2VQEM

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2vqeM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2vqeM02
5FLXS 1L1ZA 1TDHA 4LF5M 4LF6M 4LF7M 4ITQA 3VK7A 4PDIA 3U6QA 1XNRM 2OPFA 1K3WA 1N32M 3SAWA 1Q3CA 1R2ZA 2EA0A 2F5PA 2UU9M 1HNZM 4NRWA 1XNQM 1L1TA 4DR4M 2UUBM 1PM5A 1IBLM 1EE8A 1Z59A 4DV6M 5ITTA 1XC8A 4MB7A 2XZFA 4X62M 2XZUA 4JI8M 1XMOM 3J7AS 2VQEM 1HNXM 3GO8A 4B3TM 4KHPM 4B3RM 1PJIA 5IWAM 4GKJM 3A46A 1L2CA 4G4QA 3GQ4A 4G4NA 3JR4A 3GQ5A 5IT9S 4JYAM 3TWLA 4JI7M 1Z5AA 4OX9M 4PD2A 4G4OA 3DOAA 2F5QA 2HKJA 3U6EA 4YHHM 5LMNM 3GPYA 1L2DA 1PJJA 3T1YM 4JI1M 4LFAM 3J81S 3SASA 1K82A 2F4VM 1Q39A 3GPXA 2VQFM 2ZM6M 3GPPA 4JI5M 1MX0A 3GQ3A 4DV5M 2ZBKB 3SAUA 1XMQM 1K3XA 4B3MM 4DR5M 3C58A 5ITUA 4DR1M 1TDZA 2UUAM 4G4RA 4CISA 3SATA 1J5EM 1L2BA 3W0FA 4NXNM 3OTOM 5A2QS 4DV1M 1Q3BA 1HR0M 4X66M 4JI6M 1R2YA 4JI4M 1IBMM 3U6SA 5LMUM 4LFBM 5ITQA 2E5LM 4DV0M 2HHHM 4JI2M 4DR7M 3SBJA 5ITXA 3U6OA 4PDGA 2F5SA 4DR2M 4LF4M 1Z5CA 3T1HM 4AQYM 4DR6M 4DV2M 2UXDM 4LF9M 4YY3M 1Z5BA 1N34M 2F5OA 3J80S 3A42A 3A45A 3U6MA 1NNJA 4X64M 1N36M 3TWKA 2UXCM 5ITXE 4GKKM 3U6CA 4DV7M 4K0KM 1I94M 4DUZM 4DR3M 3U6PA 1IBKM 4PCZA 4LF8M 1KFVA 3JR5A 5ITRA 4JV5M 4DV3M 1FJGM 1HNWM 1N33M 4DV4M 3GP1A 3GPUA 3VK8A 1MU5A 4NRVA 4X65M 2OQ4A 4DUYM 5BR8M 2UUCM 2Q2EB 4JI0M 3U6LA 5ITYA 3JAMS 4LFCM 2F5NA 4NXMM 4B3SM 3U6DA 3SAVA 3SARA 3TWMA 4JI3M 2UXBM
chains in the Genus database with same CATH superfamily
2O01F 5FLXS 2R18A 1L1ZA 1V92A 2CUZA 5DNYA 2C9OA 4AG6A 2H1RA 5FTJA 3RE8A 1OAOC 3U6QA 1TTEA 4FVMA 2QP9X 2CHGA 2R46A 4FWDA 3SAWA 1Q3CA 2J5YA 4BLCA 5KPRA 1R2ZA 1OFHA 1DGHA 1H6UA 2APLA 1PRBA 2JZ1A 3R9XB 1PM5A 1EE8A 2Z3XA 2VIIA 2BJWA 4XK8F 4KO8A 1PJQA 1QUTA 2D7HA 5C18A 4X62M 2XZUA 3HU1A 1SXJC 2DENA 2JWSA 2RRUA 1NY5A 4P17A 3U61B 3ZC7B 1HNXM 2QBYB 4B3TM 4KHPM 4B3RM 4GKJM 2JA2A 2WSCF 4LJ4A 4BB9A 4FW9A 1G8PA 2YNMD 3HHWA 4IBKA 4QHTA 1L2CA 1IFYA 2RKOA 4JI7M 2QHOB 3AJIB 1T3TA 4G4OA 3DOAA 2HKJA 1ZAEA 5E6JA 3J2PB 3U6EA 3SFZA 2DVWB 2HL7A 1G59A 3K8ZA 1N75A 1NHWC 2L4FA 2LNHC 3GLIB 1PJJA 4AKHA 1GABA 1UFZA 4A3VB 4DBGB 3AKZA 4JI1M 4LFAM 1G41A 2X4AA 1K82A 1I4WA 3U60B 3KP0E 1IY2A 4D80A 2F4VM 2XLJA 4CGYB 3GPXA 3LMMA 2EUCA 4D82A 2DKLA 4GC5A 2B3TA 2J7OA 3HJSA 1MX0A 2C96A 3GQ3A 3AOEC 4LJ8A 4LRSA 1WJ7A 4Y28F 1XB2B 1XMQM 2UUAM 1Q02A 3I04M 2CFOA 2KHHA 2LVPC 2M60A 2X8AA 3SATA 2O25A 4FWHA 3DFZA 4NXNM 4DV1M 1Q3BA 1SG9A 1NJGA 3TQSA 5FTNA 3HJQA 1W5TA 2ZAOA 2P5TA 5LMUM 1T6OA 5ITQA 1NVMA 4MGZE 4JI2M 4DR7M 4II7A 2QNJA 4JN6A 4KODA 2OO9A 4RNAA 4LF4M 3T1HM 2UXDM 3TL4X 1HQCA 3GRUA 3E9SA 3A45A 3VLFB 1AIPC 4L4UA 1DGFA 4GKKM 3L28A 3FUTA 3RGSA 4K0KM 5C1BA 4DR3M 3VKGA 3U6PA 4M9SA 4PCZA 3KS8A 2KZSA 3L25A 2DAIA 2JNHA 5EP4A 3SHGB 5BPVA 5ITRA 3LCUA 3LVWA 3CF6E 2K9DA 1EIJA 4HLQA 4DV4M 1JR3A 3HGIA 2LVNC 2YQZA 3H4JA 3B7NA 3GLIE 3MMPA 2VDBB 1ZMWA 2AHMA 1P3QQ 2L09A 2WZJA 4BBAA 1GL7A 2JZ0A 4B7FA 2FNAA 3U61A 1IY1A 3UGJA 3FTFA 2CWBA 1FNNA 2Q2EB 1V33A 2CHVA 5JI3E 4NL4H 2BWBA 3KOXE 2F5NA 4LFCM 4B3SM 1OAIA 3SARA 2XSZA 1LV7A 2UXBM 1NHGC 3HU3A 3LVVA 1TDHA 3I4VA 4L15A 2NQ8C 2X49A 4F1IA 5GKNA 3KOWE 4LF6M 2K47A 4B7HA 3VK7A 1JR3D 1IN6A 1YUBA 3B7ZA 4L6V6 1QAMA 4Z8XA 1QUSA 2KDLA 1QANA 2V1CA 3ILKA 4Z6YA 1K3WA 1XNRM 4GHAA 1EFUB 2EA0A 2C99A 1VEJA 1XNQM 1QDRA 1GJSA 1TH2A 2UUBM 1DO0A 2FH0A 3WHKA 1Z59A 1QDTA 3CGWA 1TGUA 1QAQA 3FUWA 3GLHA 5DYIA 5ITTA 3FYDA 2XZFA 5F3WA 4HEOA 2D7GA 2VQEM 3GO8A 1SXJE 3KSXA 1PJIA 2EJSA 2ZTDA 1OQYA 1IXSB 2L2DA 4GEWA 3FE3A 2HAKA 4AI6A 3JR4A 3GQ5A 3UZUA 5EP1A 1SXJD 3TWLA 1Z5AA 4PD2A 3U5ZA 2V6ZM 4ZPXA 3SHFA 2KW0A 3Q8XA 2QSFX 5LMNM 3HJ8A 3GPYA 3FRIA 2MROB 1L2DA 4D81A 2LHCA 2LH0A 3C3EA 4RF1A 1DGBA 1XXHA 4LJAA 4WURA 3T1YM 3SASA 2DAGA 2FS1A 2C9CA 2XFTA 2R4EA 4F2LA 1QYRA 2QBYA 1Q39A 3GLHE 3FTEA 2R65A 5H37D 2CEAA 1RU3A 3B89A 3GPPA 4JI5M 4LGYA 2VF8A 1XHBA 1W5SA 4IBBA 5EXXA 2CV1A 2EKKA 4LCBA 5FTLA 4DR5M 2EO2A 1L8QA 4IBCA 1JQJC 2G3QA 4LZJA 1QVRA 4LY6A 