1IM2A

Hslu, haemophilus influenzae, selenomethionine variant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
443
structure length
346
Chain Sequence
b'SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
molecule tags Chaperone
source organism Haemophilus influenzae
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
total genus 99
structure length 346
sequence length 443
ec nomenclature
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1im2A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1im2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1im2A01
2D4HA 4PPGA 2WKQA 5AJYA 3ZIAA 2DB3A 2VLIA 1UDXA 3QKRB 5K8UA 2HLDA 2AR7A 1U0HC 4D4LA 1HQCA 1DE0A 2O8DB 3PV0A 3O8RA 4QG7A 4TWZA 4IOJA 5C2JB 1E1QD 3RRMA 1KSJA 2R6CA 4M9SA 3VR3A 1PUIA 5AR1A 4LPSA 1ANKA 4O25A 4PSKA 1ZU4A 1HA3A 1N25A 4M4SA 1GDDA 1WE2A 3BGWA 3F0TA 4F4CA 2C04A 3CM0A 1YQTA 2V1UA 4BLSA 2K5UA 3WBJA 5KSPA 4B47A 2DPXA 1WXQA 2GRJA 2YC2C 2VSFA 4HLDA 4CT4B 3GJ8A 2IS4A 2IYRA 1AQUA 1VCIA 4WZ6A 1BMFD 4HATA 1VEKA 4MDEA 3DOFA 4I1VA 3JZAA 5HCNA 4Z8YA 1VIAA 3T1QA 1RKBA 4LCBA 3X1ZA 4LUCA 4OK5A 4I1SA 1WB9A 1G1MA 2WVJA 5F9HA 1G7SA 3DEFA 4HAWA 2ZAOA 3FRIA 4MDFA 2KJQA 2QRZA 3K0EA 4OI0A 3VU9B 2PMDA 3K0AA 1E3MA 2YV5A 1RRGA 1NBME 4NU0A 4DLTA 3FHTA 2CLCX 2IYZA 3RWMB 3M4YA 1SXJA 3T5DA 3SQXA 1G21E 4PSVA 3QXJA 3AKCA 5FUWA 2ORWA 5KPDA 3KX2A 4HB4A 3Q7QA 1LV7A 4M9QA 2RRUA 2OLJA 3RAPR 2G83A 1E0AA 3B1YA 3LA6A 1U81A 4JLKA 1KGDA 3I3SR 4M8NE 5KOYA 1CEEA 2UZ3A 1W0JA 4MYCA 2VHCA 4PR0A 1T9HA 3CPEA 4Z1MA 5H1YA 4LHWA 1CXZA 4F2LA 4KFSA 1AIPC 2QM7A 3OAAA 2NO6A 2NZ8A 1UKYA 4MRPA 4N0EA 4Q03A 3SU8A 1VG0B 3E1SA 2WKRA 3UG6A 5LD2C 4B71A 1X1RA 2ERYA 4RD2A 1XD2B 1HURA 3BB1A 2Q9CA 2GEVA 3RDPA 2HF8A 1U8YA 5HPYB 1E2DA 4Q9IA 2V9PA 3FKQA 4CIDA 2OFWA 3UKDA 2ODEA 4HLQB 2FFBA 4F1IA 3WYAA 5SZJA 1TEXA 3X2SA 2PBRA 3FB4A 1XF9A 4DEXA 4B3XA 3ZLJA 4EUNA 1M74A 2VRWA 1Y8GA 4DLYA 1NLFA 1BOFA 3AGQA 1QVRA 2J3EA 3KXKA 4PHFA 5FOXA 2FDCA 1Z6YA 4HEJA 1PLJA 1M7HA 1T3LA 2ZE6A 2DAMA 3B78A 4MRSA 2ZR9A 2JAQA 3WNDA 3OEED 1OB2A 2ZJ5A 3KFXA 1U9IC 2QN6A 2YZ2A 5AJZA 5FH9A 2CL7X 2ZYUX 5SZKB 2NPFA 2JUJA 3QOFA 4V0NA 3TAHA 3THYA 4NONA 1Q0UA 4B6EA 4KAXA 4G5GA 2JA1A 4TTRA 2XB2A 3CRW1 2KRKA 2OILA 2WMNB 2ZUCA 1E2LA 4NCHA 3RS3A 2KNAA 4LWZA 2IYXA 1C1KA 1KAOA 3FE3A 1ZD8A 3TJZA 2XAUA 2VYFA 4JLAA 1LB1B 2A30A 2YWEA 2VBCA 3OEEA 1LF0A 1BYIA 3FHOA 3K0CC 4JLDA 1Q3TA 4P4SA 1TR8A 1P3QQ 4ZKDA 3EZ7A 2RAPA 3B6EA 1W0JD 3ICQB 3Q9LA 1YR7A 2OCYC 1NN3A 4XWAA 2YC4C 2LWIA 3BH0A 2BOVA 4DWJA 2ZYWX 3I32A 1ZIPA 1E9DA 4L9WA 2O0JA 2IYLD 3BRWD 5JJIA 5HE9A 1ZYUA 2ZR7A 3ONWA 1QG2A 3TLXA 1N5LA 4NDZA 3PEUA 2LTUA 2VP9A 3LFUA 2EU8A 5M04A 2WWIA 4TT3A 1KJWA 4KI0A 2ZRJA 1P62B 4TL8A 3QE0A 4KV9A 1A7JA 1YR8A 4Q9KA 5TY0A 2P6RA 4KHZA 4UXHA 2EW1A 3RS0A 1Z6GA 2VHJA 2WWWA 4PPQA 3AVQA 2KNVA 3BFXA 2XXAA 4C7OB 1VEJA 4A2WA 2MSCB 3GFPA 4DLRA 2FZ4A 5EP2A 4URXR 2OAP1 1OH7A 3FYHA 1A2BA 4KYIB 3ADCA 3SFVA 4BEBA 1II9A 4KODA 3SOPA 3HU3A 1E2KA 3FTQA 2W83A 3SJBA 5DI3A 2RHDA 3W8RA 4D26A 2HUPA 3FWYA 1G9XA 1P2TA 4ZIRA 1UEIA 2A5FA 4D4KA 3SFZA 5JCZA 2ZM5A 3ZD7A 5DI3B 1E9RA 1TQ2A 1UKEA 2WSMA 2XZPA 3LY5A 3NWJA 4JVNA 3E5HA 3HU1A 2YNMA 4DDWA 2Q3FA 2WJGA 4Q00A 4KSBA 5G3YA 4G1UC 1NKTA 1RYFA 1E2GA 1KJYA 4UNNA 2XOKD 3GJXC 1F2TB 4EPXA 1BO6A 3Q8XB 1G64A 4UNSA 1YE8A 2A5YB 3VX3A 4FWTA 5DFLA 1US8B 4L8GA 1PVOA 2QBYB 1IXZA 4R98A 2EQBA 1J2JA 5KDLA 2V54A 1Q20A 521PA 2J0UB 5EE0A 2ZJOA 3SR0A 1XU4A 3IPYA 2RCNA 1DEKA 1UBEA 2WZQA 4LJ9A 1TQ6A 1N6HA 2J0UA 1E0JA 1JJ7A 1XXHE 2FNAA 4LC0A 2C98A 2GZAA 3OESA 4DDTA 4MGKR 4B74A 4AKGA 1J70A 1JEEA 3ASYA 3HP1A 4WIAA 4GEWA 1MABB 4PO1A 4N1AA 5E4FA 2QAGA 2DFNA 2CE2X 3AH8A 3L0PA 4DCNA 1GKUB 1O3YA 1RE0A 1X6VA 1HYQA 2J41A 4JS0A 4B32A 2ATVA 2XITA 3L82B 3NVAA 4Q47A 1EX6A 3H4JA 1ZP6A 2VF8A 4QJ5A 2XB4A 3AVXA 3VHLB 1H65A 4MA4A 2F55A 1BYUA 1E9AA 4TMXA 1NG1A 1ZRHA 1NMXA 3DO6A 5FBWB 4QBIA 1AK2A 2BV3A 4YQFA 1Z3IX 5E3HA 1UAAA 1X8JA 2G1KA 3SNHA 4OHZA 1HV8A 1KZ7B 5FBLB 2L2DA 3CPHA 1JNYA 2Q21A 3DM9B 4YMTA 4HEOA 4ZKEA 4WXPA 2IXGA 2PX3A 4CEIB 4JVSB 5CM8B 4B3CA 4AK9A 3U7EB 3KJIA 4UXJA 3PVSA 3KTAA 3FMFA 3BXZA 1MN3A 4EPRA 2OXCA 1IXSA 5F9FA 3QUSA 3FE2A 2A78A 1IOZA 2I3BA 1E2FA 1TQ4A 1OH5A 4B3GA 4QXAA 3C7KA 2J0VA 1PLKA 2GJAA 1EFUA 4PQYA 1ZC4A 3RWOA 3CR8A 2OBNA 1H8HD 4TYPA 4DCSA 2FJUA 4CW7A 4Q1CA 4M21A 1R7RA 3DM5A 3B2EA 4Q7LA 3OAAD 4O3MA 4PHHA 1K6MA 2BMDA 3OIWA 5D3QA 4TMWA 1NBMD 3BB3A 1OXVA 5BW8A 1AIPA 3DPUA 4TLCA 3QKSA 1J99A 2R2AA 3QKUA 4RFSA 1CIPA 1HY3A 3CF2A 3C4JA 3WYFA 2CBZA 4YONB 3VKHA 3A36A 2CDNA 4IHQA 4AKHA 1E9CA 1GAJA 1IHUA 4QJ3A 2H7VA 1NMYA 2W58A 1FNMA 2K9DA 4KLZA 3TR0A 3EZFA 4D0NA 2J7KA 3F3YA 3X1DA 4LI0A 4LOAA 4JLOA 4E09A 2I1QA 4UN2B 4D80A 1T3HA 4TQAA 3TIFA 3D6TB 4NYMQ 1DPFA 4MH0R 1KI6A 3K9LA 3X1XA 4KBGA 3AF3A 2C5LA 3BBZA 2JLXA 1Z0FA 3MLEA 4NZYA 2JLSA 2F9MA 1DAIA 1OFTA 3A6PC 2FV8A 2OG2A 1EXMA 3MJHA 4X8LA 3ZZ0A 3K9HA 3AVPA 2LVOC 2DNAA 1NVWQ 1NVMA 4JSTA 3C14C 3LNCA 1C4OA 3ADBA 1E96A 1Q1QA 2QGZA 4LX0A 3TR5A 3I5XA 2IS6A 2ZRFA 5AWFC 3QG1A 4DEYA 3KB2A 1GVNB 1IJFA 4D2IA 5JECA 4D82A 2R9VA 1MKYA 4Q9LA 5CK5A 3B1VA 