1IM2A

Hslu, haemophilus influenzae, selenomethionine variant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
443
structure length
346
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAMKLVRQQEIAKNRARAEDVAEERLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone
total genus 99
structure length 346
sequence length 443
ec nomenclature
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1im2A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1im2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1im2A01
2H1LA 4EPTA 2O52A 4URWR 1OXTA 4W5JA 1OQYA 1S3SA 2RHDA 4NCHA 3GFTA 3KJGA 1U90A 2NQ2C 4XVRA 1CBUA 3BH6A 2O0JA 4TTQA 2MMGA 4GNKA 1SXJC 4I81A 1Q1EA 4QRHA 3H4MA 3OAAD 2ZSDA 2WWYA 1E2DA 2OESA 3LV8A 4PPFA 5ANRB 4LHVA 2DFTA 3MSXA 4BFXA 2GEUA 3QI2A 2B3TA 4B3GA 4M1KA 2ZI6A 3VR6A 3KTAA 3UXMA 3PUYA 1QHHA 2AK3A 2CLSA 2Q0HA 3KB2A 5DYGA 3SJBA 3W8NA 4X8MA 3I5XA 2HYIC 1KSHA 4S35A 1E2NA 4LBZA 4JBYA 1P3JA 3FHCB 4LJ6A 2VHQA 4LHZA 4DWJA 3OFNA 1R5OA 1T3HA 1M7BA 1E2IA 1XEWX 4KSCA 2YWFA 421PA 5KSYA 4M1TA 4RD1A 1WBBA 4A1FA 4OK3A 3G82C 1Q0UA 4TYYA 3SJAA 2LWIA 3GLFA 4BRUA 2R8RA 1IFYA 2EYUA 2JCSA 2ZI3A 3UKDA 4L8GA 4DLWA 2IYLD 3TLXA 3UMRA 3BAFA 3SR0A 1OH5A 2ATVA 3K70B 3A36A 4BASA 1HURA 2A9KA 2IYWA 4D80A 4ZDIA 2BWJA 5J4HA 1KNQA 4IXNA 4B73A 2JA1A 1QVRA 4G3OA 1FPMA 4L4UA 1U9IC 1U9IA 4JSYA 3ZJYA 1D6JA 1UEJA 1YZGA 2XSZA 4KSBA 2IYSA 4JT2A 4C4PA 5HZKA 2L4FA 5KNBA 4M22A 1XCGB 1RRGA 4DUGD 2QBYA 2GDJA 4EFMA 4F91B 1KKLA 2VEDA 5KDLA 5AK0A 2ORWA 3VHXA 3U4QA 2IC5A 2IWRA 2R6FA 3Q9LA 3TIFA 2K0BX 4W9MC 4OQFA 4DSNA 3QUSA 4WZAE 1XD2A 1YZQA 3ZVRA 3OEED 2Z5FA 3MLEA 2ANBA 4DT1B 3IUYA 3FPAA 2IUTA 4C0SA 4UNSA 1DADA 4CEHB 1G5PA 4JS0A 4AI6A 2G1JA 3I5YA 3QOFA 3THXB 1OKKD 2IHBA 2ZI9A 3W34A 3EX7C 2QE7A 2QN6A 1U99A 2ODBA 1OHHA 3MGCA 3GJ7A 4TWZA 5EP3A 2JZ0A 2W6ID 5CYPA 2MSDB 1T43A 3KKOA 1XB2A 4IOMA 3LBIA 1OSNA 4C0HA 5GVSA 1FTSA 5LB2A 4H1VA 4ZKEA 1FQJA 2GXAA 2QPOA 5FBQB 1KSGA 4C3ZA 2YOHA 1HH4A 1IN8A 3AP3A 4WZBE 5E7IA 1P6XA 5CM8B 4DCUA 4C2TA 4EPWA 2BMEA 4AYTA 1DOAA 3L0OA 4XD7D 3K70C 3BFKA 3RLFA 4RJLA 3LRPA 3LD9A 3EC1A 2BWBA 2F7SA 2QI9C 1Z0FA 1T3LA 4TLAA 5TVKA 3WNBA 1G8FA 5FTJA 1T0JB 3DKPA 3KL4A 3KQLA 1R0YA 3B7GA 5EP4A 3OZXA 1RRFA 5LBIA 2FZ4A 1KAOA 2VP2A 4EPRA 3IHLA 1TQ2A 2ZYVX 4ESVA 1Z63A 1XX6A 5EE9A 2QSFX 1P2VA 2W83A 1P61B 2CK3D 1B23P 2ORIA 2DPXA 3CR7A 4RFVA 2FEMA 1CJUC 2REOA 4IVQA 4OHWA 3I72A 3KXLA 1X37A 5IRCD 4FWHA 1KK3A 3RS0A 3JVUA 2CDNA 4XOIA 4DT1A 2CBZA 4PAOA 1E2FA 3IQWA 4KAXA 1JNYA 3NBFA 2XOKD 2CCKA 3N5CA 4BEJA 1XTQA 1CR2A 2EKFA 1FOEB 1ZM9A 4LDJA 3THXA 5AUPB 1ZRHA 2E1RA 2OSBA 1U8ZA 4B44A 3RRYA 1G4AE 3QQ5A 2O8FB 1CJMA 4DXAA 4PPGA 3IBGA 2RMKA 2QNRA 5IT5A 3WYFA 1ETUA 2I4IA 3DMNA 3QKUA 4LK2A 2FFHA 1R4GA 4BFUA 2J0QA 4PC2A 1ESNA 1AKEA 1TAGA 3PEWA 3NH6A 3NBXX 2EU8A 1CR1A 1CS4C 3L8ZA 4GMXA 4HEJA 4A0FA 3PVSA 3R7WB 3MRSA 4N1AA 4MITA 3WP0A 4E09A 3CZPA 1EG7A 4POAA 2BIFA 3ZDQA 2WIAA 1X3SA 1A2KC 3ONWA 1JXMA 2ZE7A 3BE4A 2RGXA 4QKQA 4LSGA 1VHTA 1ZAKA 2JY6B 1EWRA 4WXPA 2HAKA 1N0VC 3DMDA 3P32A 1Y3AA 1S4QA 1EFHA 4BZQA 4MH0R 1LVGA 1EFRD 2JLRA 3FKSD 2VSFA 1EFUB 1TUIA 2JY8A 2B8TA 4PSVA 4QM7A 5C18A 1JR3D 4GOKA 4QG7A 3PQCA 5BYJA 3QSYA 5L3SA 2OCAA 2MSEB 2GCPA 2KNZA 4DBLC 4RFSA 2CHVA 2DWOA 4IFEA 4KHZA 1MO3A 3T34A 1HYQA 4HB3A 3TUIC 1QZEA 5HTKA 3LO5A 2P6UA 3TW8B 1XXHB 4RSGA 3W6OA 4ZCMA 4HSEA 3SFVA 2DZNB 2I3BA 1KMHB 1M74A 2ZREA 4DLTA 1Z6GA 5L8VA 2X19A 1Z6AA 4NKRA 2WPDA 5FOXA 3J81k 1XTKA 2NOAA 2OFWA 4B2PA 2J0SA 3QKRB 4IJMA 2QHOB 4OQMA 4Q1FA 2OOBA 1G9XA 1IBRA 1IHUA 2J7PA 4M1OA 4PPNA 3EIQA 4IDOA 1MO5A 1DS6A 3LXXA 4LUCA 4S2EA 4DLZA 4BZXA 1E3MA 1XTRA 3DO6A 2ZAOA 1E6CA 4ACBA 1OXSC 3U6KA 5FOVA 1HE1C 2QGZA 3KJHA 3KKPA 1W4BA 1DTSA 2IXFA 4TYQA 1UAAA 1NIPA 2GCNA 3EG5A 2FH5B 2F1HA 3L8YA 4EQ6A 5CK4A 2BDTA 3L82B 3ADDA 2KSQA 3K9NA 3CH4B 5EE3A 1MKYA 2QRNA 3LA6A 1EK0A 3BS4A 2EFHB 4D4MA 2V1UA 1R2QA 2GTPA 3A4MA 4B34A 5JBQA 3VLFB 2IUUA 2J1LA 4JSTA 2CNWD 3GD7A 4TTPA 2B92A 1U0HC 2BM1A 2GF9A 2QTFA 2VQSA 1NVXQ 2MJ5B 3SHFA 2EFGA 3WNDA 1IXZA 2OAP1 2XNDA 1JPNA 3Q85A 5HCNA 3TQCA 1NSTA 4TQAA 1G19A 4YLGA 4B76A 4Q66C 721PA 1R8QA 5GJCA 1XNJA 4HLQB 1YRAA 5JJLA 4OHXA 2OXRA 1U8YA 3SQXA 4AWXA 3CPEA 3OIWA 5D3MA 5TB5A 1Q1QA 4DCTA 2CCJA 2ZRPA 2OEPA 3NG1A 2IEYA 4F2LA 1C1KA 3HU3A 2ERYA 2XTZA 2GVDC 4B2LA 1F48A 4XSGA 1UDXA 3MHVC 1NG9A 4PXAA 4Q1AA 3BORA 2P67A 3F8TA 4Q4HB 2JIZD 2W0MA 3AKYA 3S1AA 1ZNYA 4TL6A 1NVMA 3WYAA 2W2VA 3T1QA 2GRJA 1F2UA 2A5DA 2CK3A 1J99A 1N2CE 5JS8A 3RSLA 2WICA 1BKDR 1ELOA 2DKLA 2J41A 1TX4B 3A1UA 1OFHA 1CJKC 4AYXA 2A5FA 4GT1A 1IOZA 1Y63A 4EPVA 2GJSA 2W2TA 2KNAA 1SVIA 1S9DA 1G4UR 621PA 1FP6A 4GFDA 2ZIAA 2ZYUX 3JZAA 3LVRE 4ZDJA 821PA 4DB4A 2XXAA 2HWJA 4DSOA 2K5UA 4E07A 1NF3A 1CF4A 4MUBA 1NL3A 1F2TA 2IUSA 4KBGA 4CT5A 3TSOA 1YVDA 2ZAMA 5JJIA 3FTQA 3C14C 3K9PA 3M1IA 2ZVPX 5CK5A 5UKDA 2ZYTX 4Q00A 3LX5A 4QC2A 2BBTA 3X1XA 1WIVA 3BC1A 4QXAA 3Q8XB 1XZQA 2AN9A 2MGWA 2GEVA 3PUWA 5AR1A 5EZ6B 3V9PA 4Q48A 3VX3A 3RSOA 3KW6A 1E94E 4MYUA 4B35A 2HYDA 4ASUD 4HYYA 2PBRA 4M1SA 3K0SA 1TQDA 4A15A 3FKSA 3Q3JB 3R20A 5TARA 4W7SA 3WBKA 