1IM2A

Hslu, haemophilus influenzae, selenomethionine variant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
443
structure length
346
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone
total genus 99
structure length 346
sequence length 443
ec nomenclature
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1im2A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1im2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1im2A01
4NDZA 3AUYA 4C9BA 2GBLC 2GXSA 1W4AA 1Z07A 1W0KA 2V6IA 4NH0A 1SVSA 2BWJA 1QZMA 4Q01A 1KDOA 4C0SA 2CMKA 5E7JA 2C96A 2C03A 1VYTA 1RRCA 2BV3A 2G6BA 2DWQA 2OBMA 2YJTD 1Z0IA 1E1QA 3DKVA 4ZCIA 3H1TA 4KJZA 4HB3A 2GZAA 2X1VA 3RSOA 4EPTA 3RABA 2B7BA 2XOKA 4DCUA 1US8B 4YC7A 1JJVA 3HP1A 2DFTA 4CEIB 5C46F 4E09A 2QSZA 4DXAA 4HLQB 3KDSE 2EFEB 3EIHA 2WWFA 3QKRA 5GJWC 3HJNA 2R6FA 4URUR 2PL3A 1RJ9A 3KW6A 1G19A 1H65A 2L0XA 4B75A 3AEZA 3ICEA 4IKEA 3PR1A 4QJ4A 1M8PA 2WJJA 3N2EA 1OFHA 5CYPA 2ZSFA 4LJ8A 5JCZA 1Q21A 1KDRA 2WWIA 4LBZA 2GF9A 1D8TA 3ZQJA 1SULA 4TMZA 3E2IA 4B3XA 4QBGB 1N0VC 4XOIA 1YRAA 2A5FA 3GLIE 4RZUA 4Z1MA 1UAAA 1U9IA 2CLDX 3K0FB 3LAWA 4HUQA 1CJVC 2IYUA 1ZNYA 4PC3A 1OIVA 4IHQA 1W5SA 4WW0A 1E9FA 3IQXA 3LV8A 1OE0A 2WSSA 4PPFA 4URYR 2OO7A 3QBVA 5BN4A 1QHYA 3NHAA 1PV4A 3TR5A 1P61B 1Z06A 1IAQA 2A2ZA 1OIXA 4MITA 5CLLA 1OB5A 5EXXA 3ZZTA 5JWRA 3ZDQA 1E9EA 3FFAA 3QG5A 3A1VA 4Q7LA 1NY6A 3NC1C 2J7PD 4QGGA 4WBSA 1QDEA 2Q0HA 3OEHD 1E0AA 3BIFA 4WZ6A 4QM7A 1KK3A 4ON9A 4IVRA 3LQQA 5JRJA 1P6XA 1X8JA 1A7JA 4ILEA 4WP2A 2KB0A 3RS0A 1T5IA 3AVYA 3KB1A 5L3RA 3FMOB 4DLVA 2YC2C 2PMDA 4NCIA 3NH9A 5HR5A 2J0UB 1COWD 1GDDA 2FMXA 1Z47A 2VQSA 1PJRA 2PZGA 4C0AC 3PVSA 1A2KC 4DIDA 3OF5A 3LFUA 3EIQA 1E99A 4TL8A 2A5DA 1NIJA 3EC1A 1OJLA 1EG7A 1WCV1 2OFXA 4DJTA 5JMTA 2OILA 3Q5EA 4GI7A 1WHCA 1TL7C 4TT3A 3VU9B 2XXAA 3T1TA 1FPMA 3OEEA 4OK5A 2HEIA 1A5TA 3ZH9B 2GWHA 4N1AA 3R7WA 2NTYC 1LV7A 3AKCA 2I3BA 3ZGXA 2IYQA 1RW4A 2VHQA 1KY3A 2OCAA 4WOPA 2J1LA 4DDVA 2MMGA 4PC6A 3H4MA 1KI6B 2VP9A 2FSFA 1GNRA 2I1VB 4YMVA 1JAIA 2REXB 1ZM3A 1YZQA 1E32A 2X2EA 2QAGB 2ZJ8A 5L8VA 5JECA 2IBMA 3NIBA 4D25A 1YZKA 1XJQA 4PC7A 1MR3F 5DISB 1A2BA 5E7IA 3DOEA 1X37A 1QF9A 2PEZA 1KI2A 1NMXA 2WMNB 5FUXA 3P26A 1OKKA 1K5DA 2EFHB 3CO5A 2HCJB 2AWNA 3L0SA 5J4HA 4B44A 1QG4A 1ZM9A 1XRJA 4D6PA 2J0SA 3K09A 1G8HA 1QHNA 2GEVA 2CLCX 3Q7PA 1UKZA 2FX3A 4JLVA 3T6PA 4DLXA 5JS7A 3CKLA 2PCJA 3EAQA 4JLNA 5HE9A 1T4GA 1YRBA 5JEDA 2CXXA 5JSZB 4EPRA 4DVGA 3TH5A 1SQ5A 1W1WA 1Z28A 1AQYA 1BYIA 1Z22A 2WIAA 2ZRLA 2R6CA 3HR8A 5CJPA 2HAKA 2QPAA 1VTKA 1G1MA 1GKUB 4FN5A 5FOTA 3WMFA 3ND8A 5KUTA 2ZI7A 1GNQA 5TXGA 4W5JA 3NEYA 5FL7A 2OO9A 1SKYB 2QROA 1J8YF 4Q4HB 4YXWD 5F98A 2ZI3A 4YLGA 3ZZ0A 5F3WB 4U7DA 1IONA 1CR2A 1FUUA 3KKOA 2IEZA 1UFQA 5B58C 3KUCA 4CEIA 3TW8B 4B76A 4FMDF 3SHFA 5FTJA 3GLFB 2GEDA 5DLQC 4AKHA 4L4UA 1YZGA 1E2IA 2JATA 3X1WA 4XSHA 2HWJA 4GP6A 4KYUA 1NN1A 1GNPA 4PXAA 4Q1FA 3SZRA 4CW7A 2RAPA 1S1MA 4II7A 4Q47A 1XEFA 3OAAA 4MYCA 5FBQB 3EC2A 1OIWA 4UNSA 3VNUA 5C4GB 2CHVA 1OAIA 1S8FA 3K53A 3QXHA 2JJ8A 5DGXA 1ZJ6A 1E4YA 2NO7A 1FP7A 1YZUA 2ZROA 4Q7JB 2DAGA 4TMVA 4UXHA 1YLAA 3RVBA 2RCNA 1XDBA 3AVTA 4PO9A 3K0FA 3P27A 5JHHB 3BC1A 4JVNA 1XZPA 2PEYA 4MKGA 4U02A 2EWVA 4GNKA 2GCNA 3CX7A 2A9KA 3M6AA 1KOFA 4GITA 1A4RA 2ZRGA 3IHPA 3UWKA 1SXJC 1N6PA 5KDLA 4XSGA 1PUJA 1SKQA 1P2VA 4BEJA 4Q9JA 2WMOB 2VPPA 3SU8A 2NZ8A 1R7RA 4TSFD 3MLEA 2MROB 2VF7A 3DHWC 4D26A 3Q72A 5FTNA 2B3TA 2G1JA 2RKOA 4TYNA 5FBLB 1GTVA 3UMSA 2WJIA 1OKSA 2AN9A 4B43A 5TY0A 1WIVA 1XD2B 1WR1B 3LRPA 4OHWA 4QHSA 3OIYA 4ZI2A 2ZRDA 5KNBA 2V54A 4A4DA 3A1TA 3B5JA 1E0JA 1GOTA 3DOFA 3DL0A 3X1XA 4ASUD 3FDIA 5IK2A 1NL3A 1W5TA 2FJUA 1BMFA 3G5UA 3JZAA 1W49A 2J0UA 3N2IA 4V02A 3T34A 1P7CA 4DCTA 1MABB 2ONKA 4PTLA 1EWRA 4M1TA 4WIAA 1U0HC 3NVAA 1Z0AA 3AM1A 2KJQA 3DM5A 3EIEA 2CJWB 3T5GA 5CK5A 2ZQ5A 1Z29A 4JLJA 1M7BA 2JUJA 4ZCMA 1KSFX 4G5SA 3GJXC 4HB2A 2ZS7A 1K6MA 1ZC3A 1E9RA 4I99A 3SOPA 2OFWA 1ZVQA 3VU9A 4X8LA 4Q48A 1CP2A 3GJ3A 3IEVA 4Q9LA 1G5RA 1GSIA 4A0FA 4NZYA 3B78A 3ZYCA 3IIKA 2QP3A 5GJBA 1XEWY 4JL6A 5FR2A 3TUJC 1KSJA 4CIDA 1IN7A 2V9PA 4PC2A 3RWMB 3GEEA 1W4RA 3K0EA 4OJQA 2ZE6A 4YONB 5B2ZA 1TEXA 1GRRA 2V7QA 4I1UA 5AJYA 1VIAA 3WYAA 3LLMA 2O8CB 2DNAA 2W2XA 2WIBA 2YOGA 2QAGA 4HZUB 5A5GA 3I8SA 3PIRA 1PZNA 3T1VA 4EPXA 4GL2A 1M7GA 1XTIA 3RYTC 1HE8B 1IXRC 4C0QC 3WYGA 4IEIA 3QUSA 3HU3A 1KGDA 2ZRAA 1EFCA 4ZDJA 2O52A 3HDTA 3IEUA 1VEGA 2AWOA 1YE8A 3K70D 2EKKA 4TQ9A 1MRNA 1P2SA 5DHAA 1G3IA 4P4TA 1DS6A 3CWZA 4KBFA 5C4MA 1NVWQ 3NKVA 5DHFA 5EE1A 1N6KA 2CL0X 1DELA 4HAUA 2G9NA 3MGCA 5JSZA 1N6LA 2L2DA 4EAQA 4FMDB 4G01B 1AIPA 3A37A 2C8VA 5LD2B 1KO5A 3LBHA 1YZLA 2P6UA 1HURA 3BAFA 1RFLA 3B1VA 1XJCA 4QHYA 3MWKA 1HH4A 1G3MA 3ADKA 2BMJA 3CX8A 1XNJA 2F55A 4JVLA 1JR3E 2KNAA 2JLSA 4H9GA 4Q4HA 3FMPB 1OPXA 5H1YA 4LYJA 3TSWA 2W0MA 4GMXA 3BOSA 3GEIA 3VTKA 2H17A 1E2GA 2CBZA 2KNZA 3GLFA 2REOA 3CNNA 3B82A 3FHOA 2ZAOA 3CPEA 4DLYA 1KDTA 1CJMA 2R65A 4OQLA 1IN4A 2V8OA 5FFMA 5HCNA 2ZAMA 4HATA 4M0LA 1C1KA 1NVMA 2A7QA 1RVDA 4E22A 1J90A 4DRZA 3QKSB 3KJHA 5A4JA 2RMKA 2PH1A 4IDPA 1YJ5A 