4W5WA

Rubisco activase from arabidopsis thaliana
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
269
Chain Sequence
NLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMAKMGINPIMMSAGPAKLIRQRYREAADLIKKGKMCCLFINDLTTQYTVNNQMVNATLMNIADNKEENARVPIICTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase, chloro
publication title Structure of Arabidopsis thaliana Rubisco activase
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 81
structure length 269
sequence length 298
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4w5wA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w5wA01
4YMSA 1XPUA 4ABYA 4EPTA 2PZGA 4Q9KA 1G8GA 3FHTA 1TMKA 621PA 3NXSA 1HEIA 1G41A 1RRCA 3EASA 5SZJA 1T8UA 4JL6A 3BJIC 3GLGE 2DFNA 4NHOA 1ZNXA 2Q6TA 1M74A 4AWXA 2PZEA 4Q48A 3RS2A 3U6KA 1NN1A 1ZNZA 3W6PA 2RGXA 1XMJA 2V6IA 1H8HA 3BH6A 4OQXA 4R7ZA 4GP7A 1EFHA 1RIFA 1EGAA 3JVUA 2XOKD 3EC1A 3DMDA 2RGBA 1QF9A 3TSOA 3CUEF 1DAMA 4TL6A 2ZRFA 3B5JA 3QBVA 2ZYUX 3SFZA 2QMOA 4QM7A 2OXRA 4DWJA 3IKJA 3CX6A 3DVLA 3WMGA 4A92A 3IIKA 3TKLA 4TMZA 1VG0B 2AK2A 2FZLA 5DN6D 4DCTA 2QI9C 2ZVQX 4YXWA 2X77A 2AL7A 1CR0A 1OB5A 1F5NA 1P6XA 4IOLA 2WIBA 2IUSA 2REBA 2JJ2D 1E4YA 4DLRA 5K8TA 1A4RA 1ZNYA 3K9GA 2F55A 1QDEA 1ZM7A 2IC5A 1KI8A 1U0LA 3OE7A 5KSOA 4TZ6A 1XCGB 4M0LA 4MKFA 4D81A 2HYIC 3EZFA 2VRWA 2ZM5A 4BFWA 1CTQA 1XEFA 2JCSA 4EDHA 2WPDA 3T5DA 3KQUA 1IY0A 3L0SA 1TEXA 3RRNA 3ASYA 1AGPA 3MLEA 3EWSA 2EFHB 3A1VA 4HSEA 3AF1A 1R5NA 2VP4A 1UADA 3C4JA 4JBXA 1ZUNB 3THYA 5JWOA 1G8PA 1D2NA 4Q7JB 2FPMA 1GILA 2ZRHA 3GLIE 1D9XA 3EZ2A 4TLBA 4LJYA 2JGNA 1KJYA 4G5SA 1M7HA 1DAHA 1N6IA 3VX4A 4C0SA 2YWHA 1OFUX 4PHTA 1CULC 1ZM9A 1G4UR 4XTRA 3VTKA 1P9WA 3NBZC 2YOHA 2FSFA 4TYQA 5L3SA 4GL2A 4IFEA 1KO8A 3CPEA 3EZ7A 4QGFA 4EAQA 1YR6A 3EA5A 3OESA 2EQBA 4B35A 4QGGA 2OFWA 4TQ9A 1DEKA 3BFVA 3K0FB 4HATA 3ZD7A 2B92A 1FP6A 4IVQA 5KDDA 3T35A 3WYAA 1OXTA 3KXLA 4WZAE 1W44A 3MJHA 2PCJA 3EIQA 1YR7A 4CYMA 2BWJA 3CLVA 2OE2A 4MH0R 2H8KA 3B85A 1E96A 4KVAA 1FZQA 4LHVA 2JDID 5EXSA 1NVVR 3FHOA 2EFEB 2Z0MA 4HDCA 2FWRA 4DKXA 3UIEA 5EJEA 3R9IA 2JASA 3ZH9B 5DIFA 3GLGB 4M1KA 1T6NA 5EZ6B 4AD8A 4ZDIA 2OBMA 3A58B 2QP3A 4KYUA 4G3XA 3PR1A 2IWHA 4A2PA 2ZRJA 5C46F 5CM9C 1N0UA 1JR3D 3I72A 3OAAD 3SE0A 1NL3A 4PO1A 1XJ0A 3R7WB 4ERNA 5KHOC 1DO0A 1WE2A 4WXRA 2AXNA 2OEPA 4AKHA 3T15A 3TVTA 3ZGXA 1O3YA 4IDHA 1UF9A 4JT2A 2IL1A 4TLEA 1IHUA 2HF9A 2QPTA 3MG9A 4FN5A 5G3YA 4Z8XA 2O52A 2BMFA 1ZINA 3KKMA 1RW4A 2ATXA 3FKSA 4NCKA 1NKTA 3RS5A 3WHLA 1FX0B 4ZDKA 1ZD1A 3AEZA 3LQRA 4CIDA 4N0DA 1NMYA 5L3RA 4RZ2A 2C78A 1QRAA 4DDTA 3U4QB 3ADBA 1LY1A 1HURA 3FFAA 1AQUA 1XP8A 2GILA 1HT1E 2WMOB 5FI0B 3K0EA 3B13B 1E2HA 3HR7A 1E0SA 1G3IA 2D2FA 4HLCA 3FHCB 1NLFA 2ZI6A 4QHYA 1G1MA 3QXHA 4OK6A 1NVXQ 1D8TA 2WJGA 3RS4A 1NP6A 4NP6A 1GNRA 1JALA 1G3UA 4TYPA 1E9FA 3K0FA 1GKYA 3Q85A 1L4UA 3VAAA 2WHXA 1OT3A 2AD5A 4EUNA 3GLIB 4D0GA 1ZYUA 3LQQA 1GRRA 2PZFA 3B78A 4PZLA 3N2EA 1SVOA 4URXR 5K8UA 2J59A 1W2HA 1NG1A 2VSXA 3B9QA 1MO3A 1OPXA 3E5HA 2FEOA 1GG2A 4N3NA 4NYIQ 1KKMA 1S4QA 2E87A 3V9PA 3AV0B 5KSZA 1HH4A 1UBFA 1AS2A 5EE3A 1Q44A 2CLCX 4JL8A 1VMAA 2H1LA 3EC2A 1ZD8A 2ZYTX 3LX8A 5DYIA 3GLGA 1KKLA 1COWA 4RZ3A 3NEJA 4PC6A 3C14C 3EW9A 2ODWA 5DLQC 2V1XA 3AKEA 2B7BA 4QFMA 4Q1FA 1XDBA 3R7WA 1RC8A 1F48A 3FMIA 1Z0FA 4B34A 3W5JA 1E2PA 1W0KD 3EZ9A 2AHOA 5DNYB 1UBGA 2OAP1 1VIAA 2V54A 2FN4A 5GVRA 5FPYA 4IVRA 1OSNA 3MFYA 1T3LA 3UXMA 4BFUA 2OFOA 2EWVA 4BLTA 2HLDD 1SZPA 1NRJB 3OFND 5CITA 4D4LA 4A15A 1FX0A 1GWNA 1OH8A 1LS1A 3CH5A 4M22A 2DFLA 4LC1A 1VTKA 3NKVA 3U4QA 1H65A 2ECKA 2QU8A 2FG5A 2H18A 4IHQA 3WYGA 2OLKA 4C2UA 4WAUA 4JVMA 4HUTA 2BOVA 1KI6B 3SHFA 1PZNA 1XEWY 1IONA 2RGEA 4LV8B 3KB1A 1VHTA 2VH5R 2WWIA 3QUSA 4OKSA 2YHSA 3U3RA 1CU1A 2YOFA 1TU4A 5FOSA 4XWAA 5JEDA 2C77A 4OI2A 2HXYA 3B1VA 4LY6A 3GLIA 3NIBA 1TUEA 5HCNA 1Z06A 4JSTA 4CEHA 4QKQA 1W2GA 1LS6A 3FVQA 3THGA 2GCOB 2ATVA 1YZTA 5FBRB 4EPRA 4R2IA 4URUR 1Z29A 5HPYB 1KIMA 3MWKA 3QIAA 1RFLA 2XNSA 3CNLA 3LNCA 1II9A 1XTJA 1Z5ZA 1U99A 3AB3A 4B73A 1Z6GA 4D80A 1XEXB 1KTVA 5JFGA 3FMOB 1M34E 4Q1CA 3ZJYA 2GJSA 1MOZA 3D8BA 3U7FB 1G7CA 1Z0AA 3I32A 2MMCA 1E99A 2RCNA 3Q5EA 4FD2A 4PZZA 3TW4A 3RHFA 1HV8A 1P5ZB 3LXXA 5AUNB 1G7TA 2FU5C 4MRPA 5DO9A 2WKQA 2OHFA 3RC3A 3QEOA 4IFBA 3MWYW 4LI0A 5GJWC 1OH6A 4UXIA 3LBHA 3U44B 5FOVA 3MWJA 3A1UA 1E94E 1XTSA 3R8CA 4BZXA 1W36D 4EPYA 2QA5A 2ZIAA 4R98A 4BLRA 2HT1A 3VMFA 1G18A 4G01B 1Q1EA 1VG9B 1JBKA 4XD7A 2H16A 4M9QA 4Q01A 4AYWA 3WXMA 4B75A 1T9HA 1F6BA 1OLOA 3O8RA 4WXPA 3UG6A 5JJKA 2XNDA 1OIWA 2YWGA 1YZGA 2Q21A 1QHYA 1FW6A 2FZ4A 4OQFA 1OHHD 3AVTA 2J46A 1KI6A 3K70D 3WRYC 1E2FA 2RGNA 1NNEA 1NSFA 1WCV1 1KI9A 3AP1A 3J81k 1WBDA 4KLZA 2CE7A 2VSFA 3SFVA 4RKEA 3BE4A 1Y3AA 3G82C 1J70A 2GESA 2BMJA 2QP9X 3AF0A 2F43B 1XTRA 1SVIA 1KSGA 1X6VA 2JLRA 2WOOA 4IW3B 1GAJA 5C2JB 1E98A 4LSGA 3SYLA 2UZ3A 2ZUCA 2JLVA 2WSSD 2Z83A 1TQDA 1US8B 5EXXA 2XSZD 1X8LA 2GCOA 4Q4JB 5D3MB 4KO8A 3AVWA 1OJLA 3NEYA 3QKTA 5JHGB 1GOTA 1DAGA 1IOZA 2QMHA 2ANCA 2J0VA 4QGAA 1XJQA 5FBWB 1NMZA 1GITA 4PPNA 4EPWA 1DVRA 2F3RA 3K9NA 1X8JA 4TN1A 1Q12A 2ORWA 4NKRA 1G3QA 1L4YA 