4W5WA

Rubisco activase from arabidopsis thaliana
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
269
Chain Sequence
NLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMAKMGINPIMMSAGPAKLIRQRYREAADLIKKGKMCCLFINDLTTQYTVNNQMVNATLMNIADNKEENARVPIICTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase, chloro
publication title Structure of Arabidopsis thaliana Rubisco activase
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 81
structure length 269
sequence length 298
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4w5wA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w5wA01
1OFTA 4Q1CA 5F9FA 4JYBA 3D31A 5JBQA 3HR8A 2QQ0A 2YC2C 1N5LA 2FMXA 1XPRA 4HB4A 2BMJA 3NVAA 2VHTA 2ZUBA 2IXGA 4OQNA 1W48A 1JNYA 2Z83A 3E2IA 4TT3A 4Q21A 5TMPA 3DEFA 2HUPA 2JLVA 1L4YA 2ZE6A 3MWJA 2EFCB 1COWA 2RHMA 1HURA 1P3JA 2OLJA 4NZYA 5EQTA 3T5GA 4M1SA 4KVAA 4C3ZA 3U7EB 5TXGA 3K53A 3EAQA 2F7SA 5EZ6B 1YHNA 2YKGA 4KV9A 1KGDA 5EXPA 2ECKA 1OLOA 1IJEA 2YWFA 4U02A 1DELA 1Q20A 4NCJA 3RYTC 1AN0A 1NIPA 3PR1A 3PUYA 4Q1FA 4R2IA 4GNKA 1FMLA 4AWXA 1GRNA 1N6RA 5CLLA 2XZOA 1E0KA 5B58C 4EQ6A 1VECA 3W6OA 1SKQA 4F38A 3GLHA 4TN1A 3W8RA 4TT3D 3QPWA 4BZQA 3UPUA 2XSZA 3R8CA 1KKMA 2QU8A 3AGPA 2QAGC 4FINA 3REFA 2GILA 4PAMA 3HU3A 3IIMA 1YU9A 2XAUA 2HEIA 4NYJR 2V1UA 3VR3A 4HAWA 4RZ2A 1E9SA 1P72A 1WE2A 1W36C 4O25A 3KQNA 3ADBA 2P6NA 1Z6YA 4YDSA 2ONJA 3T1OA 2WBLC 2PZGA 2FU5C 1TUIA 1DG3A 2ZRGA 3ADKA 5BYKA 4MRSA 1OF1A 2FFAA 2H57A 4ZDWA 4ZCIA 4URXR 3QKTA 4ACBA 1XZQA 1UKVY 2O8FA 2WIBA 3LRPA 2GEDA 5HZKA 1Z0JA 2XZLA 2Z0MA 1AK2A 3TIFA 3PUXA 4NYJQ 1PUIA 4M1OA 4BFUA 4M8NE 2EFHB 1OYYA 1PJRA 2FGKA 3OEEA 4JLDA 1E9AA 2J0UA 2G3YA 3TUZC 3B1WA 4RD4A 5E7JA 1OB5A 2XSZD 5AWFC 1U8AA 5DHAA 1OH6A 3EZ7A 1NJGA 2RGNA 1NY6A 4BWYA 4Q02A 1KY2A 2KSQA 1NN3A 3MWLA 5BW8A 2VHCA 3P4YA 4MITA 1YRAA 1LS1A 3FHCB 3PENA 4KFTA 3G0HA 2QMEA 4QJ5A 2IUTA 2HYIC 2JLZA 1UEJA 2DFNA 4Q7KA 4PHTA 1VPLA 1NIJA 4OI1A 4BUJA 5KHOC 3EIHA 5P21A 3U4QB 4WZ6A 2QN6A 2VSOA 2ZAMA 1ZD1A 4B3XA 3THGA 2QQEA 2F9MA 1DEKA 3H4MA 2PCLA 3QNUA 1CULC 1GUAA 1XB2A 2RH5A 4PXAA 2VP0A 3OEED 4JLNA 5LB4A 5AUNB 5JZVA 1QG4A 1Z6AA 2MMCA 3THXB 1OJLA 4B3CA 1K8RA 1U90A 1E32A 5C46F 1MRNA 3P20A 5LB2A 2J7PA 5DHFA 1T0HB 5HTKA 3FFBA 2FV8A 4BLRA 3QBVA 1HT1E 2P6UA 5FPHA 621PA 3RANA 1CU1A 2FN4A 1W7AA 3H0KA 2VP5A 1XD8A 3GLGE 1J99A 1US8B 4G5OA 1AGRA 1NLZA 4RD2A 5AUQA 4JYCA 2SHKA 2OBNA 1J7KA 5AUPB 4I1UA 1TX4B 3I61A 3BB3A 3CKLA 1RRGA 3O8DA 3DOEA 2JDIA 4CRWB 2ATXA 3C8UA 2E1RA 4L8GA 4URVR 1WMSA 1XRJA 1Z83A 8OHMA 4IXMA 1TTTA 2VL7A 1R4AA 2QPAA 4BLPA 5JHGB 1GVNB 2XXAA 2MMGA 3W6PA 2YINC 2O8DA 4DSTA 5TV2A 1LFDB 1U0HC 3RS0A 1II8B 5C1BA 4RCYA 2GVDC 2ZRFA 1DOAA 4DDUA 5EZ5A 2YNMA 5A5GA 4CVNA 2RGCA 4CYMA 4MRRA 1Z0AA 3AH8A 3RSOA 3DZDA 2OFOA 1F2UA 5KDLA 4P4TA 1O87A 3RC8A 1QF9A 4OK6A 2QSZA 1BIFA 1AZSC 3IGFA 4HDQB 2IEZA 4GOJA 3SFVA 1KKLA 1Z28A 4RJLA 4L4UA 3U44B 3LBNA 4TMZA 4O2RA 5DYGA 2VA8A 1TF7A 3CR7A 3EASA 4LBZA 2CK3D 2GJ9A 1VMAA 3EWSA 1RC8A 4NU0A 2ANBA 1GRQA 2J46A 2ZI3A 1I4LD 1T5LA 2IL1A 2JDID 3AVPA 3VU9B 2BBOA 4S35A 5F3WB 4FIDA 4GT1A 2GXQA 2IS4A 2ZAOA 4W5JA 4B73A 5FTKA 5B64A 3ASZA 1F2TB 3ZJYA 2I3BA 1UKEA 1L8QA 3GQBA 1YZLA 2MSDB 4AIIA 4B2IA 4P0TA 3FHTA 1UAAA 2YV5A 3O8BA 1ZCBA 2GF9A 1VTKA 1Q1BA 5JS8A 5JFGA 3THYB 2V9PA 2BBSA 4FMCF 3IKJA 3R9IA 4HLUC 4B3GA 4XSHA 3QXSA 5L3QA 1G8FA 2AR7A 4RD3A 3CIOA 3CF2A 4PPNA 2ZXUA 1M6NA 2G9NA 1NG9A 4LJ7A 4ZIRB 3TKLA 4V0MA 1OB2A 5CK4A 3QY0A 1FX0B 3BK7A 5BN5A 2DCUA 4POAA 2GZAA 4DT1A 1OFIA 2BMFA 5IHPA 4BQSA 1Y63A 3IDQA 4PPQA 1X8KA 4IFEA 4L9SA 3ICQB 3VQTA 1WBBA 4DLRA 1GKUB 3IO3A 4EKDA 2A5FA 3LVQE 1M1YE 1GKYA 1W5TA 2DWQA 3LQRA 4G5RA 4QG7A 1II9A 4V0OA 3ASYA 5DIFA 2OLKA 1IXRC 1ZINA 4AURA 4GZMA 1Z8FA 3DHWC 2IEYA 5GVSA 4LPSA 4YMUA 5KPDA 4RFSA 1G7CA 3SYLA 2A2ZA 1ZM2A 2TMKA 4DLVA 3RWMB 4BZPA 2F43A 3BRWD 1JI0A 2GZHA 5FL3A 2A30A 4JL8A 4EQ6B 3I8SA 3HR7A 3L82B 4F92B 3NWJA 1CR0A 3GLHB 1NVVR 2HCJB 1EX7A 1QBKC 4M22A 4CW7A 4IFBA 3ADDA 1VCIA 1GP2A 4ZKEA 1R2QA 3UKDA 2IBMA 3B85A 4B3DA 5DO9A 4XD7A 2ZRJA 2G88A 3L0IB 2ZI4A 2P5TB 5C4MA 4HLCA 3L8YA 3OFNA 1BH2A 1JEDA 1ZNWA 1IAQA 4CEIA 2O8FB 3N2IA 1NVVQ 3CUEF 2FH5B 1YQTA 5FPSA 3SYNA 1ZW6A 2IX3A 4UNQA 2D2FA 2VP6A 5JRZA 2FSHA 1VG9B 2XNDA 3AVUA 1ZNZA 2GJ8A 1J70A 3UG6A 2WWHA 3V4FA 2IWRA 2J0UB 3GCGA 4BFWA 1CIPA 2HLDD 3AVQA 4MGZR 3T1TA 1CRQA 3LXXA 4C0BA 4MKFA 3VFDA 1MABA 2F6RA 3QE0A 1T3HA 2JLWA 2MSCB 4LV6A 4LHXA 4XD7D 2NIPA 4A8JA 1IN5A 4HUQA 1A2BA 3CRW1 2R6FA 3LD9A 2I4IA 4PC7A 4WXPA 4EPWA 5HR5A 4URYR 4EPYA 1E99A 3TRFA 2F55A 3IQWA 2CHGA 4R2HA 3NKVA 1SULA 2H18A 1II0A 1E6CA 5LD2B 3IILA 4AI6A 3RDPA 3SJCA 1XP8A 2ZI7A 2ZRLA 2G77B 4NONA 1CRPA 2R44A 1D6JA 2E87A 5FFMA 3WMGA 3CWQA 1XPOA 5BN4A 4HI0E 2JIZA 5DI9A 2ZS7A 1KI4A 2ZRPA 2JJ1A 1FTNA 3SS8A 1OFHA 2YVUA 1P61B 3EPJA 1OYWA 2WKQA 3LW7A 4H1UA 4NP6A 4TQ9A 4WVFA 4DWJA 4PZZA 1P2UA 1GSIA 2VO1A 3K70C 1P7CA 4PC2A 1FOEB 1DAEA 1W4AA 1TEVA 4M4SA 2N42A 3QPUA 3A1VA 1E9EA 1QVRA 3B2EA 2D4HA 4HDCA 3R9WA 4UJ5A 3RRZA 3DM5A 3IBGA 3I8XA 5FL7D 4GP6A 3RS4A 2ZE5A 2NG1A 4MRVA 3R20A 2WJHA 3B13B 4PAQA 3T06B 4DLSA 4RD6A 