1IBMM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibmM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibmM02
3T1HM 2UU9M 4LFBM 1MU5A 1Q3BA 3U6LA 3W0FA 1HNZM 4JI2M 3U6DA 5IWAM 2E5LM 4GKJM 1Z5BA 1IBMM 1HNWM 5ITQA 2F5NA 4LF6M 4PDGA 4GKKM 1TDZA 3VK7A 4X64M 3GPYA 4DR7M 5FLXS 4LFCM 3J7AS 4X62M 3A46A 3U6SA 4MB7A 3GPPA 3GO8A 2UXCM 1TDHA 3U6EA 4JI5M 1Z5AA 1N32M 2HKJA 4G4RA 5ITYA 4LF5M 3U6OA 2VQFM 3A42A 1L1ZA 1K82A 1J5EM 4DR6M 5ITRA 4DV4M 4JI3M 5LMUM 2HHHM 4NXMM 3GPUA 1IBLM 2ZBKB 1MX0A 1L2DA 3GPXA 2XZUA 1HR0M 1R2YA 5ITXE 3U6MA 3DOAA 3J80S 4DV0M 4CISA 1PM5A 4X66M 1PJIA 2OPFA 5LMNM 2UUAM 2UXDM 4JV5M 1KFVA 1K3XA 3OTOM 3SAWA 3SAUA 5ITTA 4NXNM 3SAVA 1XNQM 4DR1M 3J81S 3SATA 1R2ZA 1L2BA 4JI4M 1N36M 2OQ4A 4DR2M 3JR4A 3SBJA 1L2CA 4JYAM 1Q39A 3VK8A 4G4OA 1Z5CA 1XMOM 4PD2A 4B3SM 4OX9M 4DV6M 4JI0M 4G4NA 4LF8M 4DV2M 4DV5M 2F5SA 1NNJA 4YY3M 3C58A 4PDIA 1Q3CA 1XMQM 3SARA 5A2QS 1Z59A 2F5PA 5IT9S 2F5QA 1IBKM 5BR8M 4DV7M 4NRVA 4LF4M 2VQEM 1HNXM 4KHPM 2UUBM 2F5OA 2ZM6M 4AQYM 1FJGM 2F4VM 4DUZM 1I94M 5ITUA 3U6QA 1XC8A 1PJJA 2UUCM 1K3WA 4JI7M 1L1TA 3GP1A 2EA0A 3TWLA 4LF7M 4JI6M 4LF9M 3T1YM 3GQ4A 4DV3M 1N33M 1XNRM 2Q2EB 4DR3M 4B3TM 5ITXA 4ITQA 3JAMS 4X65M 3TWMA 4B3MM 3GQ3A 3A45A 4LFAM 4DUYM 4G4QA 3GQ5A 2XZFA 1N34M 4JI1M 3U6CA 2UXBM 4YHHM 4K0KM 3TWKA 3SASA 3U6PA 4B3RM 4PCZA 4JI8M 1EE8A 4DR4M 4DV1M 4DR5M 4NRWA 3JR5A
chains in the Genus database with same CATH superfamily
1JR3A 2H1RA 3B7NA 4L16A 3NBIA 1MU5A 2KNVA 3IG8A 3KSJA 5EXSA 1Q3BA 2WSCF 2R6FA 2LVNC 5EP1A 3U6DA 3B7ZA 1DGHB 1IFYA 4AI6A 2R4EA 4CHTB 2F5NA 1E32A 1XHBA 4JN6A 5GKNA 1XNRM 2DVWB 2QENA 3ILKA 3SYKA 2LVQD 4X64M 1DGGA 1TH2A 2FFJA 2M60A 2O01F 2RGOA 3B74A 5DYIA 3SHGB 3K9OA 2G3QA 4DR7M 3FTCA 1VEJA 1QAOA 2KRKA 2XGNA 1OAIA 2NQ8C 3B9PA 3GLHA 4LFCM 2RGHA 3J7AS 1PJQA 4M0DA 4L4UA 4B7HA 1N75A 3KP0E 3QYBA 3VKHA 1UFZA 1Z5AA 3DA1A 4GH9A 2VF7A 3ZH9B 2AHMA 3HJQA 3KSXA 2L7HA 3U6OA 4LJ7A 3UGJA 3GLGE 2JNHA 1SG9A 2R65A 1T6OA 1L1ZA 3CF6E 1J5EM 4LZZA 1HT2E 3K9PA 1GO5A 2LH0A 2JY6B 2WSFF 1IY1A 5LMUM 2CE7A 4ANRA 2HHHM 4NXMM 3GPUA 1NHWC 2ZBKB 1G41A 4FCTA 1QAMA 4LRSA 2ZAMA 4BLCA 1HR0M 1XXHB 8CATA 3KOYE 5ITXE 3AJIB 2FNAA 2JZ1A 4RNAA 2JZ0A 4X66M 2QBYB 4M0WA 5LMNM 4W5WA 1W5SA 4FWGA 2DXIA 1KFVA 4LY6A 3SAUA 4WURA 1NJGA 2MR9A 3SAVA 2JP7A 4DR1M 3UZUA 1JR3E 1QZEA 4HEOA 4KO8A 4B7GA 2BJWA 1QUSA 4AKIA 5EXTA 2XH9A 2LVAA 1N36M 2WZJA 4F1IA 4AKHA 2C9CA 2KW0A 1ZMVA 1D0KA 4I8OA 4D82A 4IJFA 4JYAM 2DHRA 1HQYE 3H4JA 2DWZB 3K8ZA 1W5TA 3LW5F 3QWLA 4GHAA 2K9DA 2Z8YM 1J09A 3IECA 3J7BA 4YY3M 1KYIA 3LQRA 2CUZA 2KRUA 3PNVA 2F5PA 1HQCA 3I4VA 2R46A 3FUVA 4HL4A 2WSEF 3T15A 5BR8M 1PJTA 1MN3A 2CFOA 3GLIA 4DV7M 2VQEM 2X8AA 3LCVB 5KPZA 2QP9X 2DENA 2C99A 3L26A 4QNRA 2ZM6M 1FJGM 4DUZM 3U6QA 1IM2A 2UUCM 4LJ9A 2XFTA 1IN5A 2XFSA 1L1TA 3GP1A 2QQ8A 4JI6M 3U5ZA 1QUTA 3VKGA 2XSZD 2I7NA 1N33M 4CGYB 2A5YB 3RE8A 4KODA 2VF8A 1IY0A 3WHLA 2ZTCA 4DUYM 1QQWA 2C9OA 3WHKA 1AIPC 4L15A 2XEPA 5IREB 3U6CA 4XK8F 1IQPA 3SFZA 2DAMA 3FKEA 3GRRA 2CHVA 1XWIA 3HHZA 3U6PA 1DGBA 2CV2A 1IY2A 1EE8A 2G8LA 2RKOA 4LJ5A 4NRWA 3JR5A 4LF9M 4FCWA 2X49A 4DR4M 2OOAA 2ERCA 7CATA 3BOSA 3UMMA 1JR3D 2KHHA 4KLNA 1DO0A 4IBGA 1C1KA 1IN7A 2CHQA 2D7EA 3B89A 4G6ZA 3T6PA 2E5LM 1H6UA 3THGA 2HWJA 1IBMM 4P17A 2CV1A 4LF6M 4PDGA 2GQFA 4GKKM 3ZC7B 3VK7A 3U61B 4AG5A 2KA6B 3E46A 3DZDA 2CEAA 3MMPA 2R18A 2C96A 3KP1E 4MM3B 3GLGB 1ORYB 2QSFX 1VG5A 1OAOC 2YFQA 4R3DA 4NL4H 5FLXS 2QZ4A 3B7QA 4IBBA 3V76A 3MHVC 2V1UA 2MROB 3CF2A 3UJNA 1VEKA 2M5ZA 3LCUA 2FOIC 1TR8A 5KPTA 1TDHA 1R7RA 3GO8A 4JI5M 3E21A 3NBXX 3AFHA 4KT0F 5ITYA 4LF5M 4RF0A 2JXNA 2JY8A 3AOEA 2KZSA 1D0MA 1VDLA 2DZOB 3HWSA 3A42A 1ZV1A 3AKZA 2DI0A 4EIWA 2HCBA 2G5GX 3HHYA 4GHLA 3KW6A 4JI3M 2BNKA 4IBEA 2FE8A 2LWXA 3K92A 3AL0C 4LG2A 1IXSB 4LGMA 4AG6A 1WGLA 2XZUA 3FTDA 2LHGA 2MJ5B 3KOZE 1OIZA 1X37A 1DGHA 3DOAA 3J80S 4DV0M 1PJSA 3FTEA 4UN2B 1QANA 1WGNA 2CHGA 4M9XA 4NSOB 4IBIA 