA 3NIZA 4C38A 2X2KA 2YDJA 2ZAZA 3NUXA 3EHAA 3QX4A 3F5XA 1UWJA 4OTPA 4WUAA 4BYJA 2VGPA 4W8EA 3BGPA 3UPXA 2XK8A 4ZOGA 1U4DA 2PHKA 3TTIA 5DRBA 3N51A 4FSNA 4AOIA 4O0UA 5JGBA 4JIAA 2JZ0A 4FK6A 3UG2A 2X81A 3WZUA 3SG9A 1UV5A 1M17A 4K11A 3I6UA 2QC6A 2UUEA 4QQJA 3QTUA 4D4RA 4GMYA 1ZAOA 2F2UA 3PVBA 3LVPA 4ZIMA 4ZS0A 2EKKA 3B8RA 4IHPA 4DN5A 3U6IA 4GCJA 2LVPC 4FUYA 4QTCA 4UBAA 3IW7A 4H05A 3HX4A 1A5TA 4MQ1A 3H30A 3UGCA 5EI6A 2YDIA 5HEZA 2JEDA 4E7WA 3CGOA 2ZMCA 2PULA 3W10A 3PG1A 4ACHA 3BHHA 4QNAA 4F0IA 1VEBA 2PVHA 4MHAA 3QLGA 2OFVA 3EB0A 2X7GA 3BBTB 5CT0A 3AGLA 3UPZA 2BIYA 4DBXA 3E46A 5CI6A 3PZHA 3BQCA 4D4VA 4BWXA 1JLUE 4FEWA 3NZ0A 5EDQA 5D11A 4V0GA 4NTTA 4HYIA 1UWHA 3FMNA 4QYGA 2G2IA 3VRZA 4R5YA 4IX5A 4JDHA 3IW6A 3DKFA 5C8MA 1FVVA 1MQ4A 3BHYA 3E8CA 3KA0A 4UEUA 3F3UA 3Q9ZA 4QPSA 2JD5A 3QC9A 4CLIA 4O86A 3E3BX 1YKRA 3QWJA 4Q7JA 4BB4A 5HKMA 4F6SA 4C3FA 3LM0A 2PUNA 3QRUA 2XIZA 3ACKA 1BYGA 3QXPA 4EOIA 4ZZOA 4C7TA 3FMLA 3EYGA 4LOPA 4U81A 5EYKA 1DI8A 3IOPA 4JI9A 3TACA 4EKLA 4EWHA 3HA6A 4LL5A 5FEQA 4WBOA 3BI6A 3UYTA 3CGFA 4L46A 2JC6A 4YP8A 3F92A 3K9OA 4D2SA 4GK3A 5L8LA 1OGUA 2WTIA 3O7LD 4H3PA 3QRTA 4XG7A 4PPCA 3F2NA 4RVKA 4JAJA 4PUZA 4LGGA 2RGPA 4YZ9A 5EW3A 1M14A 4MNFA 3BGZA 3O7LB 5AV3A 2YA9A 5I0BA 4AT4A 1YDRE 3BBWA 5EYCA 1F3MC 1V0OA 3BLQA 4I6QA 4MWIA 3LCSA 4TWCA 5M56A 2ZTCA 2I0EA 4EOSA 4XOZA 4PDOA 4AP7A 5EKNA 2DAEA 1RW8A 2PZ5A 3LFDA 5AAGA 4DH1A 3Q4UA 4GFOA 2ZB0A 4AGCA 3MMPA 3ZFYA 4S31A 2VWZA 4EOMA 4DLJA 4FNYA 1WCCA 4XNEA 2DAIA 3ZO1A 3RAKA 4F6WA 3TXOA 4QP4A 4USEA 2YM4A 2Y4IB 3FLSA 2GQGA 2P55A 2VX1A 3GLHE 3CQUA 3R8PA 4D5HA 1NW1A 3HRFA 3RCDA 4BL1A 4KKEA 5D41A 2H9VA 2PVKA 4I1ZA 4WG4A 5IUHA 4BI0A 5K5NA 4IAKA 2C5XA 5JK3A 3VW8A 4CMUA 4BIBA 4FSQA 2X7OA 4O0YA 4F1MA 2JAMA 5GINE 4ZTHA 2R9SA 3W1FA 3V6SA 2YM6A 4ZXTA 4CYIA 1NV8A 3ELJA 2FA2A 4TYHB 4KIQA 2I0HA 4QP2A 4A4XA 2WMBA 2R3LA 4BDIA 3DKGA 3QTQA 4EK4A 4Q2AA 4ZSJA 1KOBA 2CN5A 4ZAUA 3ZXTA 3EL8A 1PF8A 5M53A 3EQFA 3MDYA 1XR1A 2PMNX 4WO5A 5AP3A 4XG3A 3V5WA 2R7IA 3D5XA 5AR3A 1AIPC 3SA0A 2Y7JA 1T43A 3QLFA 5HORA 3NCGA 4FT5A 4FSZA 4AUAA 4OTQA 4AF3A 2R3MA 2XH5A 1R78A 4LRMA 4MXZA 5DHJA 5IA3A 2XP2A 4FTTA 5EG3A 4A9TA 3R0TA 2YCSA 4QYYA 2WMVA 2QU6A 5GIPE 2V7OA 2V0DA 4O27B 5AEPA 1WBTA 1KE6A 1UKHA 3MFUA 3OBGA 2DYLA 4RJ7A 5ICPA 3F66A 2HZIA 3GU4A 1ZY5A 5F9EA 3EQRA 4YJQA 3UO4A 3FJQE 5KNJA 4AGWA 2BKZA 2QOKA 2JFMA 2IVUA 2WEVA 4I92A 3W2PA 4ZSAA 3SHEA 2RFNA 4W4XA 4KS7A 5FBOA 5GJDA 3C0IA 3GU7A 1KE7A 2W5AA 3IO7A 3QTXA 5AR4A 3W2CA 4WG5A 3QKMA 4BY9E 4GUBA 4C35A 3NUYA 3BHVA 3R9OA 5C8KA 5A4LA 3R7IA 4X2NA 4DA5A 1BI8A 3F6XA 3VC4A 3NGAA 1BL7A 5AIRA 3V5LA 4G3FA 5BVNA 5IA4A 4DTAA 3MSSA 4CLJA 2EUFB 2EVAA 4FIEA 2RRUA 4I0RA 3UYSA 4X2GA 4R1VA 4YSJA 4GIHA 2GNJA 2V5QA 5CASA 3BU5A 3HGKA 3NUAA 1B6CB 2W7XA 3UO5A 3QRJA 3TZ9A 3SVVA 4BTFA 4G3CA 4TW9A 3CPBA 2CCIA 3SXRA 3K5UA 4I3ZA 4G34A 2PZPA 2YN8A 5AV1A 1JSTA 5HE0A 5I9VA 4FKSA 2F7EE 3ZBFA 2CGWA 2PE2A 1H1WA 3D15A 2Z60A 4ZTSA 3F9NA 5AM7A 2FSMX 4HGTA 2W0JA 2PVRA 1PYXA 5JGDA 3F69A 3OG7A 3DBDA 1F4IA 4S32A 4TY1A 4R3CA 2X9FA 1FMOE 3COKA 5FLFA 5LCJA 4HEOA 4G16A 4GRBA 1CKIA 2PVFA 4UMPA 3NVKI 2PMLX 5A14A 5ACKA 3FKLA 1YHSA 5JFXA 3WF9A 4KWPA 3RKBA 4EJNA 2OOBA 2IO6A 4C62A 4DAWA 2UZTA 2PVMA 2QO7A 3FLQA 4FNWA 1CMKE 3D7ZA 4FTUA 3DAEA 3DXNA 2Z02A 5FRIA 3DJ6A 2F49A 4FTLA 5EYMA 3W55A 3HRCA 1VG5A 4FK3A 3VF9A 2P0CA 4WT6A 4LYNA 4MF0A 3ZOSA 2WQOA 3DBCA 3DS6A 2QHOB 2WMUA 3LXLA 4ZY6A 1UFZA 3PFQA 2XNNA 1SNUA 3CJFA 3FLNC 4TWNA 5EDRA 2QKRA 5CEMA 2XJ0A 4USFA 3CSVA 3COHA 2W4JA 4A07A 4OBPA 3PA4A 2OWBA 4YLKA 1ZMWA 4ANQA 2BROA 4JBVA 2LVAA 4FSRA 3ZEPA 4ACCA 2E9UA 3I7CA 3PRIA 3EQGA 3ZEWA 3O71A 3QQUA 4BDEA 5CEPA 4CGAA 3VAPA 2JFLA 4MXOA 1H01A 3FL5A 1FGIA 3KB7A 2VTHA 3DLZA 2BRNA 4L3PA 4CYJA 3QQLA 3HDMA 5JSMA 5L2WA 4EH5A 4WNPA 3HUBA 3NUNA 3OCSA 3HZTA 2QI8A 3D7TA 3LFNA 3F3TA 3R7UA 4BDCA 2JITA 5DFPA 3U6JA 3L9MA 4GIIA 4JG6A 4UMQA 3QQFA 4G6NA 4M3QA 2B54A 4CKRA 2X9EA 4DGGA 5HG8A 4TYIA 3LQ8A 1LPUA 4TYGA 4F4PA 3ZZWA 4PMSA 3UQCA 4DLIA 5IKWA 4AN3A 1YLAA 3ZC5A 4E6AA 4LRJA 2GHLA 2I7QA 4LV5A 4WHZA 4AW5A 4LOOA 3UVRA 3VBWA 2QOOA 1J1CA 5CU6A 2OO9A 3SC1A 5CEKA 1ZMUA 2NPQA 4HCTA 3LAUA 4LG4A 4BDKA 5C26A 2R3IA 5HX8A 4IC8A 2C5OA 3Q6UA 3ZSHA 3MA6A 2V7AA 4JDJA 3ALOA 3Q9WA 3FZPA 4A4LA 3FPMA 3FMMA 2QLUA 4AZSA 4QMYA 1OZ1A 5DE2A 3V51A 4BCKA 5J5SA 3E8NA 1JKKA 1NY3A 2BALA 3KMMA 4G6OA 5CNOA 1W8CA 3EZVA 4NTSA 5HOAA 4FV0A 3ZDIA 4JR7A 3QGYA 4D55A 2DUVA 5I9WA 1YI3A 5M4FA 5H9BA 3IW5A 1KOAA 2ZMDA 2I40A 1YHVA 4WUNA 1ATPE 3LCDA 3ZSGA 3BYUA 4DH8A 3QGWA 1JWHA 1OTRA 3QCXA 3ITZA 1ZYLA 1GNGA 3LJ2A 4RFMA 3PP0A 4C34A 4C61A 3ZUVA 2VWXA 4TNDA 2VAGA 3OY1A 1VQ1A 5IQFA 2VTOA 1L3RE 4O6EA 2ZVAA 3G6HA 5AUZA 3H9OA 5AX3A 3K2LA 4EUTA 5ANJA 3WYXA 5I9ZA 4JNWA 3R71A 5E8YA 1NVRA 4YJPA 5JEBA 1XWSA 1VDLA 3M1SA 2OIQA 1HT2E 4C4HA 5CLPA 2Q83A 2R3KA 2WU7A 3VQUA 4W8DA 3JY0A 1OM1A 3ZCLA 5CEOA 