1TF2A 1JXOA 5FOVA 1P2VA 1NG1A 1AQUA 5SZJA 1F60A 4Q4AA 4XOIA 4M1KA 4D81A 2XXAB 4WA7A 2O8DB 1QHYA 4IDQA 1G21E 1LW7A 4MGKR 2IYUA 3ZYCA 4XWKA 4M9XA 3ZVLA 2WJGA 5EE5B 4DLZA 4Z8YA 1SKYB 3W8NA 1F2UB 4XWOA 3B7GA 3TGPA 4LV8B 2O8CA 4AKEA 3FKQA 2KBEA 2VRWA 4JIMA 1E9BA 3I4LA 2OXRA 5F2EA 1RZ3A 4E03A 2R8RA 2HT1A 5L3VA 4DDTA 4XIGS 1LS6A 2W2TA 1JBKA 5AJWA 1ZRHA 4B3FX 2WICA 1OHHD 5JJLA 3EX7C 1I4DD 1DARA 1ZIOA 3RRMA 3W5JA 4IRUB 2Q6TA 2VHJA 4KLZA 3OIUA 3TR5A 3AM1A 4JLAA 1QZXA 4A0HA 3R8FA 1F3OA 4Q5IA 3WYAA 5BN3A 2QNRA 1NJFA 2BM0A 5JWRA 1WCV1 1JAHA 1XEWY 2RGAA 1KJWA 3NTUA 5TARA 4LJ8A 2AD5A 1ZM4A 2J0SA 2V7QA 2UZ3A 3MUFA 2JJ2D 3BOSA 4JVLA 4DC9A 2HJVA 1W2HA 3NBYC 4TQUS 5L3QB 2R6AA 2W0SA 4IW3B 3TLXA 2FFQA 3AF1A 1DAMA 1G5TA 2VF8A 1BYUA 4PC1A 5KYKA 3R7WA 4RY2A 1E0SA 2IYSA 4GI7A 1W1WA 1JPJA 1KOFA 3BAFA 3Q7QA 2E9SA 1E4YA 1A82A 4ZI3A 2WHXA 1DG1G 3HP1A 3IHWA 2WZQA 1ZUIA 3M4YA 4DT1B 3EC1A 3EZ9A 1KK3A 1G3UA 4YXWA 4JS0A 3FMOB 4XTRA 4AG5A 1N0UA 3EZ2A 2ORIA 4P32A 4U5XA 3SJZA 4W5WA 4IVRA 2WSSD 1T0JB 2ZRMA 2AL7A 1OKKA 3VR1A 3SJBA 1XTIA 2RGNC 1G8GA 4TTQA 1ELOA 4LBYA 4UXIA 3V9PA 4D4JA 3I92A 1KO1A 1UADA 3SBDA 3FYHA 1KYIA 5C4GB 4A92A 2V7QD 2EW1A 4HB0A 4H9GA 1UM8A 2W6JA 4OI0A 2RGXA 1G7SA 3P27A 4RFSB 2O0KA 5LD2C 1DS6A 3DPUA 4X8HA 1EFRA 1JJVA 3VTKA 3BB1A 3T35A 5E7MA 1T9HA 4PC6A 1CLUA 1GAJA 2KB0A 4A2WA 4GDFA 1PLKA 4ITRC 4DBLC 2OCAA 1YZNA 2ZM5A 5J4LA 4Q4JA 3A4LA 1XD2A 1NSFA 2MSEB 2RGBA 3K9GA 2ZRHA 1KMHA 4X8LA 4Q4HA 5ANRB 3THOA 4DLYA 1XNJA 1Z6GA 3GLFA 1QHNA 3KXIA 1Q21A 1X1RA 3C7KA 3IPYA 1N0WA 2OM2A 1XXHA 5FPYA 1QHIA 2R6DA 1CTQA 1GL6A 1P2SA 3C5CA 3RVBA 4UNRA 4YMVA 3T61A 3SE0A 1YR9A 2B21A 3AB3A 4DCSA 2FFBA 1NBMA 4HYYA 4PSAA 4CEIB 1QHHA 3OIYA 4RVCA 2W6JD 4MYTA 1P2TA 3K0FA 4HAUA 1KI1A 4KO8A 4M2LA 5LBIA 1MO6A 1Z0KA 4ZV4A 4F93B 2YOGA 2QGZA 5CIQA 2IA5A 3AP3A 2Q9BA 1JAIA 4RSGA 2QI9C 3MWKA 2UVQA 1VYTA 5G40A 4GL2A 1EWQA 3QBTA 1V43A 2BVNA 4NCHA 5DN6D 4K46A 4ZKDA 3KKPA 1MABB 3ZVMA 2IW3A 1N6HA 2RKOA 1CF4A 2ZQ5A 1E9RA 1IN4A 2FSFA 2P3SA 1FL9A 3QKRA 2VSXA 1Z06A 4M53A 4A8JB 2GETA 2Z43A 4HUQB 2IS6A 5B2ZA 3G82C 1Q1QA 4B33A 1IJFA 2D7CA 2FX3A 2ZJ2A 1KI9A 1Z6TA 4NH0A 4QNRA 2LKCA 4XWAA 1A2KC 2F1IA 1OT3A 5JWOA 1TU3A 4IOJA 5GJWC 3N5CA 2O0HA 3L0SA 3PUZA 4F91B 2ZI6A 1FPMA 3VAAA 2QPTA 1TAGA 3NBXX 4JBWA 1KAOA 2KJQA 3ZQJA 5IK2D 3VKHA 4LHVA 5JLJA 1J90A 1G8PA 1KI6A 1FW6A 3PUVA 2OCPA 1UEIA 1OFUX 2GHIA 4LBVA 3CH5A 1R10A 5J47A 1KSFX 3SN6A 1JR3E 1ZCAA 2XEXA 1G291 3GJ4A 4KLNA 3M1IA 1WXQA 3CNNA 4C0JA 4MUAA 3AVYA 1DO0A 2GXSA 2QZ4A 1R8QA 1JALA 2EFDB 2HT6A 3FTQA 4MYUA 5TVKA 1I2DA 4MRPA 3LFUA 2VLIA 5FTJA 4M21A 3WHKA 2JLSA 1DADA 2HXSA 4CDGA 2DWOA 4ZIRA 3GPLA 2IYXA 3FVQA 2WMNB 1FX0A 3ZH9B 1W4CA 1M7HA 2D74A 2ZVQX 3ETLA 4EJSC 4RD1A 1XEXB 4JLVA 1XPUA 1MOZA 2AX4A 2O8BA 4Q9IA 2JJ8A 3ZZUA 2JGNA 2OCYC 4KBFA 1KZGB 3PFIA 3CLVA 4W7SA 4XSGA 1S1CA 2C96A 4TLDA 3EWAA 1FNNA 4Q4AB 4ZPXA 4EFMA 4L15A 3QIAA 4OQXA 3MAAC 4N0DA 4TYPA 5FBVB 3FMFA 2AXNA 1R0XA 4OHXA 3WNBA 2HV8A 3NIBA 4BLQA 1TUEA 2WM9B 3K0AA 1LY1A 4MQBA 2ZANA 5AJXA 2X2EA 2FEMA 1GDDA 1SZPA 1X86B 1SXJC 2VYFA 4L5BA 2O8CB 821PA 3ZD7A 1UBGA 2PX0A 3L2OB 4DSOA 1P9WA 1UJ2A 4LUCA 4DLWA 4DUGD 2QMHA 2AWOA 3AVWA 4M1MA 4BRUA 2CCJA 2ZUCA 2Z4RA 2OT3B 1OXSC 1G18A 1TEXA 3O8CA 1KO7A 1SVMA 1P9NA 2JLRA 2Q3FA 4LDJA 1OH5A 4LV5B 3AF0A 3X1ZA 1U0LA 1VG8A 3TR0A 4WIAA 1BYIA 1HE1C 2IXEA 2D06A 2OAQ1 1D2MA 4B2PA 5KNCA 2HYDA 1M74A 2IS1A 2VH5R 2V1XA 3ZS9A 1G64A 1HUQA 2OFXA 1NN1A 3K0CA 1P5ZB 1ZM7A 3PEVA 3VX4A 1EG7A 4EFNA 4Q01A 1ZNXA 5J4KA 2GJSA 4I99A 3MJRA 4B75A 4GMXA 2ZRAA 1GM5A 2EVWX 3CX8A 2QAJA 3OEHD 2IS2A 3B9QA 5CYOA 4N3NA 1E2EA 3GEHA 1AJEA 3KL4A 4PX9A 3AKDA 3TUIC 4ZDJA 4URWR 3OIVA 2CL0X 2QTVB 3U7FB 1KDOA 3R7WB 4EPTA 1MV5A 3KXLA 1BO6A 3FMIA 1FZQA 3L43A 5FI0B 1NKTA 1XFAA 5EP3A 2ZYVX 1RFLA 2B7BA 1E2MA 1XMSA 3CONA 1W49A 2FSIA 3RHFA 4BEJA 3CRQA 4FN5A 4GOKA 1PV4A 1W46A 5KUTA 2H5EA 3QJYA 5B57C 1OSNA 2YC4C 4MDFA 2ZJ8A 4JLKA 1YE8A 2OBMA 3TSZA 2BC9A 3BBPA 3B60A 4JZKA 1E96A 4GZLA 3GD7A 4TMKA 2QY9A 1KI8A 1FUUA 4MUBA 2PLRA 1WRBA 3U3JA 1E9DA 1UDWA 2V4ZA 3OE7D 1DAFA 4EPRA 4D4MA 1WDTA 1JR3D 5EE3A 1G1MA 4OI4A 1Q3TA 4QRHA 1TADA 4O3MA 2W2VA 1N2CE 1J2JA 3TSWA 2ZI5A 3I3SR 5TDHA 2ZRIA 4Q4JB 1GKIA 2EYQA 1I4TD 3LA6A 2IYLD 1XD2B 4TTPA 5GADl 2ZUDA 4LJYA 4CF7A 4URZR 4OYHA 1KMHB 2QEQA 1G8YA 2CHQA 3IPXA 2DYKA 4Q4HB 3C14C 1U99A 3NBFA 5HCIA 4TL9A 1MR3F 4HZUB 1ZU5A 2G83A 3GLFB 1DO2A 2FE4A 3LX8A 1XCGB 1ZYUA 2IYTA 1XXHB 4HSEA 2CK3A 3MLEA 2O5VA 1XTRA 1RKBA 4I81A 5JSZB 3F5FA 1Z22A 3RRYA 1KI7A 1G3QA 2D62A 2Y8EA 4LC0A 1HTWA 1KK0A 3SU8A 4DEYA 1EK0A 5AK0A 1QHHB 3TMKA 2W58A 3K0FB 3MD0A 1YZQA 1G3MA 1E2PA 4DIEA 3BE4A 3A8TA 4D0LB 1N5KA 5CB6A 2FJUA 2DFTA 4C0LA 3Q9LA 1ZC3A 2GEVA 2BMEA 4TLAA 2ZJ5A 2GAAA 2ZI9A 3DL0A 5IDVA 2EWVA 4OJKA 3A1SA 3SDZA 4B74A 5FUWA 5E3HA 1N5IA 2DBYA 4JVSB 1U8YA 4JLOA 2QP3A 2CL6X 2OSBA 4HZIA 1ETUA 3L0OA 5HKKD 2ZE7A 3KKMA 4P31A 4BFXA 1SXJE 3QKRB 3ICEA 3D6TB 3HYTA 1G4AE 1B0UA 1UBFA 3W90A 3IO5A 2CEAA 3IEVA 5J4YA 1AS3A 1BS1A 1GILA 2QM8A 3M0EA 4HLQB 4HB3A 2EWWA 4KFSA 1Q1EA 1ZUNB 2VTKA 1FMJA 1CR1A 1CJTC 1NLFA 3EC2A 3TBKA 2CJWB 1NY5A 4PO8A 3MMPA 