1E1QD 1RZ3A 3JVVA 1E9BA 5JFGA 3SU8A 1SVLA 4ARZA 4KBFA 4IDNA 1P60A 3KKMA 2JATA 2RGCA 1LF0A 3UG6A 2BVNA 1NVVQ 5FOTA 4URXR 1MO4A 3K09A 2IS1A 4NH0A 1MABB 2C95A 5BN5A 4QHSA 2WWGA 4LGMA 3A1SA 1W36D 1FX0B 3LBNA 4B3FX 4DLSA 2KRKA 4V02A 1CUKA 4ZV4A 2GAAA 3PENA 2FJUA 2GWHA 4IW3B 4G5OA 5BQ5A 1NNEA 1NRJB 3C7KA 3ZS8A 4LJ9A 1M34E 4Q4AB 4KV9A 2FOLA 2R6AA 2HLDD 4RD3A 2E87A 2OFOA 1E2PA 2VTKA 1RFLA 1XFAA 2EFEB 1IONA 3WHKA 3TQFA 2KHHA 4QFMA 4OJQA 1DAMA 4BLPA 2PH1A 1E0JA 4DDTA 2VRWA 2KE5A 3AVTA 3MWLA 1M6NA 4HZUB 4XWOA 2F9LA 4NPHA 3A58B 3GJ4A 4US0R 2FV8A 5EP2A 2QT0A 1IY0A 1PUJA 3N2EA 3AVWA 2QROA 2WWWA 3NH9A 1E9FA 1TEXA 1ZIOA 2PJZA 3T61A 1UF9A 2WJJA 1KYIA 2QG6A 4JJZA 1QHSA 1TMKA 4B3DA 5FUYA 1KSFX 4D2IA 1F3OA 2ZRCA 1ZCBA 4V0MA 3SS8A 1DELA 3VR1A 3IEVA 1NJFA 4DIDA 5KUTA 5IHPA 1T4GA 3GEIA 3HPQA 4AIIA 1HA3A 1QHXA 2J59A 4RD2A 4LY6A 5AUQA 2WAXA 3G5UA 4TLBA 3VNVA 1VPLA 2FPMA 1E2QA 1SHKA 3NEYA 4PQYA 1FL9A 2YZ2A 1N6HA 1GL9B 1UEIA 3PV0A 4DLUA 4NCJA 1UKZA 5EQTA 4NYIR 1GILA 4MRPA 2PMKA 4JLJA 2QSZA 2P6RA 4Q4LA 5CLQA 4I4LA 1VIAA 2GJ8A 2O8EA 4TN1A 2JY5A 2ZRLA 2J0VA 2C8VA 4ERNA 1IXSB 3B60A 3ND9A 1BO6A 4NYJR 1B0UA 1R5BA 2RGNC 2MSCB 2ZROA 3PG5A 1TTTA 2C99A 5B30A 1ANKA 5J47A 1KI3A 1CKEA 3FMPB 1KDTA 4Q03A 3DDCA 3IIKA 3SJCA 3EWAA 4PHHA 1W7AA 4FW9A 2GETA 2IEZA 4G5SA 2BV3A 2H5EA 4JLMA 4X8LA 5FOUA 3VKWA 4PQFA 3RS3A 1ZUNB 2WMOB 2JDID 3O8DA 4M4SA 3REGA 1V92A 1H8HA 3MMPA 2DAKA 1SQ5A 2H92A 3FE2A 4PPQA 3AVYA 2YNMA 2VBCA 1WGLA 5FR1A 2PZEA 1DAFA 4MUAA 1JQLB 1G3IA 1XPRA 3TVTA 2CE2X 4D0LB 5EXTA 2C98A 3EA5A 2C9CA 3AH8A 2L0XA 4FMDB 2FFBA 2FWRA 1E9EA 3N70A 4QBFA 3K0CA 4HUQA 3RRMA 1G8HA 1UBFA 3H0KA 1KIMA 2OLKA 1YR6A 4EAQA 4Q1BA 2CMKA 2FG5A 3CM0A 5B58C 4TMTA 4TL9A 1T6OA 5FOWA 2JLWA 1G3MA 3KKNA 4BLSA 5JCPA 2BWEA 2N46A 4CGZA 1KO4A 1X6VA 3FMIA 4PAMA 1GRRA 3O8RA 3UK6A 3QXXA 4P4SB 4YMSA 4ASUA 1I2MA 1COWD 2YWEA 3O47A 3HYTA 1R6BX 4YXWD 1PVOA 3B1ZA 2D06A 1FUUA 3NHAA 2VH5R 3UPUA 4OI2A 1ZMUA 4MDEA 1QRAA 1SKQA 2A5JA 4I1SA 5E7JA 4FCWA 1E9RA 5AJXA 1IXSA 3SYNA 3B89A 1VG1A 1KI7A 1US8B 1Z28A 3OHMA 3WBJA 1E2HA 3FMFA 4Q18A 1PLJA 2ZXUA 1LY1A 2P0EA 2ANCA 1R10A 3CRQA 3R8FA 2ZTDA 4K46A 3NXSA 4OKSA 4Z1MD 1P2TA 3B82A 3FRHA 2Z6VA 2GZAA 1S1CA 2B7CA 2V54A 2FMXA 3U60B 3AVPA 2I1VB 4JT4A 1W49A 5G3ZA 2QTVB 2OCYC 2J45A 4LOAA 5KPJA 2QP3A 2ZRBA 3QXSA 1IAQA 3KFVA 2F6RA 4FMBB 5CITA 2CHQA 3TR5A 1NY6A 5A5GA 2DHYA 2FSFA 3NDBB 2D7CA 1CP2A 4LC0A 2DI0A 3WRXC 1OFTA 2ZUCA 1GOTA 5GJVC 1TU4A 4KVAA 3REFA 2QY9A 4C0JA 3D6TB 5GJBA 1GKIA 2PT5A 1G7CA 4Q7KA 4UXJA 2Z4SA 4GPTA 3ZIAD 4LX0A 4MKHA 1E2JA 1OYYA 1UKVY 4UN2B 2FGJA 3KTAB 5FOSA 1QHHB 3BD9A 4IXMA 5JZVA 2IYXA 1LW7A 2F1RA 1OJLA 2GF0A 1RYFA 2FPKA 2NTYC 2JZ1A 2ONKA 4MGIR 4DC9A 2XZOA 3B6EA 1ZU5A 2JJ1A 1EX7A 1CXZA 2NO7A 1E2LA 2C78A 2J9RA 1W47A 4XTRA 1PUIA 4IOKA 4N0DA 1NY5A 3GLHA 1VG8A 1GIAA 1US8A 5KSZA 1NBMA 1TF7A 2GJAA 2ZJ5A 2XJ9A 3CPJB 4RZUA 1AQYA 5KSPA 5BW8A 3QY0A 4AY2A 3R9XA 2J7KA 2XB2A 4R2IA 1SVOA 3CRMA 4NMMA 1KMQA 3GLFB 1G16A 2LVAA 1XPOA 3SNHA 2C9YA 2AD1A 3HDTA 5TDHA 4US2R 1HEIA 2XGJA 1Z47A 2WIBA 1H8ED 2OV2A 1ZC3A 1SHZA 2VP5A 2W6JD 2IYQA 1BIFA 5DE3A 4KYIB 3V4FA 3ZD7A 2PLRA 2RB4A 3O8BA 4TLDA 4XVUA 1IXRC 3SFZA 4KO8A 1G8PA 1QHGA 3A1WA 4HLCA 4LBYA 5JEEA 3VMFA 4MRNA 4O3MA 1JPJA 1VCMA 2FFQA 5HCIA 1PLKA 4HAWA 3B78A 2A78A 5TXGA 4R9UC 4CDGA 3ICQB 4DEXA 1M8PA 2GZDA 1A7JA 2QBYB 1NLZA 3RS2A 1Q3TA 2V6JA 5DH9A 4A8JA 4A8JC 2A2ZA 1ZM3A 1T9HA 3LLUA 1GITA 4GBMA 4KCGA 3NKVA 1VYUA 4RVCA 1EX6A 3R8CA 4Q4JA 1E2KA 4GRAA 4FMCB 3TKLA 1VKJA 1XD2B 2IYVA 1GFIA 2W2XA 1KZ7B 1LF5A 4OQXA 4C0BA 5JSZA 1VCOA 1QHYA 4I99A 1H65A 3ZLJA 5F9HA 1Z8FA 3PEVA 2R65A 3BH0A 4Q21A 1JQJC 1G21E 1WMSA 4M8NE 1EFCA 1R0ZA 1S96A 1BYIA 5DHFA 4OI4A 1Z0IA 3B1WA 3W90A 1XB2B 1WXQA 3MFYA 2JY7A 4Q5IA 1F6BA 3PUVA 2IK8A 4BEBA 2F55A 2DAEA 1U98A 1W0KA 1RE0A 1ZIPA 2ZETA 1VCNA 2Q3FA 4OHVA 1DV0A 1SXJE 1TL7C 2F3RA 4URZR 2GAOA 1C4OA 2JJ2A 3OESA 4Q01A 4OK5A 3KDSE 5HR5A 5EXSA 3EZ6A 4BWYA 4Z54A 1GDDA 2GJ9A 1E2GA 1COWA 4TSFA 1N5LA 1DO2A 3X2SA 1YZKA 1PV4A 5B2ZA 2CLDX 4UNNA 3U44A 2AKAB 2ODEA 4GI7A 1HT2E 4JZKA 3LWNA 2IA5A 2WSSD 4OI0A 4AKHA 4AKGA 5L3RA 1N25A 2CL0X 3LDAA 3MWJA 4R2HA 1QHNA 2LCFA 2V1XA 3K0EA 4AKEA 4AYWA 3QNUA 1NV9A 2HXSA 4BFZA 5C4GB 3K9HA 4Z8XA 1DVRA 2JLYA 5G53C 1KK1A 3FFBA 1AZSC 4U00A 4TMXA 1AIPA 2ZRFA 1AIPC 3WYGA 4Z1MA 3AVUA 2Z4RA 1E9SA 2VYFA 2ZRKA 3OIYA 2IXGA 2ZI5A 1OIVA 1W46A 2NGRA 3GLGB 3GLFE 2HUPA 3H2YA 1YZUA 3PUXA 3QG1A 4Q02A 3IGFA 3TNFA 4PHTA 2ZQ5A 3W5IA 1C7YA 2GK7A 4R7ZA 1U0LA 3KUDA 4KLNA 1E1RA 1F4IA 1X8KA 3VHLB 3QBVA 1Z0JA 4D4LA 4JBXA 5JECA 5M04A 3W3ZB 3TJZA 1N5KA 4W5HA 1GKYA 3I4LA 4A0HA 3QBTA 2AHOA 4BFTA 4EUNA 3Q72A 3T1OA 4B32A 5CLLA 4CW7A 4DLYA 4NCNA 4D81A 5DN6A 2F43B 4GSYA 3EPJA 4TZ0A 5C1BA 4LJ7A 4GZLA 3ZQ6A 2GJKA 3P26A 3GEEA 4RKEA 2BJWA 2D2EA 2BKUA 3RDPA 3CNLA 3ZYCA 1G8GA 5K8LA 1HV8A 1FZQA 4TMKA 4HATA 3OEHA 4G3XA 5ELXA 2YC2C 3C41J 5JI3E 2AL7A 2YINC 2RAPA 2WHXA 4KI0A 1MRNA 3U3RA 1II8A 1XJCA 1XBTA 1JB1A 3E2IA 1G5TA 1D2EA 2IW3A 1P2UA 4LV6A 5FUWA 5CB6A 3B2EA 5H1YA 1GUAA 4PSAA 4ESHA 1XD8A 5J4YA 4Q7JA 5L3SB 4ABYA 3GP8A 3BERA 1TR8A 