1IBMM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibmM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibmM02
4JI2M 1XMOM 3U6CA 2XZUA 3DOAA 2F5OA 1TDZA 4YY3M 3SAWA 4DR1M 4PCZA 4JI6M 4JI0M 3GPXA 4JV5M 4JYAM 1HR0M 3C58A 3U6PA 2HHHM 2F4VM 4B3RM 1N34M 3W0FA 2UUBM 5LMNM 4JI8M 1L1TA 4G4QA 3SBJA 4LF7M 1L2BA 3GQ3A 4LFBM 1KFVA 1HNXM 4ITQA 4LF8M 3A42A 3J80S 4LF5M 2UXDM 5LMUM 1XC8A 3GPUA 4DV5M 1L1ZA 3SATA 5ITRA 1Z5CA 2F5SA 2Q2EB 4DR7M 3TWLA 1FJGM 3JAMS 2ZBKB 4B3SM 1PJJA 3U6EA 1L2CA 5ITUA 3U6LA 4KHPM 1Z59A 4NRWA 2UXCM 3A46A 1HNZM 3T1HM 2OPFA 4NXMM 5FLXS 1PM5A 3U6MA 2UUCM 3GQ4A 4DV2M 3U6OA 1K82A 4JI7M 1PJIA 4JI1M 2XZFA 3U6SA 4DV4M 2EA0A 1XNRM 4G4RA 4DR4M 4LF4M 4PDIA 4DV6M 3VK7A 1NNJA 1MU5A 4DR2M 3VK8A 4JI4M 4DR5M 4DR6M 4X66M 5ITXE 1K3WA 1R2ZA 1IBLM 1N32M 4X64M 2VQFM 4NXNM 4NRVA 1Z5BA 1IBMM 2UXBM 2UU9M 4JI3M 1Q39A 5IT9S 1TDHA 3JR4A 1HNWM 3GP1A 2F5QA 1N36M 1IBKM 1XNQM 4DV0M 4DUZM 3U6QA 4CISA 2UUAM 5ITXA 5ITTA 3TWKA 4PDGA 4LF6M 2VQEM 3GPYA 3OTOM 1R2YA 3SARA 1EE8A 1L2DA 3J7AS 2F5PA 1Z5AA 5ITYA 4DV7M 1I94M 4MB7A 2F5NA 1Q3BA 4GKKM 4GKJM 3SAVA 4JI5M 2OQ4A 4DUYM 4B3TM 3J81S 4G4OA 4PD2A 4DV1M 4B3MM 4LF9M 2HKJA 3GQ5A 1MX0A 2ZM6M 5IWAM 4X65M 5A2QS 1K3XA 3JR5A 5ITQA 3GPPA 4X62M 4K0KM 3SASA 4AQYM 4OX9M 3U6DA 4YHHM 3SAUA 3TWMA 3T1YM 4LFAM 4G4NA 1Q3CA 4DV3M 2E5LM 3GO8A 4LFCM 3A45A 1N33M 1XMQM 4DR3M 5BR8M 1J5EM
chains in the Genus database with same CATH superfamily
3LMMA 2WSEF 2BJVA 3TL4X 2XZUA 2H5XA 2M5ZA 4M9ZA 3WHLA 1TDZA 3KP0E 3DZDA 3RGSA 3SAWA 4LRTA 1QDRA 1OIPA 4UN2B 4Z8XA 4F1IA 3B74A 4JI0M 5DNYA 2JY5A 2I7NA 3T6PA 4LJ8A 2MROB 2LTUA 2ZTDA 4IJFA 1GABA 3J27B 3C58A 2HHHM 1C7YA 4HL4A 3W0FA 1QUSA 2JA2A 4IBKA 1TF0B 3SFZA 4OVZB 4QHTA 1DGBA 2XGNA 4QNRA 2DXIA 3HX3A 1KFVA 4LF8M 4OU7A 3T15A 2DWNA 1KSFX 4R3DA 1YSYA 1R4GA 1D0KA 2BWEA 5LMUM 2KNZA 4DV5M 1SXJB 2O25A 5FTJA 3SATA 1DGFA 1Z5CA 2Q2EB 4MGKE 4BBAA 4QOSA 3UZUA 2DAIA 3FUTA 4FWGA 5BPVA 2KEBA 2R44A 4JN6A 4ANRA 3E21A 4KHPM 4NRWA 3R9XB 2K0BX 2L7IA 1DGHA 2R45A 3GLFA 2OPFA 3U61A 4IBCA 5FLXS 2KZUA 1NSFA 3U6MA 2JY7A 2M60A 1QZMA 3K9OA 4AG5A 4QOZC 1K82A 1PJIA 2CRUA 2KRUA 3GLHE 3H4JA 1NVMA 1DO2A 1IXSA 3AJIB 1GLNA 1RU3A 3AOEC 1LTMA 3KS4A 1NNJA 1G8PA 2FOIC 1JR3E 3KXEC 1MU5A 5KPZA 5JI3E 2MH8A 4JI4M 2H1RA 2Z3XA 2LVNC 4X66M 4AKIA 5ITXE 2KRKA 2R6FA 5EJCA 4GEWA 5FSWA 1ORYB 2QZ4A 1I4WA 1NV8A 2CV0A 1GO5A 1E9RA 2Y0TA 1GVNA 1Q39A 3NWLA 3FRIA 2HCBA 1WGNA 2Z7JA 1HNWM 2F5QA 4EIWA 1XNQM 1HQCA 2ZANA 3CF2A 4OW0A 2OOBA 1E9SA 1OJLA 3TWKA 4FCVA 2KNAA 3BXWA 3FD9A 5E26A 4PDGA 2DKLA 2WSFF 5H37D 5EP4A 4Z6YA 2Z4RA 3GRVA 1T3TA 4Y28F 4IIWA 3OTOM 1EE8A 4B7HA 3GPYA 4I8OA 2QHOB 3J7AS 5DYIA 1IN4A 5ITYA 3GLGE 3VLFB 4DV7M 3LVVA 4GKKM 1NHGC 2DNAA 2J7OA 4GKJM 4DUYM 3D8BA 4G4OA 2KXEA 1VQ1A 3SYKA 2CV1A 4D82A 2ZAOA 2J7NA 3AOEA 3W68A 1MX0A 1TH3A 1C1KA 2A5YB 2FS1A 4CGYB 5ITQA 2QQ8A 1OTRA 3FTEA 4LZJA 4AW4A 4FW9A 3HKPA 1Y8GA 4D81A 4S12A 4AQYM 1XXHE 4P17A 1GKIA 2JY8A 4G3OA 1QANA 3SAUA 3TWMA 3IG5A 3WHKA 4G4NA 1Q3CA 2E5LM 2L7HA 2WZJA 4LFCM 1LV7A 4KT0F 4DR3M 5IT9S 2K47A 4II7A 1XMOM 2XFTA 4L16A 3QAUA 3DOAA 2D7EA 2R4EA 2JNHA 2R4JA 2L09A 4JI6M 1YUBA 5EXTA 3RFWA 1W5TA 4FVMA 4IBBA 1WJ7A 1ZMVA 4GC5A 2F4VM 2K9DA 2DZNB 3FUVA 1N34M 4LJ7A 1MJGM 3EIEA 2UUBM 3KDSE 1L1TA 3I51A 1J7KA 4XK8F 4LFBM 3AKZA 1HNXM 4ITQA 2QSFX 3AFHA 4MGZE 3A42A 4LF5M 3KSJA 3B89A 2C9CA 1T6OA 1HJPA 1ZMWA 1SXJE 2GQFA 3L2AA 3K2LA 2HL7A 3U5ZA 1QAQA 4XGIA 2K6BA 2L4FA 2F5SA 3L29A 3W67A 3F92A 1QDTA 1XB2B 1XWIA 2D7HA 2MR9A 3KSXA 3TWLA 1WR1B 1YE9A 3HHXA 5KPTA 3U6EA 2GNOA 5ITUA 3U6LA 2UXCM 4L15A 3K9PA 7CATA 4AKHA 3KS8A 3HJQA 4TUWA 3W0LB 4WURA 2Y20A 4NXMM 1IXRC 3T38A 2LBCA 3FUWA 2RRUA 2UUCM 1G3IA 4JI7M 4IBJA 1V34A 2EKFA 3UGJA 2XZFA 2FH0A 4IBIA 2LVQD 3AL0C 2DI0A 1GL6A 3HJSA 3H4MA 2KA6B 2EA0A 5EXSA 1OAIA 1TH4A 4G4RA 1XNRM 4PDIA 3HHYA 5EP1A 3SMPA 4DR5M 3E9SA 2VF8A 4MM3B 2DWMA 1K3WA 1J09A 1N32M 4X64M 2XF3A 3GLHA 1G59A 