1XEXA 1N3BA 2ZJZA 3QVVA 3P1JA 3L8YA 1W47A 1EFRA 1P62B 1UJ2A 4JYCA 4LYHA 3K8YA 4P33A 821PA 2IYVA 2HV8A 4Q1DA 1YR8A 4LJ4A 1QHNA 4CW7A 2QTFA 3GJ4A 4JLVA 3EIHA 2J9RA 4PSKA 4GZLA 4LDJA 1LVGA 1GIAA 2MSCB 2VHUA 3RSOA 4P31A 3RYTC 3DO6A 2QGZA 4H9GA 2I3BA 2FJUA 5AUQA 1NN5A 3B1YA 4B3FX 2NZ8A 1CR1A 3SYNA 5FTNA 1B23P 1BIFA 3SBDA 3QSYA 3U44A 1SXJD 4NMMA 2IUUA 3A6PC 4K8OA 3K9HA 2ZRKA 2ZRPA 5F9HA 2FEMA 4WW0A 4X8OA 4V0LA 1U9IC 2IS4A 3B1ZA 4B3CA 4OI0A 4TMKA 2G0TA 2XTNA 3B1XA 3CRQA 5HR5A 3LO5A 3OEED 4B33A 4TYNA 5AWFC 4QJ5A 5CDFE 2XB2A 5SZHB 2R6GA 4U00A 3RS7A 5F98A 4C2TA 4S2EA 2JEOA 1GZSA 1S0UA 4LRWA 2VIIA 3GJXC 3AVXA 1OKKD 4L9WA 4GMXA 1B0UA 2ZE5A 1SVWA 1U9IA 4LX0A 4Q66C 4URYR 3AVUA 3PEWA 2QGNA 2VP2A 1E79D 2ZYWX 4JL5A 1T3HA 3GP8A 1G7RA 4PSVA 2GNOA 2ZYVX 1S1MA 4LWZA 4E5UA 1YVDA 3CRVA 1QG2A 2PEYA 1IN5A 2JAQA 3K0AB 5KSPA 3R9XA 1E9AA 1FUUA 5F9FA 2F43A 1N5JA 3H86A 1Z0DA 3ICEA 3CR7A 1YRBA 2ONKA 1R0XA 2R6CA 1GNPA 3THWB 4A36A 1US8A 4DRZA 1CRPA 3B1WA 4UXJA 2WV9A 1P72A 3H2YA 2XOKA 4Q4JA 5D3MA 1FOEB 2D4HA 2W2TA 3GLHE 5KYKA 1JPNA 4NDZA 1IY1A 3B7GA 4KSBA 4AIIA 3OIWA 5IRCD 1MKYA 1VECA 5BYJA 4PAOA 2R6DA 2J1LA 2ZRNA 4XVRA 4MYTA 1UPTA 1CRQA 2ZI7A 4NU0A 2P0EA 3PUYA 3WBKA 1Q0UA 2WWFA 4BASA 2VPPA 1NF3A 5G40A 5DN6A 3RWOA 2PL3A 3SI7A 4JVNA 4A8JB 3MD0A 2QMEA 4XH9B 1NBMD 3SU8A 5C18A 5TV2A 3C41J 1IJFA 2QE7D 1ESMA 2NQ2C 3TUJC 1ELOA 4M9SA 5FBLB 3LBNA 4D4KA 3D31A 1FP7A 4Z8YA 1Z0JA 1P3JA 5IHPA 2IWRA 3M4YA 5TVKA 2A78A 2G3YA 3AF3A 5FTJA 2HF8A 2V7QD 5JWHA 4URWR 1YZKA 5C4MA 4LHWA 2OILA 1AS3A 3BGWA 4FW9A 4DC9A 1T3SA 1J8MF 3RSLA 1ZUIA 5AJYA 4D2IA 1EWRA 4R2HA 4UXHA 1Z22A 1G8HA 2BIFA 2YJTD 4ACAA 1V5WA 4WA7A 3WY9A 4RD3A 3CW2A 1SVMA 1VCOA 2B21A 5AR1A 2X2FA 1KO1A 2ZJAA 5FL7D 1EFUA 3PEVA 5JI2E 2QT1A 3HU1A 3IQXA 1UDWA 3QVUA 2F7SA 2IXGA 1U0JA 2OG2A 1G20E 2HEIA 3SHWA 1U98A 4P4UA 4XTCS 3WP1B 4DXAA 1EG7A 1N0VC 1HA3A 4ARZB 4BLOA 4HUQB 4HZIA 4P32A 5CYPA 2YC2C 3GJ8A 5CJPA 4GPTA 5GJCA 2ZS7A 3K0AA 4LJ6A 4M1YA 3H84A 3U60B 2F6RA 1Q22A 3ZIAD 2QENA 4US1R 1EXMA 5JBQA 2O5VA 4GBMA 2CDNA 2IYXA 1CS4C 2RH5A 4OQMA 4PQYA 3THWA 4KYIB 1L8QA 2A7QA 4L9SA 2JDIA 5C4GB 3SZRA 3KFVA 4JBWA 1IY2A 1SKYE 2OT3B 4NL4H 3N70A 2UZIR 1YHNA 3I1FA 4DLUA 2LWIA 3A36A 4PO8A 2UKDA 3CF2A 3HJNA 1G6HA 1KO7A 5SZIA 3PUZA 2BC9A 4AKEA 4TTPA 3AKCA 1Z8FA 2A30A 2VYFA 3BH7A 5IF9A 2O8EB 3BC1A 4KCGA 1JR3A 3GMTA 5TDHA 4A8JA 3UK6A 3BRWD 1KO4A 2BKUA 1SVKA 2QUZA 1IBRA 3HYTA 5GJBA 2HXSA 2VHTA 3GLHB 1IM2A 1CJTC 2GJ9A 2EFDB 2F1JA 2FFBA 2IS6A 1EESA 3BORA 3OIVA 4LJ8A 2ZETA 4DSUA 4LHYA 1NLYA 3I5XA 2AKYA 4K46A 4L5BA 2C04A 2Z5FA 3M1IA 4DDUA 2DWPA 4HLDA 1E2NA 3OF5A 1RYFA 1F2UB 1P61B 5KNDA 2LCFA 2ODNA 4X8LA 4IRUB 1FUKA 4V02A 4AI6A 1AKEA 3LX5A 5G3ZA 3VHLB 1I4LD 4XOIA 3QNUA 2KBEA 3TNFA 2FX3A 1AM4D 4QXAA 4C0HA 1M6NA 2PLRA 2O8FB 2CK3D 2VP5A 4DEYA 3WP0A 1TQ4A 3ICQB 4JLMA 4GOJA 2V1UA 1U8YA 1BYUA 1R0WA 2OFXA 2GRJA 3LRPA 1QHGA 5JEEA 3BB3A 2IT1A 1MH1A 3IQWA 1KDRA 4HB0A 521PA 2W6IA 4ARZA 2JLSA 4HUQA 4N0EA 1A5TA 1GDDA 5BN3A 1GL7A 1LV7A 5J4VA 1G21E 2C2HA 1G291 3BB4A 4TSFA 1H8ED 4W5HA 2QTHA 4LZZA 3W8NA 4XWOA 2HYDA 4Z51A 3IUYA 3ZS8A 5CDFA 1ZVQA 5EE5B 4QM6A 1OFHA 1F3OA 2WJIA 2R2AA 4LV6A 4D26A 1KZGB 2RB4A 1SHZA 4MITA 2A2ZA 4LBZA 1QVAA 4OL0A 5E7IA 4CEJB 2YNMA 3BERA 2J5XA 2YINC 4FWIB 3B6EA 2OBLA 3CIOA 5HZKA 4BE7B 3W9YA 4ZV4A 1Z28A 3K9LA 2CNWD 4BFXA 1TX4B 4FMCB 1ZP6A 3U7HB 2CHQA 2HCBA 2O8EA 4L16A 3QY0A 1Z07A 3TJZA 5KPDA 2ZI3A 2WICA 1ZW6A 2GK6A 4YDSA 1RRGA 2F9LA 3DZ8A 2B6HA 1ZM2A 3UWKA 2BM1A 1KDTA 3GLHA 2IEYA 5JI3E 2ZITA 4ZCLA 4X8HA 3GJ7A 1SKYB 3QOFA 3QPWA 4NCJA 4B71A 5FPHA 1JECA 2ZROA 4JMPA 4DUGD 2CL0X 3T34A 5FOXA 3HU2A 3X1ZA 4LJ5A 3V4RA 2BHRA 2NZJA 3C15C 1HUQA 3NWJA 5J4LA 2P6NA 4KI0A 1F2UA 1X1RA 3TW8B 2ZRGA 2PMKA 3DZDA 4RCYA 1NVVQ 1YJ5A 2NO7A 2X2EA 2PJRA 1D2MA 4WVFA 3W6OA 5DI9A 3T12A 4LPSA 2GZHA 2RHDA 2ZR7A 2HJGA 3E2IA 3ETLA 1PUIA 4BZQA 2GJKA 3RABA 2O8FA 4LBWA 4M21A 2AFIE 4ZI2A 1I2DA 1J2JA 2GXQA 4JLNA 3ASZA 3PITA 4HAWA 3ZLJA 2VP9A 2WMNB 2J0UB 4OHXA 2JLZA 3TGPA 1FTSA 1OIVA 2WJHA 3L0PA 1FMJA 3EG5A 1JEEA 2OZEA 4RD0A 5A5GA 2ASEA 2QEQA 5CJ2A 1E2LA 2QORA 2RGGA 3CO5A 4FMCF 1SVSA 2GA8A 4B47A 4G5RA 1W49A 2W0MA 4Q9IA 4MGIR 1M7BA 1A2BA 1W4BA 2VQSA 2GHIA 2IYRA 3B60A 4TLAA 1E1QA 2H17A 1W0JD 4CEJA 1QVRA 3KQLA 3PEUA 4JLDA 2VLIA 3ZVMA 4D6PA 4LYAA 1NMXA 1OV4A 1S2MA 1ZNWA 2IXFA 5JS7A 4TYYA 1XRJA 1E3MA 3TR0A 4V03A 4YLGA 3TSWA 3FFBA 4IDNA 3ZDQA 5EXPA 1GTVA 2W58A 1S96A 2AWNA 2Z4SA 2QRZA 3BAFA 3NBFA 4MQBA 2OCPA 3D6TB 2F1HA 4M1WA 1L2TA 3TQFA 1YZQA 4NYMQ 2YKGA 4LYFA 4AY2A 221PA 2OCBA 5CK5A 3SJBA 4C4PA 1R7RA 3K0CC 4MYHA 5A4JA 3P4YA 4O2LA 1JAIA 5FTLA 5IK2D 1E2DA 4O0MA 4JLKA 1WA5A 3GJ6A 3RAPR 1Q1ZA 2RGCA 3PG5A 4B48A 3T61A 2WWYA 3I3SR 3SOPA 1JJVA 4BGDA 2F3TA 1DE0A 3FKQA 3EX7C 3K0CA 5GVSA 1E0JA 2GBLC 1OXUA 5J47A 1Z6XA 1IN8A 1DELA 1QHXA 4PX9A 5EP4A 2QSZA 3RS0A 4B2LA 1EFTA 3DM9B 1KNQA 3TK1A 4JS0A 1AK2A 3PV0A 1JNYA 4DLWA 2A5GA 4DLZA 1W5SA 2QZ4A 3GFOA 1I2MA 4JLBA 2J0UA 4AKGA 5FR1A 4TMWA 4DLXA 2D06A 4JZKA 2Q3FA 3KJHA 3EWAA 2BVNA 3CR8A 2GBLA 2JLQA 1R8SA 2GKSA 4JBYA 4PZYA 3KQNA 4GT1A 5F2EA 4OHZA 4LUCA 1S3SA 4B43A 1JXOA 1E4VA 