1IBLM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1iblM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1iblM02
2HKJA 4JYAM 4NXMM 3J81S 3GQ5A 2EA0A 1HNWM 2F5NA 3U6PA 3U6CA 1IBKM 4DV7M 3VK7A 2F5SA 3SAUA 2HHHM 1N34M 3U6DA 1FJGM 4B3TM 5ITXE 2E5LM 4X65M 1PJJA 2UUAM 4DV5M 3GP1A 3VK8A 4G4NA 5IWAM 4DR5M 3U6EA 1NNJA 1MU5A 2VQFM 3OTOM 4YY3M 1L2DA 1Q39A 5ITUA 3JR4A 5BR8M 5LMNM 4GKKM 3U6SA 3SASA 3GO8A 3A46A 2OPFA 4DR2M 3SARA 3U6QA 2F5QA 4B3RM 2XZFA 2F5PA 4JI0M 1TDZA 4B3MM 1K3XA 1KFVA 4LFAM 4JI1M 5ITTA 2UUBM 1L2CA 1K3WA 2VQEM 4OX9M 3A45A 5A2QS 1XNRM 1HNZM 4K0KM 1N33M 3DOAA 1Z5AA 5ITQA 3GQ4A 3A42A 1Z5BA 4DV4M 4LF8M 3SBJA 4NRVA 4DR7M 3GPUA 3TWKA 1PJIA 4CISA 3SAWA 1L1ZA 4LF9M 2F4VM 4NXNM 4PDIA 4JI3M 1MX0A 3U6MA 5IT9S 1IBLM 2OQ4A 2F5OA 2UUCM 2UXBM 4LF7M 4KHPM 1PM5A 4MB7A 1HR0M 1L2BA 4JI8M 4DV6M 4DR6M 4X62M 4ITQA 4DR1M 5ITXA 1IBMM 4G4QA 4LF6M 1XC8A 5FLXS 4G4OA 3JR5A 1J5EM 4JI5M 4LF5M 3JAMS 4DV0M 2UU9M 4LF4M 4AQYM 3GQ3A 2XZUA 1R2YA 4X66M 2ZM6M 1L1TA 1Q3CA 1K82A 4X64M 2ZBKB 1N32M 3TWLA 4JI2M 3SAVA 4PCZA 5LMUM 1HNXM 5ITRA 3W0FA 4DR4M 3T1HM 4GKJM 3J80S 3U6OA 4JI4M 1XMQM 4JV5M 3T1YM 5ITYA 4JI7M 4DV2M 3GPXA 4DUYM 2Q2EB 3TWMA 4DV3M 3SATA 4B3SM 1EE8A 4DUZM 3GPPA 1N36M 1TDHA 4YHHM 4JI6M 4NRWA 2UXDM 3C58A 4LFCM 3GPYA 1R2ZA 1Z59A 4PD2A 4G4RA 3U6LA 1XNQM 4PDGA 3J7AS 4LFBM 1Z5CA 2UXCM 1I94M 1Q3BA 1XMOM 4DV1M 4DR3M
chains in the Genus database with same CATH superfamily
1IY2A 4ANRA 2JY7A 2F5NA 2C99A 3HY5A 2CHGA 3FUXA 3U6CA 1TGUA 4GH9A 4DV7M 2FOIC 2M60A 3CF0A 3HHXA 3BOSA 4P17A 2F5SA 3IG8A 5GKNA 2HHHM 2LVOC 5DFLA 1E32A 1ZV1A 3B9PA 4NL4H 1VEGA 3AKZA 1IXZA 5EJCA 5KO3A 3LCUA 2JA2A 4DV5M 4ZPXA 4OVZB 2XH9A 5IWAM 2X8AA 3KS4A 2YFQA 3QWLA 1TR8A 4AZFA 3HJSA 3U6EA 1NNJA 4AKIA 4R7GA 4KT0F 1L2DA 2DWLA 3T6PA 3FTDA 1V33A 1OAOC 3U6SA 3SASA 3KXEC 3A46A 4DR2M 3SARA 2WSEF 1NY5A 2KRKA 2F5QA 2KHHA 3J2PB 2XZFA 4B3RM 3RGSA 4JI0M 3ZC7B 4QNRA 3FTEA 4JI1M 2BJWA 1G41A 2DENA 2JXNA 1NSFA 3NBIA 4I81A 2Y0QA 1YLAA 3I51A 1WIVA 3LCVB 3SMSA 4KO8A 2LWXA 2MH8A 2KNVA 4JN6A 2V6ZM 1P3QQ 3KW6A 3A45A 4KODA 1WGLA 3PNVA 3D8LA 5ITQA 4AKHA 3HHZA 1QQWA 2DI0A 4I8OA 4S12A 3R8FA 1OJLA 3A42A 1L8QA 2OO9A 1Z5BA 4FCWA 4AG6A 1R4GA 2CEAA 4LF8M 4B7FA 2WSCF 3D8BA 1N78A 3MMPA 3DA1A 3RFWA 3HU2A 1HQYE 5EP4A 4IJEA 1MX0A 3HU1A 4FD2A 2FE8A 5FTNA 1IBLM 3ZH9B 3NWLA 2DZOB 3H4MA 4KHPM 4AW4A 3FYCA 5KPTA 2JP7A 3KFUG 4GRIA 4DR6M 4MGYE 4DR1M 3TPZA 1PJSA 4GHAA 1DGGA 2DAIA 3FRHA 4LCBA 4LF6M 2DAEA 3SHGB 4G4OA 4JI5M 3MK6A 1QVRA 3LW5F 2JWSA 3AOEC 2E5LM 4MGIE 4LF4M 1DO2A 1WHCA 2O5RA 1MN3A 2G3QA 2X49A 3L29A 2HWJA 4I5SA 4X66M 2QSFX 3HHWA 1G59A 2LBCA 4UN2B 1SXJE 2QCUA 5C18A 3T15A 3AFHA 4JI2M 4M9XA 2QPAA 4PCZA 2FH0A 3B74A 4GHLA 5ITRA 1W5SA 1OIZA 4GKJM 3HHYA 1GJSA 2CE7A 3U6OA 3IECA 4NC6A 5EXSA 1SXJC 3AOEA 3HZJA 3T1YM 4L6V6 2KNZA 4JI7M 4DV2M 1QZEA 3GPXA 2KA6B 2CHQA 1TF0B 3L25A 1KYIA 1T3TA 2DWZB 1TDHA 1OIPA 1IN4A 1SXJD 3I04M 2CUZA 1J09A 3DZDA 2CHVA 1Z59A 4G4RA 5KPZA 2VF8A 1SXJA 4IBFA 2CFOA 2XFSA 4B7HA 3W68A 1D0MA 1RU3A 1Z6TA 1ZMUA 2EA0A 1HNWM 3PVSA 1T43A 2OOAA 3U6PA 1NV8A 1IBKM 1DV0A 2C9OA 2YNMD 3FTCA 4FW9A 3IG5A 2A5YB 1GKIA 2VDBB 1V92A 2YR0A 1IXRC 4B3TM 1NO1A 1ORYB 4IBBA 3ZQJA 4NOOB 2RGOA 4G4NA 4II7A 1OQYA 2RGHA 2VQFM 3ILKA 4OVZA 3OTOM 2ZAMA 4WP2A 1SXJB 4IBIA 3SHFA 1OTRA 3E21A 2XLJA 4DBGB 1IQPA 3GO8A 1ZMVA 2R65A 4NSOB 1QUSA 5EXPA 2F5PA 1ZMWA 3UJNA 2K0BX 1KFVA 2LTUA 3E4RA 3GLHB 1MJGM 1R7RA 2QQ8A 3U60B 5DYGA 3AJIB 2VQEM 1NY6A 2J5YA 1IY0A 2L4EA 2O01F 4OX9M 1XNRM 3LQRA 1HNZM 3A98B 4RKUF 2QP9X 4RNAA 1S3SA 5L8RF 2QZ4A 3GLIE 2MJ5B 3RE8A 4DV4M 3KVWA 3VDUA 4CISA 2DVWB 2LH0A 4Z6YA 1G3IA 2L7IA 2VIIA 3C9PA 3L2AA 1GL7A 4JI3M 2LHGA 1XHBA 4LRSA 2O25A 5FTJA 2OQ4A 2UXBM 3PXGA 3QAUA 2JUJA 2LVAA 4IBJA 2N35A 5KQ8A 1PJQA 4DV6M 3SC3A 3WHKA 4ITQA 2WSFF 5EXXA 3VFDA 2CV0A 2R18A 4QOSA 2DZNB 1VG5A 2MGWA 2JZ0A 3AV0A 1R6BX 1J5EM 3JR5A 4LF5M 2R45A 1H6UA 4AQYM 3GQ3A 2LNHC 