3AV0A 2LHCA 1IBMM 4GMQA 2CWBA 2UU9M 4JI3M 1JB0F 4M0WA 1AUAA 3CF6E 3KOZE 2C5RA 4GH9A 3GP1A 1JR3A 2DZOB 2RGOA 2LVOC 4DV0M 1N77A 3M0EA 5EXPA 2I7PA 3ZQJA 4LJ9A 4CISA 2UUAM 2YFQA 5ITXA 4JXJA 1EFUB 3GLIB 1IY2A 3I01M 4GC9A 2DAKA 3UMMA 4FD2A 3HU2A 1KYIA 4G6ZA 1ZMUA 2V1CA 4LF6M 1PGYA 3U60A 4L6V6 1R2YA 1E94E 4B7FA 2XH9A 1X37A 1L2DA 1N75A 4IJEA 5GKNA 4RNAA 4HLQA 4GHLA 1G71A 5FTNA 3LQRA 3J7BA 2F5PA 1I94M 2CHGA 3KFUG 1GL7A 1Q3BA 4L4UA 2CP8A 1OFIA 2OQ4A 3IECA 1NJFA 2BNKA 4M9XA 4AI6A 4B3MM 4LF9M 2L2DA 3FKEA 4FWDA 1SG9A 1AIPC 2DZLA 5IWAM 2DVWB 3K1JA 5E6JA 1K3XA 3JR5A 5C18A 3KOWE 3FTFA 3AOGA 1QVRA 3KOXE 4X62M 3MJ5A 4GITA 4OX9M 3K8ZA 2DENA 3GLGA 4FWHA 4LRSA 4HEOA 2R46A 1UM8A 4LFAM 3E4RA 4DV3M 1WXQA 3M6AA 3BOSA 4WP2A 3QYBA 4MGIE 2MJ5B 1SXJC 2QBYA 3QYEA 4JI2M 2MGWA 2CHVA 3HGIA 3ZC7B 3U6CA 3FUXA 1OKSA 1E32A 4YY3M 2JZ0A 1QYRA 4B7GA 1XXHA 4MGHA 3GRYA 2LWXA 2WSCF 3FE3A 3LW5F 1HT1E 4JV5M 2JP7A 1HR0M 4B3RM 3KOYE 1YLAA 2KHHA 3UJNA 1N78A 2CE7A 2Y0QA 3HY5A 1EIJA 3HZJA 4MH0E 4LF7M 1VEJA 3SBJA 2YNMD 3CF0A 4IBEA 1L2BA 4MGYE 3GQ3A 3GRRA 1IXZA 1D0MA 1DGHB 2JXNA 1R7RA 2KW0A 2EO2A 3M7GA 3J80S 3EIHA 4AZFA 3GLFB 3U61B 4LJ6A 3GPUA 3PXGA 3PVSA 2Y21A 3VFDA 3RE8A 2EJSA 4FCWA 2FNAA 1SXJD 3JAMS 2V1UA 1IXSB 2XSZA 4OVZA 1PJJA 2DHYA 1Z59A 3VKGA 3IHPA 4PT5A 3VKHA 1BVSA 3KW6A 3LQQA 2JWSA 4QHSA 1S3SA 1VDDA 3SC3A 1SXJA 4L8RC 1IN5A 2APLA 2QPAA 4DV2M 4JI1M 3U6SA 1V92A 1NY5A 3C3EA 3FUUA 5C1BA 5EXXA 2R62A 2VF7A 4DR4M 4LF4M 2QP9X 4DV6M 3B7NA 2EUCA 2LHGA 1H6UA 3J2PB 2HAKA 2X4AA 2FFJA 1FNNA 2W82A 3K92A 4NOOB 2B3TA 2L4EA 4REZA 1IY1A 3HU3A 3RGPA 5FTLA 1R2ZA 2RGHA 4KODA 3ZH9B 2DWZB 4LJAA 3A98B 1NY6A 4NRVA 3L25A 3BBZA 1R5LA 2EKKA 3TQSA 1TDHA 3JR4A 2ZTCA 5IZ7D 2ZAMA 1DV0A 3VDUA 3HJ8A 3Q8GA 4LZZA 1CUKA 1NNUC 3D8LA 1IM2A 1IY0A 4I81A 4DUZM 3U6QA 3GLIE 3B7QA 3TE6A 2N35A 3LCUA 2LNHC 4BB9A 4IBDA 2LVPC 3VDPA 1VEKA 3SARA 5FTKA 2CHQA 3ILKA 3FYDA 2P5TA 1HT2E 1Z5AA 1WIVA 2F5NA 1NO1A 2RKOA 4W5WA 1JR3D 2X8AA 4L78A 4XBOA 3SAVA 3J81S 2VIIA 4DV1M 4P16A 2HKJA 3DFZA 3FYCA 3LCVB 1ZAEA 3I4VA 3GRUA 1VEGA 1WGLA 2C99A 2ZM6M 1TR8A 4X65M 1P3QQ 5FTMA 2JY6B 4NC6A 2C98A 1QAOA 3GPPA 3FRHA 1XHBA 1JQJC 1L8QA 1OQYA 5KQ8A 2HWJA 3SASA 3U6DA 4K0KM 2LVAA 3E46A 4IBFA 4LGMA 5DFLA 3HWSA 4LG2A 3I04M 3T1YM 1UFZA 2O01F 4KLNA 2OO9A 3GO8A 3A45A 3LVWA 1XMQM 5BR8M 2CEAA 1J5EM 3PFIA 2CV2A 4GHAA 1IFYA 1V33A 1G4AE 4QNMA 2CFOA 2C96A 3L28A 2KNVA 2YQZA 3SHGB 3HHZA 2F5OA 4NL4H 5JI2E 2G3QA 5IREB 4Q7JA 2FE8A 2O5RA 4D80A 4DR1M 4I5SA 4LGYA 4PCZA 3L27A 2L6OA 4B08A 1ZV1A 3DA1A 2XLJA 3GPXA 4JYAM 1GJTA 3I4YA 2OOAA 3MMPA 3U5ZB 1QAMA 3B7ZA 1R6BX 3U6PA 3KVWA 1QUTA 3IG8A 5LMNM 4JI8M 2CUZA 1IN6A 4G4QA 3ZCBB 5L8RF 1IN8A 3THGA 2JZ1A 2NQ8C 3GLFE 2UXDM 1F4IA 3HU1A 4NSRA 4NSOB 5F3WA 1XC8A 2DWLA 1IN7A 1L1ZA 2ERCA 3PNVA 4ZPXA 5ITRA 4DR7M 1A5TA 2KDLA 1VG5A 4F2LA 3CTWB 1FJGM 2ZBKB 4B3SM 1L2CA 2R65A 4M9SA 4RF0A 3A46A 4CHTB 2QENA 1HNZM 3T1HM 3FTDA 1TH2A 4R7GA 2R0IA 1OIZA 2KZSA 5EP2A 1PM5A 3SYLA 2DHRA 3GQ4A 3U6OA 3SMSA 2BWBA 4LY6A 4A3VB 3GLHB 3MHVC 2C9OA 2BJWA 2QNJA 4DV4M 1DGGA 2DAMA 2XSZD 3HHWA 3VK7A 4FCTA 4AKGA 4DR2M 8CATA 3VK8A 1TTEA 1QZEA 4DR6M 3UK6A 1ZQ9A 3B9PA 2G5GX 4BLCA 1IBLM 1NV9A 2VQFM 3NBIA 2AHMA 4NXNM 4LJ4A 2UXBM 1Z5BA 3U60B 2D7GA 2YR0A 3NBXX 1TGUA 5DYGA 4LCBA 2XFSA 2QCUA 1NHWC 1N36M 3PNYA 1PRBA 1IBKM 4GIPA 1D0LA 1NJGA 2DAEA 1G41A 4GRIA 2G8LA 2XEPA 1OFHA 4CJ6A 4CIZA 5ITTA 2VDBB 3C9PA 2VQEM 2DAGA 4RF1A 1DO0A 2JUJA 4LJ5A 3TPZA 5KQDA 4DBGB 1D2NA 1Q02A 2LH0A 1PJTA 1W5SA 4MB7A 4R71A 3GLGB 4JI5M 4B3TM 4PD2A 1HQYE 5EP3A 4IBGA 1Z6TA 1QQWA 2J5YA 5EQTA 4AG6A 3GLIA 3GQ5A 2LXEA 2QBYB 2X49A 1PJQA 3KP1E 5A2QS 3C3DA 4RKUF 3SHFA 3Q8XA 3L26A 1GJSA 1T43A 1MN3A 2Z8YM 1OAOC 4WW0A 1WHCA 1XXHB 5KO3A 4I4LA 1PJSA 5KPRA 4YHHM 1VDLA 2V6ZM 4M0DA 3MK6A 3R8FA 3QWLA 2R18A 3CGWA 4KO8A 3V76A 1N33M 3FTCA 2Z4SA 1IQPA
chains in the Genus database with same CATH topology
