1IM2A

Hslu, haemophilus influenzae, selenomethionine variant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
443
structure length
346
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 99
structure length 346
sequence length 443
ec nomenclature
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1im2A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1im2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1im2A01
2GJAA 4F38A 1XEWY 4E03A 3T6PA 1A2BA 1T0JB 2YOGA 5CK5A 1XTSA 4EAQA 1G16A 3THXB 3ZZTA 5EP1A 1II9A 2AD1A 4LJAA 3WNCA 3WP0A 1DVRA 3GLGA 1A7JA 4P3YA 1M7GA 1E9CA 1L4UA 1BO6A 1TX4B 1W46A 2HXYA 2XEXA 3GCGA 3GFPA 4LPKA 3FMOB 2PLFA 2VP4A 1O87A 3TIFA 4W5JA 4XWAA 2GAAA 2JLSA 1WA5A 3IPYA 3QKTA 2A3RA 1P75A 2GK6A 4M1TA 3PG5A 4NCNA 1MABB 4QXAA 4NYMR 4GITA 1EX6A 4G1UC 2CL6X 4JJKA 5EE9A 2CWBA 1GL7A 4Q4AB 3SHFA 4CGZA 2JDID 5LBIA 2ZRMA 2WOJA 1XD8A 2YC2C 4PZLA 4OQNA 1UKYA 4NONA 1MT0A 4KI0A 1FTNA 1ZC4A 3DMNA 2ZRKA 4OHZA 2H92A 1W36B 4DJTA 3WMFA 1Q0UA 1E2LA 1QHYA 5TXGA 5DYIA 3NWJA 4AKIA 2EWWA 1G6HA 2VSXA 1NVVQ 2FX3A 2EKKA 1TL7C 4IW3B 1XCPA 5FUXA 1SVWA 3WNBA 4XVUA 3U7GA 5AJWA 4UNNA 4A36A 4W5HA 1FUUA 1GSIA 2BBWA 4LV5B 3WRYC 2VL7A 3AP2A 4F93B 4NCIA 4KSBA 3IGFA 2DAMA 2QTVB 1H65A 2L0XA 3K9GA 2UKDA 3P27A 4F4JA 5CYPA 2FNAA 3BK7A 2NO9A 2RGBA 2BWBA 1NIPA 4AY2A 4D2IA 5JJLA 3MHVC 4M9QA 4Q5IA 4TL7A 4GZLA 1G5TA 1HY3A 4MDEA 4NU0A 3O8DA 5CYOA 1RE0A 3GEIA 4AG5A 1II0A 4LBZA 1BMFD 3TR0A 4Q1EA 3EIEA 1VTKA 1VG5A 2FPKA 3PEYA 3ECCA 2DWPA 1MO3A 1IAQA 4MRVA 2H7VA 1OIWA 4G5GA 5AK0A 4Q1FA 4RSGA 3KKQA 1ZNWA 3RVBA 3WMGA 5J40A 3BERA 1W0KA 1FPMA 1PUIA 4MGYR 3NH6A 1OYYA 2VHQA 3B1WA 3I72A 1KK1A 5LB2A 3SJAA 2UZIR 4AK9A 1JB1A 3C4JA 1IJEA 1J99A 1KK3A 4DEYA 2ZI6A 1CF4A 1E4VA 4K46A 5FTMA 1SGWA 5G41A 2MROB 1EFUB 1FQJA 3DKPA 3ZQ6A 1MRNA 1XJ0A 3EWSA 3QKSA 1GKUB 3NC1C 1YR8A 2QPTA 3RS4A 5CIQA 4LOAA 1ZINA 4QHTA 1BKDR 2GXSA 1P72A 1JPNA 5EUQB 3G5UA 1EESA 1OH5A 4TN1A 2ZEJA 5FBWB 2IF2A 2V3CC 1QHHA 3GEHA 1GWNA 3OE7A 2QSFX 1EGAA 3O8BA 4XVRA 2IUUA 4D4LA 5EZ5A 3BFKA 1COWA 4F91B 1CS4C 4UQOA 5F2EA 3UIEA 1ZVQA 4QJ3A 4Q1AA 5J4HA 4PAOA 3HU3A 1S96A 2GJSA 2ZRFA 4IFBA 3KDSE 4OHVA 3TLXA 1XD2A 2A5FA 2WICA 1KKMA 1QRAA 3WP1B 4IDPA 4PC7A 4RFSB 5BW8A 3D3QA 2IHBA 3E70C 3T06B 2NPIA 5JCZA 4KVAA 2P6RA 2ANBA 5FBVB 1R5NA 1P73A 3RWOA 2OUKA 1IXSA 4MGZR 3MD0A 4AKGA 4KFRA 4TYQA 1U8YA 4GOKA 2XXAA 1RC8A 2Z6VA 1IHUA 1YZKA 3ETLA 4JLOA 2ASEA 3CRW1 4MKFA 2GZDA 3LW7A 3KX2A 1G64A 4FI3C 4XD7A 2V1UA 4HAXA 2IYRA 3FHTA 4C0HA 4DKXA 2O8FB 4F4CA 2WWHA 3AEZA 1X8JA 4M53A 2BCGY 3B89A 2ZITA 3KJIA 5DYGA 4M4SA 3A37A 3RS7A 1Q1ZA 3REFA 1FW6A 1NL3A 1NBMA 1TU3A 3AUXA 2NMVA 5JCPA 1CJVC 5BN3A 1CIPA 4DSUA 3GLFB 2WPDD 3VU9A 4B76A 4TT3A 2LVAA 2RCNA 4KAXA 4GFDA 4YC7A 1U2RA 1FZQA 1EFCA 3KFVA 3ICQB 1G1MA 1GOTA 3HYRA 2OOAA 1Y3AA 2GZHA 1UBGA 5F3WB 1FQKA 1FOEB 2VH5R 4R7ZA 4ZDIA 5JECA 3B9PA 5JI3E 2AHOA 3TSZA 2FMXA 4DLVA 3AH8A 1Z3IX 5E7IA 4NH0A 4B3GA 2IEZA 2OAQ1 2FFHA 1Z6AA 5KSZA 4TTPA 5FOWA 4C2UA 4EUNA 4MKGA 2IYVA 3LWNA 2NO0A 5GJBA 1CP2A 4OI4A 2IYLD 3Q7PA 4LHVA 4V0NA 3QPUA 2XAUA 5BYJA 4A82A 4UN2B 5LB4A 3UG7A 4B74A 1IY0A 2J45A 4LY6A 3K9LA 3LCVB 4PQFA 2ERXA 3UANA 1RRCA 1E2IA 4YMWA 2OCBA 4A0HA 1Q44A 3QF4A 4PHGA 1UM8A 4OK6A 2IYTA 2KNZA 2GETA 3D31A 3LQRA 4M9XA 3T61A 2O8DA 2VP2A 3ND8A 2K0BX 1MR3F 3ZVRA 4C7OB 5FUYA 4S2EA 1G3IA 3MMPA 1YQTA 1M7HA 4QNMA 3WHKA 4MYTA 3HWSA 4JYBA 3HPQA 1JBKA 1CR2A 4O2RA 4E5UA 4Q7JB 1V92A 1FNNA 4CF7A 3RHFA 1G8HA 3OESA 2FFBA 2AX4A 2A2ZA 2ZSFA 3THWA 4HB4A 2YV5A 4FN5A 4KU4A 4X8LA 3UATA 1OHHA 4JLVA 4PSVA 2JY8A 1NVWQ 4NYMQ 1ODFA 1NLFA 2XZLA 1NNEA 1TQ2A 5HTKA 1KJYA 2GCNA 2HCBA 3BS4A 1G5RA 4G5QA 3HP1A 4GT1A 4TTQA 1YU9A 2ZJZA 3O8CA 1B0UA 1S9HA 3ZS9A 1E94E 1K8RA 3N5CA 3U44A 3DKVA 2G0NA 3T34A 3OEHA 2RGXA 3X1YA 4EJSC 1IOZA 2HV8A 3AGPA 1XJCA 3X1XA 4OI1A 2I4IA 2WKQA 1OFUX 3U6KA 4WW0A 1T6NA 2F1HA 1Q21A 5FL3A 4O3MA 3GJ7A 4LJ5A 2ZJYA 5IDVA 4C30A 4TYWA 3U2QA 1OTRA 4C4PA 1CULC 1NMYA 2BBOA 4ZV4A 2XXAB 2C8VA 1NG9A 1WBBA 4X8OA 4LBVA 5JZVA 5KPJA 3AKDA 5EQTA 4AYTA 1SULA 4CEJB 3FFBA 4B71A 3VMFA 4XVQA 2X19A 2ORWA 4O25A 4Q1BA 2CVHA 4KSCA 4RZXA 4TMTA 3EX7C 4HZIA 3KKPA 2O8BA 4QBIA 1XEXA 1PGYA 4YDHB 2QAJA 1VCOA 2IX3A 2QMUA 2GAOA 4FWGA 4HDOB 4TLDA 4H1VA 1ESMA 2D4HA 1M7BA 2QEQA 2QRNA 3FB4A 4W9MC 2DHRA 2WSMA 5AJZA 2BV3A 1OSNA 1OXXK 3WBJA 5CM9C 1SHKA 1NV8A 1CXZA 2YWEA 1E69A 4ERNA 3LXXA 2R65A 2MMCA 3C14C 3RRYA 1E2QA 2PMKA 2W6JD 3PITA 1KTVA 3LA6A 1DAEA 4BGDA 1JR6A 3OIUA 5FOXA 2OLJA 2IS4A 3B1XA 1E2JA 1ESNA 1D6JA 4BLQA 4D0NA 1UEIA 3NBZC 2YINC 5HE8A 2ZVQX 1IN8A 1OT3A 2GJ8A 4FCWA 4RZ2A 5DI3A 3CRRA 3QEJA 4M1KA 4I1VA 1JEEA 1U0HC 5DI9A 1P6XA 3DOFA 4O2LA 1TF5A 2ZSDA 3NEJA 2WSSA 3P1JA 1T8TA 5JFGA 4KFUA 3VLFB 3IECA 4MRRA 3BH6A 2DFKB 4KLNA 3OIYA 1NJGA 5JWHA 4D80A 3WMEA 3X1DA 2NZ8A 2ZR7A 4Y0AA 5DHAA 3R7WA 4ZDWA 5TDHA 2ODWA 2O25A 4YMSA 1ZUHA 4GDFA 3LX5A 3QVVA 1OFHA 3AP3A 4ZIRB 2C78A 4PSKA 2BEKA 2OHFA 2ZRIA 3P26A 1NKTA 1UKVY 2EFCB 4H9GA 4KXFB 4V0MA 4BQSA 1W0JD 4JKYA 4F1IA 3C5HA 1F2TB 4LJ9A 1P9RA 3NHAA 2QNRA 1ZNXA 2E87A 2CK3D 1CJKC 3ZIAD 4MUAA 4AURA 