2VQEM

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2vqeM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2vqeM02
4G4RA 3C58A 2OPFA 2VQEM 4YHHM 4X64M 3GQ5A 1R2YA 3U6LA 1TDHA 4JI7M 2ZBKB 2EA0A 4NXNM 1I94M 4KHPM 4B3SM 2F5OA 3GPXA 1Q39A 4LFCM 2F4VM 4JI2M 3TWMA 5FLXS 1L1TA 4B3RM 4X65M 3GQ4A 1HNWM 1Q3CA 4LF7M 1KFVA 4OX9M 4GKKM 4X62M 3J81S 3GPYA 2UUBM 1HR0M 3U6MA 5ITRA 3OTOM 5IT9S 4ITQA 4PDGA 4DR3M 3SAWA 1HNZM 4JI5M 1XNRM 4JYAM 3T1YM 2UU9M 4LF4M 2E5LM 3U6PA 2OQ4A 2Q2EB 4DR2M 3A45A 5ITTA 4DR6M 3U6SA 4DV4M 5LMNM 3U6EA 4JI1M 4JI3M 5LMUM 1K3XA 2UUAM 2F5PA 4LF9M 3VK8A 3TWLA 4DV3M 4LF5M 3J7AS 1R2ZA 1L2DA 1XNQM 5ITQA 1Z5CA 1XMOM 4PCZA 1L1ZA 4YY3M 3U6OA 4DV6M 4JI8M 2UXBM 4K0KM 1N33M 2HKJA 2ZM6M 3SASA 4X66M 1XC8A 3U6DA 2UXCM 4DR1M 2XZUA 4MB7A 3A46A 1IBLM 4LFAM 3T1HM 1HNXM 2VQFM 3U6QA 3SATA 3GPPA 4DUYM 1J5EM 4DV2M 4DV5M 3SAVA 3SAUA 3J80S 5ITYA 4DR5M 4NRVA 3VK7A 3SBJA 2UUCM 1PJJA 3JR4A 4LFBM 1MU5A 4G4NA 4JI4M 3GP1A 5ITXE 4CISA 1IBKM 5A2QS 3W0FA 2XZFA 4DR7M 4DV1M 3GPUA 4JV5M 1MX0A 3GQ3A 1PJIA 1IBMM 2F5QA 2HHHM 1N32M 4DV7M 3GO8A 4JI0M 4NRWA 1EE8A 1K82A 1XMQM 1Z5BA 4LF8M 5ITXA 4G4OA 1FJGM 1N36M 3TWKA 4NXMM 4LF6M 1N34M 1K3WA 1PM5A 4AQYM 3U6CA 4G4QA 4B3MM 2UXDM 1Z5AA 3A42A 1L2CA 5BR8M 4JI6M 4DUZM 1Q3BA 3DOAA 3SARA 2F5NA 1L2BA 4DR4M 3JR5A 2F5SA 5ITUA 4DV0M 4PD2A 4GKJM 4PDIA 1NNJA 5IWAM 4B3TM 1TDZA 1Z59A 3JAMS
chains in the Genus database with same CATH superfamily
4G4RA 1GL6A 3AV0A 1QZMA 1TH4A 4YHHM 3EIEA 3U61A 3GQ5A 3HJQA 1DO2A 2ERCA 2KEBA 3QWLA 4JI7M 4NXNM 2EKKA 2DHYA 4IJFA 3RFWA 4JN6A 5JI2E 3DA1A 2J5YA 4MGYE 1IY0A 3CF6E 4IBDA 1AUAA 2CWBA 3AFHA 3LVWA 2R4JA 4CJ6A 4HLQA 4L15A 1HQCA 5IREB 3HWSA 1HNWM 4NOOB 4NL4H 2LH0A 1C7YA 1KFVA 1V34A 3FUWA 2VF8A 1VQ1A 2R6FA 3C3DA 5FTKA 2QHOB 3GPYA 4QNRA 2UUAM 2L09A 1KSFX 1NVMA 2JA2A 3W0LB 3SAWA 4JI5M 1PGYA 5FTJA 3GLIB 1JR3A 2E5LM 2JWSA 3NBXX 1IN5A 8CATA 2Z3XA 1E32A 3KFUG 1TH2A 5EP3A 3KSXA 1IXRC 2ZANA 5ITTA 1UFZA 5FTLA 4AZFA 5LMNM 1IXSA 4QOZC 2LVOC 1GVNA 2Y21A 1IFYA 1L2DA 2G3QA 4GEWA 1VDDA 1Z5CA 2FH0A 2Z7JA 4DBGB 3U60A 1QDTA 2I7PA 4D80A 4DV6M 1GL7A 2L2DA 4NSRA 3SMSA 2DAKA 2JZ1A 3LW5F 2BNKA 2UXBM 1XXHB 1V33A 3KXEC 2HKJA 1XC8A 3BOSA 2LHCA 3U6DA 3HY5A 1W5SA 2LXEA 4DR1M 1WGLA 2DI0A 5EXSA 2XZUA 1GO5A 3GLHE 2O25A 3A46A 1CUKA 1D2NA 4ANRA 3SATA 3GPPA 3B7QA 2H1RA 1J5EM 1F4IA 2R45A 2D7HA 4F1IA 2QP9X 4RKUF 2CRUA 1IXZA 3PFIA 3AKZA 4DR5M 4KT0F 1QZEA 3HU2A 3TQSA 1E94E 2AHMA 3SFZA 4WW0A 3SBJA 2LVAA 4LG2A 4AKIA 3UZUA 3JR4A 2DAGA 2L4FA 4G6ZA 1MN3A 2KZUA 4REZA 1DO0A 3GP1A 3UGJA 3U5ZB 4UN2B 1HQYE 2BWEA 4AW4A 4DV1M 4DR7M 1MX0A 5DNYA 2J7NA 2F5QA 4DV7M 4OVZA 4LY6A 3GO8A 2DVWB 2DWLA 2RGOA 1G59A 4NRWA 1EE8A 3FTFA 3MK6A 1I4WA 3U60B 2HWJA 3TWKA 3KOXE 1NV8A 2EJSA 3I4YA 3ZCBB 3HHXA 2CEAA 2Z8YM 3E9SA 1SG9A 2GQFA 4MGZE 1PM5A 1VG5A 2QZ4A 3CF2A 4F2LA 5F3WA 3SMPA 2NQ8C 3E46A 3U6CA 2LTUA 4MGIE 1XWIA 2M5ZA 1UM8A 1WJ7A 3MMPA 2JY5A 1JR3D 1VEKA 2DZNB 2WSFF 3IECA 1HT1E 3Q8GA 1L2CA 3DOAA 4LJ7A 1HJPA 3UJNA 3SARA 2FOIC 1E9SA 4CIZA 4PD2A 5KPZA 2LVNC 2XEPA 4IBIA 3RE8A 3D8LA 2R4EA 3L28A 1IN6A 4LCBA 3KW6A 3GLIA 4ZPXA 3ZH9B 2DKLA 5EXXA 2C9CA 4LFCM 2F4VM 3FUVA 1Q39A 3GPXA 1RU3A 4JI2M 3KP1E 2H5XA 3L29A 4QOSA 5FLXS 1L1TA 2QQ8A 2R65A 2L7HA 3HU3A 4FW9A 4FCTA 4IBBA 4B7GA 1QAQA 1Q3CA 4D81A 4JI1M 4OX9M 3FE3A 2KRUA 4GKKM 2XSZD 4X62M 1YE9A 4OVZB 4BBAA 1G41A 3PNVA 2RKOA 4OU7A 1NSFA 1R6BX 5IT9S 3GLGE 3LMMA 2YR0A 4JYAM 1S3SA 2OOBA 1QQWA 4LF4M 2R62A 4II7A 1IN4A 3K92A 2OQ4A 4DR2M 3ZC7B 1QAOA 3C9PA 3E21A 4DR6M 4R3DA 1SXJA 1T3TA 1LV7A 3VKGA 1K3XA 3VK8A 3TWLA 4DV3M 4LF5M 3FRHA 3J7AS 2CUZA 1G8PA 4YY3M 1N78A 2QPAA 1ORYB 4JI8M 3WHLA 1N33M 2WZJA 1PJTA 3LQQA 2QBYB 1OAOC 2CP8A 1WGNA 4LGMA 4M9XA 4BLCA 2MR9A 3K9PA 3FTDA 4TUWA 3U5ZA 4IBKA 4FVMA 4BB9A 1ZV1A 3FYCA 1D0KA 3C3EA 2VQFM 1NV9A 3GRVA 2VIIA 4JXJA 4DV2M 2KNAA 2JY8A 2LBCA 3BBZA 4IIWA 3T6PA 4DV5M 3SAUA 2KNZA 1VDLA 1J09A 4NRVA 2BWBA 1IN8A 