3LMMA 2BJVA 3TL4X 2XZUA 2M5ZA 4M9ZA 3WHLA 1TDZA 3KP0E 3DZDA 3RGSA 3SAWA 4LRTA 4Z8XA 4JI0M 5DNYA 2I7NA 4LJ8A 4IJFA 3J27B 3C58A 2HHHM 4HL4A 3W0FA 2JA2A 4IBKA 3SFZA 4OVZB 4QHTA 1DGBA 2XGNA 4QNRA 2DXIA 1KFVA 4LF8M 4OU7A 3T15A 2DWNA 1KSFX 4R3DA 1YSYA 5LMUM 4DV5M 1SXJB 5FTJA 3SATA 1DGFA 1Z5CA 2Q2EB 4MGKE 4BBAA 4QOSA 3UZUA 3FUTA 4FWGA 5BPVA 2KEBA 4JN6A 4KHPM 4NRWA 3R9XB 2L7IA 1DGHA 2R45A 3GLFA 2OPFA 3U61A 4IBCA 5FLXS 2KZUA 1NSFA 3U6MA 2M60A 1QZMA 4AG5A 4QOZC 1K82A 1PJIA 2KRUA 1NVMA 1DO2A 3AJIB 1GLNA 3AOEC 3KS4A 1NNJA 1G8PA 2FOIC 3KXEC 5KPZA 1MU5A 5JI3E 4JI4M 2H1RA 2Z3XA 4X66M 4AKIA 5ITXE 2KRKA 5EJCA 5FSWA 1ORYB 2QZ4A 1I4WA 2CV0A 1E9RA 2Y0TA 1GVNA 1Q39A 3NWLA 2HCBA 1HNWM 2Z7JA 2F5QA 4EIWA 1XNQM 1HQCA 2ZANA 3CF2A 4OW0A 1E9SA 1OJLA 3TWKA 4FCVA 5E26A 3FD9A 4PDGA 5H37D 5EP4A 4Z6YA 2Z4RA 3GRVA 1T3TA 3OTOM 4IIWA 3GPYA 1EE8A 4B7HA 4I8OA 3J7AS 5DYIA 1IN4A 5ITYA 3VLFB 4DV7M 3LVVA 4GKKM 1NHGC 4GKJM 2J7OA 4DUYM 3D8BA 4G4OA 2KXEA 2CV1A 3SYKA 4D82A 2ZAOA 2J7NA 3AOEA 1MX0A 1TH3A 1C1KA 2A5YB 4CGYB 5ITQA 3FTEA 4LZJA 4AW4A 4FW9A 3HKPA 4D81A 4S12A 4AQYM 1GKIA 3SAUA 1QANA 3TWMA 3IG5A 3WHKA 4G4NA 1Q3CA 2E5LM 2L7HA 4LFCM 1LV7A 4DR3M 5IT9S 2K47A 4II7A 1XMOM 2XFTA 4L16A 3QAUA 3DOAA 2D7EA 2R4EA 2R4JA 2L09A 4JI6M 1YUBA 5EXTA 3RFWA 1W5TA 4FVMA 4IBBA 2F4VM 4GC5A 2DZNB 3FUVA 1N34M 4LJ7A 2UUBM 3EIEA 3KDSE 1L1TA 3I51A 1J7KA 4LFBM 3AKZA 1HNXM 4ITQA 3AFHA 4MGZE 3A42A 4LF5M 3KSJA 2C9CA 1SXJE 3L2AA 3K2LA 2HL7A 3U5ZA 1QAQA 4XGIA 2F5SA 3L29A 3TWLA 1XWIA 2D7HA 3KSXA 3HHXA 1YE9A 5KPTA 3U6EA 5ITUA 3U6LA 2UXCM 4L15A 7CATA 4AKHA 3KS8A 3HJQA 4TUWA 3W0LB 4WURA 2Y20A 4NXMM 1IXRC 3T38A 3FUWA 2UUCM 1G3IA 4JI7M 4IBJA 3UGJA 2XZFA 4IBIA 3AL0C 1GL6A 3HJSA 3H4MA 2KA6B 2EA0A 5EXSA 1TH4A 4G4RA 1XNRM 4PDIA 3HHYA 5EP1A 3SMPA 4DR5M 3E9SA 4MM3B 2DWMA 1K3WA 1J09A 1N32M 4X64M 2XF3A 3GLHA 1G59A 3AV0A 1IBMM 4GMQA 2UU9M 4JI3M 4M0WA 3CF6E 3KOZE 2C5RA 4GH9A 3GP1A 1JR3A 2DZOB 2RGOA 4DV0M 1N77A 3M0EA 5EXPA 2I7PA 4LJ9A 4CISA 2UUAM 2YFQA 5ITXA 4JXJA 3GLIB 1IY2A 4GC9A 3UMMA 4FD2A 3HU2A 1KYIA 4G6ZA 2V1CA 4LF6M 3U60A 1R2YA 1E94E 4B7FA 2XH9A 1X37A 1L2DA 1N75A 4IJEA 5GKNA 4RNAA 4HLQA 4GHLA 5FTNA 3LQRA 3J7BA 2F5PA 1I94M 2CHGA 3KFUG 1GL7A 1Q3BA 4L4UA 1OFIA 2OQ4A 1NJFA 2BNKA 4M9XA 4AI6A 4B3MM 4LF9M 3FKEA 4FWDA 5IWAM 2DVWB 3K1JA 5E6JA 1K3XA 3JR5A 5C18A 3KOWE 3FTFA 3AOGA 1QVRA 3KOXE 4X62M 3MJ5A 4GITA 4OX9M 3K8ZA 3GLGA 4FWHA 4LRSA 2R46A 1UM8A 4LFAM 3E4RA 4DV3M 1WXQA 3M6AA 3BOSA 4MGIE 1SXJC 2QBYA 4JI2M 2CHVA 3HGIA 3ZC7B 3U6CA 3FUXA 1E32A 4YY3M 1QYRA 4B7GA 1XXHA 4MGHA 3GRYA 2LWXA 1HT1E 4JV5M 1HR0M 4B3RM 3KOYE 1N78A 3UJNA 2CE7A 2Y0QA 4MH0E 4LF7M 3SBJA 2YNMD 3CF0A 4IBEA 1L2BA 4MGYE 3GQ3A 3GRRA 1IXZA 1DGHB 4AZFA 1R7RA 2KW0A 2EO2A 3M7GA 3J80S 3EIHA 3GLFB 3U61B 4LJ6A 3GPUA 3PXGA 3PVSA 2Y21A 3VFDA 3RE8A 4FCWA 2FNAA 1SXJD 3JAMS 2V1UA 1IXSB 2XSZA 4OVZA 1PJJA 3VKGA 1Z59A 4PT5A 3VKHA 3KW6A 3LQQA 4QHSA 1S3SA 1VDDA 3SC3A 1SXJA 4L8RC 1IN5A 2QPAA 4DV2M 4JI1M 3U6SA 1NY5A 3FUUA 5C1BA 5EXXA 2R62A 4DR4M 4LF4M 2QP9X 4DV6M 2EUCA 1H6UA 3J2PB 2X4AA 2FFJA 1FNNA 2W82A 3K92A 4NOOB 3RGPA 4REZA 1IY1A 3HU3A 5FTLA 1R2ZA 2RGHA 4KODA 3ZH9B 2DWZB 4LJAA 3A98B 1NY6A 4NRVA 3L25A 3TQSA 1TDHA 3JR4A 5IZ7D 2ZAMA 3VDUA 3HJ8A 4LZZA 1NNUC 3D8LA 1IM2A 1IY0A 4I81A 4DUZM 3U6QA 3TE6A 2LNHC 4BB9A 4IBDA 3VDPA 3SARA 5FTKA 2CHQA 3ILKA 3FYDA 2P5TA 1HT2E 1Z5AA 2F5NA 2RKOA 4W5WA 1JR3D 2X8AA 4L78A 4XBOA 3SAVA 3J81S 2VIIA 4DV1M 4P16A 2HKJA 3DFZA 3FYCA 1ZAEA 3I4VA 3GRUA 2ZM6M 2C99A 4X65M 5FTMA 2C98A 1QAOA 3GPPA 1XHBA 1JQJC 1L8QA 5KQ8A 3SASA 4K0KM 3U6DA 4IBFA 4LGMA 3HWSA 4LG2A 3T1YM 4KLNA 3GO8A 3A45A 3LVWA 1XMQM 5BR8M 2CEAA 1J5EM 3PFIA 2CV2A 4GHAA 1G4AE 4QNMA 2CFOA 2C96A 3L28A 3HHZA 2YQZA 3SHGB 2F5OA 4NL4H 5JI2E 5IREB 2FE8A 2O5RA 4D80A 4DR1M 4I5SA 4LGYA 4PCZA 3L27A 2L6OA 4B08A 3GPXA 3DA1A 2XLJA 4JYAM 3I4YA 3U5ZB 1QAMA 3U6PA 1R6BX 3KVWA 3IG8A 5LMNM 4JI8M 2CUZA 1IN6A 4G4QA 3ZCBB 1IN8A 3THGA 2NQ8C 2UXDM 3HU1A 4NSRA 