1K3XA 1TF0B 3TQSA 1G71A 5ITTA 2CP8A 4IBKA 1G3IA 3AV0A 1R2ZA 4L8RC 2Y21A 3FUXA 4GRIA 5BPVA 2KXEA 2YR0A 1IN8A 2DZNB 4DR2M 4IBJA 1L2CA 4REZA 5IZ7D 1PGYA 4IBDA 1XMOM 1WR1B 1E94E 2QCUA 2LVOC 3J27B 4OX9M 3PXGA 4JI0M 1JB0F 4DV2M 4DV5M 2F5SA 3NWLA 4WW0A 1QZMA 3Q8XA 1NNJA 1IXRC 4QHSA 4S12A 4OVZB 3LVWA 1S3SA 3H4MA 1XMQM 1Z59A 1HJPA 5IT9S 1IXZA 3HHWA 2D7GA 3QYEA 2O25A 4NRVA 2R45A 2LNHC 3U60B 4LF4M 3I01M 3L28A 4AQYM 1AUAA 2R0IA 1CUKA 1C7YA 2V6ZM 3FE3A 5C1BA 3SMSA 4Y28F 1VEGA 2CV0A 4OW0A 2C98A 2DNAA 2YQZA 4GIPA 2K47A 3GQ4A 1R4GA 3HZJA 4LRTA 5EXXA 4ITQA 4R71A 4B3MM 3GQ3A 3RFWA 1NHGC 4G4QA 3SC3A 1D0LA 3SHFA 3LVVA 1R5LA 5E26A 3PVSA 5F3WA 2UXBM 3VDUA 2Z3XA 3R9XB 4FVMA 3GLHE 2LVPC 1VDDA 5DYGA 2Z7JA 3SASA 5DNYA 4JI8M 1HT1E 3T38A 4A3VB 5L8RF 2RRUA 3W0LB 1YLAA 3T1HM 2UU9M 1TGUA 4M9SA 4JI2M 1HNZM 2BWEA 2KNZA 4QOSA 2C5RA 3GLFA 4HLQA 2QPAA 4I81A 1HNWM 5FSWA 5ITQA 1N78A 1P3QQ 3HU2A 3I51A 1NNUC 1GLNA 4LJAA 2DHYA 1NVMA 3SYLA 3M0EA 1ZMUA 2D7HA 2EO2A 3K1JA 3KOXE 3FTFA 3A98B 3L25A 3L2AA 1SXJC 1SXJA 2HAKA 2JUJA 4GC9A 3W67A 1GKIA 4LJ6A 2X4AA 3U6EA 1NSFA 1DV0A 3KXEC 4MGZE 3SMPA 2Y20A 3W0FA 3M6AA 1L8QA 2VQFM 2LXEA 3FUUA 4F2LA 4BBAA 2BJVA 3Q8GA 4QNMA 2MGWA 4Z8XA 4I5SA 5C18A 1QVRA 2APLA 3GPXA 1R2YA 3U6MA 2OO9A 3C3DA 4CISA 1PM5A 3GRVA 1PJIA 4NSRA 2OPFA 4D80A 2R62A 1NY5A 1IN4A 3U61A 2UXDM 4JV5M 3L27A 3LMMA 2KZUA 1OIPA 4FW9A 3OTOM 3SAWA 1E9RA 3M7GA 2JY5A 4IIWA 3KOWE 4NXNM 3LQQA 4L6V6 3UK6A 4BB9A 3J81S 3RGSA 3GLIE 4LJ4A 2L2DA 3AOEC 4JI4M 2OQ4A 3TPZA 4CJ6A 1IN6A 3F92A 3JR4A 3SBJA 3GLFE 5FTMA 2DZLA 4B08A 1Q39A 1VQ1A 3VK8A 3E4RA 2P5TA 4PD2A 4IBCA 2O5RA 4LF8M 1WJ7A 1YUBA 3HU1A 4D81A 3R8FA 1GJSA 5JI3E 3C3EA 5EP4A 4PDIA 5FTLA 1OKSA 2Z4RA 3SARA 5A2QS 2DAEA 4DBGB 2ZAOA 5EXPA 1SXJE 2XLJA 3FRIA 1V34A 3HGIA 4NOOB 4B7FA 1OQYA 1IBKM 3HJSA 1OFIA 3FYDA 4KHPM 1ZQ9A 3MJ5A 4B3TM 3HX3A 4NC6A 2F4VM 1UM8A 3L29A 1I94M 2DWLA 2LHCA 5ITUA 4JI7M 1PJJA 2DAIA 1QDRA 1Z6TA 4M9ZA 3TE6A 1K3WA 3VFDA 2EA0A 3GLHB 3TWLA 3HJ8A 1MJGM 4DV3M 4G3OA 4L78A 3EIEA 3VLFB 1TH4A 3FUWA 5EP2A 5FTNA 4X65M 3TWMA 3A45A 2LBCA 2LTUA 3IG5A 3GQ5A 4I4LA 1DGFA 4JI1M 2EUCA 4K0KM 1GJTA 1XB2B 4MGHA 4PCZA 1NO1A 4DV1M 2CRUA 3MK6A 1XXHA 4FWHA 2JA2A 5EP3A 2OOBA 3C9PA 2DAKA 4OVZA 4LFBM 1EFUB 2I7PA 2N35A 2J7NA 3D8LA 3U6LA 1OTRA 3HU3A 4TUWA 2QBYA 1R6BX 2JY7A 4GITA 4GMQA 2YNMD 5KPRA 3TL4X 1Q02A 5IWAM 1Z5BA 4GKJM 1G4AE 1TTEA 5KQ8A 2MH8A 4MGIE 3U60A 1TDZA 4II7A 4R7GA 1EIJA 3GPYA 3KS4A 4Z6YA 4FWDA 2VDBB 1NV9A 4CIZA 1LTMA 1QAQA 4RF1A 4LGYA 3KVWA 1BVSA 4FCVA 2Z4SA 4X62M 3EIHA 3A46A 3U6SA 4MB7A 3GPPA 4XBOA 5DFLA 2L09A 4OU7A 1OJLA 1JQJC 2GNOA 1SXJD 3E9SA 3KFUG 2UXCM 1FNNA 4XGIA 1N32M 2HKJA 1DO2A 4G4RA 2H5XA 2EKFA 3CF0A 2R4JA 3HY5A 4GEWA 1PRBA 3GRUA 1A5TA 4LJ8A 1G59A 1WIVA 1K82A 4DR6M 5ITRA 4DV4M 1WHCA 1QYRA 3CTWB 3I04M 1IBLM 3ZCBB 1MX0A 1L2DA 2JWSA 4WP2A 4QHTA 2Y0QA 3AOGA 3GLIB 1TH3A 3J2PB 1LV7A 2EKKA 2K6BA 2B3TA 2QHOB 2DWMA 1N77A 1T43A 4AZFA 2L6OA 3GLFB 5KQDA 2W82A 2UUAM 4GC5A 2DKLA 4PT5A 1ZAEA 3VDPA 2FH0A 3PNYA 3RGPA 4AW4A 3U5ZB 1YSYA 2XF3A 1YE9A 2VIIA 1XNQM 1F4IA 1GABA 1J7KA 3FRHA 3SATA 1XXHE 5FTJA 4AKGA 1L2BA 1NJFA 5H37D 4IBFA 5E6JA 4JXJA 1GL6A 2R44A 2FS1A 1SXJB 4RKUF 1Y8GA 2J7OA 4G4OA 1Z5CA 1ZMWA 3KDSE 3QAUA 2KEBA 4FD2A 4B3SM 4DV6M 3K2LA 4Q7JA 4G4NA 1GL7A 3BBZA 2DAGA 3FD9A 2Y0TA 1KSFX 3I4YA 2QNJA 3C58A 1Q3CA 2KDLA 1NV8A 2L4EA 3GRYA 5JI2E 4MH0E 2F5QA 1V92A 3CGWA 2KNAA 4IJEA 1D2NA 1HNXM 2CWBA 2UUBM 2F5OA 3GLGA 1V33A 3BXWA 3PFIA 1WXQA 5FTKA 5KO3A 2J5YA 1XC8A 3HHXA 1G8PA 2BWBA 2XSZA 4MGYE 1NY6A 3KS8A 4ZPXA 1T3TA 4LF7M 2L7IA 2K0BX 1E9SA 1OFHA 4LCBA 4LZJA 3ZQJA 3T1YM 3D8BA 5EQTA 2Q2EB 2EJSA 2V1CA 4DR3M 3FUTA 4MGKE 3HKPA 2L4FA 5ITXA 3JAMS 4P16A 1GVNA 5EJCA 4QOZC 4LFAM 1N34M 2XZFA 2ZANA 3W68A 3IHPA 4YHHM 3DFZA 2DWNA 3TWKA 1I4WA 2ZTDA 4B3RM 1QDTA 2HL7A 1IXSA 4DR5M 3FYCA 1RU3A
chains in the Genus database with same CATH topology