5KQ8A 2Y0QA 4LFBM 3HX3A 1ZQ9A 2KHHA 4M9SA 3KOWE 4L4UA 5ITXE 2EO2A 2K9DA 4IBCA 5A2QS 3IG8A 3QYEA 4LJ4A 2DZOB 2ZTCA 1DGHA 1OFHA 2XZFA 3W67A 2EUCA 2HCBA 2JUJA 3GQ3A 3K2LA 1FNNA 2MJ5B 2V1CA 3B9PA 4GC5A 3HGIA 1N32M 4X65M 2BJWA 1SXJB 1IN7A 4XK8F 2G5GX 3THGA 4JI0M 3KSJA 1WHCA 2L4EA 1XXHE 1OFIA 3B7ZA 1YUBA 2DAIA 2JY6B 3GLHB 3M0EA 5L8RF 3K9OA 2I7NA 5EXTA 4G4OA 3IG5A 3FD9A 3VFDA 3GRYA 3KS8A 3GLFE 1T43A 4NXMM 3FRIA 1IY2A 3IHPA 1N34M 2DAEA 2CE7A 1K3WA 2KXEA 3CTWB 1R7RA 2RGHA 2FFJA 3FKEA 2UXDM 1Z5AA 3A42A 3HHYA 3SHGB 2D7EA 1GLNA 3PNYA 1H6UA 4DUZM 4JI6M 3FTCA 2YQZA 4LJ9A 2XF3A 1L2BA 1GJSA 3JR5A 2F5SA 5JI3E 4DV0M 1D0LA 1TGUA 2G8LA 3K1JA 3LVVA 3RGPA 3HHZA 1PJQA 1NO1A 2OO9A 5IWAM 2QCUA 4B3TM 2DHRA 3J7BA 4CHTB 3C58A 2OPFA 1DGBA 2KZSA 2VQEM 2CV0A 4X64M 1WR1B 5IZ7D 2L7IA 4IJEA 1R2YA 3AOEC 1NHGC 1TDHA 4FD2A 5FSWA 3U6LA 2EA0A 4LZZA 2QNJA 5KPRA 1DGGA 1I94M 1XHBA 4GHAA 1GJTA 1JR3E 2W82A 3FYDA 2F5OA 4B3SM 2J7OA 4AKHA 1A5TA 4B3RM 4D82A 5KQDA 1DGHB 3TPZA 1NJGA 3H4MA 3AOEA 1HR0M 3DZDA 4LZJA 1LTMA 2C98A 3W68A 5ITRA 3OTOM 3U6MA 2CV1A 4PDGA 4DR3M 2QBYA 1QDRA 1QUTA 2KDLA 1BVSA 4GRIA 4L78A 2Q2EB 1QANA 4L6V6 3A45A 5H37D 3U6SA 4DV4M 4RNAA 4LF9M 3FUUA 1IY1A 4WURA 2K47A 2VF7A 2XH9A 5C1BA 1XNQM 3R8FA 4PCZA 1XMOM 3U6OA 1IM2A 3CF0A 2K6BA 2R18A 2V1UA 4LJ6A 2ZM6M 4X66M 3MHVC 3L26A 2UXCM 1SXJC 3UK6A 3M7GA 3KS4A 4KO8A 1JB0F 1IBLM 4PT5A 4GHLA 2JXNA 2ZAMA 1QUSA 1JQJC 2XGNA 2ZTDA 1Z6TA 3D8BA 4LGYA 4XBOA 5EP1A 3TL4X 3I4VA 4GMQA 3VLFB 5GKNA 3U6QA 2DWZB 2HAKA 3KDSE 3SAVA 1NY5A 3J80S 5ITYA 3UMMA 2K0BX 1NHWC 4FWGA 4WP2A 2VDBB 1ZMWA 4XGIA 3GLHA 2QSFX 4G4NA 2FS1A 4JI4M 2Y0TA 3TE6A 2KNVA 4IBFA 5E6JA 5FTNA 3MJ5A 3W0FA 2CFOA 2KA6B 3Q8XA 4JV5M 4G3OA 1WIVA 1PJIA 2HHHM 2V6ZM 4W5WA 3T15A 1OIZA 4LJ5A 3L27A 2DENA 3T38A 3B74A 2XLJA 1PJSA 1G71A 1NNUC 4LF8M 3LCVB 1EIJA 1R4GA 1N36M 2FE8A 4KODA 4B7FA 4LF6M 2C96A 2CHGA 3ZQJA 3BXWA 2Z4RA 5BPVA 1V92A 2FNAA 3HJ8A 3VDUA 7CATA 4AQYM 4IBEA 4G4QA 4B3MM 2LVPC 3L2AA 3GLIE 2JNHA 3I51A 2CHQA 2LNHC 3SYLA 4AG5A 1DGFA 5BR8M 2C5RA 1Q3BA 2EKFA 2KW0A 1DV0A 1AIPC 3AJIB 3SYKA 3AOGA 4IBJA 2WSEF 3HU1A 4GITA 5ITUA 4GKJM 4PDIA 1NNJA 4GC9A 2MGWA 1Z59A 2UUBM 4AG6A 3JAMS 2GNOA 3F92A 4HL4A 5EP2A 2APLA 1IQPA 1TR8A 2DZLA 2YNMD 1OKSA 3CGWA 2ZBKB 3KOYE 2L6OA 4KHPM 1N75A 4I81A 1WXQA 3TWMA 4R71A 3B89A 4M9ZA 1KYIA 1SXJE 3LCUA 3GQ4A 2DNAA 4S12A 1PRBA 3EIHA 1QAMA 3PXGA 1G4AE 3PVSA 4I5SA 4LF7M 3GLFB 4FWDA 3J81S 4QHTA 1YSYA 1R5LA 2O01F 1SXJD 2Y20A 2KRKA 4ITQA 2X8AA 1HNZM 1XNRM 3T1YM 2UU9M 3U61B 2MROB 3U6PA 4FCWA 2XSZA 1OQYA 2R0IA 4P16A 2O5RA 2M60A 1OJLA 4QHSA 5DYIA 1Q02A 4LJAA 3V76A 3U6EA 4FCVA 4L16A 2R44A 1J7KA 4LJ8A 2JY7A 4JI3M 2JZ0A 3K8ZA 5LMUM 1N77A 3SHFA 1R2ZA 2F5PA 5ITQA 3FTEA 4AI6A 1QVRA 1XB2B 1L1ZA 4LRTA 3GRUA 3SC3A 2JP7A 4Z8XA 3WHKA 3RGSA 3GLGA 2B3TA 2LHGA 4K0KM 2P5TA 3FUXA 2C9OA 1TF0B 4Z6YA 1ZMUA 3SASA 1ZAEA 3H4JA 1T6OA 2X4AA 4MB7A 2CHVA 2D7GA 1TH3A 4LFAM 2RRUA 3QAUA 2DWNA 3T1HM 4QNMA 1HNXM 2X49A 2XFTA 1NJFA 4IBGA 1IXSB 3B7NA 5EQTA 4B7HA 4DUYM 4Q7JA 4AKGA 2XFSA 4LRSA 2DAMA 3NBIA 5KPTA 5EP4A 1HT2E 2BJVA 2C99A 4GIPA 4KLNA 1ZMVA 4HEOA 1MJGM 1E9RA 3HKPA 3VK7A 2UUCM 3DFZA 1PJJA 1P3QQ 4B08A 3VKHA 5DYGA 3AL0C 3KOZE 5EXPA 1MU5A 1QYRA 2MH8A 1OTRA 3J27B 1YLAA 3ILKA 4CISA 2ZAOA 1NY6A 4I8OA 4Y28F 4RF0A 4CGYB 1IBKM 4NSOB 2R46A 4EIWA 5KO3A 2CV2A 1OIPA 2A5YB 4MGHA 4NC6A 3GPUA 1IBMM 2OOAA 2DWMA 1L8QA 3A98B 3QYBA 4RF1A 1D0MA 1K82A 2LWXA 1GKIA 1TTEA 1Y8GA 1C1KA 2WSCF 3FUTA 3NWLA 3LQRA 1Z5BA 4P17A 5DFLA 5ITXA 1XMQM 4I4LA 2Z4SA 2N35A 3I04M 4L8RC 1FJGM 3GRRA 3GLGB 3E4RA 5E26A 1X37A 3HHWA 1VEGA 3KP0E 3M6AA 1W5TA 1VEJA 4A3VB 2YFQA 3I01M 2HL7A 4M0WA 3L25A 3VDPA 3HZJA 4MH0E 1OAIA 5C18A 1EFUB 5EJCA 1XXHA 2F5NA 4FWHA 4R7GA 4MM3B 4M0DA 4DR4M 3HJSA 4GH9A 1GABA 1G3IA 4OW0A 3KVWA 2LVQD 2QENA 4MGKE 5FTMA 3GLFA 3J2PB 2DXIA 3R9XB 1TDZA
chains in the Genus database with same CATH topology