3V4FA 1BYIA 3SDZA 4D4JA 1X3SA 2CLDX 1AZSC 1KSJA 1Q20A 5FFMA 1MRNA 4BFSA 1DOAA 1N0WA 4HDOB 1GP2A 3A4MA 1XB2A 2Z43A 3FTQA 3BFXA 4UJ3A 8OHMA 5JSZB 2ZRCA 1KK1A 4Z1MA 1U8ZA 1MO4A 2R65A 3SNHA 5HE8A 5J40A 4PR0A 4H1VA 3KUDA 4BWYA 2ZVPX 3BK7A 1OH7A 4PSAA 1NVUQ 3NH6A 4QGHA 3EARA 5TMPA 5BQ5A 3IILA 3CNNA 3THXB 4DCSA 4C3ZA 3E70C 4LHXA 1Z3IX 4JYBA 2NGRA 3IHLA 2Z4RA 2ZJYA 1JXMA 2UVQA 4I4LA 5LB4A 2GJ8A 4NZYA 2XJ9A 1ZIPA 4B6EA 3F5FA 3E1SA 5FTKA 4ITRC 1RVDA 1BKDR 2B8WA 2V8OA 1H8HD 2NOAA 4IVPA 5ANRB 3VX3A 1ZC3A 3H4MA 4HAVA 4C0QC 1YE8A 2DYKA 1KI3A 1EFCA 1OW3B 4KXFB 4LK2A 5H8WA 2W83A 1TF2A 4M4SA 4CEIA 3NC0C 2QQ0A 2FFHA 3P20A 1R2QA 4NYJR 3UMRA 4M1TA 4U7DA 4OI4A 3PUXA 2WAYA 3VR2A 3KDSE 2CL7X 3QXJA 1UKZA 2HJVA 1AIPA 4RSGA 4YXWD 1OB2A 1GFIA 2W6JA 3OHMA 1BMFA 3LVQE 4JLOA 4GI7A 5KOYA 4M1OA 1N2CE 1GNQA 4UNPA 2ZJ2A 3C16C 3FPAA 2R8RA 4PQFA 3OE7D 1RRFA 4XSGA 4DLVA 2ZANA 1RYHA 3IBGA 5BYKA 4Q7LA 2QY9A 4YMWA 5G53C 4PAMA 1VDZA 1K5DA 4FMBB 2FNAA 4F7WA 3BIFA 2WPDD 3EPKA 2NIPA 2V55B 1NVWQ 1XZPA 2XEXA 1VG8A 3DDCA 4G1UC 3S1AB 4I1SA 4P0TA 3SJCA 2QNRA 5LDDC 5SZKB 3F0TA 2JLUA 1Z2AA 5B64A 3I4LA 5JSZA 4NYIR 4ASUA 3X2SA 2IYUA 5LPNA 2BCGY 2JA1A 2GAOA 1DO2A 1Z08A 4PXAA 4KSCA 2IF0A 2WZQA 2XXAB 1IQPA 3I73A 1E69A 2QRNA 1R6BX 3C5HA 3ZD6A 5BN5A 5JLJA 4TZ0A 1NBMA 1ZJ6A 2GAAA 4MUAA 2J7PA 3MCAA 4UNRA 2QE7A 3THXA 1UDXA 1FNNA 3MRSA 3KKNA 2ZQ5A 4W9MC 4DZZA 1N5KA 4OI1A 5CYOA 1NN3A 3SC3A 2FOLA 3IDQA 4HB4A 1NSTA 2ODEA 1Q3HA 2DCUA 1AS0A 3HYRA 1TPZA 3O8BA 1UM8A 5E95A 3LW8A 3VKWA 2P5TB 1XNJA 3CBQA 2O8BB 2A5YB 3Q7PA 1UEJA 2A3RA 1UKYA 4XVUA 2D74A 5CLQA 3VR6A 2KI5A 2RGNC 3SJAA 2PLFA 4TQAA 4QRHA 1XTQA 2HT6A 5KDOA 1WF3A 3H0KA 3QKRB 2CHGA 2EYQA 5DHAA 1NJGA 4JVLA 4LJ9A 2EFCB 1D5CA 2C8VA 2RAPA 3AGPA 1Z6TA 3HP1A 1E1RA 1HE8B 3PIRA 3PUVA 3RC8A 1E2KA 2W0SA 3VR5A 5HKKA 1DAFA 1S9DA 1XMIA 3SYKA 3D7MA 2RHMA 4DCUA 3VFDA 3X1DA 3OEHA 2VBCA 1E2EA 3THOA 2ZJ5A 1ETUA 3GEIA 1TQ6A 1LTQA 1FQJA 3FOZA 2ORIA 3BH0A 1W7AA 3ONWA 1JR3E 3S1AA 1G7SA 4XVQA 1QHSA 4O25A 1C1YA 4TTQA 4A6XA 2AXPA 2NO0A 4Q9JA 1XMSA 2ZU0C 1S8FA 1GL9B 4N1AA 3L0IB 4GOXA 4B74A 5G41A 1P2TA 2VHCA 3AVQA 5AJZA 2XXAA 5CM8B 5LD2B 2FMXA 2GXAA 2BJVA 2P5SA 1UKVY 2BKEA 2YWEA 4B6FA 2WVJA 5J4YA 2Q9CA 5D3QA 3PJRA 3VR1A 1KI7A 3FE2A 3TMKA 3G0HA 2WOJA 3BS4A 1GM5A 3T1OA 1R10A 2JJ1A 1UAAA 2OLJA 1FNMA 1M8PA 4JKIA 3R8FA 2QM7A 2PH1A 5KTYA 2ZE7A 1FPMA 1KMHB 1DPFA 4TQUS 1G16A 1HQCA 4DSOA 5TARA 4CT4B 3CF0A 2PJZA 3SR0A 4PC2A 3LD9A 2WKRA 2FSHA 2GK7A 4ZCIA 3W34A 4OYHA 1WMSA 4J0QA 2FGJA 1IN7A 4HAZA 2O8BA 4S35A 3HDTA 1WBBA 2HCJB 1TEVA 2QQEA 2ZEJA 1UEIA 2C03A 2VF8A 2D62A 3DPUA 5K8IA 4NCIA 1J99A 4FI3C 3I62A 1XBTA 1U94A 3U6BA 5BW8A 2N46A 1COWD 1DG3A 4AYXA 2REXB 5DHFA 4LBYA 5TY0A 3MAAC 3CH4B 1VIYA 2WWGA 5AUPB 3QKRA 4ESVA 3WMFA 5B58C 1E0KA 1HT2E 3NTUA 3TQCA 3ADDA 1CJUC 2CMKA 1OH5A 2GEUA 3VHXA 1E9RA 1TADA 4MKGA 2JLYA 2TMKA 3UG7A 4JLPA 3EXAA 4A0RA 1ZAKA 2R44A 1S3GA 4RY2A 3KB2A 4XWKA 4Q4LA 4DSNA 1E0AA 1CXZA 4MKIA 2BCJQ 1Q3TA 5LD2C 1KI2A 2CLSA 3RWMB 2IS2A 2DWOA 4D4MA 2IYSA 5DISB 3ADKA 2W00A 4CRWB 1S1CA 3PFIA 3GCGA 1QG4A 1KY2A 1Z6YA 1DAKA 3W3AA 1G6OA 2N42A 1FFHA 3R20A 2G9NA 2XITA 2XX3A 2ZJOA 5HZHA 4LHZA 1TTTA 5EE0A 3M6AA 4QOSA 1E2QA 3I92A 3Q5DA 3C8UA 3TUIC 3IGFA 2A9KA 4HAXA 3LLMA 2G6BA 1TF5A 1FTNA 3RDPA 2JJ2A 1YKSA 2QG6A 4OJKA 4Q5IA 5BWMA 3LA6A 5CB8A 4DB4A 4KU4A 3KJEA 1IXSB 1KMHA 1BOFA 1LFDB 3KKQA 1C9KA 2GJAA 2ZREA 2DWQA 1N6KA 5FUXA 2WBLC 4FIDA 2CVHA 5E7MA 3TIFA 3QI2A 4ACBA 4BEJA 5FR2A 4BPBA 1XJCA 3NG1A 4UNQA 1KI1A 1D6JA 1NIPA 1AKYA 1F2TB 2RKOA 3CX7A 4MRRA 4B44A 1G5RA 4LBVA 5JS8A 4RD2A 3KUCA 4RD6A 5TB5A 2CCGA 4GDFA 1PJRA 1KK3A 1ZCBA 3MJRA 1ZCAA 2D7CA 4WOPA 4KBFA 2QP4A 4HI0E 4UKDA 3OZXA 1HTWA 3DHWC 4PHFA 5FBQB 4TYWA 2Q9BA 3QG5A 1MR3F 3G5UA 4A2WA 2OESA 4ZDJA 4TL9A 1Z2CA 4DDWA 1UBCA 3BBPA 1CIPA 4NH0A 3QKSB 1A2KC 4UNSA 1D9ZA 3DM5A 4Q7MB 2GCNA 4M1MA 2ZE8A 4NTZA 2I4IA 2B8TA 1P9RA 1FL9A 3LLUA 3LV8A 4H1UA 3IBYA 4KFSA 3DL0A 2WJVA 4IDPA 4Q47A 1W0JA 4YMVA 5BXQC 1CJVC 2VF7A 1SGWA 4EIWA 3ZVNA 1FQKA 2C9YA 4HB3A 5E4FA 4XD7D 3AVOA 3EIEA 4F93B 2YOGA 2C5LA 4A8JC 2D7DA 2ZSBA 2VA8A 4DBLC 2MMGA 1WQ1R 4IEIA 4BUJA 3IEVA 4PTLA 1T0HB 2XNDD 4PC3A 4DSTA 5A0FA 4DJTA 3NDPA 1EX7A 1UKEA 4BLQA 1VCIA 1N25A 1UBEA 1DG1G 4PAQA 3LW7A 4QJ3A 4G5OA 1KI4A 4EPVA 4U5XA 5J4HA 1TUIA 4NONA 4MYUA 1SHKA 2WAXA 3OAAA 2V6JA 5HCIA 3IPYA 3VNVA 2R62A 4TT3D 4A0GA 4PHHA 1A7JA 4LV5B 1QHIA 2AK3A 3F8TA 5J4KA 4URZR 4TTRA 4KFRA 3UMSA 3FB4A 5L8VA 1N5LA 3KFXA 4IDQA 4YDHB 4PFSA 4AYTA 2J0QA 4UQOA 1N6NA 1F2TA 1SQ5A 3L82B 4HAYA 2ZS9A 3L0OA 4YMUA 1IXZA 3FMPB 1NN0A 4NCNA 2IYQA 3L8ZA 2IA5A 3A4NA 1A82A 2ZSFA 4TMVA 4AG5A 4KFTA 3CNOA 2EVWX 2NO9A 3EPLA 2NPIA 4MYCA 4Q7KA 3IIJA 1EFRD 4IOMA 4Y0VA 2CVFA 2ZUDA 3BWDD 3NBYC 2JJ8A 4US2R 3L2OB 1IJEA 4W7SA 2PMDA 4EQ6B 3C5CA 4BZPA 1AJEA 1NY5A 1XCPA 1KDPA 3QKSA 1CP2A 1GL6A 5EP3A 5FUVA 3EA0A 4UJ5A 5AK0A 1X1SA 2ORVA 4AG6A 2ZAOA 3ZVLA 3KTAB 5DYGA 5M04A 1LF5A 3Q9LA 2IBMA 4ILEA 3LY5A 1KDOA 2GVZC 2ZR0A 4QC2A 1U8AA 1VYUA 5LBIA 4MKHA 2VEDA 2GEVA 1AGRA 3U5ZB 4Q18A 3NHAA 1JPJA 1KSHA 2AFHE 2SHKA 3FWYA 1G3MA 2KSQA 4QL3A 1LW7A 5EE9A 2FFAA 4E22A 