4NSOB 5F3WA 1XC8A 2DWLA 1IN7A 1L1ZA 2ERCA 3PNVA 4ZPXA 5ITRA 4DR7M 3CTWB 1FJGM 2ZBKB 4B3SM 1L2CA 2R65A 4M9SA 4RF0A 3A46A 4CHTB 2QENA 1HNZM 3T1HM 3FTDA 1TH2A 4R7GA 5EP2A 2KZSA 1PM5A 3SYLA 2DHRA 3GQ4A 3U6OA 3SMSA 4LY6A 4A3VB 3GLHB 3MHVC 2C9OA 2BJWA 4DV4M 1DGGA 2XSZD 3HHWA 3VK7A 4FCTA 4AKGA 4DR2M 8CATA 3VK8A 4DR6M 3UK6A 1ZQ9A 3B9PA 2G5GX 4BLCA 1IBLM 2VQFM 3NBIA 2AHMA 4NXNM 4LJ4A 2UXBM 1Z5BA 3U60B 2D7GA 2YR0A 1TGUA 5DYGA 4LCBA 2XFSA 2QCUA 1NHWC 1N36M 3PNYA 1IBKM 4GIPA 1NJGA 1G41A 4GRIA 2G8LA 2XEPA 1OFHA 5ITTA 2VQEM 4RF1A 1DO0A 4LJ5A 3TPZA 5KQDA 1D2NA 1W5SA 2LH0A 4MB7A 3GLGB 4JI5M 4B3TM 4PD2A 1HQYE 5EP3A 4IBGA 1Z6TA 1QQWA 5EQTA 4AG6A 3GLIA 3GQ5A 2LXEA 2QBYB 2X49A 3KP1E 5A2QS 3SHFA 3Q8XA 3L26A 4WW0A 1XXHB 5KO3A 4I4LA 5KPRA 4YHHM 2V6ZM 4M0DA 3MK6A 3R8FA 3QWLA 2R18A 4KO8A 1N33M 3FTCA 2Z4SA 1IQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 M;  1XMO M;  3U6C A;  2XZU A;  3DOA A;  2F5O A;  1TDZ A;  4YY3 M;  3SAW A;  4DR1 M;  4PCZ A;  4JI6 M;  4JI0 M;  3GPX A;  4JV5 M;  4JYA M;  1HR0 M;  3C58 A;  3U6P A;  2HHH M;  2F4V M;  4B3R M;  1N34 M;  3W0F A;  2UUB M;  5LMN M;  4JI8 M;  1L1T A;  4G4Q A;  3SBJ A;  4LF7 M;  1L2B A;  3GQ3 A;  4LFB M;  1KFV A;  1HNX M;  4ITQ A;  4LF8 M;  3A42 A;  3J80 S;  4LF5 M;  2UXD M;  5LMU M;  1XC8 A;  3GPU A;  4DV5 M;  1L1Z A;  3SAT A;  5ITR A;  1Z5C A;  2F5S A;  2Q2E B;  4DR7 M;  3TWL A;  1FJG M;  3JAM S;  2ZBK B;  4B3S M;  1PJJ A;  3U6E A;  1L2C A;  5ITU A;  3U6L A;  4KHP M;  1Z59 A;  4NRW A;  2UXC M;  3A46 A;  1HNZ M;  3T1H M;  2OPF A;  4NXM M;  5FLX S;  1PM5 A;  3U6M A;  2UUC M;  3GQ4 A;  4DV2 M;  3U6O A;  1K82 A;  4JI7 M;  1PJI A;  4JI1 M;  2XZF A;  3U6S A;  4DV4 M;  2EA0 A;  1XNR M;  4G4R A;  4DR4 M;  4LF4 M;  4PDI A;  4DV6 M;  3VK7 A;  1NNJ A;  1MU5 A;  4DR2 M;  3VK8 A;  4JI4 M;  4DR5 M;  4DR6 M;  4X66 M;  5ITX E;  1K3W A;  1R2Z A;  1IBL M;  1N32 M;  4X64 M;  2VQF M;  4NXN M;  4NRV A;  1Z5B A;  1IBM M;  2UXB M;  2UU9 M;  4JI3 M;  1Q39 A;  5IT9 S;  1TDH A;  3JR4 A;  1HNW M;  3GP1 A;  2F5Q A;  1N36 M;  1IBK M;  1XNQ M;  4DV0 M;  4DUZ M;  3U6Q A;  4CIS A;  2UUA M;  5ITX A;  5ITT A;  3TWK A;  4PDG A;  4LF6 M;  2VQE M;  3GPY A;  3OTO M;  1R2Y A;  3SAR A;  1EE8 A;  1L2D A;  3J7A S;  2F5P A;  1Z5A A;  5ITY A;  4DV7 M;  1I94 M;  4MB7 A;  2F5N A;  1Q3B A;  4GKK M;  4GKJ M;  3SAV A;  4JI5 M;  2OQ4 A;  4DUY M;  4B3T M;  3J81 S;  4G4O A;  4PD2 A;  4DV1 M;  4B3M M;  4LF9 M;  2HKJ A;  3GQ5 A;  1MX0 A;  2ZM6 M;  5IWA M;  4X65 M;  5A2Q S;  1K3X A;  3JR5 A;  5ITQ A;  3GPP A;  4X62 M;  4K0K M;  3SAS A;  4AQY M;  4OX9 M;  3U6D A;  4YHH M;  3SAU A;  3TWM A;  3T1Y M;  4LFA M;  4G4N A;  1Q3C A;  4DV3 M;  2E5L M;  3GO8 A;  4LFC M;  3A45 A;  1N33 M;  1XMQ M;  4DR3 M;  5BR8 M;  1J5E M; 
#chains in the Genus database with same CATH topology
 3LMM A;  2WSE F;  2BJV A;  3TL4 X;  2XZU A;  2H5X A;  2M5Z A;  4M9Z A;  3WHL A;  1TDZ A;  3KP0 E;  3DZD A;  3RGS A;  3SAW A;  4LRT A;  1QDR A;  1OIP A;  4UN2 B;  4Z8X A;  4F1I A;  3B74 A;  4JI0 M;  5DNY A;  2JY5 A;  2I7N A;  3T6P A;  4LJ8 A;  2MRO B;  2LTU A;  2ZTD A;  4IJF A;  1GAB A;  3J27 B;  3C58 A;  2HHH M;  1C7Y A;  4HL4 A;  3W0F A;  1QUS A;  2JA2 A;  4IBK A;  1TF0 B;  3SFZ A;  4OVZ B;  4QHT A;  1DGB A;  2XGN A;  4QNR A;  2DXI A;  3HX3 A;  1KFV A;  4LF8 M;  4OU7 A;  3T15 A;  2DWN A;  1KSF X;  4R3D A;  1YSY A;  1R4G A;  1D0K A;  2BWE A;  5LMU M;  2KNZ A;  4DV5 M;  1SXJ B;  2O25 A;  5FTJ A;  3SAT A;  1DGF A;  1Z5C A;  2Q2E B;  4MGK E;  4BBA A;  4QOS A;  3UZU A;  2DAI A;  3FUT A;  4FWG A;  5BPV A;  2KEB A;  2R44 A;  4JN6 A;  4ANR A;  3E21 A;  4KHP M;  4NRW A;  3R9X B;  2K0B X;  2L7I A;  1DGH A;  2R45 A;  3GLF A;  2OPF A;  3U61 A;  4IBC A;  5FLX S;  2KZU A;  1NSF A;  3U6M A;  2JY7 A;  2M60 A;  1QZM A;  3K9O A;  4AG5 A;  4QOZ C;  1K82 A;  1PJI A;  2CRU A;  2KRU A;  3GLH E;  3H4J A;  1NVM A;  1DO2 A;  