2WAXA 5JCPA 2NO6A 3S1AA 1MT0A 2ERXA 4CT4B 1NMYA 3FFAA 3NC0C 4UNSA 4ZO4A 4LWZA 2V6JA 5DYIA 1A7JA 1ZD9A 1JPNA 5LPNA 2WMOB 3AKEA 1E2LA 1PLJA 3ZLJA 1QHGA 1ESNA 1KI6B 3B1ZA 3B78A 2XJ4A 4YQFA 1Z2CA 5FTMA 2GRJA 3HDTA 3KUCA 3SR0A 4LJ9A 5D3MA 4TMVA 3AVXA 2WWGA 2Q21A 4P4UA 4LJ6A 4F7WA 3LBHA 4Z51A 4E07A 1Q1ZA 1E2DA 4RCZA 1JR6A 3T5DA 2J7KA 3OESA 4LJ4A 1KTVA 1S8FA 4AD8A 1E2IA 1ZBDA 4ASUA 1WF3A 4KXFB 1N6NA 1R5BA 3AVOA 3VR5A 2C77A 2GBLC 3IIKA 3LWNA 1N6PA 4LYJA 1XBTA 3REGA 4ZDKA 1HT2E 2O8BB 3I5YA 4IDHA 4Q9KA 1D2NA 5H1YA 3MSXA 1W2GA 1BOFA 1DAHA 4DLTA 1SVWA 2ZE8A 3TVDA 4M9ZA 2ZVPX 1TU4A 3H2YA 4QBFA 1LVGA 4PZLA 2G1KA 2GA8A 1AZTA 2WJJA 1DTSA 1XTKA 3IQXA 4MRNA 4YONB 1LB1B 4FMDB 4BLOA 2NOAA 5EP4A 4A9AA 3K0AB 1KMQA 5FBRB 1VYVA 3JVVA 4C0SA 4QKQA 2JLXA 2IYZA 1VHTA 5CITA 4N1AA 5AUOB 2Z6VA 3QEOA 4IOLA 3U3KA 1G9XA 2FG5A 1IBRA 4Z1MA 3WMFA 5K8TA 1GFIA 3PVSA 1G5RA 2H92A 3P32A 3E1SA 2GK7A 4TL8A 4ASUD 4C7OB 2BEJA 1OV4A 1VDZA 1H8HD 3U5ZB 1MKYA 1GZSA 3TK1A 1T8TA 3QPVA 1KO5A 3LW8A 2HLDA 1LV7A 1HQYE 2PX3A 4XH9B 3K09C 3ADCA 2HF8A 3JZMA 4B47A 2WOJA 4BFSA 3GFPA 4JSTA 2OFWA 4G01B 5EE1A 1KI2A 2R9VA 3DMDA 2ZRBA 4G1UC 5E7IA 1TQ2A 4GFDA 2J9RA 1RRFA 2QAGA 4JLPA 4GSYA 4LYHA 2PZEA 1W44A 4LGMA 3ZGXA 5EUQB 2ZTSA 5JECA 1G19A 4AC9A 2BBWA 1N6LA 3OIWA 2GJAA 1GNPA 3HU1A 4Z1MD 4DSNA 3LLMA 3QKUA 3EW9A 4CEHB 1JJ7A 2WIAA 2ZSDA 4NBSA 3EIEA 3THWA 2EYUA 3AKYA 2QM7A 3AKCA 4PQFA 1T3LA 2IC5A 3CNOA 2ZSBA 4JBYA 4US2R 3ONWA 1K5GA 2I1QA 4LX0A 4YMWA 1OXUA 5J40A 2RGDA 4TSFA 4TMTA 2J3EA 4W5HA 5EXSA 2D3WA 1Q44A 4S2EA 2PT7A 2XB4A 2IF0A 4PTLA 4K8OA 4A0FA 3B82A 5FL7A 2ZYUX 3WYFA 1G8HA 4FCWA 4KSCA 3ZVRA 2QROA 2IK8A 1CBUA 2REBA 3UMSA 4D2IA 4TMXA 1W36D 1G16A 4B71A 3RAPR 3TNFA 5EXXA 1DBSA 1P75A 4MA4A 1OXVA 2QT0A 1GRRA 2AK2A 2A3RA 1OE0A 3U6KA 1RJ9A 1NF3A 3EXAA 5FOUA 2ZR9A 3AQ4A 2VEDA 2GAOA 1E94E 4Q7JB 4QHSA 2D2EA 1TMKA 2G6BA 5A0FA 5IRCD 1OH8A 2ASEA 1CJVC 1J8YF 3RS2A 3X1XA 2ZITA 4HEJA 4AG6A 4BZXA 1JXMA 5CDFE 1X6VA 4NMMA 1D2EA 5JJKA 4TSFD 4C9BA 3WXMA 3CPHA 4DZZA 1Z07A 2YWHA 4DLUA 3KQHA 4FCTA 4ON9A 3T34A 1J8MF 3I1FA 3KJIA 5KPJA 1KO8A 3WBJA 1P6XA 4MYHA 3RABA 5J4VA 1XEXA 2Q9CA 3DMNA 2CVFA 1GNRA 4AKGA 3LDAA 3CM0A 3LLUA 1XZPA 1Z29A 2C04A 1TPZA 4BFZA 1OHHA 2BV3A 2P5SA 4HAZA 1G7RA 1ZP6A 1G6OA 2B92A 4PHFA 3EIQA 2QT1A 1XWIA 4US0R 3LX5A 2RGGA 3CF6R 5SZKB 2A5GA 4MKHA 2ZRDA 2C9CA 2YOHA 1MO4A 3L0PA 4J0QA 4BPBA 1NN5A 1NRJB 1E2FA 5FH9A 4B34A 4C30A 2WV9A 3DDCA 3GJ8A 1AS0A 1FQKA 3K9HA 3SHWA 2QA5A 2JJ2A 3SOPA 1XJCA 4OK3A 4HATA 2IF2A 3MRSA 4QJ3A 3UANA 3UATA 3SQXA 3HPQA 5FI1B 4OHYA 2G0TA 5EUMA 2ODBA 1VKJA 1KAGA 3LH5A 2WKRA 4RZXA 1ZUHA 2VBCA 3QXCA 1G17A 4HB2A 1KJYA 4V0NA 5H68A 3RS5A 2QRZA 421PA 5FR1A 4DB2A 3VKWA 5KTYA 4BFYA 2F3TA 2W0MA 1Z6XA 5TY0A 2NZJA 3EPLA 3S1AB 3FMPB 2N1BA 3SJAA 521PA 3QG5A 2PMKA 2YWEA 2F3RA 2O8EA 3Q3JB 3AF4A 1VIAA 1WB9A 4R71A 2WSSA 5L3RA 4GOXA 1A1VA 4AK9A 5F98A 2CLCX 1XJQA 2BJVA 4BGDA 4Q66C 1T3SA 4II7A 1LF0A 1H8ED 2A7QA 5KDDA 1AS2A 5D3MB 4YC7A 2EFGA 1L2TA 4RKEA 2J0QA 3W5IA 2WWFA 2PJRA 3HYRA 3K0CC 2XX3A 4MGIR 4KSBA 2A78A 4X8MA 3T12A 1XDBA 2QTHA 4A2QA 1DAKA 2QENA 3PIRA 1Y3AA 3BFVA 3NHAA 3WP1B 2REOA 4HLUA 1OIWA 3C5HA 4E5UA 2IWHA 1W5SA 4E22A 4R9UC 4Q9LA 1KDTA 4DRZA 2Q9AA 3ECCA 4IKEA 4QJ4A 1AA9A 3OF5A 3EZ6A 2GNOA 5FUXA 3UMFA 3EPKA 4A15A 1S4QA 221PA 4EDHA 4B43A 3GLGB 3HPRA 5FR2A 5SZHB 1Z63A 2DY1A 2NGRA 3EA0A 4MGYR 5AJZA 3EARA 2B8TA 2FPLA 4B2LA 2C98A 2VHUA 1ZD8A 2A5DA 4WBSA 4G0NA 1S1MA 3FB4A 3LAWA 3W3AA 1U0JA 5DI3A 2DHRA 3NHBA 2C78A 1F48A 1NMZA 2X8AA 4FMBB 3IUYA 4BECA 1NI3A 3QUSA 2FF7A 5K8UA 3OAAD 4QGGA 1ZAKA 3TJZA 4NHOA 1EGAA 2W2XA 1YKSA 1T6NA 2QORA 5L8VA 1NLYA 3QXXA 4E09A 3RLFA 3B9PA 1K5DA 1ZC4A 1QRAA 3KJGA 4M1YA 4I1SA 4W9MC 1PZNA 4NCNA 2F1RA 4NTZA 3O8RA 1P73A 1R7RA 2WVJA 1VG0B 4QL3A 4NE2A 3JZAA 2FWRA 2FPKA 3QI2A 4TLEA 4Q7LA 4B6EA 4B32A 3RRNA 4EFLA 5DLQC 4RFVA 1GG2A 3CRVA 2C95A 4M0LA 4QGFA 5DN6A 2W6IA 3NG1A 4FWTA 5CM9C 2KBFA 4V03A 3CF0A 4A6XA 1HY3A 1R6BX 1GL9B 3W6NA 4HZUA 5KSPA 4GPTA 1WP9A 2AN9A 2Z5FA 1CXZA 2J5XA 2HDNB 4C0QC 2VF7A 5JSZA 2QAGB 5CM8B 1UKZA 4N0EA 2FZ4A 3FKSA 2AFIE 1W36B 5K8LA 2H16A 4LHYA 4C4PA 2QSYA 4BLTA 4UXHA 5SZIA 4KFUA 1W0KA 3FGNA 5EXTA 2QP9X 5EE9A 2WJYA 1N0VC 2X1VA 3C15C 3BS4A 1DVRA 3ND9A 2IYVA 2WTUA 2C8VA 5IK2A 3GMTA 3TW4A 4Y0VA 1F6BA 1QHXA 2ZJAA 3THWB 1NVWQ 3QENA 1Z5ZA 1R5NA 4Q00A 4O0MA 3BXZA 2W6ID 2GXUA 3KZ1E 4CGZA 1W47A 3CO5A 3SC3A 3WRYC 2AWNA 4TZ6A 4JL6A 4IEIA 4EUNA 1TQ6A 3Q8XB 4O2LA 2H8KA 1IQPA 1D9XA 2IYQA 3A1UA 1AKEA 3V00A 4DVGA 5JMTA 3GP8A 2ZETA 3X1YA 2RMKA 4IXNA 5BWMA 3MJHA 1Z0IA 5C18A 2ZU6A 3VNVA 4LC1A 3X1WA 1HQCA 2GDJA 3A6PC 1W4RA 4Y0AA 1GOTA 3T1QA 2KE5A 3FKSD 2CJWA 4ZCLA 2ZROA 1YVDA 3AVTA 2NO9A 3HJNA 2Q0HA 3LV8A 2VQSA 4KBGA 1U9IA 1W0KD 1CR4A 5FPKA 2GESA 4JJKA 3LO5A 1T8UA 1CKEA 3GJ3A 4D4LA 3GLIA 1RJ9B 2K5UA 3TQFA 5JEEA 4I1VA 4FMCB 1OXXK 1Q0UA 2ATVA 3PITA 1OPXA 3GLHE 4D0NA 1UKYA 1VHLA 1ONBA 2A9KA 3LBIA 4PSKA 1YR7A 2OE2A 4QHTA 5BQ5A 4GP7A 2OG2A 1XMIA 4KYIB 4CT5A 2O0JA 2AHOA 4XJXA 3KFXA 4A2PA 1XCMA 2IUSA 2QGNA 3LXRA 1M34E 2B7CA 1HA3A 2CVHA 2GKSA 4JKIA 2JLQA 1SVIA 4OHVA 1EESA 4YMSA 3H1TA 2PJZA 