1IBLM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1iblM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1iblM02
2F4VM 4B3TM 5ITTA 3GPPA 4JI3M 4DR5M 4ITQA 2ZM6M 5ITXA 2UUAM 1IBKM 1IBLM 1HNWM 3SARA 4DV7M 2UUBM 2F5QA 5LMNM 1NNJA 4CISA 1N33M 4B3MM 3C58A 5ITUA 1L1TA 4JV5M 1XMQM 1N32M 2F5PA 3U6EA 5BR8M 2XZUA 2UU9M 1PM5A 1R2YA 1N36M 4G4QA 1XNQM 4B3SM 4LF5M 4DR1M 4DV4M 1K82A 1Q3CA 3SBJA 3U6PA 4LF4M 4DR6M 2HKJA 1XMOM 1L2DA 5ITRA 3GO8A 2F5NA 3SAWA 4KHPM 4DV1M 1MU5A 4JI1M 1PJJA 2F5OA 3A46A 1PJIA 5A2QS 4G4OA 4PCZA 4JI8M 1TDZA 3JR4A 5ITQA 1R2ZA 4JI6M 4DUYM 3SAUA 3T1YM 4GKKM 1XNRM 4X62M 4G4RA 4DV6M 4JI7M 3W0FA 1EE8A 3JAMS 3GQ4A 4X64M 4JYAM 3U6SA 3VK8A 4LF8M 4DR2M 3VK7A 3TWKA 4LFCM 4DV3M 3OTOM 4DUZM 2OQ4A 5FLXS 3U6OA 4GKJM 1I94M 4DR7M 3GP1A 5IT9S 1K3XA 1L2BA 5ITXE 4JI0M 2HHHM 3J7AS 1L2CA 3GQ3A 5IWAM 5LMUM 2XZFA 4LF9M 1HR0M 3SATA 4AQYM 4B3RM 3J81S 2UUCM 1N34M 4LFAM 2VQEM 4JI2M 4OX9M 2OPFA 4MB7A 3GPXA 4DV5M 4LFBM 3A45A 1Z5BA 1XC8A 4DR3M 5ITYA 4JI4M 4NRVA 1Q3BA 2ZBKB 2EA0A 3A42A 2UXBM 4YHHM 3U6MA 4NXMM 3GPUA 3GPYA 2E5LM 4NXNM 2UXCM 1HNXM 3J80S 3DOAA 1K3WA 4JI5M 3TWMA 1J5EM 1MX0A 1IBMM 4K0KM 1FJGM 4DV0M 4PD2A 4DV2M 4X65M 4X66M 3JR5A 3U6LA 3GQ5A 1Q39A 4YY3M 1Z5CA 1Z59A 3U6CA 3U6DA 3U6QA 4LF7M 4PDIA 4DR4M 2VQFM 1L1ZA 1HNZM 2UXDM 4LF6M 1KFVA 2F5SA 3SASA 4PDGA 3TWLA 4NRWA 4G4NA 1Z5AA 1TDHA 3T1HM 2Q2EB 3SAVA
chains in the Genus database with same CATH superfamily
2F4VM 2DAMA 3R8FA 2CE7A 4JI3M 1IXSB 4ITQA 1G8PA 3HGIA 1MJGM 2LHCA 3KOYE 1IBLM 1QYRA 4AI6A 1T3TA 3AFHA 4QNRA 1PGYA 3GLFB 4GMQA 2KRUA 2F5QA 2OOAA 1QUTA 5LMNM 2DWMA 1N33M 1SXJB 3V76A 3FUVA 4JV5M 2Y0TA 3GLHA 3U6EA 5DYGA 1E9RA 4GIPA 1Y8GA 4G4QA 3KSXA 1C7YA 1WIVA 3VKGA 5KPRA 2V1UA 2EKKA 2MROB 3U5ZB 1E32A 1DGGA 2LVAA 4W5WA 1D0KA 1YSYA 2MR9A 4M0WA 1ZV1A 2DI0A 3RFWA 3SBJA 3W0LB 3K8ZA 3T15A 4DR6M 2ZANA 1VEKA 2Z4RA 3RE8A 2C5RA 1XMOM 4QOZC 2L4FA 4D82A 1PJTA 4LJAA 1ZAEA 1DGHB 3A46A 1PJIA 3FTCA 1JR3D 3IG5A 3NBIA 1NJFA 4MGYE 2WSFF 3E21A 3FTDA 2CV1A 3JR4A 1N75A 1UM8A 4IBBA 1R2ZA 2AHMA 3AKZA 1QDRA 5FTJA 3SAUA 2O5RA 2D7HA 5KPZA 3HHWA 1G41A 1OQYA 4FCWA 2Z3XA 4X64M 4JYAM 2JXNA 1HT1E 1NV9A 4LJ4A 3SFZA 1SG9A 4LFCM 2JY5A 2QENA 3B89A 3CGWA 4DV3M 2CRUA 5FLXS 4AG5A 1H6UA 2DAGA 2V6ZM 2Y21A 3LVVA 2QBYB 4QHSA 3LVWA 3GLIB 2C98A 2QSFX 1L2BA 2HHHM 3J7AS 2ZAMA 1L2CA 1BVSA 3U61B 5EXXA 2XZFA 3B7ZA 3CF6E 3L26A 4AQYM 2M60A 1GLNA 3HJ8A 1JR3A 3K1JA 4IBEA 4IBDA 2UUCM 1OAOC 2FH0A 1E94E 4LCBA 1TTEA 2L7IA 1VDLA 4B7GA 2J7OA 1QAQA 4LJ7A 7CATA 3GLGE 2CV0A 4JI2M 3B74A 3KS8A 5DNYA 3GPXA 2JNHA 1SXJC 2K9DA 3A45A 1XC8A 1YLAA 4L4UA 4NRVA 1AUAA 1EIJA 3QYBA 2H1RA 3TE6A 1ZMUA 2KNVA 2BNKA 3LCUA 1QDTA 4RF1A 4NXMM 3GLFE 2R18A 3GPYA 4MGHA 1NHGC 2Z4SA 3J80S 3SMSA 1ORYB 3PXGA 3DOAA 2VF8A 4I4LA 2CFOA 1G71A 4IBCA 1K3WA 1OAIA 5EP4A 3UZUA 2LVNC 3TWMA 4NSOB 4IJFA 2WSEF 2ZTCA 5JI3E 4D81A 4DV2M 2CV2A 2DKLA 1PRBA 2MH8A 4QOSA 5KO3A 4GC9A 5FTNA 4IBIA 1E9SA 3U6DA 3HX3A 2DVWB 3IECA 4JN6A 3LMMA 5F3WA 3FYDA 2BWBA 2VQFM 1R6BX 2CHGA 2Z8YM 1OKSA 4L16A 4F2LA 3PNVA 3W67A 1L1ZA 3MK6A 2YNMD 2H5XA 2XF3A 3W68A 2QZ4A 1IN6A 4AZFA 2R62A 2XH9A 2RGHA 2JA2A 5ITTA 4WURA 2KZUA 3SMPA 3NBXX 4OU7A 4XK8F 2XLJA 2MJ5B 2OOBA 2X49A 4MGZE 4IBFA 3KFUG 1LTMA 3T6PA 3C9PA 3SARA 5EP3A 1Z6TA 3L29A 4AKGA 4GH9A 4CISA 4L8RC 3UGJA 3AV0A 1JQJC 2EKFA 3B9PA 3HJQA 2JUJA 3FTEA 1EFUB 4OVZA 1XMQM 1L1TA 3TPZA 3J7BA 2DXIA 2L4EA 3KP1E 2HAKA 1LV7A 4MH0E 2XZUA 1PM5A 4Z6YA 4QNMA 3KOXE 1XNQM 