1IXS A;  3AJI B;  1GLN A;  1RU3 A;  3AOE C;  1LTM A;  3KS4 A;  1NNJ A;  1G8P A;  2FOI C;  1JR3 E;  3KXE C;  1MU5 A;  5KPZ A;  5JI3 E;  2MH8 A;  4JI4 M;  2H1R A;  2Z3X A;  2LVN C;  4X66 M;  4AKI A;  5ITX E;  2KRK A;  2R6F A;  5EJC A;  4GEW A;  5FSW A;  1ORY B;  2QZ4 A;  1I4W A;  1NV8 A;  2CV0 A;  1GO5 A;  1E9R A;  2Y0T A;  1GVN A;  1Q39 A;  3NWL A;  3FRI A;  2HCB A;  1WGN A;  2Z7J A;  1HNW M;  2F5Q A;  4EIW A;  1XNQ M;  1HQC A;  2ZAN A;  3CF2 A;  4OW0 A;  2OOB A;  1E9S A;  1OJL A;  3TWK A;  4FCV A;  2KNA A;  3BXW A;  3FD9 A;  5E26 A;  4PDG A;  2DKL A;  2WSF F;  5H37 D;  5EP4 A;  4Z6Y A;  2Z4R A;  3GRV A;  1T3T A;  4Y28 F;  4IIW A;  3OTO M;  1EE8 A;  4B7H A;  3GPY A;  4I8O A;  2QHO B;  3J7A S;  5DYI A;  1IN4 A;  5ITY A;  3GLG E;  3VLF B;  4DV7 M;  3LVV A;  4GKK M;  1NHG C;  2DNA A;  2J7O A;  4GKJ M;  4DUY M;  3D8B A;  4G4O A;  2KXE A;  1VQ1 A;  3SYK A;  2CV1 A;  4D82 A;  2ZAO A;  2J7N A;  3AOE A;  3W68 A;  1MX0 A;  1TH3 A;  1C1K A;  2A5Y B;  2FS1 A;  4CGY B;  5ITQ A;  2QQ8 A;  1OTR A;  3FTE A;  4LZJ A;  4AW4 A;  4FW9 A;  3HKP A;  1Y8G A;  4D81 A;  4S12 A;  4AQY M;  1XXH E;  4P17 A;  1GKI A;  2JY8 A;  4G3O A;  1QAN A;  3SAU A;  3TWM A;  3IG5 A;  3WHK A;  4G4N A;  1Q3C A;  2E5L M;  2L7H A;  2WZJ A;  4LFC M;  1LV7 A;  4KT0 F;  4DR3 M;  5IT9 S;  2K47 A;  4II7 A;  1XMO M;  2XFT A;  4L16 A;  3QAU A;  3DOA A;  2D7E A;  2R4E A;  2JNH A;  2R4J A;  2L09 A;  4JI6 M;  1YUB A;  5EXT A;  3RFW A;  1W5T A;  4FVM A;  4IBB A;  1WJ7 A;  1ZMV A;  4GC5 A;  2F4V M;  2K9D A;  2DZN B;  3FUV A;  1N34 M;  4LJ7 A;  1MJG M;  3EIE A;  2UUB M;  3KDS E;  1L1T A;  3I51 A;  1J7K A;  4XK8 F;  4LFB M;  3AKZ A;  1HNX M;  4ITQ A;  2QSF X;  3AFH A;  4MGZ E;  3A42 A;  4LF5 M;  3KSJ A;  3B89 A;  2C9C A;  1T6O A;  1HJP A;  1ZMW A;  1SXJ E;  2GQF A;  3L2A A;  3K2L A;  2HL7 A;  3U5Z A;  1QAQ A;  4XGI A;  2K6B A;  2L4F A;  2F5S A;  3L29 A;  3W67 A;  3F92 A;  1QDT A;  1XB2 B;  1XWI A;  2D7H A;  2MR9 A;  3KSX A;  3TWL A;  1WR1 B;  1YE9 A;  3HHX A;  5KPT A;  3U6E A;  2GNO A;  5ITU A;  3U6L A;  2UXC M;  4L15 A;  3K9P A;  7CAT A;  4AKH A;  3KS8 A;  3HJQ A;  4TUW A;  3W0L B;  4WUR A;  2Y20 A;  4NXM M;  1IXR C;  3T38 A;  2LBC A;  3FUW A;  2RRU A;  2UUC M;  1G3I A;  4JI7 M;  4IBJ A;  1V34 A;  2EKF A;  3UGJ A;  2XZF A;  2FH0 A;  4IBI A;  2LVQ D;  3AL0 C;  2DI0 A;  1GL6 A;  3HJS A;  3H4M A;  2KA6 B;  2EA0 A;  5EXS A;  1OAI A;  1TH4 A;  4G4R A;  1XNR M;  4PDI A;  3HHY A;  5EP1 A;  3SMP A;  4DR5 M;  3E9S A;  2VF8 A;  4MM3 B;  2DWM A;  1K3W A;  1J09 A;  1N32 M;  4X64 M;  2XF3 A;  3GLH A;  1G59 A;  3AV0 A;  2LHC A;  1IBM M;  4GMQ A;  2CWB A;  2UU9 M;  4JI3 M;  1JB0 F;  4M0W A;  1AUA A;  3CF6 E;  3KOZ E;  2C5R A;  4GH9 A;  3GP1 A;  1JR3 A;  2DZO B;  2RGO A;  2LVO C;  4DV0 M;  1N77 A;  3M0E A;  5EXP A;  2I7P A;  3ZQJ A;  4LJ9 A;  4CIS A;  2UUA M;  2YFQ A;  5ITX A;  4JXJ A;  1EFU B;  3GLI B;  1IY2 A;  3I01 M;  4GC9 A;  2DAK A;  3UMM A;  4FD2 A;  3HU2 A;  1KYI A;  4G6Z A;  1ZMU A;  2V1C A;  4LF6 M;  1PGY A;  3U60 A;  4L6V 6;  1R2Y A;  1E94 E;  4B7F A;  2XH9 A;  1X37 A;  1L2D A;  1N75 A;  4IJE A;  5GKN A;  4RNA A;  4HLQ A;  4GHL A;  1G71 A;  5FTN A;  3LQR A;  3J7B A;  2F5P A;  1I94 M;  2CHG A;  3KFU G;  1GL7 A;  1Q3B A;  4L4U A;  2CP8 A;  1OFI A;  2OQ4 A;  3IEC A;  1NJF A;  2BNK A;  4M9X A;  4AI6 A;  4B3M M;  4LF9 M;  2L2D A;  3FKE A;  4FWD A;  1SG9 A;  1AIP C;  2DZL A;  5IWA M;  2DVW B;  3K1J A;  5E6J A;  1K3X A;  3JR5 A;  5C18 A;  3KOW E;  3FTF A;  3AOG A;  1QVR A;  3KOX E;  4X62 M;  3MJ5 A;  4GIT A;  4OX9 M;  3K8Z A;  2DEN A;  3GLG A;  4FWH A;  4LRS A;  4HEO A;  2R46 A;  1UM8 A;  4LFA M;  3E4R A;  4DV3 M;  1WXQ A;  3M6A A;  3BOS A;  4WP2 A;  3QYB A;  4MGI E;  2MJ5 B;  1SXJ C;  2QBY A;  3QYE A;  4JI2 M;  2MGW A;  2CHV A;  3HGI A;  3ZC7 B;  3U6C A;  3FUX A;  1OKS A;  1E32 A;  4YY3 M;  2JZ0 A;  1QYR A;  