4G4RA 1GL6A 3AV0A 1QZMA 1TH4A 4YHHM 3EIEA 3U61A 3GQ5A 3HJQA 1DO2A 2ERCA 2KEBA 3QWLA 4JI7M 4NXNM 3RFWA 4IJFA 4JN6A 5JI2E 3DA1A 4MGYE 1IY0A 3CF6E 4IBDA 3AFHA 3LVWA 4X65M 2R4JA 1HNWM 4HLQA 4L15A 1HQCA 5IREB 3HWSA 4NOOB 4NL4H 2LH0A 1KFVA 3FUWA 3GPYA 5FTKA 4QNRA 2L09A 1KSFX 1NVMA 2JA2A 3W0LB 3SAWA 4JI5M 5FTJA 3GLIB 1JR3A 2E5LM 2Z3XA 3KFUG 1IN5A 8CATA 1E32A 1TH2A 5EP3A 3KSXA 1IXRC 2ZANA 5ITTA 5FTLA 4AZFA 5LMNM 4QOZC 1GVNA 2Y21A 1L2DA 1VDDA 1Z5CA 2Z7JA 3U60A 2I7PA 4D80A 4DV6M 1GL7A 4NSRA 3SMSA 2BNKA 2UXBM 1XXHB 3KXEC 2HKJA 1XC8A 3BOSA 3U6DA 4DR1M 1W5SA 2LXEA 2XZUA 5EXSA 3A46A 1D2NA 3SATA 3GPPA 1J5EM 2H1RA 2R45A 2D7HA 2QP9X 1IXZA 3PFIA 3AKZA 4DR5M 3HU2A 3TQSA 1E94E 2AHMA 3SFZA 4WW0A 3SBJA 4LG2A 4AKIA 3UZUA 3JR4A 4G6ZA 2KZUA 4REZA 1DO0A 3GP1A 3UGJA 3U5ZB 1HQYE 4AW4A 4DV1M 4DR7M 1MX0A 5DNYA 2J7NA 2F5QA 4DV7M 4OVZA 4LY6A 3GO8A 2DVWB 2DWLA 2RGOA 1G59A 4NRWA 1EE8A 3FTFA 3MK6A 1I4WA 3U60B 3TWKA 3KOXE 3I4YA 3ZCBB 3HHXA 2CEAA 4MGZE 3E9SA 1PM5A 2QZ4A 3CF2A 5F3WA 3SMPA 2NQ8C 3U6CA 4MGIE 1XWIA 1UM8A 2M5ZA 1JR3D 2DZNB 1L2CA 1HT1E 3DOAA 4LJ7A 3UJNA 3SARA 2FOIC 1E9SA 4PD2A 5KPZA 2XEPA 4IBIA 3RE8A 3D8LA 2R4EA 3L28A 1IN6A 4LCBA 3KW6A 3GLIA 4ZPXA 3ZH9B 5EXXA 2C9CA 4LFCM 2F4VM 3FUVA 1Q39A 3GPXA 4JI2M 3KP1E 5FLXS 3L29A 4QOSA 1L1TA 2R65A 2L7HA 3HU3A 4FW9A 4FCTA 4IBBA 4B7GA 1QAQA 1Q3CA 4D81A 4OX9M 2KRUA 4GKKM 2XSZD 4X62M 1YE9A 4OVZB 4BBAA 1G41A 3PNVA 2RKOA 4OU7A 1NSFA 1R6BX 5IT9S 3LMMA 2YR0A 4JYAM 1S3SA 4LF4M 1QQWA 2R62A 4II7A 1IN4A 3K92A 2OQ4A 4DR2M 3ZC7B 1QAOA 4DR6M 4R3DA 1SXJA 1T3TA 1LV7A 3VKGA 1K3XA 3VK8A 3TWLA 4DV3M 4LF5M 3J7AS 2CUZA 1G8PA 4YY3M 1N78A 2QPAA 1ORYB 4JI8M 3WHLA 1N33M 2QBYB 3LQQA 4M9XA 4BLCA 4LGMA 3FTDA 4TUWA 3U5ZA 4IBKA 4FVMA 4BB9A 3FYCA 2VQFM 3GRVA 2VIIA 4JXJA 4DV2M 4IIWA 4DV5M 3SAUA 1J09A 4NRVA 1IN8A 5KQ8A 2Y0QA 4LFBM 1ZQ9A 4M9SA 3KOWE 4L4UA 5ITXE 2EO2A 4IBCA 5A2QS 3IG8A 4LJ4A 2DZOB 1DGHA 1OFHA 2XZFA 2EUCA 2HCBA 3GQ3A 3K2LA 1FNNA 2V1CA 3B9PA 4GC5A 3HGIA 1N32M 2BJWA 1SXJB 1IN7A 2G5GX 3THGA 4JI0M 3KSJA 1OFIA 1YUBA 3GLHB 3M0EA 2I7NA 5EXTA 4G4OA 3IG5A 3FD9A 3VFDA 3GRYA 3KS8A 4NXMM 1IY2A 1N34M 2CE7A 1K3WA 2KXEA 3CTWB 1R7RA 2RGHA 3FKEA 2FFJA 2UXDM 1Z5AA 3A42A 3HHYA 3SHGB 2D7EA 1GLNA 3PNYA 1H6UA 4DUZM 4JI6M 3FTCA 2YQZA 4LJ9A 2XF3A 1L2BA 3JR5A 2F5SA 5JI3E 4DV0M 1TGUA 3LVVA 2G8LA 3K1JA 3HHZA 3RGPA 5IWAM 2QCUA 4B3TM 3J7BA 2DHRA 4CHTB 3C58A 2OPFA 1DGBA 2KZSA 2VQEM 2CV0A 4X64M 5IZ7D 2L7IA 4IJEA 1R2YA 3AOEC 1NHGC 1TDHA 4FD2A 5FSWA 3U6LA 2EA0A 4LZZA 5KPRA 1DGGA 1I94M 1XHBA 4GHAA 2W82A 2F5OA 3FYDA 4B3SM 4AKHA 2J7OA 4B3RM 4D82A 5KQDA 1DGHB 3TPZA 1NJGA 3H4MA 3AOEA 1HR0M 3DZDA 4LZJA 2CV1A 2C98A 3U6MA 5ITRA 3OTOM 2QBYA 4PDGA 4DR3M 4GRIA 4L78A 2Q2EB 1QANA 3A45A 5H37D 3U6SA 4DV4M 4RNAA 4LF9M 3FUUA 1IY1A 4WURA 2K47A 2XH9A 5C1BA 1XNQM 3R8FA 4PCZA 1XMOM 3U6OA 1IM2A 3CF0A 2V1UA 2R18A 4LJ6A 2ZM6M 4X66M 3MHVC 3L26A 2UXCM 1SXJC 3UK6A 3M7GA 3KS4A 4KO8A 1IBLM 4PT5A 4GHLA 2ZAMA 4LGYA 1JQJC 2XGNA 4XBOA 1Z6TA 3D8BA 5EP1A 3U6QA 3TL4X 3I4VA 4GMQA 3VLFB 5GKNA 2DWZB 3KDSE 3SAVA 1NY5A 3J80S 5ITYA 3UMMA 1NHWC 4FWGA 4XGIA 3GLHA 4G4NA 4JI4M 2Y0TA 3TE6A 5FTNA 4IBFA 5E6JA 3MJ5A 3W0FA 2CFOA 2KA6B 3Q8XA 4JV5M 1PJIA 2HHHM 2V6ZM 4W5WA 3T15A 4LJ5A 3L27A 2XLJA 3T38A 1NNUC 4LF8M 1N36M 2FE8A 4KODA 4B7FA 4LF6M 2C96A 2CHGA 2Z4RA 5BPVA 2FNAA 3HJ8A 3VDUA 7CATA 4AQYM 4IBEA 4G4QA 4B3MM 3L2AA 3I51A 2CHQA 2LNHC 3SYLA 4AG5A 1DGFA 5BR8M 2C5RA 1Q3BA 2KW0A 3AJIB 3SYKA 3AOGA 4IBJA 3HU1A 4GITA 5ITUA 4GKJM 4PDIA 1NNJA 4GC9A 1Z59A 2UUBM 4AG6A 3JAMS 5EP2A 4HL4A 1IQPA 2YNMD 2ZBKB 3KOYE 2L6OA 4KHPM 1N75A 4I81A 1WXQA 3TWMA 4M9ZA 1KYIA 1SXJE 3GQ4A 4S12A 3EIHA 1QAMA 3PXGA 1G4AE 3PVSA 4I5SA 4LF7M 3GLFB 4FWDA 3J81S 4QHTA 1YSYA 2Y20A 1SXJD 2KRKA 4ITQA 2X8AA 1HNZM 1XNRM 3T1YM 2UU9M 3U61B 3U6PA 4FCWA 2XSZA 4P16A 2O5RA 2M60A 1OJLA 4QHSA 5DYIA 4LJAA 4JI1M 3U6EA 4FCVA 4L16A 4LJ8A 1J7KA 4JI3M 5LMUM 1N77A 2F5PA 3K8ZA 2UUAM 3SHFA 1R2ZA 5ITQA 3FTEA 4AI6A 1QVRA 