3KDSE 2WSCF 5H37D 3EIEA 3FKEA 4IBGA 5IREB 4DR1M 4DV4M 3I04M 2XFTA 1K82A 3SYLA 3R9XB 2CWBA 3AOEC 1ZMVA 1IQPA 3U6PA 2CHQA 3HU3A 1GJSA 3FUTA 3U60B 2QCUA 3GRUA 3IG8A 5EJCA 3THGA 4D80A 3SAWA 4KHPM 2LWXA 2XSZD 3BBZA 3F92A 2KA6B 2FE8A 2G3QA 2GNOA 2LHGA 5A2QS 2DZLA 3CF0A 1DV0A 3WHLA 3HWSA 1YUBA 5C1BA 2L6OA 1G3IA 4RKUF 3AOGA 4DUYM 1WGLA 1NO1A 4RNAA 4G4RA 5E6JA 2Y0QA 4M9ZA 3B7QA 1EE8A 3JAMS 4IIWA 3CTWB 2X4AA 3GRRA 3UK6A 4GHLA 4DR2M 3TWKA 4Q7JA 2FS1A 2MGWA 2ZTDA 2R0IA 4I5SA 3QAUA 3OTOM 1V34A 3U6OA 1I94M 4DR7M 3A98B 5IT9S 1S3SA 1HT2E 3LQQA 1VEGA 4FVMA 4CJ6A 1KYIA 2R45A 2DZOB 4GHAA 3NWLA 2FFJA 2I7NA 4FCVA 2XSZA 1NJGA 3SATA 2VDBB 1MN3A 3VDPA 1QUSA 4B7HA 3E9SA 4NOOB 3SHFA 3VFDA 1N34M 2VQEM 3GLHE 2CHVA 2OPFA 2KZSA 2DHYA 3FRIA 4MB7A 4A3VB 1F4IA 4DV5M 4LFBM 5EQTA 5ITYA 5FTMA 4JI4M 2HCBA 2C9OA 3A42A 1GVNA 5E26A 1TR8A 1SXJD 1IXZA 2B3TA 2QP9X 1IY0A 3H4MA 3MMPA 3QYEA 2E5LM 2LVPC 2LVOC 2KNAA 2M5ZA 1T6OA 4LJ6A 2BJWA 3EIHA 3HHZA 3KW6A 4M9XA 2DWLA 2R46A 3KXEC 4ZPXA 3H4JA 4LJ8A 1FJGM 1GABA 2L09A 4Z8XA 4X66M 5FSWA 2FNAA 1GL6A 4FWHA 4X65M 2LNHC 3HJSA 3J27B 2QHOB 1OIZA 4KT0F 1Z5CA 4YY3M 3HU2A 1Z59A 3ZC7B 3UJNA 3UMMA 3M7GA 3U6QA 1WGNA 2JZ1A 4LF7M 4LGMA 1WHCA 4FWGA 4IJEA 3FTFA 2VF7A 1RU3A 1UFZA 3KOWE 2C99A 1HQYE 5EXSA 2UXDM 1N78A 2QPAA 2DAKA 3PVSA 3FRHA 1NY5A 1XXHA 2YQZA 3I01M 1Z5AA 1V92A 4OVZB 1TDHA 3TWLA 4G4NA 3SC3A 2YFQA 1PJSA 1HJPA 3HHYA 5EP2A 3SAVA 1T43A 3GRVA 1SXJA 3MJ5A 2ZM6M 1IN8A 5ITXA 2UUAM 1OTRA 1HNWM 3ILKA 3KP0E 4PT5A 4M0DA 2FOIC 4DV7M 2O01F 2RKOA 2KEBA 1JR3E 3PFIA 4CGYB 1NNJA 3U5ZA 3D8LA 5ITUA 1X37A 4F1IA 2LXEA 3PNYA 4WP2A 1KSFX 1IN5A 1QAOA 4LF5M 3ZCBB 3B7NA 2CEAA 4AG6A 1Q3CA 3J2PB 3ZQJA 3GLHB 1QAMA 2BJVA 3LQRA 2KHHA 4R71A 2KDLA 3GO8A 3DA1A 3Q8GA 1QQWA 3M6AA 4DV1M 1MU5A 3BOSA 1PJJA 3KS4A 3VLFB 2EO2A 3AJIB 1NHWC 4G4OA 3K92A 4AKHA 1TH4A 2JWSA 4L6V6 4BLCA 1TDZA 5ITQA 4MGIE 3SASA 2QNJA 4IBJA 1WXQA 4GKKM 2A5YB 3GLIA 1NVMA 2K0BX 4DV6M 4JI7M 3W0FA 1OJLA 4NC6A 4LG2A 1NY6A 3FUXA 2JY6B 3U6SA 3T38A 4FCTA 1HQCA 2R6FA 1XWIA 2KW0A 2DAIA 4NRWA 2D7EA 3L28A 4BB9A 2CP8A 5JI2E 2JY7A 4BBAA 2DHRA 3HZJA 1Q02A 5IWAM 1QVRA 4AKIA 3AOEA 1AIPC 1IY1A 1HR0M 1GO5A 1WJ7A 4P16A 1R4GA 4EIWA 2XEPA 2R44A 1DO2A 3FUUA 3C3EA 3L27A 4REZA 5BPVA 2HWJA 4FWDA 1D0MA 4LY6A 2DAEA 1L8QA 2WZJA 4QHTA 4LGYA 2L2DA 1VEJA 3DZDA 3QWLA 2EA0A 1VG5A 2APLA 1A5TA 1PJQA 2V1CA 4YHHM 2KRKA 4II7A 2I7PA 4NXNM 4GC5A 2UXCM 1OIPA 2EUCA 5FTKA 1GKIA 3I4YA 4NSRA 2YR0A 1VDDA 1ZQ9A 3KOZE 4M9SA 1XXHB 2DWZB 2OO9A 2RGOA 1NNUC 4CHTB 3HHXA 2KNZA 1MX0A 5FTLA 2K47A 4K0KM 3L2AA 3SYKA 4PD2A 4DV0M 4G6ZA 3E46A 5EXPA 3JR5A 4B7FA 1GJTA 4WW0A 1TH2A 1Q39A 2JY8A 4I8OA 2K6BA 1TF0B 3LCVB 2G5GX 5C18A 1XB2B 2R4EA 4PDIA 1D2NA 5GKNA 3I51A 3FUWA 3IHPA 4P17A 1D0LA 3CF2A 1HNZM 4LF6M 1KFVA 1ZMWA 1NV8A 4PDGA 1TH3A 1W5SA 4LRTA 4XGIA 3T1HM 1N77A 4B3TM 4ANRA 2X8AA 3GPPA 4R7GA 1IFYA 4DR5M 2Z7JA 2JP7A 2QQ8A 2LVQD 5EXTA 1IBKM 3WHKA 2UUBM 1QZMA 4Y28F 2BWEA 2W82A 4LZZA 4LJ9A 8CATA 3C58A 4B3MM 2RRUA 2R4JA 1N32M 4S12A 3GLGA 2F5PA 2NQ8C 5BR8M 2UU9M 4TUWA 3L25A 1R2YA 1N36M 4RF0A 4UN2B 4B3SM 4GITA 3U60A 1C1KA 1IXSA 1IXRC 1WR1B 2CUZA 2ZAOA 3BXWA 2ERCA 2O25A 5KPTA 1DGBA 4I81A 3GLFA 4LF4M 3TQSA 2HKJA 1L2DA 2DWNA 3VKHA 5DFLA 5ITRA 5L8RF 3MHVC 2F5NA 5EP1A 4HEOA 4G3OA 1DGFA 4JI1M 2F5OA 2XFSA 3FE3A 4CIZA 1G4AE 4PCZA 4JI8M 2C9CA 3K9OA 3E4RA 5DYIA 3RGSA 4JI6M 4JXJA 1I4WA 1QZEA 3T1YM 2LBCA 1XNRM 2VIIA 4X62M 1J7KA 1YE9A 2C96A 3FD9A 1GL7A 4OW0A 3GQ4A 1TGUA 4DBGB 