2H17A 2GF9A 4QBHA 2GVZC 2Q9BA 4FMCF 3DZ8A 4RKEA 1E1RD 4CRWB 3DOEA 1OB5A 3WYFA 4Z54A 1T8UA 4IRUB 1GIAA 4BLTA 1L4YA 4B2PA 2BVNA 3A36A 4Q4HA 3UKDA 4TMZA 2H5XA 1L8QA 1CKEA 1ZU5A 4JS0A 1CR0A 1NRJB 4IXMA 4WZBE 3HJNA 4B32A 4R9UC 4OHYA 3QVUA 1E9AA 2OM2A 4Q18A 2TMKA 4V02A 4L4UA 1ZIOA 1D2NA 3FKQA 3LXRA 3ADCA 1AZSC 2DENA 3LD9A 4OI0A 4PPFA 1GKYA 1G3MA 2JCSA 4BFYA 3RC8A 2R6DA 4ZO4A 4KJZA 3U7HB 1N0WA 1IONA 4DUGD 2IYXA 2VP9A 1KYIA 3K53A 3PUVA 3NHBA 4NYIR 3I8XA 2JP7A 1ZUNB 1JXOA 4LBWA 4UJ3A 4DLXA 4E22A 1ZM7A 3A1SA 3IPXA 4FMDF 4JVSB 1U81A 1Z29A 3BAFA 3FE3A 2J0QA 4PC6A 1YR9A 2HCJB 1G8PA 2XOKD 1X8KA 2BHRA 1F2UA 4IDQA 2CCGA 2F43B 4BFWA 4C0KA 1LF5A 4Q48A 3K8YA 2ZRGA 1WCV1 3OAAD 2VSOA 4B35A 2XSZA 4JLMA 3SBEA 2QGNA 3ZD6A 1XEXB 3MCAA 2BWJA 1E9EA 1FNMA 3RSOA 3K70D 3CH5A 4ABYA 2O52A 4QJ4A 2PT5A 1NKSA 2DY1A 1Q3TA 1UKZA 4QHSA 4DLRA 1Z0IA 1BYIA 3QQ5A 1KI8A 2DBYA 1W5SA 1AQUA 4HAVA 3JVVA 3W6NA 2L4FA 1II8B 2GEDA 3GP8A 4XWOA 2WJVA 3V4FA 1E79A 3R8FA 2UVQA 1DAGA 2HF9A 1JECA 3AF4A 3LY5A 1G3QA 4HB3A 2QPAA 1GVNB 2W2XA 1G7CA 3CRVA 1CR4A 1Y8GA 4YXWA 1TF2A 1SVLA 5L3RA 2K9DA 1J7KA 4ESVA 1NG1A 1TPZA 1KAOA 3N2EA 3MJRA 4Q02A 5CB6A 3KQKA 3I32A 3IKJA 1FTSA 1ANKA 4MRPA 3KQNA 5EZ6B 1J70A 3IQXA 2C5LA 4PHHA 2C03A 1VCIA 5ANRB 2ZE6A 3CRQA 3LFUA 4KFTA 5E4FA 2X2EA 1AA9A 5DN6A 4HB0A 3CRMA 1KOFA 2Z43A 2ZR0A 4QKQA 3QY0A 2WJHA 3ZZUA 2ODNA 4M9ZA 1KDPA 2RGDA 1KZGB 3OFND 1MV5A 5CDFA 4A2WA 5AUPB 5JSZB 3PEUA 1IN5A 3IIMA 2BBTA 2XTMA 1XEWX 2ZUBA 1KI3A 3ZVMA 2AWOA 3SU8A 1KDTA 2JLZA 2R0IA 3TSOA 3A4MA 2GHIA 1QDEA 4A8JC 3GLHA 3MSXA 1AS3A 1BOFA 1ZNYA 2Q21A 2YWFA 1KMHB 1YZUA 1H8HA 3AF1A 3HR8A 3EA5A 4KFSA 4Q7KA 2RHMA 1KI9A 4ZPXA 2BC9A 4BLRA 2W83A 1DADA 5AR1A 3DM9B 4LC1A 4GOXA 4RCZA 3K09A 2J7KA 2WWWA 3FTQA 3THXA 3ADDA 2C9OA 1L7VC 3K9OA 2G3YA 3AUYA 4HSEA 4Q4HB 2FEOA 3QE0A 4Q03A 5H70A 1GZSA 1ZUIA 5BXQC 4TYYA 2JLQA 4EPXA 1NF3A 2QZ4A 2H5EA 1E0JA 5M04A 2PCJA 1KJWA 1XPRA 1OF1A 4I1SA 4NE2A 1ZD9A 2GCPA 4TLEA 1MABA 1SKQA 2G77B 4Q4LA 4NP6A 2QAGB 3W6PA 2OLKA 4Q4AA 4CVNA 4Q7MB 5DHFA 1D5CA 1Z83A 5LD2C 5HKKD 1NVUQ 3GJ6A 2O8CB 5FOSA 1E3MA 1G8FA 1H8ED 2CBZA 2XTNA 4D25A 2V6ZM 3K09C 2ZREA 2IEYA 2IC5A 2ZI7A 2AXPA 2O0KA 1VG1A 1IXZA 4TYPA 1Q1EA 4OL0A 5HCNA 4CZ2A 3O47A 4AWXA 4DCSA 1FUKA 3AVTA 1DAKA 5CJPA 3Q8XB 4BASA 2VA8A 3CPHA 4JVMA 2ZQ5A 2WAXA 3TE6A 3T1OA 2ZSBA 1ZW6A 3OEED 1C9KA 3QKRA 2KNVA 4LUCA 3KTAB 5EE1A 3VAAA 3FRHA 2FU5C 3MWLA 3LLUA 1KI6B 2VHUA 3CWQA 4UNSA 1HH4A 2C96A 3GD7A 1OXUA 4TWZA 1OPXA 2EYUA 4YMTA 3CB4A 5JRZA 2EJSA 3LCUA 4WP2A 4FWDA 1SQ5A 3PQCA 4A0GA 3JZMA 1W36C 3VR2A 3PEVA 2C2HA 5G40A 3AJIB 2JLUA 2WTUA 3ZVNA 5G53C 1T3HA 2YJTD 3A1TA 2QENA 3W6OA 1NLZA 4GRAA 2IWRA 4TZ0A 4DLWA 5B2ZA 4C0AC 3AKEA 3BORA 2Q6TA 2FE4A 2RGGA 5HPYB 1E9RA 4Q00A 4EPTA 3BC1A 4FWHA 4M9SA 3W5IA 4OBEA 4E07A 1FFHA 5J4KA 2V6IA 5ELXA 3GJ0A 1JAIA 3B13B 2DAGA 4QBFA 1D2EA 3MG9A 3I92A 5EP2A 5FPSA 5K8TA 2CLSA 3GLIE 3G82C 1EFUA 1EX7A 1FX0B 4XJXA 4JSYA 2P6NA 2ZS7A 2WKPA 3CPJB 3TRFA 5C46F 5G3ZA 4IDHA 2D7DA 4LJ7A 1SZPA 3AB3A 4DLSA 3ZDQA 2MGWA 4FWIB 1IFYA 3A1VA 3E2IA 3EPHA 2ORVA 4DCTA 1K5DA 1HQYE 1XU4A 3P4YA 3Q7QA 1N3BA 3CZQA 4CW7A 1GNPA 1JPJA 1W1WA 1R0ZA 3QI2A 2QSZA 3PUWA 4ARZB 4NYJR 1G9XA 3W34A 4Z1MD 1AZTA 1N6PA 1Z0DA 1F5NA 3L82B 3C15C 3IBYA 2AKAB 2ZRNA 2PMDA 3A6PC 2IXGA 1ZMUA 2QROA 3Q85A 4NYIQ 4PC1A 4Q9JA 4MA4A 3CONA 1RPZA 4URXR 3UWKA 1AS0A 4PPQA 3GPLA 1P7CA 4FCVA 2W6ID 1GTVA 2GTPA 4RFSA 4ILEA 1YKSA 3CF0A 4AKHA 1HEIA 4OQMA 1T5IA 2P2LA 1Z47A 4K81B 2JA1A 3MGCA 3VR1A 5JWRA 3THYB 3CW2A 1YZGA 3B1YA 2I1QA 1JR3E 1NSTA 1Q1BA 2FG5A 3ASYA 4A9AA 2PZGA 1YLAA 2FFQA 4BZQA 3S1AB 1F48A 2ZI5A 5F98A 1EK0A 2REBA 3EC2A 4M2LA 5D3QA 2IS1A 3MWJA 1A2KC 4DSNA 2UZ3A 3EZ9A 3ND9A 2ATXA 4AIIA 2O8FA 1VYTA 1YRAA 2IT1A 4MKHA 2WHXA 1YZQA 1N6KA 1ZAKA 5GVSA 4RZUA 1N5KA 1RIFA 4JL8A 5TVKA 2Q9CA 2QUZA 2NO7A 1JNYA 3QKRB 4DVGA 2GF0A 1W47A 5KSPA 4HDQB 1E9BA 1DBSA 3R8CA 3EARA 2ZXUA 3GLFA 1G3UA 3PJRA 1WR1B 1GRRA 4A6PA 3LBIA 2QP4A 2QTHA 4GP6A 2OXRA 4GL2A 1XTRA 1X1RA 2RGEA 4I81A 3AVQA 1TAGA 2P0EA 3KKNA 3MRSA 4ZKDA 2OCYC 3SBDA 1UBFA 1Z6YA 1WMSA 2CNWA 4XTRA 5JEEA 1CEEA 1GL9B 1TADA 4IDOA 3GMTA 2QL6A 3KFXA 5L3QB 4IOKA 1OXSC 2WM9B 4GBMA 3PUYA 4P4SA 5A5GA 2J0VA 1JJVA 4TL9A 2ZJ5A 2DZLA 2JASA 221PA 1OE0A 2IW3A 2DKLA 4PHFA 2QBYB 1ZU4A 2XITA 3EG5A 4BPBA 3QXHA 1T3LA 3LBHA 4L16A 5CLLA 1T43A 5FBQB 3VNVA 2ZRLA 1QHXA 1YVDA 2PJZA 4WBSA 2AL7A 1VIYA 4F2LA 1KSHA 4X8MA 3V00A 3L0PA 1W2GA 3SYLA 4KLZA 4PQRA 2BM0A 5EXTA 4BLPA 3AM1A 4C7OA 5BN4A 2V7QD 1PVOA 2GNOA 2QE7D 5GJWC 2GK7A 5HCIA 3K0EA 5GJVC 4YONB 2YZ2A 4UKDA 1F60A 2QMHA 2NOAA 4YLGA 3AVXA 4TLAA 4Q7JA 3L0IB 2ZU0C 1GNQA 4BUJA 4LYHA 1KMQA 2AXNA 1DPFA 1JEDA 3FDIA 1RFLA 2VP0A 1RJ9A 2DWOA 4AI6A 2AK2A 4OHXA 1OKSA 2QTFA 2XZOA 2R2AA 4UXJA 2LVNC 1MOZA 4Y0VA 3I5YA 3BGWA 4CT5A 3VNUA 5AJVB 2KNAA 1OLOA 1TR8A 2WWXA 1GRNA 2Z83A 1DG1G 2VRWA 4MGKR 5FR1A 4U7DA 2VF7A 3RS0A 4NL4H 4HLDA 2WPDA 2PX0A 1E98A 2GZAA 2ZPTX 2HYIC 4IEEA 3J81k 3ZVLA 1Q1QA 1IN7A 4TLCA 4TMWA 3P4XA 5JWOA 1SVKA 3E5HA 3PUZA 4DB2A 4BFXA 2A5GA 4Q47A 3VX4A 3FWYA 2JEOA 4CEHB 3AVWA 2PJRA 3ZH9B 5JMTA 