2VQEM

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2vqeM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2vqeM02
5ITTA 3U6OA 1R2ZA 3U6CA 1XC8A 4DV2M 1HNZM 5IWAM 2F5PA 1TDHA 3A46A 2HHHM 4JI2M 5ITUA 4KHPM 3GPXA 4PCZA 2F5QA 1HNWM 4JI0M 3TWLA 4NRWA 3GPPA 4JYAM 2UUCM 2OPFA 1PJJA 1IBKM 2VQFM 4DUYM 4X64M 3J81S 4JI6M 2OQ4A 1PJIA 3VK8A 3A45A 3J80S 3GQ4A 2VQEM 2UUAM 2ZBKB 2UXCM 3U6LA 5LMUM 1N33M 1MX0A 4DV7M 4G4NA 1N32M 2UXDM 4DR2M 4DV6M 3GPUA 3W0FA 2F5SA 1I94M 4NRVA 4OX9M 3JAMS 5BR8M 4G4RA 3GO8A 3J7AS 4JI8M 4B3RM 3U6SA 4G4QA 3SAVA 1Z5BA 2XZFA 4LF4M 2F4VM 1K3XA 1L2CA 4YY3M 4GKJM 4YHHM 1NNJA 3SASA 1IBLM 5ITXA 3SBJA 1N36M 4B3SM 1R2YA 4X66M 1L2BA 4PD2A 1XNQM 5ITRA 4DV3M 3SARA 3TWMA 4ITQA 1L1TA 3U6MA 2XZUA 4JI1M 4LF5M 4JI7M 4DR7M 4K0KM 5ITQA 1N34M 2F5NA 4DV0M 1J5EM 1MU5A 3T1YM 1IBMM 5FLXS 4NXMM 4LFAM 1K82A 4DR6M 3SATA 3SAWA 4LFBM 4JI4M 4LF7M 3GQ5A 3VK7A 4DV5M 4G4OA 1XNRM 3U6PA 4PDIA 5LMNM 3SAUA 4X65M 4GKKM 3T1HM 4B3TM 4X62M 4PDGA 3JR4A 2HKJA 4DR5M 3A42A 5ITYA 1Z59A 1Q39A 1Q3BA 3JR5A 4LF8M 1KFVA 4MB7A 2ZM6M 2Q2EB 3U6EA 3GP1A 4JI3M 2F5OA 1L2DA 2EA0A 1XMOM 4JI5M 4DR1M 1TDZA 4B3MM 4DV4M 1Z5AA 3TWKA 3C58A 5A2QS 5IT9S 4CISA 2UXBM 5ITXE 3GQ3A 2E5LM 4DR4M 3DOAA 4NXNM 4LFCM 3OTOM 4LF9M 4DV1M 1XMQM 2UUBM 4JV5M 4DUZM 4AQYM 1L1ZA 2UU9M 1PM5A 4DR3M 3U6DA 1K3WA 1Q3CA 1Z5CA 1HR0M 1FJGM 4LF6M 3U6QA 1HNXM 1EE8A 3GPYA
chains in the Genus database with same CATH superfamily
5ITTA 1G59A 3R8FA 2KHHA 2I7PA 2DAIA 3E21A 3U6CA 2LXEA 4DV2M 1HNZM 4JI2M 3A46A 1OKSA 1PJQA 1GJTA 4KHPM 3E9SA 2Y0TA 5EXPA 1ZMVA 4KT0F 1ZV1A 1GABA 1XB2B 1XWIA 4NC6A 2L2DA 3TWLA 2L4EA 4XBOA 1N75A 1DGHB 2L7HA 2VQFM 4DUYM 3NWLA 2H1RA 3KOZE 4AKGA 2RGOA 2D7GA 3U60B 3VK8A 3RE8A 3A45A 2DAMA 4I81A 4XGIA 2ZBKB 2UXCM 1JB0F 2YFQA 1XHBA 3LMMA 4D80A 4G4NA 1BVSA 3BOSA 1N32M 4DR2M 2UXDM 3FTFA 4OX9M 2EUCA 3GLGB 2DKLA 3SHFA 4JI8M 4B3RM 1HQYE 1OTRA 3GLFE 3SAVA 1QAMA 4KO8A 2F4VM 2QP9X 2Y20A 4GHAA 2XFSA 4FVMA 3THGA 4GKJM 1NNJA 2MJ5B 1VDDA 2BJVA 3KSXA 4M9XA 1IBLM 2YNMD 2QNJA 3LCUA 4MM3B 3VKGA 5EQTA 4JN6A 4PD2A 1PJTA 1OIPA 3LW5F 5FTMA 1ZAEA 2I7NA 3TWMA 2DZNB 2KRUA 3ZCBB 3KP0E 4JI1M 2XEPA 2R18A 2KZSA 4QHSA 4WW0A 3AV0A 3BXWA 4DV0M 2QSFX 1R5LA 1DGGA 3KVWA 4B08A 4S12A 4MH0E 5FLXS 1IN6A 1T3TA 2JP7A 3HJSA 3I4VA 3IHPA 4LZJA 4LFAM 4AG6A 2LVAA 3H4MA 2CV1A 2KZUA 2H5XA 2LHCA 5EXXA 3U5ZA 2GNOA 4LJ4A 4KODA 1Y8GA 1G3IA 3SAUA 2LTUA 3FTDA 2CV0A 4X65M 3UZUA 3PNVA 1DGFA 2R62A 3GRRA 2DWNA 1QAOA 2QENA 3JR4A 4CHTB 3PVSA 3QYBA 1SXJC 1Z59A 3HHWA 5EXTA 1G71A 5FTNA 1Q3BA 2WSEF 3B7ZA 3HU1A 3JR5A 1YE9A 3LQQA 1ORYB 2Q2EB 2RKOA 3VLFB 3GP1A 3B7NA 2F5OA 1XMOM 1V34A 4JI5M 4RKUF 4DR1M 2JZ1A 1PRBA 3GLFA 4DV4M 4LG2A 2MH8A 2KW0A 2L09A 4M9SA 4GRIA 4MGIE 3UMMA 2CHVA 2Y21A 2KXEA 5FSWA 2BJWA 4GEWA 1QYRA 1NJGA 2LVNC 2DWMA 2VF8A 3KS4A 4NXNM 1J7KA 4LF9M 4LFCM 4DV1M 1XMQM 5L8RF 1QANA 5EP2A 1IY0A 4GHLA 4L15A 4AQYM 1PM5A 1IN8A 1T43A 2KNVA 4M9ZA 1Z5CA 4GC9A 4XK8F 4Q7JA 1HNXM 2BWEA 2ZTCA 1PJSA 4FCWA 3U6OA 1IM2A 4REZA 2WSFF 1R2ZA 2M60A 4LGMA 1XC8A 2CV2A 2HHHM 3FUVA 1WHCA 5ITUA 1NSFA 3SYLA 3GRVA 4PCZA 4GC5A 1D0LA 2D7EA 3GLHA 3KOYE 3L25A 3AOEA 1YLAA 4AZFA 5FTLA 2JNHA 2LVOC 1NVMA 3GLIE 2X49A 2OQ4A 1DGBA 3AJIB 1PJIA 1IXZA 2MGWA 4Z8XA 3KFUG 2VQEM 3QAUA 4R3DA 2VDBB 4A3VB 3FYCA 3GRUA 5H37D 5LMUM 3ILKA 1MX0A 1QDRA 3KW6A 4FCTA 4JXJA 4LRSA 3RGSA 2F5SA 4FCVA 4RNAA 1IN4A 1TH4A 2K0BX 4MGYE 3GO8A 4MGHA 2XZFA 1Z5BA 4LF4M 5BPVA 2FS1A 2V1UA 3B89A 1IY1A 1FNNA 1K3XA 3I01M 3LQRA 4B3SM 3SMSA 4X66M 2K6BA 2ZTDA 1P3QQ 3I4YA 1L2BA 1XNQM 2C96A 3SARA 1GL7A 1JQJC 5EP4A 3B74A 3E4RA 3J7BA 2RRUA 1EFUB 4OVZA 3VDUA 5JI2E 1SXJD 2R46A 1QZEA 3HJQA 3MJ5A 5E6JA 2VF7A 1NY6A 1NV8A 4JI7M 4DR7M 1V33A 2JA2A 4K0KM 2LVQD 2EJSA 2Z8YM 3U5ZB 1IN7A 1NV9A 3CTWB 2LH0A 3I04M 3WHLA 3T1YM 4DBGB 1IBMM 2DAEA 1E32A 4IBIA 4LJ9A 4DR6M 2BNKA 3L28A 2HAKA 2V6ZM 7CATA 3SATA 3SAWA 4LFBM 4JI4M 2KRKA 3HHXA 5KPZA 2DVWB 2JXNA 3U6PA 