1E2JA 1UPTA 4DUGA 3H84A 1E2NA 1S96A 3KJEA 5HE9A 1U81A 3ZQ6A 2X19A 3IHLA 4Q1BA 4Q4LA 2V8OA 1F5NA 3U60B 1XD9A 1XMVA 5KU1A 3IEUA 1RE0A 3FE2A 3GJ5A 3SHFA 3QVUA 2VP2A 1KDPA 4ARZA 5F9HA 4PQRA 3PEUA 1R0WA 1Z0FA 1KSGA 1QDEA 2ZRNA 1O3YA 1M8PA 2CDNA 4NPHA 6Q21A 2IHYA 1E9FA 1X8JA 2CL7X 2YHSA 4RZUA 4D25A 1KJZA 4PFSA 3P26A 3FOZA 4OL0A 4UQOA 1YR8A 2RB4A 2ZRCA 3OEHA 3QVVA 3UWKA 2WSMA 1CJKC 3OZXA 5H8WA 4TLCA 1OIVA 1E1QA 1ZVQA 3K70D 5H70A 1M7BA 3MWYW 1EFHA 4C7OA 4OK5A 1G3RA 4NYIR 4FD2A 1JB1A 3CBQA 2XGJA 3WNDA 5JRJA 2ZIAA 4A1FA 2OEPA 3B5JA 4XTCS 4QM6A 4Q9HA 2CMKA 2G1JA 1IXSB 2NO0A 3F0TA 1NP6A 3FDIA 3KKNA 4WZAE 5JHHB 3AGQA 3K0SA 1SVLA 4PANA 2O8EB 2PCJA 5E95A 1S9DA 3QG1A 1UFQA 4Q1AA 3X1DA 2ODEA 4DDVA 1Q12A 2KWIA 3FHOA 4NYIQ 5EE0A 4I4LA 3X2SA 4A82A 2DPXA 4AYTA 3CWZA 5UKDA 3A4NA 3QF4A 2QP4A 1ZM9A 2XZPA 4RZ3A 3WY9A 1OW3B 1SVKA 1RPZA 1XU4A 3KUDA 1COWD 5AJYA 3U2QA 5GJVC 1GTVA 2P65A 4EAQA 1G5PA 4PHHA 1E1QD 3W3ZB 3OE7A 3OHMA 3ZZ0A 2BBTA 3DKVA 5JI2E 4CEHA 3EG5A 4PC3A 5FBLB 1SVSA 1JR3A 3NDPA 2FGJA 4D4KA 4ERNA 3QOFA 3QSYA 3BJIC 2IYWA 1PLLA 1KI3A 4Q9JA 3KTAA 3KKOA 2OO7A 1TL7C 3ZDQA 1OH7A 1G6HA 3SNHA 1KDRA 3PEYA 5CIWA 4KI0A 3VHXA 4IVPA 1E0AA 2CHVA 1X8LA 2H7VA 1NNEA 3C4JA 1YZKA 3AUYA 1E69A 1L4UA 2BJWA 1XTQA 4KYUA 2AK3A 1YR6A 1MO5A 3BH6A 3K1JA 4Q7MB 4DLXA 3O47A 5FBWB 1TQ4A 5DI3B 1SKYE 2OILA 4BRWA 4DHEA 3ZD6A 2XTNA 4DKXA 4A8JC 1KNXA 1XEWX 3RWOA 3DVLA 4JL5A 5KNDA 3CZQA 2OZEA 1CS4C 3M6AA 3GJ7A 1N3BA 5CK5A 5FUVA 4QM7A 2ZR7A 5G3YA 5BYJA 2EFEB 2ORVA 4TZ0A 2A5YB 3WHLA 4TMWA 4C2TA 3A58B 3ND8A 3TE6A 2JLYA 2V3CC 4JLMA 5HPYB 1QG2A 1ZM3A 4I1OA 2FZLA 4DCUA 3DO6A 4P33A 1UBCA 4PO9A 4Q1EA 1S2MA 3LVRE 1GL7A 2ONKA 4LHWA 2NMVA 2P6RA 5FOWA 2BCGY 1R0YA 2QPOA 1EX6A 2XTZA 2YJTD 4UXJA 5HKKA 4MDEA 1LF5A 4QBGB 2PLFA 1E98A 1N6OA 4MH0R 4RD0A 1D9ZA 3UMRA 4JJZA 2N46A 3MG9A 2DR3A 3F3YA 1E4VA 5EP1A 3PG5A 3U3MA 1MH1A 2ZU0C 3A4MA 3CRRA 4K81B 1ZJ6A 4GMDA 3A1WA 1XTSA 1IXZA 3HWSA 4QBIA 4WAUA 4D82A 4LRWA 4H1VA 4M9SA 4URUR 3AP1A 2FA9A 3RSLA 1CEEA 3SI7A 4Q03A 5DGXA 5GJCA 4V0ME 3P4XA 1H65A 1JQLB 2NO7A 4HLDA 3B1VA 4GBMA 1HYQA 3EA5A 3QKSA 1U98A 5FBQB 5EJEA 2C9YA 3MGCA 4NDZA 5IT5A 1KSHA 1R0ZA 2ZJOA 5HZHA 4PZYA 2GK6A 3WBKA 1AIPA 3K9LA 2PEYA 4IDNA 2JA1A 1E9CA 1QHSA 1FNMA 2J0VA 1EFCA 1EFTA 1BMFA 3VKGA 1V5WA 4B6FA 2DWPA 1IN7A 2PT5A 1DE0A 1JQJC 4Q1DA 3TVTA 5BXQC 5CB8A 3KXKA 4UJ3A 1TQDA 3NC1C 2ORWA 2NPFA 3I32A 1VIYA 1ZIPA 2J7PD 1VCOA 2ZEJA 3PQCA 5G41A 3GLIB 5GJBA 1CR2A 4HAYA 1S0UA 4KU4A 1AGPA 1K6MA 2QMUA 5JJIA 2BDTA 3GEIA 5FOTA 4TYNA 2YOFA 4IVQA 2OV2A 4DJTA 3ZS8A 3CZPA 3WP0A 4QNMA 2YWGA 2BIFA 1C9KA 4UNPA 1Q3HA 1JECA 3L8ZA 1VYUA 2O52A 1WQ1R 2WKPA 3A36A 4PSVA 4YLGA 3SQWA 1BMFD 3K70B 2IXFA 4OBEA 4PQYA 5DE3A 2LKDA 4CEJA 1E3MA 1H8HA 1FP6A 2BOVA 3KDSE 1FP7A 1QVAA 2F9LA 4G3XA 4AY2A 2BM1A 2GZDA 4IDOA 3GLGA 4G5QA 2FFHA 3K9NA 2BKUA 4A0RA 4XVRA 2FNAA 3UG7A 4EJSA 4ARZB 1XJ0A 4U7DA 3GFOA 3CX7A 2F1JA 2AKYA 4RKFA 3EZFA 2ZYWX 4AKIA 2ZSAA 4M1TA 2CCGA 4V0LA 3GEEA 3D8BA 3KQUA 5DSZA 4L9WA 3E5HA 4Q19A 3WNCA 1VCNA 1XMJA 3ZIAA 2DFLA 1G3IA 5TB5A 5M04A 2QTFA 3Q7PA 1ANKA 2V54A 4NYMR 4DIDA 1W0JA 2ZS8A 1N5JA 4BEBA 2WOOA 4BLSA 4OKSA 1XX6A 4BE7B 1G41A 2GJKA 4Q47A 3NH9A 4HDOB 4YDHB 3QXJA 4IJMA 1SXJA 3FPAA 3KB2A 1IY1A 2VSFA 1KO4A 1ZNYA 4MKIA 2OAP1 2BWJA 5DISB 3GJXC 5CYPA 3VR2A 4BASA 4CZ2A 4US1R 4DEXA 2CLDX 2CE7A 2GTPA 4WXRA 1TF5A 3K0EA 1NL3A 3NEJA 1T91A 2HCBA 2H17A 3KX2A 4JT2A 4NYMQ 3U6BA 1RVDA 3KFVA 3TH5A 3N2EA 4HUTA 3BH7A 1Z47A 2P67A 2OUKA 3NH6A 4MKGA 5G53C 4FW9A 2QBYA 5LDDC 4ZI2A 1RRPA 4WW0A 1HV8A 2V6IA 3CW2A 4NCKA 5FOXA 3U3RA 4D6PA 3ZIAD 3AP2A 2W83A 3QF4B 4IDPA 4F4JA 1XTJA 2WPDA 2GCNA 3BC1A 3AF2A 4UNNA 3TSOA 4LOAA 2WWXA 2JAQA 1E2KA 1P4SA 5AJVB 4IEEA 1W0JD 4OJQA 1A4RA 3E70C 1PUJA 5GVRA 5KNBA 2RAPA 3BIFA 3SBEA 1AQYA 4PR0A 4B48A 1I2MA 5KSYA 1SXJD 3BWDD 1MO3A 3KTAB 3FWYA 4EIWA 2CNWA 5DNYB 4ESVA 2ODWA 2JASA 4LYAA 2VPPA 1Z0DA 2GEUA 4D80A 2OXCA 1IOZA 2J41A 1CJUC 3P1JA 3QEJA 1RW4A 3Q72A 5A4JA 3U7GA 4XVUA 2JLUA 1G7TA 1KNQA 1IY2A 1GIAA 5CLQA 2ZREA 2FOLA 4TL6A 3BB4A 2EU8A 3VNUA 1YRBA 3NEYA 5JS7A 2BEKA 1GITA 1WA5A 2D7DA 4Q18A 4QHYA 2WPDD 1W4BA 2CXXA 1KZ7B 2Q3MA 3QQ5A 2UKDA 2H1LA 2PL3A 4KVGA 2ANCA 5L3SA 3C41J 1L7VC 4C0KA 1C4OA 2HJGA 3BD9A 4DDWA 4B44A 1NN0A 2OHFA 2CBZA 2PMDA 2PZFA 4QGAA 2ZSFA 1U9IC 4DSUA 2NTYC 4JLJA 4TLBA 4DCVA 3WRXC 2GCOA 2CNWD 4LJAA 4QGHA 3GFTA 5FOSA 3OFND 3W34A 2J87A 4ABYA 1R8SA 2IT1A 2BKEA 3U7HB 2KI5A 1U94A 1IN6A 2GWHA 3A37A 4JVMA 4TWZA 2AFHE 3I73A 2WJIA 2PH1A 3LQQA 2EQBA 4QBHA 2HXYA 2G0NA 1M7GA 4ACAA 2XNDD 5G3ZA 2AKAB 1YZGA 2GF0A 5FUYA 1IM2A 2R6CA 2WAYA 2RGEA 4C2UA 1N6KA 2QE7A 2XJ9A 4PHGA 2LWIA 3AF3A 1G4UR 4P4SA 4JT4A 3G5UA 3T1VA 4TTRA 1RIFA 1KSJA 3CPJB 5KOYA 1IHUA 4LSGA 2IYYA 1P62B 5CJPA 4JSYA 1KIMA 2J1LA 2C9OA 4KODA 2QL6A 1NVUQ 3DZ8A 3Q5DA 4JKYA 1SVOA 3IBYA 5KDOA 5KO2A 1LTQA 5JCZA 4LCBA 3QKSB 1FFHA 2XOKA 1OXTA 2PBRA 1H8EA 2RHDA 2Z4SA 3B1YA 4FI3C 4JVNA 4LI0A 4A36A 2C5LA 2X2FA 1N25A 2QG6A 3RNLA 3UWOA 1U8ZA 2ODNA 5JI3E 2R6GA 2WWIA 2JIZD 2WWYA 1DPFA 1KK1A 2JJ1D 4DB4A 5FTNA 3CPEA 1SQ5A 1NKSA 3AEZA 2C2HA 3ZZTA 2QE7D 1CJMA 3RS3A 3TQCA 3SFZA 