2Z4SA 2Z8YM 1W5TA 3DFZA 4L15A 2ZBKB 3GRYA 1YUBA 3I4VA 4Z8XA 4L16A 3SAVA 5LMUM 3W0FA 2DWNA 1FNNA 3T1HM 2XSZD 4G6ZA 1EIJA 1AUAA 1WXQA 1GO5A 3J80S 4IBGA 1GABA 2CRUA 3LQQA 1BVSA 1C1KA 2V1UA 3I01M 1IXSA 2KDLA 2XSZA 2CWBA 2LVQD 4L8RC 1J7KA 1VDDA 3KOZE 3AL0C 3PFIA 4LJ6A 1OFHA 2JZ1A 3GLIB 2B3TA 3MJ5A 4DUZM 3GPPA 4LJ8A 4REZA 4YHHM 1D0KA 2LVNC 3IHPA 1G71A 2MR9A 1LV7A 3C58A 8CATA 2JY6B 3TE6A 4PD2A 3U6LA 4LFBM 1XNQM 4PDGA 2UXCM 1HT2E 2LXEA 3L28A 4DV1M 3C3DA 1XMOM 1JB0F 3B7ZA 1IY1A 1WGNA 3M7GA 1TH2A 4LJAA 4JYAM 5C1BA 1N77A 4MM3B 1E9SA 2LVPC 4FWDA 3W67A 2J7OA 4Y28F 2L6OA 3ZCBB 2DNAA 3HGIA 4CHTB 3U6DA 1IXSB 2KXEA 3CTWB 2DWMA 4R71A 1FJGM 4LJ7A 4W5WA 1GJTA 3GLHE 3KOYE 5EQTA 3SYLA 5ITXE 2OOBA 1VDLA 4LJ5A 4F2LA 1PJJA 1SG9A 3GRUA 5FTMA 3VK8A 2FS1A 1MU5A 5JI3E 4YY3M 1IN5A 2KRUA 2BJVA 3HJQA 3JR4A 4HL4A 3GLGB 4GKKM 1QANA 2KZSA 1WJ7A 3FYDA 3VKHA 2H5XA 4D82A 2JNHA 3QYBA 3E9SA 3CGWA 4GEWA 4L4UA 1Q02A 4B3MM 1K3XA 3UK6A 3HKPA 4LFAM 1T6OA 2C9CA 1E9RA 5ITTA 2D7GA 3Q8GA 2ZTCA 3GRRA 1NVMA 1NHGC 3FD9A 4QHTA 2R4JA 3CF2A 2BWBA 3GLHA 3U60A 1K3WA 1L2CA 5EP1A 5A2QS 1HQCA 4K0KM 3VDPA 1Z5AA 2DAKA 4MGZE 3T38A 3SFZA 2BWEA 1DGHA 4BBAA 4KLNA 4B7GA 2C5RA 2QHOB 4DR7M 4QOZC 4IBEA 1XWIA 4HEOA 4WW0A 3KOXE 4LF9M 2F4VM 4BB9A 5BPVA 2DHYA 3VLFB 4FCTA 4PDIA 4LY6A 1UM8A 1PGYA 3K9PA 5IT9S 1GVNA 3FUWA 1UFZA 1QAMA 2UUCM 1IN8A 3B89A 2QENA 3R9XB 1L2BA 1N75A 1VEKA 2FFJA 4X62M 1TH3A 4OW0A 5H37D 2I7NA 3U5ZA 1Y8GA 2G5GX 2M5ZA 2NQ8C 4GC5A 3HJ8A 4LZZA 1DGFA 4M0DA 1IBMM 2DAGA 4RF1A 4AI6A 1DGHB 3K2LA 1XB2B 4XGIA 3SYKA 5KPRA 3PNYA 5F3WA 5FLXS 5KQDA 2L09A 2XFTA 4FWGA 2UU9M 1OFIA 1VEJA 2W82A 3HX3A 2QNJA 2ZM6M 2XZUA 3LMMA 1DGBA 2HCBA 4M0WA 4CGYB 3TL4X 1Q3CA 1K82A 2G8LA 2XEPA 1G8PA 4A3VB 2DXIA 4GC9A 3TWLA 3KP1E 1N32M 4LGMA 1XXHE 4D81A 1NJGA 2HL7A 1YSYA 4FVMA 2EJSA 5IREB 2Z4RA 2MROB 4JI4M 3KSJA 4GIPA 4JXJA 1I4WA 2KZUA 1XMQM 4IJFA 4PT5A 3K92A 2R0IA 4JV5M 2Y20A 3U5ZB 2K6BA 3I4YA 4QHSA 3KDSE 2AHMA 3FUUA 1LTMA 2WZJA 2Z3XA 1V34A 4DUYM 1ZAEA 4B3SM 4IBCA 4LRTA 1HJPA 3FE3A 4NRWA 1IM2A 3GLIA 2LHCA 2GNOA 1EFUB 3FUTA 5IZ7D 2XF3A 3NBXX 2L2DA 1X37A 1Z5CA 1R5LA 4MGHA 1Q3BA 1I94M 3THGA 3U6QA 2R62A 4L78A 2HKJA 1XXHA 3J81S 3L26A 3GQ5A 3GLGE 4NXMM 1QZMA 2H1RA 4GMQA 1OKSA 3W0LB 2I7PA 4AKGA 4MGKE 3VK7A 1TTEA 3SAUA 4R3DA 1N34M 2YQZA 2ZAOA 2ERCA 4FWHA 1NNUC 4P16A 5FTKA 2RRUA 4X65M 2UUAM 3HU3A 2X4AA 3GP1A 2EKKA 2GQFA 3SMPA 3E46A 1JQJC 4F1IA 4DR5M 2EKFA 2Y0TA 4B08A 1QUTA 4MH0E 2V1CA 3U61A 4Q7JA 4WURA 4CIZA 1GLNA 1Q39A 4M9ZA 5ITUA 3K9OA 3FTFA 5BR8M 5LMNM 4BLCA 2XGNA 3FKEA 2OPFA 1XXHB 3GLGA 3FUVA 3VKGA 3H4JA 3GRVA 1YE9A 1IN7A 1D2NA 1TDZA 2C98A 4RF0A 1D0LA 4HLQA 3LVVA 4AG5A 2D7EA 2DHRA 2KNAA 4FCVA 2UUBM 4G3OA 5E26A 1VQ1A 3K8ZA 3TQSA 3M6AA 4NSRA 2APLA 3EIHA 3UMMA 1TH4A 2Z7JA 3DOAA 1N33M 1HT1E 3U61B 2EO2A 4OU7A 3M0EA 3GQ4A 3GLFE 1NJFA 3K1JA 2CV1A 7CATA 5EP2A 1G4AE 2RKOA 3BXWA 3SBJA 4NRVA 3GPUA 5EXTA 3TWKA 2DAMA 1PJIA 1GL6A 3V76A 3SAWA 1L1ZA 1JR3E 3KSXA 2C96A 4QNMA 4NXNM 1C7YA 4TUWA 1QDTA 2ZANA 2JY8A 2KW0A 3U6MA 1QYRA 5E6JA 1KSFX 3EIEA 2F5OA 2P5TA 3Q8XA 2L7HA 3UZUA 3WHLA 4LF7M 2HAKA 1PM5A 2R4EA 3B7NA 4MB7A 1HR0M 3AOGA 2R44A 3C3EA 3BBZA 2QBYA 4JI8M 2EUCA 1F4IA 3FRIA 1A5TA 5ITXA 5DNYA 5EP3A 3LVWA 3F92A 4G4QA 2R6FA 5FTLA 1XC8A 4CJ6A 4LGYA 2DZLA 3B7QA 4LG2A 1QDRA 1JR3D 3KOWE 3GLFA 1ZQ9A 3JAMS 4DV0M 1E94E 3KP0E 3CF6E 4GITA 1JR3A 1R2YA 1L1TA 3L27A 4D80A 3UGJA 2VF7A 2KEBA 1QAOA 4XBOA 2K9DA 3QYEA 4X64M 1WR1B 5DYIA 4LJ4A 2Y21A 1HNXM 2CV2A 4IBDA 4DR4M 2JY5A 4LZJA 5FSWA 1IFYA 3MHVC 2D7HA 4XK8F 2QBYB 3KS8A 2K47A 1PJTA 1NHWC 4LJ9A 2FNAA 4M9SA 2L4FA 5ITYA 3J27B 4EIWA 1CUKA 2J7NA 1PRBA 2Q2EB 3J7BA 3TWMA 3GLFB 4DV3M 3SATA 2BNKA 1DO0A 4I4LA 1EE8A 1N36M 4JI6M 2UXDM 1AIPC 1NV9A 2DKLA 4LFCM 1IN6A 2ZTDA 3GPYA 1QAQA 1R2ZA 3RGPA 3J7AS 3HWSA 4IBKA 1OAIA 2CP8A 2R46A 4IIWA 4DR3M 5JI2E
chains in the Genus database with same CATH topology