4G17A 3PJ8A 5HLPA 2A1AB 4ZSEA 4FUXA 5HG5A 4BCPA 4MQ2A 4FV2A 2WMTA 3EN6A 3F5PA 4RT7A 3BE2A 3GOKA 1P3QQ 3HLLA 1LP4A 3KRXA 4PMTA 4U5JA 4ZJJA 4AACA 5CAUA 5F4NA 2C6EA 4O7VA 4IZAA 2VTAA 4UXQA 3EWHA 4RWIA 3R30A 3E63A 1M2QA 3D5VA 3G5DA 4YR8A 5BUIA 3ZBXA 3IW8A 4OR5A 4RJ8A 4EI4A 1H27A 1J7IA 3WARA 2NP8A 1E94E 3EQPA 4D5KA 4NYEA 3BPRA 3BWJA 1ZOEA 5CAOA 4ZSGA 2HCKA 3K9PA 3FI2A 4HNIA 4YZMA 5M07A 3B2WA 3POZA 4LOQA 4AQCA 1CKPA 2WPAA 2EU9A 3NX8A 4F0GA 2WAJA 3R6XA 4XV2A 3AD4A 1UU7A 3FYKX 3G9LX 5IMXA 5G6VA 3II5A 4H3BA 2ZM4A 4L53A 5HTBA 4ZLOA 4WP2A 4FF8A 4ID7A 4S34A 3QXOA 4YBKA 1HQYE 5IEVA 1TQPA 1XKKA 2Z2WA 3TIYA 2JUJA 3ZLXA 3LJ0A 4O7WA 3VBXA 4MK0A 3R04A 4BDFA 4I6HA 4IXPA 2ZV2A 2NO3A 2OKRA 4N0SA 3AT2A 3FPQA 4QQTA 3D83A 2WEIA 4PWNA 2WOUA 2XS0A 5HE2A 5EW8A 2IW6A 3FI3A 5K3YA 3UNJA 4EC8A 2R3PA 2ZJWA 2H5XA 2AC3A 4QP7A 4C2VA 3KXGA 5AUYA 4FYOA 2XK4A 2UW8A 3K54A 3TNQB 4CFVA 2G2HA 2W9FB 4O1PA 4FNZA 4NZWB 2WMSA 2XKCA 1R3CA 4FZDB 3DB6A 1YXUA 5TR6A 3RP9A 1OIRA 2UW5A 2VGOA 4BDGA 2DHYA 1PXPA 3TUBA 3KXNA 4YLLA 4AG8A 4DFZE 4E4MA 3PG3A 4U6RA 3FYJX 4EBVA 3GLIE 4BKJA 5BUJA 2XEYA 3BELA 1ZOHA 4RVLA 4C4JA 3FEGA 4RC3A 2DS1A 2W1GA 3ORMA 3KK9A 1OKVA 4BCIA 4C4GA 3O96A 1OKWA 4BDHA 2CCHA 2YLEA 1HT1E 2ITXA 3C51A 4D4YA 1PYEA 3VHKA 5DMZA 3TKHA 2JGZA 4O0RA 1FQ1B 3QF9A 4G2FA 3IK3A 5FD2A 5EFQA 4C3RA 2WMAA 4XYFA 3U4WA 4M66A 2DAGA 2UVYA 2C4GA 5LMKA 2UW3A 3G0FA 3GFWA 2DENA 4UB7A 2OF4A 3C50A 2XNOA 5E8XA 3O51A 4BI1A 4GJ2A 2CGXA 3KMUA 3OZ6A 2QR7A 3OCTA 2VWBA 1JPAA 4EBWA 3A7JA 2ITUA 4QTAA 4M15A 1EFUB 3IHPA 3PE2A 3U9NA 2CNVA 4TYHA 1BLXA 1OL2A 4ENYA 5AR7A 5EQEA 2E9NA 4AOTA 5B7VA 3FBVA 3VBTA 3RPOA 2F9GA 4A4OA 4YTFA 3UBDA 3HL7A 4LMUA 4ANSA 4EH8A 3DDQA 3G90X 5AA9A 5FP6A 2J90A 3TG1A 2V22A 1NXKA 3PVGA 5DI1A 5H8EA 2QSFX 5ETFA 2X2LA 2OGVA 3DKOA 5J9LA 1MN3A 1H0WA 3PXKA 1ZMVA 1G41A 1IRKA 3A8WA 3ODZX 2JNHA 5CYIA 3WI6A 3I79A 4O7NA 3DAKA 3U9CA 3QRKA 4JLCA 3JY9A 4MNEB 3RAIA 2V62A 3RK5A 4AZTA 4ASEA 3DY7A 4L52A 1PMNA 5CU4A 3T8OA 2HW7A 3QUDA 4EK8A 4DBNA 4O81A 5DYJA 4RJ5A 4E93A 3KULB 1Q41A 5KHXA 3FC1X 3GCVA 2WOTA 5EW9A 3RPSA 4F64A 2R3HA 4KKGA 3ACJA 3QTRA 2JY5A 4JDKA 5FBNC 5H8BA 1FINA 4FTRA 4AN9A 4NKSA 3QZIA 2Z7RA 3Q4CA 3FY2A 3F7WA 1H8FA 4Q5EA 3GBZA 1OUKA 4EC9A 3GT8A 5LVLA 3MS9A 2RSVA 2PL0A 4YUQA 1JSVA 3P0MA 2WTKB 1XH4A 4UWYA 1Q8WA 5EDPA 5EHYA 3UOJA 4EOOA 4ALVA 5C8NA 1O6KA 2F7ZE 3A4OX 4FKTA 1OIQA 4X7QA 2C47A 1VEGA 3DU8A 3TV6A 2RL5A 2E9PA 4EH7A 4CQEA 1J3HA 4KNBA 4QMUA 5T3QA 3VWAA 2L4FA 4FTQA 3ULIA 3Q2MA 3PRFA 4EKKA 4M7IA 1W83A 2ERZE 3CP9A 3DQWA 2GDOA 3COIA 3MIYA 2NRUA 2VWIA 3RTPA 1ZY4A 4IM3A 1IA9A 3S4QA 3UIMA 4WSQA 3CY3A 1H1PA 4QMLA 3R21A 5CVHA 3T3VA 5J7BA 4R5SA 3UOLA 4FEVA 2DI0A 4CNHA 2EB2A 2G01A 3P7CA 2YIXA 3CPCA 3GGFA 3QCQA 4LV8A 2ITZA 2J51A 4Z7GA 5IA2A 4YZDA 4U45A 2C1AA 4BRXA 5BVFA 2H34A 2PK9A 1XBCA 3OD6X 4JDIA 4OBQA 1BMKA 2VX0A 3HV5A 3LCTA 3TTJA 3OXZA 3ZO3A 3I5ZA 3KRRA 2OLCA 3ID6C 1WGLA 2W5BA 4RJ6A 2PZRA 4JRNA 5AP4A 3ZZEA 4AN2A 5B2LA 5M06A 3FZTA 4CD0A 4DTBA 3R73A 1K3AA 4I6FA 4AGDA 4U80A 3HRBA 4OTHA 4Z55A 3QD3A 4DINA 2O65A 4ORKA 3I7BA 3V5QA 4RFZA 4U97A 3A4PA 3FUPA 5AP5A 4A7CA 3ZS5A 1SVHA 1SZMA 2UZOA 4D1ZA 2DNAA 4OT5A 3BKBA 3L9PA 4GL9A 2UW7A 3DJ7A 3PE1A 4FZFB 4FTKA 4DGMA 5LJJA 2VO7A 2QQ7A 4QOXA 1Y8YA 3MVLA 4LUEA 5KZ0A 4EQCA 4F08A 2R5TA 5A4CA 5E8SA 5K9IA 1K9AA 4GVAA 4IMYA 2YCFA 4BF2A 4DH7A 4IAFA 4EK3A 3FI8A 4EZ7A 3FQEA 4X2FA 2OIDA 2ZV9A 1QPJA 5E4HA 3GEQA 3Q6WA 4IC7A 4BKYA 4BKZA 1LR4A 4HVDA 3GU8A 3NYOA 2R3RA 2X8EA 4ACDA 2Q0NA 4D4SA 3LKMA 5AJQA 2YFXA 4CTCA 4PF4A 4DT9A 4ALWA 3LHJA 2OXDA 2JDTA 3LCOA 3ZO4A 2B9IA 4FG7A 1A9UA 3EIDA 5ANKA 2XM8A 3FZOA 3AD6A 4KRDA 4L44A 2C6KA 4EQUA 3PJ2A 4JX3A 4ZZNA 4ANMA 5AAEA 4UX9A 3MESA 4EORA 3LFAA 4N6YA 3HP2A 4L3JA 4ZY5A 2XK9A 1Y8GA 4U44A 4HYHA 2OSCA 2LVQD 1ZYDA 2W1DA 4FZ6A 5CF5A 2YERA 2B52A 2BDFA 4A9YA 3R8VA 2IZUA 3ORTA 4MWHA 3ODYX 5CWZA 3IG7A 1H1SA 3NAYA 4OTRA 3DZQA 3UODA 1XO2B 4ZEGA 3ORZA 3TKIA 3MFTA 3N4UA 2VRXA 4ONAA 5M08A 3Q4ZA 2GFCA 3R9RA 1IASA 4CSVA 2R0IA 2OJJA 4NW5A 3DJ5A 2UVZA 3EQIA 3FSKA 5ANIA 3RZFA 4ALUA 4Y5QA 4C37A 4CCBA 2L4EA 2LGCA 5FM3A 3UP2A 5DT4A 4AGUA 4C8BA 1YXVA 5HIDA 2UZNA 4QMOA 4KINA 2F4JA 4PMPA 2WHBA 2O2UA 5E92A 2R3NA 4B8MA 2UZWE 3KCFA 3DT1A 3KXHA 4TZRA 3WE4A 1G8SA 3PA5A 3KGAA 3QX2A 1T6OA 3NNUA 5HVJA 2ZV8A 2CNUA 2F57A 2OG8A 2W06A 4BTKA 4O0WA 2PVNA 3LJ1A 4NH1A 1K2PA 3P23A 4UXLA 3W32A 4DFUA 5FTOA 2MR9A 1YVJA 4RWKA 4YTHA 4AA0A 1DO2A 1OB3A 3R1SA 3TIZA 4AA4A 3LE6A 4APPA 3IDCA 4XV1A 4F9YA 1V1KA 4JIKA 5E90A 5IISA 5L2TA 1TVOA 4XJ0A 4F2LA 4NKAA 1HOWA 5HBEA 4GYIA 2XNPA 3GC7A 5FDPA 4FZAB 2GHMA 4Z16A 2WMRA 3SD0A 4K33A 3O8TA 4BZOA 5KE0A 3MPAA 2REIA 3SX9A 2WMQA 5HG9A 3V5TA 5CXZA 4P2KA 4IB5A 5IH6A 4AX8A 4EWQA 1ND4A 4IH8A 4RA5A 4UWBA 3P08A 2J6MA 3RAHA 1Z9XA 3VUTA 1G3IA 2CWBA 4BR3A 2YM7A 1ZV1A 2BTSA 5ACBC 2E9VA 4CFFA 1A06A 4BTMA 4QD6A 5KMNA 2P4IA 2QD9A 4QMZA 4M69B 