1IBLM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1iblM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1iblM02
1N32M 1HNXM 2VQEM 4NXNM 5LMUM 3GQ5A 3A42A 4DR1M 2EA0A 3U6SA 2UUBM 5ITXA 3JR5A 4G4RA 4LF9M 5LMNM 4G4OA 3J81S 4LFCM 4DV2M 5ITTA 5ITUA 3U6MA 5ITYA 4JI4M 2F5OA 4DV0M 3OTOM 4G4NA 3T1HM 1Q3CA 2OQ4A 1HNZM 2VQFM 4JI5M 4DR3M 4PCZA 4X62M 4B3MM 2F5QA 4JI2M 4DUYM 5ITRA 5FLXS 2UUAM 1N34M 1Z59A 4LF8M 4JI0M 3SATA 4JI6M 4JI1M 2HHHM 4DV7M 3GO8A 1HR0M 1L1ZA 3DOAA 3SAUA 4NRVA 1L1TA 4JI7M 3TWMA 4DUZM 4GKJM 1PJJA 1IBLM 4K0KM 1Z5AA 1PM5A 1TDHA 2Q2EB 4DV5M 1XMQM 2UU9M 4NRWA 4JI3M 4YHHM 5ITQA 1K3XA 3SBJA 1L2BA 2E5LM 4OX9M 1XMOM 5IT9S 4DV1M 4LF7M 2F5SA 1IBKM 4LFAM 1I94M 2UXBM 4LF5M 1XC8A 3A46A 3GPYA 3VK8A 4DV6M 1K82A 1FJGM 4DV3M 4LF4M 3U6DA 1MU5A 3J80S 3GP1A 5BR8M 4B3RM 4X66M 3U6EA 3A45A 2F5NA 1KFVA 1K3WA 3GQ4A 4JV5M 4LFBM 4DR5M 1EE8A 2XZFA 1J5EM 3GQ3A 3T1YM 2UXDM 3SAVA 5IWAM 4DR4M 3SARA 3JAMS 1Q39A 3TWKA 4B3SM 3SAWA 4YY3M 1N36M 3TWLA 4DR2M 3U6CA 1R2ZA 3U6OA 1MX0A 5ITXE 1Q3BA 3U6PA 4G4QA 3J7AS 3VK7A 4PDIA 2XZUA 1TDZA 1XNRM 2UXCM 1NNJA 4GKKM 4DR6M 1N33M 3C58A 4DV4M 1L2DA 4PD2A 2ZBKB 4X65M 3JR4A 4B3TM 4JYAM 3GPPA 1Z5BA 4ITQA 4PDGA 4AQYM 4KHPM 2HKJA 4X64M 1HNWM 1XNQM 1R2YA 4JI8M 4CISA 2F4VM 3U6LA 4MB7A 2F5PA 1L2CA 3GPXA 1PJIA 5A2QS 1IBMM 4LF6M 3SASA 2OPFA 4DR7M 3W0FA 3U6QA 4NXMM 3GPUA 2UUCM 2ZM6M 1Z5CA
chains in the Genus database with same CATH superfamily
1N32M 5FTNA 1ZAEA 1XWIA 1CUKA 3FUVA 2H1RA 2V6ZM 3LCVB 5LMUM 3GQ5A 2KZUA 3BOSA 4LJ4A 1MN3A 4MM3B 3JR5A 5LMNM 4G3OA 3B9PA 2LTUA 2R4JA 3AKZA 4FCWA 2CV0A 2I7PA 2QBYB 1WGLA 2FE8A 3R8FA 2F5OA 2DZLA 2DHYA 4G4NA 1QAQA 1Q3CA 2GNOA 2KDLA 5KPRA 2XLJA 2OQ4A 3T1HM 1WXQA 4ZPXA 4JI5M 4KLNA 2F5QA 1WJ7A 2Y21A 3B7ZA 1N34M 2FOIC 4JI0M 1AUAA 2G5GX 4JI6M 4JI1M 1D2NA 2HHHM 4DV7M 2QENA 4Z8XA 1QVRA 3FRHA 4Y28F 1VEGA 4M0DA 2RGOA 3B7QA 2X8AA 3SYKA 3D8BA 1PJJA 4P17A 1Z6TA 4IIWA 1PM5A 4QHSA 5IZ7D 1XMQM 4GEWA 4DV5M 4CGYB 4YHHM 3J27B 3SYLA 2R18A 2R46A 2Z8YM 4BBAA 5IT9S 3PVSA 4W5WA 2LVAA 2BNKA 5KQ8A 1N75A 2C96A 2LBCA 3MHVC 4JI2M 3SHGB 2L4EA 2WSCF 2JY5A 4LG2A 1G41A 1GKIA 1K82A 1FJGM 4MH0E 3U6DA 1MU5A 2MH8A 3F92A 2XFTA 2R62A 2RKOA 3I04M 3L29A 4LZZA 5KPTA 2O25A 3THGA 1KFVA 1F4IA 4IBDA 2DAKA 1S3SA 2FFJA 4DR5M 2DAGA 1J5EM 2BWEA 3GQ3A 4GITA 4JXJA 3L27A 3UZUA 2K47A 1Q39A 1R4GA 3AFHA 3FYCA 1NV8A 2CHGA 4RF1A 5EXXA 3WHLA 2CEAA 2VIIA 1MX0A 2CV1A 2VF8A 3E4RA 3HHWA 3U6PA 5F3WA 3J7AS 1JQJC 1V34A 2UXCM 2ZAOA 1NNJA 4DR6M 3HU3A 3NBXX 3VKHA 3GLGA 2HL7A 2QZ4A 1R5LA 4LCBA 2DHRA 1XB2B 4X65M 3U61B 3TE6A 2H5XA 2BWBA 1IQPA 3FKEA 4XBOA 1IXRC 2LWXA 3LQQA 1ZMWA 1UFZA 4PT5A 2X49A 3UGJA 1QZMA 4KHPM 1SXJD 4I5SA 4L78A 1IY0A 2C98A 1R2YA 4JI8M 4NC6A 3U6LA 2AHMA 2G8LA 2X4AA 1J7KA 2MGWA 4LY6A 2LXEA 4L8RC 1PJIA 1N77A 2DAIA 1L8QA 3MMPA 4DR7M 3W0FA 4LJ6A 2KW0A 2XEPA 3PXGA 3KS4A 4HL4A 3U5ZB 1D0KA 3L28A 5C18A 3ZQJA 1R6BX 1WIVA 3M7GA 3KOXE 2JNHA 2EUCA 1DGBA 1R7RA 3W0LB 3HY5A 2JXNA 2R4EA 2VQEM 4NXNM 1DGHB 4LGMA 1XHBA 4QHTA 1PJSA 1WGNA 3B7NA 2D7GA 5ITXA 5EP3A 4G4RA 3AOGA 4LFCM 2QP9X 2QBYA 1WR1B 2CFOA 5ITUA 3E21A 1ZMUA 1SXJA 4JI4M 2OOAA 2GQFA 1HNZM 1IN5A 3HKPA 4NL4H 1JB0F 1G4AE 4DR3M 4PCZA 1T3TA 1E9RA 3K1JA 4REZA 1OAIA 4EIWA 5ITRA 5FLXS 2C5RA 1Z59A 2KZSA 1G59A 4LF8M 2XFSA 2C9OA 4WURA 1G8PA 4LGYA 2JZ1A 1GVNA 2CWBA 4OVZB 4WW0A 1NVMA 3GO8A 4RNAA 2LNHC 2DAEA 2YR0A 3KVWA 3VDPA 4BB9A 2EJSA 3GLGB 4DUZM 2DWMA 2DVWB 1HT2E 1UM8A 1GL7A 2NQ8C 1TDHA 2VDBB 5E26A 1TGUA 4LJ5A 4JI3M 2QSFX 5E6JA 3SBJA 3HU2A 2L2DA 3RGSA 2QPAA 2BJWA 4FCTA 4LF7M 1DO0A 3B74A 3KSJA 1I94M 1OAOC 1D0LA 4LF5M 3GLIA 3GPYA 1IFYA 2A5YB 3KP0E 2O01F 3VFDA 5DNYA 2DXIA 2VF7A 1NO1A 1FNNA 2DNAA 2JY6B 4GIPA 1Q02A 4L6V6 3ZH9B 3T38A 2QNJA 5FTLA 1XXHE 4B3RM 3FRIA 1LV7A 4X66M 3NBIA 3FUUA 5FTMA 1K3WA 4AZFA 3HJSA 4JV5M 2WZJA 4LFBM 3FTDA 4FW9A 3GLHB 1E32A 3L25A 3T1YM 1RU3A 2FNAA 3M0EA 4B7FA 2N35A 2R44A 3LCUA 3TWKA 3SAWA 3FYDA 