4W5WA

Rubisco activase from arabidopsis thaliana
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
269
Chain Sequence
b'NLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMAKMGINPIMMSAGPAKLIRQRYREAADLIKKGKMCCLFINDLTTQYTVNNQMVNATLMNIADNKEENARVPIICTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase, chloro
publication title Structure of Arabidopsis thaliana Rubisco activase
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 81
structure length 269
sequence length 298
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4w5wA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w5wA01
4XD7A 1ZU4A 1OKKD 4UNRA 1BOFA 2YWHA 3W3AA 4Q4JA 1P60A 1ZUHA 4I99A 1DAHA 2J0SA 5L3SB 4XH9B 5FOVA 1QHNA 1R0XA 2JJ2D 4AKGA 5J4HA 2BDTA 2WPDA 3OIVA 4G3XA 1DO0A 1OYWA 1ZVQA 3AVVA 2VHUA 1DAKA 1YR7A 5C4MA 1EFUA 4IVPA 1KNXA 4O2LA 3IQWA 5H1YA 4GSYA 3H1TA 2J41A 1JJVA 4Q03A 1AGPA 2YHSA 3ZIAD 5BN5A 2Z0MA 1GKIA 2J7KA 2IXEA 3AV0B 3QG5A 4JS0A 1ZNXA 2VYFA 3FMIA 2ORIA 2QBYB 4DDUA 4PR0A 3D7MA 5JECA 1FPMA 1RRFA 1XTRA 1Z0JA 2ZRIA 1Q1QA 4WW0A 4YC7A 3TK1A 2DFTA 1XMJA 1VECA 1ONBA 5JEEA 3TKLA 3D8BA 2N42A 4W5HA 5EE3A 3NVAA 3K0CA 4IDQA 3LV8A 2PMKA 3LWNA 3FMPB 1TF2A 5FBLB 5TARA 2V7QD 2AFHE 2OBLA 1COWD 4LX0A 5IT5A 3IEVA 3V4RA 1VCOA 3U3KA 4A8JA 2BOVA 4JYCA 1FQJA 4MRVA 3U44A 5F3WB 1KY2A 3ONWA 2EU8A 3LVQE 3VR4A 4RCYA 2HLDD 1G20E 4DEYA 5GVRA 4QNRA 4RZUA 2FFQA 3BRWD 2H5EA 2ZJAA 4LJAA 3P26A 2F9MA 5FOTA 3X1XA 3U4QA 4PQFA 3ADDA 4GMDA 3KTAB 2DR3A 3X1YA 3WRYC 1AZSC 4AG5A 1U98A 4ILEA 4XIGS 5LDDC 4Q66C 4A9AA 1J7KA 2IW3A 3ETLA 5JJLA 1QHHB 2JLQA 1YZQA 2X2EA 4NONA 3UMFA 2XGJA 3SU8A 1ZMXA 3AP1A 2WWYA 1G7RA 3UANA 2Z5FA 3PR1A 3U3RA 2QP3A 4KFSA 1Z3IX 2JASA 1CLUA 4RFSB 5H8WA 1XTIA 3LXXA 2BMFA 1E79D 1KHTA 1W4AA 3KQNA 2XNDA 3LO5A 4PQYA 2O8EB 2GRJA 3C15C 3SYNA 4D4MA 1E99A 3B7GA 4B3FX 1UKYA 1JQJC 1JR3A 4HAUA 5GADl 4A0FA 2GETA 4LCBA 3SR0A 1NBMA 2IYSA 3WBJA 3H84A 4M9ZA 4NBSA 2FOLA 5FFMA 4JLBA 4R2HA 2O52A 4D26A 4BLOA 4BWYA 1E2NA 1CKEA 3C16C 5HCNA 1YQTA 3QPWA 2WKRA 2RGBA 2FU5C 2GA8A 3BH0A 5DI3A 4DRZA 2P6RA 4QHTA 3REGA 4ZDIA 2AFIE 3RSLA 4BFUA 1ZRHA 2CK3A 1MABA 4P4TA 2WWHA 2J0UB 4CEIB 4NCJA 4I1OA 2VHQA 4RZ3A 3PUZA 2ZS8A 3T35A 5FUYA 2BMDA 3GJ6A 3KKMA 4CVNA 1K8RA 4PHGA 1NIJA 4OKSA 1E9AA 1JQLB 1N0WA 5EXTA 2NZJA 1JALA 4JLKA 2GZHA 4C4PA 3THGA 3BB4A 3E70C 3RC8A 4HUTA 1C1YA 3DMDA 4PAQA 4EQ6A 2J0QA 4HB0A 4GBMA 3IHLA 4DUGA 3SHFA 1ZCAA 3CX6A 3Q8XB 2DFNA 4NP6A 1UKVY 1EG7A 1X8LA 3QI2A 5EP4A 4B71A 3GFTA 3GLHE 4PPNA 4Q1AA 2IYZA 3CR8A 2QG6A 1ZM2A 3A4LA 4FCWA 4KFUA 4LJ4A 3T1OA 1GL9B 3CF6R 2FSGA 4ZDWA 1IBRA 3T1VA 1XXHE 4UNQA 3TRFA 2OCYC 2J7PD 1NY5A 5CIQA 3T1QA 3KDSE 2EFDB 3BK7A 3QIAA 1TEVA 2OEPA 4C2UA 5FOUA 3ZZTA 1FNMA 2UKDA 4ZCIA 1SXJD 2RKOA 2IBMA 4MKHA 4ASUD 2J59A 5AUQA 5FH9A 4MKFA 5B64A 1AS0A 5EUMA 1H8ED 1HV8A 4LPKA 4CW7A 3PXGA 3CF0A 1KDPA 4PC2A 1Z83A 5AJWA 3OZXA 1R5OA 1Z6TA 2QTHA 5L3QB 3NWJA 4LHVA 2EW1A 3X2SA 3OAAD 3BE4A 2VTKA 2O5VA 1KO8A 4TYWA 4QXAA 1F2UA 1BKDR 1NSFA 1Q3TA 2DFKB 2ODWA 2YWGA 4MKGA 5IK2A 2ZU0C 4Z8XA 4EFMA 2WHXA 4GOKA 1UPTA 4LGMA 3KXKA 5HKKA 1ZC4A 3VU9B 4DCTA 3KKQA 3HDTA 5KUTA 1II8A 3MWYW 2X2FA 4N0EA 1IXRC 1EX7A 1OXVA 1SVSA 1VKJA 3X1WA 1DBSA 3B8HA 2GCOB 1JBKA 2HXYA 3N2EA 4KLZA 4MRNA 4DC9A 3ZS9A 3L0OA 3RVBA 5CJPA 3GFPA 3THOA 3QPUA 5TMPA 2GNOA 2VSOA 5CM8B 3JZAA 1KAGA 2D2EA 3IEUA 3O47A 4JSYA 4Q1EA 2C98A 2W00A 5HR5A 3C5HA 3QNUA 3Q9LA 5JHHB 2IEYA 1T3SA 4WBSA 4CEHB 4FCVA 5M04A 3KKPA 5J40A 1KI9A 3GD7A 1EESA 3P4YA 2OT3B 2QMOA 4BQSA 1SXJE 1SVKA 1ZU5A 4KVGA 5K8UA 4MRPA 4TMKA 2GEUA 4Q9JA 1HUQA 1NI3A 3OEHA 3AKEA 3LW7A 1FMJA 3K09C 4JL6A 5HE9A 5BQ5A 4HATA 4BGDA 5JCZA 3GMTA 2KWIA 1NG9A 4O25A 2NMVA 4TQ9A 4I1VA 3B85A 4POAA 5EP2A 3CIOA 3DM5A 5E7MA 4DLZA 5KHOC 4UXJA 5F98A 3EIEA 2AX4A 1HTWA 1TQ2A 4P33A 3SJAA 4D0GA 3WP1B 3THYA 2CNWA 2ZSEA 2ZIAA 3GEIA 3K9GA 4ESVA 4OI0A 2FEMA 1NLYA 2DBYA 3CRW1 2PH1A 3KKNA 5TB5A 3KJGA 1W0JA 1E96A 4UJ5A 2CJWA 4B73A 4RKFA 5BYKA 2IXGA 2GXQA 1DAIA 3EX7C 1KOFA 4BZXA 1UEJA 1OE0A 4MYUA 2IL1A 1RW4A 2GXUA 1WE2A 1TL7C 4Q47A 2D62A 4U02A 4C7OB 2VP5A 3OFND 3W34A 1G4UR 2A5FA 2ZYVX 1ZM9A 2X8AA 2ZJBA 4CEJA 4C3ZA 3W5IA 3UG6A 4AURA 4KJZA 2O8FB 1W0KD 2XTMA 3FFBA 4RD3A 4US1R 1CR1A 3TUZC 3OESA 1A1VA 3THWA 3W3ZB 1D2EA 3GLHB 3I3SR 2QU8A 3HYTA 4ARZB 1YR6A 2OXRA 1M74A 2HCJB 3IBYA 4RD4A 3K8YA 1O87A 1E69A 4BE7B 3FMFA 2OLJA 121PA 2ONKA 1L8QA 3CW2A 5JJKA 1T8UA 4OQFA 4XWAA 1M1YE 2NOAA 4UQOA 1S3GA 1XXHB 2CCKA 2QI9C 3C5CA 1KI8A 3CWQA 1OHHA 1KY3A 3CNOA 2OXCA 4N1AA 2A5JA 4AYTA 1XCPA 1CJMA 2ZRDA 3M0EA 4Q9HA 1U8AA 3RWMB 4DLTA 5GJVC 2ODNA 4DT1B 1G8GA 4TLBA 4Q5IA 2WTUA 2VHCA 4QKQA 1KNQA 721PA 3MWKA 3NDPA 4LBVA 4NTZA 1R8QA 1B23P 2WJGA 4UKDA 4LUCA 1E6CA 1U9IA 4G01B 1US8A 2F1JA 1IN6A 3EASA 2A78A 4IHQA 2ZUBA 4UXHA 5EZ6B 1KSGA 3S1AB 4ZV4A 1AZTA 3MWJA 1UFQA 1VG0B 3CPJB 3B9PA 2JDID 2O8BA 4F4JA 1SVLA 1PZNA 1YZTA 5CYPA 2I1QA 1G7CA 3B1VA 3BS4A 4TMVA 5JZVA 3TH5A 2PX3A 4PPQA 1NVXQ 2A5GA 4B74A 1OF1A 2Q21A 4MKIA 2R6AA 3LDAA 2JLWA 2WIBA 4GP6A 1LW7A 2CVHA 3Q5EA 2B92A 3CR7A 2W6IA 2JJ1D 2ERXA 5DO9A 2O0KA 3CNNA 2ZVPX 2JLRA 1G5PA 4ZCLA 1XPUA 