1PHKA 1H00A 2VTJA 5GIOE 3P86A 5J8IA 3WZJA 1OPKA 1Y57A 3O2MA 4FE2A 4FNXA 3PVUA 4NCTC 1G8AA 2CKOA 4J95A 4F9BA 1F0QA 2XVDA 5HCXA 1GIHA 5HO6A 3BV2A 3W2SA 4GFMA 1QL6A 4L67A 1CM8A 4A9UA 3D5WA 4AT5A 1P5EA 4J96A 4ZY4A 2VTPA 4FA2A 5H8GA 2R3FA 2W96B 5LMAA 4PDSA 1YW2A 4J71A 4FTJA 4WIHA 4XG8A 1GOLA 4AT3A 5HICA 5CQWA 5I9XA 3PZEA 5IQIA 3DFAA 5TT7A 2R3JA 4GS6A 3R00A 3RJCA 4NM3A 3GLGE 2X7FA 4OAUC 4X6QC 4BZDA 1S9JA 4E8AA 3G6GA 4FKQA 4L42A 4OUCA 3SAYA 4OTWA 1MQBA 3PWDA 4FGBA 1OPLA 2C0IA 4M0YA 4PNIA 5A46A 5CVGA 3ET7A 1OL7A 4M68A 4RX7A 4C02A 4QO9A 3KC3A 3VW6A 4O91A 1JKSA 2BAJA 4AFJA 5BYYA 3PSCA 5GJFA 3GB2A 4C3PA 3L9LA 4FVRA 5L8JA 3QTZA 1UNLA 2UZVA 4IQ6A 3ZXZA 2YCQA 3SG8A 3ROCA 4GT4A 4CRSA 4RIYB 4O7RA 4YSMA 5D9HA 3RPVA 3PSBA 2WZJA 2C30A 2YLFA 4PQNA 1OKZA 3OTUA 4X3FC 2QG5A 3W2QA 4QRCA 3QTWA 5FEDA 4QYHA 3MN3A 2Z7LA 4NJDA 4I4FA 4DG2E 2IZTA 3QC4A 1XB2B 4U8ZA 4W4WA 4ZTQA 3BX5A 1KSWA 4I0TA 3EKKA 3IECA 4AFEA 1Q97A 4QP6A 2C6OA 4EUUA 1KV1A 1G3NA 3PIYA 4M14A 4O2PA 5LXMA 3NAXA 2H8HA 3M42A 4IANA 4KA3A 5I5ZA 3VUGA 1Q24A 2ZDTA 1OVEA 2BTRA 4D2TA 2OFUA 3D2IA 1XBAA 3EQHA 3PJCA 1M2RA 3F5GA 3W8LA 5IQHA 3EN5A 4G3GA 3F7ZA 3IKAA 3SGCA 1XH9A 3EL7A 3ZUUA 3I0OA 2XB7A 5K4JA 4FSMA 4RLKA 3S95A 4I93A 4I41A 4O7ZA 1SVEA 3JVRA 4CV9A 1O6YA 4XCUA 5HE3A 3A7GA 1J91A 3PP1A 4NM7A 3HVCA 3JVSA 3TCPA 4EOQA 2C69A 1GO5A 4HVHA 5C1QB 1R0EA 3POOA 2R3OA 4FIJA 4DTKA 3QHWA 3CBLA 4MTAA 4NW6A 2BHEA 2JDRA 4OW8A 4F6UA 3MB7A 3DBEA 2X4ZA 4E6QA 1TTEA 4A9SA 1WMKA 2YIWA 4I21A 3VIDA 1R0PA 3ZDUA 3DGKA 1ZZ2A 4BDBA 3T9IA 5JKGA 2BZIB 2UW4A 2O3PA 1QPCA 2WQMA 3KRJA 4WBBB 3VF8A 4F7SA 3BLRA 3Q9XA 2X1NA 1SYKA 1OIYA 1OL1A 5DH3A 5CSWA 2CN8A 4ZZMA 1REKA 4YJOA 3VBVA 1YQJA 5A4TA 2VTSA 2G9XA 3V8SA 4FIFA 5HLNA 3IOKA 2HWJA 2CJMA 4CKJA 5AM6A 4XP2A 3KULA 3MY1A 4FICA 4EYJA 1OBDA 4UZDA 1U5RA 2VN9A 5HO7A 4EJ7A 5HVYA 3FQSA 1ZLTA 2FB8A 4G3EA 4UYAA 4Y5HA 3RNIA 2K9DA 2SRCA 4IJPA 4ARKA 1FBNA 2WD1A 1CKJA 5TKDA 3PDTA 5EHLA 2ERKA 2G15A 4IE9A 4QMPA 4RPVA 1KE9A 4NT4A 3NUUA 1KV2A 2LVNC 4YPSA 4BCQA 1QPDA 2UW6A 2OJ9A 4IVDA 2IN6A 2QHNA 4TTHB 5K0KA 3AMYA 2EXEA 1M52A 3QQJA 4L8MA 4BVUA 4IIRA 3HMMA 4CG8A 2ONLA 3DK6A 4PY1A 4QMSA 2C0OA 2W1ZA 2VTNA 4RVMA 5D7AA 3Q4TA 5IH5A 2XCHA 3FV8A 3FZSA 3L8PA 4IVCA 4CZTA 5M44A 3U6HA 1PJKA 5AR5A 2OZAA 3DNEA 5JGAA 4IWPA 4BCJA 1FGKA 4K0YA 2J5FA 4DFNA 3CD8A 3NSZA 3NUPA 3QYWA 3S2PA 1WBOA 2GQRA 4FEQA 4FODA 2JKQA 5F1ZA 4RWLA 5BYZA 3JXWA 5EHOA 3WIKA 2HELA 5DLSA 5HU3A 4U79A 3FHRA 2CSNA 3ETAA 5DOSA 3PPKA 1JOWB 2YM3A 1WIVA 3KU2A 4F0FA 3VUDA 4U41A 2GSFA 2YABA 4FV3A 4FEUA 4N70A 2ZTDA 2GMXA 3G2FA 4C58A 1Q8UA 2XM9A 2Y4IC 4RFYA 3RWQA 4L68A 4GVJA 1OUYA 2QOFA 4OBOA 5AP1A 4P90A 3C13A 1A48A 4ERKA 4LI5A 2YM8A 4XV9A 3COMA 3DFCB 2W05A 4G9RA 4XHKB 5CAVA 1SM2A 4FV5A 5LARA 4BC6A 1OIUA 5EKOA 4V01A 3TNPC 1MRVA 3E8DA 4BCNA 4DG0E 2QO2A 4I5CA 4CVAA 2XNEA 3PJ3A 3IONA 4L00A 3ZM4A 3FY0A 2GNHA 3OOMA 3V8WA 1H4LA 2WQBA 2GQSA 1GJOA 1BX6A 2HYYA 2Q0BA 4Y85A 5ANDA 2XNGA 5AX9A 5HG7A 3TN8A 1UU9A 4HVSA 1Y6BA 5LQFA 3EN7A 3TUDA 2BWEA 2OXYA 4B6LA 4ZTMA 3TKUA 1YOJA 4XBRA 1IM2A 4XUFA 4BCMA 3BWFA 4IWQA 3BHTA 2RFEA 2R7BA 4K9YA 3U8WA 4C36A 1WAKA 2R2PA 3OXIA 2JP7A 2BRHA 1NV9A 1PRYA 3KREA 2C6DA 5G1XA 4DITA 3OTVA 4FV6A 3GCUA 1VEKA 5DR2A 4IWDA 5E9EA 4USDA 1PXKA 3AD5A 4GEOA 4IX4A 4WSYA 2R64A 5FTGA 4K1BA 3CKWA 5C03A 2QCSA 3KXXA 1GAGA 1EH4A 3R2BA 2JKKA 3R7YA 4RBLA 5CTPA 3WF5A 4PL4A 4QP3A 2PUUA 2W5HA 2XA4A 5KZIA 4YJSA 3RM7A 1C7YA 2E9OA 3ENHA 4IFGA 3UZPA 3V8TA 1YXSA 4IAYA 4MD7E 3AC5A 3DNDA 2LBCA 3F3ZA 4IJ9A 3F3WA 2B9JA 3L9NA 2VTQA 3OWKA 4FVQA 4UALA 4YPDA 1H28A 4EONA 1PXIA 1MRYA 5HU9A 4IDVA 1IR3A 4HZRA 1WR1B 2ITOA 4TKSA 5L6OA 3Q9YA 4R77A 5CQUA 3QZHA 3LXNA 3QALE 3QD4A 2BAQA 4FT7A 4GV1A 2ACXA 4XV3A 3FAAA 4Y46A 4DEDA 3MI9A 3ZUTA 4L9IA 4YJNA 3SQQA 4JQ7A 4UY9A 3DDPA 3HEGA 3DLSA 1XHAA 3JS2A 3GI3A 3I4BA 1SVGA 3PLAE 4O7LA 1QZEA 1IG1A 3HV4A 1RDQE 3QA0A 2PE0A 4NL0A 3NCZA 2DQ7X 5M55A 3IQ7A 3ANRA 4RRVA 4L01A 2VTMA 4LRKA 2QOHA 3VS0A 5KMOA 3TM0A 4O0VA 4GU9A 4MCVA 5CI7A 5IDNA 3PIXA 3BIZA 4G9CA 3Q60A 3TUCA 4UMRA 2HY0A 1JKTA 1I09A 1OQYA 2YIQA 5BQ0A 2VWWA 5IA1A 3VUIA 4ZLYA 5BMMA 4FG9A 2HWOA 3CQWA 3OOGA 3PY0A 4LL0A 4CZUA 4E3CA 3SW7A 3FXXA 4O1OA 3VS1A 5L2SA 5HTCA 1BUHA 3MYGA 4K2RA 5CNNA 3L8VA 5FWKK 3LFSA 4H39A 2C3IB 3GXLA 2XIKA 1GY3A 3R7VA 3OMVA 4DBGB 4F9WA 3C1XA 3Q5IA 2MJ5B 5E8ZA 5FXSA 2HZNA 3Q96A 3HAMA 2VZ6A 4TT7A 1WBWA 2O0UA 1JNKA 4CZYB 3DK3A 3IGOA 5EK7A 3CD3A 2IW8A 4BYIA 2JKOA 4M69A 4DCEA 1PY5A 4PV0A 1YOLA 4YC6A 2VNYA 3DOGA 5D7VA 4RG0A 4O7SA 2VV9A 5AV2A 4FBXA 1J7LA 4QPMA 1U5QA 3RNYA 3NIEA 2XBAA 1O6LA 4FSYA 3UDBA 5JI2E 2PPQA 1KUTA 2BDWA 4JG7A 5BUEA 2Y0AA 1P4OA 2XMYA 2J7TA 5EOBA 4C4FA 2VO6A 5BVDA 5DT3A 3PWYA 2W1IA 2OH4A 5EI8A 1W7HA 2O5KA 2FUMA 3ALNA 3PY1A 2YACA 2PSQA 4HCVA 3WYYA 2XKEA 2CGUA 1DV0A 2JDSA 2XK3A 4JQ8A 3SW4A 3I1AA 3F2RA 2XJ1A 2XYUA 4P4CA 5E7RA 4DH3A 5IH4A 3R8MA 2IG7A 