4JBXA 4OQMA 4JMPA 3AV0B 4Q48A 4WOPA 5J5CA 1DAGA 4Z8XA 3J81k 5FTLA 3JVUA 2RCNA 4JLBA 4LJ5A 4Z54A 3LNCA 4F4IA 2FDCA 2NPIA 2XB2A 1EFUA 1VCMA 2OCBA 5JEDA 1WBDA 3CX6A 3PJRA 3NBZC 4DXAA 1KK2A 4UKDA 4B35A 2XOKD 3OAAA 4LHZA 1RRCA 3I62A 2FSGA 4ZCMA 4PAOA 5ELXA 4B3BA 3QXHA 5HCNA 3GLFE 1CP2A 1E79A 2UZIR 2YZ2A 3Q5EA 1NMXA 1XXHE 1XF9A 3V4RA 1VG1A 2CLSA 3BFXA 4WZBE 5CDFA 1IN8A 1Q22A 1DAIA 3BORA 5HE8A 121PA 3CRMA 2R62A 4V0KA 4D26A 1NBME 4CEJB 4LZZA 4KFRA 3VR6A 3GJ6A 1MRSA 1YJ5A 2NQ2C 2P0EA 2QUZA 1T5IA 3KQLA 2FPMA 3B6EA 2FEOA 4LK2A 2CCKA 3HU2A 4X8OA 2R2AA 3PEWA 3TAHA 1ZMXA 3MFYA 5J4HA 1S9HA 3AVVA 2J45A 2JCSA 2GBLA 2ZJYA 2ZS9A 4CIDA 4M9QA 4G5GA 3PUWA 4EJSB 2C99A 4R7ZA 3BFKA 2A5JA 721PA 2DB3A 1U2RA 3DKPA 3PCRB 4LY6A 5FPTA 3VHLB 4A0GA 4QXAA 3D3QA 1S3SA 3D7MA 1YZTA 1E2GA 3BGWA 4U00A 4A6PA 1E79D 3T15A 1S3GA 3DOFA 4TL7A 2B8WA 1HH4A 3UK6A 4TYWA 4OQLA 4ILEA 4PO1A 3U3OA 2IUUA 4C0HA 3UXMA 4QOSA 4OHZA 4KHZA 5C2JB 3N70A 1XEFA 2J59A 3A1TA 2CE2X 1E0JA 4XVQA 3I5XA 4HAVA 1SXJB 3GLIE 3U4QA 3U61B 2Q3HA 2BHRA 4DCTA 4NL4H 4NCIA 3AUXA 4GRAA 4NKRA 4FMDF 3KQKA 1JEEA 1KHTA 4EPXA 2NZ8A 5D3QA 4LBWA 1Z08A 2AD1A 4KCGA 4YMTA 1EXMA 2F43B 3KKQA 1SHZA 3PXGA 1SGWA 3K09A 2JATA 1AKYA 4IOMA 3THXA 2QBYB 4KJZA 1Q57A 3SYKA 1KY3A 2ZSEA 3H86A 2GVZC 3I72A 1P60A 2NO1A 2L0XA 3WYGA 1XCPA 4C0AC 1X3SA 3Q85A 2VP4A 3WMEA 1PVOA 1T4GA 4F4CA 2OESA 4R98A 4BFVA 4YXWD 2VIIA 2XNSA 4L16A 2OBLA 1E1RA 1FTSA 3BERA 5EP2A 1HE8B 1OKKD 1TNDA 1YZUA 1US8A 3SZRA 1NVXQ 2ZYTX 1GWNA 3TW8B 2B6HA 3PV0A 2R65A 4ZDIA 1X1SA 2W00A 4FWIB 4B76A 2IHBA 2XTMA 3DM9B 2GCPA 1LNZA 2DFKB 2VHQA 4FCVA 4BFTA 3VX3A 4AKHA 2QMOA 3TAUA 1EFRD 2HF9A 1Z3IX 2WJVA 2ZPTX 2ZR0A 3KB1A 4MYCA 4OHWA 3F8TA 5DH9A 1II8A 1N6IA 2VP9A 1ZU4A 4TQAA 2C03A 5KSZA 1RYFA 4KAXA 4FXPA 1EWRA 4AYWA 1AM4D 1SHKA 4TYYA 4ESHA 5CJ2A 1RYHA 2AXPA 4TYQA 3W9YA 3R9XA 2X77A 3LY5A 1GNQA 1ODFA 4LPKA 1E2QA 1A5TA 1ESMA 2QRNA 3B8HA 3CR8A 3K8YA 5K8IA 5L3SB 2YYZA 2F1HA 2V55B 1E1RD 4G5SA 4OI2A 4EPVA 1OIXA 2LCFA 2BCJQ 3U44A 1B23P 1HEIA 2JEOA 3KJHA 2XITA 3EPHA 1E2HA 1P9RA 2GCOB 2ERYA 3CH4B 3VMFA 1M2OB 1UF9A 4P3YA 3VU9A 1NBMD 2PEZA 1D8TA 3C16C 5E4FA 1UBEA 5KSOA 2GXAA 4AYXA 3UIEA 4LYFA 1BKDR 5B30A 3MCAA 5AR1A 3CNLA 3RC3A 1F2TA 2ZJZA 3TUJC 3NXSA 2REXB 1IONA 3QF7A 1FUKA 4PPFA 3ZVNA 1G20E 4KITB 3IIJA 1FQJA 4PPGA 4V02A 3SEAA 4IHQA 4QFMA 4IOKA 2WWWA 1D5CA 2ZJBA 3B1XA 3GJ0A 4DCNA 5JWHA 3THYA 3NDBB 2BMDA 4OQFA 1NSTA 1UDXA 4QC2A 3CB4A 4P4SB 3RS7A 1IY0A 2I1VB 1R5OA 1C1YA 3BH0A 4HAXA 1Z2AA 5IF9A 2IYRA 4D0GA 2P2LA 4A4DA 3VR4A 4M1WA 2ZRKA
chains in the Genus database with same CATH superfamily
5IT9A 3HR8A 3W6UA 1DAPA 4KK3A 2ZUBA 2Z83A 3PC6A 5T6MA 4TXLA 4S1PA 5JNTA 2OLJA 2PGXA 1MOQA 3HADA 4H7JA 3TDKA 2F90A 2X0FA 1DELA 4D3DA 4XB2A 1DFHA 2D5BA 1E0KA 1BKSB 5GOTA 4BNNA 2PA3A 5AOVA 2Z2KA 4G41A 2V1UA 3GFSA 3BD6A 2YN4A 3OWHA 3ADBA 4XM0A 1PNQA 3KJQA 1R9JA 1MJFA 3FF4A 2ZWOA 1Z0JA 2XZLA 5LQRA 2EFHB 2PX8A 1AURA 1JHUA 5ILGA 2J0UA 1YONA 1FCJA 3B1WA 2XSZD 5DHAA 2X0DA 1OH6A 4X93A 2PD3A 5BW8A 4FSHA 3UUWA 4MITA 1YRAA 1P9OA 1MIHA 4OXYA 5E6RB 1UFVA 3V8NA 4JIGA 4IHJF 4BATA 3DBHB 4JI8B 5ERYA 1M33A 2B34A 3I23A 1U0SY 2IQIA 4IUDS 2RC6A 1GG5A 2VP5A 1GTMA 3WL8A 3CKLA 1SR8A 2PANA 4URVR 1WMSA 1T25A 4UTNA 2D0PB 4REZA 3MTJA 4RCYA 5AW9A 4CMAA 1O1YA 3VYTB 2IY8A 1ZZGA 2OFOA 1O87A 4ZARA 2FEPA 4FSXA 5IXYA 1AZLA 2HBRA 5HQJA 3IAEA 1GU7A 2HK9A 2ZT7A 5K3FB 3AVPA 1FFBA 1WUJS 2ZT5A 4K6GA 2JW5A 1VHJA 3K31A 1ZMTA 4OIMA 4P0TA 2R8EA 2XCLA 1UAAA 1Q1BA 2P41A 3H19A 3SLKA 3R3WA 3NTLA 3BMOB 4UFPA 1G8FA 3PQFA 1NBAA 1Q83A 1M6NA 1A5AB 1OROA 1W5BA 2L2DA 1Z4QA 3TKLA 1LZLA 1CV2A 1C4WA 4BQSA 1TTHA 4P80A 1WBBA 2G9ZA 4B3MB 3VMMA 5BW4A 4QG7A 3PHLA 4KAJA 1NHGA 4DANA 4JQZA 5AKGA 3WYDA 3HHZA 5INTA 3PVCA 4U6NA 2CYAA 5KVVA 1LC0A 3SYLA 4WASA 2F43A 1PG0A 3CCCA 5K0BA 2NLOA 3D8RA 2H3EA 4M22A 2GZSA 2W2KA 5CB4B 3L4KA 2C8LA 2P9JA 3QGMA 2PX5A 1D5WA 1H6UA 3L04A 2R79A 3HGQA 2GFHA 5AW5A 1P77A 1ZNWA 4YCBA 2CZQA 1E6WA 1N57A 4JJGA 1VGRA 3GXBA 4HHEA 4ENTA 3VC1A 2VHZA 1NBHA 3FIUA 2GJ8A 3UHAA 4ED9A 2PYIA 1RJDA 1ZUWA 2XPCA 3MINB 5G0SA 2LGJA 3ZK7A 5AVVA 4UMDA 1NW4A 2C4UA 1YIOA 1EDBA 1E6CA 3Q6IA 3HZRA 2LWXA 3ISTA 3ORYA 1ZMRA 1OX6A 4DW8A 1G8MA 3LW7A 3ZH2A 4PC2A 1XQ6A 1TEVA 3OBBA 3ECSA 3L8GA 3A9UA 4HDCA 3RRZA 4MVJF 3I8XA 5FL7D 5LOVA 3MWEB 3E58A 5LP6F 3B13B 4OATA 3FKJA 4BTVA 4H27A 2IHNA 4UVEA 4AW9A 1JAXA 3ZD8A 1O0CA 5C7IO 1K7EB 3BTUA 1QHYA 2X0IA 3ZYCA 2WJGA 4HH1A 2V6ZM 3PEEA 3QLJA 1PQPA 3NYQA 4XRGA 4HNAB 4K9PA 5F2EA 3R24A 3HE3A 1TEZA 1THTA 3PQ8A 3ICCA 4WV3A 5JJLA 4DHWA 4L76A 3DOJA 4WKPA 2RHTA 3ZXUB 4OU5A 3KVRA 2H4XA 1YRWA 2BM0A 3K6RA 2RGAA 4GGPA 4IP0A 5FDFA 3IRVA 3O82A 3MLBA 1Z7GA 2AIRA 3NBYC 4M46A 2G9UA 3BAZA 2VF8A 1NW8A 4G1CA 5KYKA 2DQYA 3INRA 1W1WA 2V6FA 1OU0A 3ZDBA 2I3DA 5DB4A 4AO7A 3KB6A 4ZOQI 1K68A 2POQX 1D4AA 3AY3A 2DT5A 1N0UA 2ORIA 1MIOA 2WSSD 3U9LA 4BYGA 3OMWA 1MQSA 3DXXA 1N2BA 2HIGA 4EYEA 5NULA 3DC7A 4CODB 3KOMA 3VTKA 2OR3A 5E7MA 1T9HA 3G17A 1NJ2A 5FV7A 2QF7A 5IVDA 3FVRA 4DBLC 3NRCA 3I2JA 4JI0B 2VJNA 4ZYVA 4EA9A 3KXIA 3QUAA 1QHIA 3CLRD 4NEHB 1EM8A 2Q5OA 2O7QA 2W6JD 1P2TA 5FHRA 3MZ0A 