3GP8A 1ZCBA 3K9NA 4WXPA 1CS4C 2GBLA 4KSCA 1OXUA 4Q7JA 2QN6A 2RGCA 3GFOA 4Q1AA 1FMLA 1PLJA 3VX3A 5EE0A 2PMKA 1P2UA 3Q5DA 1GFIA 3SYLA 1W7AA 3AP2A 4MKIA 4C4PA 1XCGB 2BOVA 3B1XA 4KBGA 3CR8A 4LSGA 3TW4A 1CJTC 1R0XA 3C7KA 4X8HA 4M9XA 2XTNA 4JLAA 5G53C 3EPJA 4R2IA 1WB9A 1YR7A 2XB2A 1YU9A 3I1FA 4OHYA 1N0UA 3AF1A 2ZRNA 4MKFA 4PZLA 4US1R 2JDIA 5J40A 1XTJA 2VO1A 5FH9A 5CDFA 4HUTA 1QBKC 3O8RA 4V03A 1ZAKA 4FMCF 3AVQA 1TNDA 5JZVA 1XD2A 2IYZA 2G88A 2WKQA 4M1YA 5M04A 1ETUA 4L5BA 2PX3A 1MT0A 3TQFA 5KOYA 2PT5A 4ZKEA 3FRIA 2ZYTX 4Y0VA 4A8JC 1ZC4A 2XNSA 3RHFA 3SFZA 4A6PA 4EDHA 4BLQA 5AJWA 2QA5A 2DBYA 1R4AA 4ESVA 3PUVA 5JHGB 2L4FA 4PO8A 4X8MA 4BUJA 1KJWA 1MABA 1N5JA 3CUEF 1NNEA 2FPMA 4B3FX 4LC1A 3U44B 1QG2A 2CJWA 1CJUC 2JJ2A 1BH2A 3GD7A 4HB4A 5DN6A 1JXOA 3RWOA 2ZJAA 2FSHA 1OHHA 4L9SA 3C8UA 3SNHA 2HUPA 3ZIAD 4F4CA 4UJ3A 4D0NA 4ZDWA 2AXNA 4V0KA 3ADDA 1SXJB 3U60B 2YZ2A 2VHUA 4TTRA 4UQOA 1QVRA 3C41J 1P9RA 5D3MB 2DWZB 1W48A 2YC4C 3SFVA 4I1SA 1BKDR 1XEWX 1CULC 5UKDA 1SVWA 2BC9A 2GDJA 2B8TA 4PQRA 5GJCA 4PHTA 2R62A 3UG6A 1WBDA 4OI2A 2OCBA 3FFBA 4DKXA 4DDWA 4LJ6A 3BXZA 3UKDA 2VP5A 3DPUA 1T3LA 3THWB 3AH8A 2O8CA 2VHTA 3AKDA 3KXLA 1Z2AA 5HKKA 4GOXA 1T0JB 2ZSEA 4NCHA 2IA5A 4HZUA 1ZMXA 2OEPA 3A1UA 4DUGA 1L7VC 2GJKA 2DI0A 2Z43A 3T5DA 1KZ7B 2XSZA 5GVRA 2QNJA 4B33A 3P4YA 4QXAA 3O8CA 3CWQA 2VHCA 4IVPA 4NONA 1Z6AA 2PJRA 2BVNA 1N3BA 1JI0A 2IXGA 2GZHA 4JZKA 4FCTA 1AS2A 5HZHA 1BIFA 2XTZA 3TQCA 1IQPA 1FX0B 2BJWA 1P72A 1W0JA 2QTHA 2FU5C 1SHZA 1ZUIA 4OI1A 1KI7A 3EXAA 3SS8A 4HZIA 3SBDA 4A2PA 3V4RA 1Q57A 2C99A 3HPQA 1RKBA 2IUUA 4CT4B 3K70C 2V6ZM 2GEUA 2RGAA 2GCOB 4U5XA 1YKSA 2W2VA 1ZNZA 4LRTA 1JNYA 4AYWA 3I92A 3RRZA 2NQ2C 1ZM7A 1R5NA 4C0HA 4IW3B 1CR1A 2PT7A 5SZJA 1GAJA 3BH6A 4G5RA 1KI8A 4KXFB 2HV8A 4TQAA 4BLSA 4MYHA 2BJVA 2ECKA 1Z0JA 2VP2A 2KHHA 2ZU6A 4P32A 2AFIE 4OK3A 3RS4A 4GPTA 3J81k 3THXB 3UATA 4XVQA 4R98A 4NPHA 3QPWA 3QKSA 1GG2A 1NKSA 3F5FA 1A82A 4J0QA 3BK7A 2JIZD 1CXZA 2ZUDA 1KNXA 3D8BA 1G3RA 1N5KA 5CJ2A 2WPDA 2NPFA 1EFRD 1NIPA 2C5LA 1TADA 3ZD6A 3AF0A 4UJ5A 1OSNA 3WNCA 4HB0A 1PGYA 4C3ZA 1XEXB 1PVOA 4TLBA 3P4XA 1NP6A 3KTAB 2GK7A 2ZI9A 2FNAA 5F9FA 3U7FB 1G6OA 1H8ED 4MGYR 3VR4A 2KBEA 3CF6R 3MMPA 2GVZC 3S1AB 3V00A 4TMKA 1D5CA 3KKNA 3T35A 1IY2A 3FE3A 1RRGA 5DFLA 4BPBA 2ZYVX 2YKGA 1D2MA 3UXMA 1IN6A 5KDDA 1JALA 4HLUC 1GL7A 5DE3A 3NTUA 1VEKA 1A1VA 5F2EA 3BB1A 3GLGB 3K9HA 3SQXA 1WP9A 5DI3B 1VDZA 4UXIA 4YDSA 2A78A 1VPLA 2ZSAA 4KLNA 2NZJA 2W6IA 2VL7A 4GOJA 3FRHA 4R2HA 4OJKA 2QSFX 3BBZA 3GJ4A 1U98A 3P1JA 3D3QA 3WBJA 4V0NA 1OFIA 2R0IA 1QVAA 5BQ5A 2W2TA 5C18A 1Z0DA 4JN6A 1X1RA 4QJ5A 3LCUA 4GP7A 2G83A 1GP2A 1EGAA 3VR3A 3LDAA 3D7MA 1DVRA 1DO0A 3H0KA 1QHHB 4C0JA 1II9A 5EZ5A 1RRPA 3LWNA 1NSTA 2XNDD 3U44A 5KO2A 4OI4A 5EXSA 3I5YA 3FE2A 821PA 4RD2A 1GL6A 1NLYA 2WSMA 3TSZA 1SXJA 1T0HB 3RS2A 2N42A 4HYYA 4BLPA 1G5TA 4DT1B 2ZRHA 2ZJ2A 2ASEA 5D3MA 1FOEB 4QFMA 2ANBA 5DIFA 3SJBA 3FWYA 2RGEA 1HQCA 1VCIA 4PHFA 5AUNB 4NCKA 3VR5A 4HEJA 1MOZA 2CCKA 1U8ZA 4DLWA 4F4IA 1DAFA 1R4GA 1VKJA 3THWA 5FUYA 2GAAA 1P2TA 2WBLC 1XTRA 2E9SA 1QZXA 2IYWA 4LHZA 4MRVA 2W6JA 1XTSA 4KAXA 4QRHA 4F38A 4TYYA 4YMUA 1VIYA 3D6TB 1Z0KA 1DBSA 2BWBA 4XWOA 3GJ0A 1XJ0A 3CR7A 4WAUA 3U3JA 2RHMA 2PJZA 3NBFA 2JJ1D 4BFSA 1VG8A 4JBWA 4LX0A 4D4JA 4UNPA 3WYFA 1U94A 3CPJB 1LNZA 5A0FA 3SJCA 1OQYA 1FX0A 2Q9CA 4FINA 2EFDB 4O25A 2CE7A 1G17A 5KSOA 3R9XA 4UXJA 3CPHA 2Z4RA 1UKYA 3CZPA 3KFVA 2IW3A 3U3MA 2QEQA 2QTFA 4L9WA 4XIGS 2FGJA 1KTVA 3BB3A 3OE7A 4KLZA 3EPHA 4PAMA 3GLIB 2F43B 4IFBA 2BBOA 1EX7A 4LV5B 4KV9A 3CH4B 2GCOA 4M9SA 4FMBB 1NBMD 3UWOA 5EP4A 1OFTA 2DPXA 3R9WA 3K9LA 4HAZA 3C5CA 1XMIA 2IWRA 1NVVQ 3PXGA 1LW7A 4URVR 3DM9B 1QHXA 2RB4A 1Q1BA 4ZO4A 4M4SA 3LX5A 5E95A 3KB2A 3QNUA 1MKYA 1P73A 2KNVA 3O8BA 2FE4A 1FZQA 2GVDC 5BYKA 3THXA 3KQKA 5TV2A 3R8FA 1B0UA 2J7KA 2GETA 2QP4A 2ZI4A 3NHBA 2MSDB 2EFGA 1ESMA 1M2OB 4OQMA 1W46A 2GXQA 2HJVA 4LRWA 4XD7A 5D3QA 1HA3A 1TU4A 4B2LA 2WKPA 3K9OA 4A9AA 3VKHA 1GIAA 4QNMA 3AGPA 4IRUB 4NTZA 2DZOB 1XEXA 3KTAA 1SHKA 3EZ9A 1O87A 3DO6A 3UMFA 2BKUA 2VSFA 1W36D 1P4SA 5LBIA 2ZYUX 2G3YA 2Z4SA 2GKSA 4MGKR 4I81A 1D9XA 1R10A 1EFTA 2NIPA 3S1AA 1Z08A 4IOKA 3NC0C 5ANRB 2IHYA 1U2RA 4FIDA 1NN5A 3Q7QA 3AP3A 4QHTA 4BLTA 2BBSA 4QJ3A 3FKSD 4TYQA 1R0YA 5IDVA 5TVKA 3L0OA 3GLGA 2BKEA 2ZJ5A 4DLZA 5DI3A 1IBRA 5F9HA 1WXQA 3I73A 4MRRA 1FW6A 3T15A 5JJKA 3SR0A 3HR7A 1NN0A 3AGQA 4Q1BA 4A0RA 3RRNA 3GPLA 2I4IA 2Q9AA 4FWGA 1MO5A 4EQ6B 1DAEA 2P65A 1W4CA 4YXWA 1RIFA 3LNCA 2ZR0A 2FV8A 1TQ6A 4FD2A 4JYCA 4KVAA 4TLEA 2IEYA 3GQBA 5HPYB 2OOAA 1KMQA 1ZW6A 3THOA 1QHHA 3RC3A 3RSLA 1E1QD 2DKLA 3TNFA 2UVQA 2J46A 1KNQA 3KFXA 2PX0A 4GBMA 3I62A 1KO8A 1P3QQ 3UG7A 1WJ7A 2OE2A 2XOKD 3L43A 2H8KA 1MO3A 2VF8A 1KAOA 5H8WA 4WZAE 2XEXA 2H18A 2CK3A 5DI9A 3FB4A 2HF9A 4DT1A 1NI3A 2EYUA 3F3YA 2C95A 3MCAA 1CUKA 2ZS8A 3UPUA 3M0EA 3KKPA 4OHVA 1JQJC 1TPZA 4NYJR 1Z2CA 2D74A 2FFBA 1U8YA 2X77A 4LJYA 1UEJA 2QZ4A 2FEMA 2WAYA 3MFYA 1ZD8A 3A36A 3THYB 1T6NA 2DWOA 2MGWA 4RZ3A 4TSFA 4LY6A 4Q9HA 4Q7KA 5E4FA 4ACBA 1G20E 3AKYA 1TX4B 2ZRCA 1DTSA 5AWFC 5J4VA 2OUKA 4LRSA 1SGWA 1T5LA 