1IY2A 2F5NA 2C99A 2CHGA 3FUXA 3U6CA 1TGUA 4GH9A 4DV7M 2FOIC 2M60A 3CF0A 3HHXA 3BOSA 2F5SA 2HHHM 3IG8A 5GKNA 1E32A 3B9PA 4NL4H 3AKZA 1IXZA 5EJCA 5KO3A 2JA2A 4DV5M 4ZPXA 4OVZB 2XH9A 5IWAM 2X8AA 3KS4A 2YFQA 3QWLA 4AZFA 3U6EA 3HJSA 1NNJA 4AKIA 4R7GA 1L2DA 2DWLA 3FTDA 3U6SA 3SASA 3KXEC 3A46A 4DR2M 3SARA 1NY5A 2KRKA 2F5QA 4B3RM 3J2PB 2XZFA 3RGSA 4JI0M 3ZC7B 4QNRA 3FTEA 4JI1M 2BJWA 1G41A 3NBIA 1NSFA 4I81A 2Y0QA 3SMSA 3I51A 4KO8A 2LWXA 4JN6A 2V6ZM 3KW6A 3A45A 4KODA 3PNVA 3D8LA 5ITQA 4AKHA 3HHZA 1QQWA 4I8OA 3R8FA 4S12A 1OJLA 3A42A 1L8QA 1Z5BA 4FCWA 4AG6A 2CEAA 4LF8M 4B7FA 3D8BA 1N78A 3DA1A 3RFWA 3HU2A 1HQYE 5EP4A 4IJEA 1MX0A 3HU1A 4FD2A 2FE8A 5FTNA 1IBLM 3ZH9B 3NWLA 2DZOB 3H4MA 4KHPM 4AW4A 3FYCA 5KPTA 3KFUG 4GRIA 4DR6M 4MGYE 4DR1M 3TPZA 4GHAA 1DGGA 4LF6M 4LCBA 3SHGB 4G4OA 4JI5M 3MK6A 1QVRA 3AOEC 4MGIE 4LF4M 1DO2A 2O5RA 2X49A 4I5SA 3L29A 4X66M 1G59A 3HHWA 1SXJE 2QCUA 5C18A 3T15A 3AFHA 4JI2M 4M9XA 2QPAA 4PCZA 4GHLA 5ITRA 1W5SA 4GKJM 3HHYA 2CE7A 3U6OA 5EXSA 1SXJC 3AOEA 3T1YM 4JI7M 4DV2M 3GPXA 2KA6B 2CHQA 3L25A 1KYIA 1T3TA 2DWZB 1TDHA 1IN4A 1SXJD 2CUZA 1J09A 3DZDA 2CHVA 1Z59A 4G4RA 5KPZA 1SXJA 4IBFA 2CFOA 2XFSA 4B7HA 1Z6TA 2EA0A 1HNWM 3PVSA 3U6PA 1IBKM 2C9OA 2YNMD 3FTCA 4FW9A 3IG5A 2A5YB 1GKIA 2YR0A 1IXRC 4B3TM 1ORYB 4IBBA 4NOOB 2RGOA 4G4NA 4II7A 2RGHA 2VQFM 3ILKA 4OVZA 3OTOM 2ZAMA 1SXJB 4IBIA 3SHFA 2XLJA 3GO8A 1IQPA 2R65A 4NSOB 5EXPA 2F5PA 3UJNA 1KFVA 3E4RA 3GLHB 1R7RA 3U60B 5DYGA 3AJIB 2VQEM 1NY6A 1IY0A 4OX9M 1XNRM 3LQRA 1HNZM 3A98B 2QP9X 4RNAA 1S3SA 2QZ4A 3RE8A 4DV4M 3KVWA 3VDUA 4CISA 2DVWB 2LH0A 4Z6YA 1G3IA 2L7IA 2VIIA 3L2AA 1GL7A 4JI3M 1XHBA 4LRSA 5FTJA 2OQ4A 2UXBM 3PXGA 3QAUA 4IBJA 5KQ8A 4DV6M 3SC3A 3WHKA 4ITQA 5EXXA 3VFDA 2CV0A 2R18A 4QOSA 2DZNB 3AV0A 1R6BX 1J5EM 3JR5A 4LF5M 2R45A 1H6UA 4AQYM 3GQ3A 2LNHC 2Z4SA 1W5TA 3DFZA 4L15A 2ZBKB 3GRYA 1YUBA 3I4VA 4Z8XA 4L16A 3SAVA 5LMUM 3W0FA 1FNNA 3T1HM 2XSZD 4G6ZA 1WXQA 3J80S 4IBGA 3LQQA 1C1KA 2V1UA 2XSZA 4L8RC 1J7KA 1VDDA 3KOZE 3AL0C 3PFIA 4LJ6A 1OFHA 3GLIB 3MJ5A 4DUZM 3GPPA 4LJ8A 4REZA 4YHHM 1LV7A 3C58A 8CATA 3TE6A 4PD2A 3U6LA 4LFBM 1XNQM 4PDGA 2UXCM 1HT2E 2LXEA 3L28A 4DV1M 1XMOM 1IY1A 4LJAA 3M7GA 1TH2A 4JYAM 5C1BA 1N77A 4MM3B 1E9SA 4FWDA 2J7OA 2L6OA 3ZCBB 4CHTB 3HGIA 3U6DA 1IXSB 2KXEA 3CTWB 2DWMA 1FJGM 4LJ7A 4W5WA 3KOYE 3SYLA 5EQTA 5ITXE 2E5LM 1PJJA 4LJ5A 3GRUA 5FTMA 3VK8A 1MU5A 5JI3E 4YY3M 1IN5A 2KRUA 2BJVA 3HJQA 3JR4A 4HL4A 3GLGB 4GKKM 1QANA 2KZSA 3FYDA 3VKHA 4D82A 3E9SA 4L4UA 4B3MM 1K3XA 3UK6A 3HKPA 4LFAM 2C9CA 1E9RA 5ITTA 2D7GA 3GRRA 1NVMA 1NHGC 3FD9A 4QHTA 2R4JA 3CF2A 3GLHA 1K3WA 3U60A 1L2CA 5EP1A 5A2QS 1HQCA 4K0KM 3VDPA 1Z5AA 4MGZE 3T38A 3SFZA 1DGHA 4BBAA 4KLNA 4B7GA 2C5RA 4DR7M 4QOZC 4IBEA 1XWIA 4WW0A 3KOXE 4LF9M 2F4VM 4BB9A 5BPVA 3VLFB 4FCTA 4PDIA 4LY6A 1UM8A 5IT9S 1GVNA 3FUWA 1QAMA 2UUCM 1IN8A 2QENA 3R9XB 1L2BA 1N75A 2FFJA 4X62M 1TH3A 4OW0A 5H37D 2I7NA 3U5ZA 2M5ZA 2G5GX 2NQ8C 4GC5A 4LZZA 3HJ8A 1IBMM 1DGFA 4M0DA 2DWNA 4RF1A 4AI6A 1DGHB 3K2LA 3SYKA 4XGIA 5KPRA 3PNYA 5F3WA 5FLXS 5KQDA 2L09A 2XFTA 4FWGA 2UU9M 1OFIA 2W82A 2XZUA 2ZM6M 3LMMA 1DGBA 2HCBA 4M0WA 4CGYB 3TL4X 1Q3CA 1K82A 2G8LA 2XEPA 1G8PA 4A3VB 2DXIA 4GC9A 3TWLA 3KP1E 1N32M 4LGMA 4D81A 1NJGA 2HL7A 1YSYA 4FVMA 5IREB 2Z4RA 4JI4M 3KSJA 4GIPA 4JXJA 1I4WA 2KZUA 1XMQM 4IJFA 4PT5A 3K92A 4JV5M 2Y20A 3U5ZB 3I4YA 4QHSA 3KDSE 2AHMA 3FUUA 4DUYM 2Z3XA 1ZAEA 4B3SM 4IBCA 4LRTA 4NRWA 1IM2A 3GLIA 3FUTA 5IZ7D 2XF3A 1X37A 1Z5CA 4MGHA 1I94M 1Q3BA 3THGA 3U6QA 2R62A 4L78A 2HKJA 1XXHA 3J81S 3L26A 3GQ5A 4NXMM 1QZMA 2H1RA 4GMQA 3W0LB 2I7PA 4AKGA 4MGKE 3VK7A 3SAUA 4R3DA 1N34M 2YQZA 2ZAOA 2ERCA 4FWHA 1NNUC 4P16A 5FTKA 4X65M 2UUAM 3HU3A 2X4AA 3GP1A 3SMPA 1JQJC 4DR5M 2Y0TA 4B08A 3U61A 4MH0E 2V1CA 4WURA 3FTFA 1GLNA 1Q39A 4M9ZA 5ITUA 5BR8M 5LMNM 4BLCA 2XGNA 3FKEA 2OPFA 1XXHB 3GLGA 3FUVA 3VKGA 3GRVA 1YE9A 1IN7A 1D2NA 1TDZA 2C98A 4RF0A 4HLQA 3LVVA 4AG5A 2D7EA 2DHRA 4FCVA 2UUBM 5E26A 3K8ZA 3TQSA 3M6AA 