1XXHE 3VK8A 4KLNA 1OFHA 2L7HA 3HKPA 4GEWA 3VK7A 4LF8M 2D7GA 2JZ0A 1DGHA 1NSFA 4HL4A 2OQ4A 4DUZM 3K2LA 4GKJM 1SXJE 2J7NA 4B08A 3GP1A 1P3QQ 1K3XA 1DO0A 4LZJA 5ITXE 1IY2A 3FYCA 4L15A 1VQ1A 2HL7A 4JI0M 1W5TA 3SHGB 4XBOA 3GQ3A 2LH0A 5LMUM 4LJ5A 4LF9M 1J09A 4FD2A 4KODA 3J81S 3Q8XA 4FW9A 1JB0F 2N35A 4IBKA 3HU1A 3KVWA 4LFAM 2R65A 4OX9M 4B3RM 3DFZA 2DZNB 4R3DA 2G8LA 1IM2A 1QANA 1Z5BA 3D8BA 3TL4X 4LRSA 4DR3M 2QBYA 2P5TA 1Q3BA 3HY5A 4MGKE 2ZBKB 4HLQA 2UXBM 1IN7A 3U61A 3U6MA 5KQ8A 3GPUA 3K9PA 1HNXM 2KXEA 2DENA 3AL0C 3ZH9B 4JI5M 1G59A 1R7RA 1J5EM 1IBMM 1CUKA 3LW5F 3M0EA 4GRIA 4KO8A 3U6LA 4AW4A 3GQ5A 1R5LA 5KQDA 2Y20A 2GQFA 3GRYA 1IN4A 3KSJA 3U6CA 5IZ7D 4MM3B 2XGNA 1V33A 1OFIA 2J5YA 3I4VA 3GLIE 3C3DA 4DR4M 3VDUA 2EJSA 4NL4H 2LTUA 3RGPA 1FNNA 1XHBA 2DNAA 2F5SA 4L78A 3GLGB 2Q2EB
chains in the Genus database with same CATH topology
2F4VM 3R8FA 2CE7A 4JI3M 1IXSB 4ITQA 1G8PA 3HGIA 3KOYE 1IBLM 1QYRA 4AI6A 1T3TA 3AFHA 4QNRA 3GLFB 4GMQA 2KRUA 2F5QA 5LMNM 2DWMA 1N33M 1SXJB 3FUVA 4JV5M 2Y0TA 3GLHA 3U6EA 5DYGA 1E9RA 4GIPA 4G4QA 3KSXA 3VKGA 5KPRA 2V1UA 3U5ZB 1E32A 1DGGA 4W5WA 3RFWA 1YSYA 4M0WA 3SBJA 3W0LB 3K8ZA 3T15A 4DR6M 2ZANA 2Z4RA 3RE8A 2C5RA 1XMOM 4D82A 4LJAA 1ZAEA 1DGHB 3A46A 1PJIA 3FTCA 1JR3D 3IG5A 3NBIA 1NJFA 4MGYE 3FTDA 2CV1A 3JR4A 1N75A 1UM8A 4IBBA 1R2ZA 2AHMA 3AKZA 5FTJA 3SAUA 2O5RA 2D7HA 5KPZA 3HHWA 1G41A 4FCWA 2Z3XA 4X64M 4JYAM 1HT1E 4LJ4A 3SFZA 4LFCM 4QOZC 2QENA 4DV3M 5FLXS 4AG5A 1H6UA 2V6ZM 2Y21A 3LVVA 2QBYB 4QHSA 3LVWA 3GLIB 2C98A 1L2BA 2HHHM 3J7AS 2ZAMA 1L2CA 3U61B 5EXXA 2XZFA 3CF6E 3L26A 4AQYM 2M60A 1GLNA 3HJ8A 1JR3A 3K1JA 4IBEA 4IBDA 2UUCM 1E94E 4LCBA 2L7IA 4B7GA 7CATA 2J7OA 1QAQA 4LJ7A 4JI2M 2CV0A 3KS8A 5DNYA 3GPXA 3A45A 1SXJC 1XC8A 4NRVA 4L4UA 2H1RA 3TE6A 2BNKA 4RF1A 4NXMM 2R18A 3GPYA 4MGHA 1NHGC 2Z4SA 3J80S 3SMSA 1ORYB 3PXGA 3DOAA 4I4LA 2CFOA 4IBCA 1K3WA 5EP4A 3UZUA 3TWMA 4NSOB 4IJFA 5JI3E 4DV2M 4D81A 2CV2A 5KO3A 4QOSA 4GC9A 5FTNA 4IBIA 1E9SA 3U6DA 2DVWB 4JN6A 3LMMA 5F3WA 3FYDA 2VQFM 1R6BX 2CHGA 4L16A 1L1ZA 3PNVA 3MK6A 2YNMD 2XF3A 2QZ4A 1IN6A 4AZFA 2R62A 2XH9A 2RGHA 2JA2A 5ITTA 4WURA 2KZUA 3SMPA 4OU7A 2XLJA 2X49A 4MGZE 4IBFA 3KFUG 3SARA 5EP3A 1Z6TA 3L29A 4AKGA 4GH9A 4CISA 4L8RC 3UGJA 3AV0A 1JQJC 3HJQA 3B9PA 3FTEA 1L1TA 4OVZA 1XMQM 3TPZA 3J7BA 2DXIA 3KP1E 4MH0E 1LV7A 2XZUA 1PM5A 4Z6YA 4QNMA 3KOXE 1XNQM 3KDSE 5H37D 3EIEA 3FKEA 4IBGA 5IREB 4DR1M 4DV4M 2XFTA 1K82A 3SYLA 3R9XB 3AOEC 1IQPA 3U6PA 2CHQA 3HU3A 3FUTA 3U60B 2QCUA 3GRUA 3IG8A 5EJCA 3THGA 4D80A 3SAWA 4KHPM 2LWXA 2XSZD 2KA6B 2FE8A 5A2QS 3CF0A 3WHLA 3HWSA 1YUBA 5C1BA 2L6OA 1G3IA 3AOGA 4DUYM 4RNAA 4G4RA 5E6JA 2Y0QA 4M9ZA 1EE8A 3JAMS 4IIWA 3CTWB 2X4AA 3GRRA 3UK6A 4GHLA 4DR2M 3TWKA 4I5SA 3OTOM 3QAUA 3U6OA 1I94M 4DR7M 3A98B 5IT9S 1S3SA 1HT2E 3LQQA 4FVMA 1KYIA 2R45A 2DZOB 4GHAA 3NWLA 2FFJA 2I7NA 4FCVA 2XSZA 1NJGA 3SATA 3VDPA 4B7HA 1N34M 3E9SA 4NOOB 3SHFA 3VFDA 2VQEM 2CHVA 2OPFA 2KZSA 4MB7A 4A3VB 4DV5M 4LFBM 5EQTA 5ITYA 5FTMA 4JI4M 2HCBA 2C9OA 3A42A 1GVNA 5E26A 1SXJD 1IXZA 2QP9X 3H4MA 1IY0A 2E5LM 2M5ZA 4LJ6A 2BJWA 3EIHA 3HHZA 3KW6A 4M9XA 2DWLA 2R46A 3KXEC 4ZPXA 1FJGM 4LJ8A 2L09A 4Z8XA 4X66M 5FSWA 2FNAA 1GL6A 4FWHA 4X65M 2LNHC 3HJSA 3J27B 4YY3M 1Z5CA 3HU2A 1Z59A 3ZC7B 3UJNA 3UMMA 3M7GA 3U6QA 4LF7M 4LGMA 4FWGA 4IJEA 3FTFA 3KOWE 2C99A 1HQYE 5EXSA 2UXDM 1N78A 2QPAA 3PVSA 3SASA 1NY5A 1XXHA 2YQZA 4OVZB 1Z5AA 3TWLA 4G4NA 1TDHA 3SC3A 2YFQA 3SAVA 3HHYA 5EP2A 3GRVA 1SXJA 3MJ5A 2ZM6M 