2ZETA 3ASYA 4V0OA 3AF1A 2GILA 3GLGA 2R9VA 1IOZA 1VCMA 1ZJ6A 1TUIA 2H17A 5EE1A 4GZLA 2RH5A 2QTFA 1SQ5A 3RSOA 4KHZA 4M22A 4BFWA 1E2MA 3IUYA 2IHYA 4A2WA 3KQLA 5TVKA 8OHMA 1T0JB 1KGDA 1LB1B 2Z4SA 4B75A 2Z4RA 1SXJB 4QJ5A 1AS3A 1XEWY 2XSZA 2D2FA 3D31A 3SDZA 4MQBA 4B3DA 1E32A 3TE6A 3E5HA 5BN3A 5KNDA 2PEYA 2WAXA 3THXA 1EFCA 5L3VA 4M21A 2K5UA 3SBDA 3FHOA 2ZI9A 2PZEA 1XB2A 1OXXK 3VHXA 3NHAA 2PT5A 3O8RA 1OT3A 3QKRB 4E5UA 1N5IA 2FV8A 1DG1G 4LBYA 3UATA 2CVFA 4TLCA 3L43A 4D4LA 2GJSA 1XTSA 2QSYA 4WA7A 2YV5A 1PLKA 4KYIB 1D2NA 1PUJA 2F1HA 1ZINA 1ZD1A 2XEXA 1E2HA 2FNAA 3M1IA 4O2RA 1QVAA 3I61A 4HB3A 2ZREA 1XD9A 1H8HA 1DTSA 3GLIE 3JVVA 2TMKA 2H8KA 1U94A 2ASEA 4URUR 3TVTA 4WAUA 4F92B 4TYNA 2ZM5A 1OFUX 4DKXA 1I2MA 4JBYA 4GRAA 4BECA 3AVPA 3B2EA 1W1WA 4D25A 4I81A 2WOJA 1XPOA 4R71A 3AF3A 1L4UA 1E9RA 5SZJA 5H68A 3HU3A 4QGFA 1GFIA 4LHXA 1VG1A 1E1QD 1CIPA 2F43A 4PO8A 4QGAA 4M8NE 1Z5ZA 1P6XA 3BFKA 3K0CC 3RHFA 4EDHA 5JSZB 2N1BA 2AXPA 1P5ZB 2F9LA 2W2VA 3QKSA 2JIZD 1IY2A 1TX4B 1MT0A 3EZ6A 4DCSA 4XD7D 1S2MA 2WWGA 4ZI3A 2GTPA 2J87A 221PA 2QAGB 2OM2A 2PEZA 1XJCA 4UNPA 1Z0IA 1W4BA 4Q21A 4Z1MD 3FVQA 3LY5A 3PUWA 4CF7A 4NKRA 3ZJYA 3LNCA 4ZI2A 5FR1A 1ZNWA 4QJ3A 3EA0A 2WPDD 1CULC 1RIFA 3RS3A 4GDFA 1LS1A 2RGAA 3ZZ0A 4MYTA 1R0WA 5JRZA 3GJ4A 1HEIA 4TSFA 2YC2C 2QQEA 3CZQA 1YU9A 4A92A 3OE7A 1XEXB 4XVUA 1NJGA 4JLOA 4KV9A 4KSCA 4FXPA 4YDSA 3SBEA 4HUQA 3R8FA 1QZXA 1BMFA 3ND8A 1N6NA 3M6AA 3QBVA 4NCNA 3QXXA 3UWOA 4JVLA 1BYIA 2AWOA 2ZRGA 3KFVA 3QOFA 1OFHA 3B1XA 3AGQA 1RJ9A 1SKQA 1N0VC 3LBIA 2IF2A 2W83A 4LZZA 4V0ME 4TL8A 3SQWA 2ZU6A 3W9YA 1Z0FA 4MGKR 3EPJA 1OYYA 4Z51A 2GK7A 3WYAA 1GP2A 1UAAA 2G1JA 2HYDA 1A5TA 1FOEB 2IUSA 2O0HA 3VR1A 1JEEA 4KVAA 2REXB 5FUWA 2ERYA 3VX4A 1XX6A 5FOSA 2EVWX 4B3CA 2A5DA 1OH7A 2ZEJA 4YXWD 1KI6A 4K81B 3LA6A 4JBXA 5BN4A 2WWIA 1T5IA 4TLDA 2WJVA 1RZ3A 1N6RA 4PZZA 3TAHA 2XZLA 4PX9A 3CH5A 4V0LA 5K8TA 2AXNA 3RDPA 4KODA 2LWIA 1Q22A 1RKBA 3VMFA 3NH6A 4TL7A 4CZ2A 2BM1A 1M8PA 2BC9A 5EE9A 5FUVA 3F5FA 3R7WB 2G0NA 2YVUA 1E2DA 3CRQA 2IS4A 4IJMA 2BEJA 2ZR0A 5KSYA 1DELA 4N0DA 4G5GA 2ZRFA 4M1YA 3QXCA 1XD8A 1W46A 3C14C 1QVRA 4B43A 1RYHA 2XNDD 1FZQA 5AJZA 2HT1A 3RC3A 3T15A 4DSUA 1UBFA 1A7JA 2W2TA 3PEVA 3QEOA 1JR3D 1F6BA 1XZQA 2W0MA 4B32A 1T8TA 4WZAE 1GDDA 3U7GA 1I4DD 5C4GB 4AKEA 1F2TA 5C46F 2H16A 1NLFA 2GJ9A 2AR7A 1ZCBA 1NVUQ 3GJ0A 1GSIA 2VF8A 2CE7A 4TT3A 2QBYA 3BB1A 4MRSA 2WJHA 4QC2A 4EFLA 5TDHA 5E7IA 1Y63A 1NL3A 2CL0X 4NPHA 4F4IA 3C7KA 2UZIR 3NBFA 2ZI5A 4LHZA 3D6TB 3DZ8A 3VKGA 4Q18A 1VIAA 1VYUA 2R6GA 2D74A 3FTQA 4RVCA 2QT0A 2YOGA 2CK3D 4GPTA 4P4SB 1VYVA 2GBLA 1G291 4PSVA 1E2JA 3GLIB 1KKLA 1FL9A 2HV8A 3M4YA 4IOLA 2IUUA 4OHYA 4HLCA 5JI2E 4TMWA 1K5DA 5KDLA 2ZXUA 4MYHA 4EKDA 1YJ5A 4PZLA 2GJ8A 4X8LA 2WMOB 5GJWC 5D3QA 4DUGD 2R6DA 1GG2A 2F3TA 6Q21A 3AVTA 3QUSA 5AJXA 2G83A 4N3NA 4PXAA 4FWTA 2O8CB 4EPWA 3FFAA 2FN4A 2QROA 4DDVA 2CE2X 4IXNA 4OK5A 4TQAA 1J8MF 4URYR 4Z1MA 1EFTA 1JR3E 1QG4A 1VTKA 2NQ2C 4QNMA 4S2EA 1QHHA 4A15A 2GDJA 5DISB 2GZDA 2ZPTX 2GKSA 5KSPA 2NPIA 5A0FA 2XXAA 3CLVA 1MH1A 3W6OA 2EWWA 4LYJA 4G5QA 4OL0A 1FTNA 4EJSC 1OSNA 2A5YB 2ZJ8A 2GXAA 2A30A 1GOTA 2O8EA 1W7AA 3QPVA 4I4LA 1KI7A 4NMMA 3B5JA 3RS7A 3QG1A 3NC1C 2IA5A 1NN1A 1QDEA 4M9SA 1ZD8A 4Q1DA 3Q7PA 4KO8A 1KI3A 4MGYR 4BUJA 1N6LA 1HE8B 5FTLA 1SVWA 3MCAA 3QF4A 4CYMA 3VNVA 3B6EA 1RPZA 4GT1A 1ZIOA 4D80A 1TEXA 3P20A 4FN5A 2F3RA 2YWFA 4QOSA 2RGNA 1P4SA 1AQYA 1NKSA 1Q21A 2XOKD 1E3MA 2EWVA 4TMZA 5HKKD 1DAMA 1OFIA 5ANRB 1OLOA 4KFRA 4DLWA 4YMWA 1QHSA 1YVDA 1G3QA 4A36A 2ZTSA 2WSSA 2D7DA 3VR5A 5K8IA 2VP4A 1VMAA 3IBGA 4URWR 3DZDA 2QP9X 2QTVB 4A1FA 1WF3A 3Q3JB 4OI2A 1TAGA 3QXHA 2C8VA 2IYLD 2C9OA 1W2GA 3RWOA 1T0HB 1X86B 1AK2A 2FGKA 1O3YA 2J9RA 4Q4JB 4U00A 4XTRA 1TADA 1ZIPA 3A1VA 3FKSD 4KYUA 4R7ZA 4EPVA 1CR2A 4IKEA 3U6KA 1R0ZA 2FDCA 4RZ2A 1CRPA 3LFUA 4RY2A 1KI1A 3TGPA 1LV7A 1E94E 2PJRA 2E1RA 2IF0A 1G3IA 2QP4A 4Y0AA 1WP9A 3HPQA 5FL7A 5FPKA 5KTYA 4KI0A 1OH5A 2RGGA 2P2LA 3KQUA 2OESA 4LV8B 2D7CA 4JT4A 3ECCA 1M6NA 3B82A 3CRVA 3OEHD 4K46A 2FWRA 2RHDA 1D8TA 4F7WA 3T5DA 1ETUA 2CHGA 1P7CA 4HAXA 4HLUA 4LOAA 1X3SA 5KDOA 2H57A 3EC1A 2NZ8A 3SI7A 4F4CA 3A1WA 1Z6GA 5DN6A 5GVSA 3BJIC 1GNPA 2PMDA 4LJ6A 1GWNA 2FSHA 1AGRA 3OIUA 4AK9A 1CP2A 2ZSAA 1KIMA 2PCJA 1JNYA 4Q00A 3ZLJA 1Z07A 5B2ZA 1A82A 3AF0A 4DJTA 2CNWD 1D9ZA 5HCIA 1EFRA 5J4KA 4M1KA 4M1MA 1SXJC 4H1VA 1Z47A 3K0AA 1FP6A 3GLFA 2RGEA 4JLAA 2D4HA 4A8JB 3KUDA 1CXZA 1Q57A 1W0JD 2NTYC 2GXSA 4FMCF 4JVSB 3O8DA 3U44B 1CRQA 1GTVA 4D0LB 3CX7A 1OFTA 4A0GA 4TWZA 4DDWA 1NN0A 2Q9AA 2XX3A 1YE8A 5G53C 4TMXA 3SN6A 5LPNA 5IRCD 3MJRA 3SC3A 2CBZA 3RRNA 3SJCA 3U4QB 1MRNA 4HSEA 4BFZA 4TYYA 2QENA 4JIMA 1K6MA 2G0TA 3LLUA 2J45A 1QF9A 2BBSA 3KFXA 4JLJA 2FG5A 3FOZA 2FEOA 5D3MA 3MUFA 2ECKA 3F0TA 3KL4A 5DHAA 2P5TB 1YZNA 4MA4A 1R5BA 5DGXA 2W58A 1XMIA 5FTMA 3PIRA 4LHYA 2XZOA 1GNQA 2B8TA 4IVRA 4BFXA 4D6PA 3KQKA 1N3BA 3B60A 3AQ4A 2C99A 5CB6A 4UNNA 1BO6A 2IXFA 2DWQA 2Q9CA 1LS6A 3A8TA 1W44A 2A3RA 2DPXA 1N5KA 5J4LA 4RD1A 2JJ2A 2I4IA 4JL5A 4A6PA 1GAJA 1M7BA 3U7EB 4JKIA 3U61B 4C2TA 1II0A 2VP2A 1L2TA 3HP1A 2ZSBA 1NMYA 1R4AA 1KK0A 2WMNB 5G40A 