1L1ZA 4LRTA 3GRUA 3SC3A 3WHKA 4Z8XA 3RGSA 3GLGA 4K0KM 2P5TA 3FUXA 2C9OA 4Z6YA 3SASA 1ZAEA 2X4AA 4MB7A 2CHVA 2D7GA 1TH3A 4LFAM 2DWNA 3QAUA 3T1HM 4QNMA 1HNXM 2X49A 2XFTA 1NJFA 4IBGA 1IXSB 5EQTA 4B7HA 4DUYM 4AKGA 2XFSA 4LRSA 3NBIA 5KPTA 5EP4A 1HT2E 2BJVA 2C99A 4GIPA 4KLNA 3HKPA 1E9RA 3VK7A 2UUCM 3DFZA 1PJJA 4B08A 3VKHA 5DYGA 3AL0C 3KOZE 5EXPA 1MU5A 1QYRA 3J27B 3ILKA 4CISA 2ZAOA 1NY6A 4I8OA 4CGYB 4RF0A 1IBKM 4NSOB 2R46A 4EIWA 5KO3A 2CV2A 2A5YB 4MGHA 3GPUA 1IBMM 2DWMA 1L8QA 3A98B 4RF1A 1K82A 2LWXA 1GKIA 3FUTA 1C1KA 3NWLA 3LQRA 1Z5BA 1XMQM 5ITXA 4I4LA 2Z4SA 4L8RC 1FJGM 3GRRA 3GLGB 3E4RA 5E26A 1X37A 3HHWA 3KP0E 3M6AA 1W5TA 4A3VB 2YFQA 2HL7A 4M0WA 3L25A 3VDPA 4MH0E 5C18A 5EJCA 1XXHA 2F5NA 4FWHA 4R7GA 4MM3B 4M0DA 4DR4M 3HJSA 4GH9A 1G3IA 4OW0A 3KVWA 2QENA 5FTMA 4MGKE 3GLFA 2DXIA 3J2PB 3R9XB 1TDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4R A;  3C58 A;  2OPF A;  2VQE M;  4YHH M;  4X64 M;  3GQ5 A;  1R2Y A;  3U6L A;  1TDH A;  4JI7 M;  2ZBK B;  2EA0 A;  4NXN M;  1I94 M;  4KHP M;  4B3S M;  2F5O A;  3GPX A;  1Q39 A;  4LFC M;  2F4V M;  4JI2 M;  3TWM A;  5FLX S;  1L1T A;  4B3R M;  4X65 M;  3GQ4 A;  1HNW M;  1Q3C A;  4LF7 M;  1KFV A;  4OX9 M;  4GKK M;  4X62 M;  3J81 S;  3GPY A;  2UUB M;  1HR0 M;  3U6M A;  5ITR A;  3OTO M;  5IT9 S;  4ITQ A;  4PDG A;  4DR3 M;  3SAW A;  1HNZ M;  4JI5 M;  1XNR M;  4JYA M;  3T1Y M;  2UU9 M;  4LF4 M;  2E5L M;  3U6P A;  2OQ4 A;  2Q2E B;  4DR2 M;  3A45 A;  5ITT A;  4DR6 M;  3U6S A;  4DV4 M;  5LMN M;  3U6E A;  4JI1 M;  4JI3 M;  5LMU M;  1K3X A;  2UUA M;  2F5P A;  4LF9 M;  3VK8 A;  3TWL A;  4DV3 M;  4LF5 M;  3J7A S;  1R2Z A;  1L2D A;  1XNQ M;  5ITQ A;  1Z5C A;  1XMO M;  4PCZ A;  1L1Z A;  4YY3 M;  3U6O A;  4DV6 M;  4JI8 M;  2UXB M;  4K0K M;  1N33 M;  2HKJ A;  2ZM6 M;  3SAS A;  4X66 M;  1XC8 A;  3U6D A;  2UXC M;  4DR1 M;  2XZU A;  4MB7 A;  3A46 A;  1IBL M;  4LFA M;  3T1H M;  1HNX M;  2VQF M;  3U6Q A;  3SAT A;  3GPP A;  4DUY M;  1J5E M;  4DV2 M;  4DV5 M;  3SAV A;  3SAU A;  3J80 S;  5ITY A;  4DR5 M;  4NRV A;  3VK7 A;  3SBJ A;  2UUC M;  1PJJ A;  3JR4 A;  4LFB M;  1MU5 A;  4G4N A;  4JI4 M;  3GP1 A;  5ITX E;  4CIS A;  1IBK M;  5A2Q S;  3W0F A;  2XZF A;  4DR7 M;  4DV1 M;  3GPU A;  4JV5 M;  1MX0 A;  3GQ3 A;  1PJI A;  1IBM M;  2F5Q A;  2HHH M;  1N32 M;  4DV7 M;  3GO8 A;  4JI0 M;  4NRW A;  1EE8 A;  1K82 A;  1XMQ M;  1Z5B A;  4LF8 M;  5ITX A;  4G4O A;  1FJG M;  1N36 M;  3TWK A;  4NXM M;  4LF6 M;  1N34 M;  1K3W A;  1PM5 A;  4AQY M;  3U6C A;  4G4Q A;  4B3M M;  2UXD M;  1Z5A A;  3A42 A;  1L2C A;  5BR8 M;  4JI6 M;  4DUZ M;  1Q3B A;  3DOA A;  3SAR A;  2F5N A;  1L2B A;  4DR4 M;  3JR5 A;  2F5S A;  5ITU A;  4DV0 M;  4PD2 A;  4GKJ M;  4PDI A;  1NNJ A;  5IWA M;  4B3T M;  1TDZ A;  1Z59 A;  3JAM S; 
#chains in the Genus database with same CATH topology
 4G4R A;  1GL6 A;  3AV0 A;  1QZM A;  1TH4 A;  4YHH M;  3EIE A;  3U61 A;  3GQ5 A;  3HJQ A;  1DO2 A;  2ERC A;  2KEB A;  3QWL A;  4JI7 M;  4NXN M;  2EKK A;  2DHY A;  4IJF A;  3RFW A;  4JN6 A;  5JI2 E;  3DA1 A;  2J5Y A;  4MGY E;  1IY0 A;  3CF6 E;  4IBD A;  1AUA A;  2CWB A;  3AFH A;  3LVW A;  2R4J A;  4CJ6 A;  4HLQ A;  4L15 A;  1HQC A;  5IRE B;  3HWS A;  1HNW M;  4NOO B;  4NL4 H;  2LH0 A;  1C7Y A;  1KFV A;  1V34 A;  3FUW A;  2VF8 A;  1VQ1 A;  2R6F A;  3C3D A;  5FTK A;  2QHO B;  3GPY A;  4QNR A;  2UUA M;  2L09 A;  1KSF X;  1NVM A;  2JA2 A;  3W0L B;  3SAW A;  4JI5 M;  1PGY A;  5FTJ A;  3GLI B;  1JR3 A;  2E5L M;  2JWS A;  3NBX X;  1IN5 A;  8CAT A;  2Z3X A;  1E32 A;  3KFU G;  1TH2 A;  5EP3 A;  3KSX A;  1IXR C;  2ZAN A;  5ITT A;  1UFZ A;  5FTL A;  4AZF A;  5LMN M;  1IXS A;  4QOZ C;  2LVO C;  1GVN A;  2Y21 A;  1IFY A;  1L2D A;  2G3Q A;  4GEW A;  1VDD A;  1Z5C A;  2FH0 A;  2Z7J A;  4DBG B;  3U60 A;  1QDT A;  2I7P A;  4D80 A;  4DV6 M;  1GL7 A;  2L2D A;  4NSR A;  3SMS A;  2DAK A;  2JZ1 A;  3LW5 F;  2BNK A;  2UXB