3EIHA 1OKSA 1YSYA 2J7NA 1J5EM 2QZ4A 3OTOM 5A2QS 3CF0A 2LTUA 3K2LA 3LQRA 1VDDA 3BBZA 5JI2E 3GLGA 3U60A 1QZEA 4NSRA 1D0MA 1QQWA 3BOSA 4LFBM 4DV0M 4R3DA 2YR0A 2FOIC 1PJTA 2H5XA 2ZAMA 2DAEA 4R7GA 5ITXA 2HHHM 5EQTA 4PDGA 2FE8A 1Z5CA 3HY5A 4G6ZA 3C3DA 4GRIA 4LGMA 4LF9M 1Z5BA 1KSFX 4UN2B 3W68A 1JB0F 3A98B 3KOZE 3PFIA 4IBGA 3U6MA 2XEPA 1N36M 2UXCM 4WW0A 4DV7M 4DUZM 4AZFA 4JXJA 3GLFA 4MGIE 4LF8M 2Y0TA 4AKGA 4AW4A 5IZ7D 4JV5M 4IBIA 2MR9A 2I7PA 3KOYE 4XBOA 3GLGB 1N33M 3I4YA 4QOZC 1TF0B 3L29A 3PXGA 4IBJA 2LVQD 1QZMA 4X65M 3T6PA 2R62A 2DAKA 2DZNB 5EXTA 1GO5A 3M7GA 2OQ4A 1IM2A 5BR8M 2UUCM 2OOAA 2D7EA 4M0WA 2CV2A 1HT1E 4JI0M 2QCUA 4FCTA 5ITYA 3TPZA 1TH3A 3U6DA 4QHSA 1GKIA 1GJTA 2Z4SA 3FD9A 3GLFE 2DXIA 2M5ZA 1D2NA 4FCVA 3R8FA 2XFSA 4EIWA 4LF5M 4LF7M 3SYKA 1ZMVA 1HQYE 3IG8A 3LQQA 4ITQA 4MH0E 3KSJA 1ORYB 4LG2A 3UMMA 4PDIA 3GRYA 3LW5F 3VDUA 1F4IA 1XXHB 2OPFA 4CHTB 3AL0C 3VDPA 2Z7JA 2F5PA 2UU9M 1TR8A 2FFJA 5EXPA 1HNZM 1L1TA 4XGIA 4NRWA 4DR4M 3Q8GA 2KNVA 4NSOB 3KFUG 2LHGA 3QYBA 4DV6M 4PT5A 1XC8A 4MB7A 3FRHA 1XMOM 3NBXX 3VKHA 3F92A 3WHLA 5L8RF 3GLGE 4L8RC 5IWAM 1OFIA 4KT0F 4NOOB 3A46A 1E94E 3I01M 3GQ4A 3V76A 4IBFA 2JY6B 2MGWA 4JYAM 2DWMA 4RF0A 2F5QA 2JXNA 4GMQA 4YHHM 4IBDA 2I7NA 1IN5A 2DI0A 3FTCA 3E21A 4GH9A 5FTMA 1G4AE 2DNAA 3PNYA 4Q7JA 3AV0A 3J81S 4LJ7A 2GQFA 3HHYA 1T43A 2EKFA 2WSFF 4P16A 1HJPA 1MN3A 3AOEA 1SXJB 2RGOA 1E9RA 4L78A 4GC9A 5FSWA 1NJFA 1DO2A 3EIEA 3SAUA 1K3XA 4QNRA 1IN8A 1TDZA 1NSFA 3RGPA 2R45A 2Z4RA 2KNAA 3IECA 2N35A 2DWLA 2C5RA 2R4JA 1HR0M 2L7HA 2LVOC 3MJ5A 4X66M 5KQDA 4JI6M 2GNOA 4GITA 1NNUC 3DZDA 2KRKA 2CRUA 4M9XA 2LXEA 3RFWA 3UJNA 4AG5A 3VFDA 1YLAA 1R2YA 1IBMM 1Y8GA 2BJVA 2L7IA 2LWXA 2BWEA 2QPAA 1S3SA 4GIPA 4W5WA 1A5TA 3UK6A 2DHRA 4ANRA 3U6OA 3W0LB 4G3OA 4DR2M 4DR6M 4AQYM 4DV2M 1DV0A 4YY3M 2ZTCA 1WXQA 2F5OA 1WIVA 2CP8A 3K92A 3HHXA 1ZMUA 2KA6B 2JY7A 1N78A 1E32A 2DWZB 4X64M 2QQ8A 3D8LA 5IREB 5ITXE 2KEBA 2CE7A 1NV9A 2KNZA 1NY6A 2Y21A 3ZH9B 1HT2E 4REZA 3U6CA 1BVSA 1KFVA 2OOBA 1N77A 1J7KA 1R6BX 2G5GX 1KYIA 2YFQA 1D0LA 2QENA 4DV3M 1FJGM 2KZUA 1HNWM 3QYEA 1C7YA 1IN7A 3GP1A 4FCWA 3THGA 3VK8A 1MU5A 3PVSA 4FWGA 1OIZA 5EXSA 1XWIA 5KPZA 1IN4A 2XH9A 5KQ8A 3MHVC 4LJ5A 4GHLA 3K9PA 1J09A 3CTWB 3MK6A 2Z8YM 3ZQJA 1R5LA 3W67A 1VEKA 3IG5A 3KXEC 3JAMS 3GRVA 4I81A 3B9PA 3SAVA 3BXWA 3GLHB 3KDSE 2LVAA 4S12A 4MGYE 3FUVA 1V34A 3U5ZB 2JY5A 2K6BA 1D0KA 3C9PA 2DZOB 3FUUA 5KPTA 4WP2A 2JP7A 4I4LA 1IXSA 3KVWA 1IXZA 1ZV1A 2DWNA 2JY8A 4MGHA 2L4EA 3L2AA 4OW0A 2V1UA 1N32M 1G71A 3J7BA 3TE6A 2R6FA 3HZJA 5EP2A 1WGLA 1YE9A 3SYLA 3T38A 3FKEA 1IBLM 4IBEA 1OTRA 1SXJA 5EP3A 2CHQA 2R44A 4JI8M 4IJEA 1LTMA 3L27A 1G3IA 3B7QA 3J7AS 2LBCA 3H4MA 3LCVB 5KO3A 5E26A 4M0DA 2R0IA 4R71A 4M9ZA 1VEGA 2Y20A 1OIPA 4G4QA 4G4NA 2RGHA 5IT9S 2MH8A 2JUJA 4B7GA 3ZCBB 4OX9M 4OU7A 1IY0A 3K1JA 4HL4A 2KRUA 1GVNA 3HWSA 4LZZA 7CATA 3QWLA 4LRTA 3K9OA 4MM3B 1QAOA 4RKUF 2ZANA 1MJGM 3KP1E 1E9SA 3I51A 5DFLA 1PJSA 4LJ9A 4QOSA 3J27B 3D8BA 4B08A 2C98A 1NO1A 2VQFM 2ZM6M 3FUXA 3IHPA 1NV8A 1OJLA 3AOGA 4DV5M 2DZLA 1DGGA 2ZBKB 3NWLA 2DHYA 4B3MM 3E46A 5ITUA 4I5SA 3C58A 4DR1M 1IXRC 2WSEF 4G4RA 4CISA 3GLIA 2KXEA 1VG5A 3CF2A 3W0FA 3HU2A 1R7RA 2K0BX 1JR3E 3FYCA 8CATA 1L2BA 3L26A 1IQPA 3SMSA 4L16A 4TUWA 1GL6A 4JI4M 3GLFB 3U6SA 4CJ6A 2E5LM 4CIZA 1WGNA 2VF7A 2MJ5B 3SBJA 3T15A 1VDLA 2F5SA 2CV0A 4I8OA 2XF3A 2W82A 1AUAA 1PGYA 3PNVA 1XXHE 2XGNA 2HWJA 5EJCA 1N34M 3J80S 3A42A 1NNJA 3TWKA 5FTKA 1GLNA 3HKPA 4IIWA 1I94M 3M0EA 2DAMA 5DYGA 1IBKM 4AKIA 4NC6A 2A5YB 3B74A 3SC3A 2ERCA 2O5RA 1WHCA 3JR5A 1C1KA 2Y0QA 3GRRA 3KW6A 1R4GA 1WR1B 1VQ1A 1TH4A 3FTDA 4OVZB 3GPUA 3KS4A 4FD2A 4IJFA 3HX3A 4NRVA 2BNKA 3AFHA 3SMPA 1UM8A 3NBIA 4MGKE 2G8LA 4DUYM 2L6OA 1CUKA 2HCBA 4LJ6A 1ZQ9A 1DGHB 3E4RA 3HHZA 4QNMA 3M6AA 3U6LA 1Z6TA 3DA1A 1X37A 2XSZD 4NXMM 3QAUA 4KLNA 3TWMA 4JI3M 4OVZA
chains in the Genus database with same CATH topology