4NSRA 3UMMA 3EIHA 1TH4A 2Z7JA 3DOAA 1N33M 1HT1E 3U61B 2EO2A 4OU7A 3M0EA 1NJFA 3K1JA 2CV1A 7CATA 5EP2A 1G4AE 2RKOA 3SBJA 4NRVA 3GPUA 5EXTA 3TWKA 1PJIA 1GL6A 3SAWA 1L1ZA 3KSXA 2C96A 4QNMA 4NXNM 4TUWA 2ZANA 2KW0A 3U6MA 1QYRA 5E6JA 1KSFX 3EIEA 2F5OA 2P5TA 3Q8XA 2L7HA 3UZUA 3WHLA 4LF7M 1PM5A 2R4EA 4MB7A 1HR0M 3AOGA 4JI8M 2QBYA 2EUCA 5ITXA 5DNYA 5EP3A 3LVWA 4G4QA 5FTLA 1XC8A 4LGYA 4LG2A 3KOWE 1JR3D 3GLFA 1ZQ9A 3JAMS 4DV0M 1E94E 3KP0E 3CF6E 4GITA 1JR3A 1R2YA 1L1TA 3L27A 4D80A 3UGJA 2KEBA 1QAOA 4XBOA 4X64M 5DYIA 4LJ4A 2Y21A 1HNXM 2CV2A 4IBDA 4DR4M 4LZJA 5FSWA 3MHVC 2D7HA 2QBYB 3KS8A 2K47A 1NHWC 4LJ9A 2FNAA 4M9SA 5ITYA 3J27B 4EIWA 2J7NA 2Q2EB 3J7BA 3TWMA 3GLFB 4DV3M 3SATA 2BNKA 1DO0A 4I4LA 1EE8A 1N36M 4JI6M 2UXDM 4LFCM 1IN6A 3GPYA 1QAQA 1R2ZA 3RGPA 3J7AS 3HWSA 4IBKA 3GQ4A 2R46A 4IIWA 4DR3M 5JI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKJ A;  4JYA M;  4NXM M;  3J81 S;  3GQ5 A;  2EA0 A;  1HNW M;  2F5N A;  3U6P A;  3U6C A;  1IBK M;  4DV7 M;  3VK7 A;  2F5S A;  3SAU A;  2HHH M;  1N34 M;  3U6D A;  1FJG M;  4B3T M;  5ITX E;  2E5L M;  4X65 M;  1PJJ A;  2UUA M;  4DV5 M;  3GP1 A;  3VK8 A;  4G4N A;  5IWA M;  4DR5 M;  3U6E A;  1NNJ A;  1MU5 A;  2VQF M;  3OTO M;  4YY3 M;  1L2D A;  1Q39 A;  5ITU A;  3JR4 A;  5BR8 M;  5LMN M;  4GKK M;  3U6S A;  3SAS A;  3GO8 A;  3A46 A;  2OPF A;  4DR2 M;  3SAR A;  3U6Q A;  2F5Q A;  4B3R M;  2XZF A;  2F5P A;  4JI0 M;  1TDZ A;  4B3M M;  1K3X A;  1KFV A;  4LFA M;  4JI1 M;  5ITT A;  2UUB M;  1L2C A;  1K3W A;  2VQE M;  4OX9 M;  3A45 A;  5A2Q S;  1XNR M;  1HNZ M;  4K0K M;  1N33 M;  3DOA A;  1Z5A A;  5ITQ A;  3GQ4 A;  3A42 A;  1Z5B A;  4DV4 M;  4LF8 M;  3SBJ A;  4NRV A;  4DR7 M;  3GPU A;  3TWK A;  1PJI A;  4CIS A;  3SAW A;  1L1Z A;  4LF9 M;  2F4V M;  4NXN M;  4PDI A;  4JI3 M;  1MX0 A;  3U6M A;  5IT9 S;  1IBL M;  2OQ4 A;  2F5O A;  2UUC M;  2UXB M;  4LF7 M;  4KHP M;  1PM5 A;  4MB7 A;  1HR0 M;  1L2B A;  4JI8 M;  4DV6 M;  4DR6 M;  4X62 M;  4ITQ A;  4DR1 M;  5ITX A;  1IBM M;  4G4Q A;  4LF6 M;  1XC8 A;  5FLX S;  4G4O A;  3JR5 A;  1J5E M;  4JI5 M;  4LF5 M;  3JAM S;  4DV0 M;  2UU9 M;  4LF4 M;  4AQY M;  3GQ3 A;  2XZU A;  1R2Y A;  4X66 M;  2ZM6 M;  1L1T A;  1Q3C A;  1K82 A;  4X64 M;  2ZBK B;  1N32 M;  3TWL A;  4JI2 M;  3SAV A;  4PCZ A;  5LMU M;  1HNX M;  5ITR A;  3W0F A;  4DR4 M;  3T1H M;  4GKJ M;  3J80 S;  3U6O A;  4JI4 M;  1XMQ M;  4JV5 M;  3T1Y M;  5ITY A;  4JI7 M;  4DV2 M;  3GPX A;  4DUY M;  2Q2E B;  3TWM A;  4DV3 M;  3SAT A;  4B3S M;  1EE8 A;  4DUZ M;  3GPP A;  1N36 M;  1TDH A;  4YHH M;  4JI6 M;  4NRW A;  2UXD M;  3C58 A;  4LFC M;  3GPY A;  1R2Z A;  1Z59 A;  4PD2 A;  4G4R A;  3U6L A;  1XNQ M;  4PDG A;  3J7A S;  4LFB M;  1Z5C A;  2UXC M;  1I94 M;  1Q3B A;  1XMO M;  4DV1 M;  4DR3 M; 
#chains in the Genus database with same CATH topology
 1IY2 A;  4ANR A;  2JY7 A;  2F5N A;  2C99 A;  3HY5 A;  2CHG A;  3FUX A;  3U6C A;  1TGU A;  4GH9 A;  4DV7 M;  2FOI C;  2M60 A;  3CF0 A;  3HHX A;  3BOS A;  4P17 A;  2F5S A;  3IG8 A;  5GKN A;  2HHH M;  2LVO C;  5DFL A;  1E32 A;  1ZV1 A;  3B9P A;  4NL4 H;  1VEG A;  3AKZ A;  1IXZ A;  5EJC A;  5KO3 A;  3LCU A;  2JA2 A;  4DV5 M;  4ZPX A;  4OVZ B;  2XH9 A;  5IWA M;  2X8A A;  3KS4 A;  2YFQ A;  3QWL A;  1TR8 A;  4AZF A;  3HJS A;  3U6E A;  1NNJ A;  4AKI A;  4R7G A;  4KT0 F;  1L2D A;  2DWL A;  3T6P A;  3FTD A;  1V33 A;  1OAO C;  3U6S A;  3SAS A;  3KXE C;  3A46 A;  4DR2 M;  3SAR A;  2WSE F;  1NY5 A;  2KRK A;  2F5Q A;  2KHH A;  3J2P B;  2XZF A;  4B3R M;  3RGS A;  4JI0 M;  3ZC7 B;  4QNR A;  3FTE A;  4JI1 M;  2BJW A;  1G41 A;  2DEN A;  2JXN A;  1NSF A;  3NBI A;  4I81 A;  2Y0Q A;  1YLA A;  3I51 A;  1WIV A;  3LCV B;  3SMS A;  4KO8 A;  2LWX A;  2MH8 A;  2KNV A;  4JN6 A;  2V6Z M;  1P3Q Q;  3KW6 A;  3A45 A;  4KOD A;  1WGL A;  3PNV A;  3D8L A;  5ITQ A;  4AKH A;  3HHZ A;  1QQW A;  2DI0 A;  4I8O A;  4S12 A;  3R8F A;  1OJL A;  