4TMZA 2MJ5B 3BORA 2O8FA 4OQMA 3WY9A 1NVVQ 3QIAA 1CP2A 3AVTA 1PJRA 1UM8A 2PEZA 2QTVB 3QVVA 3PUYA 3EAQA 1IM2A 4E07A 5HR5A 2V6JA 3T1OA 5J4KA 4Y0AA 2JP7A 3F8TA 1TTEA 1VG5A 1D2EA 3RNLA 2HYIC 2ZVQX 4OQXA 4UNQA 2YOFA 2WBLC 1E9EA 2IW3A 2GETA 1XCGB 1P2VA 1I2MA 4YMSA 4KFUA 2OM2A 2HT6A 3HDTA 4OI4A 4P0TA 1FOEB 3VR6A 4PC3A 2IS1A 2IEYA 2VHUA 2QM8A 2KHHA 1L8QA 4IEIA 4PHTA 2DENA 1U0LA 3C5CA 4BASA 2DFKB 3KUCA 5DYGA 1S3SA 5JS8A 2CHQA 2OBLA 2ZJ8A 1EESA 2G6BA 3REGA 2KWIA 2CHVA 3LQQA 4S35A 5B57C 4Q4JB 4PZYA 3QF4B 4RFVA 4U02A 2XSZA 1E79A 3NH6A 3Q85A 5HZKA 3OE7D 5G40A 3PUWA 3F5FA 3T1TA 1TF2A 2RMKA 5FPKA 2CLDX 2YOHA 4OK3A 1IJEA 4M1SA 3JZMA 2DWPA 2JZ0A 1G3IA 1UBCA 1LW7A 1VG8A 2GESA 1G7TA 2REBA 2DZNB 3SDZA 2OEPA 3KZ1E 3W5JA 5CDFA 3QPVA 1JAIA 3OIYA 4JBWA 5FOWA 2KI5A 1W47A 4Q4AA 1XRJA 1MO6A 3UG7A 1SKYE 1W44A 2ZRBA 2ZS7A 3I1FA 3G82C 5DISB 1TADA 3OEHA 5KSOA 3B60A 5DLQC 3CX7A 1ZC3A 3KXIA 5FL3A 2RGNA 4HUQA 4US0R 1G6HA 1P3JA 1GM5A 4NPHA 1EFRA 2W0SA 4LK2A 2QTHA 2ZRDA 4RCYA 3MGCA 4XD7A 4ARZB 1SVOA 5L3SA 1JXMA 2DY1A 2ZRKA 4Q1EA 3MUFA 4BFZA 5G41A 2O8EA 2OLKA 121PA 5C18A 1D6JA 3IHPA 2QQEA 4QGFA 5GVSA 1KJZA 3RS7A 4JL6A 3CRRA 4WAUA 1VEGA 3CW2A 1ZM2A 2OCBA 2QRNA 2GJ8A 2WTUA 2ZRIA 4JYCA 3GLIB 1KI4A 3B7GA 4II7A 1MOZA 1OXXK 2GEDA 3N2EA 1SKQA 2HEIA 2ERXA 2R6AA 721PA 2I4IA 1N6IA 3KKQA 3PUZA 5HTKA 1GRRA 2NO9A 2E9SA 2A2ZA 1EGAA 3EIQA 3LO5A 2OOAA 1Z2AA 2PLRA 3CRVA 2HJGA 4PX9A 3E46A 4PO8A 4U00A 4BZPA 1SVIA 1T3SA 2WWHA 3ZJYA 2QORA 1COWA 4V02A 2AFHE 1UF9A 3CLVA 1UJ2A 4DCTA 4B35A 1GL9B 2ZR0A 1M34E 4URWR 4LZZA 1N6LA 1NN5A 1E4YA 1G17A 3THYB 1UFZA 4PAOA 3AP2A 4E5UA 3BE4A 5LB4A 3GLFE 4NYMR 2DFLA 2R65A 1E0SA 5KPJA 2D2FA 2Q9AA 3U3MA 4XOIA 4B75A 4HAZA 4NMMA 1XTRA 2B92A 1OV4A 1DTSA 1ZD9A 5FOUA 1Q21A 5FUYA 1F4IA 4WP2A 3W5IA 3U7FB 1I4TD 1Z0JA 1G291 2LVQD 2ZE7A 4HUTA 5K8TA 1OH6A 1P9WA 3B13B 2AWNA 4DLSA 2ZI3A 2P6NA 2DR3A 1SKYB 2EYUA 3DKPA 1ZM7A 2JJ2A 2Q0HA 3BK7A 3QVUA 5TDHA 2HT1A 1IN5A 3W8NA 5JSZB 4DSTA 1N3BA 3K70D 1YZNA 2D3WA 2QP4A 3AEZA 5AJXA 1HEIA 1XEXA 4W5HA 2DAIA 4NL4H 3ND9A 5FI1B 1G4UR 4NYJR 5ELXA 1LFDB 1XEXB 2J0QA 1P6XA 2F1RA 2FPLA 4EAQA 4IFBA 4V0OA 5JWRA 5KSZA 2BCJQ 4MGYR 2ZEJA 1W46A 3A1SA 4ZI3A 4F92B 2C77A 2GJSA 1N0VC 2C2HA 2QMHA 2W6ID 4MITA 4TQ9A 2BBOA 5FBQB 2QPTA 2J87A 3GJ3A 5C46F 1CJTC 1JQLB 4HSEA 3ADKA 1H8ED 1OKSA 1GITA 2MMGA 3IILA 4OL0A 2BCGY 1IY2A 1CJUC 1OSNA 3CZQA 4IXNA 3MWKA 1G16A 4TMKA 3D3QA 4MKFA 2RGDA 5GJCA 2RGXA 2QMEA 1ZUIA 5TXGA 4ZIRB 5AUPB 1UKZA 1SQ5A 4C0QC 3FFBA 3VKWA 5JS7A 1OLOA 1UBGA 1E2PA 1X8KA 5G3ZA 4S2EA 1Z63A 2JNHA 3EA5A 2WM9B 3BWDD 1AS0A 4OHYA 3BFVA 4DLUA 4AKEA 3E2IA 2PZEA 3B9QA 4PTLA 2A3RA 2ZRMA 4TT3D 4EFMA 3U7HB 3NH9A 3QPWA 5AUOB 3T1VA 1IN4A 2IYQA 1GRNA 3TAUA 4FD2A 1IXRC 2HYDA 1TPZA 1YKSA 1EFRD 3W9YA 2GCOB 2GZDA 421PA 2KBEA 1W4RA 1TF7A 3W6NA 1J8MF 2H5EA 1R4AA 2GCOA 5CM9C 1E79D 1JBKA 4XVRA 2FMXA 2C96A 1ZNZA 3GEEA 4IKEA 1DBSA 2QSZA 2ZS9A 5BN3A 4PQFA 1IY1A 2C78A 4NP6A 4AG5A 1HE8B 3T06B 1KK3A 4D6PA 3LWNA 4BLQA 5JEEA 1R5BA 2JATA 4J0QA 4BLTA 2CCJA 2FEMA 3O8CA 2FN4A 3V4FA 3K9OA 2JY7A 3MCAA 5L3VA 3SS8A 3U3OA 2DHYA 1BIFA 3VLFB 3ZVMA 2ZJZA 3FVQA 4NBSA 3ZIAD 1DOAA 4F7WA 5TB5A 3CWZA 3J81k 2C95A 2JLQA 3FHCB 3GPLA 1Z22A 1KNQA 3GEHA 3AUXA 4MYTA 4AYWA 4CRWB 1G41A 3AP1A 1KO8A 2DAEA 4P4UA 4BZXA 2QTFA 2KSQA 1G8PA 4XJXA 1E98A 2PEYA 3IDQA 3SJCA 3SI7A 1TMKA 3TVTA 2V8OA 3NKVA 3W3AA 2Z43A 4QBFA 1S1MA 1Z06A 1DVRA 3QG5A 2JLUA 4JSYA 3Q5EA 3RANA 5DYIA 4LJ4A 3W6OA 5EE5B 3GLGB 1E0KA 1N6KA 3A1TA 4PPFA 5D3MB 3IHLA 1X37A 3GLGA 3THWB 1II0A 2H5XA 3SEAA 3KFVA 1L7VC 3QEJA 1NSFA 1NN1A 2MSEB 3QENA 2AXNA 1T8UA 1IQPA 3UATA 3CF0A 4BLRA 2FFQA 4NYJQ 5DO9A 3FRHA 1XD8A 3WNCA 2B3TA 1PLLA 4A0GA 3P4XA 4Q48A 1MO5A 3V00A 2PLFA 4V0ME 3AGPA 2DZLA 2AWOA 4OQFA 5JJKA 1RPZA 4MGIR 1G6OA 2PT5A 2DI0A 5FFMA 3Q5DA 1QZMA 4IEEA 1CR2A 4ZO4A 2Q3HA 2VF7A 4LBYA 1FQKA 1D2NA 3K9PA 4M53A 1XPOA 1Y3AA 2DYKA 5AUQA 1G7CA 1GNQA 2Z5FA 5K8LA 1SVMA 4B76A 1CR0A 1T6OA 3WP0A 5TARA 2VH5R 1IBRA 5JHGB 3MMPA 2IWRA 1XEFA 3OIVA 821PA 4DCUA 1YRBA 2R0IA 4PAMA 2QL6A 3OF5A 1E9BA 5JCPA 1MH1A 2ODWA 3EZ6A 4QKQA 4C0BA 2FFHA 1COWD 1DARA 1Z0AA 1XCPA 2QY9A 3H0KA 4GI7A 2LCFA 3VHXA 4MRNA 4BFYA 3DMDA 5CB8A 3PR1A 1ZMUA 4PHGA 1VHLA 1OXSC 2Z83A 3BAFA 1JQJC 4A3VB 3VAAA 3EPJA 2ZAMA 1W4AA 3K70C 2WICA 4Q1AA 2J5XA 2CHGA 2YKGA 2OZEA 2ZSBA 3KKMA 2CL6X 3KJEA 4A2QA 1OFIA 4TSFD 1U2RA 1MRNA 2OCAA 4AIIA 2OAQ1 3N2IA 1UBFA 5EE9A 3IIMA 4Q5IA 4P3YA 5CLLA 5EP3A 4DUGA 2HV8A 2IYYA 4M1OA 4B2PA 2J1LA 3G0HA 5EXXA 3NBFA 2ONKA 5FI0B 1SZPA 3K9NA 3SBEA 1TNDA 4GPTA 4Q7JA 2GTPA 1GRQA 5JI2E 3MFYA 5L3RA 1N5JA 4Q7JB 4DBLC 2IK8A 4JT2A 3OE7A 4D0GA 1E2EA 1XZQA 1OYYA 4BRUA 2ZE5A 2IHBA 2OV2A 1F48A 3IBGA 3QPUA 1EFCA 2JIZD 3U44B 1L2TA 4HLUA 4TYNA 1OKKA 1IN7A 4KXFB 4IDPA 1AZSC 1G5RA 2X2FA 2YWHA 2EFHB 1KDPA 1X1SA 1AS2A 3ZDQA 3LCUA 1FUKA 1OTRA 2BMJA 2PZGA 4Q4JA 5J4HA 1NJFA 2NGRA 2BMFA 2DWOA 3FGNA 3MHVC 1SULA 5KDDA 1XWIA 5LDDC 4RZ3A 3P32A 1VPLA 3NBXX 1W49A 1MRSA 2ZI7A 4RD4A 8OHMA 1OHHD 1PGYA 4RD6A 4EJSC 5LBIA 1A4RA 2V1XA 4DSOA 2G88A 5A0FA 4CEJB 4R7ZA 3X1WA 2WJYA 1GILA 4FWGA 3IGFA 1N0UA 4M1WA 3KW6A 3VR5A 