4PPAA 2BR1A 3DCVA 3LOKA 5EI2A 4HCUA 4PTCA 5AP7A 4A06A 4CFXA 4D9UA 2FYSA 2J50A 3HMPA 3VNTA 2HXQA 4HPUE 2G3QA 2B9FA 4FKGA 4DFBA 4ZK5A 4L45A 3FL4A 2HK5A 3EMGA 4I23A 4XG2A 1IEPA 2PMOX 1YWRA 4O21A 2I6LA 4EHGA 4UZHA 3KMWA 3KQ7A 3A2CA 2O64A 4ACMA 4AS0A 3MPMA 2WIPA 2CPKE 3EQBA 3Q04A 4H1MA 4QMTA 2WU6A 2PU8A 3PXQA 3HYHA 2NRYA 3QD2B 5CF6A 1P2AA 3ZLSA 4FKOA 4G5PA 5KUPA 4FKIA 3O8UA 3TV4A 3FMKA 3GCQA 4F9CA 3PLSA 4QP8A 2FO0A 3ZONA 3LFQA 2GNGA 3E3PA 3QQKA 4U9AA 2E2BA 3OS3A 5JRQA 2HXLA 3ULZA 4IB0A 1YXXA 4RIYA 2YISA 4AW2A 1WFCA 1QMZA 1XH6A 1Y91A 2R3GA 2WO6A 3GU6A 3CIKA 3KFAA 3N9XA 2L2DA 3RCJA 2XRUA 3TJCA 4YLJA 5KMJA 3BQRA 2GTMA 3R1NA 4J8MA 3B8QA 3KN6A 3ZU7A 2OO8X 2PTKA 4Z3VA 4E4NA 3LCVB 2A0CX 2AUHA 2GTNA 2O8YA 4FSTA 3BYVA 3QKLA 4O38A 2ZB1A 3QRIA 4EOJA 3MH3A 1UNHA 2J0LA 2QOIA 4FZ7A 4FKUA 5CVFA 1ZYSA 4IVAA 3NRMA 1XBBA 5ETIA 2X0GA 3E7OA 4KABA 3SOAA 2BDJA 4AAAA 3EOCA 2PUPA 3R7OA 5HX6A 1PGYA 2EWAA 3NPCA 3OT3A 4JG8A 4WD5A 1H26A 2OW3A 4D28A 1LEWA 3NR9A 4K8AA 3OWJA 2G1TA 3UMWA 4YU2A 4XLIA 4F9AA 3FZ1A 4JVGA 3DTCA 1UU3A 4CXAA 4I0SA 1T45A 3KEXA 2W9ZB 1Y6AA 4CCUA 3U54A 3CTHA 4E26A 3A99A 4G5JA 2YAAA 4DT8A 4FTOA 4MF1A 2HENA 1PMVA 5DWRA 2C0TA 3OVVA 1U54B 3T3UA 3NVMB 2BKKA 4C57A 2QNJA 1WVWA 3EFLA 4JRVA 3GC8A 3TL8A 3FLYA 4D9TA 2GU8A 2OH0E 3WZDA 5L6WL 4PL3A 4DGNA 3KL8A 3GUBA 2YJSA 4YMJA 1TR8A 4QTDA 3U87A 5JFVA 1JAMA 4BDAA 4E6DA 5HTIA 1IFYA 4S33A 3ANQA 5E8VA 5TO8A 3UTOA 1OBGA 2JZ1A 4PP9A 4DG3E 2A27A 4FYNA 5H3QA 5CENA 3RK9A 3KF4A 3VN9A 3ORNA 4B4LA 4EH6A 3UZRA 3GENA 3W2RA 3Q5ZA 3FKOA 3OP5A 4JBOA 3FDNA 1IXSA 3P9JA 3IDPA 5T68A 2C5NA 2KTYA 3BE9A 3FI4A 4OTFA 2XKDA 4ASXA 4W4YA 3RI1A 4EHEA 1LUFA 3KF7A 2JLDA 4J99A 2UV2A 4I94A 5K0XA 5FM2A 3UNZA 4M0ZA 1H1QA 4J1RA 5AR8A 4QMXA 3SV0A 4ANBA 3O50A 3CEKA 4IWOA 5KKRC 2J0KA 3KK8A 5AUVA 3E21A 3AMAA 5JZJA 3R8UA 1FOTA 1O9UA 1OL6A 3PA3A 2QHMA 4O22A 3VVHA 1Q5KA 2VTRA 4IX3A 5E91A 3NWWA 5GZ8A 5A4EA 3FXWA 3RWPA 5AV0A 5IU2A 5EOLA 4V04A 1H08A 3O23A 3S3IA 5D10A 3MTFA 3KN5A 4KBCA 3QTIA 5ANGA 4AOJA 2XK6A 3MGYA 3QTSA 5DR6A 3PPZA 4I20A 5A3XA 3RHKA 3D5UA 2YHVA 4KBKA 4KS8A 3H3CA 4NFNA 4FKJA 2BAKA 2QOBA 5AMNA 3THBA 4KSQA 4DEAA 5IEXA 3ZSIA 3EZRA 3NUSA 3QCSA 3HMIA 3RVGA 3R7GA 4NK9A 3VBQA 2J0JA 3D2KA 2UW0A 3G0EA 2DKLA 4FKWA 4KBAA 2IVSA 3MY0A 2XIRA 3NYXA 5IZFA 2PZYA 5JFWA 4F7LA 5JMSA 3NW7A 1BI7A 2YITA 3K3JA 4I5MA 4AW0A 3DTWA 4CFNA 3QYZA 2GNLA 5L2IA 5CEIA 2GHGA 2IVTA 4NEUA 1OKSA 5IQBA 5E8TA 3MPTA 4ASDA 5KMKA 4RIXB 3DKCA 2LVOC 1XH8A 3PTGA 4FC0A 4DEIA 4KB8A 2ITNA 1Q99A 3EJ1A 3QA8A 3F3VA 3P4KA 2GS7A 4BI2A 4RZWA 4TL0A 4RC4A 2QVSE 2XIYA 3BU3A 3MH2A 3RINA 4QTEA 4UWCA 1DAYA 4XH6A 3OW4A 1TKIA 3OROA 3UOKA 4QMNA 2Z8CA 5AP2A 1MRUA 2VTIA 4J53A 1PXJA 2YIRA 3VS5A 5JH6A 1J7UA 1V0PA 1RJBA 2CKQA 2W17A 3HP5A 4KD1A 4M8TA 2CDZA 2WTWA 3FWQA 3AQVA 2BZJA 2JBPA 1JKLA 4I22A 4JS8A 4LQMA 4S2ZA 4DEHA 3GC0A 5IA5A 3AC3A 3LCUA 4XOYA 3GCPA 4XX9A 4G6LA 4D0WA 5IDPA 2B3TA 5DT0A 4HZSA 4ZJIA 3VS4A 5J1VA 5AR2A 3R9HA 4ANNA 2CKEA 2QOLA 3D7TB 1NA7A 3G51A 3NYVA 3C4FA 4EOPA 4K77A 4F65A 4FEXA 3C5UA 3Q52A 4QMMA 5AP6A 5CF8A 3R83A 3HMOA 2OOAA 4ITHA 3MB6A 3K5VA 2CP8A 2O25A 4OTGA 4U0IA 3LQ3A 1GZKA 2WTDA 1KE8A 5BPYA 4ZMFA 5IUGA 3ATSA 4DHFA 4FV4A 3ZMMA 3CTQA 4H1JA 5E1EA 4U7ZA 1Q8ZA 3FMJA 3HUCA 4JL9A 5JN2A 4QQ5A 4FOBA 5LVOA 3OUKA 4JJRA 4BFMA 3RM6A 4TYEA 1F5QA 2JAVA 2WNTA 2Y6OA 3LFBA 5GZ9A 5HCZA 4O0TA 3ORIA 5IA0A 4J98A 2P33A 3CC6A 1GZ8A 3D94A 3O8PA 5EYDA 1PKGA 3E88A 2BZHB 3DA6A 2J0MB 3MFSA 4WA9A 4I5HA 2WMWA 2XZSA 3DBFA 4HYUA 4QP1A 2ESMA 4ASZA 4E6CA 3LLAA 3H9RA 3BEAA 4PPBA 4RA4A 1T46A 5LVPA 5C01A 4X3FB 3VS2A 1P14A 4XRLA 5J9YA 3R63A 4FV7A 5JZNA 3S00A 3GCSA 4FTAA 3ENMA 4X3JA 5CAPA 2ITQA 4FL3A 4NUSA 3R01A 5FQDC 1LEZA 4L43A 1MP8A 2CLQA 3EYHA 4ZTRA 4DE4A 5LWNA 1W84A 4FKVA 3R2YA 3NW6A 3SKCA 1E9HA 3RHXA 1Q3DA 4FL2A 4CQGA 4CV8A 4EK5A 4MXXA 1UKIA 5IQDA 3OFMA 4NIFB 3SXFA 4ZLZA 1OECA 4J7BA 3ZLWA 1H07A 3JYAA 3C4ZA 3MA3A 4HJOA 3ZO2A 2B4SB 3M2WA 3ZRMA 1XXHE 2ETRA 3RGFA 4BBMA 5LMBA 5J95A 5M4IA 4LGDA 2JY8A 4XG4A 2P2HA 4YTIA 3AXWA 2IZSA 4HGEA 3HMNA 4IADA 4JBPA 4M13A 4IFCA 5HO8A 3SOCA 3QZGA 2B7AA 2YWPA 3MFRA 5AUXA 5EM7A 3TI1A 2GNIA 3QCYA 2A19B 3RK7A 5IMEA 5L8KA 3S0OA 5I3OA 3ORXA 2J0IA 2BMCA 4PTGA 4JX7A 3V6RA 3DK7A 1OL5A 3OF0A 3TV7A 4YO6A 5FGKA 3ZYAA 2BFXA 2I1MA 4FI1A 5M4CA 2F7XE 4MXYA 4XEYA 4IZ7A 2WFYA 5BVEA 4RJ4A 3NEWA 3UO6A 3JR1A 3GOPA 3R22A 4C4EA 1QPEA 4E4XA 1NVSA 4BGQA 5DPVA 4B0GA 3BYSA 3NNVA 4MKCA 3KRWA 3VQHA 2R4BA 3R1YA 4Y95A 4YZCA 5CANA 2YAKA 3IS5A 3DPKA 4F70A 5AFVA 3SRVB 1Z57A 2XRWA 2Y4PA 1PMEA 3PPJA 5AIKA 4BHNA 4QMWA 3UQFA 1DI9A 3AG9A 3ZRKA 5B2MA 2UZDA 3A60A 4JQEA 5I3RA 4QTBA 4WOVA 4WNMA 2JDOA 3D14A 2DZLA 4NSTA 2PZIA 4AE9A 5KBQA 4GFGA 2VWVA 3CS9A 3VULA 5CS6A 4Q9SA 1PXOA 3DBQA 3FKNA 3UMXA 4KUJA 3EN9A 4I5PA 3TNIA 1TQIA 2OBJA 4RQVA 2ITVA 4Y73A 2B0QA 2NNWB 4O82A 5HBHA 3BCEA 3RMFA 5J5TA 2VNWA 4TPTA 4EH9A 4EK6A 