4RFSB 3LLMA 3T6PA 5FTLA 2PZFA 4KODA 3GLGA 1YR9A 2H57A 1W0JD 1CULC 4G0NA 2OUKA 4A36A 4QHYA 1GG2A 1QDEA 121PA 2WOOA 3DVLA 5DI3A 2CL6X 3TSWA 4IOLA 3C4JA 1NLYA 4PC6A 3AP1A 2V9PA 3RVBA 3IO3A 1GRQA 5FL7D 4HAXA 2EWWA 1XP8A 2WV9A 2REBA 2HT6A 1W5TA 4EFLA 1G6HA 3CONA 4HAYA 1FQKA 4DDVA 1DE0A 1KY3A 4IVPA 4EPYA 5B57C 1GAJA 2R6DA 4KVGA 3BXZA 3Q5DA 5CJPA 4HB0A 1WHCA 3EW9A 3OAAA 4IVRA 2D4HA 3EZ7A 4BZPA 1D9ZA 1OIXA 1J8YF 2YV5A 2CVHA 2RHMA 2F43A 3GEHA 1N6OA 1A4RA 1OB5A 3IILA 1AKYA 1P75A 1S9HA 3AVXA 4PAQA 1LB1B 4BFSA 3K0AA 4A3VB 1Q3HA 1M1YE 4PZZA 1OE0A 3EAQA 2PX0A 4DRZA 1QVAA 2HJVA 4EQ6B 2D2FA 3D31A 5AWFC 3SDZA 4A6PA 1MT0A 2GBLA 2X8AA 1D5CA 4JYBA 2RGDA 1N6NA 3BK7A 4NZYA 3K0FA 2WVJA 5EZ5A 4OQNA 1DPFA 2QUZA 3VTKA 3NBZC 2G0NA 5DISB 2OFXA 3CRRA 2OILA 3I8SA 1HT1E 3CRVA 2OBNA 5G40A 1YZLA 2Q9CA 4LBWA 4FN5A 4KFSA 2R6GA 3AGQA 3B1YA 1YQTA 3THWA 2VSOA 1FW6A 1TU3A 3QJYA 3W6NA 1E99A 1Z22A 3BB4A 2BOVA 1ZV1A 1ZC4A 4L5BA 5JLJA 3THYA 1WBDA 4R98A 4PSKA 3T06B 4MGKR 3LW7A 1NMZA 2BMDA 5D3MB 4YQFA 2ZRIA 2XNSA 1G291 4EPXA 5K8IA 3LW8A 2Z0MA 1W2HA 4JN6A 3A8TA 3NC1C 1BH2A 3RYTC 2ZI7A 1FFHA 3JZMA 3TW4A 2ZRJA 3MWYW 1E0AA 1AS0A 2J0UA 5SZKB 4TYWA 4LC1A 1JEEA 2EFDB 1BOFA 3UWKA 3L2OB 4DUGA 2A30A 3S1AB 4OL0A 2YKGA 2J5XA 3F92A 4DB2A 1L8QA 1F2UB 4QM6A 1F60A 1KDRA 1CIPA 4CZ2A 1YRBA 1AGPA 2EW1A 3SBDA 4U7DA 4LCBA 2B21A 3I32A 3OEEA 5DIFA 1DARA 5E3HA 3U3KA 5A0FA 1WCV1 5CIQA 3M4YA 4B74A 1JAIA 1LTQA 2BMJA 3VR4A 2NMVA 4GZMA 2OOAA 4G5GA 1GZSA 2D74A 2Q3HA 2QQEA 2H18A 2YYZA 4J0QA 5FPYA 1OKKA 2KB0A 2HCJB 2ZANA 2JAQA 1S2MA 1F5NA 3QPUA 3KQKA 3L0SA 3CW2A 4P4UA 2XXAB 1Z2AA 2O0KA 3TRFA 2Y8EA 3U4QB 3LCVB 1RIFA 2W6IA 1AQUA 3WHLA 2R2AA 1EWQA 2DVWB 1ODFA 2A3RA 4TYNA 1Q44A 4FXPA 1JECA 1F2TB 3PIRA 2AWNA 3H4JA 1GWNA 2VHUA 1ONBA 5FBWB 2ZE8A 3GJ8A 4P31A 1MH1A 1CR0A 4F4JA 4JVSB 4Q9HA 1N5IA 4Y0AA 1EFTA 2Q9AA 3ZS9A 5AUOB 1G3RA 4RCZA 2ZUDA 5GADl 1G6OA 1II9A 2QTHA 4DLVA 2G3QA 4ITRC 4Q9IA 4XD7A 5FR2A 1NG1A 1NMXA 5C4MA 4PX9A 2ZSAA 3VR3A 3RS5A 1VYVA 1R8SA 2ZITA 1SVMA 2ZRDA 1NJGA 4QOSA 1Z5ZA 3QG5A 4X8HA 4DSTA 3FHOA 3E5HA 2AD5A 2F3TA 4NTZA 1HQCA 1G17A 3CWQA 1I4LD 2D62A 2G1KA 4NYIQ 2GESA 4TZ6A 3NEJA 1L4YA 5FI1B 2BEJA 5JWOA 1WJ7A 3Q5EA 4DCSA 1UKYA 3GFOA 3U3MA 3EXAA 4JLDA 1SVWA 4TQUS 1GL7A 5G3YA 1NVWQ 1T91A 4ARZB 2ERXA 4HLUA 2JLZA 4HLUC 2JLVA 4RY2A 521PA 4NYJQ 1CJTC 1XEFA 3KQNA 5FPKA 3IECA 1ZD1A 4Q1DA 1ZMVA 1E2MA 5CYOA 2G83A 5DSZA 3AVQA 4RZ3A 4C0LA 3E70C 2XOKA 3IPXA 4TMZA 1CRQA 3RRNA 4DJTA 1O3YA 3THOA 1GTVA 5FTNA 1ZNZA 4O2RA 2ZM5A 1GM5A 1XXHE 1DAKA 2EKKA 3T15A 3LQQA 5BN3A 1AS3A 1T5IA 3CKLA 2ZVQX 4OQLA 3DL0A 2WJGA 4MYCA 1JJVA 4LBVA 1E2EA 1NKTA 2FEOA 2QU8A 3IHWA 2JNHA 4QBHA 2F9MA 2BBWA 4NONA 4MKGA 2HDNB 2RGBA 4ZCIA 2KBFA 2RRUA 3X1ZA 3IHPA 1G18A 1U2RA 2N1BA 4TL7A 5DFLA 1KSJA 3VU9A 3AB3A 5CJ2A 1KI8A 1Q57A 2AK2A 4LHYA 3IEUA 3MUFA 3TVDA 4B47A 2HT1A 2XTMA 4FD2A 2RCNA 2JUJA 2ZJZA 5EE0A 1W4RA 3GLIA 1X86B 3LY5A 4NBSA 1IN6A 2QENA 1WRBA 4QJ4A 4E5UA 2TMKA 3CRW1 1P2SA 4YMVA 1CRPA 1P3QQ 2GA8A 3C5CA 1EFRA 3WXMA 3DKVA 2G6BA 2PX3A 1C1YA 4G01B 4IDQA 5KDDA 2NPIA 1S0UA 4XIGS 2HCBA 1JR3A 3FYHA 5KU1A 1Z0KA 2FE4A 2IS2A 1VMAA 2WWIA 3EZFA 1E96A 3FE3A 1K8RA 2ZTSA 3MWKA 2F1IA 3OF5A 3RHFA 1GVNB 2J3EA 3K09C 3FVQA 4RKFA 2EVWX 2OG2A 1X8JA 5D3QA 2RGAA 4JLBA 1JBKA 4KITB 1NV8A 2IT1A 1D2MA 2O8BA 3EWSA 2UZIR 3GJ6A 3U7FB 3ZVLA 1RC8A 1YZNA 1M7GA 1J8MF 2OT3B 2V7QD 1G5RA 1KJZA 1ZMXA 3DZ8A 4HAUA 1VTKA 3SEAA 1NN3A 3K9OA 1G64A 4V0OA 2H16A 4ZIRA 3I62A 2O8EB 4LPKA 4G1UC 2QNJA 1EXMA 2NO9A 3HYRA 4A0GA 5HKKD 1RYHA 2ORVA 3A4NA 2DR3A 2V4ZA 2J46A 4PZYA 4DLXA 1Z6YA 3PXGA 2ZR7A 2CP8A 3ZZTA 3PITA 4UJ5A 5J4LA 4XTCS 1NP6A 5FL3A 3NHBA 4WAUA 1DAIA 3VNUA 5CDFE 1JR6A 2Q3MA 1G3UA 2VL7A 2X77A 4B6EA 1Z29A 2RGEA 4C7OA 5FH9A 1OXVA 4QGHA 2O8DA 4LJ8A 2LTUA 2R62A 1BMFD 1TTEA 1KDPA 2CNWA 4WBSA 2LKCA 4KXFB 1ZBDA 4KJZA 2A7QA 4KU4A 3IDQA 5DO9A 3M0EA 2QL6A 2X1VA 3NTUA 4JLOA 4HUQB 2ZU0C 3AV0B 3BBZA 1JALA 1Q21A 2ZRHA 4FIDA 4LJYA 4ZKDA 1W5SA 4GOXA 2ZJ8A 1NN1A 3T12A 4DCVA 1G1MA 1KKMA 4URVR 3IBYA 1XJQA 4F1IA 1KI6A 4LWZA 2ZS7A 1LFDB 5F9FA 2ZJ2A 2JP7A 1OF1A 2JEOA 2QPAA 3QF7A 4PTLA 4RD0A 4XWKA 4OYHA 1SULA 1DAHA 4QBGB 2NO1A 4GEWA 2HF8A 4D26A 2R0IA 2GK6A 2OHFA 2BHRA 2BBSA 2JIZA 2VF7A 3GMTA 4IRUB 4P33A 4CEJA 2IYUA 1Z0DA 3U7HB 4CT4B 3TBKA 4GDFA 1KJWA 3FDIA 3HWSA 2C03A 5JRJA 1E79D 4Y0VA 4NP6A 1WE2A 5A4JA 3PCRB 4BGDA 1MO6A 2PZGA 5SZIA 1Z08A 3LX8A 1V5WA 1XRJA 2P2LA 4YONB 2VF8A 4B75A 1ZD8A 2EFCB 4V0ME 4B2IA 5KHOC 5J4VA 3QF4A 4MRSA 1NMYA 4DCNA 1KK2A 2G0TA 3CPHA 1KI1A 4LV8B 4TT3D 3B8HA 2XZLA 2CCGA 4OJKA 3CF0A 3QVVA 3C15C 1DG1G 1U0JA 1K5GA 3C5HA 4TLCA 4LZZA 1P62B 3I1FA 4LYFA 4M1YA 3K1JA 2OO7A 2DB3A 5GVRA 3LAWA 1HY3A 4HDOB 3B9PA 1SXJD 2IF2A 2ASEA 2ZS8A 2WZQA 1G7SA 1IN4A 4DDWA 1E4YA 3QENA 3FGNA 1KHTA 4BECA 2VP9A 4Q19A 2EWVA 1VCIA 1ZP6A 4L15A 2C2HA 3DM5A 3K0CC 4KYUA 2AWOA 3LH5A 3KB1A 1WB9A 2AXNA 5FPTA 2WZJA 3W8RA 2Q9BA 4A2QA 2O8CA 3TUZC 4DBGB 1CEEA 4LYAA 2DYKA 4EIWA 4HAZA 4KLZA 3F0TA 5HE9A 4M9XA 5EUMA 5KNCA 5FBRB 1AZTA 5EJEA 2ZJAA 2WJHA 4AD8A 1JI0A 3OFND 5FTKA 3WMFA 2AX4A 2WKPA 3ASZA 1IY2A 1E1QA 2IYRA 1TQ6A 