1A2KC 2MR9A 4GP7A 1LY1A 3GLFA 3THOA 3ND8A 3MAAC 1FP6A 1ZM4A 3IUYA 2GCNA 1DELA 2BM1A 4UJ5A 2GAOA 2L4FA 3K0CA 4FIDA 4Q4AB 5J40A 2FG5A 4OHWA 3CX6A 3W3ZB 4C4PA 2QROA 5CYOA 2NG1A 2ZPTX 3KKNA 4BE7B 4A6PA 1XEWX 3U6KA 5EZ5A 3CPJB 3WRYC 3I8SA 2GBLC 4DVGA 1ETUA 1LS6A 1Z07A 1R0ZA 5L3SB 4JT4A 2J0SA 1XJ0A 2YJTD 3T61A 4CVNA 4EKDA 3RHFA 4FI3C 1VYVA 2CEAA 2AD1A 1HUQA 2A5DA 2RGCA 3MWJA 2GK7A 1G3UA 2V4ZA 1Z0DA 1IN8A 1W7AA 3AVUA 3F92A 1T5LA 1E2NA 4IOKA 1QZEA 2G0NA 4U7DA 2CVHA 2F9LA 3Q3JB 1NVXQ 3M0EA 1M8PA 4GOJA 1MO4A 3BB4A 4URUR 2W6IA 2D2EA 2GJKA 3L8ZA 5FOSA 4ABYA 4G5QA 2GZHA 5FBRB 1YZUA 1OFHA 2ODBA 4Q9HA 4GL2A 4RKEA 3CH5A 2IUUA 5LPNA 3SYLA 5BQ5A 3LBNA 1G5PA 3B1XA 5KU1A 2HXYA 1XX6A 4PANA 4DKXA 2IWHA 4NTZA 4XTCS 3AKEA 3H84A 3TUIC 1G8YA 3CUEF 1KHTA 2ZE8A 3GFOA 1F3OA 1CJMA 4EPVA 5CJPA 1F2UA 3KB1A 3PJRA 1IFYA 1KSGA 3X1YA 3CH4B 2XZLA 2Y8EA 3U4QB 2HXSA 4D4MA 5SZIA 3ZQJA 4RKFA 1GKYA 4ACBA 1OF1A 4XWKA 4MYUA 1HT1E 2CMKA 2QEQA 3LVRE 1ZUHA 3W90A 1XPRA 3UIEA 4N0DA 2MROB 2RHMA 3MWLA 4TSFA 4WXRA 1GUAA 5CIQA 3ZS8A 5KNCA 1F6BA 1GNPA 3LDAA 1CKEA 3FMIA 4DSNA 1G3RA 1ZNYA 1N5IA 1XD9A 2JJ1D 2NO7A 3GMTA 4WBSA 1E9SA 4FW9A 1XEWY 3MWYW 2O8CB 1LTQA 2L4EA 2IT1A 4Q66C 4DB2A 2AN9A 2QSYA 4QGAA 1VDLA 4NCIA 3V9PA 2D62A 5G53C 1NI3A 1WP9A 4D0LB 1WJ7A 1W36D 1W4BA 3DDCA 4HB0A 2H16A 2PJRA 4M9ZA 1VYUA 3ZS9A 1CR4A 4V0KA 2R6DA 5J5CA 1P9NA 4QNRA 1XZPA 3IPXA 1U98A 3OFND 2VHTA 4FMCB 2EYQA 3TE6A 1OXUA 1UKVY 3TSOA 2P2LA 4EPWA 4AKIA 4W7SA 2ONJA 4GFDA 1KIMA 1KK2A 1FPMA 1JI0A 1VG9B 1Z47A 4LRSA 5GJVC 2VO1A 1WIVA 1ZU5A 4Q21A 1XNJA 3DL0A 2PMKA 3TBKA 1G8FA 2MMCA 4LYAA 2VPPA 4P31A 2ZSAA 3U3JA 3BBPA 4E22A 2QSFX 2UVQA 1EX7A 1Q1EA 2XJ9A 1G8HA 2ECKA 4FCTA 1KI6B 1O87A 3S1AA 2GBLA 2ZITA 4URYR 4QHTA 1NSTA 4KYUA 2OO7A 5FTKA 2IXFA 3R20A 2BEJA 2VSXA 3RC8A 2VTKA 4LBVA 3R8CA 4AD8A 1V5WA 2ZYTX 4DRZA 3RS2A 4P33A 2E1RA 2ZSDA 2W2XA 4EFNA 3RS4A 4OQNA 2XNDA 3NEYA 5JFGA 3SQWA 3THXB 3AVWA 1Q1ZA 5P21A 3GLGE 1D9XA 3LAWA 2LBCA 1YZQA 4R9UC 3C15C 2XJ4A 5EXSA 4C0AC 4QL3A 4QGGA 1KMQA 4X8OA 1CU1A 2L0XA 2O8DA 2TMKA 2WWXA 2FSGA 4QBGB 2IF2A 3A1UA 2NO1A 1RFLA 1OHHA 1CRQA 4M1MA 4XVQA 5BYKA 1BS1A 4LPKA 1T6NA 2F43A 4G0NA 3TNFA 1ZD1A 3NC1C 3AKDA 1QBKC 3PUVA 4GNKA 2GEUA 3GP8A 3VFDA 4MKIA 2DVWB 2IF0A 1FMLA 2AX4A 1G7RA 2FPMA 1NLYA 2OHFA 3P4YA 4M1TA 2QENA 4ACAA 1XTJA 1DAFA 1M7BA 3FDIA 2O8BA 2C9YA 2WJJA 2DAKA 1AGPA 3AF1A 2CL0X 4TLDA 4YC7A 4DZZA 4A92A 1AKYA 3NHBA 2ZANA 1FUUA 4POAA 2ZI6A 1DO0A 2Z6VA 5KHOC 3EX7C 1JJVA 3NXSA 3UWOA 4EPYA 2AKYA 4IJMA 4M1KA 2IXEA 4O0MA 4LRTA 3NG1A 1VCMA 3K8YA 5AUNB 3QF4A 1T8TA 2X1VA 1QZXA 2ZYVX 4YXWA 1UFQA 5FPYA 2DFTA 1QG4A 1OIVA 4EIWA 4JIMA 4G5RA 2F7SA 5J4YA 3EZ2A 1GTVA 2R8RA 3BS4A 1KYIA 3VU9A 3JVVA 3K0AB 2PZFA 1YLAA 1Q44A 4IRUB 5KSYA 2J7PD 2EWVA 1QHGA 4TN1A 3GJ6A 1KO1A 2QAJA 3B89A 4JBXA 4BECA 3TW8B 1LNZA 1KO5A 1XMIA 4A9AA 1MT0A 3A4MA 1PV4A 1S9HA 2DWQA 4BLOA 3THWA 1SXJB 2QA5A 4ESHA 5L3QB 5FTMA 1XTIA 3WYGA 5H68A 2CXXA 4HUQB 1KO4A 1Q57A 1T0HB 3FOZA 2RGEA 3A1VA 4X8HA 5GADl 4AG6A 3SYKA 4L9SA 221PA 4NHOA 1GL6A 4DLVA 1Q3HA 4YMWA 3HYTA 4QC2A 3SHFA 1JECA 3I73A 2O52A 2IS2A 4DT1A 1NVVR 1OW3B 2JLYA 2CNWA 5DE3A 2HDNB 4P32A 2D7CA 2WMOB 5JMTA 1CBUA 2CK3A 4Q4LA 3TUZC 4HAUA 1TX4B 3G5UA 2QP3A 3CONA 5BWMA 6Q21A 1NF3A 3EC2A 3GLIA 2AKAB 3KQUA 5EXPA 1VG1A 2VIIA 4KO8A 4JJKA 2Q9BA 2WAYA 1N6OA 4Q02A 5AK0A 4ASUD 3PUXA 1KDRA 3AJIB 4DHEA 2X8AA 2BWBA 4JBYA 1HH4A 1WMSA 4LDJA 1KI8A 2FU5C 4GT1A 2ZJAA 5DN6A 3C16C 2ZSFA 2RKOA 3VNUA 3I72A 4OJQA 4ZCIA 1WGNA 1G5TA 1VCOA 2ZI9A 2AHOA 1R2QA 1NIJA 3WHLA 3FPAA 2IHYA 2EWWA 2WPDD 3LXXA 4XSHA 4XD7D 5JRJA 4ILEA 5TMPA 2F6RA 4JLNA 3K0FB 3LQRA 4K46A 3UMSA 2BWJA 5JHHB 4Y0VA 3R9XA 3WP1B 2HCJB 2VL7A 4IDOA 4BUJA 3K0FA 3CZPA 2BBSA 3L2OB 4I4LA 3AQ4A 4BFSA 3Q72A 1YJ5A 1G4AE 1M7GA 1UPTA 4P4SB 4JN6A 3RVBA 3QQ5A 4LJ8A 1FTNA 1KKMA 4HZUA 5UKDA 2VP2A 2CWBA 4TTQA 4CGZA 4G3OA 4GBMA 2AXPA 1U8AA 4ON9A 1WBDA 3ASZA 4HZUB 3EXAA 4LJAA 2VP4A 4QM6A 4E03A 4LSGA 4KCGA 2XNSA 3NC0C 4RVCA 4IVPA 2NZJA 2ODNA 3H2YA 4Q9JA 5JSZA 1I2DA 3DHWC 4MKHA 4TLBA 5C4GB 4JLJA 1DADA 3CO5A 2GCPA 4XH9B 4FMCF 4GSYA 5B2ZA 4GZMA 2SHKA 3KJHA 2BC9A 2Q3MA 4QJ4A 1DAMA 2XOKA 4D81A 1OIXA 3HR8A 4WZAE 3GCGA 1KI1A 1S0UA 3LW8A 4YLGA 1N6RA 4M22A 4BGDA 5K8IA 5FR1A 1MR3F 4LHYA 3BH6A 3AF2A 1RW4A 2BBTA 3GJ5A 1ZAKA 4FN5A 4M1YA 1WBBA 1Z8FA 1PUJA 1KI3A 1XCMA 3EW9A 4FINA 3BD9A 2AK3A 4HI0E 3TMKA 2JLVA 3TRFA 4C7OA 1ZMXA 3PFIA 4TQUS 2GXUA 3UXMA 1ONBA 4DXAA 1TL7C 1W36C 3AVYA 3EASA 2CP8A 1EWQA 1EFTA 3RSLA 2O0HA 1CR1A 2V6ZM 4NCJA 4JMPA 4RD3A 2EVWX 2J46A 4IDNA 1IONA 3KQLA 3UANA 2WV9A 3L0IB 4XSGA 4EPTA 4KITB 1D2MA 2XTNA 2ZJBA 2GK6A 1LS1A 5JZVA 1T5IA 1MV5A 2V55B 2GDJA 1US8A 4Q1BA 1E1QA 5HE8A 2ZTDA 3U5ZB 1Z83A 1R10A 4ZPXA 2G9NA 3B8HA 2B7BA 1XDBA 2W6JA 1S9DA 4YXWD 3I8XA 3ICEA 1ELOA 3E70C 1YZGA 2JDIA 1AS3A 1YHNA 3BH7A 3W34A 5GJBA 2QZ4A 2WOJA 3LX5A 5IDVA 3P1JA 4DDVA 2O0KA 1Z0IA 4NKRA 2Z4SA 3A4LA 2BKUA 3RSOA 3H86A 4HAXA 3IEVA 1MABA 1GOTA 3R9IA 2XNDD 5E7JA 1SVWA 2C8VA 4OI1A 4NCKA 3KQKA 1AQYA 4PC1A 3IIKA 3SC3A 4RD0A 2V7QA 1GG2A 5J4VA 2ZIAA 4K8OA 4HDOB 5EUQB 1AM4D 1P2UA 1F5NA 3VNVA 4I81A 