3QWLA 3K9OA 2R6FA 1R2ZA 5JI2E 2C9CA 1JR3A 4IBBA 1GJSA 1Q3BA 2KNZA 4FWDA 2K9DA 1QUTA 4JYAM 8CATA 1C7YA 2JY7A 2LHGA 3A98B 1GO5A 1NY5A 2QHOB 3C58A 1EIJA 3KOWE 1L2DA 4LJAA 3GRRA 4PD2A 1TH3A 3GLFA 3AL0C 4KT0F 2DZOB 4IJEA 3VKGA 2Z4SA 1DGGA 3D8LA 3GPPA 2K6BA 1PRBA 2JWSA 3J7BA 1SXJE 4LJ8A 4GC5A 3HJQA 4L15A 2DENA 2WSFF 4X64M 1MJGM 2L4FA 3LW5F 1OKSA 4AG5A 3I4YA 3I4VA 1I4WA 3E9SA 3IHPA 3QYEA 5EP1A 5BPVA 4LF6M 2HWJA 5EQTA 2DI0A 3SMSA 1TR8A 3SASA 2OPFA 4BLCA 3LVVA 2KXEA 1NHWC 4M0WA 1PGYA 4HLQA 1VG5A 3IG8A 3EIEA 3MK6A 5DFLA 4CHTB 1IN4A 3GPUA 2KA6B 2UUCM 3MJ5A 1IXSB 3VLFB 2KNAA 2LVNC 1Z5CA 3GLHE 2CV2A 7CATA 2LVOC 1QYRA 2XH9A 2ERCA 4II7A 3U60B 3T15A 2YQZA 3H4MA 4XK8F 3A42A 4DR1M 2EA0A 3U6SA 3J81S 2ZANA 5ITTA 3U6MA 4GHAA 1WHCA 2P5TA 5ITYA 1NJGA 4DV0M 3HWSA 1XXHB 4QOSA 3W68A 4X62M 4B3MM 1DV0A 1GLNA 2RGHA 2APLA 3SHFA 4QNMA 1EFUB 1OJLA 2UUAM 1HJPA 5EP2A 3SATA 1NHGC 4IBIA 4L4UA 3HU1A 3PNVA 1HR0M 1HQCA 2DWZB 1L1ZA 1IY1A 2XGNA 3AV0A 4NRVA 4JI7M 1ZMVA 3CF2A 1H6UA 1E9SA 1YSYA 1IBLM 1W5SA 5GKNA 2CRUA 1NJFA 3KFUG 1ZV1A 3KSXA 4NRWA 4AI6A 1QQWA 4M9XA 1P3QQ 1HT1E 1AIPC 2EKKA 1L2BA 2E5LM 1XMOM 3R9XB 4AKGA 4DV1M 2Z3XA 1D0MA 5H37D 2F5SA 3FUWA 1IBKM 4UN2B 2UXBM 1IN7A 3GLFE 2FS1A 3K92A 3M6AA 4IBFA 3GLFB 3A46A 4NOOB 1VEKA 3VK8A 1YLAA 4I81A 5IREB 2R45A 3DZDA 2JZ0A 3GRVA 3KXEC 4DV3M 3U5ZA 1X37A 3J80S 2HAKA 2Y20A 4D82A 2I7NA 2XSZD 2KEBA 4B7HA 3A45A 3U6EA 2F5NA 2ZAMA 4GRIA 1A5TA 1IN8A 1SXJC 1HNXM 2OO9A 4LZJA 5KO3A 4IBJA 3I51A 4DBGB 2XZFA 1OTRA 3SAVA 2JP7A 4NSOB 4GMQA 5IWAM 4DR4M 3SARA 3TL4X 2D7HA 4B3SM 2XSZA 4YY3M 1N36M 3TWLA 4DR2M 3CF0A 3U6CA 4IBCA 2MJ5B 3HHXA 1DGFA 1IY2A 5FTJA 3U6OA 3DFZA 5ITXE 2JY8A 1W5TA 4IBGA 1VDLA 4G4QA 4PDIA 2XZUA 1TDZA 4RKUF 3KP1E 3L2AA 4DV4M 5KPZA 4QOZC 3GRUA 2Y0TA 2KHHA 2KRUA 2LHCA 2OOBA 2ZBKB 4JN6A 4R3DA 2LVQD 3H4JA 2LVPC 4P16A 1IN6A 1LTMA 3LMMA 5FSWA 3JR4A 1JR3D 4IBEA 3SFZA 4B3TM 1DO2A 3ZC7B 2BJVA 1OFHA 1QDRA 3KDSE 3I01M 1QDTA 3FTCA 2RRUA 4PDGA 4TUWA 3PFIA 4KODA 2D7EA 1NNUC 1PJTA 5DYIA 1OFIA 2HKJA 3GLIE 4AW4A 4GH9A 1NV9A 2CUZA 4Q7JA 3FUXA 1NY6A 4XGIA 1TF0B 4LJ7A 4MB7A 3HHZA 2F5PA 5EXTA 4OW0A 4OU7A 1IXZA 1GABA 3Q8GA 4FCVA 3GPXA 1QANA 3RFWA 5A2QS 4AKHA 3L26A 1OQYA 3KOYE 3CTWB 5FTKA 2G3QA 1NSFA 1TH4A 1VDDA 4OVZA 3UJNA 1V33A 2L7IA 3U6QA 4ANRA 4MGYE 3IECA 1G3IA 4NXMM 3KS8A 3QYBA 3HZJA 1KSFX 3C3DA 1J09A 1Y8GA 1GJTA 1T6OA 2WSEF 1SG9A 2ZTCA 3GRYA 3LQRA 4G6ZA 1SXJB 3QAUA 3SMPA 2JUJA 3TPZA 3AOEC 3UMMA 3V76A 4MGIE 2DWLA 2UUBM 4LF9M 2CHVA 1HQYE 4G4OA 2ZTDA 3FD9A 4D81A 4DV2M 4Z6YA 1DGHA 4FWHA 1ZQ9A 3OTOM 2M5ZA 2VQFM 1E94E 3C3EA 3NWLA 3FUTA 3PNYA 4HEOA 5C1BA 2Z4RA 4AG6A 2QQ8A 4DUYM 4CJ6A 2CP8A 3Q8XA 3U60A 3FTEA 2KRKA 2R0IA 1JR3E 2J7NA 2L6OA 4QNRA 3DOAA 3SAUA 2B3TA 4L16A 1L1TA 2DAMA 3HX3A 2J7OA 3TWMA 4GKJM 2L7HA 4K0KM 1Z5AA 4NSRA 3GLGE 4LRTA 2CE7A 1ORYB 3C9PA 4R71A 2Q2EB 2YNMD 4LJ9A 5EP4A 1C1KA 5DYGA 2CHQA 1VEJA 4FWGA 3WHKA 4A3VB 2UU9M 5ITQA 5JI3E 1K3XA 2L09A 4OX9M 5L8RF 2XF3A 4LFAM 1VQ1A 3U61A 3UK6A 2KNVA 3HJ8A 4F1IA 1XC8A 2K0BX 1GL6A 5EXSA 3T6PA 2Y0QA 3ILKA 3E46A 4DV6M 5EJCA 4LF4M 4WP2A 4M9ZA 2R65A 3GP1A 4FD2A 5BR8M 2C99A 1YE9A 1G71A 1TH2A 2Z7JA 3HHYA 4IJFA 3IG5A 3GQ4A 4GHLA 3K8ZA 4D80A 1EE8A 1OIZA 3SC3A 4B08A 2UXDM 2J5YA 1TTEA 3RGPA 3TQSA 4FVMA 2JA2A 1N78A 2HCBA 3FTFA 3JAMS 4IBKA 1OIPA 3HGIA 2LH0A 2YFQA 4I4LA 1YUBA 3BXWA 1KYIA 3ZCBB 4LRSA 2V1UA 3AOEA 3GLHA 2O5RA 3VDUA 3VK7A 4S12A 1XNRM 3K2LA 4GKKM 1N33M 3FE3A 3B89A 3CF6E 3J2PB 4F2LA 1QAMA 1IM2A 4GC9A 2DZNB 3RE8A 1QZEA 4I8OA 1Z5BA 4MGZE 4ITQA 3K9PA 2DWNA 4AKIA 3LVWA 2EKFA 4KO8A 2EO2A 2MROB 3GLIB 4AQYM 1XXHA 4M9SA 1BVSA 1HNWM 1XNQM 2W82A 3AJIB 4CISA 3DA1A 2F4VM 4RF0A 2V1CA 1T43A 2MR9A 1L2CA 3EIHA 5KQDA 1V92A 3BBZA 1IBMM 3KW6A 3CGWA 4R7GA 3W67A 2FH0A 3KOZE 4B7GA 4CIZA 2DKLA 1QUSA 5EXPA 4MGHA 2QCUA 1IXSA 2M60A 4MGKE 2ZM6M 1QAOA 1PJQA
chains in the Genus database with same CATH topology