1JR3A 2H1RA 4L16A 3NBIA 1MU5A 5EXSA 3IG8A 3KSJA 1Q3BA 5EP1A 3U6DA 1DGHB 4AI6A 2R4EA 4CHTB 2F5NA 1E32A 1XHBA 4JN6A 5GKNA 1XNRM 2DVWB 2QENA 3ILKA 3SYKA 4X64M 1DGGA 1TH2A 2FFJA 2M60A 2RGOA 3SHGB 5DYIA 4DR7M 3FTCA 1QAOA 2KRKA 2XGNA 2NQ8C 3B9PA 3GLHA 4LFCM 2RGHA 3J7AS 4M0DA 4L4UA 4B7HA 1N75A 3KP0E 3VKHA 1Z5AA 3DA1A 4GH9A 3ZH9B 2AHMA 3HJQA 3KSXA 2L7HA 3U6OA 4LJ7A 3UGJA 2R65A 1L1ZA 3CF6E 1J5EM 4LZZA 1HT2E 2LH0A 5LMUM 1IY1A 2HHHM 2CE7A 4NXMM 3GPUA 1NHWC 2ZBKB 1G41A 4FCTA 1QAMA 4LRSA 2ZAMA 4BLCA 1HR0M 1XXHB 8CATA 3KOYE 5ITXE 3AJIB 2FNAA 4RNAA 4X66M 2QBYB 4M0WA 5LMNM 4W5WA 1W5SA 4FWGA 2DXIA 1KFVA 4LY6A 3SAUA 4WURA 1NJGA 3SAVA 4DR1M 3UZUA 4KO8A 4B7GA 2BJWA 4AKIA 5EXTA 2XH9A 1N36M 4AKHA 2C9CA 2KW0A 4I8OA 4D82A 4IJFA 4JYAM 2DHRA 1HQYE 2DWZB 3K8ZA 1W5TA 3QWLA 4GHAA 1J09A 3J7BA 4YY3M 1KYIA 3LQRA 2CUZA 2KRUA 3PNVA 2F5PA 1HQCA 3I4VA 2R46A 3FUVA 4HL4A 3T15A 5BR8M 2CFOA 3GLIA 4DV7M 2VQEM 2X8AA 5KPZA 2QP9X 3L26A 2C99A 2ZM6M 4QNRA 1FJGM 4DUZM 3U6QA 1IM2A 2UUCM 4LJ9A 2XFTA 1IN5A 2XFSA 1L1TA 3GP1A 4JI6M 3U5ZA 3VKGA 2XSZD 2I7NA 1N33M 4CGYB 2A5YB 3RE8A 4KODA 1IY0A 3WHLA 4DUYM 1QQWA 2C9OA 3WHKA 4L15A 2XEPA 5IREB 3U6CA 1IQPA 3SFZA 3FKEA 3GRRA 2CHVA 1XWIA 3HHZA 3U6PA 1DGBA 2CV2A 1IY2A 1EE8A 2G8LA 2RKOA 4LJ5A 4NRWA 3JR5A 4LF9M 4FCWA 2X49A 4DR4M 2ERCA 7CATA 3BOSA 3UMMA 1JR3D 3W0FA 4KLNA 1DO0A 4IBGA 1C1KA 1IN7A 2CHQA 2D7EA 4G6ZA 2E5LM 1H6UA 3THGA 1IBMM 2CV1A 4LF6M 4PDGA 4GKKM 3ZC7B 3VK7A 3U61B 4AG5A 2KA6B 3DZDA 2CEAA 2R18A 2C96A 3KP1E 4MM3B 3GLGB 1ORYB 2YFQA 4R3DA 4NL4H 5FLXS 2QZ4A 4IBBA 3MHVC 2V1UA 3CF2A 3UJNA 2M5ZA 5KPTA 2FOIC 3GO8A 1TDHA 1R7RA 4JI5M 3AFHA 5ITYA 4LF5M 4RF0A 3AOEA 2KZSA 3HWSA 2DZOB 3AKZA 3A42A 4EIWA 2HCBA 2G5GX 3HHYA 4GHLA 3KW6A 4JI3M 2BNKA 4IBEA 2FE8A 2LWXA 3K92A 3AL0C 4LG2A 1IXSB 4LGMA 4AG6A 2XZUA 3FTDA 3KOZE 1X37A 1DGHA 3DOAA 3J80S 4DV0M 3FTEA 1QANA 2CHGA 4M9XA 4NSOB 4IBIA 1K3XA 3TQSA 5ITTA 4IBKA 1G3IA 3AV0A 1R2ZA 4L8RC 2Y21A 3FUXA 4GRIA 5BPVA 2KXEA 2YR0A 1IN8A 2DZNB 4DR2M 4IBJA 1L2CA 4REZA 5IZ7D 4IBDA 1XMOM 1E94E 2QCUA 3J27B 4OX9M 3PXGA 4JI0M 4DV2M 4DV5M 2F5SA 3NWLA 4WW0A 1QZMA 3Q8XA 1NNJA 1IXRC 4QHSA 4S12A 4OVZB 3LVWA 1S3SA 3H4MA 1XMQM 1Z59A 5IT9S 1IXZA 3HHWA 2D7GA 4NRVA 2R45A 2LNHC 3U60B 4LF4M 3L28A 4AQYM 2V6ZM 5C1BA 3SMSA 2CV0A 4OW0A 2C98A 2YQZA 4GIPA 2K47A 3GQ4A 4LRTA 5EXXA 4ITQA 4B3MM 3GQ3A 3RFWA 1NHGC 4G4QA 3SC3A 3SHFA 3LVVA 5E26A 3PVSA 5F3WA 2UXBM 3VDUA 2Z3XA 3R9XB 4FVMA 5DYGA 3SASA 1VDDA 2Z7JA 5DNYA 4JI8M 1HT1E 3T38A 4A3VB 3W0LB 3T1HM 2UU9M 1TGUA 4M9SA 4JI2M 1HNZM 4QOSA 2C5RA 3GLFA 4HLQA 2QPAA 4I81A 1HNWM 5FSWA 5ITQA 1N78A 3HU2A 3I51A 1NNUC 1GLNA 4LJAA 1NVMA 3SYLA 3M0EA 2D7HA 2EO2A 3K1JA 3KOXE 3FTFA 3A98B 3L25A 3L2AA 1SXJC 1SXJA 4GC9A 1GKIA 4LJ6A 2X4AA 3U6EA 1NSFA 3KXEC 4MGZE 3SMPA 2Y20A 3M6AA 1L8QA 2VQFM 2LXEA 3FUUA 4BBAA 2BJVA 4QNMA 4Z8XA 4I5SA 5C18A 1QVRA 3GPXA 1R2YA 3U6MA 4CISA 1PM5A 3GRVA 1PJIA 4NSRA 2OPFA 4D80A 2R62A 1NY5A 1IN4A 3U61A 2UXDM 4JV5M 3L27A 3LMMA 2KZUA 4FW9A 3OTOM 3SAWA 1E9RA 3M7GA 4IIWA 4NXNM 3KOWE 3UK6A 3LQQA 4BB9A 3J81S 3RGSA 4LJ4A 3AOEC 4JI4M 2OQ4A 3TPZA 1IN6A 3JR4A 3SBJA 5FTMA 4B08A 1Q39A 3VK8A 3E4RA 2P5TA 4PD2A 4IBCA 2O5RA 4LF8M 1YUBA 3HU1A 4D81A 3R8FA 5JI3E 5EP4A 4PDIA 5FTLA 2Z4RA 3SARA 5A2QS 2ZAOA 5EXPA 1SXJE 2XLJA 4NOOB 3HGIA 4B7FA 1IBKM 3HJSA 1OFIA 3FYDA 4KHPM 1ZQ9A 3MJ5A 2F4VM 1UM8A 3L29A 1I94M 2DWLA 5ITUA 4JI7M 1PJJA 3TE6A 1Z6TA 1K3WA 4M9ZA 3VFDA 2EA0A 3GLHB 3TWLA 3HJ8A 4DV3M 4L78A 3EIEA 3VLFB 1TH4A 3FUWA 5EP2A 5FTNA 4X65M 3TWMA 3A45A 3IG5A 3GQ5A 4I4LA 1DGFA 4JI1M 2EUCA 4K0KM 4MGHA 4PCZA 4DV1M 3MK6A 1XXHA 4FWHA 2JA2A 5EP3A 4OVZA 4LFBM 2J7NA 2I7PA 3D8LA 3U6LA 3HU3A 4TUWA 2QBYA 1R6BX 4GITA 4GMQA 2YNMD 5KPRA 3TL4X 5IWAM 4GKJM 1Z5BA 1G4AE 5KQ8A 4MGIE 3U60A 1TDZA 4II7A 4R7GA 3GPYA 3KS4A 4Z6YA 4FWDA 1QAQA 4RF1A 4LGYA 3KVWA 4FCVA 2Z4SA 4X62M 3EIHA 3A46A 3U6SA 4MB7A 3GPPA 4XBOA 3KFUG 2L09A 4OU7A 1OJLA 1JQJC 2UXCM 1SXJD 3E9SA 1FNNA 4XGIA 1N32M 2HKJA 