2GHIA 5E3HA 2QMHA 3TUJC 1W5SA 4EFNA 1F60A 1DVRA 3QENA 3U3JA 3QQ5A 3AF2A 4PHFA 4M4SA 4GI7A 5FTNA 5DI3B 3U5ZB 1DAEA 5SZKB 3REFA 2QAGC 1S1CA 1VYTA 3CRMA 3HR8A 4RD2A 1QHXA 3CX8A 4HDCA 4NHOA 4V03A 3RANA 2ANCA 1MABB 3K53A 4H1UA 3TUIC 1ZNZA 1E0KA 2GF9A 2BBOA 2V7QA 1E2PA 4DLRA 3U60B 3K9NA 3IGFA 2VF7A 1JAHA 4HAVA 4A4DA 1KTVA 5L3RA 2LKDA 2W6ID 4D4KA 4EQ6B 1T6NA 2ORVA 3QVUA 4V0KA 3I72A 2WBLC 4JL8A 4AYXA 2WOOA 2OE2A 3R8CA 3PCRB 1EFHA 4KITB 2OCBA 4LHWA 1TQDA 1IONA 1NKTA 1N6PA 4IFBA 2IS6A 1VG8A 2ODBA 1UBEA 1GNRA 5GJBA 3K0EA 1KSHA 4P32A 2D3WA 4L5BA 4IRUB 1Z28A 4NCKA 4FCTA 4U5XA 4TL9A 1T4GA 4Q01A 4DEXA 5KYKA 2XITA 1ANKA 1DG3A 1FX0A 3B9QA 1JEDA 4B34A 3Q72A 1DAFA 2CDNA 621PA 4KSBA 3ZVLA 1NNEA 4JLVA 3AVXA 2CHQA 2QRNA 3ZS8A 1G3MA 4YMSA 3EG5A 4B47A 1TF7A 4PTLA 3QJYA 3EIHA 3OEEA 2ZRPA 3NKVA 2IS1A 1L4YA 1CR0A 4X8OA 5KOYA 4ON9A 1E0SA 1N6OA 2AK3A 2W6JA 2OBMA 1JXOA 3FB4A 1KO1A 4PAOA 4US0R 2FX3A 5FBQB 2JLXA 1XTQA 1VG9B 2R8RA 2QZ4A 1Z63A 2KE5A 4JJKA 2C96A 3PUVA 4DT1A 1F2UB 4Q4HA 2IK8A 3Q85A 2Q0HA 1SHZA 4LJ7A 2B7CA 5EXSA 3RS0A 1Z2AA 4II7A 3LH5A 2VLIA 1AKEA 3P4XA 3X1DA 1M7HA 1FNNA 1XBTA 1GUAA 1Z06A 3VKHA 1VHLA 3MGCA 3CWZA 1MRSA 4AWXA 5BXQC 3LBNA 4NYJR 3DOEA 3K0FB 1YKSA 3B1YA 1H8HD 3QF7A 3NEJA 1TF5A 4Q4AA 1ZM7A 2V4ZA 3TSZA 3V00A 4EJSB 4LBWA 2H92A 3GLGE 2ORWA 4ACAA 2QPOA 2IYVA 4IFEA 4Q7KA 5JS8A 1P9WA 2PT7A 2ZITA 1HURA 5H70A 4L9WA 1JXMA 3I73A 3TJZA 3U6BA 1IJEA 3NBYC 2IX3A 3ICEA 4NYJQ 3FE2A 3G0HA 2Q3MA 4DB2A 3QE0A 3EW9A 3E1SA 5CLLA 4B6EA 4ZPXA 5FOWA 3NBXX 2B7BA 3NH9A 1GITA 4OQXA 2GK6A 2ZYWX 3LW8A 2EFCB 4OJKA 2WJYA 3SJBA 3H4MA 1WMSA 4PC7A 5L8VA 2ZRMA 1KMQA 1WB9A 3LX8A 4YDHB 1KZ7B 2UZ3A 2PLRA 1E98A 1S8FA 2BHRA 3DMNA 3MD0A 2GEDA 3SYKA 1KMHB 2PZFA 4M9XA 1PVOA 1LY1A 1J8YF 4TSFD 5UKDA 1IM2A 1F48A 2NO9A 1H8EA 4LSGA 3NHBA 4BLRA 3TAUA 4B3BA 3SFVA 5G3ZA 3KX2A 5IF9A 4KAXA 2I1VB 3FDIA 4ZDJA 1BMFD 1OW3B 1JPJA 2HF9A 2QNRA 2C04A 2GAAA 3AH8A 3ASZA 4OQNA 4QRHA 1N0UA 3ZVRA 5JJIA 1KAOA 2CJWB 5B57C 2Z6VA 2ZI7A 4LC0A 3EAQA 2PL3A 3DKVA 1FW6A 1HH4A 1YZUA 4G5RA 2CL7X 3C4JA 4PPFA 5FPSA 1CEEA 3C41J 1FTSA 1E9EA 2NO7A 4GP7A 4WZ6A 1U0LA 1DPFA 2A7QA 1GIAA 4WIAA 4LV5B 1RRGA 3TMKA 2ZYTX 3KUCA 5JBQA 4QBIA 3VTKA 4CEJB 2QMUA 5TY0A 1CR4A 1E2LA 1VPLA 2CXXA 5CB8A 2ZJOA 3VNUA 1QBKC 4Q7JB 3L0SA 2BBTA 2R6CA 2RAPA 4BLPA 2YZ2A 1G8FA 1U99A 2IHBA 4ERNA 3RS2A 4Q1CA 3A1TA 2Q3FA 1PLLA 2VSXA 2W2XA 2FFBA 4OBEA 1XDBA 4ZKEA 4WXRA 4ZDKA 1VCIA 2YNMA 2GVDC 1RC8A 4NZYA 4FMBB 1HE1C 4P4UA 2FJUA 3TQCA 1KJZA 5JRJA 2GCNA 1ODFA 2ZRNA 3L82B 2FZ4A 3N5CA 3RNLA 4C9BA 2FPMA 1E0AA 2GESA 4PANA 1S0UA 1Z29A 1AKYA 4A6XA 4B2LA 3IILA 5EE0A 2OAQ1 3WNDA 1V43A 2GBLC 2ZAOA 2ZS9A 3ZDQA 5JI3E 3SQXA 2EFEB 2KBEA 4EPRA 3O8CA 3AVWA 3RRYA 4Q19A 2O8DA 4E07A 2G88A 2NGRA 3WBKA 1Z22A 1XFAA 3HJNA 1P62B 3FHTA 4RCZA 1XJ0A 1V5WA 1RFLA 4E22A 2AL7A 2VH5R 3KJIA 4I1SA 5JEDA 4Z54A 2HT6A 3HR7A 5KDDA 1UEIA 2BKUA 3CPHA 4L15A 1X8KA 1Z6YA 4PZYA 4KCGA 1GVNB 2O8BB 4XSHA 2EFGA 3NC0C 1WRBA 2FFHA 1MO3A 2WWWA 4DB4A 1XWIA 4HZUA 5DYIA 3U3MA 2AN9A 1G4AE 3VAAA 421PA 2VBCA 4TT3D 1Z6XA 5JHGB 4ZIRA 1P9RA 2W0SA 4LJ5A 5KNBA 4DXAA 2GF0A 4R9UC 1KDRA 2ZRCA 4H9GA 4TQUS 1S9DA 3RABA 2G6BA 2QE7A 3T5GA 3CB4A 2ONJA 5JCPA 1CJTC 1I4LD 2JJ8A 3A4NA 2QSZA 3K9HA 1CU1A 3PFIA 4G5OA 1U8YA 1SULA 2WAYA 4C0QC 3K1JA 3UWKA 1FUUA 4G5SA 5CDFA 3GPLA 4MDFA 5DIFA 4IW3B 4TZ0A 4IDPA 2ZR9A 1YRBA 2YINC 3LQRA 4Q7LA 1WXQA 3GLGB 3K09A 2SHKA 3U3OA 4FMCB 2D06A 2CHVA 3R20A 1HQYE 1JJ7A 1AM4D 2XTNA 2LKCA 4XWKA 2VP0A 4PHTA 5CK4A 1U8ZA 4A8JC 2JLUA 2RGNC 1ELOA 1PJRA 3RRZA 1IXSB 3UMRA 3U7HB 4D0NA 3ADBA 1J2JA 4PO9A 5CYOA 3BOSA 4C0AC 1RRCA 2F1IA 1XD2A 2JCSA 3MRSA 3TR5A 3I92A 5FPYA 1TUEA 1OJLA 1E4YA 3AUXA 3IPYA 2GCPA 3DM9B 3O8BA 3P27A 4OHXA 4S35A 3R7WA 4E09A 4URVR 1XP8A 3WHKA 5EJEA 3IKJA 1G17A 2KB0A 2R62A 5FPTA 2KI5A 2QGNA 2ZUCA 1XEFA 4WVFA 5EXXA 1WQ1R 1M7GA 2ZJZA 2HXSA 5DYGA 1SVIA 1UBCA 4DCNA 1AIPA 4IOJA 5C1BA 1ESMA 4ABYA 3QVVA 1T5LA 3EPLA 2NPFA 2XAUA 3MLEA 3ICQB 4C0SA 2F55A 1NVVQ 1CTQA 1G7SA 1JR6A 2Z83A 2H7VA 2OILA 4FWIB 3UKDA 2V1UA 1YR9A 3EARA 3SZRA 1MO6A 3G5UA 4NYIR 1G5TA 4QBGB 3N70A 1BIFA 1WA5A 1G1MA 2P0EA 4MGZR 2ZE5A 2V9PA 3EA5A 3GJXC 4Q1BA 4QGHA 2QMEA 2JLZA 3T1TA 3WY9A 1E2GA 4HLUC 2RGXA 1E2FA 2WSSD 1G8HA 1XMSA 3KJEA 2VA8A 3WNBA 2ZR7A 4A2PA 4NYIQ 5JMTA 1T91A 3W6PA 4D82A 1P73A 5DE3A 3PEUA 4O3MA 4NE2A 3A4MA 5CLQA 3EPKA 3LX5A 3Q5DA 4L4UA 3QKSB 2PZGA 1KO5A 4JJZA 3G82C 3TQFA 3EWSA 4DVGA 4P0TA 5EP3A 1OB5A 3AB3A 4B35A 2RB4A 5HE8A 3PEWA 4YMUA 2X19A 3NG1A 5L3SA 2ZRBA 1Q44A 3KKOA 3LXRA 1IN4A 4FD2A 4OK6A 5FL7D 4JLPA 2CEAA 3I62A 4DIDA 4IOMA 1E9FA 3BC1A 1DOAA 2VHJA 4BLSA 1NBMD 4BASA 1KKMA 2FFAA 2NG1A 2VL7A 1S4QA 3B13B 3PITA 3PQCA 3TW8B 1SZPA 1OPXA 5P21A 2G9NA 2R2AA 3AUYA 4HUQB 4RKEA 4Q4LA 1Z0AA 1TQ4A 1OIWA 2IS2A 5DN6D 1J90A 4K8OA 1ESNA 1F5NA 2OO7A 1RJ9B 3FHCB 2ZE7A 1E1RA 5A5GA 1F3OA 3OF5A 4L16A 2DHRA 2PJZA 3OIWA 3OHMA 3FWYA 2DY1A 2OFOA 3GP8A 4EPXA 3WYGA 4TYQA 1EFRD 2JAQA 4FMDB 2RGCA 2ZVQX 3RS4A 2QM7A 4V02A 4C0JA 1WDTA 3AM1A 2CCGA 4TYPA 4XTCS 1KZGB 1G18A 2CLSA 5DHFA 1KI6B 1N6IA 1G9XA 2HJVA 4AIIA 2NO0A 1W49A 2UVQA 4GFDA 5KO2A 5HTKA 1GL7A 