5FLXS 2R18A 1L1ZA 2CUZA 5DNYA 2C9OA 4AG6A 2H1RA 5FTJA 3RE8A 3U6QA 4FVMA 2QP9X 2CHGA 2R46A 4FWDA 3SAWA 1Q3CA 4BLCA 5KPRA 1R2ZA 1OFHA 1DGHA 1H6UA 3R9XB 1PM5A 1EE8A 2Z3XA 2VIIA 2BJWA 4KO8A 2D7HA 5C18A 4X62M 2XZUA 3HU1A 1SXJC 3U61B 1NY5A 1HNXM 3ZC7B 2QBYB 4B3TM 4KHPM 4B3RM 4GKJM 2JA2A 4LJ4A 4BB9A 4FW9A 1G8PA 2YNMD 3HHWA 4IBKA 4QHTA 1L2CA 2RKOA 4JI7M 3AJIB 1T3TA 4G4OA 3DOAA 2HKJA 1ZAEA 5E6JA 3J2PB 3U6EA 3SFZA 2DVWB 2HL7A 1G59A 3K8ZA 1N75A 1NHWC 2LNHC 3GLIB 1PJJA 4AKHA 4A3VB 3AKZA 4JI1M 4LFAM 1G41A 2X4AA 1K82A 1I4WA 3U60B 3KP0E 1IY2A 4D80A 2F4VM 2XLJA 4CGYB 3GPXA 3LMMA 2EUCA 4D82A 4GC5A 2J7OA 3HJSA 1MX0A 2C96A 3GQ3A 3AOEC 4LJ8A 4LRSA 1XMQM 2UUAM 2CFOA 2M60A 2X8AA 3SATA 4FWHA 3DFZA 4NXNM 4DV1M 1Q3BA 1NJGA 3TQSA 5FTNA 3HJQA 1W5TA 2ZAOA 2P5TA 5LMUM 5ITQA 1NVMA 4MGZE 4JI2M 4DR7M 4II7A 4JN6A 4KODA 4RNAA 4LF4M 3T1HM 2UXDM 3TL4X 1HQCA 3GRUA 3E9SA 3A45A 3VLFB 4L4UA 1DGFA 4GKKM 3L28A 3FUTA 3RGSA 4K0KM 5C1BA 4DR3M 3VKGA 3U6PA 4M9SA 4PCZA 3KS8A 2KZSA 3L25A 5EP4A 3SHGB 5BPVA 5ITRA 3LVWA 3CF6E 4HLQA 4DV4M 1JR3A 3HGIA 2YQZA 2AHMA 2L09A 4BBAA 1GL7A 4B7FA 2FNAA 3U61A 1IY1A 3UGJA 3FTFA 1FNNA 2Q2EB 2CHVA 5JI3E 4NL4H 3KOXE 2F5NA 4LFCM 4B3SM 3SARA 2XSZA 1LV7A 2UXBM 1NHGC 3HU3A 3LVVA 1TDHA 3I4VA 4L15A 2NQ8C 2X49A 4LF6M 5GKNA 3KOWE 2K47A 4B7HA 3VK7A 1JR3D 1IN6A 1YUBA 1QAMA 4Z8XA 2V1CA 1QANA 3ILKA 4Z6YA 1K3WA 1XNRM 4GHAA 2EA0A 2C99A 1XNQM 1TH2A 2UUBM 1DO0A 3WHKA 1Z59A 5DYIA 3FUWA 1TGUA 1QAQA 5ITTA 3GLHA 3FYDA 2XZFA 5F3WA 2D7GA 2VQEM 3GO8A 1SXJE 3KSXA 1PJIA 1IXSB 4AI6A 3JR4A 3GQ5A 3UZUA 5EP1A 1SXJD 3TWLA 1Z5AA 4PD2A 3U5ZA 2V6ZM 4ZPXA 3SHFA 2KW0A 3Q8XA 5LMNM 3HJ8A 3GPYA 1L2DA 4D81A 2LH0A 4RF1A 4WURA 1DGBA 1XXHA 4LJAA 3T1YM 3SASA 2C9CA 2XFTA 2R4EA 3FTEA 1QYRA 2QBYA 1Q39A 2R65A 5H37D 2CEAA 3GPPA 4JI5M 4LGYA 1XHBA 1W5SA 4IBBA 5EXXA 2CV1A 4LCBA 5FTLA 4DR5M 2EO2A 1L8QA 4IBCA 1JQJC 4LZJA 1QVRA 4LY6A 3EIHA 1YSYA 2J7NA 1J5EM 2QZ4A 3OTOM 5A2QS 3CF0A 3K2LA 3LQRA 1VDDA 5JI2E 3GLGA 3U60A 4NSRA 1QQWA 3BOSA 4LFBM 4DV0M 4R3DA 2YR0A 2FOIC 2HHHM 2ZAMA 4R7GA 5ITXA 5EQTA 4PDGA 2FE8A 1Z5CA 4G6ZA 4GRIA 4LGMA 4LF9M 1Z5BA 1KSFX 3A98B 3KOZE 3PFIA 4IBGA 3U6MA 2XEPA 1N36M 2UXCM 4WW0A 4DV7M 4DUZM 4AZFA 4JXJA 3GLFA 4MGIE 4LF8M 2Y0TA 4AKGA 4AW4A 5IZ7D 4JV5M 4IBIA 2I7PA 3KOYE 4XBOA 3GLGB 1N33M 3I4YA 4QOZC 3L29A 3PXGA 4IBJA 1QZMA 4X65M 2R62A 2DZNB 5EXTA 3M7GA 2OQ4A 1IM2A 5BR8M 2UUCM 4M0WA 2D7EA 2CV2A 1HT1E 4JI0M 2QCUA 4FCTA 5ITYA 3TPZA 1TH3A 3U6DA 4QHSA 1GKIA 2Z4SA 3FD9A 2DXIA 2M5ZA 1D2NA 4FCVA 3R8FA 2XFSA 4EIWA 4LF5M 4LF7M 3SYKA 4ITQA 1HQYE 3IG8A 3LQQA 4MH0E 3KSJA 1ORYB 4LG2A 3UMMA 4PDIA 3GRYA 3VDUA 1XXHB 2OPFA 4CHTB 3AL0C 3VDPA 2Z7JA 2F5PA 2UU9M 2FFJA 1HNZM 5EXPA 4NRWA 1L1TA 4XGIA 4DR4M 4NSOB 3KFUG 4DV6M 4PT5A 1XC8A 4MB7A 1XMOM 3VKHA 3WHLA 4L8RC 5IWAM 1OFIA 4NOOB 3A46A 1E94E 3GQ4A 4IBFA 4JYAM 2DWMA 4RF0A 2F5QA 4GMQA 4YHHM 4IBDA 2I7NA 1IN5A 3FTCA 5FTMA 4GH9A 1G4AE 3PNYA 3AV0A 3J81S 4LJ7A 3HHYA 4P16A 3AOEA 1SXJB 2RGOA 1E9RA 4L78A 4GC9A 5FSWA 1NJFA 1DO2A 3EIEA 3SAUA 1K3XA 4QNRA 1IN8A 1TDZA 1NSFA 3RGPA 2R45A 2Z4RA 2DWLA 2C5RA 2R4JA 1HR0M 2L7HA 3MJ5A 4X66M 5KQDA 4JI6M 4GITA 1NNUC 3DZDA 2KRKA 4M9XA 1R2YA 2LXEA 3RFWA 3UJNA 4AG5A 3VFDA 1IBMM 2BJVA 2L7IA 2LWXA 4GIPA 2QPAA 1S3SA 4W5WA 3UK6A 2DHRA 3U6OA 3W0LB 4DR2M 4DR6M 4AQYM 4DV2M 4YY3M 1WXQA 2F5OA 3K92A 3HHXA 2KA6B 1N78A 1E32A 2DWZB 4X64M 3D8LA 5IREB 5ITXE 2KEBA 2CE7A 3U6CA 2Y21A 1NY6A 3ZH9B 1HT2E 4REZA 1KFVA 1N77A 1J7KA 1R6BX 2G5GX 1KYIA 2YFQA 2QENA 4DV3M 1FJGM 2KZUA 1HNWM 1IN7A 3GP1A 4FCWA 3THGA 3VK8A 1MU5A 3PVSA 4FWGA 5EXSA 1XWIA 5KPZA 1IN4A 2XH9A 5KQ8A 3MHVC 4LJ5A 4GHLA 1J09A 3CTWB 3MK6A 3IG5A 3KXEC 3JAMS 3GRVA 4I81A 3B9PA 3SAVA 3GLHB 3KDSE 4S12A 4MGYE 3FUVA 3U5ZB 3FUUA 2DZOB 5KPTA 4I4LA 3KVWA 1IXZA 2DWNA 4MGHA 4OW0A 3L2AA 2V1UA 1N32M 3J7BA 3TE6A 5EP2A 1YE9A 3SYLA 3T38A 3FKEA 1IBLM 4IBEA 1SXJA 5EP3A 2CHQA 4JI8M 4IJEA 3L27A 1G3IA 3J7AS 3H4MA 5KO3A 5E26A 4M0DA 4M9ZA 2Y20A 4G4QA 4G4NA 