2G6BA 1C4OA 4CEJA 1JR3D 1GILA 3NBXX 2WJJA 1C7YA 5HE9A 1N6HA 4PPGA 1S9DA 3B1ZA 1WBDA 4C2TA 2EQBA 5P21A 4GP7A 8OHMA 3EW9A 2RH5A 4C0JA 2IHYA 2O8EB 4LJYA 3QSYA 1ZM3A 1XEFA 3A58B 3C5CA 3V9PA 2IXEA 3L8ZA 4DDVA 5C4MA 4RD3A 3QUSA 4OK3A 4LYFA 3GLIB 2GESA 4WXPA 4ACAA 1KO7A 2LVQD 4GMXA 3LW8A 3RABA 4D4MA 1F3OA 1VCMA 1VHLA 4DIDA 2LWIA 2OZEA 3QXSA 2J7PA 2JJ2D 1N6LA 4LYJA 1Q12A 2F3RA 4D26A 5BN5A 2W58A 4QM7A 2IF0A 2ZRDA 4B44A 4P4SB 2PEZA 3ZD7A 1W4BA 1DAFA 2IYQA 2J87A 2YOFA 4I1UA 2BDTA 3KKMA 1AJEA 2JJ8A 5EXSA 3LVRE 1S1CA 2G83A 3U4QB 4UNQA 5DO9A 1AKEA 3RNLA 2V55B 2X1VA 3DVLA 2GJKA 3EZFA 4US0R 3LDAA 2EKFA 3H4MA 4UNPA 2D2EA 1E2EA 3BJIC 1ZM2A 3RRZA 2QA5A 3SR0A 4MUBA 1ZRHA 2OFWA 3CX7A 4JIMA 4ZIRA 4NYJQ 4CYMA 4KODA 4XD7D 4RD1A 1S3GA 3PR1A 1CRPA 1DAIA 4MRSA 4A2PA 1FMJA 3FHOA 2F9LA 4QBGB 1F2TA 2NQ2C 4DT1B 1W44A 3RDPA 5IF9A 3AKYA 3GJ8A 1GITA 3GQBA 5FL7D 1MH1A 5CLQA 4EKDA 3OF5A 2H16A 1A1VA 4M1MA 4U00A 4LDJA 1NBMD 1RJ9B 5UKDA 1B23P 1ZD1A 5HZKA 5KNBA 2J1LA 2HEIA 1W2HA 4WVFA 2YYZA 4TT3D 1XXHE 2IA5A 3DDCA 4PPNA 5FTJA 1U8ZA 2XX3A 1N6RA 1SVIA 4CEIB 4I1OA 1R5BA 2ZTCA 1EFRD 2OT3B 4JLAA 2QNJA 4V0OA 1CJTC 2P3SA 4DZZA 4Q9LA 3T1QA 3HU1A 1E2KA 3A1WA 5TARA 2WOOA 2QM8A 3ADBA 4BRUA 1NY6A 1EWQA 2PEYA 3EIQA 2W6JA 3QXCA 3SHWA 1LNZA 1E0SA 4G5SA 2O0HA 3VHLB 4EQ6B 1N0VC 1A5TA 4JL5A 2DAIA 1CJUC 5AJXA 5EP4A 3LRPA 3K0SA 2ZROA 4WAUA 2L4EA 2AWNA 2F43A 4TL6A 4BE7B 2FEMA 2JGNA 2YHSA 1ZNZA 1KDRA 3QPVA 4Q4JB 4A2QA 3BBPA 4Q7LA 3AF3A 1ZCAA 1WB9A 2WJGA 4A15A 3SEAA 3NIBA 4JJZA 3N2IA 3C7KA 4JLJA 4LPSA 3RWMB 4BFZA 1GG2A 4DBGB 2N1BA 2KE5A 1XMIA 1YZLA 2VHJA 3IILA 2CLDX 2JJ1D 4BZXA 1WF3A 5FR2A 3IO5A 2HUPA 1WIVA 1CJMA 3I61A 2IBMA 1RRPA 2H57A 3AVUA 1TQDA 4TLBA 3RRNA 4ESHA 1HURA 3UK6A 1M6NA 1YR6A 4FMBB 5JHGB 2RAPA 2AK3A 2GEVA 1II8A 4HB2A 4J0QA 2DNAA 1VYUA 1XTJA 4M22A 1JAHA 4AG6A 5KO2A 2R6FA 2VBCA 1IY1A 4A4DA 2QP3A 3FYHA 5SZKB 3ONWA 4TMKA 4B6FA 2ZJAA 4JLKA 1Z0KA 4LX0A 3B5JA 2OOBA 1OKKD 1E1RA 4LHYA 4NBSA 4P32A 5EE3A 4C0BA 2JY5A 1VG8A 5FBLB 1S4QA 1X37A 1G17A 3LV8A 1XJQA 3EZ2A 5KYKA 3ZLJA 3QIAA 4D82A 4O0MA 2LVOC 2ZYVX 2OCPA 2OG2A 2OO9A 3BRWD 3R9IA 2FZLA 3T5DA 4HLQB 1VIAA 3EWAA 1W5TA 4WOPA 2ORIA 5J4YA 1QG4A 3P20A 4FINA 1X6VA 5JSZA 2DHYA 4DUGA 4IFEA 2IYWA 1HE1C 4IVPA 4B47A 2LKCA 1KKLA 1Q20A 3KKOA 4PQYA 3RSLA 5IK2D 4RD0A 1KMHA 3KQHA 2XJ9A 4HI0E 5CM8B 2FA9A 3FMPB 3FVQA 1PJRA 1DEKA 4RY2A 2KRKA 4PAQA 4QHYA 3SOPA 1NN3A 2G0TA 3CBQA 2HAKA 4PZZA 4DB4A 3BWDD 3BH0A 2D74A 4E09A 3E46A 1US8B 2VHCA 1TEXA 3OAAA 3VR5A 5JHHB 4GI7A 2XNSA 2HDNB 1U98A 2LBCA 4EFNA 4BLOA 2FGKA 2FPLA 1ZC3A 4X8HA 5B64A 1QZMA 4YMVA 1NMXA 2H18A 1UDXA 2HLDD 4QGGA 1UBEA 1AQYA 3RLFA 5E7MA 3CH4B 3NBFA 2ZETA 3CX8A 5H68A 2B3TA 3H4JA 1XBTA 4Q1DA 1KAGA 2QAGA 3DM5A 3I62A 5K8LA 3SC3A 3HPRA 5KPDA 5K8IA 2ZE7A 2OBNA 2BJWA 2O8CA 1DG3A 1X3SA 3TAHA 3WHLA 1ZV1A 3IO3A 2DB3A 4ZCLA 1ZP6A 4DBLC 1BVSA 1IM2A 1W48A 2G1KA 2WSSD 1N5LA 2J59A 1P2TA 1XD9A 2VHTA 4P0TA 3U6BA 1EXMA 3CLVA 4FWTA 3B8HA 3SDZA 2L2DA 2FSIA 1M74A 5FPYA 1XTQA 4BFUA 4TZ6A 3AVOA 4QOSA 2BIFA 4LV6A 1O3YA 4DSOA 3H1TA 1R5OA 2ZR9A 2V4ZA 3ZQJA 4B3XA 2B6HA 2QAGC 4URYR 1OXVA 3U61B 4JLNA 2B7BA 1LV7A 3T12A 3KTAA 4JBXA 1KY3A 3OFNA 1T3SA 2QMOA 2ZYUX 4ZCMA 2ZTSA 1KI6A 4DCUA 3L2OB 1MO6A 4URWR 1HQCA 2QMEA 3L8YA 3EXAA 2KB0A 4LC0A 4B43A 1SG9A 1XMJA 2Z0MA 2NZJA 2JIZA 3FFAA 3FKSD 4HYYA 1ZMWA 2QU8A 3VX3A 1FP6A 1Z63A 4A3VB 3PVSA 2J5XA 4PHTA 3IBGA 1OYWA 4TSFD 1SVOA 1BIFA 2BMJA 3OIVA 2FDCA 4MRNA 4DLYA 4NZYA 2CCKA 2WKRA 1XB2B 3LVQE 4FMCB 1TEVA 4GZMA 4B3DA 2CVFA 1DAMA 1E1QD 3MWYW 1XXHB 1M2OB 3PCRB 4IOMA 3T15A 2YWGA 3W8RA 2GVDC 3LAWA 4QGFA 1GDDA 3QJYA 4P4UA 3O8RA 5CK4A 3AQ4A 2DI0A 3NH9A 4RJLA 1XX6A 1S3SA 2ZI9A 4HDCA 2YWHA 4AYXA 4D4KA 2HT1A 4RD2A 1W4CA 1ZD8A 4HUTA 4XSGA 2BCJQ 1FX0A 5TV2A 4HUQB 3B1VA 3SYKA 4ASUA 1ONBA 4JL6A 3VQTA 3RC3A 1H8EA 2YVUA 2DAKA 2KHHA 1C1YA 3BE4A 3FOZA 4HEJA 2LTUA 2XSZD 1AKYA 2GXAA 2YOHA 5CIWA 1G5PA 2D7CA 2F3TA 3AF0A 2EFGA 3AP1A 4GOJA 4N0EA 4TQ9A 3QBVA 4OHWA 4B3BA 1SXJE 2GXQA 4US1R 3U3OA 2CHVA 5EP3A 1Q02A 2WWGA 3AGQA 3KZ1E 5J4VA 4ARZA 1F6BA 4IVRA 4PTLA 2FF7A 4U5XA 2RHDA 2ZUCA 3GJ5A 3TAUA 1M1YE 1WXQA 5E7JA 3OEEA 4ITRC 5KDLA 2V1XA 3K70B 3TVTA 1SHZA 4OQLA 4IXNA 2ZE8A 1E79D 2B8TA 3RAPR 2EVWX 5FTKA 2F55A 4Z8XA 5TB5A 3PIRA 4WA7A 4RKFA 5JRJA 2PLRA 4B2IA 2CHGA 1KI7A 2EFHB 3IUYA 3IEVA 3H0KA 2FOLA 3KXLA 1TF7A 3U3JA 3THYA 2GJ9A 1OH7A 4EFMA 1IJFA 3CNLA 1NY5A 2GRJA 3SN6A 2RKOA 5CJ2A 1UAAA 1OB2A 3VFDA 3S1AA 1K6MA 1PUJA 2JLVA 3EZ7A 1RKBA 1J90A 1NVMA 4PAMA 5BQ5A 5DN6D 3F3YA 2FSFA 1Z0FA 1DO0A 3F0TA 1ZYUA 2A30A 2BBSA 6Q21A 1DAHA 2QT1A 2ZRJA 3NBYC 2AFIE 2BM1A 3QEOA 4HAYA 3UMRA 4YMUA 3K9NA 1KO4A 2E1RA 4RCYA 3E21A 4F7WA 5L3SB 2HXSA 4DIEA 4US2R 3B60A 3HU2A 5C18A 2XZPA 1GFIA 1HUQA 4JT4A 1H8HD 4Q21A 3AKCA 3NDBB 4IKEA 2DVWB 2QQEA 5B57C 3I1FA 2KJQA 2GKSA 2FWRA 4C0LA 3X1WA 1A82A 3D6TB 3A8TA 5L8VA 2XB4A 3FHCB 4ZI2A 4Q01A 1KSGA 5AUOB 3IQWA 3GLGE 2H1LA 3M6AA 1AK2A 4WZ6A 4LRSA 1ETUA 4Q9IA 2RMKA 3CO5A 4B75A 3MFYA 4DCNA 5L3QA 1I2DA 1VEJA 3QNUA 1NMZA 3UWOA 4Z1MA 4MITA 1GUAA 2IWHA 2EWVA 5HZHA 4POAA 2QBYA 2RGNA 1RYHA 