2I0YA 2XKFA 1OI9A 4KIKB 4KIPA 4L6QA 4MVFA 4HVIA 4Y72A 3Q2JA 3FLWA 3V5JA 4BCOA 1ZARA 4WG3A 3PSDA 3PY3A 4HOKA 2ITYA 4IB1A 3E8EA 4D2RA 1TQMA 4TRLA 2BRMA 3BRBA 2KNZA 4RSSA 3U4UA 5T6KA 4OTIA 4XG9A 5HVKA 4QNYA 3MV5A 4U3ZA 5DFLA 2W1FA 4DC2A 2QURA 4EHZA 1URWA 4H58A 5GNKA 1VJYA 4DF3A 2X6DA 2CHLA 5HIEA 2FSTX 1S9IA 3W16A 2RFDA 1E1XA 2YCRA 2GPHA 2B1PA 4GKIA 1WJ7A 2W1CA 5KO1A 1IAJA 2YIYA 3AC1A 4XMOA 4YHTA 2PUIA 3ORLA 2VTTA 5E8WA 1WGNA 4TN6A 3ZHPC 4PRJA 5CALA 3QU0A 4YGAA 1YDSE 1YI4A 5HE1A 3PXFA 4MBLA 4AZVA 5IG1A 2LAVA 3UVQA 2FGIA 4BWKA 5TOZA 3NMUF 4K18A 3S1HA 3HECA 4EH3A 2K0BX 1GZOA 3A7IA 4J97A 4PP7A 2Y8OA 3FLZA 4I6BA 1DM2A 4C59A 5F95A 5CU2A 1R4GA 5IUIA 1OKYA 4UMTA 3GQLA 2WB8A 5FXQA 3TNWA 4MAOA 4BCHA 4LFIA 4Q9ZA 4AXAA 4IEBA 3MJ2A 3UVPA 1OAIA 3T6PA 3ROYA 4FV1A 4PX6A 2QOCA 2FVDA 3PXRA 4JR3A 4MD8E 3H0ZA 3WILA 4CFWA 2HW6A 4EOLA 4DEBA 4LM5A 1PMUA 4C4IA 5GZAA 2JIVA 3HAVA 4MNEA 4FVPA 3F5UA 1P4FA 3O0GA 4OAVB 3MBLA 3G15A 3TDWA 5LCKA 3MVMA 4GH2A 4QMVA 3UIXA 4YJRA 5E1SA 4RGJA 3CXWA 2WMXA 4A9RA 5L4QA 2XF0A 2BIKB 3H9FA 1YXTA 4NFMA 2YEXA 4YNOA 2XBJA 5CXHA 3P78A 4RX8A 5I9UA 4DFXE 1B39A 5J1WA 1JVPP 1M7NA 4YBJA 5EQPA 1KYIA 4GEWA 2GFSA 3OEZA 1U54A 5KX8A 3CY2A 2ITTA 1YHWA 4FIHA 3Q3BA 5HCYA 3UG1A 2I0VA 4C0TA 4C2WA 4D2WA 4MXCA 5LVNA 3DZOA 3V01A 3MTLA 2KNVA 4XRJA 4IB3A 4KKHA 4DYMA 3A8XA 2GS6A 1ZRZA 2X39A 3NYNA 1W98A 4X21A 3WBLA 1H0VA 4W4VA 2ITWA 4F7NA 1Q4LA 2WGJA 1VYZA 4YC8A 1FVTA 1XH7A 1WBPA 3CJGA 3HV7A 4IZ5A 3QQHA 2WXVA 5J7HA 3ZC6A 2XCKA 4IW0A 3ZTXA 4CFUA 4FKLA 4U43A 4X6RA 1U46A 3B89A 2PVLA 4QYFA 2KHHA 1VR2A 3K3IA 1WBSA 5H2UA 3ATTA 4WNKA 4ZS4A 3F61A 4TNBA 3I81A 3KY2A 5L3AA 5FEEA 4APCA 2YJRA 1Q8TA 3HV3A 4BBEA 5K5XA 4RIWB 5LWMA 4PL5A 4XLVA 3QBNA 5FDXA 3BZ3A 3LMGA 2XUUA 3CKXA 2PVJA 4H3QA 4ENXA 4FT9A 3CR0A 3WZKA 5IQAA 2CMWA 3GP0A 1XH5A 2BRBA 2PY3A 4QQCA 2C1BA 2PE1A 4UN2B 2VD5A 4IZYA 4MXAA 3WIGA 3EQDA 4D2PA 5CSHA 5B2KA 5CT7A 4BTJA 1I44A 1UA2A 2YZAA 3V3VA 1QCFA 3QUEA 3TEIA 3U55A 3UOHA 3VJOA 3C7QA 5CSVA 3VS6A 5AV4A 3R8ZA 4QP9A 1RE8A 4FTCA 4RC2A 4O7YA 2ZV7A 1M2PA 3E7VA 3P5KA 3L8XA 1R1WA 3FHIA 2MGWA 2BILB 2P2IA 3NS9A 4LUDA 5LMKC 3C4WA 4PDYA 1ZYJA 3MY5A 2X6EA 4FSUA 3JUHA 2WTCA 2JY7A 2KNAA 3A7FA 3MH0A 2OXXA 4ANOA 5HBJA 2C3LA 4XP0A 3HKOA 5L6PA 3LQ5A 3A7HA 3UC3A 4HW7A 1R39A 4RIXA 4TWOA 4YHFA 5BX0A 4P7EA 4FSWA 4MBIA 4H36A 4JAIA 2BUJA 2P3GX 2VO3A 3ZRLA 4NM5A 4HGSA 3IDBA 3M11A 1VZOA 3OCGA 3LXPA 3OWPA 4RX5A 4NU1A 4S30A 3EFKA 1W82A 5TF9A 3VO3A 4EOKA 1FVRA 4KRCA 3RBWA 2GCDA 3U51A 5A54A 5KBRA 4NCTA 5M09A 4DGLC 5DBXA 4GKHA 3OXTA 3DQXA 3OT8A 2G2FA 3D4QA 5A4QA 2PYWA 1Q3WA 2OIBA 4FV9A 5FTQA 1WVYA 5GHVA 2RF9A 5A6OA 3TT0A 4L7SA 2BPMA 1ZZLA 3OCBA 2C6TA 5BVKA 4D1SA 4O83A 2JKMA 3TDVA 5C27A 1SNXA 3FMHA 3KXZA 4EEVA 1Q62A 5FUTA 5IQCA 4GG5A 3KRLA 3LFCA 1ZYCA 3NLBA 4GK2A 1SG9A 4ITIA 2HOGA 2OU7A 2VX3A 4GK4A 4E5WA 2UVXA 5I4NA 4O7TA 1H25A 1YOMA 3C0GA 4RVTA 4B8LA 3QAME 3QWKA 5AUUA 4ZMEA 3E87A 4E5BA 5HESA 1YDTE 2C6MA 3H10A 4F1IA 4Z7HA 5HNIX 3PXYA 1CDKA 3QKKA 3WE8A 5KMIA 3FE3A 4O2ZA 2IZRA 2WKMA 5EM5A 2LTUA 3W18A 4O0XA 4D0XA 2BRGA 4N57A 3MJ1A 3BLHA 5HLWA 4J8NA 2O63A 2V55A 3C4XA 4NM0A 4EH2A 1PXNA 3PJ1A 3R1QA 4DFYA 4GT3A 4B99A 5DIAA 1STCE 4PMMA 4F99A 4IACA 5BNJA 3N4TA 2XNBA 4CEGA 5BYLA 3WF7A 1W0XC 5J87A 5JQ8A 2EXCX 3DXPA 3NNXA 3UJGA 2IVVA 4DEEA 5M4UA 4YC3A 4JBQA 2VTLA 4FMQA 3LIJA 3LMIA 2JBOA 4GYGA 1PW2A 3DB8A 1G4AE 4OTDA 3W33A 2RG6A 4RJ3A 4X3FA 5ANOA 4AA5A 5CZIA 3HDNA 3A62A 2F2CB 4IAIA 2OK1A 5DGZA 4MH7A 2FSOX 4N6ZA 4ANLA 3BHUA 4R7BA 5D1JA 2HIWA 2QLQA 4C33A 2CNQA 2W1HA 2EKFA 4BGGA 2GNFA 4BIDA 5BVOA 2Y6MA 3FQHA 4XS2A 5EQYA 3V5PA 5ITAA 2BZKB 3P79A 4CRLA 5KMLA 2YZLA 3ZH8A 1JQHA 4NIFA 2VUWA 4F1OA 3CTJA 3MW1A 3SLSA 2Y9QA 3P7BA 4W9XA 3GFEA 4BCFA 3LM5A 4JXFA 1GZNA 2C3JA 3LFEA 4TWPA 2X8IA 2CKPA 3BBZA 3L8SA 2FSLX 4Y83A 3P7AA 3GNIB 1AD5A 2DAMA 4G3OA 3AC8A 3UZTA 5KMMA 4FT3A 4O6LA 4R1YA 3L1SA 2BVAA 1YRPA 5LVMA 5HD4A 3NW5A 5IF1A 2OZOA 3UIBA 5ETCA 4AZFA 2IJMA 2R0UA 4HGLA 4V0GB 3AT4A 4ZTLA 4E1ZA 4RLLA 4DGOA 4P5QA 3OBJA 1M7QA 4X2KA 4DEGA 4ZTNA 5DG5A 1MUOA 2B53A 3OUNB 5KHWA 5HD7A 1BVSA 2WQNA 3FZRA 4NWMA 5E8UA 5BVWA 2IW9A 4R78A 3EN4A 3LXKA 3R9DA 3VS3A 4L7FA 2ZDUA 3VS7A 2PMIA 3D0EA 3OEFX 5J9ZA 3FRIA 4FV8A 4AZWA 3AC4A 2BCJA 4CT1A 1H1RA 2UZEA 3WZEA 4E73A 3PVWA 1AGWA 4RIOA 5IQEA 4OGRA 1GIIA 1KWPA 3SRVA 4UN0C 5C9CA 1G5SA 2B9HA 4BDDA 2QONA 4F09A 2HY81 2UZBA 1PXLA 1H24A 4BCGA 4EHVA 5IPJA 4IAZA 4BIEA 3RPRA 5KKRB 3H0YA 5D12A 4BZNA 5K4IA 4F1TA 3TWJA 3I6WA 2OI4X 3LCKA 3WOWA 4G1WA 4ZP5A 5HQ0A 4GW8A 1SMHA 3R02A 3RPYA 3F82A 1V0BA 2JIIA 4FIGA 4RWJA 2AC5A 3F2AA 5B0XA 4ZSLA 1NT2A 5IQGA 4Z9LA 2A2AA 4Q5HA 2ITPA 4K6ZA 4QYEA 2QO9A 3KKVA 4CMTA 1L8TA 3V04A 4MD9E 1OMWA 4AU8A 2B55A 5L2QA 4EZ5A 4Y8DA 4FOCA 3W8QA 4RQKA 4KIKA 3E5AA 5CEQA 3E62A 5J79A 5AUWA 2C5VA 2H6DA 1FPUA 2BFYA 3BYOA 1X8BA 4UV0A 4IM2A 3VUHA 2QG7A 3BYMA 4ZJVA 3B2TA 1JSUA 