2RGHA 5IT9S 4B7GA 3ZCBB 4OX9M 4OU7A 1IY0A 3K1JA 4HL4A 2KRUA 1GVNA 3HWSA 4LZZA 7CATA 3QWLA 4LRTA 4MM3B 1QAOA 2ZANA 3KP1E 1E9SA 3I51A 4LJ9A 4QOSA 3J27B 3D8BA 4B08A 2C98A 2VQFM 2ZM6M 3FUXA 1OJLA 3AOGA 4DV5M 1DGGA 2ZBKB 3NWLA 4B3MM 3C58A 5ITUA 4I5SA 4DR1M 1IXRC 4G4RA 4CISA 3GLIA 2KXEA 3CF2A 3W0FA 1L2BA 3HU2A 1R7RA 3FYCA 8CATA 3L26A 1IQPA 3SMSA 4L16A 4TUWA 1GL6A 4JI4M 3GLFB 3U6SA 2E5LM 3SBJA 3T15A 2F5SA 2CV0A 4I8OA 2XF3A 2W82A 3PNVA 2XGNA 5EJCA 1N34M 3J80S 3A42A 1NNJA 3TWKA 5FTKA 1GLNA 3HKPA 4IIWA 1I94M 3M0EA 5DYGA 1IBKM 4AKIA 2A5YB 3SC3A 2ERCA 2O5RA 3JR5A 1C1KA 2Y0QA 3GRRA 3KW6A 3FTDA 1TH4A 4OVZB 3GPUA 3KS4A 4FD2A 4IJFA 4NRVA 2BNKA 3AFHA 3SMPA 1UM8A 3NBIA 4MGKE 2G8LA 4DUYM 2L6OA 4LJ6A 2HCBA 1ZQ9A 1DGHB 3E4RA 3HHZA 4QNMA 3M6AA 3U6LA 1Z6TA 3DA1A 1X37A 2XSZD 4NXMM 3QAUA 4KLNA 3TWMA 4JI3M 4OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX S;  1L1Z A;  1TDH A;  4LF5 M;  4LF6 M;  4LF7 M;  4ITQ A;  3VK7 A;  4PDI A;  3U6Q A;  1XNR M;  2OPF A;  1K3W A;  1N32 M;  3SAW A;  1Q3C A;  1R2Z A;  2EA0 A;  2F5P A;  2UU9 M;  1HNZ M;  4NRW A;  1XNQ M;  1L1T A;  4DR4 M;  2UUB M;  1PM5 A;  1IBL M;  1EE8 A;  1Z59 A;  4DV6 M;  5ITT A;  1XC8 A;  4MB7 A;  2XZF A;  4X62 M;  2XZU A;  4JI8 M;  1XMO M;  3J7A S;  2VQE M;  1HNX M;  3GO8 A;  4B3T M;  4KHP M;  4B3R M;  1PJI A;  5IWA M;  4GKJ M;  3A46 A;  1L2C A;  4G4Q A;  3GQ4 A;  4G4N A;  3JR4 A;  3GQ5 A;  5IT9 S;  4JYA M;  3TWL A;  4JI7 M;  1Z5A A;  4OX9 M;  4PD2 A;  4G4O A;  3DOA A;  2F5Q A;  2HKJ A;  3U6E A;  4YHH M;  5LMN M;  3GPY A;  1L2D A;  1PJJ A;  3T1Y M;  4JI1 M;  4LFA M;  3J81 S;  3SAS A;  1K82 A;  2F4V M;  1Q39 A;  3GPX A;  2VQF M;  2ZM6 M;  3GPP A;  4JI5 M;  1MX0 A;  3GQ3 A;  4DV5 M;  2ZBK B;  3SAU A;  1XMQ M;  1K3X A;  4B3M M;  4DR5 M;  3C58 A;  5ITU A;  4DR1 M;  1TDZ A;  2UUA M;  4G4R A;  4CIS A;  3SAT A;  1J5E M;  1L2B A;  3W0F A;  4NXN M;  3OTO M;  5A2Q S;  4DV1 M;  1Q3B A;  1HR0 M;  4X66 M;  4JI6 M;  1R2Y A;  4JI4 M;  1IBM M;  3U6S A;  5LMU M;  4LFB M;  5ITQ A;  2E5L M;  4DV0 M;  2HHH M;  4JI2 M;  4DR7 M;  3SBJ A;  5ITX A;  3U6O A;  4PDG A;  2F5S A;  4DR2 M;  4LF4 M;  1Z5C A;  3T1H M;  4AQY M;  4DR6 M;  4DV2 M;  2UXD M;  4LF9 M;  4YY3 M;  1Z5B A;  1N34 M;  2F5O A;  3J80 S;  3A42 A;  3A45 A;  3U6M A;  1NNJ A;  4X64 M;  1N36 M;  3TWK A;  2UXC M;  5ITX E;  4GKK M;  3U6C A;  4DV7 M;  4K0K M;  1I94 M;  4DUZ M;  4DR3 M;  3U6P A;  1IBK M;  4PCZ A;  4LF8 M;  1KFV A;  3JR5 A;  5ITR A;  4JV5 M;  4DV3 M;  1FJG M;  1HNW M;  1N33 M;  4DV4 M;  3GP1 A;  3GPU A;  3VK8 A;  1MU5 A;  4NRV A;  4X65 M;  2OQ4 A;  4DUY M;  5BR8 M;  2UUC M;  2Q2E B;  4JI0 M;  3U6L A;  5ITY A;  3JAM S;  4LFC M;  2F5N A;  4NXM M;  4B3S M;  3U6D A;  3SAV A;  3SAR A;  3TWM A;  4JI3 M;  2UXB M; 
#chains in the Genus database with same CATH topology
 2O01 F;  5FLX S;  2R18 A;  1L1Z A;  1V92 A;  2CUZ A;  5DNY A;  2C9O A;  4AG6 A;  2H1R A;  5FTJ A;  3RE8 A;  1OAO C;  3U6Q A;  1TTE A;  4FVM A;  2QP9 X;  2CHG A;  2R46 A;  4FWD A;  3SAW A;  1Q3C A;  2J5Y A;  4BLC A;  5KPR A;  1R2Z A;  1OFH A;  1DGH A;  1H6U A;  2APL A;  1PRB A;  2JZ1 A;  3R9X B;  1PM5 A;  1EE8 A;  2Z3X A;  2VII A;  2BJW A;  4XK8 F;  4KO8 A;  1PJQ A;  1QUT A;  2D7H A;  5C18 A;  4X62 M;  2XZU A;  3HU1 A;  1SXJ C;  2DEN A;  2JWS A;  2RRU A;  1NY5 A;  4P17 A;  3U61 B;  3ZC7 B;  1HNX M;  2QBY B;  4B3T M;  4KHP M;  4B3R M;  4GKJ M;  2JA2 A;  2WSC F;  4LJ4 A;  4BB9 A;  4FW9 A;  1G8P A;  2YNM D;  3HHW A;  4IBK A;  4QHT A;  1L2C A;  1IFY A;  2RKO A;  4JI7 M;  2QHO B;  3AJI B;  1T3T A;  4G4O A;  3DOA A;  2HKJ A;  1ZAE A;  5E6J A;  3J2P B;  3U6E A;  3SFZ A;  2DVW B;  2HL7 A;  1G59 A;  3K8Z A;  1N75 A;  1NHW C;  2L4F A;  2LNH C;  3GLI B;  1PJJ A;  4AKH A;  1GAB A;  1UFZ A;  4A3V B;  4DBG B;  3AKZ A;  4JI1 M;  4LFA M;  1G41 A;  2X4A A;  1K82 A;  1I4W A;  3U60 B;  3KP0 E;  1IY2 A;  4D80 A;  2F4V