1DO2A 4G4RA 3CF0A 2R4JA 3GRUA 4LJ8A 1G59A 1K82A 4DR6M 5ITRA 4DV4M 1QYRA 3CTWB 1IBLM 3ZCBB 1MX0A 1L2DA 4QHTA 2Y0QA 3AOGA 3GLIB 1TH3A 3J2PB 1LV7A 2DWMA 1N77A 4AZFA 2L6OA 3GLFB 5KQDA 2W82A 2UUAM 4GC5A 4PT5A 1ZAEA 3VDPA 3PNYA 3RGPA 4AW4A 3U5ZB 1YSYA 2XF3A 1YE9A 2VIIA 1XNQM 1J7KA 3SATA 5FTJA 4AKGA 1L2BA 1NJFA 5H37D 4IBFA 5E6JA 4JXJA 1GL6A 1SXJB 2J7OA 4G4OA 1Z5CA 3KDSE 3QAUA 2KEBA 4FD2A 4B3SM 4DV6M 3K2LA 4G4NA 1GL7A 3FD9A 2Y0TA 1KSFX 3I4YA 3C58A 1Q3CA 3GRYA 5JI2E 4MH0E 2F5QA 4IJEA 1D2NA 1HNXM 2UUBM 2F5OA 3GLGA 3PFIA 1WXQA 5FTKA 5KO3A 1XC8A 3HHXA 1G8PA 2XSZA 4MGYE 1NY6A 3KS8A 4ZPXA 1T3TA 4LF7M 2L7IA 4LCBA 1E9SA 1OFHA 3T1YM 4LZJA 3D8BA 5EQTA 2Q2EB 2V1CA 4DR3M 4B3TM 3FUTA 4MGKE 3HKPA 5ITXA 3JAMS 4P16A 1GVNA 5EJCA 4QOZC 4LFAM 1N34M 2XZFA 2ZANA 4YHHM 3DFZA 2DWNA 3TWKA 1I4WA 4B3RM 2HL7A 4DR5M 3FYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H M;  2UU9 M;  4LFB M;  1MU5 A;  1Q3B A;  3U6L A;  3W0F A;  1HNZ M;  4JI2 M;  3U6D A;  5IWA M;  2E5L M;  4GKJ M;  1Z5B A;  1IBM M;  1HNW M;  5ITQ A;  2F5N A;  4LF6 M;  4PDG A;  4GKK M;  1TDZ A;  3VK7 A;  4X64 M;  3GPY A;  4DR7 M;  5FLX S;  4LFC M;  3J7A S;  4X62 M;  3A46 A;  3U6S A;  4MB7 A;  3GPP A;  3GO8 A;  2UXC M;  1TDH A;  3U6E A;  4JI5 M;  1Z5A A;  1N32 M;  2HKJ A;  4G4R A;  5ITY A;  4LF5 M;  3U6O A;  2VQF M;  3A42 A;  1L1Z A;  1K82 A;  1J5E M;  4DR6 M;  5ITR A;  4DV4 M;  4JI3 M;  5LMU M;  2HHH M;  4NXM M;  3GPU A;  1IBL M;  2ZBK B;  1MX0 A;  1L2D A;  3GPX A;  2XZU A;  1HR0 M;  1R2Y A;  5ITX E;  3U6M A;  3DOA A;  3J80 S;  4DV0 M;  4CIS A;  1PM5 A;  4X66 M;  1PJI A;  2OPF A;  5LMN M;  2UUA M;  2UXD M;  4JV5 M;  1KFV A;  1K3X A;  3OTO M;  3SAW A;  3SAU A;  5ITT A;  4NXN M;  3SAV A;  1XNQ M;  4DR1 M;  3J81 S;  3SAT A;  1R2Z A;  1L2B A;  4JI4 M;  1N36 M;  2OQ4 A;  4DR2 M;  3JR4 A;  3SBJ A;  1L2C A;  4JYA M;  1Q39 A;  3VK8 A;  4G4O A;  1Z5C A;  1XMO M;  4PD2 A;  4B3S M;  4OX9 M;  4DV6 M;  4JI0 M;  4G4N A;  4LF8 M;  4DV2 M;  4DV5 M;  2F5S A;  1NNJ A;  4YY3 M;  3C58 A;  4PDI A;  1Q3C A;  1XMQ M;  3SAR A;  5A2Q S;  1Z59 A;  2F5P A;  5IT9 S;  2F5Q A;  1IBK M;  5BR8 M;  4DV7 M;  4NRV A;  4LF4 M;  2VQE M;  1HNX M;  4KHP M;  2UUB M;  2F5O A;  2ZM6 M;  4AQY M;  1FJG M;  2F4V M;  4DUZ M;  1I94 M;  5ITU A;  3U6Q A;  1XC8 A;  1PJJ A;  2UUC M;  1K3W A;  4JI7 M;  1L1T A;  3GP1 A;  2EA0 A;  3TWL A;  4LF7 M;  4JI6 M;  4LF9 M;  3T1Y M;  3GQ4 A;  4DV3 M;  1N33 M;  1XNR M;  2Q2E B;  4DR3 M;  4B3T M;  5ITX A;  4ITQ A;  3JAM S;  4X65 M;  3TWM A;  4B3M M;  3GQ3 A;  3A45 A;  4LFA M;  4DUY M;  4G4Q A;  3GQ5 A;  2XZF A;  1N34 M;  4JI1 M;  3U6C A;  2UXB M;  4YHH M;  4K0K M;  3TWK A;  3SAS A;  3U6P A;  4B3R M;  4PCZ A;  4JI8 M;  1EE8 A;  4DR4 M;  4DV1 M;  4DR5 M;  4NRW A;  3JR5 A; 
#chains in the Genus database with same CATH topology
 1JR3 A;  2H1R A;  3B7N A;  4L16 A;  3NBI A;  1MU5 A;  2KNV A;  3IG8 A;  3KSJ A;  5EXS A;  1Q3B A;  2WSC F;  2R6F A;  2LVN C;  5EP1 A;  3U6D A;  3B7Z A;  1DGH B;  1IFY A;  4AI6 A;  2R4E A;  4CHT B;  2F5N A;  1E32 A;  1XHB A;  4JN6 A;  5GKN A;  1XNR M;  2DVW B;  2QEN A;  3ILK A;  3SYK A;  2LVQ D;  4X64 M;  1DGG A;  1TH2 A;  2FFJ A;  2M60 A;  2O01 F;  2RGO A;  3B74 A;  5DYI A;  3SHG B;  3K9O A;  2G3Q A;  4DR7 M;  3FTC A;  1VEJ A;  1QAO A;  2KRK A;  2XGN A;  1OAI A;  2NQ8 C;  3B9P A;  3GLH A;  4LFC M;  2RGH A;  3J7A S;  1PJQ A;  4M0D A;  4L4U A;  4B7H A;  1N75 A;  3KP0 E;  3QYB A;  3VKH A;  1UFZ A;  1Z5A A;  3DA1 A;  4GH9 A;  2VF7 A;  3ZH9 B;  2AHM A;  3HJQ A;  3KSX A;  2L7H A;  3U6O A;  4LJ7 A;  3UGJ A;  3GLG E;  2JNH A;  1SG9 A;  2R65 A;  1T6O A;  1L1Z A;  3CF6 E;  1J5E M;  4LZZ A;  1HT2 E;  3K9P A;  1GO5 A;  2LH0 A;  2JY6 B;  2WSF F;  1IY1 A;  5LMU M;  2CE7 A;  4ANR A;  2HHH M;  4NXM M;  3GPU A;  1NHW C;  2ZBK B;  1G41 A;  4FCT A;  1QAM A;  4LRS A;  2ZAM A;  4BLC A;  1HR0 M;  1XXH B;  8CAT A;  3KOY E;  