4B7G A;  1XXH A;  4MGH A;  3GRY A;  2LWX A;  2WSC F;  3FE3 A;  3LW5 F;  1HT1 E;  4JV5 M;  2JP7 A;  1HR0 M;  4B3R M;  3KOY E;  1YLA A;  2KHH A;  3UJN A;  1N78 A;  2CE7 A;  2Y0Q A;  3HY5 A;  1EIJ A;  3HZJ A;  4MH0 E;  4LF7 M;  1VEJ A;  3SBJ A;  2YNM D;  3CF0 A;  4IBE A;  1L2B A;  4MGY E;  3GQ3 A;  3GRR A;  1IXZ A;  1D0M A;  1DGH B;  2JXN A;  1R7R A;  2KW0 A;  2EO2 A;  3M7G A;  3J80 S;  3EIH A;  4AZF A;  3GLF B;  3U61 B;  4LJ6 A;  3GPU A;  3PXG A;  3PVS A;  2Y21 A;  3VFD A;  3RE8 A;  2EJS A;  4FCW A;  2FNA A;  1SXJ D;  3JAM S;  2V1U A;  1IXS B;  2XSZ A;  4OVZ A;  1PJJ A;  2DHY A;  1Z59 A;  3VKG A;  3IHP A;  4PT5 A;  3VKH A;  1BVS A;  3KW6 A;  3LQQ A;  2JWS A;  4QHS A;  1S3S A;  1VDD A;  3SC3 A;  1SXJ A;  4L8R C;  1IN5 A;  2APL A;  2QPA A;  4DV2 M;  4JI1 M;  3U6S A;  1V92 A;  1NY5 A;  3C3E A;  3FUU A;  5C1B A;  5EXX A;  2R62 A;  2VF7 A;  4DR4 M;  4LF4 M;  2QP9 X;  4DV6 M;  3B7N A;  2EUC A;  2LHG A;  1H6U A;  3J2P B;  2HAK A;  2X4A A;  2FFJ A;  1FNN A;  2W82 A;  3K92 A;  4NOO B;  2B3T A;  2L4E A;  4REZ A;  1IY1 A;  3HU3 A;  3RGP A;  5FTL A;  1R2Z A;  2RGH A;  4KOD A;  3ZH9 B;  2DWZ B;  4LJA A;  3A98 B;  1NY6 A;  4NRV A;  3L25 A;  3BBZ A;  1R5L A;  2EKK A;  3TQS A;  1TDH A;  3JR4 A;  2ZTC A;  5IZ7 D;  2ZAM A;  1DV0 A;  3VDU A;  3HJ8 A;  3Q8G A;  4LZZ A;  1CUK A;  1NNU C;  3D8L A;  1IM2 A;  1IY0 A;  4I81 A;  4DUZ M;  3U6Q A;  3GLI E;  3B7Q A;  3TE6 A;  2N35 A;  3LCU A;  2LNH C;  4BB9 A;  4IBD A;  2LVP C;  3VDP A;  1VEK A;  3SAR A;  5FTK A;  2CHQ A;  3ILK A;  3FYD A;  2P5T A;  1HT2 E;  1Z5A A;  1WIV A;  2F5N A;  1NO1 A;  2RKO A;  4W5W A;  1JR3 D;  2X8A A;  4L78 A;  4XBO A;  3SAV A;  3J81 S;  2VII A;  4DV1 M;  4P16 A;  2HKJ A;  3DFZ A;  3FYC A;  3LCV B;  1ZAE A;  3I4V A;  3GRU A;  1VEG A;  1WGL A;  2C99 A;  2ZM6 M;  1TR8 A;  4X65 M;  1P3Q Q;  5FTM A;  2JY6 B;  4NC6 A;  2C98 A;  1QAO A;  3GPP A;  3FRH A;  1XHB A;  1JQJ C;  1L8Q A;  1OQY A;  5KQ8 A;  2HWJ A;  3SAS A;  3U6D A;  4K0K M;  2LVA A;  3E46 A;  4IBF A;  4LGM A;  5DFL A;  3HWS A;  4LG2 A;  3I04 M;  3T1Y M;  1UFZ A;  2O01 F;  4KLN A;  2OO9 A;  3GO8 A;  3A45 A;  3LVW A;  1XMQ M;  5BR8 M;  2CEA A;  1J5E M;  3PFI A;  2CV2 A;  4GHA A;  1IFY A;  1V33 A;  1G4A E;  4QNM A;  2CFO A;  2C96 A;  3L28 A;  2KNV A;  2YQZ A;  3SHG B;  3HHZ A;  2F5O A;  4NL4 H;  5JI2 E;  2G3Q A;  5IRE B;  4Q7J A;  2FE8 A;  2O5R A;  4D80 A;  4DR1 M;  4I5S A;  4LGY A;  4PCZ A;  3L27 A;  2L6O A;  4B08 A;  1ZV1 A;  3DA1 A;  2XLJ A;  3GPX A;  4JYA M;  1GJT A;  3I4Y A;  2OOA A;  3MMP A;  3U5Z B;  1QAM A;  3B7Z A;  1R6B X;  3U6P A;  3KVW A;  1QUT A;  3IG8 A;  5LMN M;  4JI8 M;  2CUZ A;  1IN6 A;  4G4Q A;  3ZCB B;  5L8R F;  1IN8 A;  3THG A;  2JZ1 A;  2NQ8 C;  3GLF E;  2UXD M;  1F4I A;  3HU1 A;  4NSR A;  4NSO B;  5F3W A;  1XC8 A;  2DWL A;  1IN7 A;  1L1Z A;  2ERC A;  3PNV A;  4ZPX A;  5ITR A;  4DR7 M;  1A5T A;  2KDL A;  1VG5 A;  4F2L A;  3CTW B;  1FJG M;  2ZBK B;  4B3S M;  1L2C A;  2R65 A;  4M9S A;  4RF0 A;  3A46 A;  4CHT B;  2QEN A;  1HNZ M;  3T1H M;  3FTD A;  1TH2 A;  4R7G A;  2R0I A;  1OIZ A;  2KZS A;  5EP2 A;  1PM5 A;  3SYL A;  2DHR A;  3GQ4 A;  3U6O A;  3SMS A;  2BWB A;  4LY6 A;  4A3V B;  3GLH B;  3MHV C;  2C9O A;  2BJW A;  2QNJ A;  4DV4 M;  1DGG A;  2DAM A;  2XSZ D;  3HHW A;  3VK7 A;  4FCT A;  4AKG A;  4DR2 M;  8CAT A;  3VK8 A;  1TTE A;  1QZE A;  4DR6 M;  3UK6 A;  1ZQ9 A;  3B9P A;  2G5G X;  4BLC A;  1IBL M;  1NV9 A;  2VQF M;  3NBI A;  2AHM A;  4NXN M;  4LJ4 A;  2UXB M;  1Z5B A;  3U60 B;  2D7G A;  2YR0 A;  3NBX X;  1TGU A;  5DYG A;  4LCB A;  2XFS A;  2QCU A;  1NHW C;  1N36 M;  3PNY A;  1PRB A;  1IBK M;  4GIP A;  1D0L A;  1NJG A;  2DAE A;  1G41 A;  4GRI A;  2G8L A;  2XEP A;  1OFH A;  4CJ6 A;  4CIZ A;  5ITT A;  2VDB B;  3C9P A;  2VQE M;  2DAG A;  4RF1 A;  1DO0 A;  2JUJ A;  4LJ5 A;  3TPZ A;  5KQD A;  4DBG B;  1D2N A;  1Q02 A;  2LH0 A;  1PJT A;  1W5S A;  4MB7 A;  4R71 A;  3GLG B;  4JI5 M;  4B3T M;  4PD2 A;  1HQY E;  5EP3 A;  4IBG A;  1Z6T A;  1QQW A;  2J5Y A;  5EQT A;  4AG6 A;  3GLI A;  3GQ5 A;  2LXE A;  2QBY B;  2X49 A;  1PJQ A;  3KP1 E;  5A2Q S;  3C3D A;  4RKU F;  3SHF A;  3Q8X A;  3L26 A;  1GJS A;  1T43 A;  1MN3 A;  2Z8Y M;  1OAO C;  4WW0 A;  1WHC A;  1XXH B;  5KO3 A;  4I4L A;  1PJS A;  5KPR A;  4YHH M;  1VDL A;  2V6Z M;  4M0D A;  3MK6 A;  3R8F A;  3QWL A;  2R18 A;  3CGW A;  4KO8 A;  3V76 A;  1N33 M;  3FTC A;  2Z4S A;  1IQP A; 