4KJZA 4EFNA 3AQ4A 1TNDA 2J87A 1SXJE 3GJ3A 4F4IA 5EP2A 5L3VA 3GJ5A 1RJ9B 4C30A 1XMVA 4XSHA 4Z54A 2G83A 2ZSAA 1BO6A 5C1BA 1W4RA 4R9UC 1ANKA 2JIZD 3LDAA 2KB0A 2FA9A 3K1JA 3U7EB 5H70A 4B3DA 1KAGA 4WBSA 1NI3A 4IXNA 2GXSA 3AKDA 4D0LB 4LJAA 1ZRHA 1CEEA 1KGDA 5L3QB 1W0KA 1G5PA 1AN0A 1G19A 4JJZA 3SBEA 2D2EA 2IEZA 4NCHA 1XD9A 2BMEA 2OCAA 3KZ1E 2YZ2A 5B57C 1TF7A 2FH5B 2FSGA 2Q3MA 3T1QA 5JMTA 3RRYA 5KO2A 1MABB 1W36B 2HLDA 5B30A 5EUQB 1WRBA 3FGNA 3OFNA 3X1YA 1YZNA 4MDFA 2XTMA 4MGZR 2NTYC 2MSDB 1D2EA 4RCZA 4WZ6A 1OYYA 3B9PA 4WZBE 5EE1A 2GDJA 4JJKA 5JZVA 1P4SA 1E9DA 1GRQA 3KJGA 3TAHA 4US0R 3TSZA 3KKOA 3B8HA 4RD4A 1CKEA 1WDTA 5H68A 3CWZA 1ODFA 3Q3JB 4EQ6A 3NVAA 2ZRAA 1KNXA 3VNUA 3B2EA 3K70B 2AN9A 3VKHA 1J8YF 2KE5A 4QHTA 2CJWB 2PT5A 3QENA 2V9PA 1KK0A 4LJ7A 4M1SA 1YZUA 4EKDA 3KTAA 5GJVC 2AR7A 2FFQA 2I1QA 3UWOA 4KAXA 5DI3B 4ZIRB 5IT5A 1EX6A 3W5IA 3DOEA 3QPVA 1NBME 2F1IA 1G17A 5FTMA 3ZS9A 121PA 2BEKA 2IYZA 2Q3HA 1G8YA 3ZZTA 4RVCA 2QN6A 2G0NA 3K09C 1JI0A 1P2VA 4JIMA 2BBWA 1E2MA 1SVLA 2X19A 3X1WA 4BLSA 2DHRA 2CEAA 4G5QA 2GCPA 1JR6A 4FINA 5AJXA 1Y63A 2ZI9A 3GFTA 2VP6A 1E9EA 4Q02A 1RJ9A 2BMDA 1IN4A 2J45A 1PLJA 2FGKA 4M9ZA 1AA9A 2FPLA 2K5UA 4Q9LA 5BN4A 3HR8A 1E6CA 1W46A 1GVNB 3U7GA 1GUAA 5AJWA 3K09A 3UATA 2ZSDA 1RZ3A 2G1JA 3MWLA 5JHHB 1W36C 4NBSA 1KO5A 2OUKA 3WRXC 2A5DA 5B2ZA 2O8DB 5HE9A 3MSXA 1OFIA 2ODBA 3BXZA 3QXSA 5L3QA 3L43A 3A8TA 3BB1A 3QEJA 1KZ7B 2RMKA 2QAGB 1SXJB 1P7CA 1JB1A 2J7KA 4FCVA 3U3JA 4CDGA 1MABA 3Q8XB 5JRZA 3VU9B 1KAOA 4TL7A 2PT7A 3K70C 4TWZA 2ZRDA 4AC9A 2X8AA 3QJYA 3KQHA 4CEIB 2YVUA 1PLLA 4C0AC 2F9MA 3VR4A 4TMXA 2P65A 1PVOA 3VQTA 3I8XA 1P73A 3PVSA 5H1YA 3GD7A 4A0HA 2IX3A 1MV5A 1Z6AA 5F3WB 2WKPA 4KHZA 3PXGA 2ZJ8A 1IXRC 4QBGB 2B7CA 1O87A 4B2PA 1OHHA 1P2UA 3GEHA 3KKPA 1E9CA 4IOKA 1GSIA 5EQTA 5EXTA 3T1TA 2ZAMA 1U0HC 1LNZA 1YRAA 2CJWA 2VHJA 2QPOA 2KBFA 4RFSB 4V0NA 4L8GA 2FF7A 2IXEA 3VR3A 4BLPA 2WWXA 1XEWX 4DDVA 2G1KA 2GEDA 2HDNB 1KK2A 3SQWA 4MDEA 1HE1C 1W4CA 1Z0IA 4O2RA 3CF6R 4JSYA 2NG1A 5DI3A 4ZIRA 2CCJA 5KNCA 2WIAA 3TVDA 2AD1A 2WSSA 5JCPA 3TUZC 2XGJA 1VHLA 4C0KA 3UKDA 5KSYA 4ESHA 2XSZA 4DVGA 4MUBA 3LBIA 1IAQA 2C99A 1BS1A 1HY3A 2QL6A 4NYJQ 4Q4HB 4Q03A 2DY1A 1OIXA 2FV8A 3TAUA 1NG9A 4YQFA 1Z47A 3P4XA 1KMQA 721PA 1YQTA 2BBSA 1RPZA 2OAQ1 2FSIA 2WM9B 4MGKR 1DBSA 1Z0KA 1R4AA 2AWOA 3QPUA 1ZBDA 4PC7A 4JT4A 2WWWA 4YMTA 4C7OB 2GXUA 2QAGC 1SXJC 4BFYA 3AUYA 1T5LA 3RRMA 2O0KA 4NYMR 2W6ID 2E1RA 2PX0A 4I1VA 5LB2A 4HAUA 4W5JA 3T1VA 3WYFA 2V4ZA 4M9XA 2VHQA 4TSFD 1P9NA 2CBZA 4IDOA 2J3EA 4BEBA 2O8DA 4Q21A 4XIGS 1F60A 3WNDA 4DEXA 1LB1B 3IO3A 2CCKA 4OK5A 2BBOA 3TLXA 2YC4C 4PHGA 2QAGA 1T8TA 1SXJA 5FUWA 2GZDA 4LPKA 4HEJA 1QBKC 4C0LA 3AP3A 4W5WA 2O8CB 3VU9A 3GEEA 2GETA 4TLDA 5FI1B 3ZQ6A 4GFDA 3RANA 2XZOA 2V3CC 4OK3A 2J0SA 3OEEA 4A2QA 2IUTA 3IO5A 4G5GA 1MO6A 5KPJA 1PV4A 1XD2B 2C98A 1K6MA 1WP9A 3FMFA 3BFKA 4DIEA 1XPRA 1MRSA 4JVSB 4XJXA 5E7JA 5HTKA 5FOWA 3CPJB 1JQJC 1J7KA 3TE6A 1ZIOA 3K53A 2AKAB 2YYZA 3EZ6A 1OKKA 3RLFA 1DAEA 3GFPA 3ADCA 2ZS8A 4F38A 3AH8A 3AVVA 3W3ZB 3DEFA 5FH9A 1G9XA 1OF1A 3ZQJA 1E79A 2WWHA 3Q72A 3N5CA 5FPKA 1CF4A 5CIWA 3U3KA 1GKUB 3FYHA 4RFSA 1DARA 2LKCA 4RZUA 2WSMA 4HLQB 2BJWA 2O0HA 5CIQA 5IDVA 4A4DA 2PEZA 4QNMA 3AF4A 1VKJA 1WXQA 1XFAA 1MT0A 2JATA 1N6OA 1OXSC 3GJ0A 3JZAA 2Y8EA 4Q1AA 3SJZA 2L0XA 4KITB 4CGZA 5UKDA 2H5EA 4EFMA 1II0A 1K8RA 2QBYB 4B3XA 3AKYA 1N6PA 1DTSA 1W4AA 4LGMA 2YWFA 4Q4HA 2IHYA 1GKIA 3NBXX 2ZPTX 3EPHA 3QF4B 4BFTA 3CRMA 4D0NA 4OQNA 1VCMA 1V43A 2G88A 2YV5A 4C7OA 5JECA 2RGAA 1VPLA 3M0EA 4KBGA 3ZZUA 2OSBA 2ZTSA 3A1SA 3LH5A 1N5IA 4ZO4A 2BBTA 4I1UA 2N1BA 4IKEA 5FPSA 3IHWA 2CXXA 4C9BA 3CRW1 3B82A 1VG1A 3RNLA 1CBUA 3A4LA 4NE2A 4HDQB 3I8SA 1R5BA 1PUJA 4LC0A 3WBJA 4V0OA 1ZU5A 3IIMA 3W90A 6Q21A 4QG7A 3ZVRA 2V7QA 3ND8A 1RKBA 4F4JA 5E3HA 5P21A 1E1QD 2BDTA 3A1WA 3DMNA 3PUWA 4RFVA 4GZMA 2ERYA 1ZUHA 2ZJBA 4RD1A 4F4CA 2VL7A 3O8CA 1N6HA 2O8CA 3KX2A 4MRVA 1Z83A 4V0ME 2ZSEA 2ZI4A 1I4DD 4Q00A 1NJFA 1R8QA 2ZRBA 1XD2A 3QE0A 3EAQA 4IXMA 2IYLD 4KODA 2GVDC 4OJQA 1UFQA 2LKDA 5JWRA 4HYYA 4PO9A 1G4AE 3PQCA 5FL7A 2EWWA 5KU1A 1C4OA 1CLUA 1Q1QA 3LWNA 1KHTA 1E2JA 1M7GA 4P4TA 3LVRE 4POAA 3REGA 2DR3A 5KDLA 4CVNA 2H92A 4BRUA 3QF7A 3GLFE 2H57A 3QKUA 1RE0A 5AJVB 1N6LA 2XZLA 1HQYE 3CPHA 3Q7QA 2BM0A 4TL8A 3K0SA 4DLTA 4CEHB 4F91B 5FPTA 4BRWA 4IOJA 1T0JB 1JAHA 1CJMA 4KVGA 4OQLA 4QJ4A 4ZDWA 3ZIAA 1Q21A 4FCTA 4BQSA 3U61B 2Q0HA 4L15A 4OHWA 4TLCA 1YR9A 4QBFA 1I4TD 4EPXA 3ND9A 4Y0AA 3FDIA 4B32A 3P26A 1X8KA 1L7VC 3FKSD 4AK9A 2QBYA 2BEJA 3AP2A 3KXKA 1TQ2A 2NPFA 2Q9AA 3EPJA 3UPUA 2EU8A 2XAUA 3QF4A 4KFUA 1XF9A 2IW3A 2WJYA 2R9VA 3P32A 3KJIA 2R6AA 1R5OA 3DKVA 2CE2X 1VCNA 4PPQA 2O0JA 3T06B 4QNRA 3WNBA 3LXRA 3TRFA 1OXVA 4TT3A 1A1VA 2P6RA 3PEYA 3MUFA 5GADl 3PENA 3WNCA 3I5YA 2JLWA 2QSYA 4F92B 4B3GA 1NKSA 1KJZA 4PQRA 1NIJA 4BECA 4DT1B 1CJKC 5FOTA 2BV3A 4Q19A 4DIDA 4LYJA 5DH9A 1CR4A 4DHEA 5JJLA 3U3OA 3AM1A 3UANA 2NMVA 4GRAA 5DE3A 1G3RA 2ZUBA 1E2IA 4Q1EA 2EYUA 4URVR 3SQXA 4FWTA 1E2GA 1YU9A 2H7VA 1TU3A 2ZRLA 2XB4A 4B3BA 3CONA 1K5GA 3CZQA 4JKYA 1EWQA 4Z1MD 1DADA 4M2LA 3IPXA 3I61A 3V00A 2P67A 5FL3A 