2JASA 2PBRA 3QPVA 3IIMA 1L2TA 1E6CA 2H16A 1OLOA 3AVVA 2WSSD 4ZI3A 1P3JA 5FPTA 4OBEA 3GLHE 2VHJA 1LS1A 2FOLA 4C30A 2CHQA 3PEUA 1L4YA 1J2JA 3CBQA 5K8IA 1HE1C 4OL0A 4QC2A 3TJZA 2XZPA 1MN3A 1Q3TA 2C9CA 4GZMA 4HDQB 4JBYA 4LI0A 5HTKA 4NYIR 2ZSBA 2JLWA 2D06A 5FOXA 4NHOA 1DAMA 1UM8A 1IXSB 3GLIA 1OXSC 1XCMA 1IN8A 2F43A 2QQ0A 5IHPA 3WHLA 4RSGA 2QMOA 1OT3A 1ZU5A 3KXIA 3QY0A 1F4IA 4EUNA 1XX6A 2PCLA 3EPKA 3PUXA 1OB2A 1XWIA 2RH5A 3I32A 5EZ6B 4BQSA 4TZ0A 1GKYA 4NBSA 1EFHA 2JY5A 3VR1A 4FWIB 4JT4A 4RZXA 1T9HA 1F2TB 4NP6A 1X8KA 3NBZC 4Q7MB 4IOMA 3DZDA 1TTEA 3LXXA 2LVQD 5AJVB 3B1ZA 1AGRA 1JECA 2BEJA 2CCGA 1GO5A 4TT3D 2JY7A 1IN5A 2O25A 2HLDD 3TK1A 1NRJB 2NO0A 3EWAA 4JLOA 3WRXC 4DLRA 1VMAA 1DPFA 1WRBA 3AF4A 2DFLA 1LVGA 2BDTA 3PUZA 3GMTA 3BFXA 3CRW1 4MRNA 1YVDA 5LB2A 1T8TA 4LCBA 2IXEA 1G7RA 1X6VA 4RKFA 1UEIA 2BBTA 2J5XA 2WM9B 4LHWA 1ZINA 1D2EA 3A4MA 2O0HA 4M1WA 4ZCLA 4CT5A 5BW8A 2FF7A 4JLDA 3ZS8A 4DDTA 3M1IA 4D4MA 3AVXA 2ORIA 3E70C 2FEOA 2OXCA 3FHTA 4B35A 2ZXUA 4M9ZA 1RPZA 1CLUA 1TMKA 2QUZA 3H2YA 4BRUA 2P5SA 3CRRA 5FR1A 3ZVNA 4CEHB 1FTNA 1G18A 2DFNA 1OKKD 1Z5ZA 5E3HA 2NO9A 3DVLA 2YWGA 4M8NE 4DDUA 1KI3A 4PHGA 1MV5A 5AUPB 2WVJA 5FPYA 4V0OA 1FL9A 4EJSC 1NY5A 4DEYA 5JFGA 1Y63A 1JQLB 1KI4A 1S4QA 1X86B 2AL7A 2MSEB 1VG9B 2NO1A 2QY9A 1NN3A 4IOLA 4LYAA 3REGA 2A3RA 1YZNA 4YDHB 3ADBA 1LY1A 4LJ7A 1ZD1A 5JJIA 1CEEA 1DAHA 2HDNB 2JLRA 1KMHB 4TZ6A 4FWDA 1R5OA 2PLFA 3K0CC 2EKFA 5FBRB 1OH8A 3SQWA 2QTVB 2RGNC 2AKAB 4A6XA 3K0AB 5EP1A 3A8TA 1CF4A 3BFVA 4Q4AB 5JWHA 1ZM2A 4R71A 4PPGA 4B74A 2GJ9A 3ONWA 2EQBA 3F92A 5FL7D 1F5NA 2OBNA 4FCVA 1ZUNB 1GUAA 1FNMA 4LOAA 3KX2A 4B32A 2GXUA 3CNLA 1GRNA 3U6BA 2VSXA 1IXZA 2PZFA 4KSBA 4GOKA 3TVTA 1HTWA 4JS0A 2WJVA 4HLUA 4QM6A 3IO3A 4DZZA 1RZ3A 1C7YA 2FSIA 1JEEA 4AG5A 2YWHA 1NMZA 4B48A 2AK2A 1AK2A 1ESNA 1ZUHA 2QU8A 3OAAD 4QG7A 1AJEA 3MJRA 1VG1A 1NV9A 5G3YA 4AWXA 3W5JA 1DADA 3LXRA 1OV4A 2O8DB 1ELOA 4UNNA 4K46A 3THYA 2JEOA 1C9KA 4YQFA 2BMFA 1NJGA 2XZLA 4IDHA 5EP3A 2FWRA 4AC9A 4UN2B 2WZJA 1UBCA 3K9GA 2OESA 2UZIR 5L3VA 2ZRFA 1ZM4A 2IYSA 1OW3B 3C15C 4IXNA 2EYQA 4A0HA 4B47A 4OHZA 5LPNA 1TTTA 2P6NA 2Q3FA 3BE4A 2HYIC 1B23P 2TMKA 4FWHA 1H8HA 1E2NA 1JJ7A 1U9IC 4MRSA 4PSVA 1VHLA 1XPOA 4A36A 4IJMA 3SI7A 3KZ1E 1BS1A 3H86A 3ZD7A 2ZE8A 1GVNB 2XAUA 2GRJA 3W6PA 3X2SA 2WJHA 1XB2B 1IXSA 721PA 4CGZA 3F0TA 1G41A 1FNNA 2LTUA 4URZR 4G3XA 2CEAA 5FOWA 5ELXA 1XXHE 3RS7A 1KK2A 2VP6A 5IK2D 4JLBA 3ZVMA 4DB4A 1BMFD 1W2HA 3QENA 1DO2A 4DSTA 4LJ9A 4TQUS 2JLQA 3BGWA 1F2TA 3ADCA 2QP9X 2G0TA 3GJ6A 4KFRA 4IDQA 1E2HA 4LHVA 3ZLJA 3PJRA 4BFXA 4ITRC 4GEWA 4RD3A 5CLQA 4BEBA 4MQBA 4NYJQ 4Q03A 4IXMA 1G3QA 2ZRIA 2EVWX 1DAKA 4OHXA 1Y8GA 2ONJA 1RC8A 3O47A 4HLDA 5CIQA 3LD9A 4DBGB 4QBHA 2NMVA 3AV0B 1BOFA 2F3RA 2EWWA 2ZRBA 2CL6X 2A5JA 1AZSC 3IQWA 2XITA 4ZPXA 5HE8A 2F9LA 4NYMR 3H4JA 4HLCA 3SDZA 1OH7A 1SVOA 5KSYA 3VFDA 2Z6VA 2GJ8A 3KKQA 1KKMA 4LC0A 3NXSA 3AB3A 3PENA 1IY0A 1S3GA 2RGDA 3MD0A 4ZKDA 5JWOA 4LWZA 4DLTA 4JMPA 2J59A 2LWIA 1S9HA 3GJ5A 2BM1A 4KODA 1VCMA 3T12A 1HJPA 1DAIA 1OXVA 1J7KA 4CEHA 2H57A 1ZP6A 3I5XA 4KCGA 4AKGA 2ODEA 2VA8A 5DYGA 3IHWA 521PA 3EPLA 2QG6A 1WE2A 2W00A 1UADA 2G77B 2ERXA 4W5WA 4V0ME 3RS5A 3VR2A 2WZQA 2HT6A 1YZTA 3PEVA 4JL5A 4DSNA 2VEDA 1KMHA 4Z8YA 4M1MA 5TMPA 1GM5A 3VKWA 1P9WA 2ERYA 4C0KA 1TQ2A 1XF9A 4D2IA 4PC1A 3K0AA 3EA0A 2WWWA 3HYTA 3K09C 4Q4AA 2IS6A 2OCPA 4KHZA 4AYXA 1NBME 2WHXA 3RRYA 2ZR9A 2JIZA 3VR6A 3AVOA 3QXSA 3E5HA 3B85A 2IYYA 3QSYA 3V4FA 3BJIC 1DAGA 3W8NA 4EPVA 4D0LB 3T1QA 3FYHA 1E2QA 2OM2A 4B73A 2NGRA 2GCPA 5AJXA 1W2GA 3ZVRA 1VHTA 3CLVA 1G5PA 1Q12A 1GZSA 2NOAA 4P31A 3K8YA 1T43A 3MG9A 2IUTA 4DCNA 2ZITA 4RD1A 4C0LA 4HI0E 4TWZA 1I4TD 1X1SA 2IF2A 3CW2A 2AKYA 1IY1A 2O8DA 2YOFA 4RY2A 2O8BB 2CNWA 4QNRA 4EPWA 2RGGA 3IKJA 5SZIA 1R6BX 1JR3A 1OXTA 3QJYA 3CONA 1UBGA 1ANKA 2K0BX 2BMDA 3OIVA 4DWJA 4TN1A 2CE2X 3C5HA 4E03A 1XMJA 1JB1A 5EXPA 1KY2A 3WXMA 5H68A 4KFTA 3WBKA 1Z8FA 4LGMA 2R44A 3TLXA 3A1WA 3C16C 4K8OA 3B13B 3SN6A 4A0GA 4MYUA 1QHSA 1E94E 1TF2A 3SE0A 4AG6A 1T3SA 3LA6A 1SVKA 2NPIA 2GILA 2D2FA 2QHOB 2QI9C 2CLSA 5FTKA 1KSHA 3JZMA 4HAXA 2IYTA 3CM0A 3JVUA 2JDID 4XVUA 1Q1QA 1R8SA 2DVWB 2AK3A 2C9OA 1XB2A 3I61A 1II0A 2XNDA 3VHXA 3REFA 8OHMA 2IWHA 2LKDA 4HDCA 3EA5A 1KO7A 1TUEA 3KJGA 5KYKA 1EFUB 2Z0MA 3ZJYA 5CIWA 1HUQA 2VP4A 2YWEA 2HCBA 1IHUA 2QE7A 4HDOB 5CB8A 5AUQA 2SHKA 5IT5A 1QHGA 4NL4H 3B9QA 1Q3HA 1XMVA 2GXAA 4EIWA 5TDHA 2V4ZA 2JY8A 3KUDA 1PLLA 3MJHA 2VIIA 4MDFA 1P62B 2FZLA 1OHHD 4S35A 1AKYA 4PAQA 3QEOA 2OG2A 4G1UC 1L4UA 3RAPR 1E1RA 3I72A 4EFNA 2OOBA 1XP8A 4I4LA 1G7SA 1R2QA 2FGKA 2Q9BA 2XX3A 1RYFA 3FTQA 3Q9LA 2DHYA 5J5CA 3ZVLA 3W9YA 2BCJQ 2ZI6A 3N5CA 1ZMWA 1UDWA 1IM2A 3PCRB 4BFZA 3W8RA 1CRPA 5FOSA 3PFIA 1SVLA 1G64A 1R8QA 4DSOA 4AYTA 2WWGA 1SVIA 2OV2A 6Q21A 4A3VB 3X1DA 1U90A 4D4LA 4POAA 2P0EA 1M6NA 3CNOA 4LPSA 2OHFA 2HT1A 1NLFA 3MWJA 4PX9A 1VEJA 3A6PC 2ZUCA 2FA9A 3EZ2A 4US2R 5HKKD 1OH6A 1N6NA 4DUGD 1Q22A 3AQ4A 3FMIA 2XZOA 3AJIB 2XSZD 3FGNA 4Q19A 2VTKA 2W83A 4RD6A 1G8YA 3BWDD 4PZZA 3NDBB 1E79D 4Q4LA 2GNOA 4ARZB 2D7DA 1TF7A 3MWYW 2DHRA 1NKTA 2IC5A 4KU4A 