1N32M 5FTNA 1ZAEA 1XWIA 3FUVA 2H1RA 2V6ZM 5LMUM 3GQ5A 2KZUA 3BOSA 4LJ4A 4MM3B 3JR5A 5LMNM 3B9PA 2R4JA 3AKZA 4FCWA 2CV0A 2I7PA 2QBYB 2FE8A 3R8FA 2F5OA 4G4NA 1QAQA 1Q3CA 5KPRA 2XLJA 2OQ4A 3T1HM 4JI5M 1WXQA 4ZPXA 4KLNA 2F5QA 2Y21A 1N34M 2FOIC 4JI0M 2G5GX 4JI6M 4JI1M 1D2NA 2HHHM 4DV7M 2QENA 4Z8XA 1QVRA 4M0DA 2RGOA 2X8AA 3SYKA 3D8BA 1PJJA 1Z6TA 4IIWA 1PM5A 4QHSA 5IZ7D 1XMQM 4DV5M 4CGYB 4YHHM 3J27B 3SYLA 2R18A 2R46A 5IT9S 4BBAA 3PVSA 4W5WA 2BNKA 5KQ8A 1N75A 2C96A 3MHVC 3SHGB 4LG2A 1G41A 1GKIA 1K82A 1FJGM 4MH0E 3U6DA 1MU5A 2XFTA 2R62A 2RKOA 3L29A 4LZZA 5KPTA 3THGA 1KFVA 4IBDA 1S3SA 2FFJA 4DR5M 1J5EM 3GQ3A 4GITA 4JXJA 3L27A 3UZUA 2K47A 1Q39A 3AFHA 3FYCA 2CHGA 4RF1A 5EXXA 3WHLA 2CEAA 2VIIA 1MX0A 2CV1A 3E4RA 3HHWA 3U6PA 5F3WA 3J7AS 1JQJC 2UXCM 2ZAOA 1NNJA 4DR6M 3HU3A 3VKHA 3GLGA 2HL7A 2QZ4A 4LCBA 2DHRA 4X65M 3U61B 3TE6A 4XBOA 1IQPA 3FKEA 1IXRC 2LWXA 3LQQA 4PT5A 2X49A 3UGJA 1QZMA 4KHPM 1SXJD 4I5SA 4L78A 1IY0A 2C98A 1R2YA 4JI8M 3U6LA 2AHMA 2G8LA 2X4AA 1J7KA 4LY6A 2LXEA 4L8RC 1PJIA 1N77A 1L8QA 4DR7M 3W0FA 4LJ6A 2KW0A 2XEPA 3PXGA 3KS4A 4HL4A 3U5ZB 3L28A 5C18A 1R6BX 3M7GA 3KOXE 2EUCA 1DGBA 1R7RA 3W0LB 2R4EA 2VQEM 4NXNM 1DGHB 4LGMA 1XHBA 4QHTA 2D7GA 5ITXA 5EP3A 4G4RA 3AOGA 4LFCM 2QP9X 2QBYA 2CFOA 5ITUA 1SXJA 4JI4M 1HNZM 1IN5A 3HKPA 4NL4H 1G4AE 4DR3M 4PCZA 1T3TA 1E9RA 3K1JA 4REZA 2C5RA 4EIWA 5ITRA 5FLXS 1G59A 1Z59A 2KZSA 4JI2M 4LF8M 2XFSA 2C9OA 4WURA 1G8PA 4LGYA 1GVNA 4OVZB 4WW0A 3GO8A 1NVMA 4RNAA 2LNHC 2YR0A 3KVWA 3VDPA 4BB9A 3GLGB 4DUZM 2DWMA 2DVWB 1HT2E 1UM8A 1GL7A 2NQ8C 1TDHA 5E26A 1TGUA 4LJ5A 4JI3M 5E6JA 3SBJA 3HU2A 3RGSA 2QPAA 2BJWA 4FCTA 4LF7M 1DO0A 3KSJA 1I94M 4LF5M 3GLIA 3GPYA 2A5YB 3KP0E 3VFDA 5DNYA 2DXIA 1FNNA 4GIPA 3ZH9B 3T38A 5FTLA 4B3RM 1LV7A 4X66M 3NBIA 3FUUA 5FTMA 1K3WA 4AZFA 3HJSA 4JV5M 4LFBM 3FTDA 4FW9A 3GLHB 1E32A 3L25A 3T1YM 2FNAA 3M0EA 4B7FA 3TWKA 3SAWA 3FYDA 3QWLA 1R2ZA 5JI2E 2C9CA 1JR3A 4IBBA 1Q3BA 4FWDA 8CATA 3A98B 1NY5A 3C58A 3KOWE 1L2DA 4LJAA 3GRRA 4PD2A 1TH3A 3GLFA 3AL0C 2DZOB 4IJEA 3VKGA 2Z4SA 1DGGA 3D8LA 3GPPA 3J7BA 1SXJE 4LJ8A 4GC5A 3HJQA 4L15A 4X64M 4AG5A 3I4YA 3I4VA 1I4WA 3E9SA 5EP1A 5BPVA 4LF6M 5EQTA 3SMSA 3SASA 2OPFA 4BLCA 3LVVA 2KXEA 1NHWC 4M0WA 4HLQA 3IG8A 3EIEA 3MK6A 4CHTB 1IN4A 3GPUA 2KA6B 2UUCM 3MJ5A 1IXSB 3VLFB 1Z5CA 2CV2A 7CATA 1QYRA 2XH9A 2ERCA 4II7A 3U60B 3T15A 2YQZA 3H4MA 3A42A 4DR1M 2EA0A 3U6SA 3J81S 2ZANA 5ITTA 3U6MA 4GHAA 2P5TA 5ITYA 1NJGA 4DV0M 3HWSA 1XXHB 4QOSA 4X62M 4B3MM 1GLNA 2RGHA 3SHFA 4QNMA 1OJLA 2UUAM 5EP2A 3SATA 1NHGC 4IBIA 4L4UA 3HU1A 3PNVA 1HR0M 1HQCA 2DWZB 1L1ZA 1IY1A 2XGNA 3AV0A 4NRVA 4JI7M 3CF2A 1H6UA 1E9SA 1YSYA 1IBLM 1W5SA 5GKNA 1NJFA 3KFUG 3KSXA 4NRWA 4AI6A 1QQWA 4M9XA 1HT1E 2E5LM 1L2BA 1XMOM 3R9XB 4AKGA 4DV1M 2Z3XA 5H37D 2F5SA 3FUWA 1IBKM 2UXBM 1IN7A 3K92A 3M6AA 4IBFA 3GLFB 3A46A 4NOOB 3VK8A 4I81A 5IREB 2R45A 3DZDA 3KXEC 3GRVA 4DV3M 3U5ZA 1X37A 3J80S 2Y20A 4D82A 2I7NA 2XSZD 2KEBA 4B7HA 3A45A 3U6EA 2F5NA 2ZAMA 4GRIA 1IN8A 1SXJC 4LZJA 5KO3A 4IBJA 3I51A 2XZFA 3SAVA 5IWAM 4NSOB 4GMQA 4DR4M 3SARA 3TL4X 2D7HA 4B3SM 2XSZA 4YY3M 1N36M 3TWLA 4DR2M 3CF0A 3U6CA 4IBCA 3HHXA 1DGFA 1IY2A 5FTJA 3U6OA 3DFZA 5ITXE 1W5TA 4IBGA 4G4QA 4PDIA 2XZUA 1TDZA 3KP1E 3L2AA 4DV4M 5KPZA 4QOZC 3GRUA 2Y0TA 2KRUA 4JN6A 2ZBKB 4R3DA 4P16A 5FSWA 1IN6A 3LMMA 3JR4A 1JR3D 4IBEA 3SFZA 4B3TM 1DO2A 3ZC7B 2BJVA 1OFHA 4JYAM 3KDSE 4TUWA 3FTCA 4PDGA 3PFIA 4KODA 2D7EA 1NNUC 5DYIA 1OFIA 2HKJA 4AW4A 4GH9A 2CUZA 3FUXA 1NY6A 4XGIA 4LJ7A 4MB7A 3HHZA 2F5PA 5EXTA 4OW0A 4OU7A 1IXZA 3GPXA 4FCVA 1QANA 3RFWA 5A2QS 4AKHA 3L26A 3KOYE 3CTWB 5FTKA 3UJNA 1NSFA 1TH4A 1VDDA 4OVZA 2L7IA 3U6QA 4MGYE 1G3IA 4NXMM 3KS8A 1KSFX 1J09A 4G6ZA 3LQRA 1HNXM 3GRYA 3SMPA 1SXJB 3QAUA 3TPZA 3AOEC 3UMMA 4MGIE 2DWLA 2UUBM 4LF9M 2CHVA 1HQYE 4G4OA 3FD9A 4D81A 4DV2M 4Z6YA 1DGHA 4FWHA 1ZQ9A 3OTOM 2M5ZA 2VQFM 1E94E 3NWLA 3PNYA 3FUTA 5C1BA 2Z4RA 4AG6A 4DUYM 3U60A 3Q8XA 3FTEA 2KRKA 2J7NA 2L6OA 4QNRA 3DOAA 3SAUA 