4Y6LA 4C1BA 4IDCA 4NCBA 4AS1A 1PT9A 2GPAA 1LPSA 2YZ7A 3MWKA 4UASA 1CNFA 4D4GA 3I6MA 1WTAA 2WD7B 3KQPA 3WK9A 3IVCA 1FEZA 3ELUA 5BQ3A 1SUEA 4K9NA 5C3MA 2Q4TA 2B8JA 3U81A 2QWXA 3MB5A 1TU3A 3VAAA 1VE1A 5IK2D 1EAYA 3EIFA 3RHSA 2OCPA 3T5CA 1ZCAA 5IANA 4OGLA 1HOTA 1R8QA 1EDOA 1BEEA 2VC2B 1XEXB 3HVJA 2GEKA 4PXSA 4KBFA 4OXRA 2PR2A 4AJNA 4L5CA 1FNNA 1RIIA 1C3OA 2X8WA 1K7YA 2WM9B 2WAOA 3I1JA 1EEHA 1QAQA 2QL5A 1ZMBA 1KFBB 1RMQA 2I8LA 2NYUA 4WIAA 5HKBA 1OZFA 4ZJPA 3VPXA 1AHPA 4C3VA 4F4HA 2Q3BA 4E14A 1HDYA 4LF9B 3QFFA 4LF4B 2UUPA 2PUTA 4K87A 1SC6A 2JAPA 1CVIA 3LE8A 2Q1WA 4YRSA 4EPTA 3FFWA 2C2ZA 3J2PB 4D4HA 3JYHA 4EHBA 1FP4B 5KNCD 1E1CA 3VJRA 3G1WA 1EFLA 1PM5A 3EFHA 1ZKMA 1VB5A 4W1QA 4L4XA 3HNOA 3MB8A 1W0CA 4DG8A 5E6JA 1J2EA 2UAGA 4J6EA 4D9GA 1UDWA 3I42A 1WDTA 1U6KA 2ATEA 3GFFA 3RE1A 2R8XA 3GT3A 1ZCFA 3R7AA 3ENNA 2CHQA 2WMDA 3EXG1 4ZJZA 2IP1A 2LDXA 2IYTA 3WLJA 4FCCA 3BWBA 4FJ0A 4LC0A 3SC4A 3C3AA 3EEYA 2ZUSA 1DC3A 4FS8A 3FOWA 2XY4A 3CB2A 4ATNA 3A1SA 1QDTA 2QP3A 5HIIA 1KJ9A 3OZEA 4TOIA 1UBFA 1Z59A 5J4YA 2QM8A 4HLQB 2EWWA 3JWJA 2UYCA 4ZU3A 1NY5A 5ECYA 3UPTA 1ZD9A 1NZDA 2EZ9A 1XROA 1ESNA 1YA4A 2XJ4A 4TMVA 4WADA 4TSRA 5JPDA 2PT6A 2FZEA 4QUEA 1AU9A 4LXIA 1N6PA 1Q1AA 4IMJB 3VJMA 3DT6A 1XTKA 4HQOA 4EW1A 2P4EA 4BNIA 4MIEA 2IV7A 1BFDA 1NFFA 2Z6VA 2DQZA 2E4YA 4ND2A 1Y98A 4O4HA 1GKLA 5F12A 2EX0A 4K9MA 3WA6A 3RVOA 4GFDA 3PL1A 4KR9A 3AINA 2PZEA 1A8UA 3TZBA 4RPKA 5EUQB 4RORA 3VSAA 4K6CA 1GNPA 4MSUA 5A9SB 2WZDA 4DSNA 3LLMA 3ZHXA 4MP6A 3U39A 3F4LA 3FAZA 4LFAM 2WD8A 4US2R 1WWKA 5IKEA 5FLYA 3RRJA 3OKCA 3KEGA 1I4EB 4K8RB 3BEDA 3HXLA 1XMXA 4WSOA 3N0RA 3NU1A 4JC0A 5BRJA 4BMZA 2M5ZA 3PNOA 1AX9A 1IBMM 4JI7B 5K3DA 4NLLA 3EGCA 2Q50A 1JDNA 2C9MA 3DNFA 3GR6A 3WDLA 4NMMA 2P1RA 3G2NA 4MUFA 3R7LA 1E59A 3U6DA 3W5BA 2QRKA 4FCTA 1HX7A 3I1FA 3RV3A 4FFDA 1UJ4A 5ARCA 5JSKA 3RABA 5CNKA 5KJFA 2GD0A 4AKGA 3C3WA 3L7DA 1WVGA 4DR4M 4S1OA 4BMSA 4MKHA 3SDSA 3TXAA 3ZCTA 3UUEA 4CM9D 4GDMA 1DMSA 2X9NA 4E1VA 1U0BB 4XYMA 1O8BA 1Z88A 3KO8A 3HHEA 2G0TA 3AO0B 3CX4A 2WKRA 4ZGWA 1N34M 5AI6A 1XRRA 4HS9A 4BNZA 3FDFA 1U2PA 3WGZA 3ABOB 3EZYA 1J8DA 4EEKA 3GDGA 5D3MB 3JQBA 3MCUA 2JXNA 3PIRA 1F2VA 1HE3A 1K6IA 3VR5H 2AHMA 3V8MA 2GNOA 5FUXA 2D5AA 3TTXA 5HHTA 3IT0A 1GTG1 3LQ2A 2UUBM 3EA0A 3C85A 4KRGA 3MAGA 2DFPA 2R25B 3NHBA 1F48A 1NMZA 4G1VA 3OT5A 4R05A 4IGKA 4XQEA 2QORA 4R0VA 3VVMA 5ILOA 1K5DA 4CN9A 2F1RA 1QIMA 4YO7A 2HWYA 2QW1A 4OMUA 4RJJA 4B6EA 4RF3A 3OM0A 3CRVA 3E35A 2G1UA 3V4SA 4QVIA 1V9LA 4LFBM 1SUCA 1YQWA 3IAM1 4L4YA 3VV2A 4EA7A 1NBIA 4HJRA 2EQ5A 2H16A 3AJ9A 3GC6A 5SZIA 2QP9X 3BS4A 1OUMA 4RHFA 2V5UA 3GMTA 3UAVA 2ZJAA 3WZLA 1Y34E 4B0OA 1OREA 1O6CA 3RSZA 1D0SA 3PLNA 3GELA 4OPMA 3BXWA 5BWMA 4JYAM 1HQCA 5DYTA 1YVDA 3A42A 2KLBA 3U48A 1U9IA 3P52A 2GESA 3WICA 3K5WA 5T5QA 3GLHE 3KB8A 4YJ3B 2G25A 3GZ4A 1N9GB 5KYVA 4XJXA 2O50A 4OGKA 3DTVA 4DE5A 4HXFB 1H94A 1V3QE 3DVAB 4IIWA 4OFWA 1QG0A 2QTZA 1CF9A 1WDWB 4DSZA 2FMTA 4OHOA 4IBOA 4DUZB 1M8PA 4MMZB 6AT1A 1QQ5A 1E9FA 1JFFA 2DZDA 4J1TA 4YLYA 3D5TA 3VO8A 2NXEA 2H63A 1DLIA 2EKPA 3IAAA 5C3UA 1KU0A 4A1FA 3RJ5A 1TTEA 3TEFA 3F0TA 4QYSA 5L40A 1IPFA 1I5EA 2JK1A 4LRQA 1EM6A 4WZAE 5JHHB 1FYWA 4H7DA 4YMIA 4M54A 2QUAA 4LAFA 1NVTA 4DDVA 3BJEA 2KWIA 3FHOA 4NYIQ 2XCTB 1Z6PA 3QF4A 4E2XA 1R6VA 3S5UA 1GTVA 1DDIA 5KB3A 3IB6A 4PHHA 3C4VA 4AKTA 1JR3A 1W73A 3QSYA 2Y76A 2JVIA 2QNJA 1YACA 1QGDA 2HNAA 4G89A 3AUYA 4MTCA 5L7TA 4RPIA 3BH6A 4YP0A 5DI3B 3O03A 1VJCA 3RVMA 3GQVA 1IY8A 1QHEA 3URMA 2ZR7A 2ORVA 1DX4A 5EKSA 3FM9A 3A58B 2Z3VA 2AJCA 5I5EA 1ZS9A 5FCDA 1YBMA 2C29D 3MOGA 4MGIE 2H1CA 4G86A 1OWNA 2H1RA 3AEKA 4PFQA 3E4RA 5HQ3B 1GA1A 3RSHA 1NUPA 4HRAA 4IL5A 1BWPA 4MGYE 3E0XA 1JSRA 2ZBUA 2GFQA 3MXOA 3RSLA 3GNQA 1HL3A 4Y30A 2VNJA 3B1VA 3RYFB 1S5PA 4CMIB 5HZHA 4PZYA 1SB8A 3L8CA 5A4KA 1E9CA 2W42A 1IXKA 1WCYA 2DKNA 4NJMB 1JQJC 2FWIA 2ZOSA 1C8BA 3GMSA 2PYDA 1X38A 1IHOA 4QSHA 5IBQA 1UMCA 2FW0A 4F3CA 2K9DA 5BSFA 4DJTA 4QNMA 1EE1A 2YWGA 3L8ZA 4UATA 3TJMA 4EVRA 5F7JA 2UXDM 1RHMA 4PQYA 2LKDA 3UAYA 1GABA 3PXAA 3PQ5A 4TUYB 4XVRA 1G66A 2QN1A 4F56A 3E9CA 4R9VA 3SE7A 3PX7A 4U2FA 2RONA 1QNLA 3OFVA 1YCGA 5J5VA 3TRJA 2HNKA 3LFHA 1NDQA 2FKNA 2ZG6A 4WD3A 3E7FA 2I7DA 5HDQA 1SUBA 1YDFA 2VRNA 3OPVA 4DVJA 3H3XA 2AYZA 4GX0A 1KWKA 5CYPA 2RH4A 2JGFA 4CWAA 1TT5B 4R0NA 1SZDA 1RVDA 1WV1A 1DQYA 5G0VA 2WPDA 1L1EA 3DDZX 3ZIDA 4DRXB 1SQFA 4TTIA 3T6PA 3BWDD 3A26A 4LWQA 2YXDA 1LCIA 3D3NA 4IX9A 4YLEA 1EGVB 3W7BA 4QHYA 3G0DA 2Q8QA 1Y4SA 3HKEA 1GYRA 1R3UA 2PWAA 4GHWA 4QGHA 3GFTA 4R5MA 5BR4A 3SVLA 2KI5A 4MEJA 4GOLD 5HKLA 3LQQA 3SM9A 1YZGA 4N3AA 5AQEA 1Y9AA 2GLXA 4QYWA 4RJIA 4XLZA 3ST7A 3W06A 1KIMA 3NJ8A 1EFAA 3B1YA 3LSTA 4Z0PA 4QVGA 1NI4B 1IPEA 4FFBB 5FTNA 4DMGA 3FUWA 4YHHM 4JI5B 4MWZA 1DAGA 3F7NA 4JLBA 1KF0A 3LNCA 2VTVA 4XQ9A 1I3MA 2AW5A 3W5DA 5FJIA 6LDHA 2WWTA 1FVFA 4B17A 2D1YA 1UBJS 1XXHE 3SHVA 1KR2A 4IQ8A 4CNBA 4WZBE 3GUYA 2CFSA 2WUFA 3VC2A 2ZJ4A 1QH0A 4E5KA 2Z5GA 5C5DA 2CCKA 3GGOA 4IDEA 4WA8A 3S7TA 2QK4A 3VHLB 3U6EA 2Y99A 1ZVVA 4A6PA 1JLRA 2XMBA 5IJ0A 1T15A 4BGUA 3AR9A 1RAFA 4XVHA 3TG2A 3KHTA 2I8CA 1Z16A 4IHKA 3HHPA 3PHIA 4FDAA 4G0MA 