2ZU0C 4JJKA 5H70A 5DSZA 1W4BA 5AUOB 2YVUA 1J99A 4OKSA 2WKRA 1S9DA 4FCWA 1W0JD 2YINC 4XJXA 2O0KA 2P6RA 1HV8A 3KQLA 2IX3A 4LV8B 4Q1DA 1JAHA 4WVFA 2J0QA 2GF0A 2DCUA 3X1YA 2YWFA 3NH6A 2XJ4A 1LS6A 2B8WA 2BCGY 3QPUA 4P4UA 2YHSA 4MUBA 3GJ7A 1CR4A 3VMFA 2IYVA 5DO9A 3O8DA 4E5UA 4N3NA 5JJLA 4FWTA 3LW8A 5GADl 3IHLA 1Q02A 1FFHA 1TR8A 2FFQA 4TLAA 2DZNB 3TIFA 2GJAA 5IRCD 2FSGA 1KIMA 4M1KA 1E2KA 4MGIR 1EX6A 4CRWB 1UBFA 2HYDA 2CHGA 4XWKA 3CX6A 4CF7A 2QGZA 2VP0A 1E2PA 1VYUA 1CJKC 4A8JB 3ICQB 3EASA 5FPKA 3QF7A 1J70A 3TSOA 1XD9A 1M34E 5P21A 3PUWA 4Q9IA 1AKEA 2VH5R 2ZVPX 3FOZA 2J7PA 4NYMQ 3RS3A 4TMWA 3OEHA 2WPDD 2C98A 1E9BA 3W6NA 2O8BA 2IYRA 4OYHA 1N6RA 4YMTA 2ZRPA 4M2LA 2BMEA 2FG5A 1LF5A 4JSYA 3FPAA 3I4LA 2LBCA 1ODFA 3ZZUA 3K0CA 2B6HA 2WAXA 4DC9A 4RD4A 1IOZA 2HJGA 1G8FA 3QVUA 2RGNA 2QMUA 1COWA 1M7HA 1OYWA 4D80A 4N0EA 2QRNA 1QRAA 4ZDIA 2QPTA 3NDPA 2VLIA 4AKIA 1DOAA 2H1LA 3L8ZA 1TQDA 2ATXA 1XPRA 2WJGA 5E7MA 1KO4A 2W6ID 3OFND 4K81B 4D0GA 4WXRA 4TLDA 4GFDA 5BYJA 4RCYA 4GSYA 4H1UA 4PZYA 4S2EA 2KWIA 2ZIAA 1EFUA 1NSFA 1SZPA 2F3TA 2GAOA 4QBFA 3TBKA 2RRUA 4G5GA 4D82A 1VCOA 2CVFA 3MSXA 1XFAA 2FN4A 2QSYA 1FP6A 3L2OB 3CH5A 3OESA 1E2FA 1T3HA 2C2HA 4AY2A 4M9QA 3E21A 1J8MF 1JPNA 4RFVA 5G40A 3LX8A 4BECA 1T91A 3IPXA 2X8AA 4P0TA 4PQYA 1Z3IX 3P20A 3OZXA 3TKLA 4R9UC 4C7OB 1SXJD 2VSOA 3R20A 2GZDA 2ZPTX 1GWNA 4DHEA 3L8YA 2ZUBA 4F1IA 3HU1A 1TEVA 1DEKA 3K70B 3F8TA 4Q1CA 4RCZA 4ZDKA 2R6GA 3C4JA 3U6KA 4W7SA 3B60A 2DWPA 4KYIB 5EE9A 1EXMA 2O0JA 2H5XA 2QGNA 1XZQA 5CM9C 4HAVA 3PITA 1FUKA 5DNYB 3WHKA 1JXMA 2AFHE 2AR7A 1ZBDA 4JYBA 1V92A 2ORWA 2V6JA 4TMTA 3U61B 3MRSA 2F9MA 2NG1A 2AD1A 3HPRA 4EPYA 2G1KA 4GDFA 2Y8EA 2OCYC 4BGDA 3QEJA 4FXPA 1G9XA 2IF0A 3TVDA 3KQHA 2OBLA 4X8OA 3QXJA 5IF9A 2W6JD 2WWHA 2C77A 2G0NA 2QMEA 2EJSA 2BBWA 2FPKA 5B57C 1W0KD 5KNDA 3U5ZB 1WBBA 1TU3A 1ZNWA 5K8TA 2F1RA 4A82A 2ATVA 2LKCA 5KU1A 1CRQA 1F6BA 4ARZA 5FTMA 4MRPA 3B1WA 5CYOA 5FUVA 4B34A 1S0UA 1MO6A 2VYFA 1KK0A 3IBGA 2OXRA 4PSKA 1CBUA 4PPNA 5EUMA 2D4HA 2IXFA 4YMWA 4QKQA 2MR9A 1KI1A 2GTPA 1D9ZA 3BORA 4JVSB 4QGAA 4UNRA 4XTRA 3W3ZB 4FW9A 1BVSA 3IBYA 2QENA 2PLRA 3IGFA 1DG1G 4IFEA 4Q4JB 1VECA 4Q1EA 3OE7D 4KFSA 3A58B 4E07A 4EFMA 5KHOC 3AF3A 2UKDA 4MA4A 4US0R 3DEFA 1YQTA 4Q21A 5B64A 3WMGA 3LY5A 2JP7A 4NKRA 1X8LA 3BERA 2R6DA 4O2LA 2P2LA 5DYIA 3CRMA 4LUCA 2HLDA 4IDNA 5FOVA 121PA 2P5TB 1FQJA 3WP1B 2ANCA 3GLHB 5FBWB 3QIAA 1XTQA 3DKPA 4XH9B 3K9PA 4DBLC 3B2EA 2JGNA 1QHIA 2E1RA 5LD2C 1VG0B 1K5GA 2C04A 3N70A 4TLCA 4AURA 1X3SA 2ODNA 2X2FA 3DMNA 4LYFA 1Q44A 5EE3A 4DB2A 2RGXA 4FI3C 4JLKA 4A8JA 2KI5A 4F4JA 2JLVA 4Z1MD 3T61A 3NBXX 5BN5A 3Q85A 3ZS9A 4LBVA 2KRKA 3MWLA 5CB6A 3ZQ6A 4QOSA 4XD7D 2XTMA 4BFUA 1WGNA 5KNCA 4B3CA 4Q18A 3BB4A 2UZ3A 3W6OA 3JVVA 3TE6A 4OQXA 4B3GA 1AS3A 3WNDA 3CRVA 4A2QA 4Q66C 4TMXA 2CDNA 2KSQA 2GK6A 4JBXA 3U7GA 1I4DD 5JEEA 4C0BA 1VYVA 4ASUA 5LDDC 5JS8A 4RFSB 4ABYA 2FPLA 4DIEA 3PUYA 3LVRE 1N0WA 4TL9A 4JL8A 4CEJB 2H92A 5KDOA 1GL9B 1NVXQ 3IILA 4Y0AA 4BZQA 3NEJA 1UFZA 1AZTA 4XTCS 1P5ZB 3VQTA 4C2TA 4TTQA 4LV6A 4RJLA 3GJ8A 2QT1A 3I8XA 3L0IB 2E87A 4LPKA 2DZLA 1NLZA 3QE0A 1KK1A 1E0SA 2C9YA 1U0LA 5FOUA 2WTUA 3GEHA 4O2RA 3CB4A 1WQ1R 2BEKA 4WA7A 2GHIA 5FL3A 1US8A 1SVMA 3CZQA 1KAGA 2ZSDA 1HEIA 1AA9A 2CCJA 1L8QA 2DY1A 2Q6TA 1FQKA 1E9DA 1R0WA 1N5IA 3OEED 1CU1A 3GFPA 2OSBA 5GJVC 4LHYA 2BWEA 5KTYA 4IDOA 2JAQA 3KL4A 5BN3A 4F92B 4F7WA 1LTQA 4PPQA 4AIIA 1E96A 4IOJA 2XJ9A 4JLMA 3WY9A 4C7OA 3LQRA 1SKYE 2CK3D 2EFCB 5TB5A 4F91B 1W44A 2QBYB 4LYHA 3SJAA 1XD8A 1CR0A 5JCPA 1U81A 1GRQA 3GLFE 3IDQA 4RD0A 1JPJA 3PV0A 3B9PA 4LBWA 2P67A 4MYTA 3WNBA 5JBQA 4U00A 4YMSA 1AN0A 1YR9A 3BH0A 2QAJA 2RHDA 1JR6A 4QL3A 2G3QA 3SHWA 2ODWA 4BFYA 1U99A 2IT1A 4P3YA 4KVGA 1W36C 2LVAA 1KKLA 1TF5A 2V1UA 2J3EA 4MDEA 3KJIA 2FZ4A 3KXKA 2ZJYA 1Q20A 2C78A 4LJ4A 2ZVQX 5B30A 3BS4A 2Q21A 1RYHA 2ZJOA 1T6OA 2VBCA 2HXSA 1N5LA 5KSPA 1OTRA 3FMFA 2R8RA 3MUFA 2Q3MA 3LH5A 2FFAA 5L3QB 3G0HA 1WF3A 1NJFA 2ODBA 3VHLB 1LB1B 1XBTA 4C2UA 2OLKA 5AR1A 3VAAA 3I3SR 5JI2E 1E4VA 2WOJA 3FVQA 5JI3E 1W47A 2J0VA 4JLPA 4Q4JA 4BLOA 5AK0A 3TRFA 3QF4B 3D31A 1KHTA 1OXXK 3W3AA 5CDFE 1E9AA 3UANA 1GITA 5KPJA 1KJYA 4JIMA 3UIEA 1YR8A 1ZD9A 1O3YA 1KDPA 2A5GA 1E2JA 1R5BA 2OFOA 4MGZR 4DSUA 2P3SA 2A5YB 4MKHA 3GLHA 3RRMA 2X19A 3RNLA 2WWYA 4M1OA 3EZ7A 1M1YE 1ZRHA 1QZEA 1LFDB 2R9VA 1EWQA 3VNVA 3UK6A 5C1BA 4M53A 1KSGA 4CDGA 2W58A 3PEWA 4LK2A 4QGFA 2IYLD 3OHMA 5J4KA 4BFWA 1U8AA 4F93B 3AP1A 2LVNC 2AHOA 3BD9A 2ZI5A 1KI6A 4DLUA 4AI6A 3AF2A 3VX4A 3QG1A 2J87A 4BZPA 1G8PA 1EK0A 1E2LA 1XXHB 4KO8A 3M4YA 5JRZA 1AM4D 3U7HB 4W9MC 1LF0A 4B2PA 2IS1A 2QPOA 5G3ZA 4M21A 1F48A 3QXXA 2D7CA 3H84A 2JZ1A 4D81A 3P32A 1E3MA 3U2QA 4PANA 4RVCA 3SC3A 3HYRA 3QBTA 4RFSA 3T1OA 1IJEA 1JEDA 3EARA 3QOFA 2QL6A 1E2MA 4TTPA 3R8CA 3SJZA 4CEJA 2CL7X 1G21E 3QVVA 2XB4A 3LW7A 4A92A 1I2DA 3A4LA 5J4YA 1KYIA 221PA 5L3SB 1NG9A 4MUAA 4H1VA 3ZIAA 2CP8A 5CITA 1DV0A 3TAUA 1E0KA 3LCVB 3U3KA 1GILA 1II8B 3G82C 1CTQA 4BLRA 3W34A 1S2MA 4Z8XA 2XGJA 1E9CA 1FTSA 4LBYA 3E46A 1PUIA 4B3BA 3KKMA 1UF9A 1Z6XA 3UMRA 4OI0A 5J4LA 2H7VA 4BFVA 1SG9A 