M;  2XLJ A;  4CGY B;  3GPX A;  3LMM A;  2EUC A;  4D82 A;  2DKL A;  4GC5 A;  2B3T A;  2J7O A;  3HJS A;  1MX0 A;  2C96 A;  3GQ3 A;  3AOE C;  4LJ8 A;  4LRS A;  1WJ7 A;  4Y28 F;  1XB2 B;  1XMQ M;  2UUA M;  1Q02 A;  3I04 M;  2CFO A;  2KHH A;  2LVP C;  2M60 A;  2X8A A;  3SAT A;  2O25 A;  4FWH A;  3DFZ A;  4NXN M;  4DV1 M;  1Q3B A;  1SG9 A;  1NJG A;  3TQS A;  5FTN A;  3HJQ A;  1W5T A;  2ZAO A;  2P5T A;  5LMU M;  1T6O A;  5ITQ A;  1NVM A;  4MGZ E;  4JI2 M;  4DR7 M;  4II7 A;  2QNJ A;  4JN6 A;  4KOD A;  2OO9 A;  4RNA A;  4LF4 M;  3T1H M;  2UXD M;  3TL4 X;  1HQC A;  3GRU A;  3E9S A;  3A45 A;  3VLF B;  1AIP C;  4L4U A;  1DGF A;  4GKK M;  3L28 A;  3FUT A;  3RGS A;  4K0K M;  5C1B A;  4DR3 M;  3VKG A;  3U6P A;  4M9S A;  4PCZ A;  3KS8 A;  2KZS A;  3L25 A;  2DAI A;  2JNH A;  5EP4 A;  3SHG B;  5BPV A;  5ITR A;  3LCU A;  3LVW A;  3CF6 E;  2K9D A;  1EIJ A;  4HLQ A;  4DV4 M;  1JR3 A;  3HGI A;  2LVN C;  2YQZ A;  3H4J A;  3B7N A;  3GLI E;  3MMP A;  2VDB B;  1ZMW A;  2AHM A;  1P3Q Q;  2L09 A;  2WZJ A;  4BBA A;  1GL7 A;  2JZ0 A;  4B7F A;  2FNA A;  3U61 A;  1IY1 A;  3UGJ A;  3FTF A;  2CWB A;  1FNN A;  2Q2E B;  1V33 A;  2CHV A;  5JI3 E;  4NL4 H;  2BWB A;  3KOX E;  2F5N A;  4LFC M;  4B3S M;  1OAI A;  3SAR A;  2XSZ A;  1LV7 A;  2UXB M;  1NHG C;  3HU3 A;  3LVV A;  1TDH A;  3I4V A;  4L15 A;  2NQ8 C;  2X49 A;  4F1I A;  5GKN A;  3KOW E;  4LF6 M;  2K47 A;  4B7H A;  3VK7 A;  1JR3 D;  1IN6 A;  1YUB A;  3B7Z A;  4L6V 6;  1QAM A;  4Z8X A;  1QUS A;  2KDL A;  1QAN A;  2V1C A;  3ILK A;  4Z6Y A;  1K3W A;  1XNR M;  4GHA A;  1EFU B;  2EA0 A;  2C99 A;  1VEJ A;  1XNQ M;  1QDR A;  1GJS A;  1TH2 A;  2UUB M;  1DO0 A;  2FH0 A;  3WHK A;  1Z59 A;  1QDT A;  3CGW A;  1TGU A;  1QAQ A;  3FUW A;  3GLH A;  5DYI A;  5ITT A;  3FYD A;  2XZF A;  5F3W A;  4HEO A;  2D7G A;  2VQE M;  3GO8 A;  1SXJ E;  3KSX A;  1PJI A;  2EJS A;  2ZTD A;  1OQY A;  1IXS B;  2L2D A;  4GEW A;  3FE3 A;  2HAK A;  4AI6 A;  3JR4 A;  3GQ5 A;  3UZU A;  5EP1 A;  1SXJ D;  3TWL A;  1Z5A A;  4PD2 A;  3U5Z A;  2V6Z M;  4ZPX A;  3SHF A;  2KW0 A;  3Q8X A;  2QSF X;  5LMN M;  3HJ8 A;  3GPY A;  3FRI A;  2MRO B;  1L2D A;  4D81 A;  2LHC A;  2LH0 A;  3C3E A;  4RF1 A;  1DGB A;  1XXH A;  4LJA A;  4WUR A;  3T1Y M;  3SAS A;  2DAG A;  2FS1 A;  2C9C A;  2XFT A;  2R4E A;  4F2L A;  1QYR A;  2QBY A;  1Q39 A;  3GLH E;  3FTE A;  2R65 A;  5H37 D;  2CEA A;  1RU3 A;  3B89 A;  3GPP A;  4JI5 M;  4LGY A;  2VF8 A;  1XHB A;  1W5S A;  4IBB A;  5EXX A;  2CV1 A;  2EKK A;  4LCB A;  5FTL A;  4DR5 M;  2EO2 A;  1L8Q A;  4IBC A;  1JQJ C;  2G3Q A;  4LZJ A;  1QVR A;  4LY6 A;  3EIH A;  1OKS A;  1YSY A;  2J7N A;  1J5E M;  2QZ4 A;  3OTO M;  5A2Q S;  3CF0 A;  2LTU A;  3K2L A;  3LQR A;  1VDD A;  3BBZ A;  5JI2 E;  3GLG A;  3U60 A;  1QZE A;  4NSR A;  1D0M A;  1QQW A;  3BOS A;  4LFB M;  4DV0 M;  4R3D A;  2YR0 A;  2FOI C;  1PJT A;  2H5X A;  2ZAM A;  2DAE A;  4R7G A;  5ITX A;  2HHH M;  5EQT A;  4PDG A;  2FE8 A;  1Z5C A;  3HY5 A;  4G6Z A;  3C3D A;  4GRI A;  4LGM A;  4LF9 M;  1Z5B A;  1KSF X;  4UN2 B;  3W68 A;  1JB0 F;  3A98 B;  3KOZ E;  3PFI A;  4IBG A;  3U6M A;  2XEP A;  1N36 M;  2UXC M;  4WW0 A;  4DV7 M;  4DUZ M;  4AZF A;  4JXJ A;  3GLF A;  4MGI E;  4LF8 M;  2Y0T A;  4AKG A;  4AW4 A;  5IZ7 D;  4JV5 M;  4IBI A;  2MR9 A;  2I7P A;  3KOY E;  4XBO A;  3GLG B;  1N33 M;  3I4Y A;  4QOZ C;  1TF0 B;  3L29 A;  3PXG A;  4IBJ A;  2LVQ D;  1QZM A;  4X65 M;  3T6P A;  2R62 A;  2DAK A;  2DZN B;  5EXT A;  1GO5 A;  3M7G A;  2OQ4 A;  1IM2 A;  5BR8 M;  2UUC M;  2OOA A;  2D7E A;  4M0W A;  2CV2 A;  1HT1 E;  4JI0 M;  2QCU A;  4FCT A;  5ITY A;  3TPZ A;  1TH3 A;  3U6D A;  4QHS A;  1GKI A;  1GJT A;  2Z4S A;  3FD9 A;  3GLF E;  2DXI A;  2M5Z A;  1D2N A;  4FCV A;  3R8F A;  2XFS A;  4EIW A;  4LF5 M;  4LF7 M;  3SYK A;  1ZMV A;  1HQY E;  3IG8 A;  3LQQ A;  4ITQ A;  4MH0 E;  3KSJ A;  1ORY B;  4LG2 A;  3UMM A;  4PDI