5LMNM 2FH0A 4TUWA 1E94E 2XSZD 3DA1A 3U61B 4LRTA 2KNZA 3FUWA 3IG5A 4I8OA 4PDGA 1RU3A 5DFLA 4X62M 3GLIA 5DYIA 4LJ5A 1LV7A 4MGKE 3GLFB 2O25A 2JUJA 1T6OA 2FOIC 5IREB 2Z4RA 2WSCF 2NQ8C 4CGYB 4L16A 4MB7A 4P16A 5GKNA 3UJNA 1NJFA 2ZM6M 3LVWA 4WURA 4IBGA 3TPZA 1I4WA 1OJLA 2EA0A 1QVRA 1GVNA 1D2NA 2L6OA 4B3MM 3HWSA 1Z5AA 2GQFA 3C58A 2DWLA 1F4IA 1Q02A 2O5RA 3LVVA 3AL0C 4L6V6 2KNAA 4B7GA 2UXBM 5ITXE 3GQ3A 3GLHE 3V76A 1C7YA 2W82A 2CHQA 3SYKA 2E5LM 3HY5A 1DO2A 3Q8GA 4GMQA 3T38A 1LTMA 1TGUA 4PT5A 2LBCA 3HZJA 4DR3M 1ZMWA 2Y0QA 2XLJA 1FJGM 3U6QA 2DAKA 1UFZA 4D81A 3U61A 1EE8A 2G5GX 3GLHB 2KEBA 3W68A 5KPTA 1VEJA 4G3OA 1N77A 1SXJE 3AOEC 1AIPC 4GIPA 1IXSA 5EP1A 1XXHE 2QPAA 2YQZA 1TDHA 4M0WA 2AHMA 4BLCA 1GL6A 5E26A 5FTKA 3TL4X 3GPXA 1VQ1A 1ZQ9A 3HJ8A 3KXEC 4IBCA 1HNWM 3KDSE 3GPPA 3DZDA 2UUCM 3FKEA 1DV0A 1R7RA 2R4EA 3TE6A 3QYEA 1PJJA 3FUXA 1VG5A 4LJ7A 3MMPA 4X64M 1MN3A 4JI6M 2DAGA 3M6AA 3NBXX 4M0DA 3J80S 3GQ4A 3E46A 2CEAA 4AKHA 1R4GA 3UGJA 4L78A 1NHWC 4OU7A 2R65A 4DV7M 5KQ8A 1JR3E 3UK6A 4DV6M 5C1BA 3W0FA 1C1KA 4NRVA 1X37A 2QQ8A 4OW0A 3JAMS 5BR8M 4G4RA 4ZPXA 5C18A 3WHKA 1DO0A 1S3SA 1IFYA 4OVZB 2HWJA 1J09A 1ZMUA 4YHHM 1WJ7A 4P17A 3SASA 5ITXA 2X8AA 3L2AA 1MJGM 4W5WA 4BBAA 2KA6B 2QZ4A 4BB9A 3J2PB 5ITRA 4IBFA 3C3EA 4WP2A 3CF2A 2DWZB 3AOGA 1E9RA 3D8LA 2DZLA 3Q8XA 4NSOB 1OQYA 3U6MA 2XZUA 4ITQA 3R9XB 3K92A 1IN5A 1QUTA 1N34M 3KOWE 5KPRA 1J5EM 1MU5A 4CIZA 1V92A 3K2LA 3HGIA 2CHGA 1SXJA 1K82A 3I51A 3VKHA 4EIWA 1XXHA 2VIIA 3GLIB 3L26A 3SHGB 4LF7M 4CJ6A 1GJSA 4AKIA 1QUSA 5EJCA 4F1IA 5JI3E 3GQ5A 1HT2E 8CATA 4DV5M 1XNRM 3D8BA 2Z4SA 3F92A 3EIHA 3K9OA 2JWSA 3PFIA 3FTEA 1HJPA 4QOSA 4GKKM 2CFOA 1KYIA 4HLQA 3T1HM 4I4LA 5IZ7D 4LGYA 4D82A 4DR5M 4AI6A 3SMPA 4NOOB 1WIVA 4Z6YA 3A42A 1EIJA 2XSZA 1IY2A 1Q39A 3FD9A 4G6ZA 4F2LA 3HX3A 2XF3A 3PXGA 1AUAA 2D7HA 3SFZA 1D0MA 1JR3A 2FFJA 3W0LB 3J27B 4QHTA 3ZQJA 3K8ZA 1YUBA 4B7HA 1L2DA 1WGNA 2R0IA 4II7A 4FWDA 5F3WA 3FUTA 1TDZA 2XGNA 3HU2A 4FWHA 3TWKA 2MROB 3FYDA 1QQWA 3BBZA 3HU3A 3L27A 2P5TA 4L4UA 4B7FA 4IJEA 2O01F 4IBEA 3A98B 3GLGE 1NNUC 3IG8A 3DOAA 1NO1A 3OTOM 4QNMA 2C9OA 4ANRA 2UUBM 1OAIA 4LJ8A 2CP8A 1JR3D 1IXSB 4DUZM 3KS8A 2JY8A 2JY5A 2QBYA 2C99A 2ZAMA 2G8LA 3U6DA 1K3WA 1Q3CA 3AKZA 1HR0M 3FUUA 3CGWA 4RF1A 4GH9A 2M5ZA 2HCBA 5DNYA 3SC3A 2LWXA 4IIWA 5IWAM 2F5PA 3C3DA 3L29A 4NL4H 4QOZC 2N35A 3RGPA 3EIEA 1OFHA 2F5QA 2J7NA 3FTCA 4JI0M 2C9CA 4GITA 4NRWA 4KLNA 4JYAM 1R6BX 2OPFA 1WR1B 2A5YB 3QWLA 4FWGA 2JZ0A 3MHVC 4Y28F 1IBKM 1QZMA 1PGYA 3B9PA 3K1JA 3T6PA 3HHZA 2CUZA 1TTEA 3J81S 5DYGA 1WGLA 3CF0A 3B7QA 2UUAM 3M7GA 2L4FA 2DHYA 3FE3A 4FW9A 2B3TA 3IECA 3VDPA 3ZC7B 3U6LA 3K9PA 1N33M 1DGHA 1TR8A 3VFDA 4AG5A 1GO5A 1NHGC 1GLNA 1G8PA 1YSYA 3GPUA 2JY6B 1I94M 2DZOB 4MGZE 2YR0A 3U60A 1G4AE 3J7AS 1D0KA 2BWBA 3U6SA 4G4QA 4L8RC 2DNAA 2DXIA 3C9PA 1IXRC 1VEGA 1L2CA 4YY3M 4LY6A 3M0EA 1OIZA 1G41A 2C98A 2C5RA 2QHOB 2XFTA 3GLGA 3SBJA 1N36M 2R6FA 1R2YA 2ZAOA 2K9DA 2R4JA 4IBKA 3RFWA 2ZANA 4DV3M 5FTJA 1SXJB 2OOBA 1OAOC 1L1TA 1W5TA 1XXHB 1NY5A 2HL7A 4IBDA 1H6UA 5ITQA 2F5NA 2Z3XA 2LNHC 2MR9A 3MK6A 2DHRA 2EKKA 5KQDA 4NXMM 4R71A 5KO3A 2KDLA 2LVPC 1QDTA 2OOAA 4LF5M 2RGHA 4I5SA 3ZH9B 1KSFX 2R45A 3KP1E 4NSRA 1HT1E 4G4OA 3VK7A 4HL4A 4PDIA 1HQCA 2FE8A 3CF6E 3GRYA 4LZZA 1OFIA 4UN2B 5EP3A 2APLA 2L7IA 2OO9A 2QCUA 4B3TM 3HHYA 2HKJA 4HEOA 2WZJA 2Z7JA 4LJ6A 3AFHA 1CUKA 5ITYA 2EKFA 1IQPA 3DFZA 1L8QA 4LF8M 1KFVA 3KSJA 2CE7A 4FD2A 3TQSA 2J5YA 3HKPA 3U6EA 1E9SA 4JI3M 1GKIA 3H4JA 2J7OA 2FNAA 2X4AA 2V1CA 4LJAA 4QNRA 2ERCA 1N78A 1W5SA 3KOXE 5A2QS 2G3QA 2K47A 2LHGA 1VEKA 5IT9S 1A5TA 4CISA 2QBYB 1Z6TA 2R44A 4AW4A 2XH9A 4DR4M 3NBIA 2EO2A 5EXSA 1TH2A 2JY7A 1TF0B 1VDLA 1WXQA 2DI0A 4IBJA 3PNYA 4R7GA 1UM8A 3W67A 3LCVB 4JV5M 1L1ZA 2UU9M 1TH3A 3FRHA 2CWBA 3FRIA 1QAQA 4IJFA 4IBBA 4LF6M 3T15A 2CRUA 4RF0A 2DENA 1SG9A 4LCBA 3GPYA
chains in the Genus database with same CATH topology