1G20E 4PO9A 3TUIC 3KQUA 1WRBA 1G6OA 4MKIA 4URVR 4L8GA 3QPWA 4EDHA 3DZDA 1G7TA 4A92A 3NVAA 2R9VA 1KK2A 1A4RA 3B9QA 1Z6GA 4GNKA 2VQSA 4IVQA 2V6JA 2ZYWX 1N2CE 2W6IA 4AD8A 2F1RA 3AV0B 3CPEA 2FSGA 2YKGA 3SQWA 1NN5A 2RGAA 2W0SA 1KNQA 2JDIA 3B82A 2PT7A 1Z6TA 5J4LA 2ZRPA 1W36D 1Z6XA 3UG6A 1ELOA 5SZHB 4GMDA 5B58C 4K8OA 1GRQA 3K0AA 1NI3A 3SNHA 3AVYA 4NTZA 1UDWA 1Z5ZA 4TMXA 1KO5A 2J46A 121PA 1N5JA 3TQCA 4BLSA 1AS2A 2WIAA 1I4TD 2P6UA 1SXJD 2XTZA 2ZI3A 5KSYA 4OYHA 3WYGA 2QPOA 1E9FA 2LKDA 3NXSA 3NEYA 2NIPA 2W2TA 4OJQA 4Q66C 3VR6A 2A5DA 2A7QA 1AIPA 2GEUA 2BWEA 2ZSAA 3Q9LA 1KIMA 2HJVA 1HTWA 5L3VA 1T91A 1E4YA 1MN3A 2VTKA 1P2UA 3PENA 4W7SA 3M0EA 1QVRA 1G21E 2GXUA 4LBYA 1N25A 1TQ6A 3TMKA 1RRFA 1Z06A 3SJCA 4ON9A 2VF8A 2CL0X 3EPJA 3CZPA 5FI0B 4DRZA 2EYQA 1ZMXA 2J0UB 3VKGA 1BYUA 1QF9A 2IXFA 5JI2E 4CEHA 2D3WA 1XMVA 3LX8A 1R4GA 3L0OA 3CKLA 2K5UA 4M1YA 1BMFA 1VG0B 1IN6A 4FCTA 4MYUA 3SYNA 3T1TA 3F92A 1KI2A 2PCLA 3CR7A 1AIPC 4RVCA 2AN9A 4AC9A 4LZZA 2QHOB 4NPHA 2IK8A 2DZNB 1PV4A 1YHNA 2ZAMA 4OI2A 4QRHA 1LS1A 4BEBA 2GCOB 4P33A 1T0HB 5GADl 3CF2A 3NTUA 4JZKA 4DDTA 1G41A 2ZTDA 3EPLA 2O8EA 2MMGA 4QGHA 3BIFA 1T6OA 2JNHA 3EC1A 3WBKA 3IIJA 3JVUA 1XMSA 2XNDD 1LS6A 3FRIA 2IYYA 2ZIAA 1HYQA 1FL9A 3IHLA 1HT1E 2V7QA 3Q5DA 2LCFA 4CT4B 3GLIA 2QE7A 5DH9A 4EPYA 1E0KA 2BOVA 3E1SA 4FIDA 4EJSB 4G01B 2FSHA 4QNRA 2Q3MA 5KU1A 1IY2A 1ZBDA 4PO1A 4DCVA 2IUTA 4IOJA 2JAQA 2VP6A 3BFVA 3DMDA 1ZMVA 2Z4SA 1BS1A 4YQFA 4QJ5A 1M8PA 5FPKA 1OFIA 2A5YB 1SXJB 4QC2A 4DSTA 3Q5EA 5BYKA 4F92B 5KHOC 5H8WA 3K9HA 1NIJA 1WE2A 4DDUA 2JZ0A 4LHZA 3BBZA 2CCJA 5EE5B 2V9PA 1NJFA 1XZPA 2P5SA 1YE8A 2D62A 2VSFA 4JT2A 1JQLB 3IIKA 3W90A 3U4QA 1V43A 2SHKA 2QY9A 3QXXA 5KTYA 1W7AA 4KBGA 1E2GA 5EE0A 5C1BA 2B21A 4N0DA 1E9DA 2CJWB 2ONKA 4BZPA 1S0UA 1KSJA 1U9IA 4KCGA 1KY2A 4LRTA 4R2IA 5D3MB 1LVGA 5FUVA 5GJCA 5SZJA 2OEPA 4CIDA 1BH2A 2BMFA 1IQPA 1LFDB 2OFOA 3L0SA 1WGLA 5CITA 1YR7A 2WIBA 5FI1B 3WYAA 3LBNA 3K0AB 2GBLA 3EA0A 4HEOA 3F5FA 4OQXA 3CF6R 4DT1A 4M0LA 4KO8A 1JR3A 1NBME 1RVDA 2ZJ8A 3CWZA 1CTQA 3LO5A 3R20A 4G3XA 4MGIR 4PO8A 3PV0A 4PXAA 5E95A 2EFEB 4TYNA 2VP5A 4DDWA 2DZOB 1XCMA 3LQQA 2X77A 2ZJBA 4RZ3A 4V03A 3P32A 1U99A 2OSBA 421PA 4DXAA 5FTLA 3VHXA 3CIOA 3SE0A 1TMKA 4BFTA 2MSCB 2IUSA 2Q9AA 3TKLA 3WRXC 1E9SA 3AF2A 5HR5A 1J8MF 1MO4A 4WIAA 2ATVA 2WWFA 1P3QQ 1U9IC 4TMVA 4B3FX 4CEIA 2W2VA 3VKHA 5LDDC 1E2PA 3TVDA 2G88A 4A0RA 1XFAA 3I5XA 2D06A 2JLWA 4JBWA 2CNWD 1JQJC 4WXRA 2G9NA 3MAAC 1R8QA 2C9YA 3BXZA 3FMFA 5DSZA 2GBLC 4KVGA 2A5JA 4LWZA 2ZJ2A 3W9YA 4EPWA 3R9XA 1PLKA 2PZFA 1E2DA 1DE0A 3RYTC 3IHPA 3X2SA 2JJ2A 1OXTA 1R2QA 5DFLA 2BKEA 4TTRA 4B33A 3RS2A 2OBMA 3GLGB 1W0KD 1P5ZB 4EQ6A 1SKYE 3ICEA 1YZNA 2R8RA 2WJYA 1ZM9A 2WZQA 4OQFA 1GKIA 4HZUB 3HYTA 2R44A 4DEXA 3U3MA 2G1JA 2JLXA 1G18A 1D2MA 1QG2A 4Q4JA 1AGPA 1W4RA 1RZ3A 1OJLA 2WMOB 3GFOA 3H2YA 4DLTA 2VIIA 4MDFA 4LJ8A 2PH1A 1R0XA 1QHSA 3BOSA 1U0LA 3KJEA 1MO5A 4Q19A 2LVPC 1IXRC 2DFNA 5CB8A 2WZJA 1KDOA 4PFSA 1TTTA 2O0JA 4FW9A 2QRZA 1AM4D 2WBLC 2FH5B 2I1VB 1NVXQ 1DO2A 1QBKC 1D9ZA 3OE7D 4XWKA 2DWZB 1T4GA 4BFSA 1COWD 2RB4A 4LI0A 5FL7A 2ECKA 4L15A 2RGCA 3U5ZB 4WZAE 2CEAA 2FFAA 3U3RA 1KO8A 4JVLA 3KB1A 3A4NA 4ZKEA 3UMFA 3F8TA 4JMPA 4QGAA 1WGNA 2DFTA 2N46A 1JALA 3TH5A 1WHCA 2C95A 2JLYA 2ZSEA 2QSYA 4N1AA 2KI5A 4HAZA 2QM7A 1WP9A 5C2JB 3X1ZA 4D0LB 1UPTA 3MUFA 4CDGA 3IDQA 1EFRA 2DAEA 1UADA 1M34E 2AR7A 2AFHE 4G5OA 1GL6A 5AUQA 4R98A 4AKEA 2BMDA 2VYFA 4D4JA 3T35A 5FFMA 3BD9A 1KZ7B 2OFXA 2J3EA 1G19A 1U94A 1FMLA 1D9XA 2EFDB 3R9WA 1NN1A 1AGRA 1OIXA 2VO1A 2MSEB 4UXHA 3WY9A 1N6NA 3KXKA 2BJVA 1IBRA 5B30A 1X1SA 4B6EA 3EIHA 5FH9A 1TTEA 1G8YA 3MJHA 5KDDA 4EIWA 3BB1A 4PC3A 1GAJA 1US8A 2HWJA 3DO6A 1KHTA 4C0SA 3QKSB 3I73A 3KJHA 5C4GB 3KXIA 4C9BA 2EW1A 3LNCA 4L9SA 1XRJA 1P2SA 1X8LA 4NMMA 2IS2A 2JJ1A 1AN0A 5EXPA 2YNMA 2ODEA 2ZRCA 2J7PD 1P60A 3I8SA 2QORA 3TW8B 1QHHB 4QM6A 2F7SA 2ZRBA 2JUJA 2WMNB 3RRMA 2WJIA 5FPTA 4W5WA 1LB1B 1Z07A 3ADKA 1Z2AA 1KJZA 1TUEA 1R10A 4RD6A 4PR0A 3EAQA 1G4AE 4PC2A 1PZNA 3THOA 4Z51A 1YRBA 4M8NE 2ZM5A 3KQLA 3MLEA 3KUDA 2JY7A 1OKKA 3SQXA 1XTKA 1XD2B 2FZ4A 3DEFA 3TR5A 3TUJC 3TJZA 1VCNA 4KYIB 2OAP1 2WV9A 4LRWA 2REXB 5AWFC 3M4YA 4IJMA 4M1WA 4V0LA 5BWMA 3TW4A 3HR7A 4DC9A 1VEGA 2IYUA 3FPAA 4TQUS 4V0ME 5DGXA 3K1JA 5FOVA 1CR1A 1IXSB 4IOLA 2DFLA 1VPLA 1U90A 2OE2A 2ODBA 5FBRB 1KO1A 1JI0A 4JLPA 2Y8EA 4HATA 4HAUA 2W00A 4ZDJA 1HE8B 5KUTA 1Z2CA 1HJPA 1KNXA 3DL0A 1NP6A 2ANCA 1XP8A 3SS8A 2OILA 3CM0A 1OHHD 1W0JA 5IK2A 2FJUA 3B6EA 1I4LD 1F4IA 4S35A 5IRCD 3ZIAA 2CK3A 1P2VA 2JATA 1PLLA 3A1UA 4HLUA 1NN0A 3CNNA 5LPNA 2J0SA 1VYVA 5JJKA 4YDSA 2VLIA 3IEUA 1XNJA 2DCUA 1YZTA 1E2FA 5IT5A 3OEHD 4G3OA 1Z8FA 3VU9B 2YC4C 2JY6B 1XB2A 4LHXA 2FV8A 4MYHA 4DWJA 1Q57A 3WNDA 2GWHA 3GJ4A 1U8AA 2XJ4A 4I99A 3TBKA 1XXHA 2DPXA 2KSQA 1V5WA 2KBEA 4P31A 1E32A 1I2MA 2OBLA 2HLDA 3RS5A 1CU1A 2OCAA 3L43A 3NC0C 4L5BA 1E2HA 1WQ1R 2DWQA 4HAWA 2QGZA 4URUR 1XDBA 1OQYA 4HLCA 4HUQA 4MYCA 4LK2A 4HLUC 1VDLA 1G7RA 4N3NA 3GJ3A 4NCKA 5A0FA 3D7MA 4B34A 4ZDKA 5H1YA 1NSFA 3SFVA 1G7SA 3AVPA 3IHWA 2CP8A 2HF8A 5EXXA 2BEJA 1XCGB 2ZS9A 4AYWA 