1IN8A 5ITXA 2UUAM 1HNWM 3ILKA 3KP0E 4PT5A 4M0DA 2FOIC 4DV7M 2RKOA 2KEBA 3PFIA 4CGYB 1NNJA 3U5ZA 3D8LA 5ITUA 1X37A 2LXEA 3PNYA 1KSFX 1IN5A 1QAOA 4LF5M 3ZCBB 2CEAA 4AG6A 1Q3CA 3J2PB 3GLHB 1QAMA 2BJVA 3LQRA 3GO8A 3DA1A 1QQWA 3M6AA 4DV1M 1MU5A 3BOSA 1PJJA 3KS4A 3VLFB 2EO2A 3AJIB 1NHWC 4G4OA 3K92A 4AKHA 1TH4A 4BLCA 1TDZA 5ITQA 4MGIE 4IBJA 1WXQA 4GKKM 2A5YB 3GLIA 1NVMA 4DV6M 4JI7M 4LG2A 3W0FA 1OJLA 1NY6A 3FUXA 3U6SA 3T38A 4FCTA 1HQCA 1XWIA 2KW0A 4NRWA 2D7EA 3L28A 4BB9A 5JI2E 4BBAA 2DHRA 5IWAM 1QVRA 4AKIA 3AOEA 1IY1A 1HR0M 4P16A 4EIWA 2XEPA 1DO2A 3FUUA 3L27A 4REZA 5BPVA 4FWDA 4LY6A 1L8QA 4QHTA 4LGYA 3DZDA 3QWLA 2EA0A 2V1CA 4YHHM 2KRKA 4II7A 2I7PA 4NXNM 4GC5A 2UXCM 5FTKA 2EUCA 1GKIA 3I4YA 4NSRA 2YR0A 1VDDA 1ZQ9A 3KOZE 4M9SA 1XXHB 2DWZB 2RGOA 4CHTB 1NNUC 3HHXA 1MX0A 5FTLA 2K47A 4K0KM 3L2AA 3SYKA 4PD2A 4DV0M 4G6ZA 5EXPA 3JR5A 4B7FA 4WW0A 1TH2A 1Q39A 4I8OA 5C18A 2G5GX 2R4EA 4PDIA 1D2NA 5GKNA 3I51A 3FUWA 3CF2A 1HNZM 4LF6M 1KFVA 4PDGA 1TH3A 1W5SA 4LRTA 4XGIA 3T1HM 1N77A 4B3TM 2X8AA 3GPPA 4R7GA 4DR5M 2Z7JA 5EXTA 1IBKM 3WHKA 2UUBM 1QZMA 2W82A 4LZZA 4LJ9A 8CATA 3C58A 4B3MM 2R4JA 1N32M 4S12A 3GLGA 2F5PA 2NQ8C 5BR8M 2UU9M 4TUWA 3L25A 1R2YA 1N36M 4RF0A 4B3SM 4GITA 3U60A 1C1KA 1IXRC 2CUZA 2ZAOA 2ERCA 5KPTA 1DGBA 4I81A 3GLFA 4LF4M 3TQSA 2HKJA 1L2DA 2DWNA 3VKHA 5ITRA 3MHVC 2F5NA 5EP1A 1DGFA 4JI1M 2F5OA 2XFSA 1G4AE 4PCZA 4JI8M 2C9CA 3E4RA 5DYIA 3RGSA 4JI6M 4JXJA 1I4WA 3T1YM 1XNRM 2VIIA 4X62M 1J7KA 1YE9A 2C96A 3FD9A 1GL7A 4OW0A 3GQ4A 1TGUA 3VK8A 4KLNA 1OFHA 2L7HA 3HKPA 4LF8M 3VK7A 2D7GA 4HL4A 1DGHA 1NSFA 2OQ4A 4DUZM 3K2LA 4GKJM 1SXJE 2J7NA 4B08A 3GP1A 1K3XA 1DO0A 4LZJA 5ITXE 1IY2A 3FYCA 4L15A 4JI0M 2HL7A 1W5TA 3SHGB 4XBOA 3GQ3A 2LH0A 5LMUM 4LJ5A 4LF9M 1J09A 4FD2A 4KODA 3J81S 3Q8XA 4FW9A 4IBKA 4LFAM 3HU1A 3KVWA 2R65A 4OX9M 4B3RM 3DFZA 2DZNB 4R3DA 2G8LA 1IM2A 1QANA 1Z5BA 3D8BA 3TL4X 4LRSA 4DR3M 2QBYA 2P5TA 1Q3BA 4MGKE 2ZBKB 4HLQA 2UXBM 1IN7A 3U61A 3U6MA 5KQ8A 3GPUA 1HNXM 2KXEA 3AL0C 3ZH9B 4JI5M 1G59A 1R7RA 1J5EM 1IBMM 3M0EA 4GRIA 4KO8A 3U6LA 4AW4A 3GQ5A 5KQDA 2Y20A 3GRYA 3KSJA 1IN4A 3U6CA 5IZ7D 4MM3B 2XGNA 1OFIA 3I4VA 4DR4M 3VDUA 4NL4H 3RGPA 1FNNA 1XHBA 2F5SA 4L78A 3GLGB 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V M;  4B3T M;  5ITT A;  3GPP A;  4JI3 M;  4DR5 M;  4ITQ A;  2ZM6 M;  5ITX A;  2UUA M;  1IBK M;  1IBL M;  1HNW M;  3SAR A;  4DV7 M;  2UUB M;  2F5Q A;  5LMN M;  1NNJ A;  4CIS A;  1N33 M;  4B3M M;  3C58 A;  5ITU A;  1L1T A;  4JV5 M;  1XMQ M;  1N32 M;  2F5P A;  3U6E A;  5BR8 M;  2XZU A;  2UU9 M;  1PM5 A;  1R2Y A;  1N36 M;  4G4Q A;  1XNQ M;  4B3S M;  4LF5 M;  4DR1 M;  4DV4 M;  1K82 A;  1Q3C A;  3SBJ A;  3U6P A;  4LF4 M;  4DR6 M;  2HKJ A;  1XMO M;  1L2D A;  5ITR A;  3GO8 A;  2F5N A;  3SAW A;  4KHP M;  4DV1 M;  1MU5 A;  4JI1 M;  1PJJ A;  2F5O A;  3A46 A;  1PJI A;  5A2Q S;  4G4O A;  4PCZ A;  4JI8 M;  1TDZ A;  3JR4 A;  5ITQ A;  1R2Z A;  4JI6 M;  4DUY M;  3SAU A;  3T1Y M;  4GKK M;  1XNR M;  4X62 M;  4G4R A;  4DV6 M;  4JI7 M;  3W0F A;  1EE8 A;  3JAM S;  3GQ4 A;  4X64 M;  4JYA M;  3U6S A;  3VK8 A;  4LF8 M;  4DR2 M;  3VK7 A;  3TWK A;  4LFC M;  4DV3 M;  3OTO M;  4DUZ M;  2OQ4 A;  5FLX S;  3U6O A;  4GKJ M;  1I94 M;  4DR7 M;  3GP1 A;  5IT9 S;  1K3X A;  1L2B A;  5ITX E;  4JI0 M;  2HHH M;  3J7A S;  1L2C A;  3GQ3 A;  5IWA M;  5LMU M;  2XZF A;  4LF9 M;  1HR0 M;  3SAT A;  4AQY M;  4B3R M;  3J81 S;  2UUC M;  1N34 M;  4LFA M;  2VQE M;  4JI2 M;  