1DEKA 1XJ0A 2CLCX 5FBLB 3GCGA 1BYUA 2FX3A 2DBYA 3GLHB 4D0NA 4Q7LA 5H8WA 2ATXA 4FCTA 1RJ9A 2IL1A 1X8LA 4OK6A 3PUZA 1W36C 1KZGB 2QP4A 1VECA 4DKXA 4M0LA 2ZRAA 4TMWA 2ZE6A 4DSUA 1A82A 2VIIA 3RAPR 2DAGA 1ZM4A 3ZZ0A 1JJ7A 5FUVA 3OIUA 2XSZD 5AUNB 2WSMA 4CVNA 1FP7A 3AKEA 3SE0A 2HLDA 3PR1A 3T5GA 2QQ0A 3W9YA 3LVQE 3RWOA 4UXIA 4IEIA 5EP1A 1N6PA 3AP2A 1Z0AA 4D25A 4FI3C 2UKDA 1GRNA 1UBEA 3A1TA 3DEFA 3U7EB 4A8JB 4DVGA 4US1R 1YZTA 2QT1A 4LI0A 4WOPA 1Z6TA 4DIEA 1GP2A 2QAGA 4Q4JB 4LRTA 1N6RA 1DO0A 1U94A 1Q1BA 3H86A 4V0NA 2Q21A 4KFTA 1N0WA 4KFRA 5JSZB 4OHYA 1ZCAA 3ZH9B 1R7RA 3ZGXA 2GILA 5FI0B 1N6KA 3T5DA 3QKSB 2A5GA 4K8OA 4CEIB 1BMFA 5F3WB 2H5XA 1SKYB 4BFYA 4A2WA 4XJXA 3SHWA 4BRWA 1ZM2A 1N6LA 2R44A 3UWOA 2CWBA 4F38A 1VEGA 4NCIA 2OBMA 1I4DD 1E98A 2JLXA 4EFNA 2LVOC 1QZXA 2XAUA 3WMGA 1ZW6A 3K70D 4LJAA 1OPXA 3AKCA 4JL5A 1VG9B 4Q1CA 1W48A 3CX6A 4NYMR 2CJWA 2QEQA 4PFSA 3TGPA 1WP9A 4C0KA 3A1VA 1ZNWA 3X1YA 1YU9A 2JLUA 3EPHA 3R9WA 2P65A 2A5YB 2NG1A 1VEJA 2ODWA 4RZXA 3U44B 1E79A 4ZDWA 2OO9A 4URUR 3P1JA 3IIMA 4AC9A 2V6ZM 2B7BA 2O5VA 4OBEA 5JEDA 1MV5A 1II0A 3BFXA 4ZO4A 3RC3A 4Z8YA 2PCJA 1J90A 4LHWA 1G7RA 4B3BA 1OKSA 3CIOA 1NBME 4YMTA 3BFVA 4O25A 3VR5A 1JEDA 4L16A 2JDIA 2YVUA 3AJIB 3WMEA 3B85A 3RANA 4TQ9A 3QVUA 1G8YA 2L2DA 2BKEA 2WKRA 1T8UA 1C9KA 4FMDF 4ZCLA 1FUKA 3QKSA 4CEIA 1QHIA 4P0TA 4M53A 1EESA 2WJIA 1PGYA 1D9XA 1UM8A 3CF6R 3IPYA 4Q9LA 3ZVMA 1SXJA 1CJVC 1CLUA 1RKBA 2PL3A 3KQUA 1G20E 4UNQA 1K5DA 5E4FA 1N5JA 1T0HB 3C16C 4EJSA 3X1WA 2IBMA 3FMOB 4EJSC 1P7CA 2OCPA 3B1VA 2QRZA 4RCYA 1T8TA 3CNOA 3LXRA 4JKYA 2E9SA 2RKOA 4JVLA 4LYHA 3QXHA 4M2LA 4UXHA 3V00A 2P5SA 5DGXA 3MJRA 3CNNA 2WAYA 4CYMA 2ZRNA 1D8TA 2IS6A 2N42A 2DWQA 3H84A 2GCOA 4YXWA 4ZI2A 3N2IA 2L4EA 2PEZA 4LJ4A 2RGGA 5BN4A 3D3QA 2QAJA 2DHRA 4FWDA 2DFNA 1II8B 4F93B 4W5WA 3KZ1E 3CZQA 1XMIA 4WXRA 1A5TA 1SKYE 2AFHE 2VHJA 3TE6A 3CUEF 3U3JA 1AK2A 2DFKB 5KYKA 2G3YA 4Q47A 2FU5C 2UZ3A 2NZ8A 1ESMA 3BB3A 1NKSA 4Q7JB 1KOFA 1T5LA 3I8XA 3VFDA 3PJRA 2V55B 5SZJA 3IO5A 4GP7A 3QXCA 1LV7A 3WY9A 2MMCA 4A2PA 3BIFA 4AK9A 1IM2A 2RH5A 1W2GA 1Q22A 2WPDD 2FNAA 4C9BA 5DI3B 1KI2A 4JLNA 4JVMA 2EJSA 3AF0A 2W0SA 5E7MA 4URYR 2LVQD 3ADBA 1P73A 2J7PD 5FUXA 1N6IA 5EXPA 2QGNA 1N0UA 3LFUA 5CIWA 2QZ4A 5GJWC 2OLJA 4MYHA 2ZUBA 3BOSA 1AM4D 2J87A 3QE0A 4YMUA 1OH6A 4D6PA 3GQBA 4V0KA 3IIJA 4TYPA 4TTRA 4BLRA 4WP2A 4HDCA 5H70A 5JHGB 3ADCA 3ZQJA 3ZIAA 2FF7A 1ZJ6A 1KTVA 1OXUA 5E95A 2JLSA 5JMTA 3K0AB 1OAIA 1XWIA 2QA5A 2ZRMA 3GJ0A 3V4RA 5FPSA 4I1UA 4II7A 1MN3A 5JCZA 3T1TA 4LJ5A 3IKJA 1KO8A 1TPZA 3P4YA 3I73A 2XJ4A 5CM9C 1ZYUA 2FZLA 3SN6A 2GNOA 2YJTD 1UBCA 2XZPA 2ZJOA 2ZR0A 3K0FB 3TSZA 5FTMA 2OCBA 2DENA 2VHCA 2VP0A 5J40A 1M7HA 2ZI4A 4FINA 1DBSA 3CH5A 4PHGA 4QJ3A 1XTJA 3VR2A 2BCGY 2FSHA 5FPHA 3D7MA 4NDZA 2XNDD 2NIPA 4QNRA 2WBLC 3B13B 3QPVA 4CF7A 4UJ3A 3P27A 1OV4A 3THWB 1H8EA 1DAGA 2W6JA 3PEUA 3VKGA 1RRPA 3TH5A 1W1WA 4NCKA 4A4DA 2WTUA 2HEIA 3THYB 2QSYA 3FKQA 3P20A 4H1UA 4IDHA 1ZMWA 2FA9A 1E9AA 1GNPA 2PMDA 1BS1A 3I92A 4HB4A 2J0UB 4BFWA 4F92B 2P6NA 4FMCF 1BVSA 1XEXB 2G88A 5K8UA 4PQRA 1YR7A 4LPSA 3RABA 4LRSA 4HLDA 4WVFA 1KK0A 2GXQA 4PO1A 2Q6TA 3TAUA 2WWHA 4F7WA 2QMUA 4ILEA 2YOFA 3L0IB 2MR9A 3MAAC 5EE5B 2GKSA 2QMOA 4XVQA 5LB4A 5KOYA 2FGKA 1YR8A 2AXPA 1SGWA 4IKEA 5TMPA 3U6BA 4KFUA 4CEHA 5JJKA 5IF9A 5JS7A 5C46F 5JRZA 1VDZA 2AFIE 5AJVB 3KX2A 3NDPA 4JL6A 4MA4A 2HF9A 1R4AA 3D8BA 1QG4A 3GLGE 2GBLC 4RD4A 4GOJA 4D4JA 1ZUIA 2JJ8A 4U02A 4UKDA 4V03A 3DOFA 1Z83A 1XMSA 1IN5A 1ZU4A 3UIEA 5BXQC 1OIWA 2CEAA 3B5JA 3AQ4A 4A92A 4CRWB 2V3CC 4Z51A 2BEKA 4AKIA 3CB4A 1VG0B 2O25A 1Z06A 3ND8A 3QPWA 5H68A 1KDOA 1E0SA 2XTNA 5LPNA 3L0PA 4PC7A 4Q1EA 4EDHA 1PZNA 2EYQA 2WKQA 2GXSA 4LYJA 1OFUX 4JYCA 3VX4A 3K8YA 1A2BA 1OXXK 3DM9B 4NU0A 3CR8A 2F1JA 1GNRA 2GVZC 3W3AA 3EPLA 3E1SA 1X1SA 3BH7A 3EARA 4R71A 3HU1A 2JLQA 2WSSA 5AJWA 1J2JA 4EKDA 2IS4A 4BE7B 2D3WA 1XEXA 3ASYA 1OT3A 3GFPA 1MRSA 2ZTCA 4BPBA 3NBYC 1UFZA 3EA0A 4RD6A 4BLTA 2W58A 3QXJA 3T35A 5JWRA 2DNAA 2X2EA 3E21A 1S1MA 2LVPC 4HZIA 3EPKA 1TQ4A 2IWHA 4PC3A 4DLRA 4GL2A 1WR1B 2O8FA 5DLQC 1G41A 4YC7A 3KJEA 5CB8A 3EASA 1FNNA 1W4AA 5IK2D 1R5NA 2FDCA 3MJHA 4MQBA 3FOZA 2ZJYA 1YLAA 3QEJA 2JGNA 2WJYA 3F3YA 4FWIB 4B6FA 3MD0A 4I1VA 4PANA 1Q20A 1FNMA 4GITA 1ZD9A 3R7WA 3UANA 3U61B 5KSOA 2WWFA 1QF9A 4JBWA 5AJYA 2IYZA 5P21A 1YJ5A 3RWMB 4PHFA 3VU9B 4AURA 4NL4H 4YDHB 2VLIA 1ZM7A 3EC2A 1XMJA 4M21A 4V0LA 3U7GA 4LHXA 3CF2A 1O87A 4ACAA 5BYKA 1EGAA 1LNZA 1R0WA 2IHYA 3GLIB 1OB2A 3GJ3A 4L9WA 5TY0A 4O2LA 2VHTA 1EFUA 2ZR9A 1WA5A 3EZ9A 2HXYA 3A4LA 1DG3A 1V43A 3DOEA 3A37A 5F98A 4UQOA 1W44A 1G3QA 2YWHA 4Q7MB 5KO2A 2KNVA 1UADA 4HUTA 4M9SA 3AUYA 5KNDA 1AJEA 1MR3F 5HE8A 2MROB 4PZLA 2UVQA 1L2TA 5LDDC 2DFLA 3BGWA 5L3QB 5DYIA 1XXHA 3CWZA 5EE1A 4B48A 3WRYC 1IY1A 1D2NA 1GNQA 4PR0A 2QP9X 1W0JA 3PFIA 1HTWA 1KMHA 2DY1A 4X8OA 1S3GA 3AVOA 1NIJA 1XZPA 5EUQB 1FMLA 4HI0E 5AJZA 6Q21A 3HPRA 2O8BB 3QKRA 1IJEA 2VO1A 2V6IA 1M2OB 2ZYWX 3TAHA 5FL7A 2D7DA 3DPUA 3H1TA 5JI2E 3EIEA 2ZE5A 3SBEA 1E9CA 5BWMA 2OAQ1 2PT7A 2VSXA 4NE2A 2ZSEA 2LKDA 4B43A 1NSFA 1E4VA 4DEYA 1KNXA 2B8WA 2KBEA 3BJIC 