1YVDA 1NY6A 5CJ2A 4JZKA 1SXJE 4FWHA 2W2TA 4ESVA 1S96A 3MJRA 1KI7A 2B7CA 1JEDA 5KTYA 5FTLA 1R0WA 1W2HA 4LYFA 3OFNA 4DLWA 3RYTC 3WRXC 1CULC 2IYVA 3KQHA 3GQBA 2H1LA 4FCWA 3LVQE 1G3QA 1KZGB 2JLZA 3L0OA 4GMXA 1OE0A 3U4QA 2JY5A 1GP2A 4LC1A 3RC3A 3SZRA 3ZGXA 3E21A 1NBMA 2QMOA 1QRAA 2JZ1A 4A8JA 2MSDB 3B1WA 1OKKD 4A0HA 4L5BA 5EZ6B 2GAAA 3CNLA 3KTAB 4A8JB 4O2LA 1OQYA 1J7KA 3SBDA 5HCIA 5EP4A 4L4UA 1DG1G 1NN0A 3JVUA 4W5WA 5JLJA 4A4DA 2C9OA 2ZJ2A 2R6GA 4OBEA 4P4TA 3LLUA 4JVLA 4A8JC 1S8FA 4C0HA 3Q7PA 1ZW6A 1ODFA 3U3RA 1PZNA 4ZCMA 1GO5A 1E4VA 3RS5A 3T12A 5HZHA 2ANBA 2RGBA 4CDGA 3HJNA 2X77A 1BVSA 1RZ3A 2HWJA 1KKLA 1KNXA 1YR6A 4LV5B 3W6PA 2IUTA 1SG9A 2EKFA 4OHXA 3IO3A 2WKPA 5FOTA 1FX0B 3REFA 4ZI2A 5F2EA 3QKSB 2GXQA 1AZTA 1KDTA 5DN6D 1R0YA 4RFSB 5CB6A 5H70A 1XP8A 4JL5A 1QHYA 1CF4A 1R6BX 2WJVA 2KBFA 1JR3A 1XJQA 4LV8B 4W9MC 2FH5B 1HE1C 4RD1A 4DJTA 1Q1BA 5CLQA 621PA 4QFMA 1NL3A 3PITA 1P60A 4MQBA 3CRMA 3PIRA 1T91A 3T34A 1ESNA 3U61B 5DGXA 2JJ8A 4A2PA 2R62A 2NTYC 3O8DA 1X3SA 3I4LA 4LJYA 4OKSA 3WBKA 2QHOB 4IVRA 2IBMA 1T43A 1E6CA 5A5GA 1NIPA 1E2MA 5FPHA 2GVZC 3RABA 1II8B 2VHQA 1RYHA 2QE7D 4QRHA 2K0BX 1AGRA 2VP5A 4GMDA 4KFRA 4UXIA 4BFXA 1ZCAA 4Q7MB 4IDQA 5IHPA 5EJEA 4W5JA 3BOSA 2RGGA 4HB2A 2AFIE 2V7QD 3EARA 1A82A 2H57A 1FP7A 3DOEA 2A9KA 4QHSA 1F60A 2IEZA 5J47A 3VX4A 3OZXA 4GZLA 2O8FB 5LD2B 1W1WA 2P0EA 1UEJA 1QHHB 2B8TA 2VSOA 2DZOB 2PL3A 1WHCA 2WWYA 4TMTA 1RC8A 2FE4A 3EZ9A 4RZ2A 4QGHA 4M2LA 2PT7A 1U0JA 1JR3E 2F43B 3UK6A 2G1JA 2IX3A 3U3KA 2F3TA 3QXSA 2BIFA 3ZVLA 4G3XA 4BEJA 2VA8A 5B58C 1Z08A 1S3GA 2FSHA 3BIFA 4PZZA 2HJVA 2GVDC 4JLMA 1KMHA 1T4GA 1NKSA 2O8BB 1P72A 4AI6A 1OAIA 3U44A 3IECA 2D74A 2ATXA 2BHRA 4JYBA 4LRWA 2ZXUA 2ZVPX 1KK1A 1QHXA 1IAQA 4PC2A 4JVMA 4B3FX 5KNDA 2OCPA 4Q7KA 2EJSA 4JJZA 4X8MA 1NRJB 1SVSA 2OO9A 3DZDA 4HLUC 2OFXA 1TU4A 2KE5A 2YINC 1P4SA 3SJAA 5FBVB 3B82A 1NVUQ 2ZRCA 5TVKA 2XSZD 3K0SA 1DS6A 2DBYA 4NE2A 3PQCA 2QQ0A 3IHWA 3TSZA 2QNRA 3RRZA 3RRYA 2ORVA 3GLHA 1M1YE 1QHIA 1XFAA 3AF4A 3AB3A 3SE0A 2NO0A 2FEOA 2XZOA 4B3DA 3I62A 2CE7A 4FMDB 4UNPA 3U2QA 3GLHB 4CEJA 3TUJC 2BBWA 2YOGA 3DKVA 4MYHA 1ZBDA 4PC6A 4Q01A 4RSGA 5FOVA 4AWXA 3FKSA 4AURA 1NJGA 1C1YA 3GLFB 3NDPA 1ZM3A 2NPIA 1OT3A 4UKDA 4URZR 4WZBE 1R5NA 1M2OB 3NBYC 5E7MA 2GXSA 1KO7A 1YU9A 4A15A 1TQDA 4BPBA 1CJKC 3K70B 1RJ9A 2HLDD 5DI9A 1DAGA 4ARZA 1CTQA 1N2CE 1QVAA 5J4LA 4A36A 2BKEA 3LD9A 3VTKA 5IK2A 5FUXA 5B64A 4KU4A 3KKOA 1CRPA 2WAXA 1NY5A 1VDZA 3L43A 1QDEA 1OXTA 4UJ3A 2WZJA 1M6NA 1BH2A 4BQSA 1H8EA 2YVUA 1SXJC 1XD2A 2O8EB 2REXB 1CJVC 2N1BA 5JJLA 4WOPA 1H8HA 1MO3A 2ZI4A 3V4RA 4TYQA 3ZZUA 4B34A 4PFSA 3EG5A 2UZIR 2ZTCA 2X19A 3C41J 4I99A 4NH0A 3NBZC 3I92A 2QNJA 2XTZA 2WSSD 3LXRA 3IIJA 4QHYA 3QSYA 1VHTA 4RY2A 4AY2A 2QT1A 1XMVA 4ZDJA 3QY0A 3UMFA 3IEUA 3CB4A 1U9IA 5BN5A 1E1RA 2AK2A 2P65A 1OPXA 2JJ2D 4CF7A 3CR7A 2FOLA 4LJ5A 4Q19A 2P67A 3BJIC 1G3MA 1Z0KA 1JB1A 1E1RD 4LV6A 2DAGA 2HAKA 5IRCD 1KI2A 1W2GA 2LVNC 2OBMA 1SGWA 4BFTA 4Z8XA 3VKGA 5JWHA 4G5OA 2ZROA 1FQJA 2H8KA 3D7MA 2H18A 5BYJA 4C0JA 1ZMVA 4OJKA 4M0LA 4QNMA 2HCBA 3K1JA 2OESA 1VYTA 1LVGA 2CVFA 1GFIA 2H92A 3WXMA 1U99A 2W2VA 4TLAA 1WCV1 4Q4HB 4US1R 5E7IA 4BZQA 4WW0A 2FWRA 1KSFX 1D8TA 5DHFA 3AKYA 2GA8A 4F38A 4R2HA 4IFEA 2GF0A 1D5CA 1L4YA 4A6XA 4YDSA 2OUKA 2GILA 2FFAA 1KDOA 4ZDWA 4C9BA 1QHSA 2XEXA 4FWDA 1DAKA 2EFCB 1JPJA 1E2QA 4C3ZA 5EE3A 2JDID 1AKEA 1R8QA 5FR2A 3PEWA 2WJIA 1NLZA 4CYMA 5C4MA 3EPKA 3GLHE 4KVAA 1SHKA 1XBTA 2CCGA 3GD7A 2ZRPA 3LH5A 4PXAA 2GNOA 5FPTA 2O5VA 3WMEA 2DHRA 1NP6A 1XTQA 4YMUA 3LLMA 2ANCA 4A82A 4RJLA 3O47A 2QAGC 3M6AA 3HPQA 3GJ4A 5JI3E 5IT5A 3PEVA 3QNUA 4RCZA 5FL7D 4ZDIA 4ZDKA 4TYWA 1P5ZB 1WQ1R 2IUSA 3VR1A 1VIYA 3NTUA 4AC9A 3TQCA 1WR1B 5TV2A 1ZVQA 2A7QA 4DSUA 4Z1MD 4JLVA 5CK4A 4G01B 3GLIE 4FCVA 1AN0A 1G8GA 4EJSA 1UADA 1XB2B 3LRPA 1JPNA 3NEJA 3TW4A 4A0FA 1OB5A 3DZ8A 4D25A 3QF7A 3MD0A 3QI2A 2BJWA 1I4LD 5DIFA 1F2TA 3KXLA 1C9KA 1BKDR 4MRRA 2VP0A 1JALA 1KOFA 1ZUNB 4HB3A 2QBYA 1ZMWA 3PXGA 1WF3A 3D31A 3T35A 3R7WA 2YHSA 3GJ7A 3HPRA 3OIUA 4R2IA 4Q1DA 2NIPA 4MKGA 3R7WB 1K5DA 4KVGA 3SHWA 1BMFA 3DMNA 3C5HA 3I61A 3R8FA 2JGNA 2P3SA 2QPOA 3EA0A 1GKIA 4DBGB 2RGNC 5CYPA 4GITA 1OFUX 3QKRA 1GSIA 1NV9A 2F1IA 3BERA 1P73A 4LHZA 2D7DA 2HF9A 3HYRA 3I5YA 4B48A 3ZQ6A 1R0XA 1P2SA 2F1HA 2C9CA 2QAGB 2RGAA 5ANRB 2OT3B 5KDOA 3K09A 1FMJA 4JL8A 4Z51A 3K9GA 5F98A 1VKJA 3CNOA 4IDHA 4TL7A 2ZTSA 4DLZA 2QGNA 3U6BA 1DV0A 4ERNA 2EKKA 2GKSA 5JBQA 4PAQA 1J90A 5E95A 1CUKA 1G19A 1KTVA 3EC1A 3FMPB 2UKDA 3A4NA 1E99A 3VQTA 4TYYA 1FL9A 2B6HA 3SYNA 1S2MA 2VQSA 4TZ0A 3LX8A 1E32A 4CEIA 3B5JA 4EDHA 3ZVNA 5CITA 1W36B 2Q6TA 1VCNA 4MRVA 2OXRA 5CIWA 2EFGA 2LVAA 4FMDF 2RB4A 3QKTA 2WWGA 3QXCA 2XGJA 1OJLA 1Z6AA 1K8RA 3CWQA 2JASA 2QG6A 3CX8A 1TAGA 1XTKA 3EIEA 4V03A 3CIOA 1G20E 1XMJA 2CJWB 1FFHA 2QUZA 5BXQC 5KYKA 1ZNWA 5B30A 4TTPA 1Y63A 5D3MA 1YR9A 2B8WA 3PG5A 4GDFA 1TUEA 2CJWA 2WOOA 4LBWA 4WA7A 3RLFA 2PCJA 4I1OA 1R4GA 2GJ9A 2BDTA 2CNWD 1P61B 4N3NA 5H8WA 2WIBA 3IBYA 3N5CA 2P6UA 1KAGA 3TGPA 2DWZB 2OFOA 1ZNXA 5A4JA 1FX0A 2PX0A 2FZLA 2GXAA 2XTMA 1D9ZA 2FF7A 3M1IA 3UPUA 4FMBB 1NNEA 2ZRGA 