1E96A 3KUCA 2QQ0A 3QF4B 4PANA 2XOKA 3BFXA 4RFVA 2IS6A 1SKYB 1YJ5A 1HV8A 4GEWA 4NCHA 2O8DB 4NCJA 3RS3A 1OW3B 3I4LA 5FTNA 1MRSA 4GPTA 2OXCA 4DLZA 2QT0A 3JZAA 3SZRA 4FD2A 1E2NA 3CNOA 3SI7A 3U60B 3ZGXA 4G0NA 5KOYA 2VPPA 3C8UA 4A1FA 4KBFA 1S1MA 5JBQA 3MWKA 3K0FA 1GO5A 1VHTA 1PLJA 1XPUA 1Y63A 3VTKA 2XGJA 4KYUA 2GDJA 2QN6A 4MQBA 1WJ7A 2KBFA 3QENA 4XIGS 3PXGA 1TNDA 1IN4A 2QG6A 1DOAA 3THWB 4D6PA 2R6GA 2P5TB 4BEJA 2EU8A 2NO1A 1ZJ6A 4P4TA 2IYSA 2AKYA 4BFVA 2C98A 1Z22A 1DARA 1MKYA 3FKSA 4EPRA 1R7RA 3W3AA 2C9CA 1OFTA 4JYCA 4UNRA 5DLQC 1T9HA 1T5LA 1CLUA 2CMKA 2Q3HA 4IDNA 4LHWA 1EG7A 1QHGA 4PSAA 4TSFA 1N6IA 1N6OA 3LH5A 4EPVA 3CR8A 3U44B 2N42A 721PA 5CDFE 3K70C 3TGPA 2MJ5B 1QHNA 4Q9HA 1QZEA 1OH8A 4BRWA 3ASZA 1OAIA 1E1QA 2B8WA 2O5VA 1S2MA 2A9KA 3EASA 5AUNB 3DHWC 1P61B 4LSGA 5KNCA 1GP2A 2F9MA 3NDPA 2WVJA 3ZJYA 3GLHE 1KI1A 2ZS8A 1G4UR 2P67A 4JLBA 3QG5A 5L3SA 2R6CA 5TMPA 1G291 4XTCS 4M1SA 2CE7A 2HT6A 2ZUDA 5GVRA 1N0UA 1ZCBA 4Z8YA 5DISB 4F4IA 3QXJA 2OV2A 3GJXC 4C0QC 1WDTA 2OESA 4TL8A 2Z4RA 5IHPA 1P9NA 4QG7A 2O8BB 3KJGA 2E9SA 1QHIA 2NGRA 1SVMA 4H1UA 1KI4A 1Z0JA 2NO6A 2NG1A 2QI9C 2ZI4A 2IYZA 2H8KA 4L9WA 2ZRHA 2G3QA 4B48A 4B3CA 4JSTA 3AVVA 2GILA 3UPUA 4ZCIA 1EWRA 1Z28A 2A78A 3QG1A 2AD5A 1NVVR 3GEEA 1UFQA 1XF9A 4KV9A 1LY1A 1RYFA 1ZM4A 2Q3FA 3QOFA 4PX9A 2ZU6A 621PA 1E2MA 2C77A 5KNDA 2F1JA 4M21A 3A4LA 4A8JA 5KSOA 1VECA 5HKKA 4V0KA 1UBCA 1OV4A 3WXMA 4QFMA 2QP9X 5DI3B 3V4RA 5F9FA 2KWIA 4XSHA 3W8NA 1JJ7A 3REGA 1GNRA 3BB3A 1R0YA 4Q9KA 5FOTA 3W5JA 3TUZC 1LW7A 4FMDB 3QKUA 5FPHA 3PUXA 2GA8A 2RRUA 1Z08A 1XWIA 2Q0HA 3HDTA 3GFTA 2ONJA 3R7WB 5DNYB 1TQ4A 1UKEA 4IEIA 2MSDB 1DTSA 2J41A 1G8GA 2ERYA 3B85A 1RW4A 2NTYC 3QBTA 1KSFX 3TSWA 3BH7A 1E0AA 3SJZA 4KHZA 4RD4A 3T1VA 2C99A 1DELA 3K0FB 4B73A 1R6BX 3OIWA 2JIZD 2CE2X 1CUKA 3TK1A 1DV0A 1VDZA 3OZXA 4HZUA 1ZIPA 2PX3A 1LTQA 1JXMA 5JEDA 2REOA 4II7A 2OO7A 4LJ4A 4B2LA 4URZR 3TNFA 2WWIA 4YXWD 2J0UA 3G0HA 4OKSA 5EUMA 4EFLA 1P9WA 3FGNA 2F1IA 4JKIA 1W49A 4BECA 2WAYA 2I3BA 3U3KA 3FMIA 2NPFA 3TQFA 1E6CA 2R6AA 3KB2A 2B7CA 5KDOA 4JVNA 3SJBA 3BB4A 3UXMA 4BWYA 5DIFA 1X86B 1C1KA 1UEJA 3OHMA 5JLJA 2WWYA 5A4JA 3FE2A 3VKWA 3ZZ0A 4NKRA 2GCOA 2FN4A 3U7FB 3CUEF 1FP7A 4ASUD 3W3ZB 1L2TA 2P65A 2X8AA 5FOUA 5J47A 3K0CA 1KK0A 1UFZA 2ZANA 1EFTA 1P62B 3I3SR 2B92A 5G3YA 2JZ1A 2IL1A 4JLDA 4R2HA 4OK5A 1J8YF 5FUWA 1F2UB 2CDNA 3DPUA 1Q3HA 4MH0R 4XH9B 4D81A 3QF7A 1TU4A 5F9HA 4EJSA 821PA 3Q3JB 5JJIA 1VMAA 2HYDA 521PA 2ZJOA 4LYAA 3U7EB 3PFIA 1QZXA 2CLCX 2BMEA 1VQ1A 2CHQA 3B7GA 5SZIA 1SXJA 1LF0A 1CRQA 1NLYA 3LLMA 1R8SA 1HT2E 3K0CC 5TY0A 1G3RA 4C3ZA 1R0WA 4UXIA 4UJ5A 1U0JA 4A0FA 4D0GA 3UMSA 3EZ6A 5EJEA 2JLRA 1K5GA 1Q22A 1XZQA 1VG9B 1OIVA 2V8OA 4OJKA 3SFZA 2X2FA 1KGDA 2FGJA 3C16C 4QL3A 4KITB 2C04A 3ZS8A 1QVAA 1OH6A 2D2FA 5E3HA 4FXPA 2W0MA 2ZYTX 1UJ2A 1XTIA 4PZYA 2CJWA 2ZE5A 3B2EA 4XOIA 1TUIA 2CL7X 2DYKA 3RANA 4A6XA 4ACBA 2R62A 4DHEA 1E99A 4A8JB 3H84A 5DE3A 4LCBA 1GM5A 1P4SA 1I4DD 5AJYA 2F6RA 4JN6A 1P3JA 5D3MA 3Q72A 3VR3A 2XB2A 4I4LA 3T5GA 1VEKA 1SVSA 4M1OA 4LGMA 1S8FA 3N70A 3EPKA 4R71A 1SXJC 1W4AA 2DR3A 3H86A 4LV8B 3D8BA 2BKUA 1DS6A 4DLUA 2RGNC 5J5CA 4LJ6A 1CBUA 2PBRA 4NDZA 4Q1CA 4ZI3A 1Z0AA 3GLFE 2FPMA 3B78A 3M1IA 1UF9A 2HJGA 5JS7A 1D8TA 3NG1A 1RRGA 2VEDA 3KL4A 3NKVA 3PEWA 1EFHA 2V54A 4IHQA 3ZYCA 4TQAA 4U02A 1N5IA 2PZEA 1J2JA 2ZRAA 2CXXA 2Z5FA 2J9RA 1VKJA 5K8UA 1R4AA 2ZAOA 2MR9A 5JS8A 3CX6A 4GSYA 4JBYA 1XPOA 3K9PA 3GLHB 3C41J 4G5RA 4NHOA 2PL3A 3KW6A 2XNDA 3VR4A 5LD2B 1HA3A 1NV9A 2ZVPX
chains in the Genus database with same CATH superfamily
4DV6M 1HI9A 3KHTA 5FWDA 4FC6A 1EVEA 4BP8A 2DUNA 1OLSB 1EAMA 1Q0HA 4GITA 5EE9A 2FRXA 3NHKA 3EBPA 4MWBA 4Q4AB 4LECA 3R5KA 3WRYA 3T99A 2UZAA 2DKOA 4NK5A 4Q05A 2YC2C 4DV6B 2GQFA 2LHCA 2DUMA 2HV9A 1U80A 5FPQA 3UAVA 3P9ZA 4FR5A 1LZKA 2GN6A 4LV5B 3WRYC 3ENZA 1NM5A 3IGFA 4S12A 3DYBA 1E5LA 4QDTA 1H65A 4N6NA 4N49A 2NO9A 2WZCA 4KTTE 2RGBA 1PJBA 4NU0A 4N3GA 1XCJA 4Q1EA 5J2UB 3KKQA 3RVBA 1NM5C 3BERA 3B1WA 4MW2A 1NXXA 5FD8A 3BMOA 3R6TA 4EYGA 1Y8RB 1XJ0A 3NC1C 2D2IA 3E35A 1N5RA 3OCXA 3V76A 3GRAA 4C7VA 4G4SO 1B2LA 4ZAVA 2IUUA 2YV4A 1NPYA 1UWKA 2BM8A 2MHCA 3HJAA 5J4HA 2GJSA 4EF6A 1KPGA 2WTMA 1QYVA 3EEYA 5FBVB 2JFOA 2OUKA 4GOKA 5CR9A 1QU3A 2W71A 1QGOA 3QVSA 2QRUA 4U0JA 1FW8A 3TLJA 3TWOA 3ENQA 1F51E 2FZCA 4BRSA 2ZITA 5DYGA 3W5DA 2PUCA 2PMCA 3NIDB 1N8KA 2NMVA 4C1NA 4GP9A 3GLFB 1DOZA 1TCUA 2C7VA 4MUFA 5JLAA 3ICQB 3PIDA 2PVPA 1J42A 2OORC 3I0NA 5GV8A 5AO9A 5GJBA 2IH4A 5BYJA 1X39A 1TRHA 1I4WA 3A3YA 5FFFA 1PGNA 1HK7A 2ERXA 4I50F 4FD3A 2ZWIA 5CXQA 1ODJA 4K0KB 1SUEA 2VP2A 5BPHA 1USWA 3IXLA 3OM1A 4Y6RA 3WHKA 4B40A 5FSWA 3OE5A 2FFBA 3THWA 2A2ZA 4CLOA 1RI2A 1BX1A 2D0PB 1NLFA 4WV3A 1T36A 1EDEA 2Y2UA 4N18A 1JLMA 1GR0A 3JQBA 4B8WA 1T10A 4Q39A 4RSHA 5KPTA 1GPAA 2CNOA 2EZ8A 3GFRA 2DLDA 1XEXA 4NMWA 2IX3A 3JQBC 4YP9A 2D4HA 5CH8A 3LHFA 2DHRA 4G5FA 5CM9C 1M8GA 1PD1A 4EY4A 3RRYA 1NUAA 4E4YA 3HDJA 1VXOA 2O7SA 5EIHA 3FPEA 3ODPA 3L79A 4K9SA 2X13A 3OSUA 4UTRA 4Z0TA 4L75A 1JEEA 3L1JA 1OPRA 4N0QA 4KLNA 5JO9A 4II2A 1NYLA 3CB2A 1ZUHA 3IQDB 1TLLA 4KDFA 