1L1TA 4L16A 3TWMA 2J7OA 4GKJM 2L7HA 4K0KM 1Z5AA 4NSRA 4LRTA 2CE7A 1ORYB 2Q2EB 2YNMD 4LJ9A 5EP4A 1C1KA 5DYGA 2CHQA 4FWGA 3WHKA 4A3VB 2UU9M 5ITQA 5JI3E 1K3XA 2L09A 4OX9M 2XF3A 4LFAM 3U61A 3UK6A 3HJ8A 1XC8A 5EXSA 1GL6A 2Y0QA 3ILKA 4DV6M 5EJCA 4LF4M 4M9ZA 2R65A 3GP1A 4FD2A 5BR8M 2C99A 1YE9A 1TH2A 2Z7JA 3HHYA 4IJFA 3IG5A 3GQ4A 4GHLA 3K8ZA 4D80A 1EE8A 3SC3A 4B08A 2UXDM 3RGPA 3TQSA 4FVMA 2JA2A 1N78A 2HCBA 3FTFA 3JAMS 4IBKA 3HGIA 2LH0A 2YFQA 4I4LA 1YUBA 1KYIA 3ZCBB 4LRSA 2V1UA 3AOEA 3GLHA 2O5RA 3VDUA 3VK7A 4S12A 1XNRM 3K2LA 4GKKM 1N33M 3CF6E 3J2PB 1QAMA 1IM2A 4GC9A 2DZNB 3RE8A 4I8OA 1Z5BA 4MGZE 4ITQA 4AKIA 2DWNA 3LVWA 4KO8A 2EO2A 3GLIB 4AQYM 1XXHA 4M9SA 1HNWM 1XNQM 2W82A 3AJIB 4CISA 3DA1A 2F4VM 4RF0A 2V1CA 1L2CA 3EIHA 5KQDA 1IBMM 3KW6A 4R7GA 3KOZE 4B7GA 5EXPA 4MGHA 2QCUA 2M60A 4MGKE 2ZM6M 1QAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 M;  1HNX M;  2VQE M;  4NXN M;  5LMU M;  3GQ5 A;  3A42 A;  4DR1 M;  2EA0 A;  3U6S A;  2UUB M;  5ITX A;  3JR5 A;  4G4R A;  4LF9 M;  5LMN M;  4G4O A;  3J81 S;  4LFC M;  4DV2 M;  5ITT A;  5ITU A;  3U6M A;  5ITY A;  4JI4 M;  2F5O A;  4DV0 M;  3OTO M;  4G4N A;  3T1H M;  1Q3C A;  2OQ4 A;  1HNZ M;  2VQF M;  4JI5 M;  4DR3 M;  4PCZ A;  4X62 M;  4B3M M;  2F5Q A;  4JI2 M;  4DUY M;  5ITR A;  5FLX S;  2UUA M;  1N34 M;  1Z59 A;  4LF8 M;  4JI0 M;  3SAT A;  4JI6 M;  4JI1 M;  2HHH M;  4DV7 M;  3GO8 A;  1HR0 M;  1L1Z A;  3DOA A;  3SAU A;  4NRV A;  1L1T A;  4JI7 M;  3TWM A;  4DUZ M;  4GKJ M;  1PJJ A;  1IBL M;  4K0K M;  1Z5A A;  1PM5 A;  1TDH A;  2Q2E B;  4DV5 M;  1XMQ M;  2UU9 M;  4NRW A;  4JI3 M;  4YHH M;  5ITQ A;  1K3X A;  3SBJ A;  1L2B A;  2E5L M;  4OX9 M;  1XMO M;  5IT9 S;  4DV1 M;  4LF7 M;  2F5S A;  1IBK M;  4LFA M;  1I94 M;  2UXB M;  4LF5 M;  1XC8 A;  3A46 A;  3GPY A;  3VK8 A;  4DV6 M;  1K82 A;  1FJG M;  4DV3 M;  4LF4 M;  3U6D A;  1MU5 A;  3J80 S;  3GP1 A;  5BR8 M;  4B3R M;  4X66 M;  3U6E A;  3A45 A;  2F5N A;  1KFV A;  1K3W A;  3GQ4 A;  4JV5 M;  4LFB M;  4DR5 M;  1EE8 A;  2XZF A;  1J5E M;  3GQ3 A;  3T1Y M;  2UXD M;  3SAV A;  5IWA M;  4DR4 M;  3SAR A;  3JAM S;  1Q39 A;  3TWK A;  4B3S M;  3SAW A;  4YY3 M;  1N36 M;  3TWL A;  4DR2 M;  3U6C A;  1R2Z A;  3U6O A;  1MX0 A;  5ITX E;  1Q3B A;  3U6P A;  4G4Q A;  3J7A S;  3VK7 A;  4PDI A;  2XZU A;  1TDZ A;  1XNR M;  2UXC M;  1NNJ A;  4GKK M;  4DR6 M;  1N33 M;  3C58 A;  4DV4 M;  1L2D A;  4PD2 A;  2ZBK B;  4X65 M;  3JR4 A;  4B3T M;  4JYA M;  3GPP A;  1Z5B A;  4ITQ A;  4PDG A;  4AQY M;  4KHP M;  2HKJ A;  4X64 M;  1HNW M;  1XNQ M;  1R2Y A;  4JI8 M;  4CIS A;  2F4V M;  3U6L A;  4MB7 A;  2F5P A;  1L2C A;  3GPX A;  1PJI A;  5A2Q S;  1IBM M;  4LF6 M;  3SAS A;  2OPF A;  4DR7 M;  3W0F A;  3U6Q A;  4NXM M;  3GPU A;  2UUC M;  2ZM6 M;  1Z5C A; 
#chains in the Genus database with same CATH topology
 1N32 M;  5FTN A;  1ZAE A;  1XWI A;  1CUK A;  3FUV A;  2H1R A;  2V6Z M;  3LCV B;  5LMU M;  3GQ5 A;  2KZU A;  3BOS A;  4LJ4 A;  1MN3 A;  4MM3 B;  3JR5 A;  5LMN M;  4G3O A;  3B9P A;  2LTU A;  2R4J A;  3AKZ A;  4FCW A;  2CV0 A;  2I7P A;  2QBY B;  1WGL A;  2FE8 A;  3R8F A;  2F5O A;  2DZL A;  2DHY A;  4G4N A;  1QAQ A;  1Q3C A;  2GNO A;  2KDL A;  5KPR A;  2XLJ A;  2OQ4 A;  3T1H M;  1WXQ A;  4ZPX A;  4JI5 M;  4KLN A;  2F5Q A;  1WJ7 A;  2Y21 A;  3B7Z A;  1N34 M;  2FOI C;  4JI0 M;  1AUA A;  2G5G X;  4JI6 M;  4JI1 M;  1D2N A;  2HHH M;  4DV7 M;  2QEN A;  4Z8X A;  1QVR A;  3FRH A;  4Y28 F;  1VEG A;  4M0D A;  2RGO A;  3B7Q A;  2X8A A;  3SYK A;  3D8B A;  1PJJ A;  4P17 A;  1Z6T A;  4IIW A;  1PM5 A;  4QHS A;  5IZ7 D;  1XMQ M;  4GEW A;  4DV5 M;  4CGY B;  4YHH M;  3J27 B;  3SYL A;  2R18 A;  2R46 A;  2Z8Y M;  4BBA A;  5IT9 S;  3PVS A;  4W5W A;  2LVA A;  2BNK A;  5KQ8 A;  1N75 A;  2C96 A;  2LBC A;  3MHV C;  4JI2 M;  3SHG B;  2L4E A;  2WSC F;  2JY5 A;  4LG2 A;  1G41 A;  1GKI A;  1K82 A;  1FJG M;  4MH0 E;  3U6D A;  1MU5 A;  