5ITX E;  3AJI B;  2FNA A;  2JZ1 A;  4RNA A;  2JZ0 A;  4X66 M;  2QBY B;  4M0W A;  5LMN M;  4W5W A;  1W5S A;  4FWG A;  2DXI A;  1KFV A;  4LY6 A;  3SAU A;  4WUR A;  1NJG A;  2MR9 A;  3SAV A;  2JP7 A;  4DR1 M;  3UZU A;  1JR3 E;  1QZE A;  4HEO A;  4KO8 A;  4B7G A;  2BJW A;  1QUS A;  4AKI A;  5EXT A;  2XH9 A;  2LVA A;  1N36 M;  2WZJ A;  4F1I A;  4AKH A;  2C9C A;  2KW0 A;  1ZMV A;  1D0K A;  4I8O A;  4D82 A;  4IJF A;  4JYA M;  2DHR A;  1HQY E;  3H4J A;  2DWZ B;  3K8Z A;  1W5T A;  3LW5 F;  3QWL A;  4GHA A;  2K9D A;  2Z8Y M;  1J09 A;  3IEC A;  3J7B A;  4YY3 M;  1KYI A;  3LQR A;  2CUZ A;  2KRU A;  3PNV A;  2F5P A;  1HQC A;  3I4V A;  2R46 A;  3FUV A;  4HL4 A;  2WSE F;  3T15 A;  5BR8 M;  1PJT A;  1MN3 A;  2CFO A;  3GLI A;  4DV7 M;  2VQE M;  2X8A A;  3LCV B;  5KPZ A;  2QP9 X;  2DEN A;  2C99 A;  3L26 A;  4QNR A;  2ZM6 M;  1FJG M;  4DUZ M;  3U6Q A;  1IM2 A;  2UUC M;  4LJ9 A;  2XFT A;  1IN5 A;  2XFS A;  1L1T A;  3GP1 A;  2QQ8 A;  4JI6 M;  3U5Z A;  1QUT A;  3VKG A;  2XSZ D;  2I7N A;  1N33 M;  4CGY B;  2A5Y B;  3RE8 A;  4KOD A;  2VF8 A;  1IY0 A;  3WHL A;  2ZTC A;  4DUY M;  1QQW A;  2C9O A;  3WHK A;  1AIP C;  4L15 A;  2XEP A;  5IRE B;  3U6C A;  4XK8 F;  1IQP A;  3SFZ A;  2DAM A;  3FKE A;  3GRR A;  2CHV A;  1XWI A;  3HHZ A;  3U6P A;  1DGB A;  2CV2 A;  1IY2 A;  1EE8 A;  2G8L A;  2RKO A;  4LJ5 A;  4NRW A;  3JR5 A;  4LF9 M;  4FCW A;  2X49 A;  4DR4 M;  2OOA A;  2ERC A;  7CAT A;  3BOS A;  3UMM A;  1JR3 D;  2KHH A;  4KLN A;  1DO0 A;  4IBG A;  1C1K A;  1IN7 A;  2CHQ A;  2D7E A;  3B89 A;  4G6Z A;  3T6P A;  2E5L M;  1H6U A;  3THG A;  2HWJ A;  1IBM M;  4P17 A;  2CV1 A;  4LF6 M;  4PDG A;  2GQF A;  4GKK M;  3ZC7 B;  3VK7 A;  3U61 B;  4AG5 A;  2KA6 B;  3E46 A;  3DZD A;  2CEA A;  3MMP A;  2R18 A;  2C96 A;  3KP1 E;  4MM3 B;  3GLG B;  1ORY B;  2QSF X;  1VG5 A;  1OAO C;  2YFQ A;  4R3D A;  4NL4 H;  5FLX S;  2QZ4 A;  3B7Q A;  4IBB A;  3V76 A;  3MHV C;  2V1U A;  2MRO B;  3CF2 A;  3UJN A;  1VEK A;  2M5Z A;  3LCU A;  2FOI C;  1TR8 A;  5KPT A;  1TDH A;  1R7R A;  3GO8 A;  4JI5 M;  3E21 A;  3NBX X;  3AFH A;  4KT0 F;  5ITY A;  4LF5 M;  4RF0 A;  2JXN A;  2JY8 A;  3AOE A;  2KZS A;  1D0M A;  1VDL A;  2DZO B;  3HWS A;  3A42 A;  1ZV1 A;  3AKZ A;  2DI0 A;  4EIW A;  2HCB A;  2G5G X;  3HHY A;  4GHL A;  3KW6 A;  4JI3 M;  2BNK A;  4IBE A;  2FE8 A;  2LWX A;  3K92 A;  3AL0 C;  4LG2 A;  1IXS B;  4LGM A;  4AG6 A;  1WGL A;  2XZU A;  3FTD A;  2LHG A;  2MJ5 B;  3KOZ E;  1OIZ A;  1X37 A;  1DGH A;  3DOA A;  3J80 S;  4DV0 M;  1PJS A;  3FTE A;  4UN2 B;  1QAN A;  1WGN A;  2CHG A;  4M9X A;  4NSO B;  4IBI A;  1K3X A;  1TF0 B;  3TQS A;  1G71 A;  5ITT A;  2CP8 A;  4IBK A;  1G3I A;  3AV0 A;  1R2Z A;  4L8R C;  2Y21 A;  3FUX A;  4GRI A;  5BPV A;  2KXE A;  2YR0 A;  1IN8 A;  2DZN B;  4DR2 M;  4IBJ A;  1L2C A;  4REZ A;  5IZ7 D;  1PGY A;  4IBD A;  1XMO M;  1WR1 B;  1E94 E;  2QCU A;  2LVO C;  3J27 B;  4OX9 M;  3PXG A;  4JI0 M;  1JB0 F;  4DV2 M;  4DV5 M;  2F5S A;  3NWL A;  4WW0 A;  1QZM A;  3Q8X A;  1NNJ A;  1IXR C;  4QHS A;  4S12 A;  4OVZ B;  3LVW A;  1S3S A;  3H4M A;  1XMQ M;  1Z59 A;  1HJP A;  5IT9 S;  1IXZ A;  3HHW A;  2D7G A;  3QYE A;  2O25 A;  4NRV A;  2R45 A;  2LNH C;  3U60 B;  4LF4 M;  3I01 M;  3L28 A;  4AQY M;  1AUA A;  2R0I A;  1CUK A;  1C7Y A;  2V6Z M;  3FE3 A;  5C1B A;  3SMS A;  4Y28 F;  1VEG A;  2CV0 A;  4OW0 A;  2C98 A;  2DNA A;  2YQZ A;  4GIP A;  2K47 A;  3GQ4 A;  1R4G A;  3HZJ A;  4LRT A;  5EXX A;  4ITQ A;  4R71 A;  4B3M M;  3GQ3 A;  3RFW A;  1NHG C;  4G4Q A;  3SC3 A;  1D0L A;  3SHF A;  3LVV A;  1R5L A;  5E26 A;  3PVS A;  5F3W A;  2UXB M;  3VDU A;  2Z3X A;  3R9X B;  4FVM A;  3GLH E;  2LVP C;  1VDD A;  5DYG A;  2Z7J A;  3SAS A;  5DNY A;  4JI8 M;  1HT1 E;  3T38 A;  4A3V B;  5L8R F;  2RRU A;  3W0L B;  1YLA A;  3T1H M;  2UU9 M;  1TGU A;  4M9S A;  4JI2 M;  1HNZ M;  2BWE A;  2KNZ A;  4QOS A;  2C5R A;  3GLF A;  