M;  1XXH B;  1V33 A;  3KXE C;  2HKJ A;  1XC8 A;  3BOS A;  2LHC A;  3U6D A;  3HY5 A;  1W5S A;  2LXE A;  4DR1 M;  1WGL A;  2DI0 A;  5EXS A;  2XZU A;  1GO5 A;  3GLH E;  2O25 A;  3A46 A;  1CUK A;  1D2N A;  4ANR A;  3SAT A;  3GPP A;  3B7Q A;  2H1R A;  1J5E M;  1F4I A;  2R45 A;  2D7H A;  4F1I A;  2QP9 X;  4RKU F;  2CRU A;  1IXZ A;  3PFI A;  3AKZ A;  4DR5 M;  4KT0 F;  1QZE A;  3HU2 A;  3TQS A;  1E94 E;  2AHM A;  3SFZ A;  4WW0 A;  3SBJ A;  2LVA A;  4LG2 A;  4AKI A;  3UZU A;  3JR4 A;  2DAG A;  2L4F A;  4G6Z A;  1MN3 A;  2KZU A;  4REZ A;  1DO0 A;  3GP1 A;  3UGJ A;  3U5Z B;  4UN2 B;  1HQY E;  2BWE A;  4AW4 A;  4DV1 M;  4DR7 M;  1MX0 A;  5DNY A;  2J7N A;  2F5Q A;  4DV7 M;  4OVZ A;  4LY6 A;  3GO8 A;  2DVW B;  2DWL A;  2RGO A;  1G59 A;  4NRW A;  1EE8 A;  3FTF A;  3MK6 A;  1I4W A;  3U60 B;  2HWJ A;  3TWK A;  3KOX E;  1NV8 A;  2EJS A;  3I4Y A;  3ZCB B;  3HHX A;  2CEA A;  2Z8Y M;  3E9S A;  1SG9 A;  2GQF A;  4MGZ E;  1PM5 A;  1VG5 A;  2QZ4 A;  3CF2 A;  4F2L A;  5F3W A;  3SMP A;  2NQ8 C;  3E46 A;  3U6C A;  2LTU A;  4MGI E;  1XWI A;  2M5Z A;  1UM8 A;  1WJ7 A;  3MMP A;  2JY5 A;  1JR3 D;  1VEK A;  2DZN B;  2WSF F;  3IEC A;  1HT1 E;  3Q8G A;  1L2C A;  3DOA A;  4LJ7 A;  1HJP A;  3UJN A;  3SAR A;  2FOI C;  1E9S A;  4CIZ A;  4PD2 A;  5KPZ A;  2LVN C;  2XEP A;  4IBI A;  3RE8 A;  3D8L A;  2R4E A;  3L28 A;  1IN6 A;  4LCB A;  3KW6 A;  3GLI A;  4ZPX A;  3ZH9 B;  2DKL A;  5EXX A;  2C9C A;  4LFC M;  2F4V M;  3FUV A;  1Q39 A;  3GPX A;  1RU3 A;  4JI2 M;  3KP1 E;  2H5X A;  3L29 A;  4QOS A;  5FLX S;  1L1T A;  2QQ8 A;  2R65 A;  2L7H A;  3HU3 A;  4FW9 A;  4FCT A;  4IBB A;  4B7G A;  1QAQ A;  1Q3C A;  4D81 A;  4JI1 M;  4OX9 M;  3FE3 A;  2KRU A;  4GKK M;  2XSZ D;  4X62 M;  1YE9 A;  4OVZ B;  4BBA A;  1G41 A;  3PNV A;  2RKO A;  4OU7 A;  1NSF A;  1R6B X;  5IT9 S;  3GLG E;  3LMM A;  2YR0 A;  4JYA M;  1S3S A;  2OOB A;  1QQW A;  4LF4 M;  2R62 A;  4II7 A;  1IN4 A;  3K92 A;  2OQ4 A;  4DR2 M;  3ZC7 B;  1QAO A;  3C9P A;  3E21 A;  4DR6 M;  4R3D A;  1SXJ A;  1T3T A;  1LV7 A;  3VKG A;  1K3X A;  3VK8 A;  3TWL A;  4DV3 M;  4LF5 M;  3FRH A;  3J7A S;  2CUZ A;  1G8P A;  4YY3 M;  1N78 A;  2QPA A;  1ORY B;  4JI8 M;  3WHL A;  1N33 M;  2WZJ A;  1PJT A;  3LQQ A;  2QBY B;  1OAO C;  2CP8 A;  1WGN A;  4LGM A;  4M9X A;  4BLC A;  2MR9 A;  3K9P A;  3FTD A;  4TUW A;  3U5Z A;  4IBK A;  4FVM A;  4BB9 A;  1ZV1 A;  3FYC A;  1D0K A;  3C3E A;  2VQF M;  1NV9 A;  3GRV A;  2VII A;  4JXJ A;  4DV2 M;  2KNA A;  2JY8 A;  2LBC A;  3BBZ A;  4IIW A;  3T6P A;  4DV5 M;  3SAU A;  2KNZ A;  1VDL A;  1J09 A;  4NRV A;  2BWB A;  1IN8 A;  5KQ8 A;  2Y0Q A;  4LFB M;  3HX3 A;  1ZQ9 A;  2KHH A;  4M9S A;  3KOW E;  4L4U A;  5ITX E;  2EO2 A;  2K9D A;  4IBC A;  5A2Q S;  3IG8 A;  3QYE A;  4LJ4 A;  2DZO B;  2ZTC A;  1DGH A;  1OFH A;  2XZF A;  3W67 A;  2EUC A;  2HCB A;  2JUJ A;  3GQ3 A;  3K2L A;  1FNN A;  2MJ5 B;  2V1C A;  3B9P A;  4GC5 A;  3HGI A;  1N32 M;  4X65 M;  2BJW A;  1SXJ B;  1IN7 A;  4XK8 F;  2G5G X;  3THG A;  4JI0 M;  3KSJ A;  1WHC A;  2L4E A;  1XXH E;  1OFI A;  3B7Z A;  1YUB A;  2DAI A;  2JY6 B;  3GLH B;  3M0E A;  5L8R F;  3K9O A;  2I7N A;  5EXT A;  4G4O A;  3IG5 A;  3FD9 A;  3VFD A;  3GRY A;  3KS8 A;  3GLF E;  1T43 A;  4NXM M;  3FRI A;  1IY2 A;  3IHP A;  1N34 M;  2DAE A;  2CE7 A;  1K3W A;  2KXE A;  3CTW B;  1R7R A;  2RGH A;  2FFJ A;  3FKE A;  2UXD M;  1Z5A A;  3A42 A;  3HHY A;  3SHG B;  2D7E A;  1GLN A;  3PNY A;  1H6U A;  4DUZ M;  4JI6 M;  3FTC A;  2YQZ A;  4LJ9 A;  2XF3 A;  1L2B A;  1GJS A;  3JR5 A;  2F5S A;  5JI3 E;  4DV0 M;  1D0L A;  1TGU A;  2G8L A;  3K1J A;  3LVV A;  3RGP A;  3HHZ A;  1PJQ A;  1NO1 A;  2OO9 A;  5IWA M;  2QCU A;  4B3T M;  2DHR A;  3J7B A;  4CHT B;  3C58 A;  2OPF A;  1DGB A;  2KZS A;  2VQE M;  2CV0 A;  4X64 M;  1WR1 B;  5IZ7 D;  2L7I A;  4IJE A;  1R2Y A;  3AOE C;  1NHG C;  1TDH A;  4FD2 A;  5FSW A;  3U6L A;  2EA0 