2C78A 2OHFA 2FS1A 1SUDA 4UARA 4BQSA 1FX1A 4LJ9A 4BIIA 4CNBA 2E87A 1PFWA 5DYYA 2Q0XA 3NNNA 4F12A 5KYTA 4TXJA 1M5TA 1PR0A 1JDBB 2OK7A 3AU9A 4B32A 4OHYA 4YMGA 1D2NA 1AZSC 3FN4A 2AR9A 3H4TA 4LISA 2CLHB 3NM5A 3RFXA 1K5HA 1SHJA 1UXIA 1ZM7A 3O3NB 3HJUA 2R1ZA 4UCWA 1LF5A 1EHYA 2AYXA 2ODQA 3WWDA 1Y5NA 5AKEA 1Q7EA 3ELDA 3H11A 5ALQA 1Q3TA 1XJWA 2OCLA 4M8IA 4D5GA 1N2SA 1F12A 5EPOA 3DVAB 3MYRA 5K3CA 1E79A 2XRMA 2EP7A 1RE1A 4KN8A 3OQOA 1U9CA 2AJLI 3DF9A 2QGFA 1MO2A 4CIBA 1J7KA 1GXSA 2JFXA 5JZOA 1FTSA 4XYMA 1VCIA 3O3CA 3MAGA 1TLFA 3QY0A 1OFUA 5A3JA 1C3OA 2XTJA 4KQGA 3GK3A 5IAGA 1TO6A 1Y9AA 3U9SA 3DQQA 3HR8A 1JIXA 4AP5A 4YJ3B 3PJEA 1QCCA 3BKWA 5I7AA 1SCAA 2FEOA 1TGVA 3UGQA 4EPXA 2IOQA 2JCGA 3UJCA 1AOXA 2AI2A 1LDBA 1M0TA 2NU9B 2YJNA 1N2OA 4DSAA 2AXPA 2W2OA 2G4VA 1GAQA 1FUKA 5FF9A 2VA8A 5F52A 2GH1A 4WDQA 5EE1A 4NBNA 3NRJA 3IL2A 3CVUA 4DIBA 1AUPA 3TLBA 2C54A 3ITNA 4LGVA 2JLUA 3RW9A 2YCLA 1XLWA 5FBZA 4C0AC 1HF3A 1U2TA 1EIZA 2WLTA 5ARCA 1VL1A 3OQNA 2WKSA 4OVZB 3ZE1B 1IEVA 3SM9A 1BXRB 4IWNA 1D2EA 3WADA 3RBXA 4MEBA 3DBIA 1YJBA 5BMVA 5CLHA 4R1UA 2ZPUA 3IDSA 2EBUA 5ERXA 2WF8A 5JMPA 5EIAA 2LUOA 4Q9JA 4OQMA 3FNGA 4DRYA 4K81B 2AIRA 1YZGA 5E0OA 4UDYX 1JLKA 3KJXA 1QYXA 5DTMA 4ENVA 4JGGA 4FQ5A 4DZRA 5ALWA 1VBNA 3T9EA 2WHXA 3L07A 4PLPA 3NTOA 3QKRB 2WFLA 4HV4A 3F74A 1E9BA 3HN7A 1IQUA 3EG9A 4FLFA 4GP6A 3W1WA 4P8RA 2NU8A 1NVFA 3WIEA 1UBFA 2D8MA 1GGVA 1M0WA 5BMOA 5LBTA 4B5LA 4P4SA 5A5GA 3M49A 2J0VA 2JASA 5K4GA 221PA 3IX7A 3I4YA 3FGZA 4ZVOA 3HB1A 4D9CA 4L16A 2QZPA 3DE2X 2J3MA 1Y1KE 3SYLA 2PKCA 5I47A 4HQKA 1QSGA 3DE6X 1CJCA 3BDAA 3GG9A 2QMHA 1KMNA 1ZMTA 3HB7A 2V74B 3EVCA 1XZKA 2MSWA 3L9WA 1RJ9A 4NNJA 2AV6A 4UXJA 2NVBA 3AERB 2JIBA 3VNUA 1NI5A 2PAAA 3AB8A 2WWXA 2MU1A 2WNHA 3EGDB 3LHSA 4I4TB 1T9ZA 2PX0A 1I3CA 3ZVLA 5IC5A 2WYIA 3VVMA 5JJCA 2VJPA 4PS1A 16PKA 3LZDA 1C4OA 3CEPB 3NBXX 2WJJA 1D0KA 1C7YA 4KGVA 3CLTC 4ZTUB 5HE9A 2FSSA 4NRVA 5FHQA 4E3WA 4LDZA 4ZI7A 1C9DB 1TM1E 2ZG6A 3E9CA 2VHYA 3JR3A 4DDVA 2CB9A 3ROTA 4WXPA 2Z2KA 5CA0A 1F3OA 1XROA 4F6LA 1XZDA 2EJBA 1JG6A 3EY4A 4QQRA 1XKXA 2NUTA 2QRPA 2O2XA 1RCTE 3DVQX 2GNPA 1YGYA 1CUZA 5TIIA 3RRZA 1XCLA 1ZRHA 3SEQA 1HOXA 4NYJQ 4KODA 4RD1A 3ER9A 1GGFA 3QEAZ 3A9TA 1W44A 3OZFA 3OF5A 1Q5PA 3H65A 5GGYA 1FFWA 3WWEA 5FTJA 2HJRA 3P9QA 1U8ZA 2CSXA 1XKTA 2O2CA 1WTAA 4WK4B 4Q9LA 4BRUA 2J6HA 4I55B 3QXCA 4IG9A 5I4CA 3VHLB 1BA3A 3HLTA 5EP4A 1CY1A 3LPMA 1UC4B 1LVUA 4WAUA 2B8JA 3QX8A 4A2QA 3R0IA 3C7KA 3CLSD 2OYCA 3LYLA 3WGQA 1K1EA 3PB3A 1EE2A 2GEVA 3NRCA 4B6FA 4L07A 4E3ZA 4NBSA 1W34A 1H6CA 3PEFA 2EIHA 5CH5A 5BNTA 3DHYA 2ORIA 4FINA 3M33A 5ECYA 3ZHCA 3M9XA 3B20A 5IK2D 4RD0A 1KMHA 5KKAA 4H6VA 2R79A 3PGLA 1HDZA 4PZZA 3RVKA 4CT0A 1BVYF 4M0PA 4KQ2A 1XTTA 2XNSA 1U98A 5IVIA 3NFYA 1NMXA 1MIOB 1AQYA 3WK9A 4B7UA 1QG0A 4HVCA 1JU4A 1KAGA 3OQIB 5K8LA 3D5TA 1L5SA 3WHLA 3F9IA 3OY2A 2BFFA 2DB3A 4REZA 1CQPA 1W48A 2Y27A 1V5GA 1DZ3A 1CNFA 1O3YA 3T9AA 3F9RA 2UZ0A 4XCQA 1RTKA 2NVUB 2BSAA 3UZUA 2GM9A 2EX0A 2XUOA 4HO1X 4J0KA 5A03A 4B43A 1ZXLA 3PQ4A 4YRZA 1NHWA 4PW0A 4PLZA 1J39A 2WKRA 5K03A 4NCXA 3AQ4A 1PE0A 1KC1A 5LUAA 4PNHA 3C3XA 4DV1M 1XZLA 2G9RA 1CUJA 1O97D 2REQB 4KQIA 1FX0A 3SYKA 4ZQGA 1H8EA 2YVUA 3SQDA 4OMCA 4L95C 4U7WA 2OV3A 2WWGA 3WGYA 4AW4A 4U5XA 5DHRA 2DHQA 1JFFB 1XDSA 4TKVA 2JLAA 1WJGA 4YJDA 3C7TA 4ERXA 2V7VA 4X90A 3RAPR 5GMOA 2UVPB 2QRVA 1VHQA 5TF4A 1GVHA 3ZDYB 3TIXB 3A28A 3CNLA 2D7EA 1O03A 4MRMB 1NVMA 3HXOA 4W6ZA 4YQEA 3TEFA 3RRFA 2CFCA 4HRAA 1HPLA 5CBPA 1PCXA 5E4YA 2RK6A 5F73A 3FSEA 1RPNA 2P9TA 1XOIA 3IUNA 3UH1A 1QKIA 1SCIA 1UT5A 3PNLA 3AKCA 3EGXB 3AEUB 3SVZA 2FWRA 4X45A 4GR4A 3ZVKA 4UCFA 5ALJA 3G0OA 2ES4A 1DGFA 4QEKA 5L3QA 2BN4A 1U02A 2HJ9A 1NMZA 2F5PA 1J2EA 1P4GA 3KQUA 1G6OA 3HYNA 4URVR 2C3PA 2OMKA 2ACKA 1O0BA 2V6JA 1TQHA 4IS3A 5HFNA 3WL5A 1L8LA 2MCFA 1D0IA 3EGIA 3KQPA 3U81A 4NEQA 2JDIA 1BVRA 4R81A 1XU7A 4ENUA 1N8TA 2Y20A 2XTZA 3HTXA 1EQAA 1C9NA 3FDZB 2FEAA 1KIMA 1FSZA 2RB5A 3K9QO 3M3DA 4DMMA 2HCFA 2F4VM 3QTBA 2EX1A 3LX8A 2CZQA 2HHHB 1BHO1 4RTMA 2R00A 4WERA 5JPCA 4UVDA 4I5IA 2GQ0A 4ZN6A 4GR9A 2F4VB 5K0TA 4QGBA 1P0CA 1FFBA 4G01B 3W4IA 3R7NA 3Q0IA 2QQFA 3VH4A 2C5SA 4CL0A 3DMDA 5FPKA 1ZAYA 1SBYA 3VKFA 3MM4A 1WE2A 4X3OA 2IP2A 4IL5A 4UUOA 3FAKA 1L3IA 4OM8A 3AJ8A 5LA6B 1JSZA 1H2RS 1RHKA 1PJAA 3LYAA 4LRTA 3ZU5A 5LC1A 1KY4A 1MPTA 4CI0B 4ID9A 2EGGA 1XZGA 3LO5A 4CPDA 2XE7A 3DG9A 3WYDA 5BWNA 1HZZA 2HSZA 3SSNA 4C1BA 1YL5A 3LUKA 4YP6A 4F60A 1ZN8A 2IU4A 3C24A 2G9NA 4WXRA 3RLIA 3MJ5A 3W9YA 1V1JA 1JTVA 4G5YA 4HDNB 1HZZC 2H2DA 1ZVJA 2JLXA 1TDZA 3AI7A 4JITA 3TCXB 2GN1A 3FPGA 1A0OA 3RAJA 3WGJA 3E3MA 2O0JA 1NX6A 4HLNA 4TV8A 1ZJWA 2DWZB 4GRDA 4OX9Y 2XOEA 1HE4A 2CBGA 2D7JA 4OLJA 5C53B 3UMFA 4DG8A 3TH5A 2UXCB 1LPBB 1I36A 3NHUA 5CVCA 1DWPA 4ITVA 3ZV4A 1UADA 4OHFA 2B0CA 4FHGA 1E3LA 2ZM6M 1TD1A 1X87A 4IDCA 3KHSA 4GHWA 4ZI7F 4D9JA 2W9XA 1X9IA 3LBAA 5CA0F 5C5CA 3LNCA 3ER8A 4NMMA 2IS2A 2ZM6B 3OO1A 5LL6P 5I45A 1IEXA 2A86A 3NOXA 4QFCA 2QLLA 4HQOA 5DYTA 4IZHA 4ZVMA 3KE8A 4G1FA 3TJZA 4C4ZA 4HYTA 4QGSA 1B43A 2P40A 5CT9A 1QWOA 1CR1A 1H4SA 1HLDA 5FBRB 3F96A 3LT4A 