5ITTA 1G59A 3R8FA 2I7PA 3U6CA 2LXEA 4DV2M 1HNZM 4JI2M 3A46A 4KHPM 3E9SA 2Y0TA 5EXPA 3TWLA 1XWIA 4XBOA 1N75A 1DGHB 2L7HA 2VQFM 4DUYM 3NWLA 2H1RA 3KOZE 4AKGA 2RGOA 2D7GA 3U60B 3VK8A 3RE8A 3A45A 4I81A 4XGIA 2ZBKB 2UXCM 2YFQA 1XHBA 3LMMA 4D80A 4G4NA 3BOSA 1N32M 2UXDM 4DR2M 3FTFA 4OX9M 2EUCA 3GLGB 3SHFA 4JI8M 4B3RM 1HQYE 3SAVA 1QAMA 4KO8A 2F4VM 2QP9X 2Y20A 4GHAA 2XFSA 4FVMA 3THGA 4GKJM 1NNJA 1IBLM 1VDDA 2BJVA 3KSXA 4M9XA 2YNMD 4MM3B 3VKGA 5EQTA 4JN6A 4PD2A 5FTMA 1ZAEA 2I7NA 3TWMA 2DZNB 2KRUA 3ZCBB 3KP0E 4JI1M 2XEPA 2R18A 2KZSA 4QHSA 4WW0A 3AV0A 4DV0M 1DGGA 3KVWA 4B08A 4S12A 4MH0E 5FLXS 1IN6A 1T3TA 3I4VA 3HJSA 4LFAM 4LZJA 4AG6A 3H4MA 2CV1A 2KZUA 5EXXA 3U5ZA 4LJ4A 4KODA 1G3IA 3SAUA 3FTDA 2CV0A 4X65M 3UZUA 3PNVA 1DGFA 2R62A 3GRRA 2DWNA 1QAOA 2QENA 3JR4A 4CHTB 3PVSA 1SXJC 1Z59A 3HHWA 5EXTA 5FTNA 1Q3BA 3JR5A 3HU1A 1YE9A 3LQQA 1ORYB 2Q2EB 2RKOA 3VLFB 3GP1A 2F5OA 1XMOM 4JI5M 4DR1M 3GLFA 4DV4M 4LG2A 2KW0A 2L09A 4M9SA 4GRIA 4MGIE 3UMMA 2CHVA 2Y21A 2KXEA 5FSWA 2BJWA 1QYRA 1NJGA 2DWMA 3KS4A 4NXNM 1J7KA 4LF9M 4LFCM 4DV1M 1XMQM 1QANA 5EP2A 1IY0A 4GHLA 4L15A 4AQYM 1PM5A 1IN8A 4M9ZA 1Z5CA 4GC9A 1HNXM 4FCWA 3U6OA 1IM2A 4REZA 1R2ZA 2M60A 4LGMA 1XC8A 2CV2A 2HHHM 3FUVA 5ITUA 1NSFA 3SYLA 3GRVA 4PCZA 4GC5A 2D7EA 3KOYE 3GLHA 3L25A 3AOEA 4AZFA 5FTLA 1NVMA 2X49A 2OQ4A 1DGBA 3AJIB 1PJIA 1IXZA 4Z8XA 3KFUG 2VQEM 3QAUA 4R3DA 4A3VB 3FYCA 3GRUA 5H37D 5LMUM 3ILKA 1MX0A 3KW6A 4FCTA 4JXJA 4LRSA 3RGSA 2F5SA 4FCVA 4RNAA 1IN4A 1TH4A 4MGYE 3GO8A 4MGHA 2XZFA 1Z5BA 4LF4M 5BPVA 2V1UA 1IY1A 1FNNA 1K3XA 3LQRA 4B3SM 3SMSA 4X66M 1L2BA 1XNQM 3I4YA 2C96A 3SARA 1GL7A 1JQJC 5EP4A 3E4RA 3J7BA 4OVZA 3VDUA 5JI2E 1SXJD 2R46A 3HJQA 3MJ5A 5E6JA 4JI7M 4LF5M 1NY6A 4DR7M 2JA2A 4K0KM 3U5ZB 1IN7A 3CTWB 2LH0A 3WHLA 3T1YM 1IBMM 1E32A 4IBIA 4LJ9A 4DR6M 2BNKA 3L28A 7CATA 2V6ZM 3SATA 3SAWA 4LFBM 4JI4M 2KRKA 3HHXA 5KPZA 2DVWB 3U6PA 5LMNM 4TUWA 1E94E 2XSZD 3DA1A 3U61B 4LRTA 3FUWA 3IG5A 4I8OA 4PDGA 4X62M 3GLIA 5DYIA 4LJ5A 1LV7A 4MGKE 3GLFB 2FOIC 5IREB 2Z4RA 2NQ8C 4CGYB 4L16A 4MB7A 4P16A 5GKNA 3UJNA 1NJFA 2ZM6M 3LVWA 4WURA 4IBGA 3TPZA 1I4WA 1OJLA 2EA0A 1QVRA 1GVNA 1D2NA 2L6OA 4B3MM 3HWSA 1Z5AA 3C58A 2DWLA 2O5RA 3LVVA 3AL0C 4B7GA 2UXBM 5ITXE 3GQ3A 2E5LM 2W82A 2CHQA 3SYKA 1DO2A 4GMQA 3T38A 1TGUA 4PT5A 4DR3M 2Y0QA 2XLJA 1FJGM 3U6QA 4D81A 3U61A 1EE8A 2G5GX 3GLHB 2KEBA 1N77A 5KPTA 1SXJE 3AOEC 4GIPA 5EP1A 2QPAA 2YQZA 1TDHA 4M0WA 2AHMA 4BLCA 1GL6A 5E26A 5FTKA 3TL4X 3GPXA 1ZQ9A 3HJ8A 3KXEC 4IBCA 1HNWM 3KDSE 3GPPA 3DZDA 2UUCM 3FKEA 1R7RA 2R4EA 3TE6A 1PJJA 3FUXA 4LJ7A 4X64M 4JI6M 3M6AA 4M0DA 3J80S 3GQ4A 4AKHA 3UGJA 4L78A 1NHWC 4OU7A 2R65A 4DV7M 5KQ8A 3UK6A 4DV6M 5C1BA 3W0FA 1C1KA 4NRVA 1X37A 4OW0A 3JAMS 5BR8M 4G4RA 4ZPXA 5C18A 3WHKA 1DO0A 1S3SA 4OVZB 1J09A 4YHHM 3SASA 5ITXA 2X8AA 3L2AA 4W5WA 4BBAA 2KA6B 2QZ4A 4BB9A 3J2PB 5ITRA 4IBFA 3CF2A 2DWZB 3AOGA 1E9RA 3D8LA 3Q8XA 4ITQA 4NSOB 3U6MA 2XZUA 3R9XB 3K92A 1IN5A 1N34M 3KOWE 5KPRA 1J5EM 1MU5A 3K2LA 3HGIA 2CHGA 1SXJA 1K82A 3I51A 3VKHA 4EIWA 1XXHA 2VIIA 3GLIB 3L26A 3SHGB 4LF7M 4AKIA 5EJCA 5JI3E 3GQ5A 1HT2E 8CATA 4DV5M 1XNRM 3D8BA 2Z4SA 3EIHA 3FTEA 3PFIA 4QOSA 4GKKM 2CFOA 1KYIA 4HLQA 3T1HM 4I4LA 5IZ7D 4LGYA 4D82A 4DR5M 4AI6A 3SMPA 4NOOB 4Z6YA 3A42A 2XSZA 1IY2A 1Q39A 3FD9A 4G6ZA 2XF3A 3PXGA 2D7HA 3SFZA 1JR3A 2FFJA 3W0LB 3J27B 4QHTA 3K8ZA 1YUBA 4B7HA 1L2DA 4II7A 4FWDA 5F3WA 3FUTA 1TDZA 2XGNA 3HU2A 4FWHA 3TWKA 3FYDA 1QQWA 3HU3A 3L27A 2P5TA 4L4UA 4B7FA 4IJEA 4IBEA 3A98B 1NNUC 3IG8A 3DOAA 3OTOM 4QNMA 2C9OA 2UUBM 4LJ8A 1JR3D 1IXSB 4DUZM 3KS8A 2QBYA 2C99A 2ZAMA 2G8LA 3U6DA 1K3WA 1Q3CA 3AKZA 1HR0M 3FUUA 4RF1A 4GH9A 2M5ZA 2HCBA 5DNYA 3SC3A 2LWXA 4IIWA 5IWAM 2F5PA 3L29A 4NL4H 4QOZC 3RGPA 3EIEA 1OFHA 2F5QA 2J7NA 3FTCA 4JI0M 2C9CA 4GITA 4NRWA 4KLNA 4JYAM 1R6BX 2OPFA 3QWLA 2A5YB 4FWGA 1IBKM 3MHVC 1QZMA 3B9PA 3K1JA 3HHZA 2CUZA 3J81S 5DYGA 3CF0A 2UUAM 3M7GA 4FW9A 3VDPA 3ZC7B 3U6LA 1N33M 1DGHA 3VFDA 4AG5A 1NHGC 1GLNA 1G8PA 