2MH8 A;  3F92 A;  2XFT A;  2R62 A;  2RKO A;  3I04 M;  3L29 A;  4LZZ A;  5KPT A;  2O25 A;  3THG A;  1KFV A;  1F4I A;  4IBD A;  2DAK A;  1S3S A;  2FFJ A;  4DR5 M;  2DAG A;  1J5E M;  2BWE A;  3GQ3 A;  4GIT A;  4JXJ A;  3L27 A;  3UZU A;  2K47 A;  1Q39 A;  1R4G A;  3AFH A;  3FYC A;  1NV8 A;  2CHG A;  4RF1 A;  5EXX A;  3WHL A;  2CEA A;  2VII A;  1MX0 A;  2CV1 A;  2VF8 A;  3E4R A;  3HHW A;  3U6P A;  5F3W A;  3J7A S;  1JQJ C;  1V34 A;  2UXC M;  2ZAO A;  1NNJ A;  4DR6 M;  3HU3 A;  3NBX X;  3VKH A;  3GLG A;  2HL7 A;  2QZ4 A;  1R5L A;  4LCB A;  2DHR A;  1XB2 B;  4X65 M;  3U61 B;  3TE6 A;  2H5X A;  2BWB A;  1IQP A;  3FKE A;  4XBO A;  1IXR C;  2LWX A;  3LQQ A;  1ZMW A;  1UFZ A;  4PT5 A;  2X49 A;  3UGJ A;  1QZM A;  4KHP M;  1SXJ D;  4I5S A;  4L78 A;  1IY0 A;  2C98 A;  1R2Y A;  4JI8 M;  4NC6 A;  3U6L A;  2AHM A;  2G8L A;  2X4A A;  1J7K A;  2MGW A;  4LY6 A;  2LXE A;  4L8R C;  1PJI A;  1N77 A;  2DAI A;  1L8Q A;  3MMP A;  4DR7 M;  3W0F A;  4LJ6 A;  2KW0 A;  2XEP A;  3PXG A;  3KS4 A;  4HL4 A;  3U5Z B;  1D0K A;  3L28 A;  5C18 A;  3ZQJ A;  1R6B X;  1WIV A;  3M7G A;  3KOX E;  2JNH A;  2EUC A;  1DGB A;  1R7R A;  3W0L B;  3HY5 A;  2JXN A;  2R4E A;  2VQE M;  4NXN M;  1DGH B;  4LGM A;  1XHB A;  4QHT A;  1PJS A;  1WGN A;  3B7N A;  2D7G A;  5ITX A;  5EP3 A;  4G4R A;  3AOG A;  4LFC M;  2QP9 X;  2QBY A;  1WR1 B;  2CFO A;  5ITU A;  3E21 A;  1ZMU A;  1SXJ A;  4JI4 M;  2OOA A;  2GQF A;  1HNZ M;  1IN5 A;  3HKP A;  4NL4 H;  1JB0 F;  1G4A E;  4DR3 M;  4PCZ A;  1T3T A;  1E9R A;  3K1J A;  4REZ A;  1OAI A;  4EIW A;  5ITR A;  5FLX S;  2C5R A;  1Z59 A;  2KZS A;  1G59 A;  4LF8 M;  2XFS A;  2C9O A;  4WUR A;  1G8P A;  4LGY A;  2JZ1 A;  1GVN A;  2CWB A;  4OVZ B;  4WW0 A;  1NVM A;  3GO8 A;  4RNA A;  2LNH C;  2DAE A;  2YR0 A;  3KVW A;  3VDP A;  4BB9 A;  2EJS A;  3GLG B;  4DUZ M;  2DWM A;  2DVW B;  1HT2 E;  1UM8 A;  1GL7 A;  2NQ8 C;  1TDH A;  2VDB B;  5E26 A;  1TGU A;  4LJ5 A;  4JI3 M;  2QSF X;  5E6J A;  3SBJ A;  3HU2 A;  2L2D A;  3RGS A;  2QPA A;  2BJW A;  4FCT A;  4LF7 M;  1DO0 A;  3B74 A;  3KSJ A;  1I94 M;  1OAO C;  1D0L A;  4LF5 M;  3GLI A;  3GPY A;  1IFY A;  2A5Y B;  3KP0 E;  2O01 F;  3VFD A;  5DNY A;  2DXI A;  2VF7 A;  1NO1 A;  1FNN A;  2DNA A;  2JY6 B;  4GIP A;  1Q02 A;  4L6V 6;  3ZH9 B;  3T38 A;  2QNJ A;  5FTL A;  1XXH E;  4B3R M;  3FRI A;  1LV7 A;  4X66 M;  3NBI A;  3FUU A;  5FTM A;  1K3W A;  4AZF A;  3HJS A;  4JV5 M;  2WZJ A;  4LFB M;  3FTD A;  4FW9 A;  3GLH B;  1E32 A;  3L25 A;  3T1Y M;  1RU3 A;  2FNA A;  3M0E A;  4B7F A;  2N35 A;  2R44 A;  3LCU A;  3TWK A;  3SAW A;  3FYD A;  3QWL A;  3K9O A;  2R6F A;  1R2Z A;  5JI2 E;  2C9C A;  1JR3 A;  4IBB A;  1GJS A;  1Q3B A;  2KNZ A;  4FWD A;  2K9D A;  1QUT A;  4JYA M;  8CAT A;  1C7Y A;  2JY7 A;  2LHG A;  3A98 B;  1GO5 A;  1NY5 A;  2QHO B;  3C58 A;  1EIJ A;  3KOW E;  1L2D A;  4LJA A;  3GRR A;  4PD2 A;  1TH3 A;  3GLF A;  3AL0 C;  4KT0 F;  2DZO B;  4IJE A;  3VKG A;  2Z4S A;  1DGG A;  3D8L A;  3GPP A;  2K6B A;  1PRB A;  2JWS A;  3J7B A;  1SXJ E;  4LJ8 A;  4GC5 A;  3HJQ A;  4L15 A;  2DEN A;  2WSF F;  4X64 M;  1MJG M;  2L4F A;  3LW5 F;  1OKS A;  4AG5 A;  3I4Y A;  3I4V A;  1I4W A;  3E9S A;  3IHP A;  3QYE A;  5EP1 A;  5BPV A;  4LF6 M;  2HWJ A;  5EQT A;  2DI0 A;  3SMS A;  1TR8 A;  3SAS A;  2OPF A;  4BLC A;  3LVV A;  2KXE A;  1NHW C;  4M0W A;  1PGY A;  4HLQ A;  1VG5 A;  3IG8 A;  3EIE A;  3MK6 A;  5DFL A;  4CHT B;  1IN4 A;  3GPU A;  2KA6 B;  2UUC M;  3MJ5 A;  1IXS B;  3VLF B;  2KNA A;  2LVN C;  1Z5C A;  3GLH E;  2CV2 A;  7CAT A;  2LVO C;  1QYR A;  2XH9 A;  2ERC A;  4II7 A;  3U60 B;  3T15 A;  2YQZ A;  3H4M A;  4XK8 F;  3A42 A;  4DR1 M;  2EA0 A;  3U6S A;  3J81 S;  2ZAN A;  5ITT A;  3U6M A;  4GHA A;  1WHC A;  2P5T A;  5ITY A;  1NJG A;  4DV0 M;  3HWS A;  1XXH B;  4QOS A;  3W68 A;  4X62 M;  4B3M M;  1DV0 A;  1GLN A;  2RGH A;  2APL A;  3SHF A;  4QNM A;  