1E9SA 3P27A 5JCZA 1S9HA 1U2RA 5JRJA 2QAJA 4GMDA 1T5IA 1U90A 3W6NA 4X8MA 2CK3A 3QG1A 2DB3A 2ZR9A 4L4UA 1QZXA 1GRNA 1SULA 3F3YA 4GP6A 4KV9A 3BOSA 1Q1BA 1JEDA 3QQ5A 3CX8A 3QXXA 1II8B 3NHBA 2ZU6A 1VYTA 1N6RA 2D3WA 2IYYA 4QBHA 3CKLA 2P2LA 3OIYA 2CHVA 1QHHB 2NO1A 2XJ4A 5KNBA 1WB9A 2GWHA 2ZE6A 1ZC4A 2PCLA 3O47A 1XWIA 4MA4A 3D3QA 2CL6X 1XXHE 4MRNA 5FUYA 1H8EA 2IK8A 5K8LA 5EP1A 1KJWA 2VO1A 2A5JA 5DSZA 2IHBA 1FMLA 3TBKA 1XZQA 4QHSA 2JLXA 4UNNA 2W2XA 4PPGA 4M8NE 3BD9A 5FBVB 2E9SA 3T5GA 1ZU4A 2FDCA 4B2IA 5JJIA 5AUOB 3GLFB 4PC1A 1XU4A 2ZRIA 4YC7A 2IYTA 4RKFA 3DOFA 2A5FA 2JIZA 1MO5A 1AQYA 2CNWA 2PBRA 2P3SA 3CWQA 4BFVA 1PLKA 3LAWA 2W6JD 1JJ7A 1BMFD 2WJJA 4EFLA 4DCVA 4AKIA 3IEUA 4AURA 3CM0A 4DB2A 1U81A 1X86B 1XD8A 3NH9A 3SS8A 3TH5A 2VP0A 2AX4A 5CB6A 4ZI3A 4CF7A 4DT1A 1XX6A 4G0NA 4ON9A 5TXGA 1KY3A 3JZMA 2C96A 2XZPA 5ELXA 4ZPXA 1AZTA 4DUGA 2ONJA 4II7A 1Q57A 4LOAA 1G8FA 3HWSA 3A1TA 4ASUD 4ZKEA 1EK0A 2DFKB 1R0YA 4MGYR 3HU3A 4CZ2A 2OXCA 4EJSB 3QXCA 3MGCA 3N2IA 4WIAA 4I81A 3WHKA 1ZD9A 1OFTA 1DS6A 5EUMA 1Z63A 2I1VB 4IEEA 2IF2A 4FMDB 4DLYA 4A82A 4P4SB 2J7PD 1DAIA 5FOUA 4LCBA 1NY6A 3NC1C 2DPXA 4QBIA 2EW1A 4U02A 4KLNA 1XCMA 2C9CA 2REOA 4V0KA 2NO6A 3H1TA 1II8A 2QTVB 3RVBA 2DFTA 2PX3A 3AUXA 3HPQA 4O3MA 2F1RA 2QPAA 4RZXA 2QMUA 5CLLA 3W8RA 1QHHA 1M2OB 2C9OA 4V0MA 2EFGA 1NLZA 3CB4A 2J41A 4OHYA 3REFA 2OM2A 3PCRB 4Q4AB 3ECCA 4TMTA 2OO7A 1KSFX 3AVPA 1ZM4A 4GOKA 5KUTA 1ZMXA 5J5CA 2DBYA 4FCWA 4Q9HA 2VSOA 2W2VA 3UMFA 4JLAA 3MMPA 4HZUB 1R0ZA 4RJLA 2ERXA 4Q1BA 3RRZA 3GLFA 3VKGA 2KWIA 2ANBA 5DGXA 3GQBA 3O8DA 4M53A 421PA 4FXPA 4BFZA 4ZCMA 3OIUA 1XXHB 2OV2A 2RGDA 1M1YE 3CRRA 3LFUA 4K81B 4B76A 1E9BA 2X1VA 1XTKA 3KXIA 1OXXK 4C0JA 1E1RD 1W5TA 1YZLA 4E03A 2IYWA 1OE0A 1P60A 5HKKD 3SEAA 4A6PA 1CR2A 4OBEA 2GF9A 3DKPA 1LF0A 5CK4A 3ZZ0A 3OEHD 4EJSC 2G77B 4YONB 3HPRA 1KYIA 4FMDF 3QBTA 1TL7C 5IK2A 2FPKA 2Z6VA 3NDBB 1P2SA 4GNKA 3RS3A 4E09A 2QROA 3AF2A 4D25A 1T91A 2R6FA 3X1XA 1IN6A 2HUPA 2XTZA 3AGQA 1RRPA 4A0FA 4C0BA 4EJSA 4ZKDA 2QM8A 1HYQA 2GZAA 3R9WA 4R71A 1SKQA 3CZPA 4JLJA 1ESNA 4P4SA 4DCNA 1P75A 1ZM3A 4E07A 2JJ1D 4I99A 4PPFA 4DLSA 4I1OA 4CT5A 4P3YA 2IS1A 1J90A 3GPLA 1JQLB 1BH2A 3KL4A 4MRSA 2ZRMA 4A9AA 4GSYA 1W48A 4Q4AA 4D82A 1XPOA 1T4GA 2C95A 2MSEB 1VYVA 3AVYA 1G64A 2P6UA 4NPHA 4HLUC 3U3MA 2VTKA 2ZI5A 4PANA 1E32A 2FE4A 3WMEA 4A1FA 3THYB 1G5TA 4OHVA 4HZUA 1KOFA 2KJQA 3JVVA 4HB2A 3U2QA 1ONBA 1TAGA 3SN6A 3KQKA 1OYWA 1W1WA 2GF0A 1XXHA 2GTPA 2OBNA 2QT0A 3ZYCA 3C7KA 2WTUA 4HLUA 2OCYC 3A37A 2ZXUA 1XTIA 5L3SB 3TR5A 5EZ5A 4IJMA
chains in the Genus database with same CATH superfamily
1CQPA 3S27A 5HIMA 3CG0A 1RRCA 4IILA 3KT8A 1GY8A 1RPAA 1M74A 4AWXA 3T9AA 4PT5A 1LPOA 4OQXA 3AM3A 4GP7A 2WSIA 3SFZA 3TI9A 3HZHA 2AK2A 4FYWA 1L7XA 5L40A 2ETXA 1SZJG 1MNQA 1PJ4A 4D81A 2GD6A 4E33A 1IY0A 4N7RA 4M8LA 4NU5A 1L5ZA 2VYQA 4RMGA 2HKIA 3W7BA 2NUAA 4PCLA 2R25B 2W22A 4B80A 2FSFA 2HRCA 2CW5A 8ATCA 3VDRA 2XXJA 2P9CA 2EGGA 1K5PA 1M0WA 1OXKB 4PBSA 3Q7EA 1CHDA 5C5DA 2JASA 4LRQA 4M1KA 1HL3A 4JP3A 4AM8A 2WFLA 1YZFA 3GQ5A 5HIJA 3FYSA 4BVJA 4Z8XA 2O52A 1RW4A 2ATXA 1LDBA 4YCBA 2OXIA 3H2IA 1QK3A 2G06A 4B3TB 4YN3A 1AQ6A 2RK4A 4DM4A 4OK6A 2VZ9A 3WIEA 3M4ZA 5K51A 4DBGB 4FNGA 1XDGA 4NE9A 2Q7DA 3K0HA 3CZMA 1VJTA 4MIEA 1U5BA 3LQQA 1NU8A 3EGDA 3Q1KA 4MJXA 2VSXA 1BA3A 2CUZA 2E4AA 3V2IA 1TMYA 2E87A 3U6MA 3UT5B 1TVCA 3C14C 5DLQC 4E31A 1F48A 1D1SA 4WCFA 4K03A 3ABOB 5BWNA 3ND5A 3MLAA 2LR0A 4BFUA 1F5SA 1H9CA 4N8DA 1NRJB 3QPDA 4LOLA 1RTTA 1ZXXA 4LC1A 4CG3A 4IHQA 1FNBA 4HUTA 1Q5PA 1Z15A 4REQB 2O06A 1SUDA 2YXPX 4AF6A 3JALB 1TTEA 5CNMA 3D4OA 2D7GA 2PQMA 4I4NA 3SX0A 1C9MA 4GITA 1PEKE 5JFGA 2Y77A 2V9ZA 3CIFA 2FKAA 4YJKA 3LXXA 5K4AA 2WKQA 3R8XA 2JARA 3ZJUA 2UXCM 4HWTA 1NYQA 2Q4BA 1JLLA 2ZIAA 3T8YA 1OIWA 3PLAE 3FPFA 2JKYA 5B12A 4X61A 1GGJA 2AG1A 3FCAA 4LYYA 3J81k 3G8DA 1Y6FA 2F43B 2WOOA 3SZMA 1US8B 3RVSA 2CSXA 4KO8A 2E4XA 1K6JA 1H6DA 3ZOZA 3DEHA 3SBJA 1JEJA 3LOUA 3FWKA 4FDUA 4QVKA 2HV8A 1DGBA 5BSEA 3HY4A 3E7WA 3R5SA 1LVGA 4P31A 3F8SA 4B3FX 3U44A 1VMIA 1O94C 3JY6A 2G0TA 3LO5A 5AWFC 4BLWA 4JUBA 1YS2X 4IIJB 4L0QA 4JDPA 2QWXA 3JD1A 4G81A 4ZAYA 2A3NA 2NV6A 3TR6A 2RGOA 3WGUA 3B51X 2ZWOA 4KO1S 2VS1A 3DF7A 2XCUA 4UXJA 5DCLA 4DV1M 3B7GA 3SQMA 5IRCD 1MKYA 4MR9A 3D8HA 4S24A 5JAPA 4Z49A 1VDDA 4LDNA 4Z5XA 3D7SA 3ZJVA 3KQPA 4YY3M 2I7VA 3C6YA 1IJFA 1Q17A 1GGFA 3UPDA 5IEBA 5DHUA 5FBLB 3E7DA 1P1KA 1FP7A 1P3JA 5JWHA 3H83A 2OVFA 3ETCA 4DV5M 5C4MA 2NX2A 4HJXA 3RVOA 2PE5A 4QU8A 4ACAA 2ZW9A 4CODB 1U0JA 1YZ3A 3OPQA 2YC2C 1QCZA 4UASA 2HA3A 4B7FA 2F6RA 1ILWA 4QEKA 4C4AA 2LVQD 4KYIB 4L9SA 4BO0A 1Q50A 4KPFC 1I7QB 4LJLA 1Y1RA 4AKEA 1TGUA 4DTCA 2OV3A 2VYFA 1WUJS 4I9HA 5IF9A 1A8QA 3QFFA 5CUQA 1HNWB 4GHAA 3D7RA 2B8NA 3FFTA 1CY1A 4OL9A 5HP4A 3HYTA 1ZMBA 3FROA 2F1JA 2ZUVA 3OIVA 2VDBB 2PQ0A 1IB0A 4RHEA 1M8GA 4EHAA 1WZUA 2ZJ6A 5G3ZA 4XOIA 1UZAA 2XLCA 2Q5OA 3I4CA 3RSHA 3U4MA 1ZPDA 4QVIA 3KG2A 1DMRA 3JQBA 4DHWA 5BN3A 4FOSA 4IEFB 5TLSA 3OPMA 4ZTZB 5EE5B 4M86A 2RB4A 3NZEA 3OM0A 3NHFA 3CIOA 5SYMA 1E62A 3V34A 2Y68A 2C83A 4BMNA 2K47A 2ZI3A 4C7MA 1AC5A 4RJJA 4V2UA 2I7PA 1EE2A 2A9FA 2IEYA 