2WJJA 4URZR 1I4TD 1IXZA 3LBHA 4OJQA 4IVQA 1FQKA 2E9SA 2P65A 3DO6A 2FPKA 5C2JB 1OH8A 2HJGA 1QRAA 3KTAA 2OCPA 5A4JA 3THXB 1IHUA 1RE0A 2ZRHA 1VDZA 3BFVA 3ADKA 4HAYA 4QL3A 4W5WA 2DWOA 3VR3A 4RZXA 2IYTA 2BJWA 1DO2A 4BPBA 2HUPA 1SVOA 1ZD9A 5FBWB 2V1XA 3CONA 5AJVB 2X1VA 1W48A 1NBME 1KK2A 2Q3HA 1KO7A 4RFSA 3BB3A 2PX0A 4HAZA 5B30A 2FF7A 1P2TA 2Z43A 2JATA 4XSGA 1AJEA 2IYQA 4QHYA 2WKQA 521PA 3U2QA 3VR2A 1OB2A 4MH0R 4PC3A 1XF9A 5LD2B 1EGAA 3W8NA 1HYQA 1DADA 1II9A 3FPAA 1GL6A 1SKYE 4QBFA 4JZKA 1MO5A 4NU0A 4AYWA 1CBUA 1F2TB 2ZJYA 3QXJA 4G0NA 4TLEA 2C77A 1A2KC 2BM0A 5FTJA 2Y8EA 3BIFA 4L9SA 4DSOA 3ZVNA 1KK3A 1QHYA 5IK2D 2GZAA 3GLFE 2IEZA 2B8WA 2IYWA 3D3QA 4TTPA 4MITA 5KNCA 3AKYA 4LJ9A 2MSDB 4TTQA 2AD1A 1E2EA 1OXUA 5KSOA 4D4JA 1Z0KA 4PQRA 2WIAA 3HYRA 2A9KA 3FKQA 3MJHA 1K5GA 2J0UA 4CEIA 1RVDA 2ZUDA 5J47A 3L0IB 1KSJA 4HB4A 1FUKA 1LTQA 1EWRA 4LJYA 5FL3A 4R98A 3SJZA 1GRRA 4YXWA 2HDNB 4QJ4A 1NG1A 2I3BA 2WZQA 4Q1FA 2WICA 2R44A 4LYHA 2ZQ5A 4E03A 3UMSA 1OXSC 2QT1A 1X8JA 2CMKA 3WMEA 4M1SA 4MRRA 3DOFA 2PCLA 3R9WA 4L8GA 1H65A 4BLTA 4GL2A 4P3YA 4JVNA 4RSGA 3K9LA 4DLXA 2IUTA 3V4FA 2C78A 4A0HA 4HDOB 1NP6A 4GZMA 3AP2A 4B44A 1G16A 4LBZA 5E95A 1S1MA 3ZQJA 3QXSA 2F7SA 3SEAA 1QHIA 2VPPA 3KXIA 3IQXA 4ITRC 3BBPA 1G6HA 4Q9IA 3ZZUA 2XXAB 2XZPA 2AD5A 1Q1ZA 4JYBA 1N5JA 4TMTA 1VHTA 3CM0A 1QG2A 3PVSA 1W36C 2ZE8A 3ZQ6A 1UDWA 5FI0B 1EXMA 3OEED 2CCJA 4D2IA 3QEJA 5F2EA 2J0VA 2YJTD 2J5XA 4GNKA 4B6FA 3VFDA 1XTKA 3LLMA 4M2LA 2DYKA 2W6JD 1J70A 3W8RA 1WBDA 2IYRA 2NO1A 4C30A 4XVRA 2FZLA 2ATXA 4WOPA 4Z8YA 1E2KA 3QF4B 5CM9C 1Q20A 3IPXA 4LYFA 3ZYCA 5L3QA 4UJ3A 1X6VA 1R2QA 5JS7A 2AKAB 5AUOB 3TW4A 3PUXA 4DLUA 1XCMA 5ELXA 2C95A 2V6JA 3AP3A 4ZKDA 4WZBE 3GFOA 4QBHA 3T34A 3P1JA 5KSZA 1I2DA 3BFXA 1TTTA 2C2HA 4TL6A 3VU9A 1JI0A 1HT1E 1XPRA 2B21A 5F9FA 1B0UA 1U9IC 2GCOA 3HU2A 5B58C 5G3YA 2CL6X 1ZM4A 2QGZA 1HQCA 3I32A 1W36D 1CJUC 4HAWA 1WBBA 1DAGA 5GJCA 1G8YA 3WHLA 4F93B 5CK5A 2JA1A 3GJ7A 4M1TA 5EUQB 5IHPA 3ZD6A 3AEZA 4TN1A 3R9XA 1MOZA 2DB3A 3A37A 1OKKA 3TSWA 1S96A 1DARA 2ZRKA 4X8HA 1AN0A 5J5CA 1KDTA 2MSCB 1XCGB 1LNZA 4FIDA 4B3XA 4LC1A 4OK3A 4CEHA 3TVDA 4PPGA 2QEQA 3F3YA 5JFGA 2BEKA 4CGZA 3QBTA 2Q9BA 2RMKA 4AKIA 2ZI3A 3LAWA 4IDNA 1BYUA 2BCGY 5AK0A 1OHHD 5FBVB 4R2IA 1GZSA 2GJAA 3KXLA 4DIEA 5FPHA 3FMOB 1XJQA 4O0MA 3EXAA 3ZIAA 3EZ2A 5G41A 5DH9A 2XTZA 3BWDD 4ZCMA 1KK1A 4M1WA 3R9IA 5HPYB 1NJFA 4URXR 4RD6A 2O0JA 3WMGA 1T9HA 4IXMA 1SKYB 3RLFA 1Z08A 1T3HA 3EZ7A 2IWHA 2MMGA 4HB2A 5CITA 1ZAKA 4BFTA 3K0AB 2FSIA 3GLFB 3ZGXA 1AS2A 3H0KA 1COWA 4JLNA 4BRWA 1E9SA 1DE0A 4IDOA 1TU3A 2BJVA 4NH0A 2XOKA 4DLYA 3ND9A 2C03A 3I5YA 2XNSA 4NCIA 1P3JA 2HLDA 3L8ZA 5TV2A 3UK6A 4QFMA 3AGPA 1ZP6A 3DKPA 5K8LA 3KB2A 2YOFA 5FR2A 2J1LA 5LB2A 4C7OA 2BKEA 2HF8A 5D3MB 5KU1A 3MG9A 3K0FA 4RFVA 3SOPA 2ZROA 4ACBA 4IEEA 1NLZA 2ZRJA 3FYHA 1IY1A 2JLSA 2OUKA 3LVRE 2P5SA 3Q7QA 2FPLA 2O8FA 4W7SA 4EJSA 1IAQA 3EZFA 2ZSDA 5TXGA 3WNCA 2ZRAA 1UJ2A 2GWHA 5F9HA 1T3LA 2NO6A 1Z0DA 3GLHA 2DFLA 3CUEF 1QHGA 3PJRA 3AKCA 1LFDB 4UXIA 3FKSA 5FOXA 4ARZA 1E79A 2WV9A 5AUNB 3CNLA 4HLQB 2EYQA 4DSTA 2ZI4A 2XSZD 2V55B 3KB1A 4ZO4A 4PC6A 3LRPA 4XOIA 4ESHA 2G77B 1VCNA 2XB4A 4FMDF 4HYYA 1XXHA 4A82A 1U90A 2QPAA 4PO1A 4M1OA 2EYUA 4Q9LA 1FFHA 1FMLA 2OHFA 4FINA 3WRXC 4HI0E 4F38A 1N2CE 2ZYUX 2JLVA 1G3RA 2P3SA 4BFVA 1LVGA 3DVLA 3K70C 4QG7A 3UPUA 2YWEA 2RGDA 3K0SA 1JAIA 4QGGA 1RRPA 3S1AA 4U7DA 3H2YA 4EIWA 1KMHA 3L8YA 1II8B 4KU4A 2HEIA 3EIQA 3GQBA 4X8MA 5JWRA 4QM7A 2IT1A 3GEEA 4CT5A 4W9MC 2OG2A 3A36A 3A1UA 1CJKC 1Q1BA 4YMVA 3I1FA 2OLKA 4LYAA 3SFZA 2QRZA 1ZW6A 1Y3AA 3VR6A 2ZS7A 4YMTA 2QE7D 1N6HA 1TMKA 3DPUA 2XJ9A 1HY3A 2J3EA 1BS1A 3PG5A 2ZJ2A 1G3UA 4HDQB 2BMJA 3T06B 2V3CC 4XJXA 1IQPA 1BH2A 3GJ5A 3RYTC 1ZM3A 2J46A 2DWPA 5AR1A 5EZ5A 1OV4A 3IIJA 1OH6A 2FE4A 3QY0A 2F1RA 1TU4A 1W5TA 1P9NA 2MMCA 3GJ8A 2QAJA 4BZPA 2JGNA 3CRRA 2G3YA 2YOHA 3UXMA 1P75A 2ZRLA 3LQQA 1FX0B 3B1ZA 4OQMA 4B48A 3K70D 4DDTA 1XZPA 1E2QA 3JZMA 3X1ZA 5LB4A 4AY2A 3F8TA 1UADA 1KSFX 3WXMA 2ZE6A 1U81A 1U2RA 2J7PA 3AVYA 3IIKA 3LD9A 1E4VA 4MYCA 3AVUA 1HT2E 2Q6TA 4BEBA 4W5JA 4C0KA 2ANBA 4OI4A 4LDJA 1SXJA 4FW9A 3VHLB 1JB1A 4ASUA 4DCUA 1KJYA 2ZSFA 1ZUIA 3NXSA 2QA5A 3EC2A 4EPTA 3CO5A 5HZKA 3THYB 2HYIC 1CS4C 1G8PA 2EFHB 2KJQA 2FA9A 3HU1A 2KSQA 1WCV1 3OE7D 1UM8A 4LRWA 3GCGA 1X1SA 2WWFA 2JLYA 1MR3F 1KJWA 3OAAA 4Q4HB 1G7TA 5DSZA 1Z8FA 1MO4A 3QKRA 2YKGA 3IHWA 2A2ZA 3I8SA 2QM8A 3MFYA 3H86A 1E2IA 2KBFA 4JVMA 2OFXA 1GRQA 4NYMR 4LY6A 4PSAA 1Q12A 4UNSA 5SZIA 5JWHA 2BBWA 1X1RA 4TTRA 3MWLA 3PENA 3RAPR 2AKYA 3NBZC 3WYFA 1YHNA 3KZ1E 4LJ8A 5DNYB 3A58B 1P2SA 1W47A 3SHWA 3TSOA 1CF4A 4M9QA 5CDFE 1P72A 4YLGA 1M34E 1E0JA 5E4FA 4MDEA 2XJ4A 2P67A 5LD2C 4NYMQ 4AD8A 4Q4AB 4Q02A 1M2OB 4BRUA 1W36B 1G19A 3ZH9B 2ODEA 3BORA 1JECA 2QORA 1NF3A 2BIFA 2G1KA 3BH6A 3ADCA 3THWB 1TNDA 4OQLA 1GKYA 4F91B 4BEJA 1SVMA 3VKWA 1D5CA 5BWMA 5C18A 4OHVA 1NMZA 3VQTA 2EQBA 5BW8A 2VRWA 1IN7A 1ZUNB 2BMEA 1KI2A 1E9CA 2X77A 4PHHA 4LK2A 4GMXA 3MMPA 1G6OA 5E7JA 1CJVC 2GEVA 1P61B 1U0HC 2GAOA 4M0LA 4AC9A 1W2HA 4Y0VA 821PA 2OBNA 5JSZA 5EP1A 3WMFA 1R0YA 4MUBA 1OXTA 1GKUB 4NDZA 3KJHA 2C9CA 3WP0A 