A;  3GRY A;  3LW5 F;  3VDU A;  1F4I A;  1XXH B;  2OPF A;  4CHT B;  3AL0 C;  3VDP A;  2Z7J A;  2F5P A;  2UU9 M;  1TR8 A;  2FFJ A;  5EXP A;  1HNZ M;  1L1T A;  4XGI A;  4NRW A;  4DR4 M;  3Q8G A;  2KNV A;  4NSO B;  3KFU G;  2LHG A;  3QYB A;  4DV6 M;  4PT5 A;  1XC8 A;  4MB7 A;  3FRH A;  1XMO M;  3NBX X;  3VKH A;  3F92 A;  3WHL A;  5L8R F;  3GLG E;  4L8R C;  5IWA M;  1OFI A;  4KT0 F;  4NOO B;  3A46 A;  1E94 E;  3I01 M;  3GQ4 A;  3V76 A;  4IBF A;  2JY6 B;  2MGW A;  4JYA M;  2DWM A;  4RF0 A;  2F5Q A;  2JXN A;  4GMQ A;  4YHH M;  4IBD A;  2I7N A;  1IN5 A;  2DI0 A;  3FTC A;  3E21 A;  4GH9 A;  5FTM A;  1G4A E;  2DNA A;  3PNY A;  4Q7J A;  3AV0 A;  3J81 S;  4LJ7 A;  2GQF A;  3HHY A;  1T43 A;  2EKF A;  2WSF F;  4P16 A;  1HJP A;  1MN3 A;  3AOE A;  1SXJ B;  2RGO A;  1E9R A;  4L78 A;  4GC9 A;  5FSW A;  1NJF A;  1DO2 A;  3EIE A;  3SAU A;  1K3X A;  4QNR A;  1IN8 A;  1TDZ A;  1NSF A;  3RGP A;  2R45 A;  2Z4R A;  2KNA A;  3IEC A;  2N35 A;  2DWL A;  2C5R A;  2R4J A;  1HR0 M;  2L7H A;  2LVO C;  3MJ5 A;  4X66 M;  5KQD A;  4JI6 M;  2GNO A;  4GIT A;  1NNU C;  3DZD A;  2KRK A;  2CRU A;  4M9X A;  2LXE A;  3RFW A;  3UJN A;  4AG5 A;  3VFD A;  1YLA A;  1R2Y A;  1IBM M;  1Y8G A;  2BJV A;  2L7I A;  2LWX A;  2BWE A;  2QPA A;  1S3S A;  4GIP A;  4W5W A;  1A5T A;  3UK6 A;  2DHR A;  4ANR A;  3U6O A;  3W0L B;  4G3O A;  4DR2 M;  4DR6 M;  4AQY M;  4DV2 M;  1DV0 A;  4YY3 M;  2ZTC A;  1WXQ A;  2F5O A;  1WIV A;  2CP8 A;  3K92 A;  3HHX A;  1ZMU A;  2KA6 B;  2JY7 A;  1N78 A;  1E32 A;  2DWZ B;  4X64 M;  2QQ8 A;  3D8L A;  5IRE B;  5ITX E;  2KEB A;  2CE7 A;  1NV9 A;  2KNZ A;  1NY6 A;  2Y21 A;  3ZH9 B;  1HT2 E;  4REZ A;  3U6C A;  1BVS A;  1KFV A;  2OOB A;  1N77 A;  1J7K A;  1R6B X;  2G5G X;  1KYI A;  2YFQ A;  1D0L A;  2QEN A;  4DV3 M;  1FJG M;  2KZU A;  1HNW M;  3QYE A;  1C7Y A;  1IN7 A;  3GP1 A;  4FCW A;  3THG A;  3VK8 A;  1MU5 A;  3PVS A;  4FWG A;  1OIZ A;  5EXS A;  1XWI A;  5KPZ A;  1IN4 A;  2XH9 A;  5KQ8 A;  3MHV C;  4LJ5 A;  4GHL A;  3K9P A;  1J09 A;  3CTW B;  3MK6 A;  2Z8Y M;  3ZQJ A;  1R5L A;  3W67 A;  1VEK A;  3IG5 A;  3KXE C;  3JAM S;  3GRV A;  4I81 A;  3B9P A;  3SAV A;  3BXW A;  3GLH B;  3KDS E;  2LVA A;  4S12 A;  4MGY E;  3FUV A;  1V34 A;  3U5Z B;  2JY5 A;  2K6B A;  1D0K A;  3C9P A;  2DZO B;  3FUU A;  5KPT A;  4WP2 A;  2JP7 A;  4I4L A;  1IXS A;  3KVW A;  1IXZ A;  1ZV1 A;  2DWN A;  2JY8 A;  4MGH A;  2L4E A;  3L2A A;  4OW0 A;  2V1U A;  1N32 M;  1G71 A;  3J7B A;  3TE6 A;  2R6F A;  3HZJ A;  5EP2 A;  1WGL A;  1YE9 A;  3SYL A;  3T38 A;  3FKE A;  1IBL M;  4IBE A;  1OTR A;  1SXJ A;  5EP3 A;  2CHQ A;  2R44 A;  4JI8 M;  4IJE A;  1LTM A;  3L27 A;  1G3I A;  3B7Q A;  3J7A S;  2LBC A;  3H4M A;  3LCV B;  5KO3 A;  5E26 A;  4M0D A;  2R0I A;  4R71 A;  4M9Z A;  1VEG A;  2Y20 A;  1OIP A;  4G4Q A;  4G4N A;  2RGH A;  5IT9 S;  2MH8 A;  2JUJ A;  4B7G A;  3ZCB B;  4OX9 M;  4OU7 A;  1IY0 A;  3K1J A;  4HL4 A;  2KRU A;  1GVN A;  3HWS A;  4LZZ A;  7CAT A;  3QWL A;  4LRT A;  3K9O A;  4MM3 B;  1QAO A;  4RKU F;  2ZAN A;  1MJG M;  3KP1 E;  1E9S A;  3I51 A;  5DFL A;  1PJS A;  4LJ9 A;  4QOS A;  3J27 B;  3D8B A;  4B08 A;  2C98 A;  1NO1 A;  2VQF M;  2ZM6 M;  3FUX A;  3IHP A;  1NV8 A;  1OJL A;  3AOG A;  4DV5 M;  2DZL A;  1DGG A;  2ZBK B;  3NWL A;  2DHY A;  4B3M M;  3E46 A;  5ITU A;  4I5S A;  3C58 A;  4DR1 M;  1IXR C;  2WSE F;  4G4R A;  4CIS A;  3GLI A;  2KXE A;  1VG5 A;  3CF2 A;  3W0F A;  3HU2 A;  1R7R A;  2K0B X;  1JR3 E;  3FYC A;  8CAT A;  1L2B A;  3L26 A;  1IQP A;  3SMS A;  4L16 A;  4TUW A;  1GL6 A;  4JI4 M;  3GLF B;  3U6S A;  4CJ6 A;  2E5L M;  4CIZ A;  1WGN A;  2VF7 A;  2MJ5 B;  3SBJ A;  3T15 A;  1VDL A;  2F5S A;  2CV0 A;  4I8O A;  2XF3 A;  2W82 A;  1AUA A;  1PGY A;  3PNV A;  1XXH E;  2XGN A;  2HWJ A;  5EJC A;  1N34 M;  3J80 S;  3A42 A;  1NNJ A;  3TWK A;  5FTK A;  1GLN A;  3HKP A;  4IIW A;  1I94 M;  3M0E A;  2DAM A;  5DYG A;  1IBK M;  4AKI A;  4NC6 A;  2A5Y B;  3B74 A;  3SC3 A;  2ERC A;  2O5R A;  1WHC A;  3JR5 A;  1C1K A;  2Y0Q A;  3GRR A;  3KW6 A;  1R4G A;  1WR1 B;  1VQ1 A;  1TH4 A;  3FTD A;  4OVZ B;  3GPU A;  3KS4 A;  4FD2 A;  4IJF A;  3HX3 A;  4NRV A;  2BNK A;  3AFH A;  3SMP A;  1UM8 A;  3NBI A;  4MGK E;  2G8L A;  4DUY M;  2L6O A;  1CUK A;  2HCB A;  4LJ6 A;  1ZQ9 A;  1DGH B;  3E4R A;  3HHZ A;  4QNM A;  3M6A A;  3U6L A;  1Z6T A;  3DA1 A;  1X37 A;  2XSZ D;  4NXM M;  3QAU A;  4KLN A;  3TWM A;  4JI3 M;  4OVZ A; 