2FGKA 4ZV4A 1ESMA 3AV0B 2YYZA 2V6IA 3LV8A 4PZLA 2QU8A 4B2IA 2W00A 4G5SA 4C2TA 4MUBA 2BJVA 2FSIA 2JLRA 1DO2A 4LY6A 1XJCA 4C0SA 3QXHA 2G0TA 2OSBA 3HR7A 3OHMA 4V0LA 4DC9A 3HWSA 3ZH9B 3AVVA 3HU2A 4LJ7A 2QE7A 5EE1A 4DT1B 4DB4A 4KSCA 4QM7A 3EIHA 4K81B 3NDBB 2O25A 4BFVA 3K09C 4F4IA 2PCLA 1KY3A 2ZI5A 2CK3D 4HAYA 1QF9A 2ZRLA 2F1JA 2ZS8A 4EFLA 2GHIA 3AP3A 2J7PA 4IW3B 2ZRAA 2JEOA 3EWSA 2P5SA 2OOBA 1P7CA 2DKLA 1JR6A 1E2IA 4B3BA 3B9PA 1KY2A 4OI2A 1CLUA 4ASUA 1WDTA 1E2JA 2IC5A 3ETLA 5JEDA 1VQ1A 1B0UA 4XWOA 3GEIA 1II8A 1QHNA 1ZIOA 2BWEA 1P9RA 3B1ZA 3NHAA 4OHVA 3U60B 2NQ2C 4F91B 2IYTA 2AD5A 3BFKA 2JJ1A 3QXXA 4HAVA 5IK2D 3TK1A 1ZCBA 4FWIB 4C2UA 2VP6A 4C0KA 2ZUDA 3K53A 1YZTA 3QEOA 4TLEA 4LHXA 4L15A 2CLSA 3MRSA 4OYHA 4OQLA 3OEHD 3WMFA 4D4JA 2REOA 2WPDA 3T5GA 2WJHA 2JY8A 4DDUA 2FPKA 3CBQA 5LB2A 1QHHA 1EK0A 3AF0A 3GFTA 1A5TA 3A8TA 3FKSD 4JLPA 4RZUA 3VMFA 3TSWA 2W0MA 3TVDA 3KDSE 1V43A 4IOMA 2WWFA 4CEHA 1XTSA 1IY0A 1L4UA 2ASEA 3P20A 2YWGA 3KJGA 3N70A 3R9WA 4LYHA 5EXTA 2B21A 4PO9A 4CEHB 4PQRA 4IVQA 4KLNA 3KUDA 4PC7A 1K5GA 2Z0MA 2W6JD 1SXJD 2WSSA 5GVRA 1KMHB 2V3CC 1W0KA 1TF5A 4I1UA 5GJWC 5HKKD 1B23P 1OYWA 1SVLA 3IQWA 3MSXA 1ZV1A 4IOLA 2G3QA 1E69A 2IYUA 1I4DD 1FNNA 3BC1A 5AJVB 2GF9A 4TL6A 4KFTA 2ZQ5A 1S1CA 2N42A 2G77B 4H1VA 4Q18A 3SN6A 3PEYA 2ZUBA 4NYIR 5BN4A 1KI9A 2XXAB 3LBIA 1X86B 4H1UA 4HDCA 2C99A 3L8YA 2CCKA 4QBHA 1VTKA 4B43A 4ITRC 4NCNA 1RRCA 4KBFA 3VR2A 3KQNA 5SZHB 5CDFE 4TZ6A 1YRAA 4U5XA 1WGLA 3C8UA 2LKCA 1W48A 4B6FA 1WRBA 3P27A 1Q02A 5FL7A 2NOAA 1AA9A 1OIWA 2BMEA 2VEDA 3KKPA 1WA5A 1EG7A 4F4JA 4B44A 3H4MA 2DCUA 1GIAA 1TU3A 2R44A 2IA5A 3ZYCA 4DUGD 2ZRNA 1RJ9B 4DIDA 3SJZA 5HKKA 2PJZA 1W5SA 1VMAA 3UMRA 1P75A 5L3QA 2JCSA 4B33A 4BFWA 3QJYA 1GWNA 2MGWA 2QPAA 1Z2CA 1KK0A 5DH9A 4URVR 2WIAA 2J59A 2ZSEA 4IXMA 3WHKA 1JXOA 2FGJA 1N5KA 3O8BA 4US2R 5EQTA 3B85A 1XPUA 2ORIA 4BLPA 4HDQB 3LCVB 1ZM9A 3MG9A 2IYSA 1RIFA 4V0MA 3TQFA 1Z28A 3NIBA 1G18A 4XTRA 1E94E 2ZRHA 1Z29A 1Q12A 3KL4A 5EUMA 3TKLA 4HZIA 1NG9A 4YMVA 1YZLA 1X8LA 3AVOA 2LVPC 4C0LA 5FTNA 3IKJA 2E87A 4YDHB 4MUAA 2PH1A 3TH5A 5KO2A 1VECA 5FUVA 1W5TA 2BVNA 2G3YA 2R6FA 1ZJ6A 2YWFA 1YZKA 1W0KD 2P5TB 4HYYA 4DCVA 4B2LA 3LW7A 3EPLA 4EQ6B 5DSZA 3RRNA 1N6NA 4ZCLA 2WHXA 1F2UB 2C03A 4MGZR 4PSAA 4EQ6A 3U7GA 3ECCA 3A37A 1TUIA 3PENA 5KNBA 5FTJA 1XXHB 3ZZTA 2KNZA 4GRAA 1U94A 2X2EA 1RRPA 4CT5A 2QI9C 1UDWA 1SVKA 1XXHA 4DIEA 1Z6XA 2ZU0C 4BFUA 1KSHA 4UQOA 2FX3A 4DLXA 5IF9A 3QBTA 1EWRA 2OE2A 4WVFA 5L8VA 2IL1A 3A58B 1IXSB 3D8BA 4KJZA 4XIGS 3CNNA 4L16A 1R8SA 1GL7A 3UWKA 2QT0A 1RVDA 4Q4HA 1JR3D 2LKDA 1N0WA 4TMVA 3AUYA 1NMZA 3FFAA 4FXPA 3ZVRA 2NMVA 1NV8A 1EFUB 2AL7A 2ZU6A 1DAEA 4LYJA 4QOSA 4B73A 1OH8A 2O8CA 2BM0A 2RH5A 3LBHA 4TL9A 4UNRA 4OK6A 4JKIA 4Q1FA 4AYXA 3QBVA 5AJWA 2A5JA 2GWHA 3CRQA 1HT2E 1GNRA 4AYTA 1A1VA 2FSFA 5DNYB 3CF6R 2J45A 3AM1A 2N46A 2QMUA 4LBZA 1AJEA 4C30A 4BRWA 5JWOA 4GOKA 4LGMA 1J8YF 1FZQA 1V92A 2F3RA 3H1TA 4M9XA 4NYIQ 1EFHA 3A1WA 3PCRB 2QP9X 1DAHA 1IN6A 5F3WB 4A0RA 1RRFA 2ZETA 1CS4C 4LJ6A 4F93B 1Z6TA 3T6PA 1C7YA 3IQXA 2H17A 1JAHA 4PPNA 1U90A 4HLCA 1XMSA 1E9FA 1R5OA 4CZ2A 4H9GA 3ADDA 4Z54A 2XX3A 3ZD6A 3L0SA 3EWAA 1HQYE 4XVUA 4GOXA 2I1VB 1W4CA 5JRZA 2BEKA 2D06A 3IO5A 1U8ZA 4EJSB 4JKYA 1XB2A 3WMGA 1S4QA 1FW6A 1LF5A 4R71A 1SHZA 4JLBA 5DHAA 4A1FA 5KUTA 1Q22A 3S1AB 1HTWA 2FA9A 2Z4RA 2A5GA 4O2RA 2KB0A 1TEVA 2J9RA 4RZXA 3VR4A 5FPSA 3WNBA 4GP6A 2ZREA 5EP1A 3THXA 3CKLA 4LHVA 1DG3A 3FMOB 3P26A 3EPHA 4BWYA 1Z5ZA 1ZINA 2EFDB 1E2HA 2ZJYA 3DVLA 1TTTA 2JLWA 1HJPA 2JIZA 3GJ0A 5C1BA 1GZSA 2IYWA 1FTSA 3T15A 1T0JB 2JY6B 1N6PA 2EFEB
chains in the Genus database with same CATH superfamily
1GCIA 3S44A 2D4HA 4PPGA 3GCXA 4IIJF 5AJYA 1C4XA 2R4UA 1USKA 3O91A 4MWDA 3ZIAA 4D7AA 1MAUA 2VLIA 1U2PA 1ZX1A 1JBEA 4MS3A 1ZCJA 1FVFA 4D4LA 2OBYA 1HQCA 4UAUA 3WK6A 2X0DA 1FNSA 3PV0A 4TWZA 5C2JB 1EVKA 1O6GA 1E1QD 1XA0A 4XB6B 4FXOA 3U37A 5EWMA 1I1QB 1Y6ZA 1N75A 1I9GA 4B7FA 2LGJA 2Z3VA 3V8BA 3GUUA 1CJCA 4MW6A 4BWFB 1NU6A 4KNYA 2Y0PA 2O6LA 2PD4A 4J4BA 4LPSA 1ANKA 2Z9DA 2ZYDA 1GTRA 5IWAB 2IIQA 1SBTA 2QRLA 2C9DA 2GPBA 2XMZA 4M4SA 4MW2A 1EJ6A 1QH9A 1WE2A 2ROQA 3F0TA 3ELDA 3KXDA 4K2HA 1I0LA 4F4CA 1H6CA 3C6ZA 3B3GA 1YQTA 4H7HA 3OZSA 2R45A 4LF8M 2K5UA 4UUNA 5HOEA 4GM0A 4D9MA 2E85A 5BWOA 1E6WA 5AESA 3KLBA 3F6PA 1D2AA 1Z25A 3EVDA 3GJ8A 4GL4A 2IS4A 2H1HA 3IBTA 4P3PA 1LDYA 1M2EA 1EBFA 1RWKA 1OWNA 5LMNM 1J8QA 2RH8A 4K6FA 4Z4HA 1UWLA 2LW7A 4LUCA 4OK5A 3HMQA 1G1MA 1LPNA 1G7SA 4L73A 1XLVA 3ZXXA 2HRDA 4ER5A 3K0EA 3F78A 3NTXA 3KQSA 4P5PA 3VU9B 1RQXA 3C7CB 3I9FA 4NU0A 5IU6A 4LWQA 3LOPA 2CLCX 4U39A 2IYZA 3RWMB 4DLTA 3EODA 5EQDA 4QTTB 2XUIA 3D43A 4DQDA 1SXJA 3SSNA 2OHJA 1G21E 3P9KA 3QXJA 3HZRA 5DHQA 3AKCA 2WB2A 2ORWA 4HB4A 1UP7A 2X1MA 4KE8A 3LJKA 3JVIA 4HH3C 4TOIA 3RUCA 1APBA 4RBNA 2ZB8A 3HK2A 1DT5A 4C4TA 1LPAB 3O1HB 1E0AA 3B1YA 3EUWA 1U81A 4PVDA 5C5DA 4HJXA 4K86A 1Y9AA 3OT4A 2UZ3A 1ODKA 1W0JA 1UZUA 1T9HA 1KIAA 1VZ3A 2P79A 2Z7JA 4U3JB 4Z1MA 4F5DA 2Q4TA 3IAFA 4F2LA 4FJ2A 1AIPC 2NUPA 2QM7A 4KFSA 3VNQA 4AUKA 1GPDG 3KKKA 1H2HA 3OMLA 3PFFA 3PPVA 2JVIA 4PGMA 5H5JA 3FLBA 3SU8A 4CV2A 