2GZHA 3KXKA 3K9GA 4ZIRB 1Z07A 4BFVA 3FWYA 4D82A 3UATA 1KY2A 3HR7A 2ZPTX 1KO5A 4WA7A 3KUCA 4DZZA 2CHGA 2K9DA 1ZINA 5L3VA 3ZD6A 2BCJQ 5F2EA 2DCUA 2H8KA 3KJIA 1UJ2A 1OH8A 2P5TB 2ODNA 1JAHA 1IQPA 1CU1A 1H8HD 2I1QA 3L43A 2C9OA 1P9WA 2QMHA 1KO7A 4B33A 2ZRGA 4NHOA 2WJVA 4U5XA 3HU2A 1KGDA 3CX7A 2QM7A 3F5FA 3LNCA 5K8TA 2PJRA 2DZLA 2HJGA 4B3CA 4D4KA 1VG5A 1P9RA 4C7OB 4ON9A 4C30A 1YE8A 3DHWC 1E0KA 2NO6A 4MYTA 4F4IA 2O8DB 3G0HA 2R9VA 4QGGA 3AGPA 2KJQA 4N3NA 4UNRA 3B9QA 1U81A 2FSIA 3WP1B 2Z43A 1RVDA 4A6XA 3MCAA 5L3QA 3GJ5A 1YKSA 2BJVA 1JXOA 1OW3B 2ZSBA 4FWTA 4JLAA 4BQSA 5HPYB 2PLFA 3SI7A 3KKQA 4MGZR 2ZS9A 3AF3A 3CX8A 2DWZB 1DAEA 1KI6B 1UDWA 4HEOA 2CL7X 1WDTA 1RPZA 4IEEA 1G7TA 3U3OA 4DHEA 1RRCA 1Q1ZA 4Q4HA 2C77A 1N3BA 3GLIE 3RNLA 1WQ1R 3CO5A 3OE7D 1XTSA 4M9ZA 2GXUA 4MRVA 1CTQA 4CEJB 2XITA 2VPPA 1OTRA 5LD2B 2H17A 1UFQA 2R6CA 3EIHA 2AR7A 2PEYA 1HQYE 1NVUQ 5CDFA 1JR3E 3U5ZB 3ECCA 4TL8A 2ZJBA 2YC4C 3AF2A 2NPFA 3QF4B 3AF4A 4IOJA 4JKIA 2P3SA 4B3XA 3SZRA 3O8CA 5J4KA 1UBGA 2WOJA 3RRZA 3I61A 5DI9A 5IK2A 2FSGA 5C2JB 4FCVA 3IQXA 1XD9A 1ZUHA 4P3YA 4P4TA 1XEWY 4QL3A 4M1MA 1TUEA 4JJKA 2LBCA 3KXIA 4JL8A 2VP6A 1Q12A 1L4UA 4JLVA 4WIAA 3W6PA 4BUJA 3SQWA 3U2QA 3K53A 5FFMA 4BLQA 2NO0A 1XU4A 5KTYA 2OE2A 3RC8A 1PLLA 1TEVA 1KJYA 4IDPA 2O8CB 3VQTA 4C2UA 1VQ1A 2FFAA 1GO5A 1I4TD 2ONJA 3NC0C 2BBOA 4NYMQ 3NWJA 5DNYB 1VYTA 2FN4A 4GMDA 4I1OA 2JJ1D 2IYTA 1NN0A 4PO8A 1NBMD 5LD2C 3FRIA 1MABA 4IFBA 1X1RA 4YDSA 3AM1A 4M1WA 1J70A 1FX0A 1RJ9B 1XDBA 4E03A 4PC1A 3UMFA 1Z2CA 3I3SR 5J5CA 1W36B 2WM9B 2IX3A 2XEXA 2AKYA 4WW0A 1IJFA 1NLFA 1OLOA 2Z83A 3WNCA 2G77B 3KFXA 4D0GA 1XCPA 3B1XA 4BLOA 4IHQA 4Q4AA 3Q7PA 3FHTA 5G41A 3EZ2A 2REXB 3LBHA 2H7VA 1UPTA 4UNPA 2RGNA 4QGAA 1XF9A 4C0QC 4ZDKA 1TF5A 2CVFA 2B6HA 2YOGA 2YWGA 2C96A 4JLKA 4E22A 2ZU6A 5HZHA 4HZUA 4AG5A 3FB4A 1I2DA 1A1VA 2ECKA 2QORA 1VDLA 1K6MA 3GJXC 3FFAA 3R9IA 4C0AC 2DAIA 1KI4A 4QHTA 4HAVA 4QGFA 4A82A 2QAGB 1KO1A 1AN0A 4B71A 1GL6A 3ZVNA 4Q9JA 1XPUA 2XX3A 2HV8A 3M6AA 1YHNA 1GKUB 3A6PC 5B64A 4K81B 4ZI3A 1XCMA 5KDOA 3TMKA 2KI5A 4M9QA 3HR8A 1E69A 1QG2A 4JLPA 1AA9A 5DHAA 4CIDA 4QJ5A 1OH7A 3MG9A 3SYKA 1UKEA 4AG6A 3W5JA 3UMSA 4RZ2A 4HB2A 3BB1A 1R0XA 2X2FA 1HE8B 2IF0A 4OHZA 1W0KD 1AGRA 2EQBA 4MRRA 2OBLA 3TUJC 1NN5A 3VAAA 1LS6A 3SJZA 1VHLA 1KAGA 3BRWD 1W4CA 1IN7A 2JJ2D 3OIVA 4N0EA 3NVAA 3AKDA 2PCLA 4QNMA 1AS2A 2KWIA 2SHKA 4TSFD 1FTNA 3E46A 3AF1A 2JASA 4TMVA 4O0MA 1ZNXA 2VP4A 2OM2A 3X1DA 2CJWB 3DZDA 3SOPA 4A9AA 4A0RA 1TF2A 3ZZUA 3LCUA 2V7QA 4XH9B 3OE7A 1P4SA 2QPTA 1MOZA 1P5ZB 3ETLA 1NVVR 1E32A 3ICEA 2BM0A 1XTIA 3VKHA 4L9SA 3RS4A 3GPLA 4LRWA 2OXCA 3CLVA 5HKKA 2FPLA 3RS7A 2OZEA 3KQHA 1VEKA 1QBKC 3NIBA 2O0HA 4MDFA 5FBVB 1LS1A 1P72A 2ZEJA 4G5RA 3SYLA 2W00A 2IXEA 1CR4A 2ZSFA 3BWDD 2QAGC 1S8FA 5KPDA 1HUQA 4Q9KA 3TR0A 1WGNA 1U8AA 1T6NA 3QIAA 3CBQA 5IDVA 1HJPA 3PEYA 3QKTA 1E1RD 3AUXA 4FWGA 1QZMA 4P32A 1NI3A 3LQRA 2QE7D 2V8OA 3UG7A 1OHHD 2GEDA 4WZ6A 3BBPA 1SG9A 4QBIA 1WF3A 1Z6XA 2QM8A 1SXJB 1XMVA 2C04A 4YMWA 2C5LA 3HJNA 3P4XA 1OFIA 2CXXA 1J7KA 2G9NA 5DN6D 4F4CA 1Z3IX 4XWAA 4EJSB 3Q7QA 3T1VA 2GHIA 3K9LA 1RW4A 5JHHB 2DAMA 1FMJA 5JWHA 1GSIA 2CE7A 1E9DA 2YHSA 1SVKA 1SZPA 4P4SA 1L7VC 2LVNC 4MKFA 3OEHD 4PO9A 4JMPA 4HDQB 221PA 5TV2A 1P9NA 4DDUA 4ZPXA 4MGYR 4LV5B 1ZVQA 2GCOB 2BC9A 2IYYA 2WMNB 4MKIA 2WWXA 3C8UA 1T3SA 1PJRA 2NZJA 2XB4A 3TK1A 1KI9A 4H9GA 3HP1A 4G5QA 1TADA 1SVSA 8OHMA 2DWPA 3ADKA 1OYWA 4XSHA 4JVNA 2BMFA 2DZOB 3QEOA 3GLHE 1Q02A 5EXXA 4GP6A 1Y8GA 1VIYA 2QMEA 3SC3A 1TNDA 4TT3A 2VA8A 4JIMA 4TLEA 3AVVA 4OI1A 3AEZA 5SZHB
chains in the Genus database with same CATH superfamily
4P54A 5KVAA 5ECWA 5HIAA 4QIHA 4P53A 2A1UA 2KQUA 1Y89A 1HNXB 3GEMA 2AMVA 2SCUB 1FA9A 1NX9A 4RPHA 3GJQA 2YFQA 1EK2A 1Q2XA 1UAGA 1EVEA 1XEWX 4RL6A 4JUBA 5LXTB 2RONA 1FLAA 4YVFA 5FUMA 4GLJA 3KLOA 4YQZA 4PLYA 2I4NA 3TLBA 2BWJA 4KXVA 4G3OA 1FPMA 4NK4A 4RM3A 3LCCA 5DYTA 5KNBA 4H0FA 2YIMA 2VOJA 2HA2A 1EJ2A 1XK6A 3N1UA 3PF9A 3ZVRA 2Z5FA 4BB9A 3VR4D 3AXSA 4O63O 5EIBD 4EATA 2J9FA 3DAGA 1XB2A 2PV7A 4Y9TA 1A9YA 3ZLTA 3AP3A 4INOA 1T1IA 3VI4B 1V3QE 5CD9A 5IWCA 4XD7D 4LDQA 5HFNA 4XEUA 3TB6A 3DKPA 3KL4A 3KQLA 3LW5F 5FADA 5G4LA 4KIGA 2GYWA 2YMMA 2DPMA 1DRKA 4UBNA 5AK6A 3O4FA 1KARA 2O57A 3I72A 3KXLA 3O2QB 4HAOA 1NBEA 4D98A 1SQ6A 2E6KA 4MCAA 5IJZA 5AUPB 4N6GA 5F1KA 4EB3A 5K4HA 1BE1A 2BKVA 2PH5A 5H5JA 5AHOA 4GR5A 4A0FA 4AX8A 3A3YA 4MITA 1A96A 1MX1A 1DXYA 1IHXA 1PCXA 2RAVA 4YCMA 3T7RA 1DCFA 1YIAA 4L02A 2OAEA 4M49A 1MQ8B 4IUBS 4PSVA 1WKCA 3P0JA 2VJNA 3PPIA 4GOKA 3PQCA 1C30A 1TMYA 1FSPA 4FP9A 1DQZA 2VC2B 2I3BA 3O2NA 4TMFA 2NOAA 3KSAC 5D6OA 1JFRA 1GN8A 4M1OA 3SF8A 3AI1A 2PZJA 4IDOA 4BZXA 2ERCA 4IBOA 4IINA 1CS0B 1MEJA 1OXSC 3U7IA 3O84A 3FYDA 1I6LA 1Q7TA 1E20A 1SC6A 4YRDA 1MAVA 4L07A 5CK4A 4ENSA 4H60A 2P2YA 3A4MA 4CISA 2CMDA 2D2VA 1NULA 5LYYA 3TN7A 1GGMA 5BW5A 2G5GX 1BXKA 3TMAA 1EHIA 2ZUSA 2QUKA 4RGVA 4HWKA 2CCJA 3NG1A 4AULA 4RQTA 4ZT3A 4ENQA 1W5FA 3OZIA 2VQFM 4LNUB 1ZNYA 2QRVB 2O7NA 3OLWA 2GRJA 1DJLA 1ORVA 2XLCA 5JS8A 3PYXA 3E2PA 3KAKA 5TPWA 2WJAA 2Q4BA 1G4UR 3B5EA 1AZWA 1MVOA 5J2UF 2AG6A 4Q00A 