1YSYA 3GPUA 1I94M 2DZOB 4MGZE 2YR0A 3U60A 1G4AE 3J7AS 3U6SA 4G4QA 4L8RC 2DXIA 1IXRC 1L2CA 4YY3M 4LY6A 3M0EA 2C5RA 1G41A 2C98A 2XFTA 3GLGA 3SBJA 1N36M 1R2YA 2ZAOA 2R4JA 4IBKA 3RFWA 2ZANA 4DV3M 5FTJA 1SXJB 1L1TA 1W5TA 1XXHB 1NY5A 2HL7A 4IBDA 1H6UA 5ITQA 2F5NA 2Z3XA 2LNHC 3MK6A 2DHRA 5KQDA 4NXMM 5KO3A 2RGHA 4I5SA 3ZH9B 1KSFX 2R45A 3KP1E 4NSRA 1HT1E 4G4OA 3VK7A 4HL4A 4PDIA 1HQCA 2FE8A 3CF6E 3GRYA 4LZZA 1OFIA 5EP3A 2L7IA 2QCUA 4B3TM 3HHYA 2HKJA 2Z7JA 4LJ6A 3AFHA 5ITYA 1IQPA 3DFZA 1L8QA 4LF8M 1KFVA 3KSJA 2CE7A 4FD2A 3TQSA 3HKPA 3U6EA 1E9SA 4JI3M 1GKIA 2J7OA 2FNAA 2X4AA 2V1CA 4LJAA 4QNRA 2ERCA 1N78A 1W5SA 3KOXE 5A2QS 2K47A 5IT9S 4CISA 2QBYB 1Z6TA 4AW4A 2XH9A 4DR4M 3NBIA 2EO2A 5EXSA 1TH2A 4R7GA 1WXQA 4IBJA 4JV5M 3PNYA 1UM8A 1L1ZA 2UU9M 1TH3A 1QAQA 4IJFA 4IBBA 4LF6M 3T15A 4RF0A 2CEAA 4LCBA 3GPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITT A;  3U6O A;  1R2Z A;  3U6C A;  1XC8 A;  4DV2 M;  1HNZ M;  5IWA M;  2F5P A;  1TDH A;  3A46 A;  2HHH M;  4JI2 M;  5ITU A;  4KHP M;  3GPX A;  4PCZ A;  2F5Q A;  1HNW M;  4JI0 M;  3TWL A;  4NRW A;  3GPP A;  4JYA M;  2UUC M;  2OPF A;  1PJJ A;  1IBK M;  2VQF M;  4DUY M;  4X64 M;  3J81 S;  4JI6 M;  2OQ4 A;  1PJI A;  3VK8 A;  3A45 A;  3J80 S;  3GQ4 A;  2VQE M;  2UUA M;  2ZBK B;  2UXC M;  3U6L A;  5LMU M;  1N33 M;  1MX0 A;  4DV7 M;  4G4N A;  1N32 M;  2UXD M;  4DR2 M;  4DV6 M;  3GPU A;  3W0F A;  2F5S A;  1I94 M;  4NRV A;  4OX9 M;  3JAM S;  5BR8 M;  4G4R A;  3GO8 A;  3J7A S;  4JI8 M;  4B3R M;  3U6S A;  4G4Q A;  3SAV A;  1Z5B A;  2XZF A;  4LF4 M;  2F4V M;  1K3X A;  1L2C A;  4YY3 M;  4GKJ M;  4YHH M;  1NNJ A;  3SAS A;  1IBL M;  5ITX A;  3SBJ A;  1N36 M;  4B3S M;  1R2Y A;  4X66 M;  1L2B A;  4PD2 A;  1XNQ M;  5ITR A;  4DV3 M;  3SAR A;  3TWM A;  4ITQ A;  1L1T A;  3U6M A;  2XZU A;  4JI1 M;  4LF5 M;  4JI7 M;  4DR7 M;  4K0K M;  5ITQ A;  1N34 M;  2F5N A;  4DV0 M;  1J5E M;  1MU5 A;  3T1Y M;  1IBM M;  5FLX S;  4NXM M;  4LFA M;  1K82 A;  4DR6 M;  3SAT A;  3SAW A;  4LFB M;  4JI4 M;  4LF7 M;  3GQ5 A;  3VK7 A;  4DV5 M;  4G4O A;  1XNR M;  3U6P A;  4PDI A;  5LMN M;  3SAU A;  4X65 M;  4GKK M;  3T1H M;  4B3T M;  4X62 M;  4PDG A;  3JR4 A;  2HKJ A;  4DR5 M;  3A42 A;  5ITY A;  1Z59 A;  1Q39 A;  1Q3B A;  3JR5 A;  4LF8 M;  1KFV A;  4MB7 A;  2ZM6 M;  2Q2E B;  3U6E A;  3GP1 A;  4JI3 M;  2F5O A;  1L2D A;  2EA0 A;  1XMO M;  4JI5 M;  4DR1 M;  1TDZ A;  4B3M M;  4DV4 M;  1Z5A A;  3TWK A;  3C58 A;  5A2Q S;  5IT9 S;  4CIS A;  2UXB M;  5ITX E;  3GQ3 A;  2E5L M;  4DR4 M;  3DOA A;  4NXN M;  4LFC M;  3OTO M;  4LF9 M;  4DV1 M;  1XMQ M;  2UUB M;  4JV5 M;  4DUZ M;  4AQY M;  1L1Z A;  2UU9 M;  1PM5 A;  4DR3 M;  3U6D A;  1K3W A;  1Q3C A;  1Z5C A;  1HR0 M;  1FJG M;  4LF6 M;  3U6Q A;  1HNX M;  1EE8 A;  3GPY A; 
#chains in the Genus database with same CATH topology
 5ITT A;  1G59 A;  3R8F A;  2KHH A;  2I7P A;  2DAI A;  3E21 A;  3U6C A;  2LXE A;  4DV2 M;  1HNZ M;  4JI2 M;  3A46 A;  1OKS A;  1PJQ A;  1GJT A;  4KHP M;  3E9S A;  2Y0T A;  5EXP A;  1ZMV A;  4KT0 F;  1ZV1 A;  1GAB A;  1XB2 B;  1XWI A;  4NC6 A;  2L2D A;  3TWL A;  2L4E A;  4XBO A;  1N75 A;  1DGH B;  2L7H A;  2VQF M;  4DUY M;  3NWL A;  2H1R A;  3KOZ E;  4AKG A;  2RGO A;  2D7G A;  3U60 B;  3VK8 A;  3RE8 A;  3A45 A;  2DAM A;  4I81 A;  4XGI A;  2ZBK B;  2UXC M;  1JB0 F;  2YFQ A;  1XHB A;  3LMM A;  4D80 A;  4G4N A;  1BVS A;  3BOS A;  1N32 M;  4DR2 M;  2UXD M;  3FTF A;  4OX9 M;  2EUC A;  3GLG B;  2DKL A;  3SHF A;  4JI8 M;  4B3R M;  1HQY E;  1OTR A;  3GLF E;  3SAV A;  1QAM A;  4KO8 A;  2F4V M;  2QP9 X;  2Y20 A;  4GHA A;  2XFS A;  4FVM A;  3THG A;  4GKJ M;  1NNJ A;  2MJ5 B;  1VDD A;  2BJV A;  3KSX A;  4M9X A;  1IBL M;  2YNM D;  2QNJ A;  3LCU A;  4MM3 B;  3VKG A;  5EQT A;  4JN6 A;  4PD2 A;  1PJT A;  1OIP A;  3LW5 F;  5FTM A;  1ZAE A;  2I7N A;  3TWM A;  2DZN B;  2KRU A;  3ZCB B;  3KP0 E;  4JI1 M;  2XEP A;  2R18 