1EFU B;  1OJL A;  2UUA M;  1HJP A;  5EP2 A;  3SAT A;  1NHG C;  4IBI A;  4L4U A;  3HU1 A;  3PNV A;  1HR0 M;  1HQC A;  2DWZ B;  1L1Z A;  1IY1 A;  2XGN A;  3AV0 A;  4NRV A;  4JI7 M;  1ZMV A;  3CF2 A;  1H6U A;  1E9S A;  1YSY A;  1IBL M;  1W5S A;  5GKN A;  2CRU A;  1NJF A;  3KFU G;  1ZV1 A;  3KSX A;  4NRW A;  4AI6 A;  1QQW A;  4M9X A;  1P3Q Q;  1HT1 E;  1AIP C;  2EKK A;  1L2B A;  2E5L M;  1XMO M;  3R9X B;  4AKG A;  4DV1 M;  2Z3X A;  1D0M A;  5H37 D;  2F5S A;  3FUW A;  1IBK M;  4UN2 B;  2UXB M;  1IN7 A;  3GLF E;  2FS1 A;  3K92 A;  3M6A A;  4IBF A;  3GLF B;  3A46 A;  4NOO B;  1VEK A;  3VK8 A;  1YLA A;  4I81 A;  5IRE B;  2R45 A;  3DZD A;  2JZ0 A;  3GRV A;  3KXE C;  4DV3 M;  3U5Z A;  1X37 A;  3J80 S;  2HAK A;  2Y20 A;  4D82 A;  2I7N A;  2XSZ D;  2KEB A;  4B7H A;  3A45 A;  3U6E A;  2F5N A;  2ZAM A;  4GRI A;  1A5T A;  1IN8 A;  1SXJ C;  1HNX M;  2OO9 A;  4LZJ A;  5KO3 A;  4IBJ A;  3I51 A;  4DBG B;  2XZF A;  1OTR A;  3SAV A;  2JP7 A;  4NSO B;  4GMQ A;  5IWA M;  4DR4 M;  3SAR A;  3TL4 X;  2D7H A;  4B3S M;  2XSZ A;  4YY3 M;  1N36 M;  3TWL A;  4DR2 M;  3CF0 A;  3U6C A;  4IBC A;  2MJ5 B;  3HHX A;  1DGF A;  1IY2 A;  5FTJ A;  3U6O A;  3DFZ A;  5ITX E;  2JY8 A;  1W5T A;  4IBG A;  1VDL A;  4G4Q A;  4PDI A;  2XZU A;  1TDZ A;  4RKU F;  3KP1 E;  3L2A A;  4DV4 M;  5KPZ A;  4QOZ C;  3GRU A;  2Y0T A;  2KHH A;  2KRU A;  2LHC A;  2OOB A;  2ZBK B;  4JN6 A;  4R3D A;  2LVQ D;  3H4J A;  2LVP C;  4P16 A;  1IN6 A;  1LTM A;  3LMM A;  5FSW A;  3JR4 A;  1JR3 D;  4IBE A;  3SFZ A;  4B3T M;  1DO2 A;  3ZC7 B;  2BJV A;  1OFH A;  1QDR A;  3KDS E;  3I01 M;  1QDT A;  3FTC A;  2RRU A;  4PDG A;  4TUW A;  3PFI A;  4KOD A;  2D7E A;  1NNU C;  1PJT A;  5DYI A;  1OFI A;  2HKJ A;  3GLI E;  4AW4 A;  4GH9 A;  1NV9 A;  2CUZ A;  4Q7J A;  3FUX A;  1NY6 A;  4XGI A;  1TF0 B;  4LJ7 A;  4MB7 A;  3HHZ A;  2F5P A;  5EXT A;  4OW0 A;  4OU7 A;  1IXZ A;  1GAB A;  3Q8G A;  4FCV A;  3GPX A;  1QAN A;  3RFW A;  5A2Q S;  4AKH A;  3L26 A;  1OQY A;  3KOY E;  3CTW B;  5FTK A;  2G3Q A;  1NSF A;  1TH4 A;  1VDD A;  4OVZ A;  3UJN A;  1V33 A;  2L7I A;  3U6Q A;  4ANR A;  4MGY E;  3IEC A;  1G3I A;  4NXM M;  3KS8 A;  3QYB A;  3HZJ A;  1KSF X;  3C3D A;  1J09 A;  1Y8G A;  1GJT A;  1T6O A;  2WSE F;  1SG9 A;  2ZTC A;  3GRY A;  3LQR A;  4G6Z A;  1SXJ B;  3QAU A;  3SMP A;  2JUJ A;  3TPZ A;  3AOE C;  3UMM A;  3V76 A;  4MGI E;  2DWL A;  2UUB M;  4LF9 M;  2CHV A;  1HQY E;  4G4O A;  2ZTD A;  3FD9 A;  4D81 A;  4DV2 M;  4Z6Y A;  1DGH A;  4FWH A;  1ZQ9 A;  3OTO M;  2M5Z A;  2VQF M;  1E94 E;  3C3E A;  3NWL A;  3FUT A;  3PNY A;  4HEO A;  5C1B A;  2Z4R A;  4AG6 A;  2QQ8 A;  4DUY M;  4CJ6 A;  2CP8 A;  3Q8X A;  3U60 A;  3FTE A;  2KRK A;  2R0I A;  1JR3 E;  2J7N A;  2L6O A;  4QNR A;  3DOA A;  3SAU A;  2B3T A;  4L16 A;  1L1T A;  2DAM A;  3HX3 A;  2J7O A;  3TWM A;  4GKJ M;  2L7H A;  4K0K M;  1Z5A A;  4NSR A;  3GLG E;  4LRT A;  2CE7 A;  1ORY B;  3C9P A;  4R71 A;  2Q2E B;  2YNM D;  4LJ9 A;  5EP4 A;  1C1K A;  5DYG A;  2CHQ A;  1VEJ A;  4FWG A;  3WHK A;  4A3V B;  2UU9 M;  5ITQ A;  5JI3 E;  1K3X A;  2L09 A;  4OX9 M;  5L8R F;  2XF3 A;  4LFA M;  1VQ1 A;  3U61 A;  3UK6 A;  2KNV A;  3HJ8 A;  4F1I A;  1XC8 A;  2K0B X;  1GL6 A;  5EXS A;  3T6P A;  2Y0Q A;  3ILK A;  3E46 A;  4DV6 M;  5EJC A;  4LF4 M;  4WP2 A;  4M9Z A;  2R65 A;  3GP1 A;  4FD2 A;  5BR8 M;  2C99 A;  1YE9 A;  1G71 A;  1TH2 A;  2Z7J A;  3HHY A;  4IJF A;  3IG5 A;  3GQ4 A;  4GHL A;  3K8Z A;  4D80 A;  1EE8 A;  1OIZ A;  3SC3 A;  4B08 A;  2UXD M;  2J5Y A;  1TTE A;  3RGP A;  3TQS A;  4FVM A;  2JA2 A;  1N78 A;  2HCB A;  3FTF A;  3JAM S;  4IBK A;  1OIP A;  3HGI A;  2LH0 A;  2YFQ A;  4I4L A;  1YUB A;  3BXW A;  1KYI A;  3ZCB B;  4LRS A;  2V1U A;  3AOE A;  3GLH A;  2O5R A;  3VDU A;  3VK7 A;  4S12 A;  1XNR M;  3K2L A;  4GKK M;  1N33 M;  3FE3 A;  3B89 A;  3CF6 E;  3J2P B;  4F2L A;  1QAM A;  1IM2 A;  4GC9 A;  2DZN B;  3RE8 A;  1QZE A;  4I8O A;  1Z5B A;  4MGZ E;  4ITQ A;  3K9P A;  2DWN A;  4AKI A;  3LVW A;  2EKF A;  4KO8 A;  2EO2 A;  2MRO B;  3GLI B;  4AQY M;  1XXH A;  4M9S A;  1BVS A;  1HNW M;  1XNQ M;  2W82 A;  3AJI B;  4CIS A;  3DA1 A;  2F4V M;  4RF0 A;  2V1C A;  1T43 A;  2MR9 A;  1L2C A;  3EIH A;  5KQD A;  1V92 A;  3BBZ A;  1IBM M;  3KW6 A;  3CGW A;  4R7G A;  3W67 A;  2FH0 A;  3KOZ E;  4B7G A;  4CIZ A;  2DKL A;  1QUS A;  5EXP A;  4MGH A;  2QCU A;  1IXS A;  2M60 A;  4MGK E;  2ZM6 M;  1QAO A;  1PJQ A; 