5DX0A 3UG6A 1ABBA 1RPNA 2FOIC 1XYYA 2ERYA 4IDBA 1BD3A 1OROA 3TI9A 5BW4A 3L6OO 5IJ9A 4KKXB 4D8WA 1TYAE 3JQRA 4PYKA 1FDRA 3NJRA 1U8YA 4BMZA 1I7SB 4DANA 2Y1DA 2XOEA 3DD1A 3L8HA 4NX2A 1UBJS 5DEOA 5HPYB 1E2DA 2DECA 3PLRA 1V8DA 1UBOS 4UM9D 4QTUB 4JV5M 1GJTA 2FY8A 3EXEA 4DHWA 5BW5A 1LC0A 2F48A 4JUIA 3U19A 1TEXA 3WV5A 5ETJA 2PBRA 1TJ3A 1XF9A 1CFJA 2KW5A 1ETHA 4KUEA 3ZLJA 3U9SA 3V33A 3LUDA 1E4EB 1BOFA 3AGQA 2J3EA 4PHFA 3OTOM 4RMHA 2KRUA 1CVRA 1NFFA 4HEJA 3RJ5A 5LP6F 1T3LA 2C9BA 3HUUA 2OZKA 4GC5A 2O2ZA 2JAQA 2AEMA 1RM4A 4EHJA 3OEED 4MWSA 1EGVB 1CHDA 5IKXA 3JSAA 3QV1A 5FH9A 3DOJA 4P3KA 2X9LA 1YJ8A 3HXLA 2JUJA 4V0NA 4EA6A 3TAHA 3THYA 1Q0UA 1A95A 3HGIA 3JR5A 4XIYA 5ICGA 3CRW1 2WMNB 4NCHA 4AZ3B 2KNAA 1E3WB 1Z2EA 3JQBA 3RKUA 1K7CA 1N92A 2YUIA 4RTLA 2Y68A 1A4XA 1K6EA 3KOYE 2XAUA 1JHUA 4NV1A 3ZIDA 4JLAA 2JB9A 3LUGA 5ESXA 5ALMA 4P4NA 3OEEA 1LF0A 2POQX 5IBCA 1TVKA 4KMRA 4KGDA 1Q3TA 4IKOA 3L1VA 1ULSA 4ZKDA 3TECE 2RAPA 3EAGA 2XWQA 3ISTA 1XA3A 2D3TA 3HDQA 4AJNA 1USIA 1JNXX 4PBTA 2IGTA 3FWPA 1TI7A 1N8TA 2OCYC 3U6OA 3TPZA 4H31A 2VWGA 2OQVA 5HFAA 3TCXB 1QIDA 1WCXA 1GQYA 4L9WA 4QOGA 1H93A 1RXUA 2JZCA 1UZMA 1BKSB 2O0JA 3K8OE 5H9VA 3UHAA 1PJJA 2LPMA 5HE9A 1ZYUA 2ZR7A 4LZJA 3ONWA 5EWLB 3UAXA 1N5LA 3ZDYB 1IBKB 2VP9A 2NZVG 3ELUA 4LJKA 2AEJA 1XNQM 5EMLA 1XVLA 2VUHB 2ZRJA 3DMTA 1P62B 3KZOA 4P2BA 4TL8A 4WLOA 2H4XA 5A6SA 1EZ4A 2CNDA 3N7TA 4Q9KA 4RYLA 5TY0A 3VTZA 3MRVA 2VHJA 2XXAA 1YBAA 5FO0A 1L5VA 2ZOSA 1NXPA 1L5HB 5A9SA 4XM1A 5BRJA 1NW3A 3S2SA 2OV1A 4URXR 3RTBA 1BGXT 1WSWA 2VBFA 1D2RA 4W82A 1E1DA 2ADFA 4KODA 2GN2A 3JQQA 2BTQB 4Y8VA 1K1EA 3MS2A 3IJRA 4ALNA 2OFPA 4GR5A 2RHDA 5DI3A 2CXNA 3QFFA 4JVOA 3PU6A 4M0FA 3UQYS 3FWYA 1K8ZB 4ZIRA 1AKVA 3ZD7A 4X44A 1NVKA 2A88A 1NOKA 4ANFA 1UKEA 2RGUA 2WSMA 3LUHA 4KO3S 3MILA 1B16A 3BMNA 3ABIA 4P5EA 3HU1A 1H6DA 4F85A 4KSBA 4DR6B 3MWDA 3FLAA 3T9CA 2K6BA 5DRYA 4C6SA 1P1BA 4KNVA 1FDOA 5BOSB 5JISA 5ISMA 3LOUA 4DIMA 5KPRA 3SC2B 1G64A 3ZJUA 1QE5A 1RAEA 1YE8A 3AY7A 1GUDA 5DFLA 1US8B 4L8GA 3AERA 5K3EA 2LHCA 4MVJH 3CISA 1YFZA 3GAMA 3RUHA 1L1ZA 2Y99A 5JH7A 4FGUA 2W2MA 3EHDA 2QV0A 4Y6GB 4ND6A 1XU4A 2B3DA 3IPYA 3PHHA 5JH7B 1XZGA 2RCNA 2HK8A 1UBEA 2Q07A 2J0UA 2QZZA 4XWWA 2NW6A 4KQIA 3EZGA 4LC0A 5JS6A 1GYRA 1A9RA 2KA6B 1B8PA 3KUUA 1Z45A 3PHIA 1U0RA 4A0QA 2VWQA 5L4SA 1JEEA 2DTDA 3EXHC 1KZ6A 1MABB 5IKPA 3R3UA 4H7IA 2QAGA 1GZVA 3I9LA 4BEWA 3GGCA 3UJAA 1VSTA 3M4NA 4PYLA 4U2CA 1X7GA 1O3YA 3VU8A 5F51A 4Z53A 2J41A 3L82B 4Q47A 2B1JA 2VF8A 1GPAA 2NVBA 1PT6A 4KQMA 5A4AA 5AVJA 1H65A 1C2TA 3VHLB 3QEBZ 1NG1A 4P7BA 4AU1A 1W85B 3I9V1 5TRTA 1Y6FA 3HUTA 4IX1A 1JIIA 5BY2A 5E6JA 1PKXA 1X8JA 3E05A 3EC7A 3TCKA 1RJGA 3OIFA 4TVBA 4YMTA 1Y6GA 2BEVA 4HXEB 3CXUA 4WXPA 4JUCA 2PX3A 4EZBA 3GVPA 3D7LA 1D2GA 4YI5A 4IHJB 4XDHA 5F33A 2DU8A 2YY6A 3I6QA 4TV9F 4U2EA 1UMDA 2A86A 5F64A 4UXJA 3PVSA 4GH9A 3DZBA 5CFPA 2WSCF 1LPPA 2PNFA 4AN4A 4ZVKA 2YN4A 3OURA 1Q95A 3QUSA 1CZUA 2A78A 1FW6A 5C81A 2I3BA 4ETNA 3NHPA 1OH5A 4B3GA 1KYTA 3C7KA 4H7JA 4YQZA 3MHPA 1QP8A 1PLKA 3G85A 3GU3A 3K5IA 3G5MA 4B3TM 2IPNA 4YRRA 2CLOB 1O94C 3INNA 1H8HD 4KN5A 4RUKA 2FJUA 4DCSA 4CW7A 4DLLA 3OLYA 5ITTA 5LYJA 3CW8X 2OYRA 3OO1A 1B6TA 1J2YA 4F3CA 3KQWA 4M21A 1R7RA 4MJLA 3N2LA 4WKOA 3B2EA 2OLEA 4UUAA 5AW4A 1SURA 4R8RA 5LZ8A 1K6MA 5DX1A 3FNEA 1NBMD 4FT2A 1UBKS 3BB3A 4PN3A 1S7GA 4AQ7A 2BGWA 1LK5A 2XLJA 4S04A 2XCOA 4IBFA 1N4DA 3DPUA 2AZ4A 3CE9A 3FI0A 4TLCA 5DWQA 3ER8A 1YS6A 2X0FA 2R2AA 7AT1A 1U7TA 4NEHB 4YUXA 5JU6A 1CIPA 1SBHA 2L42A 4XA8A 1NUAA 5IUNC 3WYFA 3VKHA 2L82A 3ZV4A 4NQRA 3AR6A 5K6AA 4OQDA 2CDNA 2Q3CA 3EMKA 3VZQA 3L1UA 3TQRA 3ZWBA 3NHWA 3LXUX 5K3CA 4CFZA 5JVDF 1Y3HA 4BQOA 4QJ3A 5CVCA 1IBLB 2Z98A 2C9ZA 1TCBA 2K9DA 2HMVA 2MINA 1DMRA 2PRJA 2TMDA 3O1IC 4UREA 5A2QA 3FMVA 3DL4A 1M6HA 3RHZA 3WB0A 1G5FA 3PPIA 3A9TA 4ND3A 4ER0A 3HHZA 3FZYA 3KE8A 1LLQA 1NJ5A 1T3HA 2A14A 4B3TB 3DWFA 3TIFA 5I7WA 1TCCA 3FPCA 4AJ2A 2J3HA 1QPBA 3X1XA 1J21A 2C5LA 4OOEA 4ZOLA 3MCZA 3TVYA 2JLSA 1V3VA 2C4NA 1L1QA 2F9MA 2X0JA 3JYHA 4TROA 3T99A 4ZI7F 4JELA 1VMIA 5T64A 4NIMA 2OBXA 1P1IA 2F8MA 2PLNA 2Z4TA 5HA5A 2R5NA 2DWUA 3ZZ0A 1Z38A 2DTEA 3EMVA 5IEJA 3VZDA 3H8VA 3NVKI 1N5OX 1NVMA 3NIWA 1Y42X 2PXCA 4RU1A 3WWCA 1C4OA 2NYAA 4J3NA 4EI8A 1E96A 1Q1QA 2GCGA 5A0VA 1FLVA 4LX0A 3I5XA 4CDRA 4N9WA 4H3KB 5AWFC 2IS6A 1TT5A 3A3KA 2DF8A 1FSGA 1TEHA 4MUHA 3U17A 3OM0A 4OHRA 3UJHA 2OHVA 3B1VA 4QUJA 3BORA 4PG6A 2Y71A 3ITNA 1MOSA 1R0RE 2WYWA 1T15A 4MS1B 2QTVB 4YAFA 2H3EA 2QXUA 5DWDA 3PUYA 3EAQA 4OP3A 5I8PA 5JFOA 2V6JA 3H4IA 4KTVE 3FWHA 1B0ZA 3GFGA 2C82A 4WI1A 1BROA 1MC8A 1FVOA 3F8TA 3RNLA 3ZE9A 3NTOA 1AXEA 3PJFA 4UTNA 3KS4A 4PAGA 1JS1X 4UNQA 2Q7OE 2WBLC 1DUVG 1E9EA 2IW3A 1FFXB 3IX7A 4PHCA 2E4WA 4TQGA 2WFAA 2OM2A 5HUHA 2HT6A 3HDTA 4OI4A 4LVOA 1U1FA 2IKSA 2J9ZB 1P0IA 3A4YA 2QM8A 1U0LA 3C5CA 2ZQYA 1OLSA 3KUCA 2CHQA 1Z33A 2VCHA 1JL3A 2G6BA 3LPMA 1EESA 4NARA 4D9NA 1JHDA 5B1YA 2CHVA 3ZWVA 1I32A 1L1FA 1QRDA 1UPUA 2O3JA 3M9XA 4PZYA 4Q4JB 4WN9A 4YRPA 4YRSA 1SBIA 1B43A 3IOCA 1K3UB 3JQ7B 3Q7SA 5HZKA 1FS6A 2HY7A 1Q1NA 2ATCA 3FCSB 3OE7D 3ES9A 5G40A 1NNJA 1D1SA 3AK4A 3QP9A 