A;  2KZS A;  4QHS A;  4WW0 A;  3AV0 A;  3BXW A;  4DV0 M;  2QSF X;  1R5L A;  1DGG A;  3KVW A;  4B08 A;  4S12 A;  4MH0 E;  5FLX S;  1IN6 A;  1T3T A;  2JP7 A;  3HJS A;  3I4V A;  3IHP A;  4LZJ A;  4LFA M;  4AG6 A;  2LVA A;  3H4M A;  2CV1 A;  2KZU A;  2H5X A;  2LHC A;  5EXX A;  3U5Z A;  2GNO A;  4LJ4 A;  4KOD A;  1Y8G A;  1G3I A;  3SAU A;  2LTU A;  3FTD A;  2CV0 A;  4X65 M;  3UZU A;  3PNV A;  1DGF A;  2R62 A;  3GRR A;  2DWN A;  1QAO A;  2QEN A;  3JR4 A;  4CHT B;  3PVS A;  3QYB A;  1SXJ C;  1Z59 A;  3HHW A;  5EXT A;  1G71 A;  5FTN A;  1Q3B A;  2WSE F;  3B7Z A;  3HU1 A;  3JR5 A;  1YE9 A;  3LQQ A;  1ORY B;  2Q2E B;  2RKO A;  3VLF B;  3GP1 A;  3B7N A;  2F5O A;  1XMO M;  1V34 A;  4JI5 M;  4RKU F;  4DR1 M;  2JZ1 A;  1PRB A;  3GLF A;  4DV4 M;  4LG2 A;  2MH8 A;  2KW0 A;  2L09 A;  4M9S A;  4GRI A;  4MGI E;  3UMM A;  2CHV A;  2Y21 A;  2KXE A;  5FSW A;  2BJW A;  4GEW A;  1QYR A;  1NJG A;  2LVN C;  2DWM A;  2VF8 A;  3KS4 A;  4NXN M;  1J7K A;  4LF9 M;  4LFC M;  4DV1 M;  1XMQ M;  5L8R F;  1QAN A;  5EP2 A;  1IY0 A;  4GHL A;  4L15 A;  4AQY M;  1PM5 A;  1IN8 A;  1T43 A;  2KNV A;  4M9Z A;  1Z5C A;  4GC9 A;  4XK8 F;  4Q7J A;  1HNX M;  2BWE A;  2ZTC A;  1PJS A;  4FCW A;  3U6O A;  1IM2 A;  4REZ A;  2WSF F;  1R2Z A;  2M60 A;  4LGM A;  1XC8 A;  2CV2 A;  2HHH M;  3FUV A;  1WHC A;  5ITU A;  1NSF A;  3SYL A;  3GRV A;  4PCZ A;  4GC5 A;  1D0L A;  2D7E A;  3GLH A;  3KOY E;  3L25 A;  3AOE A;  1YLA A;  4AZF A;  5FTL A;  2JNH A;  2LVO C;  1NVM A;  3GLI E;  2X49 A;  2OQ4 A;  1DGB A;  3AJI B;  1PJI A;  1IXZ A;  2MGW A;  4Z8X A;  3KFU G;  2VQE M;  3QAU A;  4R3D A;  2VDB B;  4A3V B;  3FYC A;  3GRU A;  5H37 D;  5LMU M;  3ILK A;  1MX0 A;  1QDR A;  3KW6 A;  4FCT A;  4JXJ A;  4LRS A;  3RGS A;  2F5S A;  4FCV A;  4RNA A;  1IN4 A;  1TH4 A;  2K0B X;  4MGY E;  3GO8 A;  4MGH A;  2XZF A;  1Z5B A;  4LF4 M;  5BPV A;  2FS1 A;  2V1U A;  3B89 A;  1IY1 A;  1FNN A;  1K3X A;  3I01 M;  3LQR A;  4B3S M;  3SMS A;  4X66 M;  2K6B A;  2ZTD A;  1P3Q Q;  3I4Y A;  1L2B A;  1XNQ M;  2C96 A;  3SAR A;  1GL7 A;  1JQJ C;  5EP4 A;  3B74 A;  3E4R A;  3J7B A;  2RRU A;  1EFU B;  4OVZ A;  3VDU A;  5JI2 E;  1SXJ D;  2R46 A;  1QZE A;  3HJQ A;  3MJ5 A;  5E6J A;  2VF7 A;  1NY6 A;  1NV8 A;  4JI7 M;  4DR7 M;  1V33 A;  2JA2 A;  4K0K M;  2LVQ D;  2EJS A;  2Z8Y M;  3U5Z B;  1IN7 A;  1NV9 A;  3CTW B;  2LH0 A;  3I04 M;  3WHL A;  3T1Y M;  4DBG B;  1IBM M;  2DAE A;  1E32 A;  4IBI A;  4LJ9 A;  4DR6 M;  2BNK A;  3L28 A;  2HAK A;  2V6Z M;  7CAT A;  3SAT A;  3SAW A;  4LFB M;  4JI4 M;  2KRK A;  3HHX A;  5KPZ A;  2DVW B;  2JXN A;  3U6P A;  5LMN M;  2FH0 A;  4TUW A;  1E94 E;  2XSZ D;  3DA1 A;  3U61 B;  4LRT A;  2KNZ A;  3FUW A;  3IG5 A;  4I8O A;  4PDG A;  1RU3 A;  5DFL A;  4X62 M;  3GLI A;  5DYI A;  4LJ5 A;  1LV7 A;  4MGK E;  3GLF B;  2O25 A;  2JUJ A;  1T6O A;  2FOI C;  5IRE B;  2Z4R A;  2WSC F;  2NQ8 C;  4CGY B;  4L16 A;  4MB7 A;  4P16 A;  5GKN A;  3UJN A;  1NJF A;  2ZM6 M;  3LVW A;  4WUR A;  4IBG A;  3TPZ A;  1I4W A;  1OJL A;  2EA0 A;  1QVR A;  1GVN A;  1D2N A;  2L6O A;  4B3M M;  3HWS A;  1Z5A A;  2GQF A;  3C58 A;  2DWL A;  1F4I A;  1Q02 A;  2O5R A;  3LVV A;  3AL0 C;  4L6V 6;  2KNA A;  4B7G A;  2UXB M;  5ITX E;  3GQ3 A;  3GLH E;  3V76 A;  1C7Y A;  2W82 A;  2CHQ A;  3SYK A;  2E5L M;  3HY5 A;  1DO2 A;  3Q8G A;  4GMQ A;  3T38 A;  1LTM A;  1TGU A;  4PT5 A;  2LBC A;  3HZJ A;  4DR3 M;  1ZMW A;  2Y0Q A;  2XLJ A;  1FJG M;  3U6Q A;  2DAK A;  1UFZ A;  4D81 A;  3U61 A;  1EE8 A;  2G5G X;  3GLH B;  2KEB A;  3W68 A;  5KPT A;  1VEJ A;  4G3O A;  1N77 A;  1SXJ E;  3AOE C;  1AIP C;  4GIP A;  1IXS A;  5EP1 A;  1XXH E;  2QPA A;  2YQZ A;  1TDH A;  4M0W A;  2AHM A;  4BLC A;  1GL6 A;  5E26 A;  5FTK A;  3TL4 X;  3GPX A;  1VQ1 A;  1ZQ9 A;  3HJ8 A;  3KXE C;  4IBC A;  1HNW M;  3KDS E;  3GPP A;  3DZD A;  2UUC M;  3FKE A;  1DV0 A;  1R7R A;  2R4E A;  3TE6 A;  3QYE