#chains in the Genus database with same CATH homology
 5FLX S;  2R18 A;  1L1Z A;  2CUZ A;  5DNY A;  2C9O A;  4AG6 A;  2H1R A;  5FTJ A;  3RE8 A;  3U6Q A;  4FVM A;  2QP9 X;  2CHG A;  2R46 A;  4FWD A;  3SAW A;  1Q3C A;  4BLC A;  5KPR A;  1R2Z A;  1OFH A;  1DGH A;  1H6U A;  3R9X B;  1PM5 A;  1EE8 A;  2Z3X A;  2VII A;  2BJW A;  4KO8 A;  2D7H A;  5C18 A;  4X62 M;  2XZU A;  3HU1 A;  1SXJ C;  3U61 B;  1NY5 A;  1HNX M;  3ZC7 B;  2QBY B;  4B3T M;  4KHP M;  4B3R M;  4GKJ M;  2JA2 A;  4LJ4 A;  4BB9 A;  4FW9 A;  1G8P A;  2YNM D;  3HHW A;  4IBK A;  4QHT A;  1L2C A;  2RKO A;  4JI7 M;  3AJI B;  1T3T A;  4G4O A;  3DOA A;  2HKJ A;  1ZAE A;  5E6J A;  3J2P B;  3U6E A;  3SFZ A;  2DVW B;  2HL7 A;  1G59 A;  3K8Z A;  1N75 A;  1NHW C;  2LNH C;  3GLI B;  1PJJ A;  4AKH A;  4A3V B;  3AKZ A;  4JI1 M;  4LFA M;  1G41 A;  2X4A A;  1K82 A;  1I4W A;  3U60 B;  3KP0 E;  1IY2 A;  4D80 A;  2F4V M;  2XLJ A;  4CGY B;  3GPX A;  3LMM A;  2EUC A;  4D82 A;  4GC5 A;  2J7O A;  3HJS A;  1MX0 A;  2C96 A;  3GQ3 A;  3AOE C;  4LJ8 A;  4LRS A;  1XMQ M;  2UUA M;  2CFO A;  2M60 A;  2X8A A;  3SAT A;  4FWH A;  3DFZ A;  4NXN M;  4DV1 M;  1Q3B A;  1NJG A;  3TQS A;  5FTN A;  3HJQ A;  1W5T A;  2ZAO A;  2P5T A;  5LMU M;  5ITQ A;  1NVM A;  4MGZ E;  4JI2 M;  4DR7 M;  4II7 A;  4JN6 A;  4KOD A;  4RNA A;  4LF4 M;  3T1H M;  2UXD M;  3TL4 X;  1HQC A;  3GRU A;  3E9S A;  3A45 A;  3VLF B;  4L4U A;  1DGF A;  4GKK M;  3L28 A;  3FUT A;  3RGS A;  4K0K M;  5C1B A;  4DR3 M;  3VKG A;  3U6P A;  4M9S A;  4PCZ A;  3KS8 A;  2KZS A;  3L25 A;  5EP4 A;  3SHG B;  5BPV A;  5ITR A;  3LVW A;  3CF6 E;  4HLQ A;  4DV4 M;  1JR3 A;  3HGI A;  2YQZ A;  2AHM A;  2L09 A;  4BBA A;  1GL7 A;  4B7F A;  2FNA A;  3U61 A;  1IY1 A;  3UGJ A;  3FTF A;  1FNN A;  2Q2E B;  2CHV A;  5JI3 E;  4NL4 H;  3KOX E;  2F5N A;  4LFC M;  4B3S M;  3SAR A;  2XSZ A;  1LV7 A;  2UXB M;  1NHG C;  3HU3 A;  3LVV A;  1TDH A;  3I4V A;  4L15 A;  2NQ8 C;  2X49 A;  4LF6 M;  5GKN A;  3KOW E;  2K47 A;  4B7H A;  3VK7 A;  1JR3 D;  1IN6 A;  1YUB A;  1QAM A;  4Z8X A;  2V1C A;  1QAN A;  3ILK A;  4Z6Y A;  1K3W A;  1XNR M;  4GHA A;  2EA0 A;  2C99 A;  1XNQ M;  1TH2 A;  2UUB M;  1DO0 A;  3WHK A;  1Z59 A;  5DYI A;  3FUW A;  1TGU A;  1QAQ A;  5ITT A;  3GLH A;  3FYD A;  2XZF A;  5F3W A;  2D7G A;  2VQE M;  3GO8 A;  1SXJ E;  3KSX A;  1PJI A;  1IXS B;  4AI6 A;  3JR4 A;  3GQ5 A;  3UZU A;  5EP1 A;  1SXJ D;  3TWL A;  1Z5A A;  4PD2 A;  3U5Z A;  2V6Z M;  4ZPX A;  3SHF A;  2KW0 A;  3Q8X A;  5LMN M;  3HJ8 A;  3GPY A;  1L2D A;  4D81 A;  2LH0 A;  4RF1 A;  4WUR A;  1DGB A;  1XXH A;  4LJA A;  3T1Y M;  3SAS A;  2C9C A;  2XFT A;  2R4E A;  3FTE A;  1QYR A;  2QBY A;  1Q39 A;  2R65 A;  5H37 D;  2CEA A;  3GPP A;  4JI5 M;  4LGY A;  1XHB A;  1W5S A;  4IBB A;  5EXX A;  2CV1 A;  4LCB A;  5FTL A;  4DR5 M;  2EO2 A;  1L8Q A;  4IBC A;  1JQJ C;  4LZJ A;  1QVR A;  4LY6 A;  3EIH A;  1YSY A;  2J7N A;  1J5E M;  2QZ4 A;  3OTO M;  5A2Q S;  3CF0 A;  3K2L A;  3LQR A;  1VDD A;  5JI2 E;  3GLG A;  3U60 A;  4NSR A;  1QQW A;  3BOS A;  4LFB M;  4DV0 M;  4R3D A;  2YR0 A;  2FOI C;  2HHH M;  2ZAM A;  4R7G A;  5ITX A;  5EQT A;  4PDG A;  2FE8 A;  1Z5C A;  4G6Z A;  4GRI A;  4LGM A;  4LF9 M;  1Z5B A;  1KSF X;  3A98 B;  3KOZ E;  3PFI A;  4IBG A;  3U6M A;  2XEP A;  1N36 M;  2UXC M;  4WW0 A;  4DV7 M;  4DUZ M;  4AZF A;  4JXJ A;  3GLF A;  4MGI