A;  4LZZ A;  2QNJ A;  5KPR A;  1DGG A;  1I94 M;  1XHB A;  4GHA A;  1GJT A;  1JR3 E;  2W82 A;  3FYD A;  2F5O A;  4B3S M;  2J7O A;  4AKH A;  1A5T A;  4B3R M;  4D82 A;  5KQD A;  1DGH B;  3TPZ A;  1NJG A;  3H4M A;  3AOE A;  1HR0 M;  3DZD A;  4LZJ A;  1LTM A;  2C98 A;  3W68 A;  5ITR A;  3OTO M;  3U6M A;  2CV1 A;  4PDG A;  4DR3 M;  2QBY A;  1QDR A;  1QUT A;  2KDL A;  1BVS A;  4GRI A;  4L78 A;  2Q2E B;  1QAN A;  4L6V 6;  3A45 A;  5H37 D;  3U6S A;  4DV4 M;  4RNA A;  4LF9 M;  3FUU A;  1IY1 A;  4WUR A;  2K47 A;  2VF7 A;  2XH9 A;  5C1B A;  1XNQ M;  3R8F A;  4PCZ A;  1XMO M;  3U6O A;  1IM2 A;  3CF0 A;  2K6B A;  2R18 A;  2V1U A;  4LJ6 A;  2ZM6 M;  4X66 M;  3MHV C;  3L26 A;  2UXC M;  1SXJ C;  3UK6 A;  3M7G A;  3KS4 A;  4KO8 A;  1JB0 F;  1IBL M;  4PT5 A;  4GHL A;  2JXN A;  2ZAM A;  1QUS A;  1JQJ C;  2XGN A;  2ZTD A;  1Z6T A;  3D8B A;  4LGY A;  4XBO A;  5EP1 A;  3TL4 X;  3I4V A;  4GMQ A;  3VLF B;  5GKN A;  3U6Q A;  2DWZ B;  2HAK A;  3KDS E;  3SAV A;  1NY5 A;  3J80 S;  5ITY A;  3UMM A;  2K0B X;  1NHW C;  4FWG A;  4WP2 A;  2VDB B;  1ZMW A;  4XGI A;  3GLH A;  2QSF X;  4G4N A;  2FS1 A;  4JI4 M;  2Y0T A;  3TE6 A;  2KNV A;  4IBF A;  5E6J A;  5FTN A;  3MJ5 A;  3W0F A;  2CFO A;  2KA6 B;  3Q8X A;  4JV5 M;  4G3O A;  1WIV A;  1PJI A;  2HHH M;  2V6Z M;  4W5W A;  3T15 A;  1OIZ A;  4LJ5 A;  3L27 A;  2DEN A;  3T38 A;  3B74 A;  2XLJ A;  1PJS A;  1G71 A;  1NNU C;  4LF8 M;  3LCV B;  1EIJ A;  1R4G A;  1N36 M;  2FE8 A;  4KOD A;  4B7F A;  4LF6 M;  2C96 A;  2CHG A;  3ZQJ A;  3BXW A;  2Z4R A;  5BPV A;  1V92 A;  2FNA A;  3HJ8 A;  3VDU A;  7CAT A;  4AQY M;  4IBE A;  4G4Q A;  4B3M M;  2LVP C;  3L2A A;  3GLI E;  2JNH A;  3I51 A;  2CHQ A;  2LNH C;  3SYL A;  4AG5 A;  1DGF A;  5BR8 M;  2C5R A;  1Q3B A;  2EKF A;  2KW0 A;  1DV0 A;  1AIP C;  3AJI B;  3SYK A;  3AOG A;  4IBJ A;  2WSE F;  3HU1 A;  4GIT A;  5ITU A;  4GKJ M;  4PDI A;  1NNJ A;  4GC9 A;  2MGW A;  1Z59 A;  2UUB M;  4AG6 A;  3JAM S;  2GNO A;  3F92 A;  4HL4 A;  5EP2 A;  2APL A;  1IQP A;  1TR8 A;  2DZL A;  2YNM D;  1OKS A;  3CGW A;  2ZBK B;  3KOY E;  2L6O A;  4KHP M;  1N75 A;  4I81 A;  1WXQ A;  3TWM A;  4R71 A;  3B89 A;  4M9Z A;  1KYI A;  1SXJ E;  3LCU A;  3GQ4 A;  2DNA A;  4S12 A;  1PRB A;  3EIH A;  1QAM A;  3PXG A;  1G4A E;  3PVS A;  4I5S A;  4LF7 M;  3GLF B;  4FWD A;  3J81 S;  4QHT A;  1YSY A;  1R5L A;  2O01 F;  1SXJ D;  2Y20 A;  2KRK A;  4ITQ A;  2X8A A;  1HNZ M;  1XNR M;  3T1Y M;  2UU9 M;  3U61 B;  2MRO B;  3U6P A;  4FCW A;  2XSZ A;  1OQY A;  2R0I A;  4P16 A;  2O5R A;  2M60 A;  1OJL A;  4QHS A;  5DYI A;  1Q02 A;  4LJA A;  3V76 A;  3U6E A;  4FCV A;  4L16 A;  2R44 A;  1J7K A;  4LJ8 A;  2JY7 A;  4JI3 M;  2JZ0 A;  3K8Z A;  5LMU M;  1N77 A;  3SHF A;  1R2Z A;  2F5P A;  5ITQ A;  3FTE A;  4AI6 A;  1QVR A;  1XB2 B;  1L1Z A;  4LRT A;  3GRU A;  3SC3 A;  2JP7 A;  4Z8X A;  3WHK A;  3RGS A;  3GLG A;  2B3T A;  2LHG A;  4K0K M;  2P5T A;  3FUX A;  2C9O A;  1TF0 B;  4Z6Y A;  1ZMU A;  3SAS A;  1ZAE A;  3H4J A;  1T6O A;  2X4A A;  4MB7 A;  2CHV A;  2D7G A;  1TH3 A;  4LFA M;  2RRU A;  3QAU A;  2DWN A;  3T1H M;  4QNM A;  1HNX M;  2X49 A;  2XFT A;  1NJF A;  4IBG A;  1IXS B;  3B7N A;  5EQT A;  4B7H A;  4DUY M;  4Q7J A;  4AKG A;  2XFS A;  4LRS A;  2DAM A;  3NBI A;  5KPT A;  5EP4 A;  1HT2 E;  2BJV A;  2C99 A;  4GIP A;  4KLN A;  1ZMV A;  4HEO A;  1MJG M;  1E9R A;  3HKP A;  3VK7 A;  2UUC M;  3DFZ A;  1PJJ A;  1P3Q Q;  4B08 A;  3VKH A;  5DYG A;  3AL0 C;  3KOZ E;  5EXP A;  1MU5 A;  1QYR A;  2MH8 A;  1OTR A;  3J27 B;  1YLA A;  3ILK A;  4CIS A;  2ZAO A;  1NY6 A;  4I8O A;  4Y28 F;  4RF0 A;  4CGY B;  1IBK M;  4NSO B;  2R46 A;  4EIW A;  5KO3 A;  2CV2 A;  1OIP A;  2A5Y B;  4MGH A;  4NC6 A;  3GPU A;  1IBM M;  2OOA A;  2DWM A;  1L8Q A;  3A98 B;  3QYB A;  4RF1 A;  1D0M A;  1K82 A;  2LWX A;  1GKI A;  1TTE A;  1Y8G A;  1C1K A;  2WSC F;  3FUT A;  3NWL A;  3LQR A;  1Z5B A;  4P17 A;  5DFL A;  5ITX A;  1XMQ M;  4I4L A;  2Z4S A;  2N35 A;  3I04 M;  4L8R C;  1FJG M;  3GRR A;  3GLG B;  3E4R A;  5E26 A;  1X37 A;  3HHW A;  1VEG A;  3KP0 E;  3M6A A;  1W5T A;  1VEJ A;  4A3V B;  2YFQ A;  3I01 M;  2HL7 A;  4M0W A;  3L25 A;  3VDP A;  3HZJ A;  4MH0 E;  1OAI A;  5C18 A;  1EFU B;  5EJC A;  1XXH A;  2F5N A;  4FWH A;  4R7G A;  4MM3 B;  4M0D A;  4DR4 M;  3HJS A;  4GH9 A;  1GAB A;  1G3I A;  4OW0 A;  3KVW A;  2LVQ D;  2QEN A;  4MGK E;  5FTM A;  3GLF A;  3J2P B;  2DXI A;  3R9X B;  1TDZ A; 