A;  1PJJ A;  3FUX A;  1VG5 A;  4LJ7 A;  3MMP A;  4X64 M;  1MN3 A;  4JI6 M;  2DAG A;  3M6A A;  3NBX X;  4M0D A;  3J80 S;  3GQ4 A;  3E46 A;  2CEA A;  4AKH A;  1R4G A;  3UGJ A;  4L78 A;  1NHW C;  4OU7 A;  2R65 A;  4DV7 M;  5KQ8 A;  1JR3 E;  3UK6 A;  4DV6 M;  5C1B A;  3W0F A;  1C1K A;  4NRV A;  1X37 A;  2QQ8 A;  4OW0 A;  3JAM S;  5BR8 M;  4G4R A;  4ZPX A;  5C18 A;  3WHK A;  1DO0 A;  1S3S A;  1IFY A;  4OVZ B;  2HWJ A;  1J09 A;  1ZMU A;  4YHH M;  1WJ7 A;  4P17 A;  3SAS A;  5ITX A;  2X8A A;  3L2A A;  1MJG M;  4W5W A;  4BBA A;  2KA6 B;  2QZ4 A;  4BB9 A;  3J2P B;  5ITR A;  4IBF A;  3C3E A;  4WP2 A;  3CF2 A;  2DWZ B;  3AOG A;  1E9R A;  3D8L A;  2DZL A;  3Q8X A;  4NSO B;  1OQY A;  3U6M A;  2XZU A;  4ITQ A;  3R9X B;  3K92 A;  1IN5 A;  1QUT A;  1N34 M;  3KOW E;  5KPR A;  1J5E M;  1MU5 A;  4CIZ A;  1V92 A;  3K2L A;  3HGI A;  2CHG A;  1SXJ A;  1K82 A;  3I51 A;  3VKH A;  4EIW A;  1XXH A;  2VII A;  3GLI B;  3L26 A;  3SHG B;  4LF7 M;  4CJ6 A;  1GJS A;  4AKI A;  1QUS A;  5EJC A;  4F1I A;  5JI3 E;  3GQ5 A;  1HT2 E;  8CAT A;  4DV5 M;  1XNR M;  3D8B A;  2Z4S A;  3F92 A;  3EIH A;  3K9O A;  2JWS A;  3PFI A;  3FTE A;  1HJP A;  4QOS A;  4GKK M;  2CFO A;  1KYI A;  4HLQ A;  3T1H M;  4I4L A;  5IZ7 D;  4LGY A;  4D82 A;  4DR5 M;  4AI6 A;  3SMP A;  4NOO B;  1WIV A;  4Z6Y A;  3A42 A;  1EIJ A;  2XSZ A;  1IY2 A;  1Q39 A;  3FD9 A;  4G6Z A;  4F2L A;  3HX3 A;  2XF3 A;  3PXG A;  1AUA A;  2D7H A;  3SFZ A;  1D0M A;  1JR3 A;  2FFJ A;  3W0L B;  3J27 B;  4QHT A;  3ZQJ A;  3K8Z A;  1YUB A;  4B7H A;  1L2D A;  1WGN A;  2R0I A;  4II7 A;  4FWD A;  5F3W A;  3FUT A;  1TDZ A;  2XGN A;  3HU2 A;  4FWH A;  3TWK A;  2MRO B;  3FYD A;  1QQW A;  3BBZ A;  3HU3 A;  3L27 A;  2P5T A;  4L4U A;  4B7F A;  4IJE A;  2O01 F;  4IBE A;  3A98 B;  3GLG E;  1NNU C;  3IG8 A;  3DOA A;  1NO1 A;  3OTO M;  4QNM A;  2C9O A;  4ANR A;  2UUB M;  1OAI A;  4LJ8 A;  2CP8 A;  1JR3 D;  1IXS B;  4DUZ M;  3KS8 A;  2JY8 A;  2JY5 A;  2QBY A;  2C99 A;  2ZAM A;  2G8L A;  3U6D A;  1K3W A;  1Q3C A;  3AKZ A;  1HR0 M;  3FUU A;  3CGW A;  4RF1 A;  4GH9 A;  2M5Z A;  2HCB A;  5DNY A;  3SC3 A;  2LWX A;  4IIW A;  5IWA M;  2F5P A;  3C3D A;  3L29 A;  4NL4 H;  4QOZ C;  2N35 A;  3RGP A;  3EIE A;  1OFH A;  2F5Q A;  2J7N A;  3FTC A;  4JI0 M;  2C9C A;  4GIT A;  4NRW A;  4KLN A;  4JYA M;  1R6B X;  2OPF A;  1WR1 B;  2A5Y B;  3QWL A;  4FWG A;  2JZ0 A;  3MHV C;  4Y28 F;  1IBK M;  1QZM A;  1PGY A;  3B9P A;  3K1J A;  3T6P A;  3HHZ A;  2CUZ A;  1TTE A;  3J81 S;  5DYG A;  1WGL A;  3CF0 A;  3B7Q A;  2UUA M;  3M7G A;  2L4F A;  2DHY A;  3FE3 A;  4FW9 A;  2B3T A;  3IEC A;  3VDP A;  3ZC7 B;  3U6L A;  3K9P A;  1N33 M;  1DGH A;  1TR8 A;  3VFD A;  4AG5 A;  1GO5 A;  1NHG C;  1GLN A;  1G8P A;  1YSY A;  3GPU A;  2JY6 B;  1I94 M;  2DZO B;  4MGZ E;  2YR0 A;  3U60 A;  1G4A E;  3J7A S;  1D0K A;  2BWB A;  3U6S A;  4G4Q A;  4L8R C;  2DNA A;  2DXI A;  3C9P A;  1IXR C;  1VEG A;  1L2C A;  4YY3 M;  4LY6 A;  3M0E A;  1OIZ A;  1G41 A;  2C98 A;  2C5R A;  2QHO B;  2XFT A;  3GLG A;  3SBJ A;  1N36 M;  2R6F A;  1R2Y A;  2ZAO A;  2K9D A;  2R4J A;  4IBK A;  3RFW A;  2ZAN A;  4DV3 M;  5FTJ A;  1SXJ B;  2OOB A;  1OAO C;  1L1T A;  1W5T A;  1XXH B;  1NY5 A;  2HL7 A;  4IBD A;  1H6U A;  5ITQ A;  2F5N A;  2Z3X A;  2LNH C;  2MR9 A;  3MK6 A;  2DHR A;  2EKK A;  5KQD A;  4NXM M;  4R71 A;  5KO3 A;  2KDL A;  2LVP C;  1QDT A;  2OOA A;  4LF5 M;  2RGH A;  4I5S A;  3ZH9 B;  1KSF X;  2R45 A;  3KP1 E;  4NSR A;  1HT1 E;  4G4O A;  3VK7 A;  4HL4 A;  4PDI A;  1HQC A;  2FE8 A;  3CF6 E;  3GRY A;  4LZZ A;  1OFI A;  4UN2 B;  5EP3 A;  2APL A;  2L7I A;  2OO9 A;  2QCU A;  4B3T M;  3HHY A;  2HKJ A;  4HEO A;  2WZJ A;  2Z7J A;  4LJ6 A;  3AFH A;  1CUK A;  5ITY A;  2EKF A;  1IQP A;  3DFZ A;  1L8Q A;  4LF8 M;  1KFV A;  3KSJ A;  2CE7 A;  4FD2 A;  3TQS A;  2J5Y A;  3HKP A;  3U6E A;  1E9S A;  4JI3 M;  1GKI A;  3H4J A;  2J7O A;  2FNA A;  2X4A A;  2V1C A;  4LJA A;  4QNR A;  2ERC A;  1N78 A;  1W5S A;  3KOX E;  5A2Q S;  2G3Q A;  2K47 A;  2LHG A;  1VEK A;  5IT9 S;  1A5T A;  4CIS A;  2QBY B;  1Z6T A;  2R44 A;  4AW4 A;  2XH9 A;  4DR4 M;  3NBI A;  2EO2 A;  5EXS A;  1TH2 A;  2JY7 A;  1TF0 B;  1VDL A;  1WXQ A;  2DI0 A;  4IBJ A;  3PNY A;  4R7G A;  1UM8 A;  3W67 A;  3LCV B;  4JV5 M;  1L1Z A;  2UU9 M;  1TH3 A;  3FRH A;  2CWB A;  3FRI A;  1QAQ A;  4IJF A;  4IBB A;  4LF6 M;  3T15 A;  2CRU A;  4RF0 A;  2DEN A;  1SG9 A;  4LCB A;  3GPY A; 