2ATVA 2OSBA 1G5RA 2QAGA 4B76A 5EXPA 3BH7A 3EPHA 3OIYA 3DHWC 1G64A 1PV4A 1EK0A 3IO5A 2B6HA 1US8B 2OCAA 3AVQA 3W6NA 4DBLC 2OZEA 1NSTA 4OHWA 4BZQA 3TBKA 4YONB 2IC5A 3B1WA 4US2R 4J0QA 4Q7MB 4V0NA 4BLQA 3HWSA 2DCUA 3AVOA 5JLJA 2C5LA 1XEXA 1Z2CA 3W90A 3E2IA 4BFSA 4CT4B 1N5LA 2IYXA 1G41A 1HA3A 3AF4A 3DEFA 4DCVA 5IDVA 3L0PA 2RCNA 3SE0A 4AG6A 1E1RD 2VO1A 1KO4A 4JLDA 3EWAA 3TLXA 2WSMA 1ZBDA 1R5NA 4G1UC 4I1UA 4A0RA 4DHEA 1FP7A 4JT2A 2XB2A 5DLQC 1R6BX 4A2QA 4BFYA 3CF2A 4OI1A 1OIXA 3DDCA 4LPSA 1IJFA 4D81A 2VIIA 3QKUA 4GOJA 1XEWX 3I5XA 1TPZA 2V6IA 3OFNA 3ZVMA 1R8SA 1NMXA 2MSEB 3CBQA 3CZPA 5FBRB 3NIBA 4QM6A 1D2MA 3IDQA 1D6JA 1NIPA 2R65A 1IN5A 3V9PA 1IN8A 1ZNYA 5JWOA 1Z6AA 3FGNA 1LF0A 4IOKA 2L0XA 1JPNA 2QUZA 2ZANA 1W0KA 2FMXA 2QL6A 4KXFB 4RD0A 1Q1EA 4B3GA 4PSKA 4JKYA 2V8OA 2QY9A 2LCFA 4NCHA 3P32A 4DWJA 2RHMA 2OFWA 2AK2A 1ZYUA 5FUXA 4MUAA 3TR0A 1N25A 2BCJQ 4LWZA 1C4OA 3CH4B 3C8UA 1UBGA 1RYFA 3PV0A 5FTKA 1YZGA 2GVZC 1U0JA 2QQ0A 3I8XA 2H1LA 2V54A 5SZHB 2YYZA 1AA9A 4Q48A 2ZJ5A 4KFTA 2O8DB 1NVVR 2PLFA 3BGWA 3DL0A 1J99A 1GRNA 1NVWQ 4DLSA 2CLDX 3BD9A 4DLVA 5J4YA 1UKZA 3I4LA 4GOXA 1P2UA 2IYYA 1NN5A 5LBIA 1PLJA 4CIDA 4PFSA 2REOA 4IDHA 1PUIA 3NTUA 4B33A 2WKPA 4WXPA 1R10A 3BXZA 4C0LA 2F6RA 3T12A 2JDIA 1NRJB 1W4RA 4AKHA 4HZUB 4DSNA 2WJIA 4QHSA 3AKDA 4LV6A 3TNFA 2WVJA 4HEJA 3J81k 4ZIRB 2VP6A 3KQHA 3NDBB 4KBFA 3JVUA 2ZI6A 4YQFA 4XVQA 2WWXA 4MGIR 3RRMA 1UKEA 1GM5A 3SYLA 5HZHA 1EX6A 4DZZA 2JJ1A 4LI0A 1ZC3A 4P4SA 1A4RA 3PUYA 2VHTA 5EQTA 5KPDA 1SGWA 2AHOA 5J4VA 2F43B 4HLDA 2CLCX 2WM9B 3GLIA 1DS6A 4JMPA 2NIPA 1E9DA 2FSFA 1EWQA 2VP9A 2HCBA 5CIWA 3K70B 1SHKA 1LF5A 4KBGA 4TZ6A 3N2IA 1KI4A 1S9HA 3IO3A 5CJ2A 2IYUA 3BERA 3VX3A 3A1SA 2O8CA 4Q9KA 1XTJA 3TIFA 1D9XA 4CRWB 3W5JA 4FI3C 3CKLA 1OIVA 3EZ9A 1XD2B 4PAMA 1YZKA 4B2IA 2BV3A 2QPTA 1UF9A 3T61A 1NN3A 5AUPB 2BWJA 4KLNA 3UG7A 1Q0UA 3QKTA 2R6FA 4JBWA 4CDGA 1R7RA 1XMVA 1P2VA 2FH5B 4OYHA 2C9YA 2P6NA 4EAQA 2VQSA 1L7VC 5KPJA 3HPRA 4EPYA 2OV2A 2ZAMA 1XRJA 2FGJA 1W4CA 2N46A 4NL4H 2H18A 4P31A 3CPEA 5AWFC 2YC4C 4TLAA 2PBRA 2OAP1 3A6PC 1IY0A 2GJKA 1NY6A 1GILA 1C9KA 4HZIA 1XU4A 3GEHA 1N6KA 2VEDA 4AI6A 4RJLA 3PEYA 5DI9A 1DEKA 1UDXA 3IIMA 3U7FB 4JSTA 4JLMA 3BAFA 1S3SA 2JEOA 2AWNA 2P6UA 2REBA 1KYIA 1YRAA 3L2OB 1YZLA 3B78A 1G21E 5EE5B 3MSXA 1A2BA 2E87A 3MAAC 4V0MA 3ZD7A 3NEYA 3UIEA 4B2PA 1MV5A 1E9BA 1TQ6A 4IEIA 4C0BA 4M53A 2QN6A 1VIYA 3SS8A 1AQUA 1MKYA 3SNHA 1Q3HA 4PC1A 4OHZA 2VSFA 3RS5A 4C0HA 1E1QA 1XNJA 1KDOA 2IWRA 3GJ3A 2BVNA 1YR8A 5AJYA 4EUNA 3QSYA 5BYJA 4XWOA 5FI1B 2JIZA
chains in the Genus database with same CATH superfamily
4UNRA 1OKKD 4FMPA 2BD0A 4LXUA 4UUNA 4O63O 1UM9A 2YWBA 1AQ6A 3ICVA 4L6AA 4O08A 2WU8A 4B6PA 2J7KA 2IXEA 3BXPA 3R3UA 1RRFA 2CDCA 2DFTA 4C6HA 5JEEA 1WIVA 3STWA 3UJNA 2GN2A 5HEKA 5FBLB 5C8XA 3X1XA 3F2VA 4A9AA 2IW3A 2HPVA 3ABRB 3UANA 4WECA 5H8WA 3WLLA 1SFRA 4OHOA 2KDLA 3QUBA 3C15C 1PF7E 2JWSA 2I8LA 2GBIA 4G9BA 2DECA 4Y7CA 3JCZA 4CE6A 4EWLA 4D26A 2QTTA 4A8TA 2QN1A 1WGLA 3KOXA 2NUBA 2I3ZA 1P0IA 5KTSA 2AFIE 4FR5A 5JG7A 3F1KA 1BCSA 1JU3A 4I1OA 1R8XA 4CVNA 1NBEA 4CM9A 3KU4A 5EJ5A 5JTUA 4ZEVA 3NDJA 4PAQA 4HB0A 2BYTA 3NU1A 3JR7A 3OPVA 5CLFA 4KL8S 1LWOA 2W42A 4PYLA 5K0BA 1RVV1 3C6ZA 2GT1A 2OORC 4ZDWA 4V1CI 3BG5A 5CLHA 3KDSE 4LWQA 4FHFA 5EHIA 4PBTA 1QB7A 2Z1DA 4OKIA 1H8ED 3ESZA 1T4CB 2IV7A 5KQRA 2L7HA 9GPBA 3QYFA 4EMUA 1XMQB 5GIPE 1ESEA 1ZVVA 2VTKA 5JNWA 1Q3TA 2ODWA 5HKKA 2I99A 5BOVA 1FFAA 3MWYW 2A9QA 1Z7WA 4Z53A 2HXYA 3L0OA 1C8BA 4PRZA 3CTPA 5K8VA 4FWHA 2FR1A 4FGZA 1N2XA 3CJTA 2JEZA 2GH1A 5J40A 4EBFA 2PRYA 2QMOA 2ZIFA 2JZ1A 1KERA 1YI0A 2VPYA 4B6OA 8AT1A 1F4LA 1YB1A 1SUWA 1QRRA 3OM1A 4A5OA 5DZSA 4O25A 1RRMA 3ZDEA 3DV2A 4I1VA 3KQTA 5IMSA 1ACJA 3BPSA 1HTWA 3UH1A 4EECA 3LIIA 3WP1B 1XHLA 4Y2VA 1JQDA 3SYRA 2VBIA 3GPPA 4GKKB 4ZK2A 1DAIA 2RHJA 4MB2A 1EI9A 2ISCA 1RIIA 4B3RM 5LJLA 1OQAA 1E58A 3DT9A 4AURA 2AQIA 3TZKA 1FJ2A 1H6CA 2Z95A 3IR6A 4ZYZA 4KH1A 3NHJA 3B5EA 3N0RA 2HRZA 2WZDA 1N2IA 3CW2A 1IZ9A 3QZUA 4XWAA 3IP6A 4K1LA 4ERXA 4C7BA 4TLBA 3P9PA 3IVCA 3CU5A 4LOJA 1H42A 4ESEA 1U9IA 2IZ0A 5KYUA 5LDHA 3E2MA 1F4PA 4XX1A 4CMKA 3ZPXA 4J1TC 1Q7TA 4AN4A 2H6EA 3V4OA 4MUFA 2EL7A 2O0KA 1VXRA 3JASA 1XG5A 5ESXA 1OU0A 3O73A 1XPUA 3OF2A 1RXEA 3OZWA 1CC1S 1QIJA 2V65A 1ABFA 1SXJB 1PUXA 3K35A 5JISA 3E5HA 3DSRA 4J76A 4DG8A 3VHXA 3NHAA 2PT5A 1UQRA 3I5AA 5K05A 1VPEA 3H1GA 3L43A 5CR9A 4X95A 2H3HA 2WZCA 5DU2A 3I61A 1P4AA 1H8HA 1WSWA 2MWMA 3TVTA 4AJ2A 2ZM5A 1YTUA 4D25A 1DKRA 4BQIA 4QYSA 2JZCA 1DJOA 2E5FA 5EJFA 1GFIA 3NKFA 3O4JA 3U56A 4F7DA 3HNOA 3K9WA 4UAUA 5KCZA 3FDJA 2GTPA 3W4IA 221PA 3ZDAA 4UNPA 1Z0IA 3LY5A 3ZJYA 1JJIA 3WYBA 4GDFA 2HWXA 1JSCA 4LJKA 3RLIA 3I53A 2YC2C 5C37A 3QMVA 3MJCA 2AV6A 2X2PA 3NX4A 4HUQA 2MTBA 1Y1QA 2BDUA 2UVDA 3CUYA 4ZMBA 4J0KA 5B7GA 3OT5A 4MGKR 1BNCA 1R0KA 5TQJA 4LF8B 3TW0A 3STUA 3OZGA 3GOHA 1YQWA 3JZFA 4F72A 5C8DA 1RJDA 1T5IA 4TLDA 1PHRA 3GFQA 3G1UA 4V0LA 2ISSD 2W2KA 1BQ3A 3A32A 5T7BA 1JX6A 4JLSA 3L6UA 4CMHA 3VDRA 6CHYA 4WN9B 3HACA 1VLZA 1JDJA 2WJ4A 3ZXUB 3BK2A 2YUTA 1YR1A 3LM8A 3KSZO 3U1VA 1WCXA 2SICE 2R60A 4NJMB 1OLSB 5JXIA 1LRKA 