4OX9 M;  2OPF A;  4MB7 A;  3GPX A;  4DV5 M;  4LFB M;  3A45 A;  1Z5B A;  1XC8 A;  4DR3 M;  5ITY A;  4JI4 M;  4NRV A;  1Q3B A;  2ZBK B;  2EA0 A;  3A42 A;  2UXB M;  4YHH M;  3U6M A;  4NXM M;  3GPU A;  3GPY A;  2E5L M;  4NXN M;  2UXC M;  1HNX M;  3J80 S;  3DOA A;  1K3W A;  4JI5 M;  3TWM A;  1J5E M;  1MX0 A;  1IBM M;  4K0K M;  1FJG M;  4DV0 M;  4PD2 A;  4DV2 M;  4X65 M;  4X66 M;  3JR5 A;  3U6L A;  3GQ5 A;  1Q39 A;  4YY3 M;  1Z5C A;  1Z59 A;  3U6C A;  3U6D A;  3U6Q A;  4LF7 M;  4PDI A;  4DR4 M;  2VQF M;  1L1Z A;  1HNZ M;  2UXD M;  4LF6 M;  1KFV A;  2F5S A;  3SAS A;  4PDG A;  3TWL A;  4NRW A;  4G4N A;  1Z5A A;  1TDH A;  3T1H M;  2Q2E B;  3SAV A; 
#chains in the Genus database with same CATH topology
 2F4V M;  2DAM A;  3R8F A;  2CE7 A;  4JI3 M;  1IXS B;  4ITQ A;  1G8P A;  3HGI A;  1MJG M;  2LHC A;  3KOY E;  1IBL M;  1QYR A;  4AI6 A;  1T3T A;  3AFH A;  4QNR A;  1PGY A;  3GLF B;  4GMQ A;  2KRU A;  2F5Q A;  2OOA A;  1QUT A;  5LMN M;  2DWM A;  1N33 M;  1SXJ B;  3V76 A;  3FUV A;  4JV5 M;  2Y0T A;  3GLH A;  3U6E A;  5DYG A;  1E9R A;  4GIP A;  1Y8G A;  4G4Q A;  3KSX A;  1C7Y A;  1WIV A;  3VKG A;  5KPR A;  2V1U A;  2EKK A;  2MRO B;  3U5Z B;  1E32 A;  1DGG A;  2LVA A;  4W5W A;  1D0K A;  1YSY A;  2MR9 A;  4M0W A;  1ZV1 A;  2DI0 A;  3RFW A;  3SBJ A;  3W0L B;  3K8Z A;  3T15 A;  4DR6 M;  2ZAN A;  1VEK A;  2Z4R A;  3RE8 A;  2C5R A;  1XMO M;  4QOZ C;  2L4F A;  4D82 A;  1PJT A;  4LJA A;  1ZAE A;  1DGH B;  3A46 A;  1PJI A;  3FTC A;  1JR3 D;  3IG5 A;  3NBI A;  1NJF A;  4MGY E;  2WSF F;  3E21 A;  3FTD A;  2CV1 A;  3JR4 A;  1N75 A;  1UM8 A;  4IBB A;  1R2Z A;  2AHM A;  3AKZ A;  1QDR A;  5FTJ A;  3SAU A;  2O5R A;  2D7H A;  5KPZ A;  3HHW A;  1G41 A;  1OQY A;  4FCW A;  2Z3X A;  4X64 M;  4JYA M;  2JXN A;  1HT1 E;  1NV9 A;  4LJ4 A;  3SFZ A;  1SG9 A;  4LFC M;  2JY5 A;  2QEN A;  3B89 A;  3CGW A;  4DV3 M;  2CRU A;  5FLX S;  4AG5 A;  1H6U A;  2DAG A;  2V6Z M;  2Y21 A;  3LVV A;  2QBY B;  4QHS A;  3LVW A;  3GLI B;  2C98 A;  2QSF X;  1L2B A;  2HHH M;  3J7A S;  2ZAM A;  1L2C A;  1BVS A;  3U61 B;  5EXX A;  2XZF A;  3B7Z A;  3CF6 E;  3L26 A;  4AQY M;  2M60 A;  1GLN A;  3HJ8 A;  1JR3 A;  3K1J A;  4IBE A;  4IBD A;  2UUC M;  1OAO C;  2FH0 A;  1E94 E;  4LCB A;  1TTE A;  2L7I A;  1VDL A;  4B7G A;  2J7O A;  1QAQ A;  4LJ7 A;  7CAT A;  3GLG E;  2CV0 A;  4JI2 M;  3B74 A;  3KS8 A;  5DNY A;  3GPX A;  2JNH A;  1SXJ C;  2K9D A;  3A45 A;  1XC8 A;  1YLA A;  4L4U A;  4NRV A;  1AUA A;  1EIJ A;  3QYB A;  2H1R A;  3TE6 A;  1ZMU A;  2KNV A;  2BNK A;  3LCU A;  1QDT A;  4RF1 A;  4NXM M;  3GLF E;  2R18 A;  3GPY A;  4MGH A;  1NHG C;  2Z4S A;  3J80 S;  3SMS A;  1ORY B;  3PXG A;  3DOA A;  2VF8 A;  4I4L A;  2CFO A;  1G71 A;  4IBC A;  1K3W A;  1OAI A;  5EP4 A;  3UZU A;  2LVN C;  3TWM A;  4NSO B;  4IJF A;  2WSE F;  2ZTC A;  5JI3 E;  4D81 A;  4DV2 M;  2CV2 A;  2DKL A;  1PRB A;  2MH8 A;  4QOS A;  5KO3 A;  4GC9 A;  5FTN A;  4IBI A;  1E9S A;  3U6D A;  3HX3 A;  2DVW B;  3IEC A;  4JN6 A;  3LMM A;  5F3W A;  3FYD A;  2BWB A;  2VQF M;  1R6B X;  2CHG A;  2Z8Y M;  1OKS A;  4L16 A;  4F2L A;  3PNV A;  3W67 A;  1L1Z A;  3MK6 A;  2YNM D;  2H5X A;  2XF3 A;  3W68 A;  2QZ4 A;  1IN6 A;  4AZF A;  2R62 A;  2XH9 A;  2RGH A;  2JA2 A;  5ITT A;  4WUR A;  2KZU A;  3SMP A;  3NBX X;  4OU7 A;  4XK8 F;  2XLJ A;  2MJ5 B;  2OOB A;  2X49 A;  4MGZ E;  4IBF A;  3KFU G;  1LTM A;  3T6P A;  3C9P A;  3SAR A;  5EP3 A;  1Z6T A;  3L29 