3PUWA 1Y4AE 1DKQA 3T1TA 1NBAA 1D8AA 1Y1SA 4BKOA 5HNKA 2DWPA 4R3DA 5F2NA 1GUFA 1T9BA 1VG8A 3LS2A 2REBA 1PU2A 1DLJA 2QNBA 3KZ1E 3NAQA 1HTTA 1UK9A 3JQCA 3QPVA 1JAIA 2DKNA 4Z6YA 2PL9A 4P84A 3WTCA 3EG9B 4FEGA 1ZHOA 2WG1A 4I6JA 2Q7XA 2JFZA 5HUJA 4U9HS 1FYVA 3UG7A 1GT6A 3I1FA 1TE2A 1V96A 2JH3A 2C5GA 1Q0SA 2H8GA 3AINA 1RYZA 3G9QA 3NBMA 4MUXA 5DISB 5DLQC 4BMDA 2CZGA 1JLHA 4CR8A 4EY6A 1KEPA 1XMOM 1DX6A 3JSXA 1LUAA 1KR5A 3L5OA 3G9ZA 2A6PA 4NPHA 5L3QB 4K88A 2PGNA 3MGCA 4ARZB 3HZHA 3HN7A 1FTQA 3GRUA 5I9BA 1JKFA 1R3DA 3F46A 4Q1EA 2ZRKA 3GX1A 3L7CA 3ZC7B 2ZULA 3AJEA 1K7SN 5B1HA 1XZFA 3A3YA 3SDSA 3U7QB 1KYXA 1KJZA 5IEBA 3V7FA 4WAUA 4XM0A 3O9MA 2VR1A 4BWVA 5LMZA 3SLGA 1JSLA 1YFKA 2GJ8A 1HKHA 1YS9A 2XE4A 5F3DA 2FFRA 5DULA 5HSGA 1UMBA 3I6ZA 2W2OA 1FFEA 1KI4A 1RMQA 2NPOA 2WJ4A 3KOXA 3M5DA 4F11A 2AG0A 1MOZA 4WBXC 1OXXK 4LISA 3AUTA 3KQVA 1H5QA 1OYOA 1W29A 3CNQS 3FZEA 2Q1UA 5L53A 3IB3A 3MCTA 1OTYA 2RK3A 5HTKA 3EIQA 1GYPA 2A2ZA 2X42A 3LO5A 1GLNA 3UH1A 5KJ1A 2E4ZA 1UZLA 3IP7A 1S4MA 1OX6A 2PLRA 3CRVA 3U81A 3OPQA 5DTRA 5AVVA 4PO8A 4U00A 3NEPX 2D1SA 3QBDA 4CTJA 1PT8A 3KSAC 3JU3A 4RMGA 4AQYM 2AFHE 1JQAA 4DCTA 3W5DA 4B35A 1C3EA 4IBEA 3ZU2A 1RXWA 4ZQGA 1U2EA 1RM0A 2X4AA 1XAJA 1W96A 4LZZA 1JI3A 3P2IA 5ITXA 4Z0HO 2XIQA 1E4YA 3TSYA 1RWQA 3CLSD 1WQ4A 4HDKA 1H4SA 1S3FA 1GADO 2QM0A 1D4ZA 2V59A 3AP2A 3HVJA 4JZYA 4PAOA 2HWWA 1BHQ1 2XT6A 3QVXA 4BQPA 4DA6A 3EOZA 5F23A 2D2FA 3MGAA 1MVOA 4KO1S 3ZXUB 4BV3A 2XBUA 4AY6A 1SU8A 1XVIA 3FZNA 4HDNB 1X77A 1XTRA 3MF4A 3ZGVA 3ISJA 1ZD9A 4Z99A 4NJEA 1OIPA 3OTGA 1Q21A 5FBHA 2JIRA 2YXPX 4FFBB 2XQGA 1GNSA 3NAGA 1NP7A 1CY0A 2FPPB 3FVRA 2XHEA 4XWYA 3W5IA 3G5AA 3U7FB 2FS1A 4U8HA 3SLRA 1KS9A 5K8TA 4E33A 3JAMS 4ZXPA 4K9QA 1WJGA 4YRAA 1JHYA 4DMHA 1HG1A 2ZI3A 2P6NA 2EYUA 3Q88A 3F4KA 2JJ2A 5TDHA 4EATA 2H1OA 4LF9M 2X8BA 3DUWA 5DEIA 3AEZA 4WVLA 1T1IA 3I83A 3QX8A 2I7TA 1FFSA 3TIIA 1AF4A 1YZVA 5FPQA 3U56A 2D13A 1KPHA 4MQEB 1C9MA 1LFDB 1XEXB 2ZBFA 1P6XA 1ZJZA 2F1RA 4FZ3A 4GZ5A 4HTAA 5AKZA 6YASA 3IAXA 3EXHB 3HI6A 3OWOA 3DOAA 4L85A 5FBQB 1NBOA 4TQ9A 2Q6IA 5GP1A 3BF8A 2J87A 1UXKA 2PG3A 5BT9A 5TGZA 3UC9A 5ICFA 5H80A 4LOLA 3TWMA 2M1ZA 2MMGA 4OD0A 5ALLA 2WY2D 4QDJA 3M3HA 5KOJA 1CJUC 5CAEA 2C2BA 4HDMA 2AG6A 3S8MA 2D00A 1O58A 2NU6B 1IK6A 1S2IA 1UC4B 2RGDA 5GJCA 2CV2A 2RGXA 3LVFO 3PUIA 1RYDA 1ZUIA 2JW5A 2ZCUA 5TXGA 2WTXA 1XRNA 2E0IA 2NU6A 4HF7A 5DCUA 3VKWA 1E2PA 3A4IA 3HKDB 5HTOA 4R9SA 1RC1A 5I7AA 1IHYA 3BWDD 3AW9A 5KWJA 4HD8A 5EHGA 2RI6A 1UXGA 3Q1KA 4NK4A 4CV0A 4E1BA 1R4MB 1R15A 4HL4A 1JFFB 4PTLA 3K6SB 1WABA 2YFYA 3NYRA 1M1NA 3T1VA 3AR8A 3ZUGA 5CCXA 1IN4A 4H7FA 1L9XA 1FFCA 4FLEA 3KXEC 4PBRA 4EHAA 3L7KA 3QH4A 3ZXIA 5BV1A 2FWMX 1TF7A 3SBJA 1N36M 2H5EA 4O4LA 1R4AA 3UV3A 4CM1A 1ORDA 1S3IA 1ZIXA 2GCOA 4RF4A 4L5AA 4RVOA 3TNDA 4S05A 1BWPA 3WK7A 4S1TA 4W5OA 5EERA 4XVRA 2ZJ3A 2H48A 1PSZA 1ZNZA 3R0XA 4YMIA 1WVMA 2IZ0A 4IKEA 2O4UX 2RAFA 1U3FA 1ODIA 1QGED 1Q6ZA 1Z5UA 1V5IA 4BV2A 1D4FA 1N2JA 5LQKA 4NP6A 3G5LA 3G8AA 4GXQA 4NU5A 4JASB 3BWYA 1BWSA 1KYZA 4BKRA 1SWWA 4BLQA 1CQIB 1ATZA 1WW3A 1R5BA 2JATA 4XAQA 3T0IA 3AFHA 1GXSA 2MU1A 4J1NA 5E6UB 2FE8A 2ZWIA 4YLYA 5A4MS 1WR8A 5HWSA 3C3EA 4LOIA 2X8JA 3U09A 3ZHVA 1RT9A 3AHEA 2ZIUB 3BMCA 2DHYA 4MQMA 1BIFA 4RAQA 1X1AA 3AYXB 4YDRA 5K3SA 1QYRA 3QMVA 3N8KA 3FVQA 1HDZA 4NBSA 2HIAA 4ERXA 4IS2A 3J81k 3IVCA 3PVCA 4LRTB 4CF5A 4JC5A 4AYWA 3AUXA 4UMDA 4Q6BA 1AURA 1G41A 4H6PA 4WTOA 4TKLA 5C8YA 5L8RF 3TLAA 3TQHA 1UDRA 5FFNA 2KSQA 5AHXA 2PEYA 3HWWA 1P8JA 2VAXA 3CNEA 4X91A 2I65A 3SJCA 3SI7A 3N2YA 4DC1A 5ITRA 3MT8A 2V8OA 1EK1A 2CGEA 2W4QA 1AQNA 5K09A 1RYEA 4QBFA 3D6AA 1GPWB 2JIQA 4RCVA 1KJNA 5IYZA 2W8ZA 3E61A 1CY4A 3Q5EA 5DYIA 4LJ4A 3NV9A 1O03A 4MARA 4M60A 2OQIA 4JR2A 4LRYA 4ZYZA 2BZGA 4WCFB 2B4AA 2M32A 5AOCA 1G6KA 1SN7A 4JI3M 3K9WA 3NT4A 1X37A 4ROSA 2VJAA 1PJQA 3IE0A 4TXHA 2O7VA 3TYXA 1L7VC 4R0MA 1NN1A 2VRCD 5CEEA 1HKUA 3P2KA 3CF0A 2OOSA 1LTHR 3NHYA 1PLLA 5AFSA 5JBQA 1JQBA 2QTMA 3P4XA 3V00A 2O0MA 3FTDA 4DV4B 5HIMA 3CH6A 5JJKA 1E5DA 4MGIR 1SQFA 1FP2A 2PT5A 1Q1AA 3JTEA 1QZMA 1V7PC 2PTHA 3BHNA 3D02A 3D4OA 4IEEA 1WW8A 2VF7A 2PVCA 4GE0A 4ZO4A 2C4MA 4DTIA 3AHCA 3O93A 1NRWA 1XPOA 1Y3AA 1XL0A 5G0UA 4DGSA 4NNPA 2Z5FA 2WF7A 1UC9A 2CFSA 2X9VA 3UW1A 2IWRA 1XEFA 4B7CA 4V2IA 4PX3A 4KMOA 2D1FA 1NJ1A 2O48X 3BXEA 3HJBA 3OF5A 1E9BA 3LPDA 4QWMA 2C3MA 1XZLA 3RHTA 2ODWA 1CRWG 3NRBA 1YE5A 1C8BA 1JDPA 3VO8A 1COWD 2PR7A 1I3MA 4RPIA 1F2VA 4GI7A 5CNJA 3EJWA 3NONA 3Q8MA 3VHXA 4MRNA 4WT7A 3QU5A 5CB8A 2H65A 3LZDA 1ZMUA 1WQ3A 2AOUB 1VHLA 4J7CA 3UMGA 1JB0F 1MAVA 4OXIA 3CNHA 3ROTA 3TZ6A 2B61A 3C24A 4A3VB 2BFOA 3H9QA 1EGQA 3HYLA 3T0GA 1L9KA 4CIWA 4Q1AA 4TMYA 3NVDA 2GPSA 2CHGA 1K3WA 2W43A 3U0VA 3RAEC 3J81S 2ZSBA 3U6MA 3U60A 4P16A 2CL6X 2PKWA 4NULA 3KJEA 2OV6A 1OOEA 1AY0A 4MI9A 3KLPX 4NV3A 4G2NA 1VJ0A 1R0BA 1J5EM 4NG5A 2O2EA 2WLTA 1XIVA 3FPLA 2WDZA 4R9RA 4TSFD 3WTBA 4AIIA 1I4EB 2P2NA 2VJOA 3K0BA 3N2IA 4FMDF 3IBSA 3LBFA 5CLLA 1GM5A 3A2NA 3VKFA 3CZAA 2IYYA 1YUBA 4I9UA 4WKNA 3SDBA 4B2PA 1IE3A 5HM8A 5EXXA 4Y6PA 1CZKA 3Q0TA 1QUFA 3AM4A 3FIUA 1YA8A 2ZDQA 5CDYA 2JBAB 3SBEA 1Z13A 