2CJYA 3ZNOA 1T4MA 3JQCA 2HR1A 2JBHA 1VIAA 4XDHA 4MEBA 5IT9S 3D1VA 2CT8A 5LOVA 5CA0B 4OQDA 5EMKA 3NBMA 1VBNA 3ZCRA 4OHYA 1JIIA 4MYHA 1NT4A 3IAM6 2CD9A 6Q21A 4FWTA 1BE8A 4PXAA 4UVEA 2YH2A 4IJ6A 4OK5A 5K0CA 4MUKA 5IW8A 3ANLA 1FRZA 4H3VA 4DTCA 5A2QA 3TEJA 5B37A 2HZ7A 2CZGA 2HO4A 2AW5A 4Z3KA 2BI7A 4Z7JA 2A30A 5KOJA 3KOXE 1EVYA 3R76A 3B5JA 3RS7A 5DCWA 5TPWB 1FDOA 1WU7A 3MZ0A 4H7DA 4BS9A 4ZGGA 3AEXA 3U4IA 4IF6A 3EPPA 3PIIA 4FN5A 1PEKE 1NKSA 4KEAA 1W8IA 5KQPA 5ALQA 1XZIA 1RWWA 3ER6A 3ITNA 5LYJB 1CJSA 3A7EA 3D59A 3RWOA 4TMFA 2Z9BA 1C3EA 2FH0A 3A46A 1RHQA 5HSGA 1L4MA 1EZ1A 4NDAA 3ZE1B 2R7NA 3IP1A 1TT5B 1KPHA 4Y0AA 3DTTA 3NGLA 1AHNA 2I66A 1D8TA 4F7WA 3ML1A 4RVSA 1QO7A 3HSYA 4LDPA 1YV9A 2OV8A 2FSHA 3QVKA 4PZCA 2GN6A 3F6BX 1V9LA 3OZEA 4ZICA 2NTYC 1XN4A 1GTVA 3KVOA 4LNAA 1DWPA 3R3JA 4MMYB 1MRNA 4U63A 4TYYA 3KFXA 5ITZB 3F46A 4QVGA 4ALNA 4ESOA 2C82A 4UREA 3C7DB 3KQKA 2LD4A 1GLGA 3NAGA 1DIRA 1QZMA 5J4LA 3RYFB 2NV0A 3C0KA 4DUPA 1LSOA 1M7BA 1YIAA 3FD8A 5ICSA 2BTQB 2WWVD 5JNLA 3UYKA 3CZMA 2FMUA 1S2NA 3BBLA 2QMHA 1W5SA 3UBTA 3K92A 3U3JA 3QQ5A 3WI7A 4K6CA 2QAGC 1I32A 3T5BA 1MABB 1E7MA 4TXMA 3HGMA 2JGLA 2OHJA 2WD9A 2GF9A 3LS2A 3QVOA 1RFGE 4ND8B 2LKDA 4D4KA 3KELA 4PYOA 4B0OA 3GHYA 3UJ6A 6REQA 1VG8A 1QK3A 2YJ5A 4IRUB 4NCKA 3N2GB 4ENSA 5KEIA 1GZ5A 1L9KA 2ZGVA 1L4YA 1LU9A 2XMQA 1DKPA 1QUSA 3D1LA 4QLOA 3OM9A 5D86A 3G2JA 3TPFA 4II7A 4WY2A 4B82A 1CUYA 1W88A 1B3BA 2DC1A 3SWWA 1NTRA 4JV5M 3CTMA 4O4LA 1ZM7A 3V00A 3PVCA 1P9WA 3ROGA 2X0RA 1IJEA 2XA9A 3ZC7B 4MXDA 3DBRA 2V7TA 5CB4A 4ZPXA 1J0CA 4OA8A 4RK7A 1RP7A 3VO2A 2HD4A 3HVKA 5KAPA 2RI6A 5L8VA 4U2CA 1P19A 2UZ3A 2PLRA 2AMYA 4ED9A 1VGQA 1BEUB 5A2GA 1QGZA 2EGUA 5AI6A 2JKZA 2AKEA 1HH4A 3MWFA 1V8PA 2EJCA 4WZ6A 3S1SA 1EX9A 1E4OA 3RUPA 4F3KA 3EGXA 2XLBA 1IYZA 1I36A 2RAPA 4DV5M 3WLEA 3ICCA 4M99A 4ZVUA 3U6MA 5BPHA 2WU4A 1SQ0A 1BXZA 3WGQA 1HLPA 4A6XA 3IILA 3LUDA 1RHKA 3WLNA 1JEOA 2VVTA 2O25A 4ZEOA 3PE3A 3U6LA 3WBKA 2O59A 3HJNA 1IIRA 3MHTA 2VF5X 2AL7A 3HR7A 3GROA 1EUDA 3O3CA 3NC0C 3USES 4HZUA 4WURA 4CFZA 1NUPA 4LJ5A 4D8TA 3A4NA 2PLWA 4NIMA 1KKUA 2Y3IA 2X5NA 3D6JA 3ESBA 4E5KA 1QTQA 1HQYE 2VP0A 1DJNA 4HTFA 4BGEA 3DMGA 1IXSB 4CLEA 3U7HB 3NLLA 5FPYA 3AUXA 3KJFA 4I2NA 2JJYA 4UTNA 3EEBA 4EEKA 1TU0A 1M9NA 4RDIA 2QVYX 3ZUPA 3MLEA 5BR8M 3PRYA 2FZ5A 2G7ZA 3I2YX 1G5TA 1QIGA 4E5DA 1G1MA 1OY1A 3N76A 5AESA 2DTXA 1QRDA 1UQTA 2AB0A 3HY4A 5IX8A 1NT2A 4R3UC 2HPAA 4A2PA 1C14A 4OP1A 1JHUA 3D8UA 3SASA 4E5NA 1QQ6A 5D84A 1M75A 1T1RA 3UJ7A 3OWHA 3BF7A 3F1LA 4YS6A 5CHEA 2A14A 1K7YA 3JSAA 3E48A 5IJZA 3JR4A 1E9FA 4OL9A 4MW6A 3O31A 1Z68A 4Q4LA 5EWLB 3ZH2A 2ZE7A 4HDKB 5DM70 1YI8A 3C6KA 1YL7A 2RGCA 4OUDA 4I3HA 3HJ8A 1WDTA 3AY0A 5DHFA 4GFDA 5J58A 1KS9A 4JB2A 2KLBA 3T3PB 3PPVA 1ZITA 3JY6A 1A8QA 1T36B 2FPKA 5A4JA 5KS2A 4JYZA 3BN3A 1Q50A 2W6MA 1SKMA 2HUPA 2BTEA 3CONA 3V4PB 3IHTA 3N28A 4I8OA 2DFPA 3CSUA 2CZQA 1QF7A 3CJRA 1QR2A 2GPTA 4BP1A 1UIRA 4EY6A 5I6DA 5F9MA 3ZC3A 2B8WA 1X8XA 5BUSA 3S2EA 1E3DA 5FKJA 4OLAA 4QX6A 4MX8A 3I1YA 3STHA 3GHHA 5FL3A 2WZBA 3EJ6A 2VOJA 2R44A 4E03A 4XQ9A 4L8VA 1YS6A 5HQTA 1CE8B 4HWRA 2C3PA 2B2CA 1ZRMA 1T8RA 3G8YA 4TUWA 1JW9B 4YREA 3QXSA 5EZYA 1IVSA 3M6MD 3PVSA 5EKSA 3ZQ6A 5CU7A 1H6BA 3AR3A 1VM6A 1J70A 5IC5A 4Z2AA 4WA8A 2RFLA 4BKMA 4X1KA 2PVPA 3JQ7B 1ZH6A 1Y8GA 5JS7A 2A1IA 1Y4SA 1G55A 2UYOA 5IEBA 1CUZA 3VU9A 3MUEA 5F9FA 2GCOA 2IEBA 1Z2NX 3AQIA 3L4EA 3D4OA 2R8YA 3R0ZA 5GOZA 1V45E 2BEKA 3QYPA 2HK9A 3LDGA 4RK0A 3FTCA 3BXFA 4X1YB 1OBCA 2O0JA 1T9HA 1EJBA 2FE8A 4AY5A 1RKXA 1AS2A 3AONB 2HFJA 1FNCA 2YBEA 2BI8A 5FR2A 3H2IA 5H16A 1X87A 2AZTA 2H1IA 2RHCA 5HJ2A 3GMIA 4EJSA 1PKXA 2CNDA 2ZM6B 2BELA 2GWHA 3B20A 2V7UA 4M6WA 3AKCA 1GUBA 4ARZA 1NUTA 4UULA 2EYQA 4NSOB 4PC6A 1WUYA 1A9RA 1JFLA 1UPAA 3RAGA 2X22A 2EJTA 1FFHA 2HHHB 1Z73A 4NBUA 1G3RA 3ITEA 1MC8A 1JAIA 1SM4A 4EIWA 2COUA 5JWRA 5DP2A 4QM7A 2R4EA 1Q1BA 2GEKA 3SFZA 5KNBD 2OV4A 2PSSA 2R66A 3DPUA 2AUNA 3EXG2 4HDQB 3T6PA 1TJPB 1CFZA 1O6CA 2QAJA 2ZRLA 4OQMA 1T0IA 3I9OA 3FGZA 3WXMA 2ZE6A 1M67A 2UUAM 3AVYA 3U6CA 1E4VA 1HT2E 1U3DA 4KN9S 5CEFA 4N12A 1NBOA 2F17A 3W7BA 2OQVA 2EFHB 4DCOA 2UYQA 1HWYA 4M9RA 3L6CA 4JVMA 3H7IA 3PU6A 3L8HA 3NBZC 4TWJA 3TIVA 3QTLA 4MDEA 1P77A 4IJQA 3JVDA 5FYQA 1FU4A 2XE7A 2BIFA 4IYRA 3A6KA 2D7HA 1AUAA 2X77A 2BMEA 2FSVA 2WF8A 3DHVA 2J3LA 4RTMA 2EW2A 2Y1XA 1GTG1 3O3MB 3AVQA 1M1YA 3TBKA 1P0CA 4PGFA 5GONF 4M76B 3TTYA 1P2GA 5EKXA 3OE5A 4YAFA 4I1YA 1NULA 3PHJA 4PYMA 4FDUA 3DEFA 2VNJA 2P9YA 5FPPA 4K0KB 1L5HA 2G1PA 1JMKC 1W5EA 3GFRA 3I58A 4I55B 2P9GA 2O19A 1JFSA 1FP7A 2FLKA 1VYHA 2Y0EA 4JT2A 1O0BA 3CNEA 4FX5A 1XEWX 4RTSA 4JR2A 1R8SA 1D6JA 5DWDA 4P7GA 2FEKA 5CXQA 4D45A 3DWGA 4RD0A 4PSKA 1AK9A 5K0ZA 2J6HA 2PRIA 1USWA 1K27A 2XZTA 4BKPA 2VJOA 1LC3A 4MQFB 1I14A 1H9BA 4F3RA 5IVHA 1APBA 4BN5A 2PKWA 4DLSA 2VYND 2JNHA 4DV6M 3IP5A 2P8JA 2QKYA 3L5KA 1G60A 4EHLA 2W9XA 4N3AA 1QP0A 2Y71A 2R25B 3SDSA 2JDIA 4ND5A 3MIIA 4EB6A 3L7KA 3FX2A 2C3MA 2A1UA 4YASA 2XMCA 1MIOA 3WIOA 2PMFA 5KNCD 3MCWA 3SJUA 3GWZA 4FHZA 3HXOA 1EX6A 2HCTA 3BF8A 1XTBA 2GZ1A 2HGZA 1A9TA 3HXLA 4W5RA 2VHZA 2YHBA 5KPZA 4BMVA 3N2IA 1FXWA 5FNVB 3M5CA 