3A42 A;  1L8Q A;  2OO9 A;  1Z5B A;  4FCW A;  4AG6 A;  1R4G A;  2CEA A;  4LF8 M;  4B7F A;  2WSC F;  3D8B A;  1N78 A;  3MMP A;  3DA1 A;  3RFW A;  3HU2 A;  1HQY E;  5EP4 A;  4IJE A;  1MX0 A;  3HU1 A;  4FD2 A;  2FE8 A;  5FTN A;  1IBL M;  3ZH9 B;  3NWL A;  2DZO B;  3H4M A;  4KHP M;  4AW4 A;  3FYC A;  5KPT A;  2JP7 A;  3KFU G;  4GRI A;  4DR6 M;  4MGY E;  4DR1 M;  3TPZ A;  1PJS A;  4GHA A;  1DGG A;  2DAI A;  3FRH A;  4LCB A;  4LF6 M;  2DAE A;  3SHG B;  4G4O A;  4JI5 M;  3MK6 A;  1QVR A;  3LW5 F;  2JWS A;  3AOE C;  2E5L M;  4MGI E;  4LF4 M;  1DO2 A;  1WHC A;  2O5R A;  1MN3 A;  2G3Q A;  2X49 A;  3L29 A;  2HWJ A;  4I5S A;  4X66 M;  2QSF X;  3HHW A;  1G59 A;  2LBC A;  4UN2 B;  1SXJ E;  2QCU A;  5C18 A;  3T15 A;  3AFH A;  4JI2 M;  4M9X A;  2QPA A;  4PCZ A;  2FH0 A;  3B74 A;  4GHL A;  5ITR A;  1W5S A;  1OIZ A;  4GKJ M;  3HHY A;  1GJS A;  2CE7 A;  3U6O A;  3IEC A;  4NC6 A;  5EXS A;  1SXJ C;  3AOE A;  3HZJ A;  3T1Y M;  4L6V 6;  2KNZ A;  4JI7 M;  4DV2 M;  1QZE A;  3GPX A;  2KA6 B;  2CHQ A;  1TF0 B;  3L25 A;  1KYI A;  1T3T A;  2DWZ B;  1TDH A;  1OIP A;  1IN4 A;  1SXJ D;  3I04 M;  2CUZ A;  1J09 A;  3DZD A;  2CHV A;  1Z59 A;  4G4R A;  5KPZ A;  2VF8 A;  1SXJ A;  4IBF A;  2CFO A;  2XFS A;  4B7H A;  3W68 A;  1D0M A;  1RU3 A;  1Z6T A;  1ZMU A;  2EA0 A;  1HNW M;  3PVS A;  1T43 A;  2OOA A;  3U6P A;  1NV8 A;  1IBK M;  1DV0 A;  2C9O A;  2YNM D;  3FTC A;  4FW9 A;  3IG5 A;  2A5Y B;  1GKI A;  2VDB B;  1V92 A;  2YR0 A;  1IXR C;  4B3T M;  1NO1 A;  1ORY B;  4IBB A;  3ZQJ A;  4NOO B;  2RGO A;  4G4N A;  4II7 A;  1OQY A;  2RGH A;  2VQF M;  3ILK A;  4OVZ A;  3OTO M;  2ZAM A;  4WP2 A;  1SXJ B;  4IBI A;  3SHF A;  1OTR A;  3E21 A;  2XLJ A;  4DBG B;  1IQP A;  3GO8 A;  1ZMV A;  2R65 A;  4NSO B;  1QUS A;  5EXP A;  2F5P A;  1ZMW A;  3UJN A;  2K0B X;  1KFV A;  2LTU A;  3E4R A;  3GLH B;  1MJG M;  1R7R A;  2QQ8 A;  3U60 B;  5DYG A;  3AJI B;  2VQE M;  1NY6 A;  2J5Y A;  1IY0 A;  2L4E A;  2O01 F;  4OX9 M;  1XNR M;  3LQR A;  1HNZ M;  3A98 B;  4RKU F;  2QP9 X;  4RNA A;  1S3S A;  5L8R F;  2QZ4 A;  3GLI E;  2MJ5 B;  3RE8 A;  4DV4 M;  3KVW A;  3VDU A;  4CIS A;  2DVW B;  2LH0 A;  4Z6Y A;  1G3I A;  2L7I A;  2VII A;  3C9P A;  3L2A A;  1GL7 A;  4JI3 M;  2LHG A;  1XHB A;  4LRS A;  2O25 A;  5FTJ A;  2OQ4 A;  2UXB M;  3PXG A;  3QAU A;  2JUJ A;  2LVA A;  4IBJ A;  2N35 A;  5KQ8 A;  1PJQ A;  4DV6 M;  3SC3 A;  3WHK A;  4ITQ A;  2WSF F;  5EXX A;  3VFD A;  2CV0 A;  2R18 A;  4QOS A;  2DZN B;  1VG5 A;  2MGW A;  2JZ0 A;  3AV0 A;  1R6B X;  1J5E M;  3JR5 A;  4LF5 M;  2R45 A;  1H6U A;  4AQY M;  3GQ3 A;  2LNH C;  2Z4S A;  2Z8Y M;  1W5T A;  3DFZ A;  4L15 A;  2ZBK B;  3GRY A;  1YUB A;  3I4V A;  4Z8X A;  4L16 A;  3SAV A;  5LMU M;  3W0F A;  2DWN A;  1FNN A;  3T1H M;  2XSZ D;  4G6Z A;  1EIJ A;  1AUA A;  1WXQ A;  1GO5 A;  3J80 S;  4IBG A;  1GAB A;  2CRU A;  3LQQ A;  1BVS A;  1C1K A;  2V1U A;  3I01 M;  1IXS A;  2KDL A;  2XSZ A;  2CWB A;  2LVQ D;  4L8R C;  1J7K A;  1VDD A;  3KOZ E;  3AL0 C;  3PFI A;  4LJ6 A;  1OFH A;  2JZ1 A;  3GLI B;  2B3T A;  3MJ5 A;  4DUZ M;  3GPP A;  4LJ8 A;  4REZ A;  4YHH M;  1D0K A;  2LVN C;  3IHP A;  1G71 A;  2MR9 A;  1LV7 A;  3C58 A;  8CAT A;  2JY6 B;  3TE6 A;  4PD2 A;  3U6L A;  4LFB M;  1XNQ M;  4PDG A;  2UXC M;  1HT2 E;  2LXE A;  3L28 A;  4DV1 M;  3C3D A;  1XMO M;  1JB0 F;  3B7Z A;  1IY1 A;  1WGN A;  3M7G A;  1TH2 A;  4LJA A;  4JYA M;  5C1B A;  1N77 A;  4MM3 B;  1E9S A;  2LVP C;  4FWD A;  3W67 A;  2J7O A;  4Y28 F;  2L6O A;  3ZCB B;  2DNA A;  3HGI A;  4CHT B;  3U6D A;  1IXS B;  2KXE A;  3CTW B;  2DWM A;  4R71 A;  1FJG M;  4LJ7 A;  4W5W A;  1GJT A;  3GLH E;  3KOY E;  5EQT A;  3SYL A;  5ITX E;  2OOB A;  1VDL A;  4LJ5 A;  4F2L A;  1PJJ A;  1SG9 A;  3GRU A;  5FTM A;  3VK8 A;  2FS1 A;  1MU5 A;  5JI3 E;  4YY3 M;  1IN5 A;  2KRU A;  2BJV A;  3HJQ A;  3JR4 A;  4HL4 A;  3GLG B;  4GKK M;  1QAN A;  2KZS A;  