3EAGA 1XYYA 2RARA 2XTJA 5FPHA 2ZROA 2RHRA 3T34A 3JATA 1VLZA 4DV6M 2Q4OA 4MEBA 3HBFA 1N0IA 3WGOA 1MHPA 4WVFA 3W6OA 3T12A 3KT6A 2SKDA 3V6MA 3U62A 4UZFA 3X1KA 3D6VA 3I39X 1AKTA 5JALA 4HHEA 2EZUA 3UCXA 4RVSA 1XQ9A 1Z7WA 3UJHA 5IWAB 3KSAC 4RIIA 4EZIA 4B47A 1BGXT 1HG1A 2OO5A 3D2LA 2GHIA 1JLMA 4CQNA 1E3QA 2GPSA 2YVQA 1L8OA 1WXGA 5TF0A 4QATA 3G5AA 3DJYA 3PFFA 3S5UA 1E3MA 3TR0A 2ZM6M 4IDNA 4K1LA 1L2TA 2AFHB 4RACA 5DBHX 5FWXB 4MDYA 4LYFA 1YTLA 5A4JA 4C4PA 1N8NA 1WKBA 2PUCA 3GJ6A 4NCAA 4G09A 5CDSA 3WB9A 4MQFA 4PV7A 1BDBA 5EJ5A 1IBKB 3AHEA 4DLWA 1I2MA 4MVCA 1IIRA 3QM1A 4G1VA 1TVKB 2GKSA 4JBYA 3KQNA 5EWMA 4C01A 3O75A 4REOA 1MRNA 4RULA 2BF4A 3WTCA 4PZ0A 3WGQA 3O8NA 2R65A 3HJBA 1NUUA 1GRVA 3TI7A 4PSAA 2JCYA 3OZAA 3ZCTA 3U31A 1B42A 1SUFA 4ZC1A 1BCSB 2P9FA 5CEFA 3QJ5A 1Y80A 3P0EA 4J7AA 4R9RA 2OLEA 3D3EA 5EPOA 3I2JA 3CE9A 3T3NA 1EDOA 1FLAA 3AHJA 1GNLA 4C0QC 5HWSA 1P0PA 2W83A 1XKXA 4DRYA 3V3TA 5KKNB 1LPSA 3U6PA 2B3TA 1OB2A 1A9XB 1HC7A 3N59A 4KIWA 4EQZA 1WMBA 3K94A 3RT7A 4DLVA 3T5BA 2VAXA 4IDBA 4R1MA 4C78A 3EAFA 3H3JA 3KOXA 1NVWQ 2SCUA 3LQFA 4DLNA 3X2SA 1QQBA 4KSCA 5C3UA 2IRWA 4S2UA 1UDCA 4BNXA 3C5HA 3ZD6A 3C1TA 4XWWA 2QRJA 2B8EA 3N0TA 3PDIA 4O2BB 3SC3A 2I91A 4AF7A 1VSQA 1PWZA 5DM60 1CSEE 1SC3A 1U2GA 4MI3A 1Y34E 1IPEA 2P5TB 3F97A 4AJ9A 2KEBA 4NSNA 5CLQA 3LYAA 5A2GA 1E1CA 1I4WA 3ZGZA 1O6FA 1LJ8A 1WHTB 1Y9AA 4JVLA 4LJ9A 1TRKA 3HP1A 3U56A 1E2KA 3I3OA 5HRAA 3KQMA 1A72A 3GEIA 2P7HA 2V58A 4M83A 1UBJS 3ONWA 3KJQA 4Z3OA 4JNCA 2BFEB 4Q9JA 1N2CB 5G41A 5F7OA 4J0JA 2XXAA 1GPKA 1YS1X 1T43A 3NX4A 1JH8A 1CZRA 2NLOA 1NI4B 5FI3A 2ZBVA 4D3DA 2EG9A 1YVPA 2OPFA 6NULA 1H2FA 3MQ4A 4HXEB 3ZLUA 1AUAA 1RAHA 4UEJA 4DC0A 1XBTA 3CH4B 3T9CA 3QMWA 3NTUA 1L7QA 3CVOA 3EXAA 4AJHA 1F12A 4X00A 1U7PA 1S2IA 3TD6A 4G23A 2DWOA 3QP9A 3OQHA 1WO8A 2AOVA 2HUNA 1XF1A 1Z6YA 2PZKA 1DAKA 4JASB 2GNAA 1NW3A 2QVYX 3MTBA 1ZVMA 3FHJA 2P9TA 1TTTA 4KV7A 5HMLA 1R2ZA 1YKSA 3RVNA 5BOVA 2PM8A 1ESEA 3IAS1 3PXAA 3ER9A 2PO7A 4Q34A 3KUCA 4RD6A 1U4SA 3IELA 3UGKA 4ZC8A 3P4UA 1HTWA 4XFDA 4A2WA 3BXHA 2OESA 1J4AA 3GGSA 1LGYA 4ZYWA 1XQ1A 3K9WA 3VI4B 1YR3A 4RU1A 3L46A 3ILHA 4ANRA 4WKBA 3WYBA 4FR2A 4BNTA 1SIWA 3CZRA 3DL0A 4BMCA 1CJVC 3ZVNA 2V7UA 3M1LA 1BWPA 1L8XA 2PMWB 4G4NA 4A8JC 2OK8A 4NRVA 1IEXA 1NBIA 2NUBA 3ZE1B 3IUMA 3C3MA 5CA1A 4QJ3A 4MVXA 1ZGBA 4NONA 1OZHA 2V6JA 3IPYA 2PKRA 3J7TA 5JCOA 3E5NA 3Q5GA 2HRZA 2R86A 4PQGA 2JFOA 3UV6A 1XZJA 1WX1A 3TF5A 3L82B 4JEUA 2PUDA 2VUHB 1L8LA 4P81A 1FP1D 4MYCA 4YY3B 2REQA 3GJSA 4Y0VA 2TMDA 4UJ5A 4RJIA 3FVVA 2XUDA 5CHYA 2QN2A 3H9UA 3FZEA 1WV0A 4YRZA 3LC0A 4AJIA 4RVHA 3HXKA 1PFUA 1IG0A 3D4NA 3CEMA 1LW7A 2FFAA 1C9YA 1TNDA 3WWOA 3I0NA 4C30A 1XMVA 4XSHA 3LDAA 1JUDA 4TMYA 3RFUA 4A8HA 4B3DA 4W9RA 3UMBA 2XRFA 1YUMA 1OC4A 3UK0A 3GX1A 4NK4A 4NCHA 1JQEA 5B57C 2GEKA 3I12A 3WDMA 3L1VA 2NVUB 4WXEA 4DUPA 2NTYC 3HFSA 3ER8A 3OX1A 1ZIXA 1QGYA 4HAIA 1RKUA 5ITUA 1PL0A 3OSZA 3RV3A 1F4LA 2R00C 4ZQCB 3K6SB 2OUIA 3DA1A 3N86A 1V8FA 3F7NA 1KP2A 3SE7A 3DO5A 3AUSA 4GGOA 4LJSA 3IUPA 2QN6A 3A6EA 1SVLA 5CU7A 2EKDA 3JQ9C 3HB5X 4QSMA 2L4FA 3FTFA 1Y63A 2H31A 2Q5QA 4YGYA 1PLJA 2ZB4A 3HR8A 1W46A 4X1YA 1RZ3A 5JHHB 4QULA 3WRXC 5HTOA 5HE9A 1OGYA 3AFHA 4XJTA 1P7CA 3VDMA 4OU4A 3B1JA 2OOSA 2IZ1A 3A1EA 1T8WA 3LMKA 4C0AC 2IX3A 5F3WB 1C9EA 5A9SA 4MWBA 1VA4A 5I9IA 1QIKA 4FR0A 3AY7A 3BBZA 1YRAA 2VHJA 2O23A 1Y98A 3CF6R 4JB3A 4TRMA 4V38A 3TUZC 1XNHA 2QL6A 4KXVA 3K1AB 1LPNA 4TRNA 4D4HA 1EEHA 3O9MA 1DBSA 4M8IA 2JFZA 4HQ6A 4NATA 2OGUA 2BFDA 2AN1A 3VKUA 3FX2A 2W42A 2VHQA 2BGUA 5DM70 2VJMB 1ZOOA 4JJFA 2WY2D 1GGHA 4S1OA 4BMYA 3O82A 3E46A 4KWIA 3ZWYA 2IV7A 3RANA 3T5CA 2ZM6B 4D43A 3OCCA 1QG0A 2IV2X 1F0KA 3QW4B 2HZBA 5K0JA 2D0OB 4INOA 3WJAA 1OF1A 2JGLA 2IP1A 1SB9A 1GKUB 3V46A 4EECA 5C35A 5IBRA 1OWOA 4NEGA 2FFRA 2Y8EA 3T7AA 4RABA 2QBYB 2Z09A 5C32A 5AW5A 4C0XA 4WLNA 1O97C 2YASA 2H8GA 1ZEJA 2WHRA 1E1YA 4WHMA 2CXXA 4C9BA 3KYJB 3FVWA 2CMHA 3RG8A 3G8AA 3NYQA 2EL7A 4JOBA 4A91A 2V7QA 4H0NA 3A1WA 5ES4B 3O3MB 4MRVA 3L9WA 3OY7A 9ATCA 3QGMA 1MQ9A 1MC1A 4NEQA 4ZAWA 4WKOA 1G4AE 2VQ6A 1E2JA 4OMCA 1IZ7A 4JKOA 1NURA 3FOBA 2XZLA 1L7PA 4LA4A 1T0JB 4QJ4A 1DKLA 1Q21A 2DCMA 3MSCA 3D0KA 4YPOA 3CLTD 1MHTA 3SIRA 2Z3VA 1L7VC 5DGIA 1J8QA 5AIAA 4MQ5A 1VMKA 3V4OA 2EU8A 6PFKA 2IW3A 3WYDA 2R6AA 3DKVA 2P6RA 5GADl 3RJ9A 3MJVA 4OYLA 1C0KA 3QTLA 5JXIA 4Y2YA 5DH9A 4Q37A 1X37A 5DE3A 1L0BA 5AHKA 4UEQA 1JWLA 1DADA 2DQSA 3NT2A 3EDRA 4TXNA 3W6NA 1Y42X 3UMJA 1H9AA 1CY7A 5C8YA 1AB5A 4XDHA 1JEDA 1YT5A 1GPWB 4PQEA 4XYMA 3DONA 2X5KO 4QBHA 5KNBA 3TECE 2CL6X 4CGYB 5CVCA 3DEZA 5K8LA 2Y6UA 2JLXA 5HS6A 5LQUA 4QX6A 1JHRA 4WLEA 2WU1A 4EJ0A 1F14A 4FFWA 2IYTA 1XRLA 3DOFA 1SQ0A 3S68A 2CYCA 1THGA 1JG2A 2O5EA 1TIKA 2AVNA 1WSAA 3NIDB 3L05A 3ROZA 4MPJA 4DUGA 5IJ9B 4II7A 3F78A 3NOQA 2E4ZA 1C9JA 2D8AA 3E5RA 2GTIA 2M6KA 3VTZA 3QXCA 5JSFA 5IMBA 2C7PA 2DKOA 3DE7X 4EO9A 3MA0A 5AI0A 3LHSA 1QE3A 1SIUA 3SXUB 4UQLA 4EB0A 4XVHA 1X14A 2RJ3A 2C9CA 2XOXA 4ARCA 4FFBB 1FFGA 2XRMA 1F6DA 1DKUA 2XI4A 2AQ8A 2IEBA 1NLZA 4D3FA 2VPQA 3T4EA 2GHTA 3AVPA 1QZEA 1DAPA 1ZMXA 4O02B 1K4MA 2YHUA 5A3SA 4MR7A 1SUIA 3VZSA 5HQJA 2C5RA 