#chains in the Genus database with same CATH homology
 5ITT A;  1G59 A;  3R8F A;  2I7P A;  3U6C A;  2LXE A;  4DV2 M;  1HNZ M;  4JI2 M;  3A46 A;  4KHP M;  3E9S A;  2Y0T A;  5EXP A;  3TWL A;  1XWI A;  4XBO A;  1N75 A;  1DGH B;  2L7H A;  2VQF M;  4DUY M;  3NWL A;  2H1R A;  3KOZ E;  4AKG A;  2RGO A;  2D7G A;  3U60 B;  3VK8 A;  3RE8 A;  3A45 A;  4I81 A;  4XGI A;  2ZBK B;  2UXC M;  2YFQ A;  1XHB A;  3LMM A;  4D80 A;  4G4N A;  3BOS A;  1N32 M;  2UXD M;  4DR2 M;  3FTF A;  4OX9 M;  2EUC A;  3GLG B;  3SHF A;  4JI8 M;  4B3R M;  1HQY E;  3SAV A;  1QAM A;  4KO8 A;  2F4V M;  2QP9 X;  2Y20 A;  4GHA A;  2XFS A;  4FVM A;  3THG A;  4GKJ M;  1NNJ A;  1IBL M;  1VDD A;  2BJV A;  3KSX A;  4M9X A;  2YNM D;  4MM3 B;  3VKG A;  5EQT A;  4JN6 A;  4PD2 A;  5FTM A;  1ZAE A;  2I7N A;  3TWM A;  2DZN B;  2KRU A;  3ZCB B;  3KP0 E;  4JI1 M;  2XEP A;  2R18 A;  2KZS A;  4QHS A;  4WW0 A;  3AV0 A;  4DV0 M;  1DGG A;  3KVW A;  4B08 A;  4S12 A;  4MH0 E;  5FLX S;  1IN6 A;  1T3T A;  3I4V A;  3HJS A;  4LFA M;  4LZJ A;  4AG6 A;  3H4M A;  2CV1 A;  2KZU A;  5EXX A;  3U5Z A;  4LJ4 A;  4KOD A;  1G3I A;  3SAU A;  3FTD A;  2CV0 A;  4X65 M;  3UZU A;  3PNV A;  1DGF A;  2R62 A;  3GRR A;  2DWN A;  1QAO A;  2QEN A;  3JR4 A;  4CHT B;  3PVS A;  1SXJ C;  1Z59 A;  3HHW A;  5EXT A;  5FTN A;  1Q3B A;  3JR5 A;  3HU1 A;  1YE9 A;  3LQQ A;  1ORY B;  2Q2E B;  2RKO A;  3VLF B;  3GP1 A;  2F5O A;  1XMO M;  4JI5 M;  4DR1 M;  3GLF A;  4DV4 M;  4LG2 A;  2KW0 A;  2L09 A;  4M9S A;  4GRI A;  4MGI E;  3UMM A;  2CHV A;  2Y21 A;  2KXE A;  5FSW A;  2BJW A;  1QYR A;  1NJG A;  2DWM A;  3KS4 A;  4NXN M;  1J7K A;  4LF9 M;  4LFC M;  4DV1 M;  1XMQ M;  1QAN A;  5EP2 A;  1IY0 A;  4GHL A;  4L15 A;  4AQY M;  1PM5 A;  1IN8 A;  4M9Z A;  1Z5C A;  4GC9 A;  1HNX M;  4FCW A;  3U6O A;  1IM2 A;  4REZ A;  1R2Z A;  2M60 A;  4LGM A;  1XC8 A;  2CV2 A;  2HHH M;  3FUV A;  5ITU A;  1NSF A;  3SYL A;  3GRV A;  4PCZ A;  4GC5 A;  2D7E A;  3KOY E;  3GLH A;  3L25 A;  3AOE A;  4AZF A;  5FTL A;  1NVM A;  2X49 A;  2OQ4 A;  1DGB A;  3AJI B;  1PJI A;  1IXZ A;  4Z8X A;  3KFU G;  2VQE M;  3QAU A;  4R3D A;  4A3V B;  3FYC A;  3GRU A;  5H37 D;  5LMU M;  3ILK A;  1MX0 A;  3KW6 A;  4FCT A;  4JXJ A;  4LRS A;  3RGS A;  2F5S A;  4FCV A;  4RNA A;  1IN4 A;  1TH4 A;  4MGY E;  3GO8 A;  4MGH A;  2XZF A;  1Z5B A;  4LF4 M;  5BPV A;  2V1U A;  1IY1 A;  1FNN A;  1K3X A;  3LQR A;  4B3S M;  3SMS A;  4X66 M;  1L2B A;  1XNQ M;  3I4Y A;  2C96 A;  3SAR A;  1GL7 A;  1JQJ C;  5EP4 A;  3E4R A;  3J7B A;  4OVZ A;  3VDU A;  5JI2 E;  1SXJ D;  2R46 A;  3HJQ A;  3MJ5 A;  5E6J A;  4JI7 M;  4LF5 M;  1NY6 A;  4DR7 M;  2JA2 A;  4K0K M;  3U5Z B;  1IN7 A;  3CTW B;  2LH0 A;  3WHL A;  3T1Y M;  1IBM M;  1E32 A;  4IBI A;  4LJ9 A;  4DR6 M;  2BNK A;  3L28 A;  7CAT A;  2V6Z M;  3SAT A;  3SAW A;  4LFB M;  4JI4 M;  2KRK A;  3HHX A;  5KPZ A;  2DVW B;  3U6P A;  5LMN M;  4TUW A;  1E94 E;  2XSZ D;  3DA1 A;  3U61 B;  4LRT A;  3FUW A;  3IG5 A;  4I8O A;  4PDG A;  4X62 M;  3GLI A;  5DYI A;  4LJ5 A;  1LV7 A;  4MGK E;  3GLF B;  2FOI C;  5IRE B;  2Z4R A;  2NQ8 C;  4CGY B;  4L16 A;  4MB7 A;  4P16 A;  5GKN A;  3UJN A;  1NJF A;  2ZM6 M;  3LVW A;  4WUR A;  4IBG A;  3TPZ A;  1I4W A;  1OJL A;  2EA0 A;  1QVR A;  1GVN A;  1D2N A;  2L6O A;  4B3M M;  3HWS A;  1Z5A A;  3C58 A;  2DWL A;  2O5R A;  3LVV A;  3AL0 C;  4B7G A;  2UXB