4HLQ A;  2QPA A;  4I81 A;  1HNW M;  5FSW A;  5ITQ A;  1N78 A;  1P3Q Q;  3HU2 A;  3I51 A;  1NNU C;  1GLN A;  4LJA A;  2DHY A;  1NVM A;  3SYL A;  3M0E A;  1ZMU A;  2D7H A;  2EO2 A;  3K1J A;  3KOX E;  3FTF A;  3A98 B;  3L25 A;  3L2A A;  1SXJ C;  1SXJ A;  2HAK A;  2JUJ A;  4GC9 A;  3W67 A;  1GKI A;  4LJ6 A;  2X4A A;  3U6E A;  1NSF A;  1DV0 A;  3KXE C;  4MGZ E;  3SMP A;  2Y20 A;  3W0F A;  3M6A A;  1L8Q A;  2VQF M;  2LXE A;  3FUU A;  4F2L A;  4BBA A;  2BJV A;  3Q8G A;  4QNM A;  2MGW A;  4Z8X A;  4I5S A;  5C18 A;  1QVR A;  2APL A;  3GPX A;  1R2Y A;  3U6M A;  2OO9 A;  3C3D A;  4CIS A;  1PM5 A;  3GRV A;  1PJI A;  4NSR A;  2OPF A;  4D80 A;  2R62 A;  1NY5 A;  1IN4 A;  3U61 A;  2UXD M;  4JV5 M;  3L27 A;  3LMM A;  2KZU A;  1OIP A;  4FW9 A;  3OTO M;  3SAW A;  1E9R A;  3M7G A;  2JY5 A;  4IIW A;  3KOW E;  4NXN M;  3LQQ A;  4L6V 6;  3UK6 A;  4BB9 A;  3J81 S;  3RGS A;  3GLI E;  4LJ4 A;  2L2D A;  3AOE C;  4JI4 M;  2OQ4 A;  3TPZ A;  4CJ6 A;  1IN6 A;  3F92 A;  3JR4 A;  3SBJ A;  3GLF E;  5FTM A;  2DZL A;  4B08 A;  1Q39 A;  1VQ1 A;  3VK8 A;  3E4R A;  2P5T A;  4PD2 A;  4IBC A;  2O5R A;  4LF8 M;  1WJ7 A;  1YUB A;  3HU1 A;  4D81 A;  3R8F A;  1GJS A;  5JI3 E;  3C3E A;  5EP4 A;  4PDI A;  5FTL A;  1OKS A;  2Z4R A;  3SAR A;  5A2Q S;  2DAE A;  4DBG B;  2ZAO A;  5EXP A;  1SXJ E;  2XLJ A;  3FRI A;  1V34 A;  3HGI A;  4NOO B;  4B7F A;  1OQY A;  1IBK M;  3HJS A;  1OFI A;  3FYD A;  4KHP M;  1ZQ9 A;  3MJ5 A;  4B3T M;  3HX3 A;  4NC6 A;  2F4V M;  1UM8 A;  3L29 A;  1I94 M;  2DWL A;  2LHC A;  5ITU A;  4JI7 M;  1PJJ A;  2DAI A;  1QDR A;  1Z6T A;  4M9Z A;  3TE6 A;  1K3W A;  3VFD A;  2EA0 A;  3GLH B;  3TWL A;  3HJ8 A;  1MJG M;  4DV3 M;  4G3O A;  4L78 A;  3EIE A;  3VLF B;  1TH4 A;  3FUW A;  5EP2 A;  5FTN A;  4X65 M;  3TWM A;  3A45 A;  2LBC A;  2LTU A;  3IG5 A;  3GQ5 A;  4I4L A;  1DGF A;  4JI1 M;  2EUC A;  4K0K M;  1GJT A;  1XB2 B;  4MGH A;  4PCZ A;  1NO1 A;  4DV1 M;  2CRU A;  3MK6 A;  1XXH A;  4FWH A;  2JA2 A;  5EP3 A;  2OOB A;  3C9P A;  2DAK A;  4OVZ A;  4LFB M;  1EFU B;  2I7P A;  2N35 A;  2J7N A;  3D8L A;  3U6L A;  1OTR A;  3HU3 A;  4TUW A;  2QBY A;  1R6B X;  2JY7 A;  4GIT A;  4GMQ A;  2YNM D;  5KPR A;  3TL4 X;  1Q02 A;  5IWA M;  1Z5B A;  4GKJ M;  1G4A E;  1TTE A;  5KQ8 A;  2MH8 A;  4MGI E;  3U60 A;  1TDZ A;  4II7 A;  4R7G A;  1EIJ A;  3GPY A;  3KS4 A;  4Z6Y A;  4FWD A;  2VDB B;  1NV9 A;  4CIZ A;  1LTM A;  1QAQ A;  4RF1 A;  4LGY A;  3KVW A;  1BVS A;  4FCV A;  2Z4S A;  4X62 M;  3EIH A;  3A46 A;  3U6S A;  4MB7 A;  3GPP A;  4XBO A;  5DFL A;  2L09 A;  4OU7 A;  1OJL A;  1JQJ C;  2GNO A;  1SXJ D;  3E9S A;  3KFU G;  2UXC M;  1FNN A;  4XGI A;  1N32 M;  2HKJ A;  1DO2 A;  4G4R A;  2H5X A;  2EKF A;  3CF0 A;  2R4J A;  3HY5 A;  4GEW A;  1PRB A;  3GRU A;  1A5T A;  4LJ8 A;  1G59 A;  1WIV A;  1K82 A;  4DR6 M;  5ITR A;  4DV4 M;  1WHC A;  1QYR A;  3CTW B;  3I04 M;  1IBL M;  3ZCB B;  1MX0 A;  1L2D A;  2JWS A;  4WP2 A;  4QHT A;  2Y0Q A;  3AOG A;  3GLI B;  1TH3 A;  3J2P B;  1LV7 A;  2EKK A;  2K6B A;  2B3T A;  2QHO B;  2DWM A;  1N77 A;  1T43 A;  4AZF A;  2L6O A;  3GLF B;  5KQD A;  2W82 A;  2UUA M;  4GC5 A;  2DKL A;  4PT5 A;  1ZAE A;  3VDP A;  2FH0 A;  3PNY A;  3RGP A;  4AW4 A;  3U5Z B;  1YSY A;  2XF3 A;  1YE9 A;  2VII A;  1XNQ M;  1F4I A;  1GAB A;  1J7K A;  3FRH A;  3SAT A;  1XXH E;  5FTJ A;  4AKG A;  1L2B A;  1NJF A;  5H37 D;  4IBF A;  5E6J A;  4JXJ A;  1GL6 A;  2R44 A;  2FS1 A;  1SXJ B;  4RKU F;  1Y8G A;  2J7O A;  4G4O A;  1Z5C A;  1ZMW A;  3KDS E;  3QAU A;  2KEB A;  4FD2 A;  4B3S M;  4DV6 M;  3K2L A;  4Q7J A;  4G4N A;  1GL7 A;  3BBZ A;  2DAG A;  3FD9 A;  2Y0T A;  1KSF X;  3I4Y A;  2QNJ A;  3C58 A;  1Q3C A;  2KDL A;  1NV8 A;  2L4E A;  3GRY A;  5JI2 E;  4MH0 E;  2F5Q A;  1V92 A;  3CGW A;  2KNA A;  4IJE A;  1D2N A;  1HNX M;  2CWB A;  2UUB M;  2F5O A;  3GLG A;  1V33 A;  3BXW A;  3PFI A;  1WXQ A;  5FTK A;  5KO3 A;  2J5Y A;  1XC8 A;  3HHX A;  1G8P A;  2BWB A;  2XSZ A;  4MGY E;  1NY6 A;  3KS8 A;  4ZPX A;  1T3T A;  4LF7 M;  2L7I A;  2K0B X;  1E9S A;  1OFH A;  4LCB A;  4LZJ A;  3ZQJ A;  3T1Y M;  3D8B A;  5EQT A;  2Q2E B;  2EJS A;  2V1C A;  4DR3 M;  3FUT A;  4MGK E;  3HKP A;  2L4F A;  5ITX A;  3JAM S;  4P16 A;  1GVN A;  5EJC A;  4QOZ C;  4LFA M;  1N34 M;  2XZF A;  2ZAN A;  3W68 A;  3IHP A;  4YHH M;  3DFZ A;  2DWN A;  3TWK A;  1I4W A;  2ZTD A;  4B3R M;  1QDT A;  2HL7 A;  1IXS A;  4DR5 M;  3FYC A;  1RU3 A; 