1WJ7 A;  3FYD A;  3VKH A;  2H5X A;  4D82 A;  2JNH A;  3QYB A;  3E9S A;  3CGW A;  4GEW A;  4L4U A;  1Q02 A;  4B3M M;  1K3X A;  3UK6 A;  3HKP A;  4LFA M;  1T6O A;  2C9C A;  1E9R A;  5ITT A;  2D7G A;  3Q8G A;  2ZTC A;  3GRR A;  1NVM A;  1NHG C;  3FD9 A;  4QHT A;  2R4J A;  3CF2 A;  2BWB A;  3GLH A;  3U60 A;  1K3W A;  1L2C A;  5EP1 A;  5A2Q S;  1HQC A;  4K0K M;  3VDP A;  1Z5A A;  2DAK A;  4MGZ E;  3T38 A;  3SFZ A;  2BWE A;  1DGH A;  4BBA A;  4KLN A;  4B7G A;  2C5R A;  2QHO B;  4DR7 M;  4QOZ C;  4IBE A;  1XWI A;  4HEO A;  4WW0 A;  3KOX E;  4LF9 M;  2F4V M;  4BB9 A;  5BPV A;  2DHY A;  3VLF B;  4FCT A;  4PDI A;  4LY6 A;  1UM8 A;  1PGY A;  3K9P A;  5IT9 S;  1GVN A;  3FUW A;  1UFZ A;  1QAM A;  2UUC M;  1IN8 A;  3B89 A;  2QEN A;  3R9X B;  1L2B A;  1N75 A;  1VEK A;  2FFJ A;  4X62 M;  1TH3 A;  4OW0 A;  5H37 D;  2I7N A;  3U5Z A;  1Y8G A;  2G5G X;  2M5Z A;  2NQ8 C;  4GC5 A;  3HJ8 A;  4LZZ A;  1DGF A;  4M0D A;  1IBM M;  2DAG A;  4RF1 A;  4AI6 A;  1DGH B;  3K2L A;  1XB2 B;  4XGI A;  3SYK A;  5KPR A;  3PNY A;  5F3W A;  5FLX S;  5KQD A;  2L09 A;  2XFT A;  4FWG A;  2UU9 M;  1OFI A;  1VEJ A;  2W82 A;  3HX3 A;  2QNJ A;  2ZM6 M;  2XZU A;  3LMM A;  1DGB A;  2HCB A;  4M0W A;  4CGY B;  3TL4 X;  1Q3C A;  1K82 A;  2G8L A;  2XEP A;  1G8P A;  4A3V B;  2DXI A;  4GC9 A;  3TWL A;  3KP1 E;  1N32 M;  4LGM A;  1XXH E;  4D81 A;  1NJG A;  2HL7 A;  1YSY A;  4FVM A;  2EJS A;  5IRE B;  2Z4R A;  2MRO B;  4JI4 M;  3KSJ A;  4GIP A;  4JXJ A;  1I4W A;  2KZU A;  1XMQ M;  4IJF A;  4PT5 A;  3K92 A;  2R0I A;  4JV5 M;  2Y20 A;  3U5Z B;  2K6B A;  3I4Y A;  4QHS A;  3KDS E;  2AHM A;  3FUU A;  1LTM A;  2WZJ A;  2Z3X A;  1V34 A;  4DUY M;  1ZAE A;  4B3S M;  4IBC A;  4LRT A;  1HJP A;  3FE3 A;  4NRW A;  1IM2 A;  3GLI A;  2LHC A;  2GNO A;  1EFU B;  3FUT A;  5IZ7 D;  2XF3 A;  3NBX X;  2L2D A;  1X37 A;  1Z5C A;  1R5L A;  4MGH A;  1Q3B A;  1I94 M;  3THG A;  3U6Q A;  2R62 A;  4L78 A;  2HKJ A;  1XXH A;  3J81 S;  3L26 A;  3GQ5 A;  3GLG E;  4NXM M;  1QZM A;  2H1R A;  4GMQ A;  1OKS A;  3W0L B;  2I7P A;  4AKG A;  4MGK E;  3VK7 A;  1TTE A;  3SAU A;  4R3D A;  1N34 M;  2YQZ A;  2ZAO A;  2ERC A;  4FWH A;  1NNU C;  4P16 A;  5FTK A;  2RRU A;  4X65 M;  2UUA M;  3HU3 A;  2X4A A;  3GP1 A;  2EKK A;  2GQF A;  3SMP A;  3E46 A;  1JQJ C;  4F1I A;  4DR5 M;  2EKF A;  2Y0T A;  4B08 A;  1QUT A;  4MH0 E;  2V1C A;  3U61 A;  4Q7J A;  4WUR A;  4CIZ A;  1GLN A;  1Q39 A;  4M9Z A;  5ITU A;  3K9O A;  3FTF A;  5BR8 M;  5LMN M;  4BLC A;  2XGN A;  3FKE A;  2OPF A;  1XXH B;  3GLG A;  3FUV A;  3VKG A;  3H4J A;  3GRV A;  1YE9 A;  1IN7 A;  1D2N A;  1TDZ A;  2C98 A;  4RF0 A;  1D0L A;  4HLQ A;  3LVV A;  4AG5 A;  2D7E A;  2DHR A;  2KNA A;  4FCV A;  2UUB M;  4G3O A;  5E26 A;  1VQ1 A;  3K8Z A;  3TQS A;  3M6A A;  4NSR A;  2APL A;  3EIH A;  3UMM A;  1TH4 A;  2Z7J A;  3DOA A;  1N33 M;  1HT1 E;  3U61 B;  2EO2 A;  4OU7 A;  3M0E A;  3GQ4 A;  3GLF E;  1NJF A;  3K1J A;  2CV1 A;  7CAT A;  5EP2 A;  1G4A E;  2RKO A;  3BXW A;  3SBJ A;  4NRV A;  3GPU A;  5EXT A;  3TWK A;  2DAM A;  1PJI A;  1GL6 A;  3V76 A;  3SAW A;  1L1Z A;  1JR3 E;  3KSX A;  2C96 A;  4QNM A;  4NXN M;  1C7Y A;  4TUW A;  1QDT A;  2ZAN A;  2JY8 A;  2KW0 A;  3U6M A;  1QYR A;  5E6J A;  1KSF X;  3EIE A;  2F5O A;  2P5T A;  3Q8X A;  2L7H A;  3UZU A;  3WHL A;  4LF7 M;  2HAK A;  1PM5 A;  2R4E A;  3B7N A;  4MB7 A;  1HR0 M;  3AOG A;  2R44 A;  3C3E A;  3BBZ A;  2QBY A;  4JI8 M;  2EUC A;  1F4I A;  3FRI A;  1A5T A;  5ITX A;  5DNY A;  5EP3 A;  3LVW A;  3F92 A;  4G4Q A;  2R6F A;  5FTL A;  1XC8 A;  4CJ6 A;  4LGY A;  2DZL A;  3B7Q A;  4LG2 A;  1QDR A;  1JR3 D;  3KOW E;  3GLF A;  1ZQ9 A;  3JAM S;  4DV0 M;  1E94 E;  3KP0 E;  3CF6 E;  4GIT A;  1JR3 A;  1R2Y A;  1L1T A;  3L27 A;  4D80 A;  3UGJ A;  2VF7 A;  2KEB A;  1QAO A;  4XBO A;  2K9D A;  3QYE A;  4X64 M;  1WR1 B;  5DYI A;  4LJ4 A;  2Y21 A;  1HNX M;  2CV2 A;  4IBD A;  4DR4 M;  2JY5 A;  4LZJ A;  5FSW A;  1IFY A;  3MHV C;  2D7H A;  4XK8 F;  2QBY B;  3KS8 A;  2K47 A;  1PJT A;  1NHW C;  4LJ9 A;  2FNA A;  4M9S A;  2L4F A;  5ITY A;  3J27 B;  4EIW A;  1CUK A;  2J7N A;  1PRB A;  2Q2E B;  3J7B A;  3TWM A;  3GLF B;  4DV3 M;  3SAT A;  2BNK A;  1DO0 A;  4I4L A;  1EE8 A;  1N36 M;  4JI6 M;  2UXD M;  1AIP C;  1NV9 A;  2DKL A;  4LFC M;  1IN6 A;  2ZTD A;  3GPY A;  1QAQ A;  1R2Z A;  3RGP A;  3J7A S;  3HWS A;  4IBK A;  1OAI A;  2CP8 A;  2R46 A;  4IIW A;  4DR3 M;  5JI2 E; 