4OJMX 4GPTA 1P0CA 2B5VA 5MHTA 1EI9A 1GRQA 1TPYA 4JMLA 1BDHA 5B5SA 4TS1A 3BZWA 3KEQA 3KSXA 1L2DA 1YD7A 3CEMA 3KWLA 4BE4A 2HMUA 2AF4C 4CJXA 3DEJA 1W5FA 2IHBA 2OV2A 3IBGA 2NO5A 3O4RA 3IXLA 4X6LA 5CD1A 2VTDA 5FP0A 3WLSA 4A3SA 4TYNA 4FSHA 3VVLA 1E62A 5ABPA 1SZJG 1IB6A 2NAFA 5FNVB 2HPHA 4ENTA 4C7VA 4CKYA 3BDVA 5I7RA 3UHPA 4KXFB 5ICEA 1W5AA 2V7PA 1HOXA 2YWHA 3RUIA 5B1EA 2WJ3A 1CUBA 4RPJA 5LMUM 2J07A 5L95A 1FUKA 1B76A 3DJYA 3JRXA 4V39A 2XMDA 4AS3A 2C7QA 4Z4IA 5J4HA 2IODA 2HJ9A 3GRCA 3RBVA 3FTCA 1NASA 5IJAA 1Y8ZA 3MHVC 4QTYA 3RTCA 3NWLA 5KDDA 1XWIA 4MVCA 3NBXX 2ZI7A 4QEDA 4RLQA 2GN9A 5KVCA 1K98A 1YT5A 4PYRA 1E6KA 2CLKB 4UD6A 4YJGB 1USGA 1W93A 4MQ6A 4RD6A 5DK6A 1T1EA 4EJSC 4GIPA 1WUYA 4JU9A 5AIAA 5ED0A 1IBMM 3A6DA 2Z57A 2VTVA 1N0UA 3GAFA 4AN1A 2X9NA 2MR9A 4QU8A 3BQNB 2XCRB 4OM8A 3EG9A 2XDQA 3GZNA 1DELA 2NNWB 3IUYA 4WBNB 2L4FA 1TM1E 1OX4A 3UK1A 2VYCA 2XQFA 2QR2A 5J40A 2GPJA 3BMNB 2Q45A 3CX6A 4JI4M 2XMQA 2QROA 3SBXA 2IDZA 2WM3A 4A6PA 3BICA 3U6KA 4L2IA 1TB4A 4RESA 2XDYA 1KZYC 3O95A 3OLZA 1WAMA 1DC4A 3B6JA 2GBLC 5LKAA 1R0ZA 1ZI6A 3ZCXA 2OAGA 3PQ3A 4EKDA 5BVHA 4CVNA 4C4OA 5AW1A 4LF7B 4EGFA 1I5RA 1FB5A 3PFNA 3TD9A 1VYVA 2FG6C 5FXMA 3U7QA 2CEAA 2IW1A 2NV6A 2GFHA 4GEKA 4NBKA 1G21A 3MWJA 3QHAA 3EVCA 2GK7A 3LGXA 1Y5LA 4G4GA 4II3A 3TO5A 3WGLA 1X80A 3G2MA 2WTMA 3G02A 4WHMA 4B3MM 2WHYA 1IJBA 1G20B 1DJMA 4I3FA 1L5SA 2FMIA 2KHZA 1TMYA 4CJ6A 3ZE7A 1P2DA 3ZX5A 1K8XB 4F72A 4RDIA 2WK1A 3DDHA 3CEJA 4LRXA 4UAGA 3PKZA 1WWKA 1Z6ZA 4UU0A 5FBRB 3RYIB 4INPA 4Q9HA 5E8JA 4YUYA 3DL2A 3IULA 3MINA 3H13A 4UFNA 3S70A 2I80A 3SYLA 5LPNA 4RTSA 3CJTA 4GOOD 2XLCA 3S99A 4YRGA 3QU9A 4CKZA 2J6IA 3FDXA 5KWEA 5JXHA 3KYJB 1EXWA 2FW6A 1MA3A 2YWDA 4NTZA 2KZSA 2OG1A 1BXGA 1PWXA 1S01A 3AKEA 3SY8A 3A9UA 4C14A 3D4PA 3RFTA 3C3YA 4ZFNA 1KHTA 1JKIA 3NUQA 4J43A 4CIAA 3GEMA 4GECA 5KVQA 3T0FA 2ET6A 2D7HA 2FMKA 2FR8A 1UPFA 4OATA 3PJRA 3KPYA 4UVGA 5FB3A 4JP1A 4AMVA 1GGMA 2VDBB 2ZZKA 2Y8EA 4CV3A 2OFFA 3T3PB 2HXSA 4CU5A 2PYZA 5A71A 3TOCA 1GKYA 1IY8A 4OXRA 4XWKA 2VTBB 4IBGA 4BNTA 1HT1E 1M0SA 2CMKA 1Z7WA 4HNQA 3UIEA 2I3GA 4AQDA 4TSFA 2RHMA 3IMFA 4DR5M 1WY5A 1GUAA 5CIQA 3ZS8A 1QU3A 1F6BA 1L2CA 1GNPA 2JFUA 3B7PA 1YB5A 2Q29A 1G3RA 1ZNYA 4J0KA 1QGOA 1LBQA 4PCUA 1XD9A 2JJ1D 5EPEA 2VQ3A 1F17A 2XRYA 2XIJA 4FW9A 1VKRA 3ANNA 3D6HA 4V24A 3HABA 3MWYW 4HDSB 2QN3A 4BVBA 1MG0A 2O8CB 4LNHA 4BQRA 3DQPA 3IE2A 2L4EA 1Y3BE 3O8QB 2O2XA 3PTZA 2R2GA 2AN9A 4QGAA 4Z9BA 3WL7A 1VDLA 2CJFA 4NCIA 2C8LA 4I66A 5E9JA 3N8HA 5JPCA 1FRQA 1DAPA 4AF6A 3KOYA 1E7MA 1Z37A 2R1TB 2HPAA 3PA8A 4MCAA 4I5EA 4YVFA 2ZTHA 3W9SA 2PJRA 5ALTA 2HMTA 4S0XA 4EOGA 2IIPA 2Y9PB 4V0KA 4GP9A 4UUQA 5J5CA 1KY4A 4NBRA 1CYDA 3WRXA 2BKLA 3ZHCA 3QEAZ 5KVAA 4ND5A 3AHDA 3B38A 5HS4A 3NGMA 1CDDA 3CUSA 3AI1A 3HMKA 4GPZA 2P62A 4RJ2A 3DV2A 2W6PA 2V7BA 2DOKA 2VJPA 4Y6QA 4CL0A 2P2LA 3IT3A 3PFWO 4AKIA 4JITA 1KIMA 5D5QA 3C5VA 1GKLA 3T7TA 1O96B 4M6WA 1RZRD 5EKXA 1P1RA 1Z5CA 4LRSA 3GR6A 5GJVC 1CG6A 3EGXA 4Q9DA 3VVCA 1WIVA 2NU8A 4Z3OA 3DL0A 1U2TA 4NXMM 1QIIA 3OLXA 3D1VA 2G82A 4LYAA 1C8KA 3HR4A 1PHPA 3I3OA 2I54A 3PHCA 1TUGA 3BBPA 4TVKA 3U3JA 4BRSA 3H11A 1XQYA 5GOZA 1QPGA 2AXQA 3L1KA 4EKYA 1B8UA 2XJ9A 2XGMA 4U2KA 1QYIA 3RASA 2ECKA 4CIVA 4U7PB 2C7RA 1CQJA 3S28A 2CHFA 1YDFA 1NJ8A 3I2FA 2DE0X 4M0UA 3CF4A 1B2RA 2BP7A 1XZMA 2ZWVA 3M1YA 3D8HA 4QHTA 1E2BA 4G0QA 2O8NA 5JZSA 2OO7A 3R20A 2BEJA 4HVLA 3ZD8A 4LBVA 4XYEA 3ETGA 3HUDA 1I7DA 4DF3A 1R00A 1DBPA 4JP3A 4U5QA 3RS2A 2WB4A 4P33A 1O77A 4MIEA 4J1TC 4EFNA 2V0NA 4OQNA 5EHIA 4GMGA 1DDIA 2AFVA 3FGZA 4IICA 3THXB 4B0PA 4NRWA 1Q1ZA 1Y6QA 5JYBA 1D9XA 3T9FA 1TMGE 3U3ZA 4C88A 3AXSA 2LBCA 4NU6A 4EG1A 1YZQA 1B3RA 4I4TB 1GPNA 3DHVA 4YJ2F 4EG3A 2ISCA 4RWEA 5CHEA 1KMQA 4M36A 1V6AA 3JCZA 5FNVF 1Q0PA 2O8DA 5JCJD 2WWXA 2O54A 2H59A 4M1MA 1HDOA 3RS8A 1ZISA 2F43A 3LZCA 1TM7E 5F7XA 4XE5A 5IX8A 3CT4A 3W4KA 2KEBA 4E12A 3L4JA 2DVWB 2IF0A 5KNCH 1M1ZA 3EXIB 1FMLA 2XD9A 2XXJA 4OGFA 1P2BA 3D0RA 1D2HA 1QLJA 1C4KA 1G7RA 3COZA 3MMNA 3O26A 2QENA 1GXSB 3I4FA 4N0PA 5E6UA 1A8IA 4AG3A 3KU4A 4WOBA 4ZYWA 4ZT6A 1F1BA 3PSHA 4TLDA 4F5WA 2CL0X 3AEQB 4DG8A 2RD2A 4YV1A 5H9WA 1DO0A 1WVIA 1J1IA 1ZWLA 4BNHA 1JJVA 4I2NA 2BSXA 4KE6A 3ZWAA 3RROA 4L6AA 1GDHA 1T29A 5T41A 2F17A 1J2TA 4M1KA 3GC6A 1V37A 1A9XB 3J2PB 1KRHA 2AJLI 3K8YA 1STOA 4CT0A 1QF6A 4R2KA 2N1MA 1F1JA 3B6ZA 5FCDA 4IHAA 3VJLA 1UFQA 3JAKB 3LUFA 1QG4A 1OIVA 1U2SA 2N75A 3GH1A 1N2GA 4A26A 4BX2A 2F7SA 4D46A 5J4YA 4E21A 3EZ2A 1VFNA 2JGFA 2GPNA 2UDPA 3BS4A 4H15A 1RQ2A 4HX2A 1UKCA 1YLAA 2GN4A 1RJDA 3OTHA 4L1KA 4LCJA 3EIXA 3Q3HA 4KO2S 4PBSA 5TQ0B 4DLKA 5TPWB 1QHGA 5KQLA 5DTMA 3KZCA 3ZWCA 4G5HA 4A27A 3ESRA 3B12A 4RSMA 6NULA 3DAOA 1AKTA 2I67A 4U9IS 2DUWA 4NEGA 1GA6A 1ZIDA 1QFYA 3H1FA 1LNZA 2QHXA 2ZAGA 5GWXA 1IATA 2BEUA 1GV0A 1XMIA 3GHHA 4F4UA 2PWZA 1DAOA 2WE8A 1S9HA 4W8GA 2F4VB 1ARZA 5L7WA 3THWA 1T6YA 3A9SA 3LGSA 2QA5A 1I7LA 4M0CA 5HK8A 4ESHA 1GZHB 1J9GA 1V41E 5FTMA 1FY2A 1E3LA 4IQ4A 2CXXA 4HUQB 4ZQIA 4WESA 1UBLS 1YL5A 3NLLA 4IP0A 4B6RA 2ZIZA 3NDIA 5EMJA 2FN8A 4ND2A 4I5GA 3L1HA 3ORFA 3SJ7A 3UMYA 3DGEC 3SYKA 4EB0A 4LE1A 8CATA 1Z3CA 1J33A