E;  4LF8 M;  2Y0T A;  4AKG A;  4AW4 A;  5IZ7 D;  4JV5 M;  4IBI A;  2I7P A;  3KOY E;  4XBO A;  3GLG B;  1N33 M;  3I4Y A;  4QOZ C;  3L29 A;  3PXG A;  4IBJ A;  1QZM A;  4X65 M;  2R62 A;  2DZN B;  5EXT A;  3M7G A;  2OQ4 A;  1IM2 A;  5BR8 M;  2UUC M;  4M0W A;  2D7E A;  2CV2 A;  1HT1 E;  4JI0 M;  2QCU A;  4FCT A;  5ITY A;  3TPZ A;  1TH3 A;  3U6D A;  4QHS A;  1GKI A;  2Z4S A;  3FD9 A;  2DXI A;  2M5Z A;  1D2N A;  4FCV A;  3R8F A;  2XFS A;  4EIW A;  4LF5 M;  4LF7 M;  3SYK A;  4ITQ A;  1HQY E;  3IG8 A;  3LQQ A;  4MH0 E;  3KSJ A;  1ORY B;  4LG2 A;  3UMM A;  4PDI A;  3GRY A;  3VDU A;  1XXH B;  2OPF A;  4CHT B;  3AL0 C;  3VDP A;  2Z7J A;  2F5P A;  2UU9 M;  2FFJ A;  1HNZ M;  5EXP A;  4NRW A;  1L1T A;  4XGI A;  4DR4 M;  4NSO B;  3KFU G;  4DV6 M;  4PT5 A;  1XC8 A;  4MB7 A;  1XMO M;  3VKH A;  3WHL A;  4L8R C;  5IWA M;  1OFI A;  4NOO B;  3A46 A;  1E94 E;  3GQ4 A;  4IBF A;  4JYA M;  2DWM A;  4RF0 A;  2F5Q A;  4GMQ A;  4YHH M;  4IBD A;  2I7N A;  1IN5 A;  3FTC A;  5FTM A;  4GH9 A;  1G4A E;  3PNY A;  3AV0 A;  3J81 S;  4LJ7 A;  3HHY A;  4P16 A;  3AOE A;  1SXJ B;  2RGO A;  1E9R A;  4L78 A;  4GC9 A;  5FSW A;  1NJF A;  1DO2 A;  3EIE A;  3SAU A;  1K3X A;  4QNR A;  1IN8 A;  1TDZ A;  1NSF A;  3RGP A;  2R45 A;  2Z4R A;  2DWL A;  2C5R A;  2R4J A;  1HR0 M;  2L7H A;  3MJ5 A;  4X66 M;  5KQD A;  4JI6 M;  4GIT A;  1NNU C;  3DZD A;  2KRK A;  4M9X A;  1R2Y A;  2LXE A;  3RFW A;  3UJN A;  4AG5 A;  3VFD A;  1IBM M;  2BJV A;  2L7I A;  2LWX A;  4GIP A;  2QPA A;  1S3S A;  4W5W A;  3UK6 A;  2DHR A;  3U6O A;  3W0L B;  4DR2 M;  4DR6 M;  4AQY M;  4DV2 M;  4YY3 M;  1WXQ A;  2F5O A;  3K92 A;  3HHX A;  2KA6 B;  1N78 A;  1E32 A;  2DWZ B;  4X64 M;  3D8L A;  5IRE B;  5ITX E;  2KEB A;  2CE7 A;  3U6C A;  2Y21 A;  1NY6 A;  3ZH9 B;  1HT2 E;  4REZ A;  1KFV A;  1N77 A;  1J7K A;  1R6B X;  2G5G X;  1KYI A;  2YFQ A;  2QEN A;  4DV3 M;  1FJG M;  2KZU A;  1HNW M;  1IN7 A;  3GP1 A;  4FCW A;  3THG A;  3VK8 A;  1MU5 A;  3PVS A;  4FWG A;  5EXS A;  1XWI A;  5KPZ A;  1IN4 A;  2XH9 A;  5KQ8 A;  3MHV C;  4LJ5 A;  4GHL A;  1J09 A;  3CTW B;  3MK6 A;  3IG5 A;  3KXE C;  3JAM S;  3GRV A;  4I81 A;  3B9P A;  3SAV A;  3GLH B;  3KDS E;  4S12 A;  4MGY E;  3FUV A;  3U5Z B;  3FUU A;  2DZO B;  5KPT A;  4I4L A;  3KVW A;  1IXZ A;  2DWN A;  4MGH A;  4OW0 A;  3L2A A;  2V1U A;  1N32 M;  3J7B A;  3TE6 A;  5EP2 A;  1YE9 A;  3SYL A;  3T38 A;  3FKE A;  1IBL M;  4IBE A;  1SXJ A;  5EP3 A;  2CHQ A;  4JI8 M;  4IJE A;  3L27 A;  1G3I A;  3J7A S;  3H4M A;  5KO3 A;  5E26 A;  4M0D A;  4M9Z A;  2Y20 A;  4G4Q A;  4G4N A;  2RGH A;  5IT9 S;  4B7G A;  3ZCB B;  4OX9 M;  4OU7 A;  1IY0 A;  3K1J A;  4HL4 A;  2KRU A;  1GVN A;  3HWS A;  4LZZ A;  7CAT A;  3QWL A;  4LRT A;  4MM3 B;  1QAO A;  2ZAN A;  3KP1 E;  1E9S A;  3I51 A;  4LJ9 A;  4QOS A;  3J27 B;  3D8B A;  4B08 A;  2C98 A;  2VQF M;  2ZM6 M;  3FUX A;  1OJL A;  3AOG A;  4DV5 M;  1DGG A;  2ZBK B;  3NWL A;  4B3M M;  3C58 A;  5ITU A;  4I5S A;  4DR1 M;  1IXR C;  4G4R A;  4CIS A;  3GLI A;  2KXE A;  3CF2 A;  3W0F A;  1L2B A;  3HU2 A;  1R7R A;  3FYC A;  8CAT A;  3L26 A;  1IQP A;  3SMS A;  4L16 A;  4TUW A;  1GL6 A;  4JI4 M;  3GLF B;  3U6S A;  2E5L M;  3SBJ A;  3T15 A;  2F5S A;  2CV0 A;  4I8O A;  2XF3 A;  2W82 A;  3PNV A;  2XGN A;  5EJC A;  1N34 M;  3J80 S;  3A42 A;  1NNJ A;  3TWK A;  5FTK A;  1GLN A;  3HKP A;  4IIW A;  1I94 M;  3M0E A;  5DYG A;  1IBK M;  4AKI A;  2A5Y B;  3SC3 A;  2ERC A;  2O5R A;  3JR5 A;  1C1K A;  2Y0Q A;  3GRR A;  3KW6 A;  3FTD A;  1TH4 A;  4OVZ B;  3GPU A;  3KS4 A;  4FD2 A;  4IJF A;  4NRV A;  2BNK A;  3AFH A;  3SMP A;  1UM8 A;  3NBI A;  4MGK E;  2G8L A;  4DUY M;  2L6O A;  4LJ6 A;  2HCB A;  1ZQ9 A;  1DGH B;  3E4R A;  3HHZ A;  4QNM A;  3M6A A;  3U6L A;  1Z6T A;  3DA1 A;  1X37 A;  2XSZ D;  4NXM M;  3QAU A;  4KLN A;  3TWM A;  4JI3 M;  4OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...