4B81A 4XX0B 3G2KA 2V7VA 2FG7C 2YN0A 4QECA 3T4UA 1C9NA 3VX3A 3ICWA 1QQWA 4CMEA 1DZ3A 2YUTA 1EWYA 1SUEA 1HETA 3GLSA 1J21A 2I6GA 1SUAA 4A5OA 2C95A 5KWIA 3A1SA 2Q07A 4QBKA 1B7GO 3NORA 4LF7M 2OM6A 4V02A 4OXKA 2V7EA 3ZS8A 2GFQA 3EGOA 3DFKA 3WHKA 2WU0A 2PAFA 2AN4A 4H77A 5IFLA 4I3GA 1EFKA 3HBMA 3HVJA 4B6OA 3LDUA 4D56A 3IEVA 1DJQA 2YN2A 3S2FA 1E6MA 4D3XA 1JF8A 4QODA 1K98A 1B76A 1Y4UA 2PSHA 3NEYA 3RO7A 2QSZA 3A06A 1TVKB 4NMXB 1GGVA 1YE9A 4FKBA 1LU9A 1JFTA 3AEKA 2MSCB 5JADA 2LPMA 2HJSA 2AG1A 2VJPA 3A1DA 2SKDA 4JLMA 1LJ8A 2W7TA 1UT6A 4DNPA 2JDID 3TTWA 1CWUA 1KMNA 2QF7A 4GR4A 4YCBA 2I6XA 3HZJA 4D9HA 1BWRA 3QP9A 2Y0BA 3WV5A 3NTLA 4U2CA 4NZMA 2MSLA 4NPCA 1O6ZA 4M60A 1ZMUA 4H1WA 1SKQA 2N75A 1US8B 2NNLD 5FA6A 3HXOA 2Q5FA 1P2TA 3JQCA 2GPAA 1I6MA 5G3ZA 1E4EA 1EFVB 4E7OA 2RGRA 4LFAB 4PLGA 3SLRA 4I5EA 4ZVSA 3AQIA 3DXZA 2WZDA 3EQ2A 2F8SA 4B4OA 3FRJA 3K7EA 1UOEA 3AY0A 2JZ1A 3B6EA 1CRZA 4TV8F 2XMCA 1JTFA 3CPJB 1AQYA 1M2NA 4EI9A 1KMQA 3M6WA 4PHCA 3SNHA 1FFCA 1Z47A 1Q92A 1SHZA 4TLDA 1AKWA 4KLRA 1IMOA 1IBKM 4JU8A 1P0IA 2ZCJA 5A5EA 3GLRA 1XYGA 3B78A 5DCLA 4PWYA 4QUJA 3OJCA 3GGSA 3UXHA 4NK5A 4EITA 5EKUA 4MZDA 1VKJA 5K0EA 4BVLA 2XMPA 3WHIA 2RBGA 1UBTS 1Z8FA 5F3WA 2Q3CA 2VZLA 1R0ZA 1XWWA 1BYIA 2OGSA 5A2QA 1YQQA 3GXBA 5A7HA 4OHVA 1ZONA 3K2LA 1C4OA 3TLCA 5EXSA 4Z54A 3MILA 4FFRA 4YS6A 3MS2A 4F3KA 4YRIA 1DEOA 3M5DA 2EJWA 1QHNA 4FMPA 2R8PA 3BL8A 3BJZA 4IV0A 2WIGA 1CQWA 3KYJB 3ISVA 3H2YA 4Q02A 4IBJA 3TEJA 1C7YA 4TS3A 3EBLA 3EXG2 1N5KA 4WZBA 5CLLA 2AJ8A 4RKEA 4UZEA 3ABSB 3KQSA 3LLSA 3M81A 1QYWA 2P41A 4LF8B 3U3RA 4FEEA 2NXNA 1G5TA 5H1YA 4WD3A 1APBA 4JDPA 2VYND 5KNDD 1L9XA 3TPZA 3B6JA 4D44A 4OFXA 4AECA 3WWEA 3MK31 1PGOA 2W8BA 2CDCA 1FMFA 4ODIA 3RFFA 2CL6X 5T5QA 2RI6A 3TZCA 3AUSA 2C2ZA 4EFLA 1G6HA 4IVPA 2P9JA 1LKZA 4BZPA 2GFHA 4EA6A 2JKVA 1Q3HA 2JFGA 2X7HA 2XZTA 1N6NA 4NZYA 4KRGA 1VL8A 1SZDA 1D5WA 2GO7A 4ER6A 1NNLA 1E1DA 4LBWA 4KFSA 4TMYA 1X1QA 2XE8A 5K05A 5JLJA 3Q2OA 1WBDA 3LW7A 1HDIA 2QYHA 4R8SA 1FFHA 2HM7A 3MWYW 1M6WA 3R75A 1ABBA 5AXAA 5CVJA 1Y3FE 4DBVO 3P45A 4LCEA 2ZZNA 2FVYA 3OEEA 4H3VA 1LTQA 3IL2A 1KGSA 2HRBA 4P4UA 5BN3B 2R84A 2R2AA 4LXTA 2CUZA 4CIVA 4CT0A 3I37X 1WLYA 1G3RA 1F8FA 4KXXA 5C4MA 4B7XA 2QOEA 5AO9A 1XZKA 4X8HA 3E5HA 1A72A 1GZDA 5K0ZA 3W4IA 2FWNA 3UO8B 1S3FA 1OLUB 1U0SY 1F7UA 2VBIA 2ZIFA 3HY6A 4RY2A 3KV3O 3ZLVA 3LKDA 3UFBA 2QUJA 5TQ0A 1GQRA 6REQA 2XOKA 1R27A 3L7YA 3RJ5A 1DAKA 2EKKA 3F8SA 4NECA 2ZVQX 1LC3A 4HPJB 4D8UA 5C7IO 4GI5A 3ZXUB 1F1JA 3K0BA 3T9EA 2QUAA 3IAHA 3OLXA 2R6HA 4U3JB 3K96A 2YZ7A 3LY5A 1IN6A 2HL6A 1IHYA 2GA8A 3C5CA 4L0DA 4BKOA 4WFQA 1FRVA 5KDDA 5FAKA 3SQLA 1ONOA 3EZFA 2ZTSA 2G1AA 4LOHA 4G4GA 4LGYA 2EVWX 2TSYB 4F06A 1WPQA 3DOUA 1E5QA 2UZIR 3GX1A 3U7FB 4RIFA 1M7GA 1OLXB 1I3MA 2M32A 2CEKA 2CB0A 4QVIA 4BNVA 4U63A 2O07A 2ZR8A 3CN9A 1PJIA 3A4NA 4L5CA 2J46A 1KMMA 3KOZE 4AJ4A 4BWVA 4CM9D 4JQCA 3AF6A 1QRRA 4B6EA 3P2MA 2O8DA 1KDPA 3C7TA 3C7CB 2NP7A 3BGOS 2OOKA 3AV0B 1JALA 3V55A 1OF1A 2V5VA 1P33A 4WX2B 1X0XA 4P33A 3GMTA 4DLLA 1MB4A 2HPZA 4WADA 1JPUA 2IQ5A 1XRJA 5BWBA 4DA4A 3U7RA 1MT3A 4Z6YA 3CRZA 4BMVA 3N0WA 4YUYA 1U0JA 4X63A 2CT8A 3H2KA 2FUEA 3LAWA 4DARA 4FE4A 4TN5A 3U7QA 4OATA 1Q7BA 4G6ZA 5SY9A 5ALGA 4L8YA 1ZGBA 2PUJA 5DNYA 1RVV1 3NALA 3O90A 5EVJA 1DX9A 4L22A 2P9CA 4EKIA 4Q7LA 4E51A 3MTIA 4EG5A 4RGYA 3PUZA 2WT9A 4J8PA 4A5SA 5C1IA 3MJ4A 2JI9A 4R05A 4DW8A 3ZDAA 4OAOA 1DGFA 4RY0A 1Y1TA 4MQ4A 2X0JA 1Y9EA 1Z0AA 2NQ8A 2UXCB 3DEFA 4HN4B 1FYXA 1GP2A 3RUEA 4A91A 3DNFA 3AOEA 3JASA 4OHYA 2J6BA 4ANFA 1JL3A 5K01A 2H5XA 3FBWA 3GFQA 1BX1A 3SC2A 4C7MA 4JOQA 3C3PA 4EGQA 5KTRA 4OXQA 1ZJ5A 3KOOA 3CZ4A 4LJAA 3LHKA 1YFLA 3VV3A 4CHTB 4ZQIA 5D1HA 3OCZA 2PSEA 4WZAB 3IIMA 4R5MA 1WXGA 4OBEA 2ZULA 2PCJA 4MUEA 3ACDA 4MEAA 3TWMA 4UVGA 3C3XA 3AX6A 3KYCA 1JDVA 2ZBPA 3RANA 1EE9A 3PGVA 1QHIA 1EESA 1PGYA 4CL0A 3KOUA 3LUAA 1GZ4A 1YZYA 4EJSA 3QUQA 2OCPA 1UMCB 2BRUA 5KYGA 3I2KA 3FOWA 2R8EA 4EA9A 3UQZA 2DHRA 1Y34E 1II8B 3UC5A 3U3JA 3TE6A 4Q47A 5CH5A 1V7CA 1GZVA 2EBHX 3HQ4O 4X9XA 1H3NA 2Z2XA 4HH1A 4E1BA 2CXRA 3WY9A 4AK9A 4CLHA 1I1NA 3ZWBA 2UUBB 3LYAA 4F8JA 3AF0A 4K9RA 5ERGB 5FUXA 1OFGA 3CJQA 4L5AA 1L5WA 1U3FA 2JVKA 5F23A 2CUTA 4BLRA 2H4YA 3STHA 1MW9X 3GJ0A 2AJCA 3AESA 1RWXA 4II7A 4IX1A 3T1TA 3IKJA 4KXMA 1B93A 4JA0A 1IM8A 1ZRNA 4QJ3A 3A7DA 4BV3A 2ZK7A 3PNMA 3PFFA 4GX5A 4UTPA 4V3CA 2PRIA 4NCKA 2IDMA 1FFXB 1XVTA 4O4JA 1B74A 1KEEA 2P6NA 3QVSA 3A7EA 1EDBA 1C50A 2ZYAA 4OVZB 4MB6A 3VYWA 4XPIB 3UWDA 1FZTA 1K89A 4IKEA 4MUHA 3ZHCA 1QG4A 4MS3A 1K92A 1H2BA 4AKIA 2O25A 1Z06A 1TLFA 2E48A 5EIHA 3HN2A 5J2UB 1OFUX 1CY4A 4XUDA 1X1SA 3BH7A 3HKBA 5F7JA 1PVDA 5FB3A 3O75A 4UU0A 3HKCA 1ECJA 2F1KA 4BVEA 1MO2A 1LQUA 4DBLE 1Y4SA 3SVZA 3FDZA 3EASA 1PG5A 3TOZA 3PPVA 3FOZA 3V32A 3F3YA 3TLGA 4I1VA 1FY2A 5A3VA 5HUHA 4PANA 1EWVA 1ZD9A 4HL4A 2OV4A 4X93A 2H2AA 2Q46A 1DC5A 1VL0A 3WK4A 1H3FA 5JD4A 2C9ZA 2DSTA 2QN7A 2R7KA 3IULA 3IE2A 2RHCA 3CQ9A 1K7CA 3M6XA 1KFVA 4H16A 2H00A 5ALPA 5BV1A 1UADA 2O1WA 4PZLA 2KEBA 3FWNA 1W0JA 4UEWA 5CT6A 3PDCA 4IZHA 5LZ5A 3W6UA 2FJ0A 4MW1A 2XIQA 3FUCA 2KBEA 3R0XA 3GH1A 2VK8A 2RI1A 