#chains in the Genus database with same CATH homology
 4G4R A;  1GL6 A;  3AV0 A;  1QZM A;  1TH4 A;  4YHH M;  3EIE A;  3U61 A;  3GQ5 A;  3HJQ A;  1DO2 A;  2ERC A;  2KEB A;  3QWL A;  4JI7 M;  4NXN M;  3RFW A;  4IJF A;  4JN6 A;  5JI2 E;  3DA1 A;  4MGY E;  1IY0 A;  3CF6 E;  4IBD A;  3AFH A;  3LVW A;  4X65 M;  2R4J A;  1HNW M;  4HLQ A;  4L15 A;  1HQC A;  5IRE B;  3HWS A;  4NOO B;  4NL4 H;  2LH0 A;  1KFV A;  3FUW A;  3GPY A;  5FTK A;  4QNR A;  2L09 A;  1KSF X;  1NVM A;  2JA2 A;  3W0L B;  3SAW A;  4JI5 M;  5FTJ A;  3GLI B;  1JR3 A;  2E5L M;  2Z3X A;  3KFU G;  1IN5 A;  8CAT A;  1E32 A;  1TH2 A;  5EP3 A;  3KSX A;  1IXR C;  2ZAN A;  5ITT A;  5FTL A;  4AZF A;  5LMN M;  4QOZ C;  1GVN A;  2Y21 A;  1L2D A;  1VDD A;  1Z5C A;  2Z7J A;  3U60 A;  2I7P A;  4D80 A;  4DV6 M;  1GL7 A;  4NSR A;  3SMS A;  2BNK A;  2UXB M;  1XXH B;  3KXE C;  2HKJ A;  1XC8 A;  3BOS A;  3U6D A;  4DR1 M;  1W5S A;  2LXE A;  2XZU A;  5EXS A;  3A46 A;  1D2N A;  3SAT A;  3GPP A;  1J5E M;  2H1R A;  2R45 A;  2D7H A;  2QP9 X;  1IXZ A;  3PFI A;  3AKZ A;  4DR5 M;  3HU2 A;  3TQS A;  1E94 E;  2AHM A;  3SFZ A;  4WW0 A;  3SBJ A;  4LG2 A;  4AKI A;  3UZU A;  3JR4 A;  4G6Z A;  2KZU A;  4REZ A;  1DO0 A;  3GP1 A;  3UGJ A;  3U5Z B;  1HQY E;  4AW4 A;  4DV1 M;  4DR7 M;  1MX0 A;  5DNY A;  2J7N A;  2F5Q A;  4DV7 M;  4OVZ A;  4LY6 A;  3GO8 A;  2DVW B;  2DWL A;  2RGO A;  1G59 A;  4NRW A;  1EE8 A;  3FTF A;  3MK6 A;  1I4W A;  3U60 B;  3TWK A;  3KOX E;  3I4Y A;  3ZCB B;  3HHX A;  2CEA A;  4MGZ E;  3E9S A;  1PM5 A;  2QZ4 A;  3CF2 A;  5F3W A;  3SMP A;  2NQ8 C;  3U6C A;  4MGI E;  1XWI A;  1UM8 A;  2M5Z A;  1JR3 D;  2DZN B;  1L2C A;  1HT1 E;  3DOA A;  4LJ7 A;  3UJN A;  3SAR A;  2FOI C;  1E9S A;  4PD2 A;  5KPZ A;  2XEP A;  4IBI A;  3RE8 A;  3D8L A;  2R4E A;  3L28 A;  1IN6 A;  4LCB A;  3KW6 A;  3GLI A;  4ZPX A;  3ZH9 B;  5EXX A;  2C9C A;  4LFC M;  2F4V M;  3FUV A;  1Q39 A;  3GPX A;  4JI2 M;  3KP1 E;  5FLX S;  3L29 A;  4QOS A;  1L1T A;  2R65 A;  2L7H A;  3HU3 A;  4FW9 A;  4FCT A;  4IBB A;  4B7G A;  1QAQ A;  1Q3C A;  4D81 A;  4OX9 M;  2KRU A;  4GKK M;  2XSZ D;  4X62 M;  1YE9 A;  4OVZ B;  4BBA A;  1G41 A;  3PNV A;  2RKO A;  4OU7 A;  1NSF A;  1R6B X;  5IT9 S;  3LMM A;  2YR0 A;  4JYA M;  1S3S A;  4LF4 M;  1QQW A;  2R62 A;  4II7 A;  1IN4 A;  3K92 A;  2OQ4 A;  4DR2 M;  3ZC7 B;  1QAO A;  4DR6 M;  4R3D A;  1SXJ A;  1T3T A;  1LV7 A;  3VKG A;  1K3X A;  3VK8 A;  3TWL A;  4DV3 M;  4LF5 M;  3J7A S;  2CUZ A;  1G8P A;  4YY3 M;  1N78 A;  2QPA A;  1ORY B;  4JI8 M;  3WHL A;  1N33 M;  2QBY B;  3LQQ A;  4M9X A;  4BLC A;  4LGM A;  3FTD A;  4TUW A;  3U5Z A;  4IBK A;  4FVM A;  4BB9 A;  3FYC A;  2VQF M;  3GRV A;  2VII A;  4JXJ A;  4DV2 M;  4IIW A;  4DV5 M;  3SAU A;  1J09 A;  4NRV A;  1IN8 A;  5KQ8 A;  2Y0Q A;  4LFB M;  1ZQ9 A;  4M9S A;  3KOW E;  4L4U A;  5ITX E;  2EO2 A;  4IBC A;  5A2Q S;  3IG8 A;  4LJ4 A;  2DZO B;  1DGH A;  1OFH A;  2XZF A;  2EUC A;  2HCB A;  3GQ3 A;  3K2L A;  1FNN A;  2V1C A;  3B9P A;  4GC5 A;  3HGI A;  1N32 M;  2BJW A;  1SXJ B;  1IN7 A;  2G5G X;  3THG A;  4JI0 M;  3KSJ A;  1OFI A;  1YUB A;  3GLH B;  3M0E A;  2I7N A;  5EXT A;  4G4O A;  3IG5 A;  3FD9 A;  3VFD A;  3GRY A;  3KS8 A;  4NXM M;  1IY2 A;  1N34 M;  2CE7 A;  1K3W A;  2KXE A;  3CTW B;  1R7R A;  2RGH A;  3FKE A;  2FFJ A;  2UXD M;  1Z5A A;  3A42 A;  3HHY A;  3SHG B;  2D7E