4HZUB 3LXUX 3R0XA 3B6IA 2CB0A 4B76A 1I7LA 2NADA 5EN4A 2DTDA 5T4FA 3H5WA 2CDAA 2QGFA 1JP7A 5L6MB 3R09A 1UDBA 3TW6A 2I9KA 3UAOA 1BX3A 4CLDA 3AF2A 3X1XA 2F67A 5ALRA 5DJ5A 3SMVA 1M2JA 5BPFA 3WFZA 3MBIA 2WNIA 3JSXA 2Y0DA 3UJ8A 5CTAA 3QE3A 4MHTA 2AG6A 3QVKA 4CUJA 4HLUC 1E32A 3THYB 3R6DA 2ZIVB 4U0JA 1W1WA 5IVIA 2QT0A 3H16A 1YNOA 3WBBA 2JJMA 3UUWA 1H3NA 4MRMA 3BJIC 1RZRA 1ZNZA 3H11B 3O73A 5C7LO 4NABA 3RTDA 3NTOA 4ZQEA 4OAPA 3WICA 2DAGA 2NU9A 4ETIA 3MN1A 5A02A 1XC7A 1RHMA 4DCTA 2X77A 2YJ4A 4M37A 1LBTA 3A6LA 4B4DA 3EZFA 3L0BA 4BFWA 4DMKA 2GLXA 1K98A 3EWSA 4LE0A 2JD1A 2NP6A 1Z0SA 2DX7A 1NOIA 3LDHA 3DZGA 1V71A 4CCWA 4JR1A 4BJ1A 1P9WA 4U6SA 1VEKA 3WQBA 2EQBA 3C70A 3BFVA 4HATA 4L76A 2FRXA 1WB5A 3CLVA 3ZJ4A 3BIXA 1HSZA 3PXCX 3GFBA 1EVQA 4HNUA 1U2DA 3Q1LA 1ZFNA 1G66A 3R9IA 3HSKA 5EZ6B 4Y2PA 4HH4A 4A2PA 3GP5A 1EVEA 3LJKA 4ERNA 4PO1A 2JFVA 4WXRA 4KPEC 4O4HF 1MCZA 3T15A 4LTMA 1QP8A 2H7XA 3FBGA 1EX9A 4NCKA 1KDVA 1NMYA 4RZ2A 4HD8A 1DGQA 2VUIB 3HCOA 5FI0B 4IYRA 1E0SA 1G3IA 3H0EA 2I4MA 2D1YA 4J76A 3I5MA 3UHOA 2CHFA 3KPUA 1IK4A 2CV2A 4TYPA 5HUJA 1CY2A 1KJJA 3CCBA 5AHWA 3H1EA 3GPBA 1QRSA 3I4FA 2IHJA 1HH4A 4M88A 1VC2A 4F5YA 1X1EA 1QR6A 2B7BA 1RWQA 2J3QA 3RUDA 3U7JA 1VIAA 2I2BA 2WDPA 1GUBA 4DV4M 4BCDA 3AZPA 3V7UA 4A15A 1OH8A 1ZIYA 2ZYRA 5DHTA 2DVMA 3OEYA 1TM5E 3C6ZA 4RY8A 2OGZA 1HJPA 1GGEA 5BORA 3A9SA 2C7GA 2KNAA 3LZ6A 1T9DA 3FR8A 5GIOE 2G63A 4NJEB 3VAZA 1HDZA 1Z29A 3I53A 3PHBE 2EO2A 3DKKA 1QUSA 3CNLA 5LIRA 2WT9A 4DQKA 1AK1A 5TPZA 3DFUA 1M34E 2P9JA 4AROA 1G7CA 3TW4A 3UT5A 2RCNA 1H6CA 2HIAA 3W79A 3HYNA 4TTVA 4A5OA 4HVTA 3OPYB 4H1TA 1MAUA 1D6MA 5EKTA 5HRCA 5F78A 5INTA 1Z75A 1FYFA 4DQUA 2Q21A 3SSNA 1V95A 3NRJA 4MV8A 4AZFA 3HJAA 4K87A 4REQA 5HILA 3BWBA 3SFVA 2F5OA 3INTA 3WR5A 2BY4A 1SVIA 1WEKA 5KOHB 1KYXA 3JALA 4MEJA 4DA0A 1COZA 3I6ZA 4BAUA 1OASA 4U2KA 1KIFA 1M8KA 3CINA 5BRNA 3ZHXA 1HLDA 1GNTA 3K8YA 4KXLA 1PNRA 1PS9A 2FHSA 3B1YA 3CURA 1DHRA 2PX5A 1BIFA 1EJ2A 2FEMA 2IS4A 1B4DA 3BGDA 1IBMM 1O03A 1ZICA 1DJNA 4AICA 2I7DA 1O94A 1S0UA 4LRWA 5JE8A 4WTOA 1S7GA 3TFOA 4DPKA 1QAMA 2GNOA 1IN5A 3PNYA 2F43A 5AJUA 1US8A 1SG6A 4QOIA 3W4IA 4GEKA 5KYKA 3GW8A 3TZBA 4J3NA 1NR5A 4FGWA 2PGXA 4MYTA 1TB4A 2WQ6A 2XMZA 3E2PA 3WC4A 3LCUA 2WSCF 5HIAA 3SU8A 3F49S 3F3KA 2Y05A 3AF3A 2V7QD 4NOOB 3PKJA 1VJDA 1QH1B 1FP2A 1B43A 2ZQYA 4UXHA 1LQ2A 1G8HA 4QA9A 3ZXXA 2ZB7A 1A8SA 5CW1A 4IIJA 3GLVA 4JI1M 1F1BA 3CUVA 3REQB 3A2NA 2OG2A 1Z2PX 3SDSA 1JBEA 4R6XA 2YIVX 1WTAA 5F64A 5GJCA 4JT9A 4QXPA 4US1R 1E2BA 5TQVA 1CS4C 5CEJA 4WDRA 2LWIA 4WNAB 4GMGA 1K06A 3D3KA 4NU8X 2WD9A 1P44A 1BD4A 2YWCA 1SVKA 1IBRA 5CBKA 1B6SA 4GR4A 1H2ZA 3BORA 1UMCB 2HA0A 3I5XA 3WLQA 5FB3A 2PV0A 1B16A 4X71A 3PC8C 2XB9A 5BSMA 2J5QA 2H6EA 4JLMA 2JFWA 5EC8A 1U8YA 3N07A 1KDRA 5KNBD 2KW5A 5J4VA 3BB4A 1SOUA 4OQYA 2XCOA 1T9GR 1F20A 3IJ5A 4L51A 2JI8A 5DTRA 2OR3A 3IURA 4XCVA 3EE6A 4WBNF 1VL5A 2TYSB 3PGA1 4DUGD 2FEPA 5LOVB 3I9OA 2Y99A 4L78A 3O6VA 4XZ3A 2PMKA 4OMFG 2WU3A 2QTNA 3CF6E 3RU9A 2HSJA 2OCGA 1BN6A 4TWJA 1RJGA 3EXFB 4BNVA 3HTXA 3TGPA 2WJHA 1FMJA 4UD6A 1JEEA 4RD0A 2QORA 1NE7A 1SXPA 1W49A 1W4BA 2VQSA 2F8TA 4RHUA 4YJDA 1OLUB 3ZK7A 1O6GA 5KC8A 3F67A 1I13A 5JU6A 4B4VA 2Z56A 3GHHA 4D9GA 1DKPA 3EZYA 2OCBA 3U9LA 3WAKA 1LPAB 3AFNA 3LZDA 1FJGB 4B48A 5FAKA 3COJA 1FFSA 2YRXA 4H6WA 4ND8B 3CR3C 3FKQA 1ORVA 3L4EA 1PV2A 1AK2A 3PIIA 3DCYA 2WB2A 3NOOA 4KTVE 4X90A 4JZKA 2G5CA 2J09A 4W1QA 3AYXB 5BQOA 3ENQA 2GBGA 3DE0X 3VPSA 2XE4A 3DVRX 3GAAA 1PFQA 4QGHA 1PCXA 2DAPA 2CVPA 3IILA 3KUKA 3OJFA 3QYEA 5FHQA 4DQXA 4I66A 4JYBA 2AGVA 2AFHA 3L07A 5FWXA 5LB4A 2XJ9A 2OCIA 3JYNA 1RZRD 5FULA 1APBA 4TS1A 1Z9BA 3WMWA 5FA8A 2HU7A 2Q5EA 4CEIA 2P79A 4AX8A 4Y9TA 4M1TA 3KWFA 1ZOIA 2GAJA 2WAYA 3Q9SA 3ZWCA 1AIPA 3OEWA 1TVKA 3E9SA 2ZANA 1ZXBA 2PZLA 5BYKA 4FDAA 4PAMA 2XNJA 4MB7A 3BIFA 1TFRA 4LY0A 3EPKA 2QNRA 5IVHA 3OD1A 2C5EA 3JXEA 5E6JA 2RGYA 2IF0A 2WZQA 5A2QA 3I73A 4MO2A 5IDYA 1BDMA 1U1DA 4UNRA 3P8ZA 4MHSA 1MC5A 1BCSA 3BZUA 4EGQA 1UJMA 4GOND 3U81A 4MAMA 1AS0A 3JZDA 2HHJA 4TV8F 4IJEA 1A7KA 3HHWA 2C2XA 2D74A 5AXCA 2RGNC 3SJAA 3D0QA 1JDNA 2C97A 1LBHA 4IV5A 1A9XA 1NJGA 1NJ8A 2F2TA 3W8DA 1YBMA 3OEHA 5FNVB 4UEKA 4K9LA 2Y4OA 2H2WA 4N3GA 1SHTX 3PC4A 2B99A 1KXJA 4U2BA 3W8EA 2BJVA 3IPRA 3F9IA 3E58A 2H48A 2W4MA 1C5KA 3EBLA 4OQEA 1R9JA 4O2BA 4ZVMA 3Q6IA 3SR0A 4BKOA 1RXUA 3IMGA 2P5TA 5LQMA 4ZZ1A 1IN7A 3FSRA 3HDTA 4Q93A 4JI2M 3JX9A 2O1SA 3M81A 1XVTA 4YJ2B 3H13A 1MUUA 2XY4A 2WWGA 3B38A 1WHTA 3LGSA 2ZT8A 4JYPA 2JLYA 3TAXA 1W87A 1W76A 2R44A 3B2NA 4F86A 3U1VA 1G63A 1T5BA 1Z2EA 3RWMB 1XG5A 1BTOA 1ADFA 3TTWA 2BFEA 5LWHA 1BCRB 5KO3A 1N2CA 2PRYA 4WN9B 2NVWA 4FM9A 3H3FA 1NI4A 3KR2A 2DZDA 1TDZA 5HGJA 1YMUA 1OAOC 3EMVA 4HYEA 2DWQA 1X3LA 3KS9A 1Y4UA 2B1JA 1WVGA 4ZTBA 5BR8B 5FBQB 1NX9A 3ORYA 1JU3A 2PUFA 1TLFA 1NNLA 3EVCA 4NH0A 4Q7MB 3RFCA 4EG4A 1P91A 3LLUA 4Q3BA 4IBOA 4IIVA 4XQCA 1KH2A 2C57A 1EQAA 4P7KA 3SCZA 1RHQA 2F3UA 4DSTA 2HHCA 2QKYA 3R0IA 3RSFA 4LCEA 4EPVA 1EGMB 2H1HA 1U0EA 2ZIWB 1YBFA 1VJCA 1K66A 4AYTA 1QH0A 3TSCA 1F7VA 2JI4A 4KFTA 2WU8A 1O5TA 2IY7A 4CT0A 3X1MA 1Z18A 2G1PA 1E1LA 4BZPA 3DUWA 1C0IA 1QX3A 