2AYPA 3VUKA 4YJUA 5I9YA 4E20A 2J9MA 2RFSA 4R3PA 4BDJA 4CKIA 3WF6A 4YHJA 3UIUA 2X2MA 4FGRA 1RQQA 2XNMA 5CAQA 3QUPA 2W4OA 3TZ7A 5C4KA 4J52A 3AT3A 5AP0A 5AADA 4IM0A 4YO4A 5CU0A 4M12A 3PYYA 5FG8A 5HI2A 4I24A 3REPA 5DR9A 4D1XA 2HZ0A 3PXZA 5M57A 5JRSA 2C3KA 5AAFA 5A6NA 4R6VA 5CZHA 4FT0A 4M84A 5AUTA 1BKXA 2PVYA 5EM8A 5FXRA 4FR4A 4UYNA 3UQGA 2HZ4A 2IPXA 4LGHA 2OJIA 3JPVA 3R28A 2WTJA 5LOHA 3UNKA 4MYGA 1CTPE 4WRGA 4ITJA 1Q8YA 2WELA 3MVHA 1IAHA 2DWBA 4ERWA 3BV3A 3WF8A 4G31A 5ETAA 1WBNA 2C6LA 2Z7SA 2J2IB 3ERKA 5HIBA 3VRYA 4D58A 4LMNA 1HCKA 5CSXA 1DO0A 4YZNA 1REJA 2XYNA 3CLYA 3PUPA 4YURA 1V92A 1JR3E 2UZUE 3LZBA 4AE6A 5HNGA 4U3YA 2A4LA 3GU5A 4HPTE 4G3DA 4HVGA 3ZLYA 3AC2A 3HV6A 4QT1A 5DNRA 1Z5MA 3D9VA 2WQEA 3LPBA 3OWLA 3TZMA 2PWLA 4IDTA 2X8DA 3QHRA 5JT2A 1YWVA 4R71A 5ANEA 2Z7QA 3ZM9A 5DEWA 4KIOA 3DV3A 3FSFA 2QODA 1WHCA 4I4EA 3OC1A 2UW9A 3RAWA 4DCAA 4CT2A 4FL1A 4V05A 4JT3A 1VYWA 1UNGA 3FC2A 4FTNA 4IBMA 5KCVA 3EH9A 3KVXA 1AQ1A 2XK7A 5M51A 3QD0A 3UE4A 2QKWB 4BHZA 2OJGA 2ZYBA 1BL6A 3VUMA 3ZFXA 4B9DA 4QMQA 5A9UA 3EQCA 3TNHA 3DXQA 3E64A 3QQGA 3C9WA 2J5EA 3LW0A 4X2JA 1GIJA 4CTBA 1XJDA 5AA8A 4FX3A 4WNOA 4EZ3A 3N4VA 3AOXA 1DAWA 5CY3A 1WVXA 1B38A 2UZLA 3R9NA 4YJTA 2ZM3A 4BWPA 2VU3A 4FTIA 3GC9A 2ETKA 2WTVA 1OITA 4R3RA 2C6IA 3ORKA 3MH1A 3BGQA 2YM5A 2OF2A 3EKNA 3BEGA 3KXMA 2VO0A 1PXMA 5FP5A 4AZEA 4DH5A 1VEJA 4FKPA 5EM6A 4PNKA 3FMDA 3NNWA 4M97A 2EB3A 3LFFA 1ZOGA 3AGMA 4KSPA 1NVQA 4FKRA 2YWVA 1PKDA 3MVJA 4FTMA 2XJ2A 5GJGA 1UU8A 5HZNA 4N4SA 2H96A 2OZAB 4O0SA 5DA3A 1FMKA 3F88A 4HNFA 4RIWA 5HHWA 4YJVA 5IEYA 2VWYA 1DS5A 3TZ8A 2IWIA 4QPAA 1Q02A 3G9NA 4L3LA 4TXCA 1U59A 1IA8A 2KULA 3RALA 2WIHA 4WRSA 3IW4A 3UP7A 5DN3A 5JQ5A 1J1BA 4YNEA 3P1AA 2R3QA 3UC4A 4E5AX 2ZM1A 1Q61A 4R7IA 3LMHA 4F63A 4FIIA 4CFMA 4XG6A 4U42A 4CMOA 4PTEA 1APME 2C5YA 1KE5A
chains in the Genus database with same CATH superfamily
4OT6A 5HNBA 4GC9A 3PFYA 1HCLA 2ETMA 4B3RM 2BWBA 2MROB 4MX9A 5DEYA 2QU5A 3DAJA 4O96A 2X4FA 4R8QA 4PCZA 4M67A 3QL8A 1E1VA 4YTCA 5HGIA 3E92A 4IX6A 3I5NA 3PIZA 4MBJA 3C4EA 3EFWA 3R8LA 3LLTA 4IVBA 2VQEM 3C5IA 5CX9A 2J7OA 3NDMA 3AOEC 3ZFMA 2ZOQA 3ORPA 3BU6A 5F3WA 2EXMA 2JIUA 4F7JA 1XHBA 4UMUA 2QR8A 5EP1A 4WKQA 2HWPA 2QOQA 4FG8A 4TYJA 2RG5A 3J2PB 4X0MA 2JY6B 4HYSA 2DAKA 1URCA 3I0QA 2EJSA 4JOAA 2X2KA 3QX4A 4OTPA 2OPFA 4BYJA 1IN4A 2PHKA 3TTIA 4AOIA 5JGBA 4FK6A 2UUEA 4QQJA 3QTUA 3HKPA 3PVBA 2EKKA 3MJ5A 4AXCA 4FUYA 4QTCA 4CGYB 3AKJA 4MQ1A 3H30A 3UGCA 2JEDA 2PULA 4ACHA 3PG1A 1VEBA 2PVHA 3W0MA 5CT0A 3UPZA 2BIYA 4FEWA 5D11A 2F5SA 3FMNA 4QYGA 4R5YA 3IW6A 3TWKA 4UEUA 3BHYA 3E8CA 3F3UA 3QC9A 4O86A 1YKRA 4Q7JA 2CV1A 2APLA 3QRUA 3EYGA 4LOPA 5EYKA 4M9ZA 4DV6M 3IOPA 4LL5A 1HNXM 4YP8A 5L8LA 4H3PA 2AQXA 3TPZA 4RVKA 4LJ8A 1JR3D 4YZ9A 5EW3A 1M14A 5AV3A 1YDRE 3BBWA 4I6QA 4MWIA 4TWCA 3LCSA 5M56A 4EOSA 4XOZA 3LFDA 4DH1A 2ZB0A 3ZFYA 2C5RA 3ZO1A 2M5ZA 2YM4A 2Y4IB 3FLSA 3GLHE 3R8PA 4D5HA 3HRFA 3RCDA 4I1ZA 3I4VA 2LWXA 5K5NA 4BI0A 5JK3A 4BIBA 4FSQA 4O0YA 1QVRA 2JAMA 4ZTHA 2R9SA 4KIQA 3W68A 2WMBA 4BDIA 3DKGA 3QTQA 4Q2AA 3ZXTA 3MDYA 4FCTA 4XG3A 2R7IA 3SASA 1T43A 4FT5A 4FSZA 4A9TA 4FRFA 1PM5A 2V7OA 3KSXA 5AEPA 1UKHA 3MFUA 5ICPA 2CHGA 3F66A 5F9EA 4YJQA 3UO4A 5KNJA 2BKZA 2JFMA 3SHEA 4NXMM 3C0IA 2W5AA 3QTXA 5AR4A 3W2CA 4DV4M 4WG5A 3QKMA 3R7IA 2QPAA 5AIRA 3V5LA 4DTAA 4YSJA 4X2GA 4R1VA 4GIHA 2V5QA 5CASA 3HGKA 2W7XA 3SXRA 2PZPA 4FKSA 2F7EE 3ZBFA 5E6JA 4ZTSA 5AM7A 2W0JA 2XFTA 2PVRA 3DBDA 4S32A 2EUCA 2X9FA 1G8PA 3K1JA 2N35A 4C62A 2PVMA 2QO7A 4PDIA 1CMKE 3D7ZA 2Z02A 2F49A 4FTLA 3W55A 4FK3A 3VF9A 2P0CA 4WT6A 4LYNA 4MF0A 4QHTA 3DS6A 4ZY6A 5EDRA 3W0FA 3TWMA 2XJ0A 4USFA 3CSVA 3PA4A 4YLKA 2BROA 4JBVA 2LVAA 4ACCA 3O71A 2KEBA 1FGIA 3KB7A 2VTHA 3DLZA 4CYJA 3QQLA 4WNPA 3NUNA 2QI8A 1TGUA 3L9MA 4UMQA 4G6NA 4M3QA 2X9EA 4F4PA 5FLXS 4TYGA 3UQCA 4LRJA 4LV5A 1GABA 5HX8A 2UU9M 3Q9WA 3FPMA 3V51A 1OZ1A 5DE2A 1JKKA 1NY3A 2IF8A 5H9BA 1KOAA 2I40A 1ATPE 4DH8A 1JWHA 3ITZA 1ZYLA 1GNGA 4C61A 3ZUVA 2VWXA 2VAGA 2ZVAA 5AX3A 4JNWA 1NVRA 4IBCA 3M1SA 5CLPA 2WU7A 3PJ8A 5HLPA 3VKHA 2A1AB 4ZSEA 4BCPA 2WMTA 3KRXA 4FVMA 2C6EA 4IZAA 2VTAA 5BUIA 4OR5A 1PRBA 4RJ8A 1H27A 4LJAA 3BWJA 3SAWA 4ZSGA 5M07A 1I94M 1GL7A 3GRVA 5HTBA 4YBKA 1HQYE 5IEVA 1XKKA 3TIYA 4O7WA 3VBXA 4MK0A 3R04A 4BDFA 4L78A 4IXPA 3FPQA 4N0SA 4BLCA 2WOUA 2IW6A 3I04M 2H5XA 2AC3A 4QP7A 4CFVA 2W9FB 4O1PA 4NZWB 1R3CA 2VGOA 1PXPA 3KXNA 3U60B 1ZOHA 4C4JA 3ORMA 1OKVA 1HT1E 5DMZA 3TKHA 2JGZA 4G2FA 3U4WA 2DAGA 2UVYA 2DENA 2OF4A 3C50A 5E8XA 3O51A 4GJ2A 3IHPA 3PE2A 4YTFA 4EH8A 3G90X 5FP6A 1SXJD 1NXKA 2X2LA 3DKOA 1ORYB 1ZMVA 3WI6A 3DAKA 4JLCA 4MNEB 4L52A 1PMNA 2HW7A 4EK8A 4DBNA 4O81A 5DYJA 4RJ5A 5KHXA 2WOTA 4F64A 1QZMA 1QDTA 4FTRA 2Z7RA 3GT8A 5LVLA 3MS9A 2RSVA 2PL0A 1Q8WA 3TQSA 4EIWA 5EHYA 3UOJA 5C8NA 2F7ZE 4FKTA 4EH7A 5T3QA 2L4FA 2A98A 1W83A 3DQWA 2GDOA 3COIA 3S4QA 3UIMA 2EB2A 3GGFA 2J51A 