#chains in the Genus database with same CATH homology
 1IY2 A;  2F5N A;  2C99 A;  2CHG A;  3FUX A;  3U6C A;  1TGU A;  4GH9 A;  4DV7 M;  2FOI C;  2M60 A;  3CF0 A;  3HHX A;  3BOS A;  2F5S A;  2HHH M;  3IG8 A;  5GKN A;  1E32 A;  3B9P A;  4NL4 H;  3AKZ A;  1IXZ A;  5EJC A;  5KO3 A;  2JA2 A;  4DV5 M;  4ZPX A;  4OVZ B;  2XH9 A;  5IWA M;  2X8A A;  3KS4 A;  2YFQ A;  3QWL A;  4AZF A;  3U6E A;  3HJS A;  1NNJ A;  4AKI A;  4R7G A;  1L2D A;  2DWL A;  3FTD A;  3U6S A;  3SAS A;  3KXE C;  3A46 A;  4DR2 M;  3SAR A;  1NY5 A;  2KRK A;  2F5Q A;  4B3R M;  3J2P B;  2XZF A;  3RGS A;  4JI0 M;  3ZC7 B;  4QNR A;  3FTE A;  4JI1 M;  2BJW A;  1G41 A;  3NBI A;  1NSF A;  4I81 A;  2Y0Q A;  3SMS A;  3I51 A;  4KO8 A;  2LWX A;  4JN6 A;  2V6Z M;  3KW6 A;  3A45 A;  4KOD A;  3PNV A;  3D8L A;  5ITQ A;  4AKH A;  3HHZ A;  1QQW A;  4I8O A;  3R8F A;  4S12 A;  1OJL A;  3A42 A;  1L8Q A;  1Z5B A;  4FCW A;  4AG6 A;  2CEA A;  4LF8 M;  4B7F A;  3D8B A;  1N78 A;  3DA1 A;  3RFW A;  3HU2 A;  1HQY E;  5EP4 A;  4IJE A;  1MX0 A;  3HU1 A;  4FD2 A;  2FE8 A;  5FTN A;  1IBL M;  3ZH9 B;  3NWL A;  2DZO B;  3H4M A;  4KHP M;  4AW4 A;  3FYC A;  5KPT A;  3KFU G;  4GRI A;  4DR6 M;  4MGY E;  4DR1 M;  3TPZ A;  4GHA A;  1DGG A;  4LF6 M;  4LCB A;  3SHG B;  4G4O A;  4JI5 M;  3MK6 A;  1QVR A;  3AOE C;  4MGI E;  4LF4 M;  1DO2 A;  2O5R A;  2X49 A;  4I5S A;  3L29 A;  4X66 M;  1G59 A;  3HHW A;  1SXJ E;  2QCU A;  5C18 A;  3T15 A;  3AFH A;  4JI2 M;  4M9X A;  2QPA A;  4PCZ A;  4GHL A;  5ITR A;  1W5S A;  4GKJ M;  3HHY A;  2CE7 A;  3U6O A;  5EXS A;  1SXJ C;  3AOE A;  3T1Y M;  4JI7 M;  4DV2 M;  3GPX A;  2KA6 B;  2CHQ A;  3L25 A;  1KYI A;  1T3T A;  2DWZ B;  1TDH A;  1IN4 A;  1SXJ D;  2CUZ A;  1J09 A;  3DZD A;  2CHV A;  1Z59 A;  4G4R A;  5KPZ A;  1SXJ A;  4IBF A;  2CFO A;  2XFS A;  4B7H A;  1Z6T A;  2EA0 A;  1HNW M;  3PVS A;  3U6P A;  1IBK M;  2C9O A;  2YNM D;  3FTC A;  4FW9 A;  3IG5 A;  2A5Y B;  1GKI A;  2YR0 A;  1IXR C;  4B3T M;  1ORY B;  4IBB A;  4NOO B;  2RGO A;  4G4N A;  4II7 A;  2RGH A;  2VQF M;  3ILK A;  4OVZ A;  3OTO M;  2ZAM A;  1SXJ B;  4IBI A;  3SHF A;  2XLJ A;  3GO8 A;  1IQP A;  2R65 A;  4NSO B;  5EXP A;  2F5P A;  3UJN A;  1KFV A;  3E4R A;  3GLH B;  1R7R A;  3U60 B;  5DYG A;  3AJI B;  2VQE M;  1NY6 A;  1IY0 A;  4OX9 M;  1XNR M;  3LQR A;  1HNZ M;  3A98 B;  2QP9 X;  4RNA A;  1S3S A;  2QZ4 A;  3RE8 A;  4DV4 M;  3KVW A;  3VDU A;  4CIS A;  2DVW B;  2LH0 A;  4Z6Y A;  1G3I A;  2L7I A;  2VII A;  3L2A A;  1GL7 A;  4JI3 M;  1XHB A;  4LRS A;  5FTJ A;  2OQ4 A;  2UXB M;  3PXG A;  3QAU A;  4IBJ A;  5KQ8 A;  4DV6 M;  3SC3 A;  3WHK A;  4ITQ A;  5EXX A;  3VFD A;  2CV0 A;  2R18 A;  4QOS A;  2DZN B;  3AV0 A;  1R6B X;  1J5E M;  3JR5 A;  4LF5 M;  2R45 A;  1H6U A;  4AQY M;  3GQ3 A;  2LNH C;  2Z4S A;  1W5T A;  3DFZ A;  4L15 A;  2ZBK B;  3GRY A;  1YUB A;  3I4V A;  4Z8X A;  4L16 A;  3SAV A;  5LMU M;  3W0F A;  1FNN A;  3T1H M;  2XSZ D;  4G6Z A;  1WXQ A;  3J80 S;  4IBG A;  3LQQ A;  1C1K A;  2V1U A;  2XSZ A;  4L8R C;  1J7K A;  1VDD A;  3KOZ E;  3AL0 C;  3PFI A;  4LJ6 A;  1OFH A;  3GLI B;  3MJ5 A;  4DUZ M;  3GPP A;  4LJ8 A;  4REZ A;  4YHH M;  1LV7 A;  3C58 A;  8CAT A;  3TE6 A;  4PD2 A;  3U6L A;  4LFB M;  1XNQ M;  4PDG A;  2UXC M;  1HT2 E;  2LXE A;  3L28 A;  4DV1 M;  1XMO M;  1IY1 A;  4LJA A;  3M7G A;  1TH2 A;  4JYA M;  5C1B A;  1N77 A;  4MM3 