4A15A 2QNRA 4KITB 3DMDA 2H5EA 1HQYE 4JKIA 2PZEA 1JBKA 2I1QA 1AQUA 2ZJBA 1UBEA 2YOHA 3IO5A 3FKQA 1Z63A 4ERNA 4R7ZA 4D4KA 4EFLA 1UDXA 1XCPA 2DAIA 1N6OA 1UPTA 1BYUA 3AVPA 3IPYA 3AUXA 1F2UB 1G16A 5EUQB 3WRYC 4L15A 5LB4A 3LBNA 2DAMA 1P60A 2J45A 3ECCA 4CZ2A 3TUIC 1R0ZA 1M74A 4O0MA 2F6RA 1T8UA 2V7QD 4ESHA 2QBYA 2WJYA 4GZLA 2VRWA 4LDJA 4PSAA 4Q02A 1FMJA 2DAKA 3WMEA 2F1JA 3L0PA 4BRWA 4HAWA 1ZYUA 4ACAA 1DE0A 3K1JA 3QKTA 1UKEA 3RLFA 2J9RA 2BHRA 2OT3B 621PA 3AKEA 4ZV4A 3CF2A 3C14C 1Z6YA 1P9NA 4NYIQ 2FH5B 3TMKA 1G4UR 2ZRJA 5KSZA 3ETLA 3EZFA 3HU2A 5J47A 1N6IA 5FPSA 1IJFA 3AVWA 2V55B 1C1YA 3T06B 3DZ8A 1MH1A 3MAAC 5BWMA 2O8EB 4PO1A 3LLUA 2QT0A 4GRAA 2ZETA 1HY3A 5SZHB 4UNQA 2YV5A 2O8FB 2BM0A 2GJSA 1ZMVA 4P33A 5L3QA 1ZNXA 2N46A 3RDPA 1NVUQ 1H8HD 4TL7A 1VDLA 1HT2E 3DDCA 2KBFA 3BH7A 3HWSA 2AD5A 4G3OA 2D62A 2ZRKA 1WDTA 4PQFA 1KZGB 3EG5A 2MJ5B 4B71A 2DR3A 4RKEA 5K8LA 2F7SA 1KJZA 2CWBA 3QF4A 4IVQA 4EKDA 2ZM5A 421PA 3CF0A 1EFRA 5EXTA 4B6FA 5FBVB 4A2WA 1PLKA 2DFKB 3PEYA 1N6HA 3QKUA 1G7CA 3LVQE 3GCGA 1TUIA 3BBPA 5G41A 3W5IA 5FPHA 1NVVR 3U4QB 2REBA 2GA8A 3B7GA 4V0LA 1H8EA 4DCSA 4LZZA 4ZIRB 1S3SA 1S96A 1WMSA 3KQUA 2FDCA 1W36B 1VQ1A 3IUYA 5BXQC 3SEAA 2F1HA 4BWYA 4BFTA 1OF1A 2EU8A 2QM7A 4BZXA 3TGPA 2JLYA 2ZTSA 4EJSB 2ORVA 2IUSA 2EW1A 2JLXA 1OYYA 2OZEA 5AJZA 1P75A 1BO6A 4P4SB 2QRZA 5FTLA 4Q9KA 4QGHA 4G5QA 4PHHA 2WWXA 2ZS9A 2JLUA 1G4AE 5CK4A 1RRFA 5C2JB 1G3UA 4JJZA 4CYMA 1SXJE 4JVMA 5K8UA 1XXHA 1Y3AA 5EE5B 2YNMA 5SZKB 1MO4A 3LO5A 3B89A 1VCNA 3QQ5A 1KI9A 2B92A 3OIWA 4TYPA 4JT2A 4OQFA 1E79A 3K0SA 1XMSA 2JZ0A 1D6JA 3BRWD 1NV8A 1NMYA 3IIJA 4TL6A 2B7CA 3Q8XB 1Q0UA 3A1SA 3L82B 2JA1A 1Z0FA 3WP0A 4AK9A 1CKEA 2AXPA 2JLZA 2IS2A 1DG3A 5DH9A 3FHCB 2D2EA 3B8HA 4MH0R 5EQTA 3X1ZA 5L3SA 1VG5A 2A30A 4AD8A 1YR6A 4NCJA 1Z6TA 1II8A 4DEXA 1K8RA 1I2MA 1U0JA 5EJEA 1ZCAA 4WZBE 3QKRB 1E9SA 3AVUA 2WICA 4AKEA 1RJ9B 4NMMA 4A1FA 1E98A 3EX7C 1WA5A 2OAQ1 2JJ2D 3TR0A 1OH5A 4G5OA 5DN6D 1IFYA 4B3DA 3MHVC 1N2CE 2OAP1 4Z54A 2JCSA 2IL1A 1Q1EA 3U7EB 2WOOA 2YYZA 4BASA 4W5HA 3B1YA 2KE5A 3U3RA 4OQNA 5JLJA 2JY6B 2LVOC 2Q3HA 3EW9A 3R9IA 1NG1A 3RANA 1KO1A 1AS0A 4NE2A 2ZRMA 3PG5A 2BIFA 4HUQB 3QI2A 4Q00A 3SYKA 1F2UA 3IECA 3VLFB 1MRSA 1GKIA 2MMCA 2V3CC 4XWAA 4DLSA 3GFTA 3NWJA 4M1SA 1RE0A 4N0DA 2JJ1A 4CVNA 1CIPA 3ND9A 1F3OA 4V0MA 4URXR 4NU0A 5FUWA 2QM8A 3ASYA 3QXCA 2Z83A 2L4EA 4IEEA 1C4OA 4FMCB 5CM8B 1EESA 2D3WA 1ZIOA 4M22A 1YHNA 2AX4A 3EWSA 1V43A 1DARA 4B2IA 1E2DA 3W90A 5EP2A 2O5VA 2JNHA 1Z83A 3RC8A 1ZIPA 2ZANA 5KPDA 1XPUA 2MSCB 2CNWD 4L16A 2ZREA 2K5UA 4HAYA 1Z6GA 3NG1A 3NBYC 4HEOA 1JR3D 1E2EA 1N25A 1NBMA 4PR0A 4URWR 4B6EA 1UKVY 2V1XA 2QAGC 1ZMUA 2QMHA 2DYKA 3VKGA 3OFNA 4KI0A 4F2LA 3TUZC 1ZU4A 1WGLA 2ZE7A 2F1IA 3A4NA 5TARA 4JSTA 2O8EA 2DAEA 4GMDA 3CIOA 2N1BA 2RGBA 4QBIA 5HCIA 2W0SA 1Q1ZA 4UKDA 1D2NA 2OLJA 3SYNA 2O8FA 2QQEA 5FI0B 1G291 1E69A 2ZTDA 4Z51A 4Q5IA 2IS4A 4LHXA 2QORA 4OK6A 3V9PA 4L8GA 3LBIA 2NO6A 2CVHA 1HYQA 4JKYA 4GT1A 3ASZA 4LJAA 4HSEA 2DB3A 2XXAB 4KFUA 3GLGE 1HT1E 1ZV1A 1G8GA 3PQCA 2ZEJA 2FFHA 4G0NA 1NF3A 1AIPC 1UJ2A 2ZTCA 3KQNA 3R7WB 2ZYWX 4TYWA 1OFUX 1F60A 1XU4A 4DCVA 1G7TA 1TAGA 4PAOA 4XVRA 4EQ6A 5HZKA 3E1SA 3U4QA 3B6EA 1AGPA 2QE7D 4ZIRA 4I1VA 2IYXA 4LJ5A 1V5WA 3Q3JB 2IK8A 2LVPC 2B21A 3CRQA 3U3OA 2ZJZA 3OIUA 2Z5FA 3SBEA 3TAHA 2R2AA 5GVSA 4RZ2A 5FI1B 2GESA 4EJSA 2K9DA 3KJEA 3FKSA 3BFKA 2DENA 4NCNA 2J41A 2IHBA 2HF8A 2R6AA 2ZE5A 4P4SA 2HXYA 2WV9A 1S1CA 4BE7B 1G6HA 1E1RD 1XTKA 1TQ4A 1I4LD 2LCFA 4O3MA 1ONBA 4PFSA 3EZ6A 4I1OA 2ZR7A
chains in the Genus database with same CATH superfamily
1FVHA 3DO8A 4KR9A 2ZWIA 1XLVA 4M0UA 3TZEA 3B2NA 1VYTA 1RQLA 5FBZA 3DKVA 4N0QA 3O3NB 4PG7A 2PS0A 3M6FA 3NWEA 4IKEA 1NXPA 3PR1A 5CYPA 3W0LB 4LBZA 2GF9A 5FA8A 4XOIA 1PW5A 1QP7A 4ZQCB 3NBMA 1H2WA 2SKDA 1FU4A 3K0FB 3E7XA 4I3GA 4ROSA 3WI7A 4PPFA 5MN5A 4I55F 4NATA 3HY5A 1VMDA 2D59A 1SM4A 3SZLA 4HG2A 5EXXA 1E9EA 1NY6A 3NC1C 3V8PA 4NNOA 3S4YA 3BIFA 4WZ6A 3KZXA 3UZUA 5JRJA 4ZT4A 1P6XA 3AVYA 1V5IA 4EQZA 4ZU3A 2H8GA 1N9KA 4WE3A 5GQSA 2G40A 1H4SA 2O2YA 1UL1X 5JT1A 3EC1A 1OJLA 4GI7A 2XXAA 3T1TA 2PY6A 2AG8A 3QU7A 3I28A 1ZXLA 3R7WA 4YJGA 1RW4A 4PLWA 4XARA 2E4UA 2X7XA 2REXB 4Y9DA 4EK9A 4WFIA 3GMIA 1XO1A 5FWXB 2XWJI 1QF9A 2NVUB 4YUWA 3QX8A 1SA0A 2A1UA 3JQFC 1KR5A 2IYEA 3FNBA 3Q7PA 1YZFA 4DLXA 4Z7QB 4DA7A 4NZMA 1KOGA 3QUTA 1TCCA 1KOJA 2XXJA 3TRKA 1VTKA 3UOAB 1GRVA 5KNDD 1DKOA 4HFNA 3WAGA 1R2YA 3NYIA 4BEVA 4UHBA 2O7NA 1L1EA 5FTJA 4K6MA 1TMYA 3KWFA 2HWJA 3LYLA 5K0JA 3I2YX 1S8FA 1N5MA 2WLTA 5JDIC 1CIJA 1T2DA 2WHPB 4P4GA 2RCNA 4PO9A 1Q14A 4MUEA 5JCJD 4FHGA 1JJIA 4D26A 1R0BA 3OX1A 5K2MA 5ICEA 1CNMA 4YJKA 3JRXA 2CDRA 1X1AA 5ALNA 4FDAA 3H1FA 1O0CA 3NNSA 2GO1A 3JZAA 3RTGA 1ULTA 4M1TA 1VZ3A 3E61A 4YACA 5DXFA 3DM5A 4JJ8A 1Z29A 1FS6A 1B7GO 1XZIA 1M7BA 3MT9A 4G5SA 4U8GA 1ZVQA 5AHOA 4AZ3A 3CUKA 3ZCRA 4QUBA 3IIKA 5BUCA 5FR2A 4I8XA 2P9HA 4IBFA 4HEA6 2XH8A 4JB3A 4JI5B 3HYNA 1JHOA 3PIRA 3RYTC 1IXRC 4XYLA 1WUHS 5ITXE 4DG8A 3UUGA 1MRNA 4LG1A 2P7HA 1CCWA 3Q4GA 2CUZA 4MV7A 1KO5A 5D6OA 1YZLA 1NXSA 4QYSA 4LRTB 4GZ3A 5BV2P 1ZXXA 3OMXA 1C9EA 