A;  4AKG A;  4GH9 A;  4CIS A;  4L8R C;  3UGJ A;  3AV0 A;  1JQJ C;  2EKF A;  3B9P A;  3HJQ A;  2JUJ A;  3FTE A;  1EFU B;  4OVZ A;  1XMQ M;  1L1T A;  3TPZ A;  3J7B A;  2DXI A;  2L4E A;  3KP1 E;  2HAK A;  1LV7 A;  4MH0 E;  2XZU A;  1PM5 A;  4Z6Y A;  4QNM A;  3KOX E;  1XNQ M;  3KDS E;  2WSC F;  5H37 D;  3EIE A;  3FKE A;  4IBG A;  5IRE B;  4DR1 M;  4DV4 M;  3I04 M;  2XFT A;  1K82 A;  3SYL A;  3R9X B;  2CWB A;  3AOE C;  1ZMV A;  1IQP A;  3U6P A;  2CHQ A;  3HU3 A;  1GJS A;  3FUT A;  3U60 B;  2QCU A;  3GRU A;  3IG8 A;  5EJC A;  3THG A;  4D80 A;  3SAW A;  4KHP M;  2LWX A;  2XSZ D;  3BBZ A;  3F92 A;  2KA6 B;  2FE8 A;  2G3Q A;  2GNO A;  2LHG A;  5A2Q S;  2DZL A;  3CF0 A;  1DV0 A;  3WHL A;  3HWS A;  1YUB A;  5C1B A;  2L6O A;  1G3I A;  4RKU F;  3AOG A;  4DUY M;  1WGL A;  1NO1 A;  4RNA A;  4G4R A;  5E6J A;  2Y0Q A;  4M9Z A;  3B7Q A;  1EE8 A;  3JAM S;  4IIW A;  3CTW B;  2X4A A;  3GRR A;  3UK6 A;  4GHL A;  4DR2 M;  3TWK A;  4Q7J A;  2FS1 A;  2MGW A;  2ZTD A;  2R0I A;  4I5S A;  3QAU A;  3OTO M;  1V34 A;  3U6O A;  1I94 M;  4DR7 M;  3A98 B;  5IT9 S;  1S3S A;  1HT2 E;  3LQQ A;  1VEG A;  4FVM A;  4CJ6 A;  1KYI A;  2R45 A;  2DZO B;  4GHA A;  3NWL A;  2FFJ A;  2I7N A;  4FCV A;  2XSZ A;  1NJG A;  3SAT A;  2VDB B;  1MN3 A;  3VDP A;  1QUS A;  4B7H A;  3E9S A;  4NOO B;  3SHF A;  3VFD A;  1N34 M;  2VQE M;  3GLH E;  2CHV A;  2OPF A;  2KZS A;  2DHY A;  3FRI A;  4MB7 A;  4A3V B;  1F4I A;  4DV5 M;  4LFB M;  5EQT A;  5ITY A;  5FTM A;  4JI4 M;  2HCB A;  2C9O A;  3A42 A;  1GVN A;  5E26 A;  1TR8 A;  1SXJ D;  1IXZ A;  2B3T A;  2QP9 X;  1IY0 A;  3H4M A;  3MMP A;  3QYE A;  2E5L M;  2LVP C;  2LVO C;  2KNA A;  2M5Z A;  1T6O A;  4LJ6 A;  2BJW A;  3EIH A;  3HHZ A;  3KW6 A;  4M9X A;  2DWL A;  2R46 A;  3KXE C;  4ZPX A;  3H4J A;  4LJ8 A;  1FJG M;  1GAB A;  2L09 A;  4Z8X A;  4X66 M;  5FSW A;  2FNA A;  1GL6 A;  4FWH A;  4X65 M;  2LNH C;  3HJS A;  3J27 B;  2QHO B;  1OIZ A;  4KT0 F;  1Z5C A;  4YY3 M;  3HU2 A;  1Z59 A;  3ZC7 B;  3UJN A;  3UMM A;  3M7G A;  3U6Q A;  1WGN A;  2JZ1 A;  4LF7 M;  4LGM A;  1WHC A;  4FWG A;  4IJE A;  3FTF A;  2VF7 A;  1RU3 A;  1UFZ A;  3KOW E;  2C99 A;  1HQY E;  5EXS A;  2UXD M;  1N78 A;  2QPA A;  2DAK A;  3PVS A;  3FRH A;  1NY5 A;  1XXH A;  2YQZ A;  3I01 M;  1Z5A A;  1V92 A;  4OVZ B;  1TDH A;  3TWL A;  4G4N A;  3SC3 A;  2YFQ A;  1PJS A;  1HJP A;  3HHY A;  5EP2 A;  3SAV A;  1T43 A;  3GRV A;  1SXJ A;  3MJ5 A;  2ZM6 M;  1IN8 A;  5ITX A;  2UUA M;  1OTR A;  1HNW M;  3ILK A;  3KP0 E;  4PT5 A;  4M0D A;  2FOI C;  4DV7 M;  2O01 F;  2RKO A;  2KEB A;  1JR3 E;  3PFI A;  4CGY B;  1NNJ A;  3U5Z A;  3D8L A;  5ITU A;  1X37 A;  4F1I A;  2LXE A;  3PNY A;  4WP2 A;  1KSF X;  1IN5 A;  1QAO A;  4LF5 M;  3ZCB B;  3B7N A;  2CEA A;  4AG6 A;  1Q3C A;  3J2P B;  3ZQJ A;  3GLH B;  1QAM A;  2BJV A;  3LQR A;  2KHH A;  4R71 A;  2KDL A;  3GO8 A;  3DA1 A;  3Q8G A;  1QQW A;  3M6A A;  4DV1 M;  1MU5 A;  3BOS A;  1PJJ A;  3KS4 A;  3VLF B;  2EO2 A;  3AJI B;  1NHW C;  4G4O A;  3K92 A;  4AKH A;  1TH4 A;  2JWS A;  4L6V 6;  4BLC A;  1TDZ A;  5ITQ A;  4MGI E;  3SAS A;  2QNJ A;  4IBJ A;  1WXQ A;  4GKK M;  2A5Y B;  3GLI A;  1NVM A;  2K0B X;  4DV6 M;  4JI7 M;  3W0F A;  1OJL A;  4NC6 A;  4LG2 A;  1NY6 A;  3FUX A;  2JY6 B;  3U6S A;  3T38 A;  4FCT A;  1HQC A;  2R6F A;  1XWI A;  2KW0 A;  2DAI A;  4NRW A;  2D7E A;  3L28 A;  4BB9 A;  2CP8 A;  5JI2 E;  2JY7 A;  4BBA A;  2DHR A;  3HZJ A;  1Q02 