#chains in the Genus database with same CATH homology
 1N32 M;  5FTN A;  1ZAE A;  1XWI A;  3FUV A;  2H1R A;  2V6Z M;  5LMU M;  3GQ5 A;  2KZU A;  3BOS A;  4LJ4 A;  4MM3 B;  3JR5 A;  5LMN M;  3B9P A;  2R4J A;  3AKZ A;  4FCW A;  2CV0 A;  2I7P A;  2QBY B;  2FE8 A;  3R8F A;  2F5O A;  4G4N A;  1QAQ A;  1Q3C A;  5KPR A;  2XLJ A;  2OQ4 A;  3T1H M;  4JI5 M;  1WXQ A;  4ZPX A;  4KLN A;  2F5Q A;  2Y21 A;  1N34 M;  2FOI C;  4JI0 M;  2G5G X;  4JI6 M;  4JI1 M;  1D2N A;  2HHH M;  4DV7 M;  2QEN A;  4Z8X A;  1QVR A;  4M0D A;  2RGO A;  2X8A A;  3SYK A;  3D8B A;  1PJJ A;  1Z6T A;  4IIW A;  1PM5 A;  4QHS A;  5IZ7 D;  1XMQ M;  4DV5 M;  4CGY B;  4YHH M;  3J27 B;  3SYL A;  2R18 A;  2R46 A;  5IT9 S;  4BBA A;  3PVS A;  4W5W A;  2BNK A;  5KQ8 A;  1N75 A;  2C96 A;  3MHV C;  3SHG B;  4LG2 A;  1G41 A;  1GKI A;  1K82 A;  1FJG M;  4MH0 E;  3U6D A;  1MU5 A;  2XFT A;  2R62 A;  2RKO A;  3L29 A;  4LZZ A;  5KPT A;  3THG A;  1KFV A;  4IBD A;  1S3S A;  2FFJ A;  4DR5 M;  1J5E M;  3GQ3 A;  4GIT A;  4JXJ A;  3L27 A;  3UZU A;  2K47 A;  1Q39 A;  3AFH A;  3FYC A;  2CHG A;  4RF1 A;  5EXX A;  3WHL A;  2CEA A;  2VII A;  1MX0 A;  2CV1 A;  3E4R A;  3HHW A;  3U6P A;  5F3W A;  3J7A S;  1JQJ C;  2UXC M;  2ZAO A;  1NNJ A;  4DR6 M;  3HU3 A;  3VKH A;  3GLG A;  2HL7 A;  2QZ4 A;  4LCB A;  2DHR A;  4X65 M;  3U61 B;  3TE6 A;  4XBO A;  1IQP A;  3FKE A;  1IXR C;  2LWX A;  3LQQ A;  4PT5 A;  2X49 A;  3UGJ A;  1QZM A;  4KHP M;  1SXJ D;  4I5S A;  4L78 A;  1IY0 A;  2C98 A;  1R2Y A;  4JI8 M;  3U6L A;  2AHM A;  2G8L A;  2X4A A;  1J7K A;  4LY6 A;  2LXE A;  4L8R C;  1PJI A;  1N77 A;  1L8Q A;  4DR7 M;  3W0F A;  4LJ6 A;  2KW0 A;  2XEP A;  3PXG A;  3KS4 A;  4HL4 A;  3U5Z B;  3L28 A;  5C18 A;  1R6B X;  3M7G A;  3KOX E;  2EUC A;  1DGB A;  1R7R A;  3W0L B;  2R4E A;  2VQE M;  4NXN M;  1DGH B;  4LGM A;  1XHB A;  4QHT A;  2D7G A;  5ITX A;  5EP3 A;  4G4R A;  3AOG A;  4LFC M;  2QP9 X;  2QBY A;  2CFO A;  5ITU A;  1SXJ A;  4JI4 M;  1HNZ M;  1IN5 A;  3HKP A;  4NL4 H;  1G4A E;  4DR3 M;  4PCZ A;  1T3T A;  1E9R A;  3K1J A;  4REZ A;  2C5R A;  4EIW A;  5ITR A;  5FLX S;  1G59 A;  1Z59 A;  2KZS A;  4JI2 M;  4LF8 M;  2XFS A;  2C9O A;  4WUR A;  1G8P A;  4LGY A;  1GVN A;  4OVZ B;  4WW0 A;  3GO8 A;  1NVM A;  4RNA A;  2LNH C;  2YR0 A;  3KVW A;  3VDP A;  4BB9 A;  3GLG B;  4DUZ M;  2DWM A;  2DVW B;  1HT2 E;  1UM8 A;  1GL7 A;  2NQ8 C;  1TDH A;  5E26 A;  1TGU A;  4LJ5 A;  4JI3 M;  5E6J A;  3SBJ A;  3HU2 A;  3RGS A;  2QPA A;  2BJW A;  4FCT A;  4LF7 M;  1DO0 A;  3KSJ A;  1I94 M;  4LF5 M;  3GLI A;  3GPY A;  2A5Y B;  3KP0 E;  3VFD A;  5DNY A;  2DXI A;  1FNN A;  4GIP A;  3ZH9 B;  3T38 A;  5FTL A;  4B3R M;  1LV7 A;  4X66 M;  3NBI A;  3FUU A;  5FTM A;  1K3W A;  4AZF A;  3HJS A;  4JV5 M;  4LFB M;  3FTD A;  4FW9 A;  3GLH B;  1E32 A;  3L25 A;  3T1Y M;  2FNA A;  3M0E A;  4B7F A;  3TWK A;  3SAW A;  3FYD A;  3QWL A;  1R2Z A;  5JI2 E;  2C9C A;  1JR3 A;  4IBB A;  1Q3B A;  4FWD A;  8CAT A;  3A98 B;  1NY5 A;  3C58 A;  3KOW E;  1L2D A;  4LJA A;  3GRR A;  4PD2 A;  1TH3 A;  3GLF A;  3AL0 C;  2DZO B;  4IJE A;  3VKG A;  2Z4S A;  1DGG A;  3D8L A;  3GPP A;  3J7B A;  1SXJ E;  4LJ8 A;  4GC5 A;  3HJQ A;  4L15 A;  4X64 M;  4AG5 A;  3I4Y A;  3I4V A;  1I4W A;  3E9S A;  5EP1 A;  5BPV A;  4LF6 M;  5EQT A;  3SMS A;  3SAS A;  2OPF A;  4BLC A;  3LVV A;  2KXE A;  1NHW C;  4M0W