3BMNB 4GMXA 3TW8A 5AW2A 3KAPA 5T4EA 3CNNA 3B82A 4J76A 1EXDA 1HT3A 4UTZA 1YMVA 5HCNA 4YY3M 1J90A 4BV8A 4XKJA 3GR6A 1AKTA 4MQUA 2IUYA 4KSCA 3MELA 2HZ7A 4P93A 3VX3A 3NJRA 4NQRA 3FI9A 2BOVA 2X5OA 5BUSA 3TW4A 1CJTC 3C7KA 3P0FA 2GQ0A 3WGKA 3H16A 1Q0QA 2D0OB 5M04A 3MEQA 3DEIA 3FRIA 1M8JA 4A8JC 2RBEA 2AYXA 2VYVD 4ENPA 4D41A 2HRZA 3RWOA 5DN6A 1QG0A 2F5OA 4UHDA 4L9SA 3ZIAD 4H59A 4V0KA 3ADDA 3VTAA 1W2WB 4EUKA 2YC4C 3W3AH 4UAVA 2J6BA 4BMOB 3NP9A 5F5XA 1T9GR 4DDWA 3A2KA 1TA0A 2WZCA 3EQ7A 3BSYA 4OB8A 2NV6A 3MNFA 3VPDA 1IQPA 1DV1A 1W0JA 2M1ZA 2OTCA 2M98A 3EW7A 1RKBA 4O4IF 2XFTA 1GPYA 2NQ2C 1L8AA 2PT7A 3HL4A 3LS2A 1XCBA 5I51A 2O2CA 3I0ZA 1Y6QA 2AE1A 5CU7A 1C0KA 1KNXA 1N5KA 5LP6A 2CYAA 4C3ZA 3FYTA 4BO8A 3P4XA 2FNAA 2A3NA 3AF5A 3WTCA 4EEKA 1LPMA 2M6SA 1IYZA 4EB8A 4NOLA 1VDZA 3UK1A 4EYOA 4EA9A 2F5PA 4ND1A 3S7ZA 5IT0A 3HMQA 4DA8A 2ZJFA 1JDNA 1U98A 1C8KA 1WZEA 5EWMB 2IY8A 2XE6A 4W1RA 4DV5M 1DBQA 4CG1A 1UJ6A 3D5QA 2VPXA 4OUDB 5EXSA 4HXGA 4OGWA 4YHHB 2Z9CA 4PTYA 1NLYA 1ZIYA 2CLHB 5C8DA 3LDGA 1RWWA 3GU3A 1HQCA 4D6YA 1E5TA 1Y48E 1MBZA 4TVKA 4INOA 2J8ZA 1QZXA 2W6JA 4JWTA 2JFXA 3D6TB 1DBSA 1J0XO 1L5NA 3K4QA 3L5OA 3NBFA 3ZWWA 1GZ5A 1NNUA 1Q3KA 3CPHA 2Z4RA 3KFVA 2BEUB 5IKXA 2WI8A 4KV9A 3HZRA 2JFWA 1ESCA 1XQXA 2FUCA 2DPXA 2D5IA 4HAZA 5DYTA 5TPZA 3HV0A 1MORA 1TZJA 3RIXA 3K31A 1QZTA 3CSSA 5TV2A 1NM5A 3HXPA 3NCTA 3ZHZA 2EFGA 4XD7A 3B3AA 2R0QC 2WKPA 5ALVA 4QICA 3H4VA 4RPLA 3SARA 3DO6A 4U63A 2VSFA 2VDMB 1TM2A 1KHHA 5BNFA 3MIZA 1MLDA 4KL8S 3N9IA 1DJQA 3GJZA 1R0YA 2IP1A 3VPBA 1PV2A 5DI3A 1U7PA 3I73A 1FW6A 2JBHA 3ENNA 2PGLA 3H83A 1TQ6A 4TV9F 3DZJA 1ODJA 1KMQA 1AK1A 4P0PB 3C6KA 2PX0A 5JR3A 1Z8DA 3I62A 3LVFO 5EJMA 2EZ4A 3PGA1 5JTTA 4GOLD 2H18A 3TLAA 3THRA 2FPIA 2QMQA 3ZV3A 4BXOA 3CEPB 1YRQA 2WAYA 3FJOA 4Y1RA 4RZ3A 4TSFA 1Z62A 1G20E 2VNJA 4MO2A 5JY6A 1RTKA 4JI2M 5IAJA 2V74B 5DYYA 2H54A 3A45A 3FDZB 1UM8A 4QDTA 1SUIA 1QZUA 4EJ2A 4JOCA 1YOBA 4NCXA 5EZ6B 1ZBQA 2DWMA 1ORIA 4ISCA 4CIVA 3WNVA 2Q1YA 4MXDA 2FMKA 5NLLA 4TT3D 3FCXA 1L7DA 3D3EA 2PUBA 5FORA 1H85A 4NMLA 4UBMA 4B17A 2P9ZA 4ZTUB 2XGNA 3GY0A 3W5AA 1J8QA 3GB9A 4MR8A 1ILEA 1Z6ZA 4NEGA 3D3WB 3TRIA 1W88B 1DUVG 3TRJA 4AN4A 2AT1A 4M8NE 2PSFA 1QLWA 2V5AA 1OFVA 1X86B 4W5TA 1GFWA 5B12A 3T5PA 3A9CA 1HRDA 2RGNC 3AJRA 3K0AB 4PPGA 5B1SA 2EJBA 3U9TA 2ZIVB 4JS0A 1PJAA 2C7GA 3LF1A 2AK2A 1ESNA 1AJEA 3GGCA 3TCXB 5HRAA 4K46A 3THYA 2ZUFA 1DKRA 2P4QA 3KSAC 1GCUA 3AY0A 1V34A 2FWRA 4PIMA 3HZZA 5DSTA 3I9LA 1GZ3A 2Q3FA 1M75A 4YAEA 3GGOA 1Y5LA 4YHHM 3A9UA 3GROA 5FHQA 3D8NA 3W6PA 1DPGA 3OJCA 4URZR 1ECBA 5CLFA 2VP6A 4WN9B 4DSTA 3TGWA 1QC5A 3OEWA 4ZXPA 4E46A 4ANFA 3V34A 2OORA 2BHSA 5CLHA 4IXMA 4RDCA 1R9GA 4I6GA 5JCOC 3BJMA 4QBHA 4DBGB 3PEEA 5AM1A 2NMVA 4I66A 1JBQA 3FDFA 2I6QA 1IJBA 4BGVA 3VXKA 4OEHA 4JDPA 1XTBA 4ZVTA 2J59A 1IWPB 4B84A 3FIUA 4DTIA 2CW5A 2FSPA 3N2GB 3SX0A 1ONSA 2ODEA 1TGUA 4YRAA 1STOA 2QTNA 4OBBA 3S2ZA 2ERXA 3ZWBA 3VR2A 4IRXA 5ECWA 3SSOA 2XMGA 3LCRA 1A7UA 2WWWA 4I14A 3T8YA 2IS6A 4DNXA 4HN4B 2NXJA 3RRYA 4D44A 2KMLA 1PFWA 4ERXA 3QSYA 3V4FA 4KHPM 3FYHA 3PFKA 3TG2A 4C0LA 4MYRA 4RAOA 5EJFA 3X0DA 3W4IA 4OGKA 3R5SA 4LJSA 1PR6A 1JNXX 2QZZA 4O0LA 1ANKA 2BMDA 5LYYA 2LDBA 1E20A 1JB1A 3TLXA 3IA2A 4MYUA 4GQIA 1NQWA 1T3SA 1LK7A 3NEAA 1N5RA 1A9PA 5EIOA 1YCHA 1Q91A 2J3IA 1GR1A 2XNDA 4X0EA 1L4BA 2IHUA 3AG6A 1HUQA 5I6DA 5HQTA 2J9YB 1BAPA 1SG6A 1VSQA 1QIEA 1ISMA 1RQGA 4G09A 1L4UA 3I72A 4W63A 1G7SA 4CCYB 2Q9BA 5KX5B 1U1DA 3W9YA 3N5CA 3RS9A 5CT6A 1Y89A 1R8QA 1U8FO 2GN1A 4MAAA 5LNK6 5T41A 3MWEB 4NNPA 4N01A 1N6NA 1G8YA 1EYZA 1DL5A 4D0RA 5M7EA 1BG6A 4RC9A 1XHFA 3T7RA 2P8SA 1QIJA 3X1YA 1ZVMA 2YHSA 4FWTA 2JXNA 3IG5A 4PO3X 4YT4A 1KIMA 4R0MA 4HX9A 1GJTA 1J70A 3DL7A 1MT3A 2IZ5A 1ISHA 2B78A 3ICWA 3G0BA 5JSHA 5LMZA 1LF5A 4RD4A 1EK6A 2ON6A 2H0AA 1Q7GA 1OYWA 3RUIA 2H1LA 3CF6E 1J00A 3UJHA 2JAHA 2JZOA 3OFND 1XCLA 1TKAA 2GAJA 4O1MA 2NUPA 2D1QA 3PCTA 2P0YA 2XVZA 4R83A 1F7VA 1VI5A 3L93A 1VCOA 3VR3D 3AR5A 3L2OB 4HJRA 2RC5A 5BN3B 1PT7A 1Z3IX 4J91A 2GZDA 2ZWAA 4DHEA 2I4OA 3HU1A 4LGCA 3K70B 3F8TA 4KYIB 1EXMA 4JOQA 3PITA 2QRQA 1ZBDA 2F9MA 1IUKA 3QY9A 1CQIA 3BE8A 4ZZ3A 4EHDA 4A82A 1PFGA 5KU1A 5DGIA 5FTMA 3A28A 1AUVA 1LVHA 1HZZC 1NW3A 1TCUA 2JPDA 3AK4A 2DBZA 4MRAA 3ONDA 1F8GA 3C3BA 3PDWA 3DEFA 2BFPA 3V7FA 4L4RA 3T7KA 2JGFA 3KKZA 3NHKA 4EEXA 1TK2A 5ILGA 1E63A 3OFVA 4ABTA 1FTGA 1JHQA 5DBOA 1SC4A 5GPBA 1YI1A 1DC7A 2GD2A 1JG3A 4NS4A 3GRVA 5KQMA 2XCOA 4GLOA 4X93A 4GKKB 1YJ8A 2GZMA 1P5ZB 1A8QA 2QT1A 1ZJJA 2GLXA 2ONZA 4GWLA 3ITDA 4MJ3A 2EJVA 3UJ7A 1S01A 1K6XA 2QTGA 4LHYA 2YIDA 1MD9A 4TGLA 2JBWA 3WMXA 1MMFB 1W4ZA 2YXLA 1N34B 4F3YA 1JRLA 1PYDA 4CKCA 3W1WA 4U00A 1JR6A 5IT9S 4XA8A 3DZKA 4ND8A 2A0UA 4OH1A 4ZAGA 1N7GA 1JAZA 2QJRA 2I99A 3QPCA 1N5LA 1L5YA 4J0CA 1Q3CA 3K9WA 3LH5A 5ALYA 3STUA 3M7GA 1YASA 2EIXA 3OZSA 4ND3A 5CLGA 5JI2E 1Z2DA 4P35A 4CL8A 5E0KB 3D31A 1Y37A 2DR2A 4ZV9A 4JIMA 3RUCA 2P90A 3IAS1 1J9GA 2F8MA 3RG8A 1AB5A 4MRMA 1JLRA 1X80B 1P6QA 1HE2A 5IJZA 4A0QA 3TXXA 1KI6A 1C1DB 1LWOA 4KGDA 3AO0B 5BVHA 3SXPA 4C7MA 2NXNA 1ZK2A 2FLWA 3OLYA 4YUYA 5IMBA 5DM60 2CHFA 