#chains in the Genus database with same CATH homology
 1JR3 A;  2H1R A;  4L16 A;  3NBI A;  1MU5 A;  5EXS A;  3IG8 A;  3KSJ A;  1Q3B A;  5EP1 A;  3U6D A;  1DGH B;  4AI6 A;  2R4E A;  4CHT B;  2F5N A;  1E32 A;  1XHB A;  4JN6 A;  5GKN A;  1XNR M;  2DVW B;  2QEN A;  3ILK A;  3SYK A;  4X64 M;  1DGG A;  1TH2 A;  2FFJ A;  2M60 A;  2RGO A;  3SHG B;  5DYI A;  4DR7 M;  3FTC A;  1QAO A;  2KRK A;  2XGN A;  2NQ8 C;  3B9P A;  3GLH A;  4LFC M;  2RGH A;  3J7A S;  4M0D A;  4L4U A;  4B7H A;  1N75 A;  3KP0 E;  3VKH A;  1Z5A A;  3DA1 A;  4GH9 A;  3ZH9 B;  2AHM A;  3HJQ A;  3KSX A;  2L7H A;  3U6O A;  4LJ7 A;  3UGJ A;  2R65 A;  1L1Z A;  3CF6 E;  1J5E M;  4LZZ A;  1HT2 E;  2LH0 A;  5LMU M;  1IY1 A;  2HHH M;  2CE7 A;  4NXM M;  3GPU A;  1NHW C;  2ZBK B;  1G41 A;  4FCT A;  1QAM A;  4LRS A;  2ZAM A;  4BLC A;  1HR0 M;  1XXH B;  8CAT A;  3KOY E;  5ITX E;  3AJI B;  2FNA A;  4RNA A;  4X66 M;  2QBY B;  4M0W A;  5LMN M;  4W5W A;  1W5S A;  4FWG A;  2DXI A;  1KFV A;  4LY6 A;  3SAU A;  4WUR A;  1NJG A;  3SAV A;  4DR1 M;  3UZU A;  4KO8 A;  4B7G A;  2BJW A;  4AKI A;  5EXT A;  2XH9 A;  1N36 M;  4AKH A;  2C9C A;  2KW0 A;  4I8O A;  4D82 A;  4IJF A;  4JYA M;  2DHR A;  1HQY E;  2DWZ B;  3K8Z A;  1W5T A;  3QWL A;  4GHA A;  1J09 A;  3J7B A;  4YY3 M;  1KYI A;  3LQR A;  2CUZ A;  2KRU A;  3PNV A;  2F5P A;  1HQC A;  3I4V A;  2R46 A;  3FUV A;  4HL4 A;  3T15 A;  5BR8 M;  2CFO A;  3GLI A;  4DV7 M;  2VQE M;  2X8A A;  5KPZ A;  2QP9 X;  3L26 A;  2C99 A;  2ZM6 M;  4QNR A;  1FJG M;  4DUZ M;  3U6Q A;  1IM2 A;  2UUC M;  4LJ9 A;  2XFT A;  1IN5 A;  2XFS A;  1L1T A;  3GP1 A;  4JI6 M;  3U5Z A;  3VKG A;  2XSZ D;  2I7N A;  1N33 M;  4CGY B;  2A5Y B;  3RE8 A;  4KOD A;  1IY0 A;  3WHL A;  4DUY M;  1QQW A;  2C9O A;  3WHK A;  4L15 A;  2XEP A;  5IRE B;  3U6C A;  1IQP A;  3SFZ A;  3FKE A;  3GRR A;  2CHV A;  1XWI A;  3HHZ A;  3U6P A;  1DGB A;  2CV2 A;  1IY2 A;  1EE8 A;  2G8L A;  2RKO A;  4LJ5 A;  4NRW A;  3JR5 A;  4LF9 M;  4FCW A;  2X49 A;  4DR4 M;  2ERC A;  7CAT A;  3BOS A;  3UMM A;  1JR3 D;  3W0F A;  4KLN A;  1DO0 A;  4IBG A;  1C1K A;  1IN7 A;  2CHQ A;  2D7E A;  4G6Z A;  2E5L M;  1H6U A;  3THG A;  1IBM M;  2CV1 A;  4LF6 M;  4PDG A;  4GKK M;  3ZC7 B;  3VK7 A;  3U61 B;  4AG5 A;  2KA6 B;  3DZD A;  2CEA A;  2R18 A;  2C96 A;  3KP1 E;  4MM3 B;  3GLG B;  1ORY B;  2YFQ A;  4R3D A;  4NL4 H;  5FLX S;  2QZ4 A;  4IBB A;  3MHV C;  2V1U A;  3CF2 A;  3UJN A;  2M5Z A;  5KPT A;  2FOI C;  3GO8 A;  1TDH A;  1R7R A;  4JI5 M;  3AFH A;  5ITY A;  4LF5 M;  4RF0 A;  3AOE A;  2KZS A;  3HWS A;  2DZO B;  3AKZ A;  3A42 A;  4EIW A;  2HCB A;  2G5G X;  3HHY A;  4GHL A;  3KW6 A;  4JI3 M;  2BNK A;  4IBE A;  2FE8 A;  2LWX A;  3K92 A;  3AL0 C;  4LG2 A;  1IXS B;  4LGM A;  4AG6 A;  2XZU A;  3FTD A;  3KOZ E;  1X37 A;  1DGH A;  3DOA A;  3J80 S;  4DV0 M;  3FTE A;  1QAN A;  2CHG A;  4M9X A;  4NSO B;  4IBI A;  1K3X A;  3TQS A;  5ITT A;  4IBK A;  1G3I A;  3AV0 A;  1R2Z A;  4L8R C;  2Y21 A;  3FUX A;  4GRI A;  5BPV A;  2KXE A;  2YR0 A;  1IN8 A;  2DZN B;  4DR2 M;  4IBJ A;  1L2C A;  4REZ A;  5IZ7 D;  4IBD A;  1XMO M;  1E94 E;  2QCU A;  3J27 B;  4OX9 M;  3PXG A;  4JI0 M;  4DV2 M;  4DV5 M;  2F5S A;  3NWL A;  4WW0 A;  1QZM A;  3Q8X A;  1NNJ A;  1IXR C;  4QHS A;  4S12 A;  4OVZ B;  3LVW A;  1S3S A;  3H4M A;  1XMQ M;  1Z59 A;  5IT9 S;  1IXZ A;  3HHW A;  2D7G A;  4NRV