M;  5ITX E;  3GQ3 A;  2E5L M;  2W82 A;  2CHQ A;  3SYK A;  1DO2 A;  4GMQ A;  3T38 A;  1TGU A;  4PT5 A;  4DR3 M;  2Y0Q A;  2XLJ A;  1FJG M;  3U6Q A;  4D81 A;  3U61 A;  1EE8 A;  2G5G X;  3GLH B;  2KEB A;  1N77 A;  5KPT A;  1SXJ E;  3AOE C;  4GIP A;  5EP1 A;  2QPA A;  2YQZ A;  1TDH A;  4M0W A;  2AHM A;  4BLC A;  1GL6 A;  5E26 A;  5FTK A;  3TL4 X;  3GPX A;  1ZQ9 A;  3HJ8 A;  3KXE C;  4IBC A;  1HNW M;  3KDS E;  3GPP A;  3DZD A;  2UUC M;  3FKE A;  1R7R A;  2R4E A;  3TE6 A;  1PJJ A;  3FUX A;  4LJ7 A;  4X64 M;  4JI6 M;  3M6A A;  4M0D A;  3J80 S;  3GQ4 A;  4AKH A;  3UGJ A;  4L78 A;  1NHW C;  4OU7 A;  2R65 A;  4DV7 M;  5KQ8 A;  3UK6 A;  4DV6 M;  5C1B A;  3W0F A;  1C1K A;  4NRV A;  1X37 A;  4OW0 A;  3JAM S;  5BR8 M;  4G4R A;  4ZPX A;  5C18 A;  3WHK A;  1DO0 A;  1S3S A;  4OVZ B;  1J09 A;  4YHH M;  3SAS A;  5ITX A;  2X8A A;  3L2A A;  4W5W A;  4BBA A;  2KA6 B;  2QZ4 A;  4BB9 A;  3J2P B;  5ITR A;  4IBF A;  3CF2 A;  2DWZ B;  3AOG A;  1E9R A;  3D8L A;  3Q8X A;  4ITQ A;  4NSO B;  3U6M A;  2XZU A;  3R9X B;  3K92 A;  1IN5 A;  1N34 M;  3KOW E;  5KPR A;  1J5E M;  1MU5 A;  3K2L A;  3HGI A;  2CHG A;  1SXJ A;  1K82 A;  3I51 A;  3VKH A;  4EIW A;  1XXH A;  2VII A;  3GLI B;  3L26 A;  3SHG B;  4LF7 M;  4AKI A;  5EJC A;  5JI3 E;  3GQ5 A;  1HT2 E;  8CAT A;  4DV5 M;  1XNR M;  3D8B A;  2Z4S A;  3EIH A;  3FTE A;  3PFI A;  4QOS A;  4GKK M;  2CFO A;  1KYI A;  4HLQ A;  3T1H M;  4I4L A;  5IZ7 D;  4LGY A;  4D82 A;  4DR5 M;  4AI6 A;  3SMP A;  4NOO B;  4Z6Y A;  3A42 A;  2XSZ A;  1IY2 A;  1Q39 A;  3FD9 A;  4G6Z A;  2XF3 A;  3PXG A;  2D7H A;  3SFZ A;  1JR3 A;  2FFJ A;  3W0L B;  3J27 B;  4QHT A;  3K8Z A;  1YUB A;  4B7H A;  1L2D A;  4II7 A;  4FWD A;  5F3W A;  3FUT A;  1TDZ A;  2XGN A;  3HU2 A;  4FWH A;  3TWK A;  3FYD A;  1QQW A;  3HU3 A;  3L27 A;  2P5T A;  4L4U A;  4B7F A;  4IJE A;  4IBE A;  3A98 B;  1NNU C;  3IG8 A;  3DOA A;  3OTO M;  4QNM A;  2C9O A;  2UUB M;  4LJ8 A;  1JR3 D;  1IXS B;  4DUZ M;  3KS8 A;  2QBY A;  2C99 A;  2ZAM A;  2G8L A;  3U6D A;  1K3W A;  1Q3C A;  3AKZ A;  1HR0 M;  3FUU A;  4RF1 A;  4GH9 A;  2M5Z A;  2HCB A;  5DNY A;  3SC3 A;  2LWX A;  4IIW A;  5IWA M;  2F5P A;  3L29 A;  4NL4 H;  4QOZ C;  3RGP A;  3EIE A;  1OFH A;  2F5Q A;  2J7N A;  3FTC A;  4JI0 M;  2C9C A;  4GIT A;  4NRW A;  4KLN A;  4JYA M;  1R6B X;  2OPF A;  3QWL A;  2A5Y B;  4FWG A;  1IBK M;  3MHV C;  1QZM A;  3B9P A;  3K1J A;  3HHZ A;  2CUZ A;  3J81 S;  5DYG A;  3CF0 A;  2UUA M;  3M7G A;  4FW9 A;  3VDP A;  3ZC7 B;  3U6L A;  1N33 M;  1DGH A;  3VFD A;  4AG5 A;  1NHG C;  1GLN A;  1G8P A;  1YSY A;  3GPU A;  1I94 M;  2DZO B;  4MGZ E;  2YR0 A;  3U60 A;  1G4A E;  3J7A S;  3U6S A;  4G4Q A;  4L8R C;  2DXI A;  1IXR C;  1L2C A;  4YY3 M;  4LY6 A;  3M0E A;  2C5R A;  1G41 A;  2C98 A;  2XFT A;  3GLG A;  3SBJ A;  1N36 M;  1R2Y A;  2ZAO A;  2R4J A;  4IBK A;  3RFW A;  2ZAN A;  4DV3 M;  5FTJ A;  1SXJ B;  1L1T A;  1W5T A;  1XXH B;  1NY5 A;  2HL7 A;  4IBD A;  1H6U A;  5ITQ A;  2F5N A;  2Z3X A;  2LNH C;  3MK6 A;  2DHR A;  5KQD A;  4NXM M;  5KO3 A;  2RGH A;  4I5S A;  3ZH9 B;  1KSF X;  2R45 A;  3KP1 E;  4NSR A;  1HT1 E;  4G4O A;  3VK7 A;  4HL4 A;  4PDI A;  1HQC A;  2FE8 A;  3CF6 E;  3GRY A;  4LZZ A;  1OFI A;  5EP3 A;  2L7I A;  2QCU A;  4B3T M;  3HHY A;  2HKJ A;  2Z7J A;  4LJ6 A;  3AFH A;  5ITY A;  1IQP A;  3DFZ A;  1L8Q A;  4LF8 M;  1KFV A;  3KSJ A;  2CE7 A;  4FD2 A;  3TQS A;  3HKP A;  3U6E A;  1E9S A;  4JI3 M;  1GKI A;  2J7O A;  2FNA A;  2X4A A;  2V1C A;  4LJA A;  4QNR A;  2ERC A;  1N78 A;  1W5S A;  3KOX E;  5A2Q S;  2K47 A;  5IT9 S;  4CIS A;  2QBY B;  1Z6T A;  4AW4 A;  2XH9 A;  4DR4 M;  3NBI A;  2EO2 A;  5EXS A;  1TH2 A;  4R7G A;  1WXQ A;  4IBJ A;  4JV5 M;  3PNY A;  1UM8 A;  1L1Z A;  2UU9 M;  1TH3 A;  1QAQ A;  4IJF A;  4IBB A;  4LF6 M;  3T15 A;  4RF0 A;  2CEA A;  4LCB A;  3GPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...