B;  1E9S A;  4FWD A;  2J7O A;  2L6O A;  3ZCB B;  4CHT B;  3HGI A;  3U6D A;  1IXS B;  2KXE A;  3CTW B;  2DWM A;  1FJG M;  4LJ7 A;  4W5W A;  3KOY E;  3SYL A;  5EQT A;  5ITX E;  2E5L M;  1PJJ A;  4LJ5 A;  3GRU A;  5FTM A;  3VK8 A;  1MU5 A;  5JI3 E;  4YY3 M;  1IN5 A;  2KRU A;  2BJV A;  3HJQ A;  3JR4 A;  4HL4 A;  3GLG B;  4GKK M;  1QAN A;  2KZS A;  3FYD A;  3VKH A;  4D82 A;  3E9S A;  4L4U A;  4B3M M;  1K3X A;  3UK6 A;  3HKP A;  4LFA M;  2C9C A;  1E9R A;  5ITT A;  2D7G A;  3GRR A;  1NVM A;  1NHG C;  3FD9 A;  4QHT A;  2R4J A;  3CF2 A;  3GLH A;  1K3W A;  3U60 A;  1L2C A;  5EP1 A;  5A2Q S;  1HQC A;  4K0K M;  3VDP A;  1Z5A A;  4MGZ E;  3T38 A;  3SFZ A;  1DGH A;  4BBA A;  4KLN A;  4B7G A;  2C5R A;  4DR7 M;  4QOZ C;  4IBE A;  1XWI A;  4WW0 A;  3KOX E;  4LF9 M;  2F4V M;  4BB9 A;  5BPV A;  3VLF B;  4FCT A;  4PDI A;  4LY6 A;  1UM8 A;  5IT9 S;  1GVN A;  3FUW A;  1QAM A;  2UUC M;  1IN8 A;  2QEN A;  3R9X B;  1L2B A;  1N75 A;  2FFJ A;  4X62 M;  1TH3 A;  4OW0 A;  5H37 D;  2I7N A;  3U5Z A;  2M5Z A;  2G5G X;  2NQ8 C;  4GC5 A;  4LZZ A;  3HJ8 A;  1IBM M;  1DGF A;  4M0D A;  2DWN A;  4RF1 A;  4AI6 A;  1DGH B;  3K2L A;  3SYK A;  4XGI A;  5KPR A;  3PNY A;  5F3W A;  5FLX S;  5KQD A;  2L09 A;  2XFT A;  4FWG A;  2UU9 M;  1OFI A;  2W82 A;  2XZU A;  2ZM6 M;  3LMM A;  1DGB A;  2HCB A;  4M0W A;  4CGY B;  3TL4 X;  1Q3C A;  1K82 A;  2G8L A;  2XEP A;  1G8P A;  4A3V B;  2DXI A;  4GC9 A;  3TWL A;  3KP1 E;  1N32 M;  4LGM A;  4D81 A;  1NJG A;  2HL7 A;  1YSY A;  4FVM A;  5IRE B;  2Z4R A;  4JI4 M;  3KSJ A;  4GIP A;  4JXJ A;  1I4W A;  2KZU A;  1XMQ M;  4IJF A;  4PT5 A;  3K92 A;  4JV5 M;  2Y20 A;  3U5Z B;  3I4Y A;  4QHS A;  3KDS E;  2AHM A;  3FUU A;  4DUY M;  2Z3X A;  1ZAE A;  4B3S M;  4IBC A;  4LRT A;  4NRW A;  1IM2 A;  3GLI A;  3FUT A;  5IZ7 D;  2XF3 A;  1X37 A;  1Z5C A;  4MGH A;  1I94 M;  1Q3B A;  3THG A;  3U6Q A;  2R62 A;  4L78 A;  2HKJ A;  1XXH A;  3J81 S;  3L26 A;  3GQ5 A;  4NXM M;  1QZM A;  2H1R A;  4GMQ A;  3W0L B;  2I7P A;  4AKG A;  4MGK E;  3VK7 A;  3SAU A;  4R3D A;  1N34 M;  2YQZ A;  2ZAO A;  2ERC A;  4FWH A;  1NNU C;  4P16 A;  5FTK A;  4X65 M;  2UUA M;  3HU3 A;  2X4A A;  3GP1 A;  3SMP A;  1JQJ C;  4DR5 M;  2Y0T A;  4B08 A;  3U61 A;  4MH0 E;  2V1C A;  4WUR A;  3FTF A;  1GLN A;  1Q39 A;  4M9Z A;  5ITU A;  5BR8 M;  5LMN M;  4BLC A;  2XGN A;  3FKE A;  2OPF A;  1XXH B;  3GLG A;  3FUV A;  3VKG A;  3GRV A;  1YE9 A;  1IN7 A;  1D2N A;  1TDZ A;  2C98 A;  4RF0 A;  4HLQ A;  3LVV A;  4AG5 A;  2D7E A;  2DHR A;  4FCV A;  2UUB M;  5E26 A;  3K8Z A;  3TQS A;  3M6A A;  4NSR A;  3UMM A;  3EIH A;  1TH4 A;  2Z7J A;  3DOA A;  1N33 M;  1HT1 E;  3U61 B;  2EO2 A;  4OU7 A;  3M0E A;  1NJF A;  3K1J A;  2CV1 A;  7CAT A;  5EP2 A;  1G4A E;  2RKO A;  3SBJ A;  4NRV A;  3GPU A;  5EXT A;  3TWK A;  1PJI A;  1GL6 A;  3SAW A;  1L1Z A;  3KSX A;  2C96 A;  4QNM A;  4NXN M;  4TUW A;  2ZAN A;  2KW0 A;  3U6M A;  1QYR A;  5E6J A;  1KSF X;  3EIE A;  2F5O A;  2P5T A;  3Q8X A;  2L7H A;  3UZU A;  3WHL A;  4LF7 M;  1PM5 A;  2R4E A;  4MB7 A;  1HR0 M;  3AOG A;  4JI8 M;  2QBY A;  2EUC A;  5ITX A;  5DNY A;  5EP3 A;  3LVW A;  4G4Q A;  5FTL A;  1XC8 A;  4LGY A;  4LG2 A;  3KOW E;  1JR3 D;  3GLF A;  1ZQ9 A;  3JAM S;  4DV0 M;  1E94 E;  3KP0 E;  3CF6 E;  4GIT A;  1JR3 A;  1R2Y A;  1L1T A;  3L27 A;  4D80 A;  3UGJ A;  2KEB A;  1QAO A;  4XBO A;  4X64 M;  5DYI A;  4LJ4 A;  2Y21 A;  1HNX M;  2CV2 A;  4IBD A;  4DR4 M;  4LZJ A;  5FSW A;  3MHV C;  2D7H A;  2QBY B;  3KS8 A;  2K47 A;  1NHW C;  4LJ9 A;  2FNA A;  4M9S A;  5ITY A;  3J27 B;  4EIW A;  2J7N A;  2Q2E B;  3J7B A;  3TWM A;  3GLF B;  4DV3 M;  3SAT A;  2BNK A;  1DO0 A;  4I4L A;  1EE8 A;  1N36 M;  4JI6 M;  2UXD M;  4LFC M;  1IN6 A;  3GPY A;  1QAQ A;  1R2Z A;  3RGP A;  3J7A S;  3HWS A;  4IBK A;  3GQ4 A;  2R46 A;  4IIW A;  4DR3 M;  5JI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...