#chains in the Genus database with same CATH homology
 3LMM A;  2BJV A;  3TL4 X;  2XZU A;  2M5Z A;  4M9Z A;  3WHL A;  1TDZ A;  3KP0 E;  3DZD A;  3RGS A;  3SAW A;  4LRT A;  4Z8X A;  4JI0 M;  5DNY A;  2I7N A;  4LJ8 A;  4IJF A;  3J27 B;  3C58 A;  2HHH M;  4HL4 A;  3W0F A;  2JA2 A;  4IBK A;  3SFZ A;  4OVZ B;  4QHT A;  1DGB A;  2XGN A;  4QNR A;  2DXI A;  1KFV A;  4LF8 M;  4OU7 A;  3T15 A;  2DWN A;  1KSF X;  4R3D A;  1YSY A;  5LMU M;  4DV5 M;  1SXJ B;  5FTJ A;  3SAT A;  1DGF A;  1Z5C A;  2Q2E B;  4MGK E;  4BBA A;  4QOS A;  3UZU A;  3FUT A;  4FWG A;  5BPV A;  2KEB A;  4JN6 A;  4KHP M;  4NRW A;  3R9X B;  2L7I A;  1DGH A;  2R45 A;  3GLF A;  2OPF A;  3U61 A;  4IBC A;  5FLX S;  2KZU A;  1NSF A;  3U6M A;  2M60 A;  1QZM A;  4AG5 A;  4QOZ C;  1K82 A;  1PJI A;  2KRU A;  1NVM A;  1DO2 A;  3AJI B;  1GLN A;  3AOE C;  3KS4 A;  1NNJ A;  1G8P A;  2FOI C;  3KXE C;  5KPZ A;  1MU5 A;  5JI3 E;  4JI4 M;  2H1R A;  2Z3X A;  4X66 M;  4AKI A;  5ITX E;  2KRK A;  5EJC A;  5FSW A;  1ORY B;  2QZ4 A;  1I4W A;  2CV0 A;  1E9R A;  2Y0T A;  1GVN A;  1Q39 A;  3NWL A;  2HCB A;  1HNW M;  2Z7J A;  2F5Q A;  4EIW A;  1XNQ M;  1HQC A;  2ZAN A;  3CF2 A;  4OW0 A;  1E9S A;  1OJL A;  3TWK A;  4FCV A;  5E26 A;  3FD9 A;  4PDG A;  5H37 D;  5EP4 A;  4Z6Y A;  2Z4R A;  3GRV A;  1T3T A;  3OTO M;  4IIW A;  3GPY A;  1EE8 A;  4B7H A;  4I8O A;  3J7A S;  5DYI A;  1IN4 A;  5ITY A;  3VLF B;  4DV7 M;  3LVV A;  4GKK M;  1NHG C;  4GKJ M;  2J7O A;  4DUY M;  3D8B A;  4G4O A;  2KXE A;  2CV1 A;  3SYK A;  4D82 A;  2ZAO A;  2J7N A;  3AOE A;  1MX0 A;  1TH3 A;  1C1K A;  2A5Y B;  4CGY B;  5ITQ A;  3FTE A;  4LZJ A;  4AW4 A;  4FW9 A;  3HKP A;  4D81 A;  4S12 A;  4AQY M;  1GKI A;  3SAU A;  1QAN A;  3TWM A;  3IG5 A;  3WHK A;  4G4N A;  1Q3C A;  2E5L M;  2L7H A;  4LFC M;  1LV7 A;  4DR3 M;  5IT9 S;  2K47 A;  4II7 A;  1XMO M;  2XFT A;  4L16 A;  3QAU A;  3DOA A;  2D7E A;  2R4E A;  2R4J A;  2L09 A;  4JI6 M;  1YUB A;  5EXT A;  3RFW A;  1W5T A;  4FVM A;  4IBB A;  2F4V M;  4GC5 A;  2DZN B;  3FUV A;  1N34 M;  4LJ7 A;  2UUB M;  3EIE A;  3KDS E;  1L1T A;  3I51 A;  1J7K A;  4LFB M;  3AKZ A;  1HNX M;  4ITQ A;  3AFH A;  4MGZ E;  3A42 A;  4LF5 M;  3KSJ A;  2C9C A;  1SXJ E;  3L2A A;  3K2L A;  2HL7 A;  3U5Z A;  1QAQ A;  4XGI A;  2F5S A;  3L29 A;  3TWL A;  1XWI A;  2D7H A;  3KSX A;  3HHX A;  1YE9 A;  5KPT A;  3U6E A;  5ITU A;  3U6L A;  2UXC M;  4L15 A;  7CAT A;  4AKH A;  3KS8 A;  3HJQ A;  4TUW A;  3W0L B;  4WUR A;  2Y20 A;  4NXM M;  1IXR C;  3T38 A;  3FUW A;  2UUC M;  1G3I A;  4JI7 M;  4IBJ A;  3UGJ A;  2XZF A;  4IBI A;  3AL0 C;  1GL6 A;  3HJS A;  3H4M A;  2KA6 B;  2EA0 A;  5EXS A;  1TH4 A;  4G4R A;  1XNR M;  4PDI A;  3HHY A;  5EP1 A;  3SMP A;  4DR5 M;  3E9S A;  4MM3 B;  2DWM A;  1K3W A;  1J09 A;  1N32 M;  4X64 M;  2XF3 A;  3GLH A;  1G59 A;  3AV0 A;  1IBM M;  4GMQ A;  2UU9 M;  4JI3 M;  4M0W A;  3CF6 E;  3KOZ E;  2C5R A;  4GH9 A;  3GP1 A;  1JR3 A;  2DZO B;  2RGO A;  4DV0 M;  1N77 A;  3M0E A;  5EXP A;  2I7P A;  4LJ9 A;  4CIS A;  2UUA M;  2YFQ A;  5ITX A;  4JXJ A;  3GLI B;  1IY2 A;  4GC9 A;  3UMM A;  4FD2 A;  3HU2 A;  1KYI A;  4G6Z A;  2V1C A;  4LF6 M;  3U60 A;  1R2Y A;  1E94 E;  4B7F A;  2XH9 A;  1X37 A;  1L2D A;  1N75 A;  4IJE A;  5GKN A;  4RNA A;  4HLQ A;  4GHL A;  5FTN A;  3LQR A;  3J7B A;  2F5P A;  1I94 M;  2CHG A;  3KFU G;  1GL7 A;  1Q3B