4YI5A 5KOHB 3DV9A 4UMDA 3U2QA 1Q83A 2I7TA 2E18A 3IT3A 2Y1GA 4B7ZA 1G21E 3NV9A 3A4LA 4H1VA 4TWIA 2Z8XA 3U3KA 2ETVA 2P2CA 4YJHB 5JNLA 1GEGA 1X7ZB 4UU8A 2GTIA 4QFDA 4H27A 3JD0A 3K20A 4JKIA 1X13A 5I4CA 3OCUA 4NJMB 1UDXA 4HPXB 3LPDA 4H7DA 4X64M 3DWIA 5E9QA 4J1SA 5J1SB 3UF0A 3JASB 3ZE7A 3AEQB 3F6RA 1MG0A 4IG9A 2FH5B 1WDKA 2M1XA 1N6IA 1UDBA 1I9GA 2UUOA 3RADC 4PO1A 1NVUQ 2VCYA 2VEOA 5DWQA 5AIAA 4MA5A 3CN9A 3QKUA 2QL5A 1NVVR 4XDHA 4TUYB 2FDCA 3SF0A 2IZ1A 3E35A 2BGWA 1IHPA 5K8CA 2EW1A 5BSVA 3JU3A 5DRTA 3UTDA 2QOEA 5KI6A 1EBUA 3NGMA 4JVMA 5K8UA 3N39C 2YNMA 5SZKB 1MO4A 3BAZA 3F3MA 2XUZA 1UJNA 4C87A 1YDGA 4EG6A 2GVNA 1OU4A 3GT7A 4ND6A 4CF5A 3FHCB 2C5RA 3B8HA 3X1ZA 4UHJA 3INNA 2HNBA 1FXUA 1DGFA 3CO0S 2JJ2D 3EEYA 5BT9A 5KJCA 2UYHA 1ZX1A 4OQNA 1JXQA 3K05A 3VLFB 4AF6A 4IGKA 2D7GA 3ZU3A 4KRYA 5BOVA 5BQXA 5KNLA 4N6GA 2X9GA 1C2TA 3PUJA 3EFEA 2PSSA 2PGJA 3OD1A 2PMEA 4HVLA 5EP2A 2TMGA 4EGQA 5CXXA 4ND7A 1XLWA 3MOSA 1QRSA 2IHTA 1V11B 5TARA 3WRXA 2DAEA 4GMDA 1Q1ZA 4G5YA 4WESA 4B9EA 1ADCA 2QORA 1TUBA 3ZE9A 3OCCA 1Q16A 2R7NA 5K3AA 1LRJA 1N34M 1L7NA 1HT1E 1VOTA 1XPJA 2Q3JA 3FYUB 5LQMA 3VTZA 3WGIA 2H1OA 1DKLA 3ZXXA 5TQ0B 2IK8A 4HQ6A 1NLMA 1A9TA 2HXYA 5K20A 4I9UA 4AP6A 2JAXA 5CX4A 4QTZA 5FWYA 1M73E 3AUYA 4N4AA 2DFVA 3R6TA 3V4SA 1XL1A 2QL9A 5A3JA 4ENTA 4LHSA 2ZSHA 2GTHA 3K5WA 4EPTA 2Y0PA 1RPTA 4QOEA 2WR8A 4RO0A 3EFOA 4TRJA 4HLQB 5IJWA 5GJWC 1H65A 3R3WA 3DLTA 1VGQA 3H9BA 4R7GA 2ZSFA 1ISIA 1Q21A 5HYVA 4AJIA 1USKA 2JG3A 3IX7A 4QWMA 1R15A 2A5FA 1M33A 5DF1A 5A62A 4PINA 2IYUA 2VPIA 4URYR 3NTVA 4QGBA 2EFJA 4RE5A 5JWRA 8ABPA 2J7PD 4LRYA 4OFWA 2Q0HA 4D3SA 4DQXA 3BFJA 4HT3B 2KB0A 4GS5A 1T5IA 4JP2A 5L3RA 3NH9A 5LZ8A 3R7LA 3DNPA 2H9AA 4ZA2A 3NP7A 3QEAZ 5C5DA 2XYPA 3N2ZB 1E99A 2W4QA 3ED1A 2VT3A 2ZP1A 4O4LB 3HCNA 3ZH9B 3NYWA 3GHHA 1LV7A 3PGLA 1H69A 4TXMA 3V2UA 4RVHA 1U3UA 3R3YA 1B43A 3ZDCA 3PTZA 2ZJ0A 1YUBA 3WWZA 5A0VA 2VUHB 3HVUA 1P81A 3KVWA 1SPBS 3T7JA 2PEZA 1QG4A 2WA1A 4H17A 2FMHA 3OKCA 4DVGA 1PL0A 5K01A 3WMFA 3DAPA 1GNQA 4OJYA 1FF9A 3NEYA 3AR6A 4JT9A 2FE8A 1RIIA 3EIFA 3HRHA 5J58A 4AKHA 1GSOA 4L4UA 4GP6A 2AFHA 5THKA 4P2BA 4Q47A 5K4HA 5CA1A 2NN3C 5JAZA 4GMHA 3F78A 1TI7A 1I94M 4MKGA 2GCNA 3BWVA 1Z74A 2VF7A 3TEFA 4TYNA 3EXG1 3I9KA 5FFNA 3KV3O 2HY7A 4FDVA 3VV2A 2V54A 4UBIA 4OUKX 3U6LA 5TMBA 3KD3A 4ASUD 3N2IA 3RU7A 2KJQA 4KZKA 1IIBA 4JLJA 1A98A 4COKA 3VU9A 4Q34A 1HOXA 1B14A 3H9JA 3W4JA 4FE4A 3ZYCA 4Z1OA 4DA4A 2LIVA 3WV5A 3ACBA 2X3UA 3WB0A 4OJQA 4PCAA 4REQA 2Z2KA 4MV0A 2DOKA 1USVA 4RFLA 3L5KA 1XTIA 4C0QC 3LGSA 4DRXB 4OYRA 2XYRA 4CLXA 4IJVA 3K70D 3FFTA 2YWDA 3EDCA 2HMVA 4UTXA 2QLBA 1X0VA 3KOUA 2IHZA 2G9NA 2I3GA 1N6LA 1CUIA 3IAM6 2Y92A 4KN9S 5EN4A 1L8LA 2YQ4A 4LJRA 4H9GA 1QO0A 3MW8A 3PLAE 3BOSA 4F04A 4KRXA 3GLFA 2YQZA 4OQLA 3A9RA 3A2LA 4Y30A 3M6LA 5ITZA 1L8XA 4N76A 4WXPA 1X9IA 1KRHA 4XQEA 4NG4A 1QGDA 2P6OA 1V8ZA 1E66A 3JQGA 3Q5DA 2FSVC 1U8XX 1ZDMA 1F38A 4BP1A 5K6TA 4ZV7A 1PT9A 5KYWA 4ID3A 5IBCA 4MKFA 2QYOA 2G88A 1TEHA 3BTVA 3QGMA 1MA3A 4NZZA 3LUBA 2VLBA 1PJ8A 2IBTA 4P7FA 4L4XA 1SC6A 4MI9A 2X9LA 1ONOA 2NM0A 4LCEA 2YH2A 3CUEF 4LC1A 4BNZA 4OHBA 2G09A 4PRKA 2RBKA 4UQOA 1QO7A 3UEOA 1MHPA 4BQRA 2CBGA 3ZQUA 4P7JA 4X95A 1KJ9A 1AF7A 3IV9A 3VSEA 4FSHA 3UKDA 5C8XA 1BFDA 3ICOA 2VHTA 2O3SA 1ZMXA 1F3LA 4MULA 4BL5A 2XSZA 3RRXA 5AVJA 2VHCA 4WZBB 4L76A 1CT9A 3CLTC 1N3BA 4K1LA 4P5EA 7AT1A 3WA6A 5KEIA 1OILA 1Z18A 2UXDB 2Y0EA 2YMLA 4YAWA 3TECE 2VAXA 1YKSA 1ZNZA 3MXTA 1EP3B 4TZTA 1S7GA 2NTVA 1RCTE 4FBLA 3I45A 3NHLA 1OFGA 2JIQA 2P91A 3BGSA 2ZCVA 1BWRA 4TUWA 4E6EA 2VDVE 1PJ2A 2E7ZA 3PDJA 3D8BA 4DLLA 1EFRD 3EJWA 4UAJA 3M6VA 3BTSA 5JD4A 2JCBA 1IY2A 5KPRA 1NULA 3SQXA 1BWSA 2D1SA 4KPUB 4OHCA 4PNEA 2IY9A 5BSMA 4DWVA 1N1DA 3ESZA 2Z8ZA 1QHHB 5FO1A 4C0JA 4GOOD 1P0CA 4PWZA 2GK4A 3VO2A 1M76A 2INGX 1N4DA 1RXEA 2N42A 3RTDA 3HN7A 2ZRHA 3HXMA 2HMTA 2PD4A 3VR5A 3QUAA 3WIBA 1LQ2A 4BJHB 2P9CA 1VMIA 3TB6A 2JVKA 1EDBA 3U09A 3F6EX 1L1QA 4D4JA 3VH4A 1U94A 3CF4G 1N2CA 5KSOA 3LFHA 2C5SA 1KJIA 1JG2A 4XIGS 3DOOA 2PUTA 2ZQZA 4G84A 3TKAA 3LX6A 4R6WA 3G2JA 1IBLM 2CKDA 1QHXA 2QV7A 3UH0A 2FRDA 2FE4A 3O8OB 4R0NA 4GLBA 4UBKA 1LXCA 4B2LA 3G0DA 1P5RA 2FUG1 1T3ZA 3Q9NA 4JLUA 3EZ9A 1NZDA 3RHZA 2JCGA 3RR2A 2GKSA 4MGKR 4EYSA 2ODPA 3GN1A 1J5XA 3FKSD 5ITQA 4WACA 3QBJA 5LQJA 1PX0A 5JJKA 1NN0A 4K28A 2W6QA 4FWGA 1DAEA 2OPHA 3DJYA 1CZLA 4IBIA 4TLEA 3AYXB 1W8DA 3RSLA 3TNFA 1RRVA 2J46A 5CDUA 2C0PA 1GLGA 4FB5A 5EG5A 2FFRA 1GA1A 4D97A 5A04A 1QF6A 3MFYA 3MRTA 5CUQA 4IR7A 1D8AA 4B1FA 3S2YA 2WPNA 1QG6A 2O06A 3DV0A 4HADA 2J3MA 4OL0A 1YQXA 1MN3A 4FXOA 3LZDA 5HTKA 3L25A 2PXHA 1OXSC 5IHPA 4UHKA 4RSGA 2AZMA 4II2A 3LNTA 1B8OA 5LXTA 1JUDA 2VOJA 1GKYA 2G9ZA 3JR7A 4GGMX 4Q7MB 2L19A 4IICA 1TGVA 2YZMA 2X8BA 3AHFA 4HN9A 2HFKA 3WBFA 3ILYA 1H2XA 3GI1A 3EXHA 5LLTA 3PUZA 2IXEA 4YCJA 3QNWA 2UXDM 1T4DA 3KSZO 1GZUA 3E70C 3ZE0B 3H42B 3LUHA 4I50A 2VCHA 4B35A 1E89A 3RKRA 2I5PO 5DULA 3PE6A 2QQGA 1Z5ZA 4V0OA 4IX9A 1CEEA 3SQWA 4NLLA 1QCYA 2JH9A 3IBSA 1LPAB 5FL7D 2XT0A 2BFEB 3U6BA 5F12A 2VSXA 4KSBA 2PZFA 3NT4A 2H4ZA 1RZ3A 3ZCPA 1M6VA 1A9SA 2XQJA 4PYMA 1F4PA 