3UG7A 4CLXA 2R6FA 1UBUS 3BGVA 3E6AA 4L8YA 5KPJA 4ER6A 2C57A 4P31A 4DIMA 3T7IA 2GJKA 3PRKE 4RTNA 3KWFA 1KOGA 4AI6A 1T34A 3ZWKA 5DFLA 3L2OB 4YP6A 4EG1A 3PQ6A 4FOTA 4UBMA 4JBHA 1KEEB 1MV5A 3W1EA 3RS8A 4CG3A 4EO9A 2GVNA 3TWLA 1WPRA 1XNJA 3KJXA 2O2IA 1KFBB 4PLPA 3W04A 1IG3A 3IAS6 4XD7A 4RANA 1GCOA 5G0SA 3GG2A 4G3XA 4MP8A 4O2LA 3IQWA 3HI6A 2JJQA 5HZMA 1DHRA 3FMIA 4GI2A 5BNFA 3UBMA 3GUVA 1ONBA 2N42A 1Y6QA 4LAFA 1XHFA 3LV8A 3HJQA 1DGHB 5THXA 4KO3S 3I30X 2PX2A 4UM5A 5KPTA 4HDRB 1Z75A 1JHRA 3KTAB 4GI1A 1DT3A 3T9CA 5F2KA 1D0MA 3LC0A 1JHVA 3CEJA 2QLJA 4NFLA 5G2OA 1VL6A 1RDFA 3AETB 3IAXA 3ZK7A 1X7YA 3L7IA 4MHSA 2O52A 2IKSA 3P2YA 4TYMA 4N9WA 3FSJX 3H05A 5GONB 1UJ6A 4PZDA 4KOAA 3ZHRA 1RM3A 2EZ9A 5G0VA 2ZIXA 3WDMA 3UGJA 2OZLA 4UPVA 1NIJA 2CLHB 4BV9A 4BQRA 2EJSA 3UAYA 3E70C 2JGAA 3DMDA 1CJBA 3LWBA 3W77A 4Y9UA 3CR8A 3A4LA 1X14A 2WK1A 4KQ6A 2FSGA 1K3FA 2AZ4A 2OKGA 4REQA 5IJ0B 1TKBA 2EFDB 3VSBA 5I7OA 4J2HA 3RSGA 1AS0A 4AJ9A 3QH4A 1EBUA 1U4OA 5D1NA 5AJWA 2L4EA 1R5OA 2ZWMA 1Z6TA 2HQOA 1P0PA 3A28A 3SBXA 1BKDR 4OJYA 5H37D 4HMPA 2ECPA 4DCTA 1E6WA 1LV8A 3B8HA 1OXMA 2Z2YA 3EODA 3BXEA 4LC9A 3U80A 1LSJA 1XRMA 1OMOA 3AUFA 3RC9A 2EERA 3RC1A 2IEYA 4TSRA 1XTTA 3C6YA 3COSA 1F1BA 4MQEB 2DX7A 5MHTA 4D97A 5K8UA 3WDSA 1LI5A 1NI3A 3FNQA 4INZA 4PZ9A 4HATA 2KWIA 3IHPA 3KQOA 5E7MA 4RF0A 4P33A 3K9GA 1TVCA 2CF5A 1K4YA 1NLYA 1VA4A 1AGNA 1V5EA 1XNQM 5BYKA 1GZHB 3C3BA 3EX7C 2FZKA 4U02A 3GLQA 2ZYVX 2QB5A 4GSLA 1TE2A 3V7FA 1O5IA 1TJ3A 3IDFA 3WQSB 3AR6A 4F0JA 3RJZA 4MINA 2HCJB 3IBYA 4QOJA 3GIDA 2G04A 4XGNA 5MDHA 5JJKA 1GZ3A 1M1YE 1XNHA 2NOAA 2CCKA 5B3LA 1Z5OA 1KY3A 5EJIA 1LBSA 4Q5IA 2AFRA 4HK4A 3AYXB 2IQIA 4C4XA 5DASA 3CPJB 1BHQ1 1H9AA 2JGFA 3FDFA 4PPQA 3T3MB 4MKIA 2O8VA 4F5YA 1SC3A 5DJ5A 2ZVPX 3EF0A 3PNVA 2CD7A 2H17A 5EE1A 1VZ3A 2ZYAA 5HTOA 4RV5A 4ZV7A 4AP9A 1RPNA 5CMLA 1SPXA 1BJTA 2Y1LA 3PHHA 3LPDA 2NUPA 1ZDMA 1L5WA 3U6DA 3UMMA 3LA8A 4F6RB 4JP1A 5HVNA 5JC1A 2F1HA 1JLLB 2VNHA 1I7DA 2A9JA 4KH0A 4FFRA 1U94A 1ZNQO 1IVNA 1O0CA 2QGFA 4E2XA 1I2MA 4BECA 3B2EA 3NIGB 3D81A 2CLFB 2EX4A 2JAHA 4OLBA 3PNBA 3NHLA 4M8NE 1UMDB 5A5FA 2ZJ1A 5JSZB 2N1BA 5GZ1A 2W2VA 4DCSA 1CIVA 2WWGA 4DBZA 5LQRA 5A4AA 3CXRA 3LNCA 4UTZA 1HNWM 4Y0NA 4ZJPA 3MS7A 1HEIA 3OE7A 4OMUA 3PNYA 4EW3A 3DONA 4GRDA 2QTZA 1U2ZA 5C7OO 1KF0A 4L7VA 4EEZA 2EBFX 4MRMA 1T3GA 3C3CA 3RGSA 4RLQA 5FUWA 1XX6A 1E1NA 2XGMA 3SKYA 1OH7A 5KYYA 4DMUB 1KI6A 1PFKA 4YCSA 4YJHB 4IR7A 3RT9A 1N7GA 1KZ4A 5K8TA 4AU1A 2MR6A 3RDPA 5I5EA 4QOFA 5BWCA 4R8RA 3KRTA 2CRUA 3DUWA 2O9JA 4FYPA 1DFHA 3SDBA 2ZR0A 3MFQA 4A5SA 2WG0A 2ZRFA 1Z5UA 1VGRA 4FPXA 2CF6A 1YQXA 1ZKMA 3WNVA 2GPJA 4I8XA 2XZFA 1JXQA 1GL3A 2I1WA 1GQOA 3A10A 2V6FA 3DYVA 3IP7A 2CE7A 2WJHA 3E7XA 4EJ0A 4FXOA 2H51A 4NPHA 4WY8A 2ZI5A 2EF0A 3J81A 4MVJD 4XX0B 2QT9A 1FL9A 4KP7A 1NYLA 4HLCA 5KDLA 3U6EA 4LDRA 4YRDA 1YJ5A 1N2GA 2RHWA 1QGUA 3TTTA 3W5SA 3GNTA 5JALA 3T9DA 3AU8A 4CQLA 1Z5WA 3EMVA 4WY5A 4FFSA 4LXTA 2PFSA 5AKHA 1DKMA 1J8MF 3C8ZA 1QG4A 2BZ1A 4HS4A 5IKPA 3GG9A 1NQTA 4ZQEA 4C76A 4FGUA 3L8GA 1JWLA 1OSNA 3M4NA 2L17A 5JDIC 1ZMVA 3AG6A 5LQAA 4M0EA 4N01A 4S0ZA 1FFGA 3I9MA 3B6EA 1TEXA 3P20A 1IDN1 3RCBA 2YWFA 1JXAA 4OB6A 1DAMA 4I0WB 2Z8YM 4A36A 7CATA 4ENRA 1O08A 1ZXBA 4DQXA 1DC5A 1MV8A 2TYSB 1M66A 4PLYA 1JHXA 1TADA 3TRJA 1ZSYA 4RZ2A 3TGPA 1YL6A 5JJBA 4YR9A 3A6ZA 1ZD3A 3PDJA 1FJGB 2ZB2A 4JELA 2PSHA 4RPJA 4AF6A 4N82A 1CZRA 3P9YA 1JIVA 4WZAB 2QL7A 1J25A 3G85A 3AF0A 3NT2A 3Q0IA 3HB0A 2RGEA 4QGBA 1CXZA 3U44B 2XX3A 4ZVSA 4GD3Q 4TMXA 3MJRA 3RRNA 2FE1A 4HQ0A 7GPBA 3UWDA 1WWKA 3R7BA 7ADHA 4MS3B 2ODQA 3FWPA 3DZJA 4D6PA 1N3BA 3F47A 3WVNA 2X3UA 3DE1X 4A6DA 1J6UA 4YAOA 1L2TA 4MJXA 5EWJA 4B46A 2VAXA 3H8WA 1WV0A 3CEAA 2CLKB 4BMSA 1VE3A 4ARUA 4PTYA 5SZKB 2PWYA 1A50B 1B76A 5DHSA 3RANA 1NVMB 2KHZA 4BO5A 4RADA 4MKZA 1MC1A 1HDXA 3BICA 5BURA 1R0BA 1YXMA 1WMBA 2IZ1A 2WBLC 2AFIA 5JU6A 2R48A 1BW9B 4X41A 2ATEA 3OY2A 4LN1A 3K0EA 5CXSA 2R3SA 3C70A 3OY7A 4NEHB 1PR4A 2JCBA 3HJFA 1NNEA 4QRIA 3CRNA 3TMYA 4QEKA 4PTLA 1H2FA 2ZRPA 3NKVA 1CR0A 4MQ5A 2ZUSA 4L50A 1KO1A 4US0R 4BLWA 4B83A 1XTQA 2IU6A 2QZZA 4PNZA 5A5EA 4DT1A 3ZX5A 2J5KA 1KDVA 1E6KA 3IELA 2R18A 4JI3M 4MTCA 3FUTA 2V4ZA 5AHWA 4IFEA 4R9SA 4R2JA 5H70A 4BRZA 3K1ZA 4NCBA 1NE7A 1DC3A 3EW9A 3A45A 4Q6BA 4ZZ3A 1MLDA 2ZBKB 4YPVA 1N4DA 2VQFM 4ZXFA 3ZHVA 4BVGA 2YN2A 3C3MA 5EZSA 1P1CA 2H5LA 1KMHB 4TSFD 2XWQA 3NHBA 4JI2M 5IXJA 2BI4A 3GT7A 1A8PA 3TPZA 4WRRA 5A7GA 4CKEB 2Z6VA 2VDJA 1XTUA 4PAWA 3EAQA 3WWZA 5AVWA 4G5RA 2Q8NA 5C1OA 5LNK6 2J3HA 2C07A 1T2UA 2NTNA 3KTFA 2NN3C 3IAFA 3LMMA 5FX2A 1JDSA 1X0VA 3IAUA 1LRJA 1E0AA 5DRTA 4GWLA 5I9IA 3VOBA 2EFEB 5LQSA 4IXTA 2P2YA 1PJZA 3KPJA 3LCRA 1YVRA 2YS7A 3C8MA 4RIEA 1GNVA 1NONA 1Y8RB 3LUGA 4PDGA 3VJRA 4DB4A 4LHSA 3WAJA 3FLAA 3WJ2A 2JJ8A 2XT6A 1E7QA 3CX4A 1A9XA 5CDFA 5FF9A 3SXJA 4EMBA 3WG9A 1QORA 3S55A 1JJ7A 4P4GA 4BX9A 2BGIA 4H15A 1PSWA 3IV7A 4HWOA 3AEUA 5HM6A 5AVKA 1SCUA 4JGGA 3WKCA 1PM5A 2G3QA 1K66A 1XEFA 1OGJA 2KQUA 5C1BA 3QVVA 2Y0TA 4WFJA 4MCJA 1IXKA 2Z83A 3QYJA 4F04A 3LGSA 3HY5A 1NXTA 4ZZIA 3L07A 2VJNA 1A9YA 2HSGA 3MCVA 1HR0M 3T1TA 2I7PA 2JLBA 5KJCA 1XMSA 1TDJA 