3U61B 4RVFA 1I0LA 2Q07A 1KHTA 4DQLA 4B3RB 4KJZA 3W78A 3JSAA 5MFPA 1PVOA 4MGHA 3A1CA 2OAGA 4G4SO 5AICA 4L16A 5EP2A 5J2TF 2JLBA 5KJEA 1OLSB 1ESZA 4ZDIA 3AHHA 3DF7A 5LJLA 4BFTA 3GMIA 1AB5A 2Y3IA 2ZPTX 1UOPA 4TQAA 2QV0A 1HFJA 4FJ2A 4P0PB 4UHEA 1Q17A 4UC0A 1DRUA 4TYQA 4N5DA 3AILA 1KERA 3U44A 1J5PA 1P4AA 3EPHA 2ZQYA 5E4FA 1BKDR 3MT0A 1VKNA 1BMQA 1PHRA 3IIJA 4KITB 3SEAA 4F3TA 3EEOA 4DNOA 2LV8A 1K1EA 3N2GA 3RBAA 1B8NA 3S0JA 4A4DA 2VZ0A 4JGIA 4EF5A 4RPLA 4LG1A 2V7BA 1JNYA 3I6BA 2V7PA 3SATA 2Q4BA 4HNSA 1TYEB 2XBUA 5AIBA 3T5GA 3ROPA 2XYHA 4OX9Y 5TPWA 2H5IA 5EXPA 4MW7A 1HJPA 1NIPA 1QUSA 3CN9A 3U6SA 1DXHA 1NAIA 3CJQA 5B58C 1W6UA 5FWYA 2QAIA 3KLMX 5E8JA 4F38A 1XF1A 3HJGA 3QPWA 4KYTA 3AGPA 1UFRA 4YQEA 1GZ7A 4J0JA 4A73A 2P5TA 3M82A 5JC1A 1DWQA 5JISA 4PCLA 4Z9XA 4ZCIA 2I3ZA 3OJ0A 1XDZA 4M8NE 2P2YA 5K2MA 2ZB8A 4RF4A 3IESA 3VK7A 1LS1A 1UZMA 4PHTA 1P4RA 2BFOA 3GFQA 1B43A 3STXA 2AEEA 4WZ6A 1QIGA 3V1TC 2A1IA 2ZTLA 1B93A 5BSUA 3A1NA 4MS1B 4N6GA 2WD9A 1RNLA 2HFJA 3THXB 1OJLA 3FMGA 1U90A 3P20A 2JC3A 5EJ9A 2JBWA 4CLRB 1CU1A 1W7AA 2UU9M 4ZZ0A 3I5MA 1V0JA 2OBNA 1RXEA 1Q77A 3CJTA 1TLFA 2E1RA 3SHOA 1GZ3A 1B0AA 1ESEA 3W6PA 4RA9A 2GVDC 3ZDZB 3BBLA 1S8NA 1V7PC 3RSOA 2IH4A 2HR1A 2NXNA 3DXZA 1YDWA 1U3GA 2X86A 2RHGB 1AMOA 1HQDA 1SCNE 2HAKA 4BVAA 2QN8A 2I3BA 3DTNA 4F2WA 3IKJA 4R54A 3TIXB 4MWGA 1PJTA 4NF2A 3L6DA 1AXRA 2ZXUA 2FSSA 4OVKA 1DCKA 4KLRA 1DEOA 2PSHA 1D0MA 2C3YA 4A8PA 1YJ8A 2JEZA 4H16A 2OD9A 1ZJJA 2NYRA 2PWYA 5DHQA 2CD7A 5FORA 5HEKA 4GKJB 3OO1A 2XLCA 1TUGA 1F51E 4E3WA 4DIBA 4Y2SA 5LN1A 3D8NA 5DO9A 2HRZA 1E6UA 3L8YA 4CMGA 4FEAA 4CEIA 1HPLA 4P16A 3WB9A 1ZW6A 2VHEA 1OXMA 2FSHA 2H52A 1U3VA 1BU5A 2V74B 4QULA 4D0RA 2J0UB 5JZMA 2JF0A 4DR6M 3IOYA 3E3LA 4Q7EA 2GJ4A 1Z2OX 4AQYM 2OXIA 3QX9A 3TRFA 3V76A 5LD2B 3IILA 3GJZA 1ID1A 1BA2A 1P33A 2JH9A 4JI4M 2P2GA 2C61A 1ENYA 2JJ1A 2FHPA 1K7XB 5C1PA 1CDOA 4YROA 3GA7A 4JYMA 3VKUA 3RT9A 3LYAA 5LLSA 4M98A 2EF0A 3IBGA 4AZTA 2NG1A 2K6BA 1KRXA 4DLSA 1TF2A 1AQUA 4XWGA 1ZK1A 2GDZA 4C04A 2UZ1A 1KEVA 3PPVA 4IBFA 4B6SA 1RXYA 4M9XA 1T8RA 4Z8YA 3P9CA 3ZDYB 1XTTA 3F5MA 3WR5A 1Q0TA 5G0WA 3TQOA 2WG0A 4UEJA 2WV7A 2H1SA 3WWPA 3BTSA 4HG2A 1ZIOA 1UFZA 3IAUA 5DFLA 4PSDA 3FSRA 3OA2A 4Q5IA 3VPBA 5K0FA 1XEWY 5CCBA 2M2IA 4Y6SA 5LZ8A 2AD5A 2J0SA 4LCJA 4JVLA 4NAVA 3FNBA 4HGNA 3L18A 1AQJA 2X42A 3IG8A 3EZ9A 4MINA 2CSXA 5GZ6A 4IVRA 1UDAA 3EIXA 1G8GA 4LBYA 1UJ5A 4PTZA 3RYCA 4ZYWA 3E5MA 3UQYS 1LPBB 3N75A 4QBTA 2QRUA 2DERA 3A4LA 1NSFA 3IP8A 2RGBA 4E11A 2ETVA 2W2KB 1JIVA 3T3HA 2D5LA 1Y7LA 3G59A 3FGPA 4H35A 3TMAA 5LWQA 3FUXA 2H11A 3MOIA 3C5CA 3ZHSA 1YH3A 4XR4A 2GLTA 5C1DA 1QHHA 2XFSA 3G23A 3PX3A 4PAGA 2JY7A 1PK9A 1ATIA 4I9NA 2ZQ5A 1IN4A 2N75A 1OZHA 3GJRA 1IB0A 1NBWB 3PNLA 4HBZA 4DL9A 1HNWB 2XAAA 4U0KA 5P8WA 2ZI6A 1L7DA 3PD0A 4LHVA 2CXTA 5JLJA 4DNQA 3CH5A 1UBMS 4KLNA 5AH0A 2YWXA 1MG0A 2GXSA 4JEUA 5TVKA 3LBAA 1AQIA 5LOVB 4KXUA 2OYSA 1PJAA 3OQ1A 1BHO1 2D59A 4OW0A 1E18A 3JQ9C 1I36A 4ZPXA 4EFMA 3QIAA 1XKXA 5FBVB 3EGIA 4ID3A 1R0XA 3NIBA 3NTRA 4X60A 4MYSA 4QEKA 1VBNA 2VYFA 1GFSA 3HA7A 3MWGA 4N41A 2JFBA 4XJVA 2CCJA 1VDMA 5JNVA 3VYWA 2BMAA 1BVRA 5F2KA 4MAFA 1Q7RA 3B9BA 4GMXA 2J85A 2EVWX 4N3NA 3GEHA 1OC4A 2HQRA 1YRLA 4EB6A 1Q84A 1GGMA 1U28A 4U1RA 4B3MM 1XFAA 1TKBA 4GM4A 3B48A 1CVRA 3RHFA 1TDHA 3CRQA 2YDYA 5KUTA 4TXMA 1MIOB 3QMVA 3HDJA 3IG5A 2ZSIA 3O5AA 4TSKA 1I2ZA 4ZPJA 2HIHA 4MUBA 3DEAA 3OE7D 2I1WA 4Q7JA 3N8HA 3ZGOA 1M2JA 2B20A 1MNAA 2IYLD 2ZUDA 4LJYA 2QEQA 4QLBA 3BWCA 1WXDA 4HZUB 4PRLA 4GS5A 1V71A 3EDOA 3GDWA 4GI5A 1EM8B 4GE3A 4EDFA 4MWTA 4N5IX 3HBLA 4BAGA 5CB6A 2BMEA 3Q8GA 3TSYA 1FTGA 4EVSA 4EFKA 3DT9A 2HO4A 5JS2A 3EGXB 3WLNA 1GCUA 3RKRA 3W90A 5KWEA 1GZHB 3GZNA 3LI2A 1HRDA 4KFSA 1R6TA 2OGWA 3PC8A 4PO8A 3GNTA 4J0GA 2ADOA 4ZO4A 2ENUA 2QLLA 3I1YA 4LJ9A 3CKMA 2IITA 4RMIA 4F7WA 4E07A 1MD9A 4AP9A 2L82A 3OPYI 3PS9A 1XK6A 3NMUF 5ALPA 3C6YA 3PE6A 3F3MA 3SXUB 1RZVA 1V48A 3I5YA 1RLIA 4RTKA 1Q7BA 4DLTA 2AG1A 2NQ8C 4IHJA 2BKXA 1C3OB 4GAEA 3HDVA 4U9UA 1MJHA 2O2DA 4RX1A 5CITA 5AUOB 3D4LA 5CURA 4AMVA 3PVSA 1ZVKA 2MGWA 5I5GA 5IWCA 5ES3A 2YVQA 3UMBA 3GJSA 2J4FA 3K2BA 3D64A 1OXBB 3CF4G 4XM2A 3AEQA 1QTRA 2ZTUA 1K7SN 4LGMA 5HKAA 1XMQM 4CETA 4X7BA 3OZVA 4URFA 1HC7A 2YX1A 3QKUA 4XFDA 1PW7A 1DJMA 2VJCA 2DQKA 2I1QA 4RL4A 3VC7A 3D6HA 3BD7A 5JNRA 3EVEA 2PXAA 3E27A 3R6WA 4BFLA 1ZN2A 4B71A 5CEFA 4GICA 3W9UA 3UMMA 1RJ9A 2XUHA 3L7BA 3NHUA 3KHSA 4EJFA 3HO1A 2XGMA 5CDFE 2H31A 3B7ZA 4BTLA 3HB5X 5IG2A 2OHGA 4DLUA 3ETHA 4ON9A 3SSAA 2C94A 1P6XA 2EAUA 4BO9A 2FDXA 4O33A 2Y93A 3T5AA 2OFPA 5B12A 5MN5A 1B76A 3UT5A 4PCUA 1L5WA 4D9KA 2W8ZA 2WQ6A 1X1TA 2YOHA 1E62A 1MO4A 1K7CA 3D3KA 3GJ8A 3L7JA 2A33A 1XDUA 5SICE 4LZNA 3HPQA 1PTKA 1IIBA 2VBCA 1YWGO 1U0EA 3QXCA 3HDGA 5H68A 4QOZC 1T24A 2W0MA 4N40A 1QZEA 1H2ZA 4ZYZA 1WKVA 4PLVA 1LVUA 2R66A 2BJVA 3A6GA 1HOXA 4EY3A 3D7NA 1AS2A 4YC7A 1QZMA 4G36A 4G5FA 3UGTA 2OV4A 3WYNA 4D56A 1Z6ZA 4PG7A 1KDTA 4EMTA 3JV7A 4QJ4A 4U2KA 1BVHA 1DHRA 2JNWA 4YREA 5IC4A 1YD7A 3LGAA 1K3FA 1GGFA 4CIYA 4QGGA 2IHTA 1BS9A 1JU4A 3SS7X 5A4MS 1QV7A 1CB7A 4E09A 2O2YA 2QD5A 5BXYA 2CFRA 4DDHA 5LYJA 5KTOA 5KOHB 