A;  5IWA M;  1QVR A;  4AKI A;  3AOE A;  1AIP C;  1IY1 A;  1HR0 M;  1GO5 A;  1WJ7 A;  4P16 A;  1R4G A;  4EIW A;  2XEP A;  2R44 A;  1DO2 A;  3FUU A;  3C3E A;  3L27 A;  4REZ A;  5BPV A;  2HWJ A;  4FWD A;  1D0M A;  4LY6 A;  2DAE A;  1L8Q A;  2WZJ A;  4QHT A;  4LGY A;  2L2D A;  1VEJ A;  3DZD A;  3QWL A;  2EA0 A;  1VG5 A;  2APL A;  1A5T A;  1PJQ A;  2V1C A;  4YHH M;  2KRK A;  4II7 A;  2I7P A;  4NXN M;  4GC5 A;  2UXC M;  1OIP A;  2EUC A;  5FTK A;  1GKI A;  3I4Y A;  4NSR A;  2YR0 A;  1VDD A;  1ZQ9 A;  3KOZ E;  4M9S A;  1XXH B;  2DWZ B;  2OO9 A;  2RGO A;  1NNU C;  4CHT B;  3HHX A;  2KNZ A;  1MX0 A;  5FTL A;  2K47 A;  4K0K M;  3L2A A;  3SYK A;  4PD2 A;  4DV0 M;  4G6Z A;  3E46 A;  5EXP A;  3JR5 A;  4B7F A;  1GJT A;  4WW0 A;  1TH2 A;  1Q39 A;  2JY8 A;  4I8O A;  2K6B A;  1TF0 B;  3LCV B;  2G5G X;  5C18 A;  1XB2 B;  2R4E A;  4PDI A;  1D2N A;  5GKN A;  3I51 A;  3FUW A;  3IHP A;  4P17 A;  1D0L A;  3CF2 A;  1HNZ M;  4LF6 M;  1KFV A;  1ZMW A;  1NV8 A;  4PDG A;  1TH3 A;  1W5S A;  4LRT A;  4XGI A;  3T1H M;  1N77 A;  4B3T M;  4ANR A;  2X8A A;  3GPP A;  4R7G A;  1IFY A;  4DR5 M;  2Z7J A;  2JP7 A;  2QQ8 A;  2LVQ D;  5EXT A;  1IBK M;  3WHK A;  2UUB M;  1QZM A;  4Y28 F;  2BWE A;  2W82 A;  4LZZ A;  4LJ9 A;  8CAT A;  3C58 A;  4B3M M;  2RRU A;  2R4J A;  1N32 M;  4S12 A;  3GLG A;  2F5P A;  2NQ8 C;  5BR8 M;  2UU9 M;  4TUW A;  3L25 A;  1R2Y A;  1N36 M;  4RF0 A;  4UN2 B;  4B3S M;  4GIT A;  3U60 A;  1C1K A;  1IXS A;  1IXR C;  1WR1 B;  2CUZ A;  2ZAO A;  3BXW A;  2ERC A;  2O25 A;  5KPT A;  1DGB A;  4I81 A;  3GLF A;  4LF4 M;  3TQS A;  2HKJ A;  1L2D A;  2DWN A;  3VKH A;  5DFL A;  5ITR A;  5L8R F;  3MHV C;  2F5N A;  5EP1 A;  4HEO A;  4G3O A;  1DGF A;  4JI1 M;  2F5O A;  2XFS A;  3FE3 A;  4CIZ A;  1G4A E;  4PCZ A;  4JI8 M;  2C9C A;  3K9O A;  3E4R A;  5DYI A;  3RGS A;  4JI6 M;  4JXJ A;  1I4W A;  1QZE A;  3T1Y M;  2LBC A;  1XNR M;  2VII A;  4X62 M;  1J7K A;  1YE9 A;  2C96 A;  3FD9 A;  1GL7 A;  4OW0 A;  3GQ4 A;  1TGU A;  4DBG B;  1XXH E;  3VK8 A;  4KLN A;  1OFH A;  2L7H A;  3HKP A;  4GEW A;  3VK7 A;  4LF8 M;  2D7G A;  2JZ0 A;  1DGH A;  1NSF A;  4HL4 A;  2OQ4 A;  4DUZ M;  3K2L A;  4GKJ M;  1SXJ E;  2J7N A;  4B08 A;  3GP1 A;  1P3Q Q;  1K3X A;  1DO0 A;  4LZJ A;  5ITX E;  1IY2 A;  3FYC A;  4L15 A;  1VQ1 A;  2HL7 A;  4JI0 M;  1W5T A;  3SHG B;  4XBO A;  3GQ3 A;  2LH0 A;  5LMU M;  4LJ5 A;  4LF9 M;  1J09 A;  4FD2 A;  4KOD A;  3J81 S;  3Q8X A;  4FW9 A;  1JB0 F;  2N35 A;  4IBK A;  3HU1 A;  3KVW A;  4LFA M;  2R65 A;  4OX9 M;  4B3R M;  3DFZ A;  2DZN B;  4R3D A;  2G8L A;  1IM2 A;  1QAN A;  1Z5B A;  3D8B A;  3TL4 X;  4LRS A;  4DR3 M;  2QBY A;  2P5T A;  1Q3B A;  3HY5 A;  4MGK E;  2ZBK B;  4HLQ A;  2UXB M;  1IN7 A;  3U61 A;  3U6M A;  5KQ8 A;  3GPU A;  3K9P A;  1HNX M;  2KXE A;  2DEN A;  3AL0 C;  3ZH9 B;  4JI5 M;  1G59 A;  1R7R A;  1J5E M;  1IBM M;  1CUK A;  3LW5 F;  3M0E A;  4GRI A;  4KO8 A;  3U6L A;  4AW4 A;  3GQ5 A;  1R5L A;  5KQD A;  2Y20 A;  2GQF A;  3GRY A;  1IN4 A;  3KSJ A;  3U6C A;  5IZ7 D;  4MM3 B;  2XGN A;  1V33 A;  1OFI A;  2J5Y A;  3I4V A;  3GLI E;  3C3D A;  4DR4 M;  3VDU A;  2EJS A;  4NL4 H;  2LTU A;  3RGP A;  1FNN A;  1XHB A;  2DNA A;  2F5S A;  4L78 A;  3GLG B;  2Q2E B; 
#chains in the Genus database with same CATH homology