1IUPA 1EWKA 2G63A 2JGDB 3EH2A 4GXQA 3SS8A 1OHHD 1FFGA 4ZEWA 1F4IA 2DZDA 3OMLA 1NN0A 2WVAA 3ZPXA 2GN9A 1GAWA 2WTAA 2JY6B 4MYHA 2IYAA 2QM3A 1DUVG 2V7WA 4I99A 3TBKA 2HADA 1TE2A 3HXKA 1CU1A 2FHSA 3PU6A 3PRYA 1BFDA 2GN2A 3DKKA 3A6GA 2QGZA 3B7QA 1XDBA 2QDXA 3PHCA 1JHXA 3GJ3A 1NSFA 4QAJA 3CR3C 2VXBA 1V7ZA 4NCHA 3LRTA 1EFPB 2H6EA 3A31A 1PLJA 1XPUA 1FS6A 3QELA 3VTKA 2Q62A 4XIGS 4NWIA 4BEJA 2EU8A 1KFVA 3ND5A 2H3EA 1NUHA 1H3FA 4BATA 3W3AA 5MGNA 2YMMA 5DLQC 3RD5A 3WXBA 1KGSA 2F5QA 3GHHA 2OXIA 1QHGA 3UTCA 1BQ4A 3CR8A 4ZANA 1GDHA 4L73A 3COZA 3NVKI 1OAIA 1S2MA 2F9MA 3FETA 2GOYA 4F04A 1J49A 3LBYA 1G291 1U4SA 4PCUA 3SHGB 1UWVA 2ST1A 4QOZC 4GM4A 3Q3EA 1RLTA 2O8BB 2ZI4A 4FFLA 4U2GA 2OGZA 4TVOA 2Y0CA 3V2GA 1FTQA 1VI6A 3BGOS 5EHZA 3O0DA 4MVJP 4BQPA 4V0QA 1QAMA 2PKYX 1BMDA 5FHRA 4W8GA 5KTSA 4O08A 1Q7CA 5IABA 1BW9B 2IZ5A 4IEIA 3C43A 1RWXA 2Q4RA 3QBTA 5BP7A 1BXGB 3I4FA 3LQ1A 4MWSA 1JXMA 4MHOA 2OO7A 4DA7A 4URZR 5B37A 1POXA 3KB2A 2Q3BA 5KDOA 3FWNA 2FEXA 2WIGA 1KQ3A 5DIFA 2O2ZA 4N5LA 4MWGA 4KKXB 4HQ0A 1FP7A 2RJOA 3BK1A 1UJ5A 5A5VA 4QUAA 4MIYA 3Q2OA 2CDNA 5GY7A 5HMLA 4H1TA 3FLMA 4YR9A 3LLMA 4I5GA 1WZ2A 1U0JA 5KTKA 1Q22A 4OJKA 4GKVA 3MWFA 2FGJA 3C16C 1PO7A 3O3MB 4Q4DA 2Z3VA 5KAPA 5DE3A 1PZMA 3GC6A 5D3MA 5LZ2A 2OHVA 1NOJA 1VEKA 1S8FA 1AGNA 5CFQA 4O2AA 1UDAA 1TCVA 1DS6A 4CMIA 4PNEA 4E2FA 3M1IA 2X86A 4PQEA 4ZYTA 4FDMA 2CHFA 2MR9A 4QQFA 3UQZA 3MJCA 1QQBA 1W9HA 2VN8A 3JVEA 3HXMA 5LXTA 3G3EA 5IPFA 1T0JB 1DNPA 3THXB 1ACLA 2FSPA 3GNTA 1DT3A 1II9A 3GR6A 2WRZA 1TX4B 2IELA 2XEXA 3RSCA 3T3IA 2RKWA 4GBJA 3COJA 1EG2A 1RM4A 3T1HM 1I0LA 2AEFA 2CFTA 2D0DA 3QLTA 5L7YA 2AT1A 4OHZA 4KDCA 4MUKA 1RHUA 3ZWKA 2PMBA 3R7LA 3U7GA 5AJWA 2BPOA 4NCIA 2JIMA 5H9VA 3T1HB 3K9GA 3G2LA 2B4YA 2B20A 5JJLA 3MHVC 4BFLA 1G5TA 2GD6A 2RFLA 4A3SA 3O8DA 4G26A 4ODIA 3PHLA 4HGRA 3EIEA 1N3LA 1R15A 3T7DA 5A6VA 1OASA 3NH6A 3QV2A 5DXAA 1QG6A 4HQFA 4E13A 1VMEA 2LDBA 3T94A 3ZQ6A 1B15A 2Y1LA 4IFTA 1XTUA 1EI9A 4IWYA 1NVDA 2IF2A 3N05A 2V3CC 1QHHA 1YDMA 4LSZA 2PX8A 3D3NA 2X0EA 2DXIA 1DLIA 4AO8A 1KYWA 1WCIB 3EXFA 1S96A 5T3UA 3ROQA 1Y4UA 3D3QA 3GFVA 2P6RA 2VDJA 1CDDA 4DR4B 3LW7A 4Z4FA 3AIOA 4M53A 3KJIA 2NUAB 1ZIYA 3DOIA 5JCPA 1CJVC 1YS9A 4KLRA 2C7PA 1VE5A 2LVAA 4FFNA 3VAZA 3C1OA 4I7EA 3TL3A 3BD7A 1NT2A 1GCIA 3UTDA 2HSWA 4QYWA 1MHTA 3TSZA 2HU8A 1Z3IX 3OZCA 4JLWA 1OA0A 5HVNA 4IGFA 1HKUA 2IYVA 1EGVB 4LHVA 5LB4A 3B5IA 5BSHA 5F12A 4DG5A 4OK6A 3KK0A 4NATA 4EB3A 4TV8F 5T7BA 3K1TA 3LHIA 1P31A 2A8YA 4IZIA 1G8HA 3WRWA 3VC2A 2N9UA 2IPXA 1UXKA 3FOFC 2Q0QA 2EFJA 1U8TA 1U65A 1BKYA 2QL5A 3A2LA 1ZQ9A 1B0UA 1E94E 3OEHA 4FZJA 2I4IA 2D54A 1QH0A 3U6KA 2Y99A 3EXEA 1QF6A 1D8AA 1OTRA 3QVTA 2WD7A 3R6LA 4E5PA 1HBJA 3OPYB 2YIDA 4CM6A 2JCXA 1O5OA 4EVQA 4KSCA 2CVHA 3I9V6 1P6UA 4M99A 3AI3A 4LDAA 2J48A 4LKOA 4BNDB 4WCDA 1IAVA 1V1MB 5I7RA 4H1VA 1KETA 4J43A 2QEQA 1L5LA 4DZTA 5AJZA 4RF0A 3LXXA 4PE5B 2MMCA 1E2QA 2PMKA 5CRIA 1DAPA 3M8KA 3LA6A 1WVMA 2PFKA 2IS4A 3EEBA 2W37A 3G2OA 5KOIA 5DI3A 3AY7A 5B1IA 5JR3A 1S7GA 4MKZA 5JYEA 3FI0A 4LS3A 4AJPA 3LY8A 1F4LA 3SEFA 4S0XA 5G0VA 1NDUA 3O4HA 4NAUA 4Z4GA 1ZA2A 2ZRIA 2ZUVA 3LDFA 4H9GA 3OBIA 3EVAA 1P9RA 4B17A 4RE6A 3K1YA 1F8UA 3GXBA 4CRWB 3UB3A 1KE1A 2GI4A 1GTL1 4WZBE 3REQA 2F00A 1YJ8A 3ACCA 3USZA 2HU7A 4DMHA 1EM8B 4CIVA 4G67A 4KXQA 5EA2A 3NHBA 2D1YA 3X1KA 1Q50A 1V1RB 1YK1A 2QUKA 3P9CA 4BFWA 2F43B 1JT2A 1JHPA 4ZK6A 1VDMA 3CH5A 5JCOA 1D0SA 3O93A 1VPWA 1KI8A 5FRDA 3GB9A 1GVNB 4FUTA 2P2SA 3CRVA 1P0FA 1FDOA 2ZKLA 5CB6A 5JCOC 4B4UA 2HWYA 2J7OA 5JQGA 3O75A 1XT6A 1YNOA 2QX8A 4UM5A 4M9ZA 4JDPA 3IIMA 3QVXA 3WQSB 4ISBA 3SU8A 5FWYB 1QDEA 3AF1A 4C3OB 2O2GA 4F9TA 5C8ZA 2C9OA 3K9OA 2WUGA 2FN9A 2H5EA 3UUGA 4LJRA 1SCUA 2GTIA 3FTPA 3FTEA 2ZZNA 1QANA 1NOIA 2IEYA 4QT4A 1J00A 2GTHA 4JVMA 4NV1A 1XRLA 5BWBA 4UBLA 5EFZA 5A2QA 2P6OA 4FOPA 1KI6B 4OKIA 2FMTA 2CXHA 1TH2A 1SQ5A 4F9EA 4K9OA 2L42A 1RM5A 2OV8A 2IWRA 3ANMA 1P0QA 4L4ZA 2RGGA 4MV6A 2VNHA 1M2NA 3SLGA 5FWNA 5K8CA 3CX4A 4FHCA 3U7QB 3DL7A 5H80A 4YCDA 3NONA 2Q2VA 3A6ZA 4YT8A 2FJPA 5K0ZA 4B4VA 3EPHA 3ZWWA 5J59A 3P4YA 2JIOA 1GNPA 2VQDA 3SP1A 4BAUA 4K7JA 1T34A 4DV0M 2VR1A 1YS6A 2BI8A 1QIKA 4UMEA 3C4VA 2Y0EA 1Q6YA 2PO5A 2C5AA 4E7PA 2OENG 3HA2A 1HEIA 1QQTA 4O2AF 1EK6A 3IAM1 3V8PA 1ZCFA 3OIGA 4UU1A 1QIDA 2FW8A 1N6KA 1IM5A 2Q6OA 2F67A 2NO7A 3UJDA 3OHPA 1W47A 4BMSA 2ET6A 3UGJA 1H6UA 5LXTF 4FP9A 4PBRA 3U62A 3NBUA 1MA0A 2RGEA 1CC1S 1TECE 1Y8QB 4A0SA 3CY6A 4QQKA 4GYKA 4L78A 4FXOA 1N75A 4TL9A 4B46A 3AWIA 3S55A 4Z4HA 1VIDA 2ALJA 3QOWA 1T43A 4R2JA 2WM2A 4KLZA 3DOCA 3MVEA 9LDBA 3AM1A 4YJFA 2X0KA 4C6SA 1SY7A 3UV7A 4H4EA 3K0EA 1T2NA 3IOYA 4WEQA 3DLBA 4BUJA 3SDBA 1BN6A 3IXMA 2VT7A 4Y0VA 3CEMA 1GRNA 2Z83A 1I7SB 3IVMA 1Y6JA 3OZSA 4A03A 1JS1X 4REMA 2PUHA 4S0ZA 4J1TA 5DP2A 1Y3HA 3H2GA 4C3UA 1Z0SA 3L4EA 3V8VA 3WLNA 2ACVA 3OQ1A 4P84A 3QSYA 4PX5A 4FS8A 3SYRA 2GESA 1H2HA 3RABA 3IAM6 3EEIA 4J1TC 3B52X 2NYUA 1C0KA 4X85A 2ZIUB 2C7GA 1FFAA 3UMGA 3KKMA 3CZRA 4RABA 3ZDXB 4UNQA 3FIUA 5D3ZA 1ZLYA 3CQ9A 1RI1A 2EC5A 2ZB8A 3BJIC 5KYNA 2OYRA 3FHOA 3WKBA 1S7CA 4YPOA 4EKDA 3G68A 1I8TA 5E6RA 4NECA 