2C1AA 2PK9A 4BDGA 1XBCA 1BMKA 3ZO3A 3TTJA 3TMOA 4DINA 2O65A 3ZS5A 1SZMA 4D1ZA 3BKBA 3DJ7A 3PE1A 4LUEA 3MVLA 4MGZE 4IMYA 4DH7A 4EK3A 5E4HA 4BKYA 1SXJC 4D4SA 2YFXA 2B9IA 5ANKA 3FZOA 4ZZNA 2R65A 4B3SM 1HNZM 5CF5A 2YERA 2BDFA 3ODYX 4OTRA 4B08A 1XO2B 3TKIA 4ONAA 2FH0A 4B7FA 5ANIA 4ALUA 1YE9A 4C37A 2LGCA 4PMPA 3KCFA 1NHGC 2OG8A 4O0WA 4NH1A 4UXLA 4RWKA 4AA0A 3LE6A 3IDCA 1R6BX 5IISA 1TVOA 4KLNA 1HOWA 5HBEA 4LJ5A 4S12A 1L1TA 1I4WA 2REIA 4AXEA 3V5TA 4P2KA 4IB5A 1ND4A 4IH8A 4B3MM 3VUTA 1G3IA 2E9VA 4CFFA 1A06A 4M69B 5J8IA 4QNRA 5HCXA 3U6EA 1CM8A 1P5EA 4J96A 2W96B 4PDSA 1GOLA 5HICA 5I9XA 5IQIA 3DFAA 5TT7A 4GS6A 3R00A 3RJCA 1Z5AA 1S9JA 4L42A 3PWDA 5BV3A 5A46A 5CVGA 4AFJA 4Z6YA 3PSCA 2X8AA 3ZXZA 4GT4A 4RIYB 3QTWA 5FEDA 3MN3A 4NJDA 3QC4A 3BX5A 1KSWA 4I0TA 4IBBA 3PIYA 4O2PA 1NSFA 3EQHA 3PJCA 3SATA 1M2RA 3FUTA 3F5GA 2K47A 3EN5A 3EL7A 3S95A 3PP1A 2C69A 4HVHA 3POOA 2R3OA 4MTAA 2JDRA 4OW8A 3DBEA 3KS4A 4A9SA 2GQFA 1QPCA 3BLRA 1OL1A 5CSWA 2CN8A 1YQJA 4IBFA 3MY1A 2Q2EB 1U5RA 4IJPA 1FBNA 3L27A 2WD1A 3PDTA 5EHLA 1KE9A 2LVNC 4LV7A 3AMYA 4JI2M 3HMMA 2ONLA 3HU1A 2CEAA 4D81A 5D7AA 3Q4TA 5M44A 3FZSA 1PJKA 3KSJA 5JGAA 3QAUA 2J5FA 4DFNA 3CD8A 3QYWA 4FEQA 3JXWA 5HU3A 2CSNA 3ETAA 5DOSA 3PPKA 1JOWB 3KU2A 4U41A 3QYBA 2GSFA 3G2FA 4C58A 2XM9A 3CF2A 3RWQA 4L68A 1OUYA 4P90A 3C13A 4QHSA 4LI5A 3L2AA 2YM8A 3A42A 3DFCB 2W05A 4BC6A 5EKOA 3E8DA 4BCNA 4DG0E 3TN8A 5AX9A 1H6UA 1UU9A 4HVSA 5LQFA 3AFHA 1YOJA 4XBRA 4IWQA 4C36A 2BRHA 1NV9A 4DITA 4USDA 2CFOA 4WSYA 5FTGA 2QCSA 3KXXA 2JKKA 3R7YA 2XA4A 3RM7A 2E9OA 3UZPA 2CHVA 2VTQA 3OWKA 4FVQA 5HU9A 4IDVA 4TKSA 1WR1B 3QALE 3QD4A 2ACXA 4XV3A 3FAAA 4Y46A 1IBKM 1N36M 3MI9A 4YJNA 4UY9A 3HEGA 5EXSA 4NRVA 3GI3A 1SVGA 5IDNA 3L29A 3BIZA 4G9CA 5BMMA 3PY0A 3MYGA 3GXLA 3OMVA 4MGYE 1ZQ9A 5E8ZA 2HZNA 4I4LA 3L28A 3DK3A 2VNYA 2VV9A 1J7LA 1U5QA 2DWNA 4FSYA 4JG7A 5BUEA 2XMYA 2GNOA 3PY1A 3SW4A 5IH4A 3R8MA 2IG7A 2BR1A 3LOKA 4PTCA 2FYSA 3HMPA 4HPUE 3EMGA 4I23A 4XG2A 3FUUA 4UZHA 3KQ7A 3A2CA 3Q04A 2NRYA 5CF6A 1P2AA 3ZLSA 3UDZA 3O8UA 3FMKA 3GCQA 2Y0QA 4F9CA 3PLSA 3LFQA 1YXXA 2YISA 1WFCA 3CIKA 3BQRA 3R1NA 4J8MA 2DVWB 2PTKA 2O8YA 4O38A 1UNHA 1ZYSA 2PUPA 5HX6A 3NPCA 4JG8A 4I5SA 3VLFB 2G1TA 4JVGA 3DTCA 3W0NA 3KEXA 4JI4M 4G5JA 2HENA 4DR3M 5DYGA 5DWRA 3OVVA 2BKKA 4JRVA 3GC8A 3FLYA 3WZDA 3KL8A 4HLQA 4YMJA 4BDAA 4DR7M 4PP9A 4DG3E 2A27A 3VN9A 3W0QA 3RI1A 5K0XA 4M0ZA 5AR8A 4ANBA 3O50A 2KA6B 3AMAA 3R8UA 1OL6A 4QNMA 1VDDA 3NWWA 3RWPA 5AV0A 4V04A 4KBCA 4AOJA 4I20A 3RHKA 3D5UA 2QOBA 3EZRA 3NUSA 3HMIA 2UW0A 3G0EA 3MY0A 4F7LA 4FCVA 5ITXE 4AW0A 4W5WA 5CEIA 1OKSA 5IQBA 5E8TA 5KMKA 2LVOC 1XH8A 4DEIA 5H37D 1Q99A 3EJ1A 1W5SA 4RZWA 5EXPA 4QTEA 3OTOM 5JH6A 2CKQA 1RJBA 2W17A 2WTWA 4S2ZA 4GHLA 3AC3A 4XOYA 2B3TA 5DT0A 2VF8A 2QBYB 3NYVA 3C4FA 4FEXA 5CF8A 2CP8A 3LQ3A 2UXCM 2WTDA 4FV4A 5JN2A 4QQ5A 3OUKA 4JJRA 4BFMA 2Y6OA 5IA0A 3WHLA 4DR1M 4NXNM 2BZHB 3DA6A 2WMWA 2XZSA 3DBFA 3LLAA 4E6CA 3BEAA 5C01A 4X3FB 3VS2A 5J9YA 4FTAA 2ITQA 4NUSA 1LEZA 4L43A 3EYHA 4DE4A 3W0OA 1W84A 3TL4X 4EK5A 4MXXA 2NQ8C 3ZO2A 4J7BA 3ZLWA 2B4SB 3M2WA 5J95A 4O4BB 2JY8A 4XG4A 3HMNA 3QZGA 2YWPA 5AUXA 5EM7A 3RK7A 5I3OA 3ORXA 2J0IA 2BMCA 3V6RA 3DK7A 1Z5BA 3NEWA 3R22A 4C4EA 1NVMA 3KRWA 3R1YA 3THGA 2YAKA 3CTWB 3DPKA 5AFVA 3PPJA 2XRWA 4BHNA 5B2MA 2UZDA 4WOVA 4WNMA 2DZLA 4NSTA 3VK7A 2VWVA 4Q9SA 4KUJA 3TNIA 4Y73A 2NNWB 4KIPA 4Y72A 4BCOA 1TQMA 4TRLA 4RSSA 2O01F 3KXEC 3U4UA 2W1FA 1URWA 5HIEA 1E1XA 1WJ7A 4DV3M 3AC1A 4XMOA 4YGAA 3PXFA 4AZVA 2LAVA 4BJJA 4I6BA 3PNVA 4UMTA 4PT5A 1QDRA 4IEBA 1OAIA 3ROYA 4FV1A 2XSZD 3H0ZA 3WILA 2HW6A 4RKUF 3SBJA 4DV5M 2JIVA 5LCKA 4NFMA 5I9UA 2YEXA 4DFXE 1M7NA 4YBJA 1KYIA 5HCYA 4C0TA 4MXCA 3DZOA 4KKHA 1ZRZA 2X39A 3NYNA 4X21A 4W4VA 4F7NA 2WGJA 1VYZA 1IBMM 3QQHA 2WXVA 2XCKA 4U43A 4QYFA 3K3IA 5L3AA 1Q8TA 4XLVA 2XUUA 3CKXA 2LH0A 4LDTA 4QQCA 2PE1A 2VD5A 3WIGA 5CSHA 1QYRA 3QYEA 5CSVA 3R8ZA 4QEBA 2ZV7A 3L8XA 5LMKC 3C4WA 1ZYJA 2M60A 4AAYA 3LQ5A 4HW7A 3ZRLA 4D80A 4NM5A 3IDBA 3M11A 1VZOA 1FNNA 4S30A 4KRCA 4NCTA 4GKHA 3OXTA 1Q3WA 1WVYA 3TT0A 2C6TA 4D1SA 4O83A 5C27A 3KXZA 2R62A 3NLBA 4ITIA 2HOGA 4GK4A 5I4NA 1H25A 3C0GA 4E5BA 1YDTE 2C6MA 4F1IA 5HNIX 3PXYA 1CDKA 3QKKA 4O0XA 3BLHA 4D82A 4J8NA 4GT3A 1STCE 5JQ8A 3UJGA 2IVVA 4FMQA 4OTDA 3U5ZA 2RG6A 4RJ3A 4B3TM 3A62A 5DGZA 4N6ZA 4LY6A 2W1HA 4GHAA 5ITAA 2V1UA 4CRLA 3MW1A 3LFEA 2CKPA 3P7AA 4G3OA 5KMMA 5IF1A 4E1ZA 4DEGA 1MUOA 5KHWA 5HD7A 4DV7M 2ZDUA 5J9ZA 4E73A 1R7RA 3PVWA 5IT9S 1KWPA 1G5SA 2B9HA 4BDDA 4EHVA 5IPJA 1H24A 3H0YA 1NT2A 5IQGA 2A2AA 2ITPA 4QYEA 2QO9A 3SFZA 4Y8DA 5CEQA 4KIKA 3C58A 3BYOA 3VUHA 2C9OA 4YJUA 2RFSA 4CKIA 4FGRA 3QUPA 4IM0A 4YO4A 3PYYA 5HI2A 3REPA 2HZ0A 3Q8GA 3PXZA 5JRSA 3GQ3A 1BKXA 5FXRA 4FR4A 4UYNA 2HZ4A 1NNUC 4MYGA 3GRRA 4ERWA 1WBNA 5HIBA 4D58A 3ERKA 1HCKA 5CSXA 3CLYA 1GLNA 3PUPA 1JR3E 2UZUE 4AE6A 4U3YA 4G3DA 3HHYA 3ZLYA 4QT1A 3OWLA 3ZM9A 