3BBLA 2ZAOA 3ZJTA 4FPXA 5AIBA 1G1AA 2IBMA 3L49A 2LXNA 5EZSA 1VYUA 5I4IA 5C7YA 2D5CA 3U5ZB 1D0IA 2R4QA 1XVVA 1O94D 3BA6A 1T3TA 3EPPA 1RT9A 3IVRA 3UMVA 3MHVC 1I3KA 2OV8A 4RTNA 3D8LA 2GXSA 3H5OA 2R47A 1GCAA 4NBLA 4D9HA 3UQYS 5C8VA 2IEZA 2LCIA 5G1PA 3QKIA 3U39A 2UXBB 5JMTA 1MABB 2EKZA 3V8MA 2AA3A 1V4BA 1PZXA 1L1ZA 4F5ZA 1DEOA 1WPQA 5GONB 1RHKA 3WIOA 2H00A 3NVAA 2KE5A 3A70A 5DGHA 4CMAA 4GX2A 5IT5A 1U9JA 5JARA 4FQ7A 3A46A 2FMTA 2PL1A 3AONB 2R00A 2HMAA 3N74A 1YQGA 4MWTA 4M9ZA 3CU5A 4FYJA 3F7MA 3AF5A 4P4LA 1YQXA 1RPTA 4CTMA 3L43A 4N3AA 2MSWA 3CNEA 2XOEA 1U0NA 3U3JA 3AMVA 2NVUA 1KAOA 1C29B 3WRXA 2ZRDA 1MV5A 5BY2A 4Z4HA 2B82A 2V8BA 5EXTA 3HZRA 1YRYE 3OCWA 3K6SA 3TL2A 2KBFA 2G1KA 3EFBA 3B3FA 1AVTA 2NG1A 4JSYA 3UENA 1WV1A 3PHHA 4LMBA 5C52B 4DVGA 1HY3A 3KQTA 3MS7A 2PRZA 3W5BA 5AFSA 3EBPA 3QV2A 3AETB 2JGAA 2WWWA 3BHJA 1OBFO 1SQ6A 1PN3A 3AUYA 4AQ7A 1XHFA 5LB2A 3SEFA 4GF5A 2C1ZA 5K3FB 2BLNA 5CYFA 2I99A 2O5RA 4GAEA 1K3XA 1J2RA 2CCKA 3VZQA 3CXUA 5JT1A 1N0HA 5DSTA 5AW7A 3VYSB 1ONOA 4BYGA 4MVJE 4TSRA 3J81A 5DWDA 3IO5A 3FMFA 1N9GB 5F3WA 1ZIOA 4M9RA 3EZ6A 3VC3A 1QCDA 2ZS8A 5K3DA 4LMPA 2K6GA 4MSUA 3DMRA 3HKDB 3LY8A 2HBZA 4HLQB 3FCYA 3AF4A 4NFSA 3HYSA 1MT0A 1O6CA 4CGZA 2O3RA 2E5FA 3WL4A 1U9YA 4BX8A 3K1AA 2ONCA 1B1AA 1V43A 4HWOA 4AJ4A 3A1SA 2DAEA 3G49A 4OIFA 1TIPA 3T3HA 4OH7A 4DCPA 4HDQB 2VJMA 4C6RA 4PNZA 2HY7A 5MHTA 5AW4A 1PR1A 2FX5A 3OKAA 4RD1A 1KJNA 1N6HA 1YR2A 2IYLD 2LKDA 2C5SA 1K8YB 1EE1A 1WDMA 1GQRA 5FA5A 4CVNA 2DR3A 4JENA 3GFFA 2A84A 5MFPA 3CGWA 5B1SA 1L5FA 1S02A 2Z5VA 5D7BA 1CDZA 1HE3A 2AOTB 1BXRB 1C9NA 1UOOA 2OSVA 4UBMA 4B32A 3EFEA 1IAVA 2QBYA 2PO5A 1R9GA 4AK9A 2WIKA 3PFGA 3CZ9A 2ZSIA 4BJ6A 3WNBA 3LXRA 3G0CA 3U13A 3WXBA 4ZQBA 1ENPA 3KOOA 3TD9A 1BU8A 1B7GO 2R8ZA 1CPYA 1W581 1CE8B 3SQOA 1YU9A 1N1EA 1K5GA 5AQEA 1O7JA 4GO1A 1PT9A 3F3YA 5B7QA 4YUAA 1F38A 2XVXA 4RVFA 4P3KA 2H1CA 1T2FA 1N6RA 3FUWA 2XJ4A 1YK0A 4HDNB 4PPGA 2QX8A 1LRJA 1ZU4A 4B2IA 3GLFB 3BMQB 3DEJA 1I0IA 5KEIA 3OQPA 3RROA 1NF2A 3R5KA 1AQYA 3URMA 1LDNA 2WYVA 3KIPA 1Y7IA 5ILGA 1WS6A 4RVUA 2F5SA 3WKEA 2EX1A 4RHXA 2EP8A 4FGLA 1L9XA 4OQPA 1AMNA 1KFJB 1N4DA 3SC2B 5K3OA 1VM6A 2W2NA 4AXBA 1EK0A 1Y4DE 4FOTA 4EJSB 3N2IA 2IF2A 4A82A 4LCBA 3GJQA 3TMAA 2DPXA 3TOZA 2LPMA 4H7FA 1V6AA 4V0KA 2GVNA 1E3IA 1TT7A 2O2IA 4C1BA 2QMUA 4O29A 1QO0A 4CGYA 5DLPA 4P82A 1C7IA 1ZM4A 4GOKA 2ILTA 2XWBF 4CIYA 2HA4A 3GC6A 1KWKA 2VSOA 1QZMA 2GK4A 4CTKA 3DS8A 3MZ0A 3SZ3A 5DGXA 4M53A 3QX3A 4CM9D 5AM0A 3S2YA 1E9BA 3OOYA 4CUZA 3SEAA 4GZ5A 1R1DA 3OEHD 5DBIA 4EJSC 3HPRA 5IJ9A 2WRZA 4HWPA 4R1NA 4GNKA 4YAKA 4D25A 2XYVA 2P4QA 2J07A 3DVAB 2FPXA 1IZYA 3LQKA 1P75A 4GBED 3SXUA 3M6WA 2QQ8A 4FFBA 3TNDA 2C00A 1NULA 3SHVA 2ZJ4A 1TDJA 3IBSA 4UMFA 3ZX4A 4I55F 2YV2A 1KR2A 1EWKA 1G5TA 4HZUA 4ZCPA 2KJQA 1TAGA 3VAYA 2JCBA 3HUFA 3NDJA 2IXBA 2X0DA 3C7KA 4HLUA 1CD5A 3PD7A 3BAZA 3OLZA 4EPTA 4AU1A 1FSSA 2VK2A 3CHYA 3RS2A 3I6BA 1BDJA 1X42A 3HBAA 4YDQA 5ALKA 1MG5A 1WIVA 3P0JA 3DG9A 1ZCZA 2AL7A 2YX1A 5DULA 5IVKA 3GPIA 1U0LA 4OU5A 4KOEC 1HYHA 1YJCA 2WPDA 1TEXA 4GSLA 4HSEA 3THYA 4Q7JB 3GLIE 2HA6A 4TLBA 4RETA 5CFMA 1BJTA 3S44A 4W4TA 1TC2A 3NBZC 4ZJUA 4B35A 2IIVA 2QNIA 3ZZ1A 4YPFA 4DQ0A 2XUHA 4IVQA 4WY8A 3DPIA 4LI3X 2VF4X 2C0QA 1W44A 3H11A 4QU5A 3L01A 2KHZA 1CUAA 2XT9A 1H1TA 3DTVB 3GLGB 3JWEA 2PN1A 5CM9C 1GCGA 3LPMA 1NL3A 4IJVA 2J3KA 3DPSA 5IHXA 5AJTA 4LF6M 2Q8PA 1FDVA 4KVZA 5IKEA 2QPTA 4FN5A 4DMMA 3HCDA 4YYZA 4ZOLB 4QFDA 1LPPA 1ZD1A 4KX5A 2XF2A 4CLOB 1N5OX 4KN8A 3FFAA 4L5JA 2CJFA 5L51A 1HT1E 2XKBA 1RRMA 4EG8A 5IKMA 1CX9B 4TZTA 3RS4A 4B5KA 4NFYA 4EUNA 2HO5A 4URXR 5ALSA 4XI9A 3JR5A 1U7WA 4FFPA 1TIBA 2R5NA 2R87A 4B4KA 3BA1A 4NYIQ 4PYQA 3NWEA 1T29A 5FRDA 5DTQA 4L74A 1RI1A 2C4VA 4PC6A 3AKEA 2A9OA 3GA5A 3IE0A 1E2PA 4ZZIA 5DNYB 5GM1A 3D4LA 4JITA 1OQYA 4FEEA 3NKLA 1XRRA 1FSPA 5L7TA 4DNXA 4Y1EA 2AYYA 1H65A 3BZBA 3M8KA 2OA0A 1P7PA 4S05A 5TF4A 4CV3A 1UXOA 5FP0A 5FFFA 3U3RA 5FOSA 2HXYA 4JY7A 4Z7NB 1Z06A 1W2GA 4ZYXA 4YRSA 2XCIA 1TMGE 1I1HA 1Z5ZA 3OLQA 4EEXA 1P2BA 4B3GA 2M6RA 2QZ9A 1HM5A 1SMKA 2GZMA 1I0ZA 2XYGA 1MOPA 2Z1MA 2SECE 1JBKA 4O59O 3HABA 1K88A 3SIWA 1DJPA 2BZ1A 3UHAA 2FZ4A 3A4YA 4OQFA 3WLTA 4UBNA 3NJRA 1B6TA 2PKYX 5CDYA 2BD0A 1NNEA 1VEJA 3WGNA 1MEJA 1EMDA 2AZTA 2RH4A 1KSGA 2IBSA 4NJEA 4IW3B 4OKIA 1VA5A 3LPAA 3LTNC 2FMFA 1L4EA 5HEKA 2FZEA 2H9YA 1ZA2A 5D86A 1Q12A 2ORWA 3OZCA 1N3BA 4P33A 2V5UA 4PVCA 4CMHA 3RSOA 1E63A 3OPYA 2JFHA 4AFNA 5AVTA 3P52A 3ZV7A 4QOEA 4Q12A 3Q4GA 2Q1YA 1ECPA 4JJIA 3NM4A 1T5TA 4TMKA 2XTNA 1SWVA 3V7NA 3PTZA 1N1DA 4WEOA 1DKNA 1OA0A 4QREA 2UXCB 3U6LA 5LQRA 1EK2A 5KOHA 2IXAA 3HKBB 1M75A 1R0XA 3B1WA 4I08A 1JPNA 1RC0A 1LCIA 5HK8A 1W1IA 1BFUA 2R84A 2I7NA 1NF3A 2HL6A 4A8JB 1NBMD 2GSWA 2NQ2C 2WK1A 2Q6OA 4G1CA 2X3FA 1GZ4A 1FTGA 4D4KA 2G5PA 5TVKA 1O97D 4MKZA 3S8MA 1WSDA 3OT5A 2NT4A 1L5GB 1RU3A 4ALLA 1N2XA 2O2HA 2G71A 2HU8A 3OOEA 1EB8A 2C3YA 3LKZA 4QUJA 5HA5A 1HNNA 3GJ8A 2IP2A 3WQRA 1E3WB 3RPEA 3OKFA 5HG0A 2GGSA 4O1MA 3SEQA 2FWPA 4NL4H 3F9CA 5JMPA 2Y71A 1PNQA 2Q2WA 3KSBC 3L0ZA 1E60A 2JEZA 2GI4A 4ZPJA 1R0LA 2CLKB 2WI8A 2PL5A 3T7JA 4G8JA 2Z2YA 5GJBA 4JHXA 3B36A