3ODGA 4NE2A 1NVGA 3A4MA 2X41A 3NTQA 2P1ZA 2NPOA 4N7RA 4GW3A 4NAVA 4MYRA 4O4IA 4DIBA 4QPPA 4FUTA 2J07A 3LXRA 2QVBA 2JGDB 1KKMA 3KB8A 5AXDA 2YYYA 1DXQA 4TV9A 2F2TA 1U0RA 4ZI5A 1GAXA 1EX1A 1X1AA 2CLEB 4V02A 4LY9A 3MOIA 4YCDA 3HUUA 1JKJB 4U7PB 1Z7BA 4MS1B 3L02A 2CEKA 1YDHA 5C2JB 4CUJA 2P40A 2P1DA 2FEXA 4X24A 1NGSA 2HRDA 1KK2A 2Q3HA 2HADA 1Z5VA 1U2QA 4UAGA 4EG7A 1XU7A 521PA 2WKQA 4PG8A 3SVZA 1ADFA 5EZQA 1DADA 2XCLA 5FWYA 5DOZA 3A3YA 3HY3A 4QA9A 4RU1A 3WB9A 4PPYA 3RQIA 2XWBF 2MH8A 3VZRA 3AKYA 3AY7A 5KSOA 4D4JA 4MDHA 3O74A 1KSJA 3DFMA 2B4QA 1Y5MA 4D9JA 3LGAA 4RORA 4LOKA 2FDRA 3WSVA 7ABPA 1LBQA 1AGXA 2QJOA 2P5TA 1NP6A 1L7BA 5B36A 2R00A 5CRIA 1T2FA 1RWPA 1B16A 1QHIA 2SECE 4D46A 5F7JA 4CTJA 4J0GA 3S44A 2I34A 1XALA 5F2EA 1WSAA 4LRTA 4C30A 4LYFA 2BF4A 5HQ3B 3H4VA 3DG9A 4FR0A 2C95A 3CLTD 1YDEA 3EVTA 3GFOA 4QBHA 3S2YA 1TIBA 3IEXA 3BFXA 4XUCA 3OKPA 4U6QA 1HQCA 4JK3A 1G8YA 3WHLA 4MMZB 5EUQB 1Y42X 3R9XA 3UPDA 4G5FA 3LP6A 3STVA 1E5TA 2MSCB 2OOSA 2UZAA 3A3PA 3CYFA 3OJ0A 1DZIA 2WJPA 3FBTA 1YB7A 1R74A 3C43A 3DBLB 5BR1A 2PT9A 3BVPA 1ORTA 5BQOA 4HVLA 4MLPA 4C2BA 1A97A 4QYXA 2L7IA 1R64A 1RLIA 4JI4B 3U7QB 5EG5A 2H59A 3DO8A 3ETDA 4BPRA 1DE0A 4FT2A 4NH0A 1VEGA 3VBCA 3TECE 3CNQS 2IYNA 4J4BA 4YLYA 2DPMA 2XE6A 3LWDA 3FPEA 1UJ2A 3UC9A 2Y1GA 2YIVX 3CUEF 4ENTA 2XSZD 1LDGA 1ODTC 3HDHA 4Y6SA 1H22A 4M1OA 3H5LA 5B1SA 4LOIA 4J49A 3DBHB 2YWEA 3K0SA 4ZYXA 1RRPA 1II8B 2IT1A 2P78A 3CCFA 1XLVA 3A36A 2LH0A 1UINA 1K88A 2OLKA 4N5NA 4NI5A 2VJYA 4K9DA 3IBSA 5KVAA 2YHAA 7AT1A 3AINA 3FWKA 1IQPA 1JEYA 1Z2DA 3BA1A 1G0NA 5B1HA 2GK4A 2Q41A 3QY0A 3UVEA 3SC4A 5DM1A 2I4RA 1FX0B 3B1ZA 3K70D 1DQPA 2KNAA 3NAZA 1U2RA 1QGOA 1C1DA 4Z99A 3IIKA 1YZVA 1HYEA 4CJ6A 2ZJ6A 1DBIA 1T0BA 1ID8A 5EJCA 3ST7A 3EC2A 3G2OA 3R0XA 1WCV1 3DAHA 3Q7TA 1KJWA 4RESA 5DSZA 1Z8FA 1MO4A 3HXPA 4DLNA 4AFNA 4UNSA 1HG1A 2ESRA 1R50A 2QTRA 1TK3A 2XF2A 3ESRA 1CF4A 4BV3A 4M9QA 5CDFE 5HIMA 2XJ4A 1T13A 4BCDA 2Y6UA 4ZAXA 3H9UA 5FI5A 1DAPA 1BXRA 3HKEA 4S05A 1QYRA 1D5CA 1X94A 1K7FB 5JT1A 3P2IA 1LZKA 4NAUA 1U9CA 3FIUA 3C1TA 1FMFA 2QAGA 4GBGA 3M70A 3OIYA 3AJRA 1PV4A 1IB0A 4DCCA 2VJMA 3TLYA 3VC1A 1XHEA 3QA9A 4AJPA 4NXNB 3TZQA 1OWLA 1N1GA 1X74A 1M6WA 4CT4B 3UQYS 4UU1A 3EWAA 3SC2A 3OPXA 1RI3A 4OI1A 1OIXA 1IJFA 3AEKB 4IIUA 5FBRB 4ZHQF 4KIJA 3QOXA 4QXRA 4GO1A 1DTEA 5IFKA 4X7RA 1EFAA 3TS1A 1JHQA 2C0PA 3T7EA 2ETXA 2UUBB 2V8OA 4F5EA 4NCHA 3R6WA 4H17A 5FUXA 3P96A 2HFKA 4U7GA 4A26A 3STXA 3TDNA 2PD4A 5FTKA 2GVZC 1U5AA 2DQKA 5AD1A 3FPGA 1AA9A 2COKA 2NT3A 1VLLA 5J4YA 3I4LA 1SUPA 3DQQA 1C1KA 1P2UA 1B6GA 1U11A 1YT5A 2X49A 4X66B 3NTUA 2O14A 2WKPA 5AM4A 1F14A 2O50A 2AJCA 1L5OA 1YHYA 2AC7A 2R4QA 2VP6A 2R00C 2OCLA 4YQFA 3PJEA 1D04A 1UKEA 1U5CA 4OHPA 1FEZA 2Q46A 1A4UA 2R1VA 2F43B 5CX1A 2VYQA 5HRUA 1ORWA 1QSGA 4H59A 5CIWA 1SHKA 1T8WA 4GF5A 4WBXC 2QVXX 4E2ZA 5HS4A 4PAMA 4WK2B 3NR2A 3UCEA 5KC8A 4LZAA 2QLFA 3DMTA 3UAXA 1USKA 5JAOA 3M3PA 3HB4X 3MMNA 3IA2A 2CN1A 1UJ5A 1ML3A 2IFTA 5ILQA 4W5OA 2REBA 3F6CA 4YO7A 3L8CA 5LM3A 2VK4A 5FEMA 4LY0A 2R7LA 2ZTCA 1JF8A 3RU2A 1AQUA 4PC1A 4GXQA 2XKBA 2PUJA 2HPHA 2F5SA 3VU8A 1L2BA 1QJ4A 4IFTA 4F85A 2JJ2D 1EFDN 5AM3A 1QH1A 2HQRA 5JOQA 1E6UA 2PRKA 2E5LM 5H1YA 4I1RA 5JECA 1Z0JA 4FX2A 1XLTC 1KFCB 2KLHA 4BLVA 3ZHBA 4K86A 2AUMA 5JNRA 5ALNA 4HC4A 5FBHA 2G36A 4J4HA 4EBBA 3C3JA 4JJ7A 3IEVA 1YVUA 4Z4GA 1HE3A 1KY2A 1QDRA 2HLDD 2ZJ0A 5FWDA 2ZJAA 2HWKA 3X1YA 3HL4A 2ST1A 2QLNA 2VHXA 1G7RA 4H3KB 1WHCA 2O07A 4UBKA 4AZFA 4Y28F 3UMVA 4ALJA 3QEMB 2OHHA 3HZOA 4DC1A 3VH2A 1I3KA 4YK7A 1W35A 2R4UA 16PKA 2XNCA 1F8FA 5JC8A 3Q7SA 2BFOA 4WNIA 5LP1A 1R6VA 4BN4A 3ON5A 5T67A 4NCJA 3FOWA 4BGIA 5IZCA 3GJ6A 5FO0A 1B14A 3U60A 5J59A 1C1YA 1FFEA 3IHLA 4DUGA 1ZCAA 5EP4A 4B71A 2V7GA 2IELA 2CNLA 2IYZA 1ISHA 2J7OA 3T1OA 5DWVA 3BSSA 1MJNA 4ZHQB 5I7RA 1H2YA 3HRIA 4DMGA 4YJ2F 5A02A 2BEWB 2R1ZA 1X15A 5ALKA 4HLQA 1TEVA 3C74A 2RKOA 1QDLB 1OA0A 3O03A 4O1IA 2EX1A 4WFQA 3ZY6A 3FCUB 4QXAA 1ZZEA 5IK2A 3ZCTA 4GOKA 4Z0TA 2O1EA 3LRTA 3F3KA 1G42A 4ZGBA 3ZWQA 1JBKA 3M5WA 1R4MA 5EGSA 3OCUA 3GPUA 1PR0A 3ESCA 1UBLS 2JFQA 3NORA 4JSYA 4Q1EA 2W00A 4U3JA 5BXYA 4DC0A 1C8VB 5DT2A 4YCMA 1KE1A 3GD7A 2J33A 2BRUA 5AOCA 3O9MA 1MN3A 4BWFB 4MRPA 4Q7EA 3EVAA 5BQ5A 2QRUA 4TQ9A 4DV3M 3MXTA 3OCZA 4CISA 2GFQA 2YDXA 2B1JA 4D0GA 3OZBA 3DV0B 4GMFA 2ODPA 1YZHA 3EUAA 2NV2B 3SCZA 3CF6E 4IINA 2Q2EB 4P7FA 2H5IA 4RMJA 4GPZA 4V39A 3NT5A 5EAIA 2XTMA 1QE5A 5G1NA 2H63A 5J43A 2XUOA 2QU8A 3EFHA 4EO7A 4RD4A 4QJBA 3T4UA 2Z1MA 4W82A 4EJ6A 2EBHX 2XV1A 4YQYA 2ZRDA 4MZDA 1KXJA 4Y2XA 3M6WA 3A9VA 1FNSA 1AKUA 3I04M 1SCDA 2C7VA 3D2BA 2O8BA 1ZJYA 1YZTA 1TMGE 3MTQA 2XB8A 3CMCO 1OF1A 2I2CA 3K2IA 4J0DA 5HQJA 3DMTC 2CUNA 3Q40A 4PRLA 3QWHA 4EVIA 1TUIA 4UASA 2J32A 2JFGA 4CDNA 5MN5A 5K2OA 3FJ1A 4KN8A 1LB1B 4GS5A 1ZS9A 4QBKA 1XEWY 3ZEIA 4CUZA 3TE6A 3WL7A 2WAXA 1XB2A 3NETA 2ZP1A 3BDIA 2F8TA 1PJ4A 3T41A 4NV3A 1BDHA 2Y1WA 1NDUA 4BATA 3I0MA 4ME6A 1P7ZA 4ZU1X 4DQ0A 3NP9A 3KUKA 1GR0A 1K3UB 2WIDA 3V1UA 3Q0TA 1ZISA 2FHSA 2PUAA 3IH5A 3D3KA 3D6AA 4FW8A 4EHJA 4MDYA 3CX3A 1GCAA 3OIDA 3N74A 3UT5B 4B17A 1SO8A 4K9MA 4X62B 2VQ3A 1ZNWA 2BP7A 4OVKA 1M2JA