1SD2A 2WV7A 4O1IA 3L84A 4F2DA 1VZ3A 2DCUA 4X71A 5GINE 4MXDA 1FFBA 1P9WA 2QMHA 5F7XA 1KO7A 2ZRGA 3EQ7A 2P0AA 4MPDA 2PJRA 2HJGA 1R6VA 2W4IA 3V6MA 2FQ1A 3P9IA 2HF2A 1OW3B 2WP0A 5I9MA 2JGEA 3GHHA 1OZHA 3MQ4A 1KJJA 2NZWA 3RNLA 4KE6A 4FFOA 1A1SA 2D54A 3AFIA 1TIKA 4EY6A 2GWRA 5LD2B 2K47A 2EL9A 3ONFA 3HJUA 1U1CA 2R47A 2QT9A 3AF2A 3O8CA 2WOJA 3WGJA 1FQWA 3FMGA 3RHZA 1TUEA 4JJKA 3KXIA 4QO8A 4AG3A 3DDHA 3W6PA 2XHEA 1JJFA 3WWZA 3W5AA 4WASA 4WLVA 4E2XA 4D8XA 2I80A 1AXEA 3SG0A 1JHMA 3HB1A 2FN4A 3MHPA 4JLUA 4II2A 3WB0A 4DHWA 3E8MA 4S04A 1LSSA 4PX3A 2BM8A 4TV8B 1YZHA 3IIEA 1Z2CA 3UCEA 3JRXA 1PRBA 2WVAA 4WW0A 1NLFA 4HH3C 1UPFA 4C0QC 1VMKA 5DTMA 4E22A 1P0FA 1O5TA 5IVDA 2I2DA 2LIPA 1Z8NA 2EJBA 2IU4A 4UUAA 1VXRA 1XHLA 3QYAA 5LJIA 1GKUB 1DT3A 4K81B 5B64A 1FYEA 3Q3GE 4JLWA 6GPBA 3WJ1A 4M9QA 3NYIA 3K6JA 5FJJA 1H1DA 4YRFA 1GAWA 4CM4B 1NN5A 1IQ0A 4IMJB 1VHLA 4RMIA 5KJEA 4UVEA 3G5AA 3PFKA 5JNUA 4RSRA 1P4SA 3UGQA 1MOZA 5C7OO 1U02A 4GIPA 3JW8A 3NP9A 1QBKC 3CE6A 2OORC 3QI7A 4G5RA 2IXEA 4OHRA 2V7PA 4BWFB 3PYMA 1YB6A 2QE7D 1ULZA 4R8RA 3F74A 3T1VA 5IKXA 1A8PA 3FYTA 3T3GA 2YHSA 1PFQA 1YL6A 3OQJA 1XZNA 1K8XB 3O82A 1I7QB 2ZTUA 2HTFA 1XA3A 3EGXB 1YA4A 1JAYA 3KP1E 5AW0A 1YS4A 4JVNA 1N2JA 4MEBA 2DQYA 4QAQA 4CR6A 1QP4A 2C5BA 5JFTA 2H1LA 3PIDA 4URWR 5JJ5A 2BKXA 1AKTA 4KQWA 4I81A 3LV8A 2WKSA 4M1KA 2ZI6A 2AK3A 4H6PA 4YT5A 2HLNA 1XHFA 1NHGC 3MXOA 2JHAA 1LLDA 4K6OA 1QGUA 1PZEA 4L6CA 2VZ8A 2C61A 1TC1A 4K0RA 5JU6A 3LG2A 4ZAXA 1SCKA 2XUPA 3DAFA 2I4LA 4DJEC 4L4UA 3ZJYA 1U3CA 4KSBA 1T2AA 1PWYE 2QBYA 5KDLA 5AK0A 1RLMA 5BV0A 4CKEA 4EVSA 5LU8A 1PJZA 2SCUA 3WICA 3ZNOA 5EJ4A 3BL6A 5BV2P 4OUKX 3OJFA 4ZTUB 2XFTA 4TWZA 3G2OA 1T6ZA 4J6FA 4G67A 3HM9A 4AP5A 4WZBE 1FYVA 3CLKA 4Z0NA 3T9FA 4DCUA 3EPRA 4QAJA 3AUAA 5KC9A 5AW9A 4WI1A 1R0YA 5HGJA 1C7IA 3B7GA 3MVEA 4YRGA 2FZ4A 4HTAA 5KINB 4YUAA 2Q62A 2IV3A 2D5IA 3IFSA 1PSDA 1B15A 3VOAA 1PJTA 3FCYA 1J33A 4EG6A 4I8XA 5HQTA 5LMZA 3SLGA 2VCYA 5I9TA 3PVSA 5J2TA 1HE5A 4M38A 5HM6A 4POAA 1TYZA 2QV7A 4NU6A 2AC4A 3ONWA 1U8CB 1ZAKA 2C97A 5F1YA 5D85A 1EFRD 2JLRA 2EFYA 2JY8A 1MQAA 4D8YA 3PE3A 4ITVA 4G1EB 1V16B 2O7RA 5KHAA 4BX9A 3BDVA 3PVZA 1ORWA 4DC0A 3QA3E 3FUUA 5C1DA 5AM4A 3T54A 3SFVA 4DLTA 2WPDA 1Z35A 4IJMA 4PSUA 4LFBM 1RXCA 4MWSA 2PS9A 3RVNA 4ZVNA 4TSKA 5ENZA 3SBOA 2Q7XA 5FOVA 1WQ3A 2C2KA 2AOXA 3N2GB 4DPLA 2RIPA 4E94A 4BAZA 1QKKA 2FH5B 5DBIA 1FU7A 3L8YA 1QGYA 1V7ZA 5CVVA 1K3WA 1UM9A 5EE3A 3VC1A 1EK0A 1EUCA 1X80A 3E8SA 2A84A 2YJZA 3E5RA 5LP6F 4EGJA 4D5GA 2XRYA 2EFGA 1IXZA 1S8AA 3F6RA 1OAAA 3H4IA 3AEQA 4YROA 2VZ9A 2FWPA 2WI8A 3WKBA 2B1IA 3UM9A 4ER3A 2XTZA 2OYCA 1Y48E 4R3WA 1F48A 3MHVC 2G4LA 3N53A 3FCEA 3NBAA 1T6XA 1HNZB 4X20A 1RHQA 4AYXA 1L1FA 3GPBA 2NTNA 3DEAA 4L0QA 4BLWA 621PA 2ZIAA 3LVRE 4L57A 4WNYA 1O97C 3CFYA 4DSOA 3UVEA 4W7HA 2E4UA 1RI1A 5JAZA 4Z9AA 3BE5A 3QYEA 1N4AA 4MVJA 5B3AA 4OFWA 4C4XA 4CGYA 3LPDA 2PIDA 2PBRA 1BEUB 3R20A 4POOA 3WBKA 4JY7A 5JFGA 1XZAA 1YIOA 2BFCA 1IUNA 2JATA 4LE2A 1XKLA 4WK2B 1IRXA 4ZV4A 2FJUA 3OC0A 3FTFA 1IDN1 1FRFS 1VB3A 2CFTA 1Z5VA 4XIJA 4BLPA 2B78A 1WVGA 1RPNA 4YI3A 2BGJA 4GBGA 3DFIA 1O9BA 1E8NA 3S1SA 2QROA 2AI1A 1E9FA 2AG8A 1ZIOA 4ZQGA 2W4QA 4H3SA 1Z5UA 4WLFA 2SNIE 3ESAA 1WDWB 5KUTA 3D5TA 3EEYA 3FROA 5DHPA 5C1PA 1X70A 1JDJA 1GILA 1WY7A 2P6RA 3A45A 5CLQA 3LUHA 4NC6A 4EQZA 3DEZA 4DE5A 4RF0A 3LGAA 2HI0A 4Q03A 3CZRA 4CM8A 4JDUA 2WF9A 2BV3A 3VKWA 5FUQA 2WMOB 4NEHB 1H8HA 1DKNA 5FR1A 3RSHA 4JOCA 1T25A 4MUAA 1JQLB 1XPRA 2CE2X 1VA4A 2HN9A 4D0LB 2C98A 3HCDA 4UFPA 1NPYA 3GWGA 2EWMA 4BUZA 1KYTA 4M87A 4YMSA 3GRYA 2XF8A 3NNSA 1HE3A 1FJGB 4INZA 3SKVA 4DCMA 5E7JA 5AJXA 1GARA 3ZYZA 5FYQA 3V8NA 1EEXB 3HCFA 3BIXA 1S1CA 1QZUA 3QNMA 1PI3A 3QH4A 2QVCA 1RWBA 3QXSA 2CMHA 1IAQA 4OL9A 1Q84A 2HC9A 3OF2A 1Q74A 5GJVC 1Z0ZA 3ZIAD 1Y1LA 3BD9A 5JZVA 2I6UA 2R6ZA 1TM3E 1Z0SA 4JB8A 3HL0A 1Z38A 4BNTA 1XROA 3DAPA 1US8A 5KSPA 1YUBA 3FA2A 1H9CA 4R2IA 2OOSA 5DBFA 2BEVA 3X1MA 1NR7A 3DUWA 3ZWXA 4XVUA 3G7UA 1QHGA 2V1CA 2Q6KA 3N86A 4C88A 1AT1A 3UAWA 4OTZA 2FZVA 5CB0A 4JMLA 5K8VA 2I67A 3C2QA 2G25A 2L7HA 3DR5A 1XCJA 5ALUA 4OQXA 5AKEA 4I99A 2WLSA 2R65A 5L53A 2X9GA 4M8NE 1RRMA 2VHWA 1E8MA 1O9HA 5LYJB 2F55A 1U98A 5CIYA 3T0GA 1DV0A 1VDDA 4GWGA 3EZ6A 4UOZA 1COWA 1FP4A 1DO2A 5KNLA 3CEJA 1FMCA 4MWEA 4UNNA 2AKAB 2E5WA 1FDUA 3JQRA 1M8KA 3PFCA 3S0JA 4DNXA 1PS8A 2QD5A 3FFBA 5ISMA 4KN8A 2ZRFA 3IV9A 2WWTA 3X43A 3SS9X 1XJWA 1OBHA 3ZI7A 3KL2A 3W5IA 4F4HA 1HQDA 3KUDA 1ZR4A 1C8VB 2AS0A 3VOTA 3CY6A 3I0MA 4CW7A 3EPJA 1P2DA 3GEEA 3CEPB 2P35A 1I13A 5A03A 5LMUM 3UJ6A 5JH7A 3ETGA 3C41J 5CNJA 3EE6A 1N34M 2IW3A 5CB6A 4ZK2A 1WXDA 5JANA 5JNVA 3U0BA 2WDZA 1XMOB 4CMIB 2DX7A 3GCZA 4RS4A 2PKRA 4N5HX 4ABYA 3EEOA 1R18A 5FNVA 1DU4A 3EXIB 4Z4IA 1SXIA 2P27A 2CMFA 2H1FA 2PZMA 1YR9A 1WJGA 3RIHA 5BYAA 1GG8A 3WBFA 1GFSA 4IQ8A 3WTBA 3C4JA 3NS7A 1W94A 4IS2A 4HVLA 1SHUX 3BXGA 1K7SN 4A8TA 1DE0A 5B57C 2R6DA 3K9QO 4Y6QA 2QRUA 1WHCA 3BM5A 3R3XA 1WP4A 3SYMA 3QEAZ 5EPEA 4EYGA 1PR5A 1PTJA 1YI1A 5BPFA 1QVAA 4A6PA 2V3VA 1LVUA 1OT5A 3ROQA 4OVKA 3ZCXA 1QYDA 1FVFA 4DV0M 2BOVA 1ZC4A 3NUQA 4QGSA 4K5QA 1G291 4EY3A 4X45A 