A;  4L4U A;  1OFI A;  2OQ4 A;  1NJF A;  2BNK A;  4M9X A;  4AI6 A;  4B3M M;  4LF9 M;  3FKE A;  4FWD A;  5IWA M;  2DVW B;  3K1J A;  5E6J A;  1K3X A;  3JR5 A;  5C18 A;  3KOW E;  3FTF A;  3AOG A;  1QVR A;  3KOX E;  4X62 M;  3MJ5 A;  4GIT A;  4OX9 M;  3K8Z A;  3GLG A;  4FWH A;  4LRS A;  2R46 A;  1UM8 A;  4LFA M;  3E4R A;  4DV3 M;  1WXQ A;  3M6A A;  3BOS A;  4MGI E;  1SXJ C;  2QBY A;  4JI2 M;  2CHV A;  3HGI A;  3ZC7 B;  3U6C A;  3FUX A;  1E32 A;  4YY3 M;  1QYR A;  4B7G A;  1XXH A;  4MGH A;  3GRY A;  2LWX A;  1HT1 E;  4JV5 M;  1HR0 M;  4B3R M;  3KOY E;  1N78 A;  3UJN A;  2CE7 A;  2Y0Q A;  4MH0 E;  4LF7 M;  3SBJ A;  2YNM D;  3CF0 A;  4IBE A;  1L2B A;  4MGY E;  3GQ3 A;  3GRR A;  1IXZ A;  1DGH B;  4AZF A;  1R7R A;  2KW0 A;  2EO2 A;  3M7G A;  3J80 S;  3EIH A;  3GLF B;  3U61 B;  4LJ6 A;  3GPU A;  3PXG A;  3PVS A;  2Y21 A;  3VFD A;  3RE8 A;  4FCW A;  2FNA A;  1SXJ D;  3JAM S;  2V1U A;  1IXS B;  2XSZ A;  4OVZ A;  1PJJ A;  3VKG A;  1Z59 A;  4PT5 A;  3VKH A;  3KW6 A;  3LQQ A;  4QHS A;  1S3S A;  1VDD A;  3SC3 A;  1SXJ A;  4L8R C;  1IN5 A;  2QPA A;  4DV2 M;  4JI1 M;  3U6S A;  1NY5 A;  3FUU A;  5C1B A;  5EXX A;  2R62 A;  4DR4 M;  4LF4 M;  2QP9 X;  4DV6 M;  2EUC A;  1H6U A;  3J2P B;  2X4A A;  2FFJ A;  1FNN A;  2W82 A;  3K92 A;  4NOO B;  3RGP A;  4REZ A;  1IY1 A;  3HU3 A;  5FTL A;  1R2Z A;  2RGH A;  4KOD A;  3ZH9 B;  2DWZ B;  4LJA A;  3A98 B;  1NY6 A;  4NRV A;  3L25 A;  3TQS A;  1TDH A;  3JR4 A;  5IZ7 D;  2ZAM A;  3VDU A;  3HJ8 A;  4LZZ A;  1NNU C;  3D8L A;  1IM2 A;  1IY0 A;  4I81 A;  4DUZ M;  3U6Q A;  3TE6 A;  2LNH C;  4BB9 A;  4IBD A;  3VDP A;  3SAR A;  5FTK A;  2CHQ A;  3ILK A;  3FYD A;  2P5T A;  1HT2 E;  1Z5A A;  2F5N A;  2RKO A;  4W5W A;  1JR3 D;  2X8A A;  4L78 A;  4XBO A;  3SAV A;  3J81 S;  2VII A;  4DV1 M;  4P16 A;  2HKJ A;  3DFZ A;  3FYC A;  1ZAE A;  3I4V A;  3GRU A;  2ZM6 M;  2C99 A;  4X65 M;  5FTM A;  2C98 A;  1QAO A;  3GPP A;  1XHB A;  1JQJ C;  1L8Q A;  5KQ8 A;  3SAS A;  4K0K M;  3U6D A;  4IBF A;  4LGM A;  3HWS A;  4LG2 A;  3T1Y M;  4KLN A;  3GO8 A;  3A45 A;  3LVW A;  1XMQ M;  5BR8 M;  2CEA A;  1J5E M;  3PFI A;  2CV2 A;  4GHA A;  1G4A E;  4QNM A;  2CFO A;  2C96 A;  3L28 A;  3HHZ A;  2YQZ A;  3SHG B;  2F5O A;  4NL4 H;  5JI2 E;  5IRE B;  2FE8 A;  2O5R A;  4D80 A;  4DR1 M;  4I5S A;  4LGY A;  4PCZ A;  3L27 A;  2L6O A;  4B08 A;  3GPX A;  3DA1 A;  2XLJ A;  4JYA M;  3I4Y A;  3U5Z B;  1QAM A;  3U6P A;  1R6B X;  3KVW A;  3IG8 A;  5LMN M;  4JI8 M;  2CUZ A;  1IN6 A;  4G4Q A;  3ZCB B;  1IN8 A;  3THG A;  2NQ8 C;  2UXD M;  3HU1 A;  4NSR A;  4NSO B;  5F3W A;  1XC8 A;  2DWL A;  1IN7 A;  1L1Z A;  2ERC A;  3PNV A;  4ZPX A;  5ITR A;  4DR7 M;  3CTW B;  1FJG M;  2ZBK B;  4B3S M;  1L2C A;  2R65 A;  4M9S A;  4RF0 A;  3A46 A;  4CHT B;  2QEN A;  1HNZ M;  3T1H M;  3FTD A;  1TH2 A;  4R7G A;  5EP2 A;  2KZS A;  1PM5 A;  3SYL A;  2DHR A;  3GQ4 A;  3U6O A;  3SMS A;  4LY6 A;  4A3V B;  3GLH B;  3MHV C;  2C9O A;  2BJW A;  4DV4 M;  1DGG A;  2XSZ D;  3HHW A;  3VK7 A;  4FCT A;  4AKG A;  4DR2 M;  8CAT A;  3VK8 A;  4DR6 M;  3UK6 A;  1ZQ9 A;  3B9P A;  2G5G X;  4BLC A;  1IBL M;  2VQF M;  3NBI A;  2AHM A;  4NXN M;  4LJ4 A;  2UXB M;  1Z5B A;  3U60 B;  2D7G A;  2YR0 A;  1TGU A;  5DYG A;  4LCB A;  2XFS A;  2QCU A;  1NHW C;  1N36 M;  3PNY A;  1IBK M;  4GIP A;  1NJG A;  1G41 A;  4GRI A;  2G8L A;  2XEP A;  1OFH A;  5ITT A;  2VQE M;  4RF1 A;  1DO0 A;  4LJ5 A;  3TPZ A;  5KQD A;  1D2N A;  1W5S A;  2LH0 A;  4MB7 A;  3GLG B;  4JI5 M;  4B3T M;  4PD2 A;  1HQY E;  5EP3 A;  4IBG A;  1Z6T A;  1QQW A;  5EQT A;  4AG6 A;  3GLI A;  3GQ5 A;  2LXE A;  2QBY B;  2X49 A;  3KP1 E;  5A2Q S;  3SHF A;  3Q8X A;  3L26 A;  4WW0 A;  1XXH B;  5KO3 A;  4I4L A;  5KPR A;  4YHH M;  2V6Z M;  4M0D A;  3MK6 A;  3R8F A;  3QWL A;  2R18 A;  4KO8 A;  1N33 M;  3FTC A;  2Z4S A;  1IQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...