1P1RA 2H3HA 4MR7A 2BFCB 1O77A 3SMQA 3ET4A 4CEIB 4JX8A 1NURA 2IZ6A 1E0SA 2GYUA 4EQ6B 2DAIA 2L4EA 1ZNZA 4Q7LA 3DOUA 5KBYA 5EKSA 1FQOA 3JWIA 1DIHA 2YNMD 1TQDA 3UK6A 2DNAA 4W7HA 5G4LA 1X94A 4L8RC 2R6FA 1WMDA 4D3ZA 2MR6A 4B7XA 1K75A 4QUKA 4OOFA 3D8SA 1G17A 4L50A 3H7AA 1Z39A 4CV3A 4HLQB 3EWAA 4LZLA 3NEPX 4V0RA 1KKLA 1CQZA 4C76A 5DJ5A 4WWHA 1T15A 3U9TA 1DEKA 4X9XA 4RKWA 1RM0A 3CKYA 4NRWA 3OAAA 4HDMB 3Q1KA 3FOEC 2PKWA 4IV8A 4JASB 2BMVA 3I9KA 2VLBA 2XE6A 3DM5A 1F1JA 3EEFA 1LQUA 5BQOA 5ICEA 3C9PA 1BDBA 2I0FA 3BT7A 4C0XA 4RH3A 1TU0A 3COYA 4DBLC 1FTYA 4RO0A 3PC2A 2BEUB 5CFRA 2L2DA 2OCIA 1IB6A 4BNWA 2B6HA 5JALA 2G5GX 1UBSB 2X4LA 1LV7A 3T12A 4QX6A 2OSVA 2ZYUX 4R3NA 4FOLA 3W2HA 2QOEA 2HUNA 1BS9A 4Y3UA 1L8XA 1PJ2A 1DV1A 2KB0A 2OV4A 1A4XA 2Z0MA 1FK8A 1VL8A 4RFLA 1CUAA 3WBFA 4EJ0A 1R2YA 4DLYA 5KQRA 3ETDA 3A46A 1VHWA 5FNVB 4XX0B 4QU5A 1E1QD 2B98A 3V6MA 5AKKA 3O8RA 5CK4A 4NOKA 1XX6A 1S3SA 1FDWA 1P33A 4O2BA 3D0RA 1ONBA 2JVJA 2KHHA 4LJLA 2LTUA 3CIFA 5SICE 1SXJE 3DNFA 2OCGA 1OREA 1A97A 1GTG1 2FF7A 1FRFS 2ZUCA 5KDLA 5CCXA 4IXNA 4MUYA 4PYOA 3GWGA 2VUSA 3RGWS 2EFHB 1TO2E 1KQNA 5H0IA 1OH7A 5JQGF 4EFMA 1IJFA 4BQQA 5A62A 1YA8A 2JLVA 4JI5M 3F3YA 1NQVA 3ZNQA 8ADHA 3NT2A 2C31A 3RGSA 4MJXA 1GKLA 4IKEA 3FHCB 2XZFA 5DLDA 5AUOB 3GLGE 5HXAA 2RMKA 3FYUA 4CKCB 2I8LA 3HUDA 1J0AA 2HWXA 4CIYA 1A4RA 5AHWA 4GNKA 2MINB 3HJSA 2QXUA 4IG4A 2FPSA 1Z6TA 1RQXA 2QLNA 2TECE 4G0MA 3SNHA 1UDWA 1Z5ZA 1I13A 3H1PA 2J46A 5ILGA 1HO3A 3NHRA 1AIPA 2BWEA 3Q98A 3TS1A 4K9NA 1N5DA 1TQ6A 3R6WA 5B7PA 1C7IA 1ZMXA 4JOCA 2K5UA 3W68A 3T1TA 1EA5A 3BL8A 1AIPC 4DLBA 4JJ4A 4AC9A 3DCJA 2BKLA 2AKEA 2PRSA 2GFIA 1YACA 3N7TA 4D45A 2K6BA 1FE8A 3CCCA 2LCFA 4DQVA 4RCVA 5E9AA 5C5IA 3BFJA 2Q5LA 1E0KA 4I5DA 3MJDA 3G9XA 3OFSA 1JLRA 2AC2A 2G08A 4QPJC 5IG2A 2XMGA 2XMQA 3QXXA 4ID3A 1RPJA 2NSLA 1F9EA 4RWZA 3RUIA 1QAQA 3LPCA 3NIGB 3DE5X 3VM6A 1SCQA 1E1MA 4ED9A 4O4IB 4BO4A 1IQPA 3AFHA 4I8XA 2W6QA 1I1OA 5LJLA 4JKOA 4PO8A 4ZQFA 2VP5A 4TYNA 2EQAA 1ES9A 1QTNA 4DGQA 2GB4A 4F96A 4YV0A 1E9SA 4HVTA 2W2VA 2NAPA 2C61A 5DM60 3FMFA 4EPWA 1T9AA 3RYTC 1H9AA 2VJYA 3GD5A 2WZQA 3DUWA 3U3MA 1DKPA 1QG2A 3F9CA 1G20B 1M2FA 3CCFA 4N7JA 1MO5A 1F6DA 1K08A 4R9VA 3G0CA 4PLWA 1E64A 2GZ1A 4D3FA 2OORA 2XZDA 3EBOA 3KQVA 3TKAA 2RGCA 3VPSA 3T5BA 5EEHA 3U3RA 1KO8A 3A4NA 4ZCQA 3IDQA 2EP8A 2I62A 3GH1A 3AUSA 4Y9SA 1B6SA 5TQ0A 1T2EA 2ECPA 1KZ7B 3OJEA 1OIXA 3G2QA 3ULKA 3ZU3A 1P4AA 4X63A 4QLAA 1DINA 4B6EA 1US8A 3N6RA 3CEAA 3DO6A 1JDZA 5JYBA 4QVIA 2VRCD 1RHRA 2QYOA 3WKEA 3IBFA 4N41A 1OBFO 1RXIA 2ISQA 3VC7A 3FPJA 1G5FA 5FPTA 4W5WA 4PLYA 3S29A 5AXAA 4LAFA 2R6JA 4RGYA 3VC1A 4GNRA 1MX3A 2ADOA 3TM4A 4PZCA 4U6QA 2BTEA 4IM7A 2ODBA 4H7HA 3MUEA 2JF0A 3DL0A 4OQZA 1ULTA 4S35A 3UOWA 3IHTA 4M54A 2DLNA 1C8LA 4NG5A 4LMRA 4OJTA 3RC2A 1TFRA 2YC4C 1EDZA 1XXHA 2DPXA 3KAPA 1A1SA 2BGGA 2PS3A 1P9LA 4Z3OA 5K3AA 3HCOA 3C7CB 3GRVA 3SFVA 4WVLA 2ASVA 5ULLA 1QXSA 2QQ0A 4HFMA 3C97A 4RFVA 2JW5A 4NCJA 1XHEA 1VE7A 4XI9A 1ISSA 5B36A 4A1FA 3DHEA 4EUEA 3STVA 2VUTA 4B6JA 4C3VA 1XLUA 3M4NA 3G49A 1KEPA 2TYSB 1L5NA 4O4JF 1W52X 3C70A 2XDAA 5CDFE 2G5TA 1DLJA 4Q9HA 4O59O 1KVSA 1C3EA 5ALGA 1LVHA 1DPGA 2DG2A 4IQ0A 2FSVA 3QG5A 1UQTA 2VAWA 3B51X 3EQ9A 5F7OA 1OAAA 1WVIA 2QRKA 4XM1A 3RTBA 3UHFA 2AYZA 3O94A 2E9SA 1JF8A 3HHYA 4RJ2A 1CF2O 4U63A 2ONCA 4AS1A 3ZWAA 2FPIA 3WKAA 5EERA 2FSVC 2KLHA 1A5SB 2BLNA 4Q9DA 1KORA 4JJ8A 1I7LA 1JJ7A 4R9NA 3HHWA 3RVRA 3ZW8A 2WQ7A 2KHZA 4NC9A 1SXIA 3WA7A 3UK1A 3EVGA 2XQGA 5GZ1A 1UBOS 2H65A 3V8RA 4D3XA 4KHZA 4B73A 4WOCA 1YI8A 1FU8A 2HA2A 3DAGA 3TNFA 3VZPA 1ZRMA 3NBIA 3KU1A 5DM2A 2OB1A 1NQWA 3FVVA 2B7CA 4O2BF 1GG5A 3EYWA 2A4KA 1WF6A 2ATEA 5DM4A 5AM2A 3K0CA 2WYOA 1EFTA 1A50B 3TTTA 2XB9A 3KYIB 3LSTA 5JH7B 1GARA 3TOXA 1Z5NA 1R8SA 2QTVA 3K0CC 4U9UA 3QPBA 3SFZA 3IIEA 4NH4A 2H2AA 2KS6A 3WV5A 4E6EA 2IRWA 4MV4A 1E99A 2F3SA 4A8JB 3F6EX 1TVEA 3N2YA 4PY2A 3Q3GE 4MS1B 2X41A 3R0VA 3CFYA 3OFKA 2RGNC 5LZ8A 4ZI3A 3AIKA 3KLNA 4M8SA 4IXTA 4WXEA 3ZYCA 2HRZA 2E4ZA 5JS8A 3C3YA 3JZDA 4PAGA 1B8VA 1ZOLA 1VFNA 4LJAA 3DBLB 4B8ZA 1M7GA 3P0JA 1O87A 2F59A 4V3BA 1S2LA 1CJBA 1VOTA 3M89A 5AQEA 4M1TA 1P75A 2W2KB 4YHHM 4G1UC 1BD4A 5AVTA 3TRIA 3HB9A 2CF6A 1D4OA 2IITA 3U6OA 1X9HA 4GPBA 3Q3HA 2FQYA 3WMFA 2YVKA 4IFIA 3IAFA 5BNIA 4FHEA 1HQKA 4DJFC 2FX3A 4CXMA 1XCPA 5FUXA 4G41A 4YHHB 5AHOA 1QS0A 3EPRA 3IP8A 2FLVA 1XZFA 3QU2A 1QFJA 4YYEA 5H82A 4M9QA 4TL7A 4YFYA 2QQGA 4OH1A 1PT7A 2AFVA 4BU0A 1JJAA 2FEWB 1IAQA 2H7VA 3NX4A 2B35A 3GCWA 3SLRA 1R8XA 5B3AA 1LU9A 4AK9A 4K46A 3KAKA 4R41A 1UDBA 4RWEA 3QKSA 1JN0A 4X65M 1YR8A 3BJMA 3RF7A 4AY3A 3NHPA 2OUIA 2ONZA 5EUQB 1KS2A 2NXEA 3ZBTA 3OTOM 2HQRA 4KV7A 3OEWA 4A6EA 3Q40A 5HFAA 1Z88A 2YXDA 4IDPA 5ALRA 5BW8A 2IHBA 3T06B 5JYDA 1XN4A 1CUUA 4KMSA 4W5NA 5JU6A 3LF2A 1UC5B 3FX2A 1LRLA 1MH9A 1WMBA 5DB4A 4AXBA 2RH8A 4MV1A 4YC7A 2VDNB 3NP9A 3HA7A 3KFVA 4MK4A 4H18A 5IKEA 5KJCA 4MVJG 1X9GA 2OO3A 1ZL2A 2IEZA 4CMJA 3E9MA 4EUNA 4F5EA 3OECA 4OI4A 5E4JA 3NV9A 2J45A 2P69A 2VJOA 1IMOA 3LOUA 2QL9A 3STWA 4K40A 3D1VA 2WFMA 3A1FA 1YQTA 3EIOA 3AUKA 4D97A 3HWSA 1G0NA 3JAWB 4CN8A 3GMIA 2O3SA