5DNUA 3EVCA 1I9CA 4O4HB 2VJLA 4QGFA 3PKJA 5LP6A 3D0OA 5K3OA 2LIVA 1LBEA 1ZONA 1FQOA 3HB1A 2FZ4A 3SIWA 3FKSA 2AFIE 3PICA 4C4PA 2WIDA 3LVBA 3O4VA 1Y33E 1EK5A 3BPSA 4MI6A 3BXZA 2W6ID 3AESA 1J0XO 1GUZA 3F6SA 1GFWA 5JCJA 3Q7RA 3FCAA 3AVTA 2CMHA 3UJPA 2Q0HA 1T8UA 1JA1A 4I1VA 1OPXA 1PDWA 5JYCA 4FC7A 2I7CA 4DA9A 3IE2A 4RIGA 1HKUA 2HQBA 1H93A 1SUPA 4DUGA 1TZ2A 1T43A 5H80A 1U80A 2J3QA 2X6QA 1FTYA 4EAAA 2LVOC 5HILA 3PEUA 1Z0FA 4NPHA 1RXCA 3KP1A 1T1GA 3FOZA 4NFSA 2WLTA 3G79A 4EEZA 1HNZB 4TVBA 5G2OA 4FEEA 3EHDA 5EUCA 4OK5A 4C7OA 4U2BA 3VU0A 1XLUA 4RK0A 1EVKA 1ZA1A 3MBIA 3UH0A 2G1JA 3OCXA 3PDUA 2FVYA 3UWSA 2JFNA 5FA8A 1M83A 4XGRA 1L5LA 2PCJA 1N3YA 3RI3A 2XZPA 4YACA 1MQ9A 1Y5IA 2DLDA 5B3LA 4O0LA 4WH0A 5EIWA 3ZZ0A 1C7RA 4LVCA 1KI3A 2VAWA 4H0CA 1YHYA 3KKLA 1XDGA 4R8LA 4DMHA 2CHVA 3HUDA 1AKWA 2VJQA 2QM0A 3BXGA 3QU2A 3IMCA 2OZEA 3BRSA 5G3YA 2J3MA 2YYSA 1PNOA 2EFEB 2DCMA 3MC1A 4YAKA 4G4OA 3WLHA 4W1PA 6CHYA 1U65A 1Q2UA 2SICE 3ZNQA 1ZL2A 3ZBUA 4MWSA 4Y9RA 4MH0R 1D9ZA 1EJBA 3UMRA 2DR3A 4ER6A 4CHTA 1T2EA 1SBNE 4OKNA 4R8KA 4URUR 4HS4A 3HXPA 2LXEA 3PUKA 1H65A 2ZB3A 4L0MA 3I05A 3Q2IA 5EJEA 3GEBA 4NDZA 1YQUA 2YZGA 2JA1A 1SD1A 4NJEA 4G1EB 4GPZA 3T1NA 1N1MA 3RRXA 5DM1A 2J7PD 3VISA 3R9XB 4X44A 4ZV9A 1AGPA 1CQWA 3H9BA 5AXCA 1Y6ZA 1Q3HA 3ZU2A 3DTVB 2FB9A 1NF8A 4FQ8A 3Q10A 3RH0A 2BM1A 3RBZA 1KC1A 1NONA 3O0DA 2FFHA 3C45A 4V3BA 5A04A 1YTLA 2E4VA 1WD5A 4RKFA 1JFFB 4MW9A 2IUYA 3WNCA 1VCNA 5ALQA 2VJBA 5KBYA 1G3IA 3FCUB 1N92A 4MKIA 1ORTA 2FAXA 2I8AA 4H08A 3HCNA 3RVPA 2CMGA 2EWMA 3N2EA 2XCUA 3WVNA 2WSYB 4JOBA 3U3RA 1SURA 3QF4B 4R1TA 2H0AA 3LWDA 3R3XA 1GPH1 5C31A 3EUWA 2Y1FA 5ESXA 1PUJA 2GX6A 2DVMA 4GL4A 5JAHA 2H7YA 5HWSA 3EAFA 3RTCA 1UANA 1Z0DA 5A4JA 5GZ1A 2QN7A 2AI2A 5CLQA 2VQEB 3L6UA 4QTZA 3A3PA 1GITA 2A0UA 2BPOA 5MGNA 2B2NA 2LTUA 3DZKA 1NN0A 4BKRA 2JP7A 4IDGA 1PS8A 5IAAA 2GWHA 2AOUA 5AT1A 2PRIA 5CX1A 3I73A 2EX4A 4PIVA 5HW0A 3AEKB 2IUEA 4B6QA 3HVIA 1OWMA 5HJEA 2VNAA 1JW9B 2XJ9A 1G2OA 3NATA 3ZHOA 3SXJA 5KOYA 2E6UX 1B73A 2JJMA 2J1LA 1VHWA 3DZ8A 4GZ6A 3JAMS 4YUWA 5JCZA 3N2KA 3E8SA 2R84A 4GQBA 1FFHA 5EJAA 4WUTA 4OLFA 5JI3E 3QITA 3T41A 4E5NA 1AOXA 1P39A 2C2HA 1CJMA 4B7FA 3DLPX 5AW4A 5FTLA 2XD9A 4LJ5A 1R6XA 4QUBA 1QV6A 4XUGB 4B35A 3I62A 4ZXPA 4B3BA 2VRCD 1I5RA 2RBGA 2QN9A 3CXUA 3C43A 1H69A 4FDVA 3GBSA 3QWIA 5HE8A 3GQBB 1QRTA 1F14A 3T1HM 2H00A 2QUZA 1D0LA 4GO1A 1MEJA 3JRWA 3L3BA 5IJAA 2IHVA 1Y6QA 3OMXA 4LECA 4AMGA 4OTZA 1BE0A 1JVSA 4DADA 3AEUA 3BGWA 4AJ1A 3M6UA 1QQBA 5DEIA 1DGFA 5H02A 2QKYA 3FCSB 5K9ZA 2VBIA 1C2TA 1E2UA 3H4JA 5CT8A 2IFTA 3R3YA 4Y6QA 4RPHA 3FFTA 5JYEA 3IBSA 3TLMA 4QTTB 3UBTA 2HIMA 3KQOA 3DB1A 2ZSEA 2O8NA 5IDWA 4HZGA 2X7XA 4R98A 2OBLA 1JQEA 1THMA 3CLSD 3A6HA 4ARVA 5FNVF 3T52A 2C4TA 4B7XA 5H3HA 3AJAA 3CZ4A 2O20A 2FX2A 1II8A 5AKXA 4EVIA 1Q2XA 3D1LA 4DMUB 1FTQA 3Q8LA 1CJBA 1HDZA 2CKMA 3MTGA 2A67A 2BGJA 3HVKA 2F1HA 1E1RD 2AT1A 2BCJQ 2EZ4A 1U11A 1CE8A 3CZRA 3HKEB 1JFVA 2CHEA 1JHQA 1P9RA 2C9DA 2IEGA 2Q99A 2VYCA 5FRDA 2FZVA 1B7GO 4FT2A 4IM7A 2WWWA 1XHLA 3RS7A 4XI9A 2IU0A 4F4DA 4L02A 3O2JA 2YIJA 2IYRA 2I65A 4U2CA 3B89A 1SBTA 3W04A 1PEKE 3E2IA 4KP7A 1K9VF 4KQIA 4R51A 3Q3HA 5F3RA 3FD9A 4JODA 4BO8A 1W85A 2XF8A 3A6ZA 4ZO7A 3VDQA 1NM5A 4N0QA 2JGDB 2OHJA 3G0CA 3Q0TA 1WE2A 4YI3A 3KQNA 5AVXA 2CXOA 2QGFA 1XAJA 2GZ1A 4ACBA 3F5SA 3IUNA 5EJIA 1XQ9A 2EEZA 1PUIA 2MSNA 3IT3A 4J1SA 3OEEA 1P5RA 2W6ZA 4OGFA 2OV8A 1CZNA 1NY6A 5IJ0B 1KY2A 3G6WA 3WGGA 2AUTA 3ME5A 4NFHA 2RARA 4Z4IA 4DR7B 1NQAO 2DBRA 2C2BA 3M9XA 5FB3A 4MAAA 1BOOA 2DZLA 2QHXA 2C9BA 2RH5A 4BQFA 2MMCA 4R3NA 3UB2A 1JG6A 1JU3A 3ZIUA 2FV8A 1V45E 3NOQA 1RZRA 3DE3X 3RANA 1TC1A 1DLJA 2FN4A 3LG2A 1QIHA 3FA2A 1H2YA 5HOEA 1RAIA 3PA8A 2ATXA 4LKOA 1ISRA 2Z9DA 5EWMA 3C6BA 5C1BA 3IQDB 1IJKA 3EPPA 2YNMA 1GGJA 1JLKA 3CBGA 1F2UA 4MR7A 4P4TA 5DLDA 5L3ZA 2QZJA 4CLXA 3U44B 2Q6IA 1KDVA 3AK4A 4TMZA 1LXCA 4BNDA 2B78A 4LNHA 5EXDA 1GDHA 3DE0X 1OQYA 2ZB7A 4RKWA 3B20A 2GXQA 5FTKA 4AIIA 5L4LA 2YV5A 2GF9A 4CM5A 1Y8QA 1X7HA 3N2GB 4NBVA 3CF2A 3O2SB 4PPNA 1K8YB 4UOEA 4B8WA 1XVIA 3EGOA 4V0MA 4FFLA 5BPFA 1M5RA 2IGTA 3NDJA 5BVHA 3ND5A 3V8BA 4JI5M 4EKDA 2IZ7A 1CS0A 2HTEA 3FI0A 2OLKA 3H9QA 1GPLA 4OSOA 2PQ6A 2GZHA 5FWYB 5FL3A 4JL8A 2QD1A 1F8UA 1QQTA 3ENVA 3HR7A 3HYCA 1ACJA 4KR2A 3RTBA 1YI0A 1GP2A 3OOWA 2MIIA 2P5TB 1P81A 2FUG6 5C4MA 3F98A 4KREA 2FMIA 4I5FA 3CUEF 2KEBA 3F92A 5JRZA 4AMZA 4LRXA 3K1TA 5E0OA 1M10A 2IHKA 4M6WA 4P54A 1DPGA 1QX4A 1IN5A 3LD9A 2R6FA 4EPWA 5HR5A 3Q12A 1M2NA 4AZSA 2A7XA 3RDPA 5F23A 1XPOA 3TYXA 3PNBA 1OFHA 1Z2NX 3QVXA 1P80A 4ZVKA 4WVFA 1VQ1A 4PGFA 3T5PA 3G2PA 2DAKA 3KRTA 4TQGA 3G0IA 5EZYB 1QRUA 3UNXA 1ABEA 3ONVA 2P35A 2E4WA 4NNJA 1BVYF 2RI6A 1F60A 3RUIA 2X0NA 4FWGA 4RA9B 3RJ9A 2EHDA 1KTIA 3TZEA 1FMTA 4FXOA 4AKEA 4V0RA 2BKAA 3WLQA 2YHAA 3HGTA 2G4LA 2W2TA 2XECA 2D5CA 1CK4A 1REQA 4I7EA 3W5JA 1DBWA 1G5IA 4PYRA 3PNPA 3JQEA 1I6WA 3WJ1A 1CUZA 2RAUA 3ER6A 2QDXA 2QTVA 4G84A 5BR1A 1RLOA 2YS7A 4LG2A 3ZUGA 2JI9A 3LC7O 1T1IA 5JAOA 4L7VA 4P32A 4HDAA 5IYZF 4K0RA 2CNKA 2FHSA 1I80A 2PJDA 4M87A 2NWQA 3T1YM 1EFRA 3T35A 3FSEA 1AUVA 2PRYA 1M0EA 1V8PA 1Y8GA 4XGKA 3ANXA