4G4OA 1PG0A 4P16A 3PQ4A 3L2OB 3RUPA 4DUGA 4QT0A 4Y2PA 1CB0A 3VPSA 1LX6A 5LQRA 1ML3A 4Q9NA 4CZ2A 1EIWA 2UAGA 5A62A 5CIQA 2UXBB 4JLSA 1V2HE 3DQQA 4YRKA 4KOAA 4YRBA 2BTQB 2D74A 2P4SA 5T4HA 4UU1A 5ALEA 2ZANA 3ESBA 3LHDA 1Z2AA 2HDHA 1JQAA 3N87A 3PIRA 3JQ7B 1EUDB 1VGRA 5AUOB 4XIIA 5BQPA 1HQCA 3FFXA 4RVNA 4OOEA 2BEJA 5JWOA 4IJQA 1EQ2A 5A9RA 4JI6M 4F4FA 4NYJQ 4OY3A 1ZMVA 1B8NA 2ZJ7A 4NIMA 1CRQA 5LMNM 5EUBA 4CQMB 1O3YA 5KTKA 3OURA 3OHSX 2JCYA 5BN3A 2ZYIA 5K3DA 1OC2A 5ECYA 4AN1A 5A9TA 2J5YA 3IHPA 4FFNA 2UYYA 3K2IA 5CJ2A 5HP4A 3UCFA 1MC1A 3DUFA 1NYQA 3A2MA 1QR6A 5BNZA 3LVWA 4ZHQA 1ZIXA 2CKMA 1L6IA 5KU1A 4G0PA 2NU7B 1ZAYA 3IBTA 4ZEMA 1QIIA 3GLKA 1T5OA 4HQKA 3UY4A 4UPDA 3K9OA 1WB4A 2DOKA 4DM3A 3ZE2B 2J4DA 1MPXA 3QITA 3K20A 4C4ZA 1WB6A 2AC2A 1NP6A 1FC0A 2FLKA 1K7EB 2RGEA 5T67A 5M5BA 2PQ2A 3D7NA 1N2ZA 5M2QA 1PR4A 4LJYA 4ZKDA 5KTSA 2DTEA 2P4HX 2EJVA 2HF8A 3EDYA 1QXSA 5AKZA 5KTNA 1NW3A 1HSZA 4BNMA 2GN2A 4BGDA 1PEKE 2FSUA 5LOVA 2EP8A 3DMGA 2G0TA 4LV8B 4OJMX 2RSLA 4TLCA 4LJRA 5DGCA 4PSDA 1Z8DA 3I1FA 3AY7A 3FB1A 3SCZA 1P5FA 3ESZA 2DHQA 4Q6BA 3EVCA 4YV2A 2TECE 3K0CC 4XJVA 3AV0A 4CUZA 3HYSA 5IEBA 1UP4A 2Y4NA 1JFVA 2WKPA 1I3NA 1WMDA 4D43A 1UJMA 2KM1A 2FW9A 4KQHA 2Z1NA 1C0PA 5LNK1 4XIFA 5AYVA 3B7QA 3K1AB 1A82A 3MTEA 2ZSUA 2CYAA 5HJ7A 2Q3JA 2A0KA 1FS6A 2AUMA 2REQB 1T9DA 1Z5NA 2QTMA 4A8JB 3L7JA 4LI0A 2DUUA 4LRTA 1DUVG 4PRKA 1Y37A 4F46A 4RBNA 2XLBA 1V11A 5YASA 3PFHA 3SHWA 1Y1SA 4CTKA 3PEFA 5DEOA 2EXXA 4DXHA 4EFNA 2D1RA 4JL5A 4U4AA 3CX6A 4AU1A 1M2HA 9LDBA 1HZJA 3R9WA 2A5YB 3NHWA 4J1QA 1RHKA 1YUNA 4DV3M 1II0A 1MIOB 4J90A 1JIJA 1G21A 4U6SA 5IYZB 5TGDA 1FUKA 1T5DX 3C3AA 5JLAA 4F2PA 1CLUA 3KEQA 2E4WA 1QF7A 2R86A 5EIFA 4UDOA 2B83A 7CATA 2IBMA 2HHJA 2FRVA 5FULA 1WUTA 3RTAA 3U31A 4R31A 3LXRA 4QWWA 4JVLA 3SSOA 5DGXA 2WAYA 1QGED 1U5BA 1KR2A 1NYRA 1TK3A 5K3FB 7REQB 3D43A 5CURA 4F72A 2ZUFA 1GZ7A 4R8MA 4RDXA 2ZKLA 3KWLA 3WK6A 3AU9A 4MYHA 2BD0A 1JEQB 1MZPA 2CHUA 4QU8A 2HBQA 4ZYUA 1T2EA 4HDCA 2JFPA 2VQ6A 3ZHYA 1OAIA 2ZRMA 4X61A 3ZY5A 4YRJA 4DR4B 4DWVA 4DV2B 2DENA 2VHCA 3PNKA 4AX4A 1E7QA 3VR2A 3VR5H 5LP6B 3E3NA 1U7XA 3EVTA 2QZ9A 3R2JA 3RAEC 2WTUA 2LZ0A 1F8YA 2GOYA 1E7SA 1IVYA 4JN6B 1XNGA 1ABEA 5KJ1A 3KTDA 1XRSB 4CEHA 3QUTA 1MB3A 4LFCM 2FZ5A 3FSGD 3WNZA 5CP8A 1NXQA 1UBNA 3ZK7A 1SIUA 4GOJA 3JAKA 3TIGA 2C3UA 4DBZA 1L2BA 5AQEA 3DVRX 1SEVA 3AT1A 1ZIYA 3LF1A 2ONYA 1P7PA 3ORRA 1VJGA 1C3XA 1UFOA 3I6IA 1K08A 1OWMA 2GVZC 3W3AA 3EPLA 1NJ2A 2A92A 4RNCA 2IPAB 2BHSA 2SKEA 1R2YA 4WCFC 4ZCTA 4HDKA 5MN5A 2O1XA 3CF6E 3N0TA 4UCQA 4ZOEA 1RXIA 7GPBA 4MQBA 1EUQA 3L46A 1RM3A 4XGQA 2WTNA 3KWJA 1YB7A 4AURA 5JAHA 1ZM7A 2W5UA 3WG9A 2P9BA 2VI5A 4F2HA 4L9WA 4GE3A 3R0QA 1UJBA 4GPD1 3C3WA 3V8PA 1G3QA 2YYAA 4F9TA 1QK4A 5JNRA 3NHLA 1HG1A 3WRYA 4BO6A 4G36A 4AMYA 3M4NA 3HPRA 5JE8A 1JDBB 1JQ5A 4LQDA 1I8TA 3T7AA 4DR7M 3UHJA 4DEYA 1QBGA 3UATA 3F98A 3G8AA 4DKJA 4I4CA 4B3RB 3AIOA 3VI3B 2ODNA 1CU1A 3SS7X 3FPJA 4XDYA 1RQXA 1ZK2A 1Y8RA 4U5XA 2E37A 2DZLA 1N7JA 3A6EA 4X62M 4ON9A 2JA2A 3GGPA 4N3NA 3W5HA 1JB0F 3GPIA 3C58A 1H2EA 4M99A 5CG2A 3R0IA 2K4MA 3AF3A 4YMIA 4MVJE 4Q4HA 2GD6A 3GLIE 2OV6A 4FQ8A 5DU2A 1Y81A 3PUJA 3ZNNA 5IH3A 1I5RA 1VDMA 3UZUA 5HZGA 3RFWA 4JI5M 3KKKA 3OIDA 2OV1A 3RUAA 4AJEA 5DRYA 1LBHA 4JP8A 4TS4A 2ZBUA 1GPBA 1GSOA 2VPZA 3SQWA 2J3QA 3K53A 3Q7SA 3N6XA 4C6SA 5KTYA 2PH3A 5F4BA 2QM0A 1RYBA 4AO8A 4C2UA 2DLCX 5CX1B 2Q45A 1RACA 3SY8A 4BBJA 3Q40A 2OB2A 1VMDA 1WUYA 3LLVA 3VZDA 2X5XA 5J5CA 1DBVO 3E5NA 3JQQA 3NWBA 1BDMA 1A5SB 4WY5A 1PNQA 3DDSA 3EZ2A 3DYVA 3K94A 4F5WA 3OZDA 5HRCA 2I6FA 1YDFA 1J2RA 5FX2A 1CUWA 5ARDA 3FAZA 3GJXC 1BVUA 3RBXA 4KXYA 3ZHVA 3KZXA 1KO1A 2VJMB 1TH3A 3TJRA 1N0IA 4JLPA 4OEHA 3CSDA 4CM6A 2MWMA 1R0XA 1SBHA 4LTDA 3V9AA 3VO2A 3VAAA 4QRIA 3R3ZA 2G5TA 1JXAA 4XIYA 4E11A 3AF1A 3X1DA 5I47A 1TF2A 3LCUA 3E3AA 3ICEA 1XTIA 4L9SA 4Z1OA 3MSCA 2B5WA 4F6CA 5HKKA 3RS7A 4YFYA 4DA0A 3IELA 1ZUNA 3B2QA 1E5VA 4O4HF 1N92A 2VDRB 1DJMA 2DFVA 2XGMA 2NYAA 4FN4A 3FVWA 1HFJA 4Z0TA 1RNLA 1ZJWA 1YBMA 2X13A 4EG0A 1JG3A 1XMVA 2C04A 2WINI 2CXXA 4LZLA 3IKVA 1QONA 2GHIA 3O73A 1NUAA 1E1CB 4P4SA 3T7SA 3JYHA 3EEBA 3C8UA 4GH5A 1X7ZB 4XSHA 1QWOA 2I3ZA 2QMEA 4NBRA 3SC3A 5SZHB 1ZESA 4KWCA 5I7VA 3KJGA 2BE9A 3SC4A 1PL6A 2O0JA 4PPFA 1B8OA 4C1NA 3MK6A 3AB8A 3QV1A 2YW2A 1OBCA 1UAYA 1N1MA 4WZZA 1JMYA 3AETA 2X5JO 1PR9A 4B5KA 3IV7A 4TYYA 2LWIA 5EJ9A 3V2IA 3H1GA 4JI8B 3K70B 2IYWA 1PJAA 3MUEA 4B73A 3AKZA 1J22A 2P0YA 1U9IC 3FF1A 1WU8A 4DQLA 5BQOA 3IP9A 1Q7EA 4F04A 1T9BA 3NGXA 1ISRA 2VEDA 4YJ2F 3VHXA 5CGZA 4W9MC 5K4AA 1AB6A 5K3CA 2GTHA 4TSRA 2IP1A 3ZGLA 5CYPA 2MSDB 3G2PA 3R7LA 4JUDX 3RYFB 1I2CA 1DOAA 1AV7A 1PDWA 2J3KA 1G8FA 1BFUA 3ETCA 4L0MA 2VJYA 1NM5A 2MHCA 3LUGA 1FCJA 3DD5A 1M1XB 4RFVA 1H2YA 3BMOB 4DM4A 1M1YA 4P81A 1KK3A 1Z4QA 1Q19A 1QFXA 1ZFNA 1D0LA 5LQUA 2FWMX 1ZRHA 3I39X 1SUSA 4PPGA 3DULA 2QNRA 4DNOA 3DMNA 4EYEA 3ESQA 1ZCZA 4L72A 3NR2A 5B3JC 1XT6A 1CR1A 1CS4C 2JAHA 1BZYA 2QRMA 2O05A 1I33A 1A2KC 2RGXA 1LDBA 3VJLA 1URPA 3WGKA 2A9QA 4PZPA 3L7NA 1EBBA 1OREA 2G71A 3ZKWB 3TL4X 4TS9A 2PUHA 5AM5A 3EIOA 3T7TA 4C7BA 1QC5B 3VVCA 4UU7A