A;  1GLN A;  3PNY A;  1H6U A;  4DUZ M;  4JI6 M;  3FTC A;  2YQZ A;  4LJ9 A;  2XF3 A;  1L2B A;  3JR5 A;  2F5S A;  5JI3 E;  4DV0 M;  1TGU A;  3LVV A;  2G8L A;  3K1J A;  3HHZ A;  3RGP A;  5IWA M;  2QCU A;  4B3T M;  3J7B A;  2DHR A;  4CHT B;  3C58 A;  2OPF A;  1DGB A;  2KZS A;  2VQE M;  2CV0 A;  4X64 M;  5IZ7 D;  2L7I A;  4IJE A;  1R2Y A;  3AOE C;  1NHG C;  1TDH A;  4FD2 A;  5FSW A;  3U6L A;  2EA0 A;  4LZZ A;  5KPR A;  1DGG A;  1I94 M;  1XHB A;  4GHA A;  2W82 A;  2F5O A;  3FYD A;  4B3S M;  4AKH A;  2J7O A;  4B3R M;  4D82 A;  5KQD A;  1DGH B;  3TPZ A;  1NJG A;  3H4M A;  3AOE A;  1HR0 M;  3DZD A;  4LZJ A;  2CV1 A;  2C98 A;  3U6M A;  5ITR A;  3OTO M;  2QBY A;  4PDG A;  4DR3 M;  4GRI A;  4L78 A;  2Q2E B;  1QAN A;  3A45 A;  5H37 D;  3U6S A;  4DV4 M;  4RNA A;  4LF9 M;  3FUU A;  1IY1 A;  4WUR A;  2K47 A;  2XH9 A;  5C1B A;  1XNQ M;  3R8F A;  4PCZ A;  1XMO M;  3U6O A;  1IM2 A;  3CF0 A;  2V1U A;  2R18 A;  4LJ6 A;  2ZM6 M;  4X66 M;  3MHV C;  3L26 A;  2UXC M;  1SXJ C;  3UK6 A;  3M7G A;  3KS4 A;  4KO8 A;  1IBL M;  4PT5 A;  4GHL A;  2ZAM A;  4LGY A;  1JQJ C;  2XGN A;  4XBO A;  1Z6T A;  3D8B A;  5EP1 A;  3U6Q A;  3TL4 X;  3I4V A;  4GMQ A;  3VLF B;  5GKN A;  2DWZ B;  3KDS E;  3SAV A;  1NY5 A;  3J80 S;  5ITY A;  3UMM A;  1NHW C;  4FWG A;  4XGI A;  3GLH A;  4G4N A;  4JI4 M;  2Y0T A;  3TE6 A;  5FTN A;  4IBF A;  5E6J A;  3MJ5 A;  3W0F A;  2CFO A;  2KA6 B;  3Q8X A;  4JV5 M;  1PJI A;  2HHH M;  2V6Z M;  4W5W A;  3T15 A;  4LJ5 A;  3L27 A;  2XLJ A;  3T38 A;  1NNU C;  4LF8 M;  1N36 M;  2FE8 A;  4KOD A;  4B7F A;  4LF6 M;  2C96 A;  2CHG A;  2Z4R A;  5BPV A;  2FNA A;  3HJ8 A;  3VDU A;  7CAT A;  4AQY M;  4IBE A;  4G4Q A;  4B3M M;  3L2A A;  3I51 A;  2CHQ A;  2LNH C;  3SYL A;  4AG5 A;  1DGF A;  5BR8 M;  2C5R A;  1Q3B A;  2KW0 A;  3AJI B;  3SYK A;  3AOG A;  4IBJ A;  3HU1 A;  4GIT A;  5ITU A;  4GKJ M;  4PDI A;  1NNJ A;  4GC9 A;  1Z59 A;  2UUB M;  4AG6 A;  3JAM S;  5EP2 A;  4HL4 A;  1IQP A;  2YNM D;  2ZBK B;  3KOY E;  2L6O A;  4KHP M;  1N75 A;  4I81 A;  1WXQ A;  3TWM A;  4M9Z A;  1KYI A;  1SXJ E;  3GQ4 A;  4S12 A;  3EIH A;  1QAM A;  3PXG A;  1G4A E;  3PVS A;  4I5S A;  4LF7 M;  3GLF B;  4FWD A;  3J81 S;  4QHT A;  1YSY A;  2Y20 A;  1SXJ D;  2KRK A;  4ITQ A;  2X8A A;  1HNZ M;  1XNR M;  3T1Y M;  2UU9 M;  3U61 B;  3U6P A;  4FCW A;  2XSZ A;  4P16 A;  2O5R A;  2M60 A;  1OJL A;  4QHS A;  5DYI A;  4LJA A;  4JI1 M;  3U6E A;  4FCV A;  4L16 A;  4LJ8 A;  1J7K A;  4JI3 M;  5LMU M;  1N77 A;  2F5P A;  3K8Z A;  2UUA M;  3SHF A;  1R2Z A;  5ITQ A;  3FTE A;  4AI6 A;  1QVR A;  1L1Z A;  4LRT A;  3GRU A;  3SC3 A;  3WHK A;  4Z8X A;  3RGS A;  3GLG A;  4K0K M;  2P5T A;  3FUX A;  2C9O A;  4Z6Y A;  3SAS A;  1ZAE A;  2X4A A;  4MB7 A;  2CHV A;  2D7G A;  1TH3 A;  4LFA M;  2DWN A;  3QAU A;  3T1H M;  4QNM A;  1HNX M;  2X49 A;  2XFT A;  1NJF A;  4IBG A;  1IXS B;  5EQT A;  4B7H A;  4DUY M;  4AKG A;  2XFS A;  4LRS A;  3NBI A;  5KPT A;  5EP4 A;  1HT2 E;  2BJV A;  2C99 A;  4GIP A;  4KLN A;  3HKP A;  1E9R A;  3VK7 A;  2UUC M;  3DFZ A;  1PJJ A;  4B08 A;  3VKH A;  5DYG A;  3AL0 C;  3KOZ E;  5EXP A;  1MU5 A;  1QYR A;  3J27 B;  3ILK A;  4CIS A;  2ZAO A;  1NY6 A;  4I8O A;  4CGY B;  4RF0 A;  1IBK M;  4NSO B;  2R46 A;  4EIW A;  5KO3 A;  2CV2 A;  2A5Y B;  4MGH A;  3GPU A;  1IBM M;  2DWM A;  1L8Q A;  3A98 B;  4RF1 A;  1K82 A;  2LWX A;  1GKI A;  3FUT A;  1C1K A;  3NWL A;  3LQR A;  1Z5B A;  1XMQ M;  5ITX A;  4I4L A;  2Z4S A;  4L8R C;  1FJG M;  3GRR A;  3GLG B;  3E4R A;  5E26 A;  1X37 A;  3HHW A;  3KP0 E;  3M6A A;  1W5T A;  4A3V B;  2YFQ A;  2HL7 A;  4M0W A;  3L25 A;  3VDP A;  4MH0 E;  5C18 A;  5EJC A;  1XXH A;  2F5N A;  4FWH A;  4R7G A;  4MM3 B;  4M0D A;  4DR4 M;  3HJS A;  4GH9 A;  1G3I A;  4OW0 A;  3KVW A;  2QEN A;  5FTM A;  4MGK E;  3GLF A;  2DXI A;  3J2P B;  3R9X B;  1TDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...