A;  4HLQ A;  3IG8 A;  3EIE A;  3MK6 A;  4CHT B;  1IN4 A;  3GPU A;  2KA6 B;  2UUC M;  3MJ5 A;  1IXS B;  3VLF B;  1Z5C A;  2CV2 A;  7CAT A;  1QYR A;  2XH9 A;  2ERC A;  4II7 A;  3U60 B;  3T15 A;  2YQZ A;  3H4M A;  3A42 A;  4DR1 M;  2EA0 A;  3U6S A;  3J81 S;  2ZAN A;  5ITT A;  3U6M A;  4GHA A;  2P5T A;  5ITY A;  1NJG A;  4DV0 M;  3HWS A;  1XXH B;  4QOS A;  4X62 M;  4B3M M;  1GLN A;  2RGH A;  3SHF A;  4QNM A;  1OJL A;  2UUA M;  5EP2 A;  3SAT A;  1NHG C;  4IBI A;  4L4U A;  3HU1 A;  3PNV A;  1HR0 M;  1HQC A;  2DWZ B;  1L1Z A;  1IY1 A;  2XGN A;  3AV0 A;  4NRV A;  4JI7 M;  3CF2 A;  1H6U A;  1E9S A;  1YSY A;  1IBL M;  1W5S A;  5GKN A;  1NJF A;  3KFU G;  3KSX A;  4NRW A;  4AI6 A;  1QQW A;  4M9X A;  1HT1 E;  2E5L M;  1L2B A;  1XMO M;  3R9X B;  4AKG A;  4DV1 M;  2Z3X A;  5H37 D;  2F5S A;  3FUW A;  1IBK M;  2UXB M;  1IN7 A;  3K92 A;  3M6A A;  4IBF A;  3GLF B;  3A46 A;  4NOO B;  3VK8 A;  4I81 A;  5IRE B;  2R45 A;  3DZD A;  3KXE C;  3GRV A;  4DV3 M;  3U5Z A;  1X37 A;  3J80 S;  2Y20 A;  4D82 A;  2I7N A;  2XSZ D;  2KEB A;  4B7H A;  3A45 A;  3U6E A;  2F5N A;  2ZAM A;  4GRI A;  1IN8 A;  1SXJ C;  4LZJ A;  5KO3 A;  4IBJ A;  3I51 A;  2XZF A;  3SAV A;  5IWA M;  4NSO B;  4GMQ A;  4DR4 M;  3SAR A;  3TL4 X;  2D7H A;  4B3S M;  2XSZ A;  4YY3 M;  1N36 M;  3TWL A;  4DR2 M;  3CF0 A;  3U6C A;  4IBC A;  3HHX A;  1DGF A;  1IY2 A;  5FTJ A;  3U6O A;  3DFZ A;  5ITX E;  1W5T A;  4IBG A;  4G4Q A;  4PDI A;  2XZU A;  1TDZ A;  3KP1 E;  3L2A A;  4DV4 M;  5KPZ A;  4QOZ C;  3GRU A;  2Y0T A;  2KRU A;  4JN6 A;  2ZBK B;  4R3D A;  4P16 A;  5FSW A;  1IN6 A;  3LMM A;  3JR4 A;  1JR3 D;  4IBE A;  3SFZ A;  4B3T M;  1DO2 A;  3ZC7 B;  2BJV A;  1OFH A;  4JYA M;  3KDS E;  4TUW A;  3FTC A;  4PDG A;  3PFI A;  4KOD A;  2D7E A;  1NNU C;  5DYI A;  1OFI A;  2HKJ A;  4AW4 A;  4GH9 A;  2CUZ A;  3FUX A;  1NY6 A;  4XGI A;  4LJ7 A;  4MB7 A;  3HHZ A;  2F5P A;  5EXT A;  4OW0 A;  4OU7 A;  1IXZ A;  3GPX A;  4FCV A;  1QAN A;  3RFW A;  5A2Q S;  4AKH A;  3L26 A;  3KOY E;  3CTW B;  5FTK A;  3UJN A;  1NSF A;  1TH4 A;  1VDD A;  4OVZ A;  2L7I A;  3U6Q A;  4MGY E;  1G3I A;  4NXM M;  3KS8 A;  1KSF X;  1J09 A;  4G6Z A;  3LQR A;  1HNX M;  3GRY A;  3SMP A;  1SXJ B;  3QAU A;  3TPZ A;  3AOE C;  3UMM A;  4MGI E;  2DWL A;  2UUB M;  4LF9 M;  2CHV A;  1HQY E;  4G4O A;  3FD9 A;  4D81 A;  4DV2 M;  4Z6Y A;  1DGH A;  4FWH A;  1ZQ9 A;  3OTO M;  2M5Z A;  2VQF M;  1E94 E;  3NWL A;  3PNY A;  3FUT A;  5C1B A;  2Z4R A;  4AG6 A;  4DUY M;  3U60 A;  3Q8X A;  3FTE A;  2KRK A;  2J7N A;  2L6O A;  4QNR A;  3DOA A;  3SAU A;  1L1T A;  4L16 A;  3TWM A;  2J7O A;  4GKJ M;  2L7H A;  4K0K M;  1Z5A A;  4NSR A;  4LRT A;  2CE7 A;  1ORY B;  2Q2E B;  2YNM D;  4LJ9 A;  5EP4 A;  1C1K A;  5DYG A;  2CHQ A;  4FWG A;  3WHK A;  4A3V B;  2UU9 M;  5ITQ A;  5JI3 E;  1K3X A;  2L09 A;  4OX9 M;  2XF3 A;  4LFA M;  3U61 A;  3UK6 A;  3HJ8 A;  1XC8 A;  5EXS A;  1GL6 A;  2Y0Q A;  3ILK A;  4DV6 M;  5EJC A;  4LF4 M;  4M9Z A;  2R65 A;  3GP1 A;  4FD2 A;  5BR8 M;  2C99 A;  1YE9 A;  1TH2 A;  2Z7J A;  3HHY A;  4IJF A;  3IG5 A;  3GQ4 A;  4GHL A;  3K8Z A;  4D80 A;  1EE8 A;  3SC3 A;  4B08 A;  2UXD M;  3RGP A;  3TQS A;  4FVM A;  2JA2 A;  1N78 A;  2HCB A;  3FTF A;  3JAM S;  4IBK A;  3HGI A;  2LH0 A;  2YFQ A;  4I4L A;  1YUB A;  1KYI A;  3ZCB B;  4LRS A;  2V1U A;  3AOE A;  3GLH A;  2O5R A;  3VDU A;  3VK7 A;  4S12 A;  1XNR M;  3K2L A;  4GKK M;  1N33 M;  3CF6 E;  3J2P B;  1QAM A;  1IM2 A;  4GC9 A;  2DZN B;  3RE8 A;  4I8O A;  1Z5B A;  4MGZ E;  4ITQ A;  4AKI A;  2DWN A;  3LVW A;  4KO8 A;  2EO2 A;  3GLI B;  4AQY M;  1XXH A;  4M9S A;  1HNW M;  1XNQ M;  2W82 A;  3AJI B;  4CIS A;  3DA1 A;  2F4V M;  4RF0 A;  2V1C A;  1L2C A;  3EIH A;  5KQD A;  1IBM M;  3KW6 A;  4R7G A;  3KOZ E;  4B7G A;  5EXP A;  4MGH A;  2QCU A;  2M60 A;  4MGK E;  2ZM6 M;  1QAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...