A;  2R45 A;  2LNH C;  3U60 B;  4LF4 M;  3L28 A;  4AQY M;  2V6Z M;  5C1B A;  3SMS A;  2CV0 A;  4OW0 A;  2C98 A;  2YQZ A;  4GIP A;  2K47 A;  3GQ4 A;  4LRT A;  5EXX A;  4ITQ A;  4B3M M;  3GQ3 A;  3RFW A;  1NHG C;  4G4Q A;  3SC3 A;  3SHF A;  3LVV A;  5E26 A;  3PVS A;  5F3W A;  2UXB M;  3VDU A;  2Z3X A;  3R9X B;  4FVM A;  5DYG A;  3SAS A;  1VDD A;  2Z7J A;  5DNY A;  4JI8 M;  1HT1 E;  3T38 A;  4A3V B;  3W0L B;  3T1H M;  2UU9 M;  1TGU A;  4M9S A;  4JI2 M;  1HNZ M;  4QOS A;  2C5R A;  3GLF A;  4HLQ A;  2QPA A;  4I81 A;  1HNW M;  5FSW A;  5ITQ A;  1N78 A;  3HU2 A;  3I51 A;  1NNU C;  1GLN A;  4LJA A;  1NVM A;  3SYL A;  3M0E A;  2D7H A;  2EO2 A;  3K1J A;  3KOX E;  3FTF A;  3A98 B;  3L25 A;  3L2A A;  1SXJ C;  1SXJ A;  4GC9 A;  1GKI A;  4LJ6 A;  2X4A A;  3U6E A;  1NSF A;  3KXE C;  4MGZ E;  3SMP A;  2Y20 A;  3M6A A;  1L8Q A;  2VQF M;  2LXE A;  3FUU A;  4BBA A;  2BJV A;  4QNM A;  4Z8X A;  4I5S A;  5C18 A;  1QVR A;  3GPX A;  1R2Y A;  3U6M A;  4CIS A;  1PM5 A;  3GRV A;  1PJI A;  4NSR A;  2OPF A;  4D80 A;  2R62 A;  1NY5 A;  1IN4 A;  3U61 A;  2UXD M;  4JV5 M;  3L27 A;  3LMM A;  2KZU A;  4FW9 A;  3OTO M;  3SAW A;  1E9R A;  3M7G A;  4IIW A;  4NXN M;  3KOW E;  3UK6 A;  3LQQ A;  4BB9 A;  3J81 S;  3RGS A;  4LJ4 A;  3AOE C;  4JI4 M;  2OQ4 A;  3TPZ A;  1IN6 A;  3JR4 A;  3SBJ A;  5FTM A;  4B08 A;  1Q39 A;  3VK8 A;  3E4R A;  2P5T A;  4PD2 A;  4IBC A;  2O5R A;  4LF8 M;  1YUB A;  3HU1 A;  4D81 A;  3R8F A;  5JI3 E;  5EP4 A;  4PDI A;  5FTL A;  2Z4R A;  3SAR A;  5A2Q S;  2ZAO A;  5EXP A;  1SXJ E;  2XLJ A;  4NOO B;  3HGI A;  4B7F A;  1IBK M;  3HJS A;  1OFI A;  3FYD A;  4KHP M;  1ZQ9 A;  3MJ5 A;  2F4V M;  1UM8 A;  3L29 A;  1I94 M;  2DWL A;  5ITU A;  4JI7 M;  1PJJ A;  3TE6 A;  1Z6T A;  1K3W A;  4M9Z A;  3VFD A;  2EA0 A;  3GLH B;  3TWL A;  3HJ8 A;  4DV3 M;  4L78 A;  3EIE A;  3VLF B;  1TH4 A;  3FUW A;  5EP2 A;  5FTN A;  4X65 M;  3TWM A;  3A45 A;  3IG5 A;  3GQ5 A;  4I4L A;  1DGF A;  4JI1 M;  2EUC A;  4K0K M;  4MGH A;  4PCZ A;  4DV1 M;  3MK6 A;  1XXH A;  4FWH A;  2JA2 A;  5EP3 A;  4OVZ A;  4LFB M;  2J7N A;  2I7P A;  3D8L A;  3U6L A;  3HU3 A;  4TUW A;  2QBY A;  1R6B X;  4GIT A;  4GMQ A;  2YNM D;  5KPR A;  3TL4 X;  5IWA M;  4GKJ M;  1Z5B A;  1G4A E;  5KQ8 A;  4MGI E;  3U60 A;  1TDZ A;  4II7 A;  4R7G A;  3GPY A;  3KS4 A;  4Z6Y A;  4FWD A;  1QAQ A;  4RF1 A;  4LGY A;  3KVW A;  4FCV A;  2Z4S A;  4X62 M;  3EIH A;  3A46 A;  3U6S A;  4MB7 A;  3GPP A;  4XBO A;  3KFU G;  2L09 A;  4OU7 A;  1OJL A;  1JQJ C;  2UXC M;  1SXJ D;  3E9S A;  1FNN A;  4XGI A;  1N32 M;  2HKJ A;  1DO2 A;  4G4R A;  3CF0 A;  2R4J A;  3GRU A;  4LJ8 A;  1G59 A;  1K82 A;  4DR6 M;  5ITR A;  4DV4 M;  1QYR A;  3CTW B;  1IBL M;  3ZCB B;  1MX0 A;  1L2D A;  4QHT A;  2Y0Q A;  3AOG A;  3GLI B;  1TH3 A;  3J2P B;  1LV7 A;  2DWM A;  1N77 A;  4AZF A;  2L6O A;  3GLF B;  5KQD A;  2W82 A;  2UUA M;  4GC5 A;  4PT5 A;  1ZAE A;  3VDP A;  3PNY A;  3RGP A;  4AW4 A;  3U5Z B;  1YSY A;  2XF3 A;  1YE9 A;  2VII A;  1XNQ M;  1J7K A;  3SAT A;  5FTJ A;  4AKG A;  1L2B A;  1NJF A;  5H37 D;  4IBF A;  5E6J A;  4JXJ A;  1GL6 A;  1SXJ B;  2J7O A;  4G4O A;  1Z5C A;  3KDS E;  3QAU A;  2KEB A;  4FD2 A;  4B3S M;  4DV6 M;  3K2L A;  4G4N A;  1GL7 A;  3FD9 A;  2Y0T A;  1KSF X;  3I4Y A;  3C58 A;  1Q3C A;  3GRY A;  5JI2 E;  4MH0 E;  2F5Q A;  4IJE A;  1D2N A;  1HNX M;  2UUB M;  2F5O A;  3GLG A;  3PFI A;  1WXQ A;  5FTK A;  5KO3 A;  1XC8 A;  3HHX A;  1G8P A;  2XSZ A;  4MGY E;  1NY6 A;  3KS8 A;  4ZPX A;  1T3T A;  4LF7 M;  2L7I A;  4LCB A;  1E9S A;  1OFH A;  3T1Y M;  4LZJ A;  3D8B A;  5EQT A;  2Q2E B;  2V1C A;  4DR3 M;  4B3T M;  3FUT A;  4MGK E;  3HKP A;  5ITX A;  3JAM S;  4P16 A;  1GVN A;  5EJC A;  4QOZ C;  4LFA M;  1N34 M;  2XZF A;  2ZAN A;  4YHH M;  3DFZ A;  2DWN A;  3TWK A;  1I4W A;  4B3R M;  2HL7 A;  4DR5 M;  3FYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...