1QUTA 3DV3A 3FSFA 1DGBA 5M51A 2XK7A 4DHJA 1BL6A 4IBEA 3EQCA 3TNHA 3E64A 2XH9A 3QQGA 3LW0A 1GIJA 1XJDA 4XGIA 2UZLA 4MGIE 4YJTA 2ETKA 2C6IA 3ORKA 3BGQA 3BEGA 2VO0A 1PXMA 4AZEA 4DH5A 2EB3A 4KSPA 4FKRA 4N4SA 4O0SA 1FMKA 4RIWA 3E9SA 3TZ8A 4QPAA 3G9NA 2KULA 3RALA 2WIHA 5DN3A 3P1AA 4XG6A 4U42A 4PTEA 3UJNA 2CGVA 4EQMA 2YFQA 3AMBA 3HA8A 1TDZA 3OW3A 4LJ4A 4YZBA 4GSBA 2W1EA 1OPJA 3FXZA 3AJIB 3SXSA 4GG7A 1CSNA 3TJDA 5BMSA 5AWMA 1ERKA 1XNRM 3O17A 3SDJA 4YU2A 4I8OA 1UVRA 3FMEA 5CSPA 4KAOA 4AWIA 3CF6E 3MIAA 4U40A 5F94A 2GS2A 3FRHA 1HQCA 3C0HA 4GT5A 4GUEA 3GQ5A 2F5OA 2RIOA 2W4KA 4BICA 3GLFE 2J4ZA 4W9WA 3A61A 4RZVA 3GQIA 3ZC7B 3QZFA 5JFSA 5KO3A 2VWUA 3W2OA 2BJVA 3E93A 4MEDA 3OY3A 3ZH9B 4E4LA 2OJFE 4C38A 3C3DA 2VGPA 3BGPA 4ZOGA 1U4DA 4O0UA 3KS8A 1DGHA 2JZ0A 2X81A 3SG9A 4K11A 2QC6A 3LVPA 3B8RA 4DN5A 3U6IA 5EI6A 2YDIA 3KOYE 4E7WA 2ZMCA 3BHHA 4QNAA 4GKJM 3QLGA 3E46A 3NZ0A 4V0GA 4HYIA 1UWHA 2G2IA 4IX5A 1IN6A 1FVVA 1MQ4A 5C8MA 3KA0A 2JD5A 3E3BX 4BB4A 5HKMA 4C3FA 3LM0A 2X4AA 4EOIA 3L26A 4ZZOA 4C7TA 2MH8A 4JI9A 3TACA 3BI6A 3UYTA 4L46A 2JC6A 4D2SA 4GK3A 1OGUA 3O7LD 3QRTA 4XG7A 3F2NA 4MNFA 2YA9A 1F3MC 1V0OA 3BLQA 2ZTCA 5EKNA 2XZUA 3Q4UA 4S31A 4FNYA 3RAKA 3TXOA 2GQGA 2VX1A 1NW1A 4KKEA 5IUHA 4IAKA 4CMUA 3V6SA 2FA2A 4M9XA 2R3LA 4ZSJA 4ZAUA 3EQFA 3V5WA 2O5RA 3UMMA 1AIPC 2R18A 5HORA 4AF3A 2R3MA 4MXZA 3U6SA 2QU6A 4R7GA 3OBGA 3GU4A 2HKJA 3U61A 4AGWA 2IVUA 3W2PA 2RFNA 5GJDA 1KE7A 1IY0A 4LF8M 3R9OA 1NHWC 5A4LA 4X2NA 4DA5A 3VC4A 3NGAA 1BL7A 5BVNA 3MSSA 2EUFB 2EVAA 2RRUA 3UO5A 1NY6A 3GRYA 3SVVA 4BTFA 4G3CA 4TW9A 3DA1A 3CPBA 1SXJE 2CCIA 1OAOC 3K5UA 4I3ZA 4G34A 3B7QA 2YN8A 2PE2A 3EIEA 3OG7A 1F4IA 4TY1A 4HEOA 4G16A 4GRBA 2PVFA 3NVKI 5ACKA 3WF9A 3RKBA 2OOBA 3FLQA 4FNWA 3DAEA 5FRIA 3HRCA 4DDIA 1XNQM 4R3DA 4NRWA 3LXLA 2XNNA 1SNUA 5CEMA 4FD2A 3COHA 4ANQA 3ZEPA 3PRIA 4GIPA 4BDEA 5CEPA 4CGAA 2QZ4A 2JFLA 4MXOA 2KW0A 2BRNA 3F3TA 5DFPA 4IIWA 4GIIA 3QQFA 2B54A 4DGGA 3LQ8A 4PMSA 3B9PA 3GPPA 2GHLA 4WHZA 4LOOA 3UVRA 3VBWA 2QOOA 5CU6A 2OO9A 5C26A 2NPQA 4BDKA 3PFIA 3A98B 4IC8A 2QLUA 4AZSA 5J5SA 3KMMA 4G6OA 3EZVA 5HOAA 4JR7A 2DUVA 2AHMA 1YHVA 1TF0B 3BYUA 1OTRA 3QCXA 4RFMA 5IQFA 3J7AS 3R71A 4YJPA 1XWSA 2OIQA 2Q83A 2R3KA 3VQUA 4W8DA 3JY0A 2L6OA 4FV2A 3EN6A 3F5PA 3HLLA 4PMTA 4AACA 4O7VA 4UXQA 3R30A 3G5DA 1T3TA 3EQPA 3NBIA 4NOOB 3FI2A 4YZMA 3POZA 4LOQA 2WPAA 4AKHA 2WAJA 3R6XA 1UU7A 3II5A 4L53A 4FF8A 1TQPA 2Z2WA 3GRUA 2JUJA 5LMNM 3T15A 2ZV2A 4QQTA 2OKRA 3AT2A 4PWNA 2XS0A 3UNJA 5EW8A 4EC8A 4C2VA 2UW8A 4AQYM 2G2HA 3RP9A 2UW5A 2DHYA 4YLLA 4E4MA 3FYJX 4BKJA 3BELA 4RC3A 2W1GA 3U6LA 4D4YA 1PYEA 1FQ1B 3IK3A 4XYFA 3G0FA 4HL4A 5LMUM 4JI8M 2CGXA 3OZ6A 4OX9M 2VWBA 4NSRA 4QTAA 4M15A 1EFUB 3U9NA 4TYHA 1OL2A 2Y0TA 5AR7A 2E9NA 3FBVA 3RPOA 2J90A 1IBLM 2QSFX 5ETFA 2OGVA 1MN3A 3PXKA 4P17A 5CYIA 2JNHA 3U9CA 3JY9A 3RK5A 4ASEA 4E93A 1Q41A 3RPSA 3ACJA 3QTRA 5FBNC 3Q4CA 1H8FA 3GBZA 1OUKA 1JSVA 3P0MA 2WTKB 1GVNA 3NWLA 5EDPA 3FD9A 4X7QA 3DU8A 2RL5A 4KNBA 4QMUA 4YHHM 3VWAA 3ULIA 3PRFA 4M7IA 3CP9A 4AQKA 2NRUA 2VWIA 4IM3A 1IA9A 4WSQA 3CY3A 2Z4RA 1H1PA 3PNYA 3T3VA 1KSFX 1TDHA 2DI0A 4BBAA 4CNHA 2G01A 3P7CA 2CE7A 1TFFA 4LV8A 5IA2A 4U45A 2H34A 3I5ZA 3KRRA 1LV7A 4G4OA 2W5BA 3ZZEA 4JRNA 4AN2A 5M06A 4CD0A 1K3AA 4I6FA 4AGDA 4Z55A 3QD3A 4A7CA 4JXJA 4FZFB 4FTKA 5LJJA 2QQ7A 4F08A 3FTCA 4BF2A 3FI8A 4IAFA 4X2FA 2ZV9A 1QPJA 4IC7A 3ZCBB 4KHPM 4ACDA 2Q0NA 5AJQA 4DT9A 3LHJA 2OXDA 3LCOA 1A9UA 3EIDA 2XM8A 3PJ2A 1XMOM 1UM8A 1XXHA 5E26A 4UX9A 3LFAA 4L3JA 4U44A 4HYHA 2W1DA 2LVQD 1ZYDA 2B52A 4A9YA 5CWZA 3IG7A 2FS1A 4BI1A 2OJJA 3RZFA 2UVZA 1TH2A 4Y5QA 2L4EA 2F5NA 3UP2A 5DT4A 5EXTA 5HIDA 2F4JA 5E92A 2R3NA 3DT1A 4TZRA 2ZV8A 2F57A 4DFUA 4B7GA 1OB3A 4AA4A 4XV1A 4JIKA 2XNPA 5FDPA 4FZAB 2WMRA 1L2CA 5KE0A 5HG9A 4AX8A 4UWBA 3W0PA 2CWBA 4BR3A 2YM7A 1X37A 2WSFF 2BTSA 5ACBC 5KMNA 2P4IA 1H00A 5GIOE 3WZJA 1OPKA 1Y57A 4FE2A 1F0QA 4GFMA 4AT5A 4ZY4A 5H8GA 3T38A 1YW2A 3PXGA 4WIHA 4AT3A 3PZEA 2R3JA 4BZDA 4FGBA 4PNIA 1OL7A 4RX7A 4C02A 4O91A 2BAJA 5BYYA 1L8QA 5GJFA 4C3PA 3L9LA 3SG8A 5D9HA 4ARKA 4LG2A 2YLFA 2C30A 3OTUA 4X3FC 2QG5A 4ZTQA 1XB2B 1GL6A 4AFEA 2C6OA 4EUUA 3M42A 4IANA 5I5ZA 3VUGA 1OVEA 2BTRA 1XBAA 4G3GA 3SGCA 2XB7A 1SVEA 3HVCA 4EOQA 1GO5A 1R0EA 4FIJA 3QHWA 4F6UA 3MB7A 2X4ZA 4E6QA 1WMKA 1R0PA 5JKGA 2O3PA 3VF8A 4WBBB 2X1NA 4ZZMA 3B7ZA 2G9XA 3IOKA 4JYAM 4CKJA 3KULA 1OBDA 2VN9A 4EJ7A 4UYAA 2SRCA 4DUZM 4RPVA 2QHNA 5K0KA 2R4JA 4PY1A 4QMSA 5AR5A 4L8RC 4K0YA 3NSZA 1WBOA 2GQRA 4FWGA 4FODA 2JKQA 5DLSA 3FHRA 2YM3A 1FJGM 2YABA 4FV3A 3W67A 2GMXA 4RFYA 4GVJA 2QOFA 4OBOA 5AP1A 3COMA 1SM2A 3WHKA 4V01A 1MRVA 2VF7A 4I5CA 3PJ3A 3FY0A 3TE6A 2HYYA 4Y85A 3EN7A 3TUDA 2BWEA 4BCMA 3BHTA 2RFEA 2R7BA 2CV2A 2JP7A 1PRYA 3UDSA 2C6DA 4FV6A 3GCUA 1VEKA 5E9EA 3CKWA 1GAGA 1EH4A 3R2BA 3WF5A 4PL4A 2PUUA 2W5HA 5KZIA 3ENHA 4IFGA 4IJ9A 2B9JA 3L9NA 4UALA 1PXIA 3T1HM 1IR3A 5L6O