3TLGB 4ZANA 3LXRA 3U1VA 4LNUB 1NJGA 4H4EA 3M1YA 4A16A 2GJ4A 5T8KA 2O2XA 3BMOA 3PS9A 2OECA 3JYNA 4I5IA 4M83A 2O1SA 1NNI1 2ZE8A 4QT4A 4YRZA 1XB2B 4WLVA 3HHXA 5FOWA 1A9RA 5ELXA 3AMVA 1DKUA 1E1YA 2VZ0A 4MEJA 3T7SA 3WR5A 4I19A 1W2HA 4B0PA 3BGWA 2QQ5A 1OVGA 1BDJA 3KC2A 3AZOA 2I55A 3PJRA 4ZTZB 4OHRA 4CLRB 1J07A 3PHLA 1YOVB 2G5CA 1AZSC 3OLWA 1OXMA 5KSYA 4MV8A 4BY9E 3P9PA 3G9UA 1GSAA 4EGFA 5BOSA 3HDHA 4DV4B 2A9RA 4AKGA 1M2KA 1NTRA 1RWPA 2Y20A 3QFCA 3DZFA 4N12A 2HT6A 4DSNA 1FTWA 1W581 4JMLA 2V7TA 4E3WA 2GN9A 1NBME 2Q5IA 2C4VA 5FAKA 1E7QA 3VR6A 3DWGA 4DJJA 3PYMA 3N8GA 4PYQA 4JYMA 2LHCA 3R3UA 3GIWA 4TKUA 4OJNA 3L40A 4PX5A 1NW4A 5A3RA 2C5BA 3NBUA 1ZOOA 4BNFA 4MNTA 1JQBA 4L5JA 3H2SA 1R6BX 4GI3A 3GPIA 3SD7A 4IXDA 3S70A 2DWCA 1JJFA 3PDUA 3RUEA 2PGIA 2FVYA 5K9ZA 3KQTA 3KE9A 1D2CA 1K82A 5CPFA 3KR1A 4XVUA 2JDID 1KYWA 1KH3A 2A1TR 3NPAA 5U1PA 1Y3CE 4HDOB 3T99A 1P0QA 3V76A 4EIWA 3MHTA 3UV7A 2NAPA 2ZM6M 1N2ZA 4MDFA 4EG8A 5BNTA 4O3FA 3K8OE 1XR3A 3M9LA 2FGKA 3PT5A 1SQ6A 3EXG2 5K0SA 2F8LA 2DBRA 3JZDA 1Z37A 1E5QA 6Q21A 4OIFA 3QEBZ 2XNHA 5LKRA 4LPSA 3QE3A 1VL5A 4HD8A 4EVRA 3T7AA 4LZOA 2XZOA 4I5GA 2W8ZA 4PZZA 4I2VA 1W4BA 1GAXA 3U7IA 2WKRA 3FVTA 3L2AA 4GYKA 1U31A 2YWFA 3PHIA 2J7OA 2ZTUA 4J9UE 1UBRS 3IERA 1OLUB 3OP4A 5K4GA 4EOGA 2DZNB 2V58A 1G9SA 4CRWB 3E9ZA 1UBJS 3KYCB 3HDQA 1XWFA 4EY6A 5IH7A 4A8JB 2ZIUB 3PUWA 4Q9IA 3UH1A 2C98A 4OYHA 3IKLA 3F73A 3PNPA 4YY3B 3CLUD 3CNBA 2HJGA 4H3KB 3UWDA 3OJ0A 1DCFA 1HO3A 3T41A 1G66A 4DJFC 5GIOE 1IATA 3VNRA 4B8ZA 4JWKA 4K81B 4MIYA 5HIIA 1ES9A 4S2EA 4JNKA 2ZIAA 2F3TA 5AW7A 3QYEA 3MSXA 3DCIA 2I4NA 3PDCA 1IG0A 3KU1A 3EMVA 4X65M 1V6SA 3OIDA 1TIBA 3C4JA 3RBZA 3HI4A 3OM0A 4FOSA 1YFLA 3KQHA 2JRCA 4U3JA 4OX9Y 3ZWNA 4OKNA 2ZT6A 4MRPA 4J43A 4HH0A 1LTMA 3P9YA 1H1LA 4P6VF 2PLRA 4N49A 3F74A 5JYEA 4XX0B 4E07A 5KHOC 3IPLA 2UKDA 3LY5A 1KQFA 4O2LA 1I30A 2P5TB 3GLHB 2PXAA 2VH2A 5BQPA 1L3BA 4O02B 3DMNA 1Q44A 4MPDA 2GPWA 4DB2A 1DRVA 3X3HA 3UHAA 1Q15A 3ZQ6A 4DV4M 4ENSA 1JTFA 4B3GA 1JHDA 1USUA 2BMWA 2OC9A 3I1YA 5JEEA 1CVIA 5HS6A 2FZGA 1YFZA 4UOZA 1UFZA 1Y3HA 1G6Q1 3QVJA 3PXUA 2HPAA 1NLZA 2ZBKB 1UJMA 4Z4EA 4IBOA 1CDDA 1AQLA 4EG0A 4N82A 1KZHA 2OSBA 2V0CA 2BWEA 4GLJA 4YJ2B 5KU7A 3W6ZA 3WY9A 4JYPA 4DV5B 4C7OA 4XFDA 2C2MA 1W44A 4RK0A 3WBBA 3PX7A 3LRTA 3U9LA 3IEIA 2ODWA 3PX2A 3D2AA 2ZVQX 1NHGC 4RSRA 4AROA 3W06A 3CEJA 4TRRA 1YJAA 3LSYA 4C2UA 5IBPA 3VNQA 2J0VA 4PLFA 3H2JA 1EBBA 4G36A 5F23A 2Q8PA 4JR2A 3JALA 4LSWA 3EIWA 1MC5A 4EAAA 4UU1A 3RVQA 2H63A 2YXEA 1V16B 1XQ1A 3ILSA 1ISFA 4L8WB 3PEWA 4BFWA 3KJQA 2JJYA 5DT9A 5CAEA 4R41A 3AF2A 4TUYF 1WCIB 2PUVA 1UP7A 4RVFA 1ZL2A 1T2AA 3E5NA 3SC3A 1P18A 3QOFA 3OMLA 3TDKA 1JIUA 3ROTA 5C1IA 3DFZA 1S2MA 1FTSA 2I87A 3FCUB 1QM5A 2Y6VA 4L75A 1JH8A 1RMYA 1LVUA 4W8HA 1WM1A 2HA5A 1O6GA 1QRRA 3D8LA 3AUXA 1G16A 4P4LA 3LBNA 2OKGA 5AT1A 2B9EA 3TUIC 3OZCA 1QYRA 1NWCA 4M6WB 3OA0A 4CCSA 4BO0A 3QBEA 4DDKA 1CS0A 4FYVA 4DCPA 3T5BA 4YASA 2ZZNA 2O01F 5CVCA 1G4UR 1E1LA 4E1AA 2R5WA 1GG8A 3LLUA 1SOWA 1HY3A 1IOVA 2GJSA 4P33A 4OJTA 2N46A 3D7RA 1VE5A 2Q41A 1MP0A 1E62A 3N74A 1ZVKA 1YKGA 1NONA 4JI2B 2P9QA 4IVQA 1NDQA 1U8TA 4A2WA 1PLKA 3PZBA 3BWCA 4Q6BA 1TUIA 2FW1A 2GA8A 4LZZA 1U5BA 3OSZA 3TGPA 2CSUA 2IUSA 3ZGNA 4GH5A 2IXDA 1RPNA 5AJZA 1A71A 1BX1A 2EZTA 4FZ3A 4G26A 1QH0A 2JLUA 1UKCA 1RRFA 4BX0A 1JIQA 1Y3AA 3AW8A 4YAOA 1RXYA 2G4VA 1KI9A 4KIWA 3TKYA 5MN4A 4QRDA 1UXKA 2VK8A 3A1SA 1Y5RA 4FB4A 2JLZA 5BRJA 2EG5A 3GF4A 4N5IX 2AN1A 1NUSA 1U0JA 1Z17A 4BQQA 2F48A 1RHKA 3U4HA 3TQIA 2XUPA 4TKLA 3MLAA 3RYHA 3QFRA 1I01A 3FM9A 4CMEA 3ANXA 2PZ8A 4XW2A 3RANA 4RJTA 1OA1A 3IECA 2V7XA 2P1RA 3GFTA 1WW8A 5TQ2A 2WNHA 5KYUB 5CM8B 4B2IA 7REQA 2HEGA 4P17A 2VJBA 1CUHA 2FWJA 3NBYC 1DBIA 1ORYB 4I5SA 2ZE7A 4QBIA 2LZ0A 4NXMM 1P4JA 5HW0A 2FR8C 1NMSA 2FFHA 4PAOA 4H0NA 3B6EA 5J5VA 4ISBA 3Q5GA 3Q98A 4O4LF 4WLFA 2QVCA 2WM8A 3BFKA 3MQ4A 1E1RD 3ABRB 4BO4A 4KPEC 2GZ1A 2D54A 1N5OX 2ZR7A 1LRKA 3ZGVA 2EATA 3TM4A 3D6VA 1ZJYA 4DJ5X 1HFWA 3HJTA 2A84A 1GAEO 2YJTD 4EGJA 1Z5WA 2UUBM 3SQMA 3RABA 2XOKA 4YC7A 3LBAA 4TTIA 1FMCA 3ND5A 3GD5A 3KW6A 3NORA 3L6DA 1KJQA 1CY4A 3OZEA 4IF6A 1FLAA 3HNOA 5CFZA 2PL5A 2DUWA 4E4RA 4I4IA 3D6JA 4U9HS 5JXGA 1OIVA 4HFJA 3RYIB 1E7RA 2YQ5A 4E14A 2ZIXB 3MWDA 2ZJ3A 4ARCA 3WKBA 4Y9RA 1IAQA 3GPYA 2WV7A 3QG5A 5AXDA 1K7CA 4KHPB 3KLNA 1WY7A 1H6AA 4ZPJA 3I6BA 2CXSA 1CRZA 2V0GA 3G8YA 5HR5A 1GDDA 1ZKMA 4J6EA 4CV1A 4AJKA 3EIQA 2Q3BA 2H4YA 1AUPA 4MVYA 3I2FA 1FRQA 4QEKA 2J1LA 1RHQA 3SMVA 4CUKA 1E32A 1OROA 2B99A 1MAAA 4D25A 5DZSA 2WJAA 2N9UA 3H6HA 4RA9A 4RANA 2AWNA 1SUFA 5LP6C 1M10A 4WK0B 1YBFA 3BBLA 3BM5A 4A3SA 2Q4RA 4OQPA 3UQYS 1BYIA 5C31A 1R1DA 4FVTA 2GYWA 4QUGA 4RDHA 5C1DA 2YR0A 3UWPA 3DZGA 1IONA 4P98A 2GEDA 4OOEA 4JUBA 4Y0NA 3K0KA 3B48A 2VUSA 1JU3A 3JATB 4WEOA 4CN8A 2XFSA 3S68A 4TTTS 2GHQA 1K5HA 4UD6A 4C78A 4J0HA 1XZPA 4NFSA 4EHIA 1T3GA 2RKWA 1A2QA 2Q3CA 3IHPA 4BO9A 3ZW9A 4KAAA 1XU7A 1PUJA 1SKQA 3U37A 2C88A 4TT8A 2MROB 2JF0A 5JJ5A 2C9ZA 4ETIA 4X61A 5FBLB 4IBDA 1AH2A 4B43A 5GONF 4WXMA 3OZIA 3TTVA 3LVBA 4LRXA 3DE1X 5CCEA 3R3XA 3WL8A 1NI4B 2CJWB 3MFQA 3LQ4A 4HWTA