 2F4V M;  3R8F A;  2CE7 A;  4JI3 M;  1IXS B;  4ITQ A;  1G8P A;  3HGI A;  3KOY E;  1IBL M;  1QYR A;  4AI6 A;  1T3T A;  3AFH A;  4QNR A;  3GLF B;  4GMQ A;  2KRU A;  2F5Q A;  5LMN M;  2DWM A;  1N33 M;  1SXJ B;  3FUV A;  4JV5 M;  2Y0T A;  3GLH A;  3U6E A;  5DYG A;  1E9R A;  4GIP A;  4G4Q A;  3KSX A;  3VKG A;  5KPR A;  2V1U A;  3U5Z B;  1E32 A;  1DGG A;  4W5W A;  3RFW A;  1YSY A;  4M0W A;  3SBJ A;  3W0L B;  3K8Z A;  3T15 A;  4DR6 M;  2ZAN A;  2Z4R A;  3RE8 A;  2C5R A;  1XMO M;  4D82 A;  4LJA A;  1ZAE A;  1DGH B;  3A46 A;  1PJI A;  3FTC A;  1JR3 D;  3IG5 A;  3NBI A;  1NJF A;  4MGY E;  3FTD A;  2CV1 A;  3JR4 A;  1N75 A;  1UM8 A;  4IBB A;  1R2Z A;  2AHM A;  3AKZ A;  5FTJ A;  3SAU A;  2O5R A;  2D7H A;  5KPZ A;  3HHW A;  1G41 A;  4FCW A;  2Z3X A;  4X64 M;  4JYA M;  1HT1 E;  4LJ4 A;  3SFZ A;  4LFC M;  4QOZ C;  2QEN A;  4DV3 M;  5FLX S;  4AG5 A;  1H6U A;  2V6Z M;  2Y21 A;  3LVV A;  2QBY B;  4QHS A;  3LVW A;  3GLI B;  2C98 A;  1L2B A;  2HHH M;  3J7A S;  2ZAM A;  1L2C A;  3U61 B;  5EXX A;  2XZF A;  3CF6 E;  3L26 A;  4AQY M;  2M60 A;  1GLN A;  3HJ8 A;  1JR3 A;  3K1J A;  4IBE A;  4IBD A;  2UUC M;  1E94 E;  4LCB A;  2L7I A;  4B7G A;  7CAT A;  2J7O A;  1QAQ A;  4LJ7 A;  4JI2 M;  2CV0 A;  3KS8 A;  5DNY A;  3GPX A;  3A45 A;  1SXJ C;  1XC8 A;  4NRV A;  4L4U A;  2H1R A;  3TE6 A;  2BNK A;  4RF1 A;  4NXM M;  2R18 A;  3GPY A;  4MGH A;  1NHG C;  2Z4S A;  3J80 S;  3SMS A;  1ORY B;  3PXG A;  3DOA A;  4I4L A;  2CFO A;  4IBC A;  1K3W A;  5EP4 A;  3UZU A;  3TWM A;  4NSO B;  4IJF A;  5JI3 E;  4DV2 M;  4D81 A;  2CV2 A;  5KO3 A;  4QOS A;  4GC9 A;  5FTN A;  4IBI A;  1E9S A;  3U6D A;  2DVW B;  4JN6 A;  3LMM A;  5F3W A;  3FYD A;  2VQF M;  1R6B X;  2CHG A;  4L16 A;  1L1Z A;  3PNV A;  3MK6 A;  2YNM D;  2XF3 A;  2QZ4 A;  1IN6 A;  4AZF A;  2R62 A;  2XH9 A;  2RGH A;  2JA2 A;  5ITT A;  4WUR A;  2KZU A;  3SMP A;  4OU7 A;  2XLJ A;  2X49 A;  4MGZ E;  4IBF A;  3KFU G;  3SAR A;  5EP3 A;  1Z6T A;  3L29 A;  4AKG A;  4GH9 A;  4CIS A;  4L8R C;  3UGJ A;  3AV0 A;  1JQJ C;  3HJQ A;  3B9P A;  3FTE A;  1L1T A;  4OVZ A;  1XMQ M;  3TPZ A;  3J7B A;  2DXI A;  3KP1 E;  4MH0 E;  1LV7 A;  2XZU A;  1PM5 A;  4Z6Y A;  4QNM A;  3KOX E;  1XNQ M;  3KDS E;  5H37 D;  3EIE A;  3FKE A;  4IBG A;  5IRE B;  4DR1 M;  4DV4 M;  2XFT A;  1K82 A;  3SYL A;  3R9X B;  3AOE C;  1IQP A;  3U6P A;  2CHQ A;  3HU3 A;  3FUT A;  3U60 B;  2QCU A;  3GRU A;  3IG8 A;  5EJC A;  3THG A;  4D80 A;  3SAW A;  4KHP M;  2LWX A;  2XSZ D;  2KA6 B;  2FE8 A;  5A2Q S;  3CF0 A;  3WHL A;  3HWS A;  1YUB A;  5C1B A;  2L6O A;  1G3I A;  3AOG A;  4DUY M;  4RNA A;  4G4R A;  5E6J A;  2Y0Q A;  4M9Z A;  1EE8 A;  3JAM S;  4IIW A;  3CTW B;  2X4A A;  3GRR A;  3UK6 A;  4GHL A;  4DR2 M;  3TWK A;  4I5S A;  3OTO M;  3QAU A;  3U6O A;  1I94 M;  4DR7 M;  3A98 B;  5IT9 S;  1S3S A;  1HT2 E;  3LQQ A;  4FVM A;  1KYI A;  2R45 A;  2DZO B;  4GHA A;  3NWL A;  2FFJ A;  2I7N A;  4FCV A;  2XSZ A;  1NJG A;  3SAT A;  3VDP A;  4B7H A;  1N34 M;  3E9S A;  4NOO B;  3SHF A;  3VFD A;  2VQE M;  2CHV A;  2OPF A;  2KZS A;  4MB7 A;  4A3V B;  4DV5 M;  4LFB M;  5EQT A;  5ITY A;  5FTM A;  4JI4 M;  2HCB A;  2C9O A;  3A42 A;  1GVN A;  5E26 A;  1SXJ D;  1IXZ A;  2QP9 X;  3H4M A;  1IY0 A;  2E5L M;  2M5Z A;  4LJ6 A;  2BJW A;  3EIH A;  3HHZ A;  3KW6 A;  4M9X A;  2DWL A;  2R46 A;  3KXE C;  4ZPX A;  1FJG M;  4LJ8 A;  2L09 A;  4Z8X A;  4X66 M;  5FSW A;  2FNA A;  1GL6 A;  4FWH A;  4X65 M;  2LNH C;  3HJS A;  3J27 B;  4YY3 M;  1Z5C A;  3HU2 A;  1Z59 A;  3ZC7 B;  3UJN A;  3UMM A;  3M7G A;  3U6Q A;  4LF7 M;  4LGM A;  4FWG A;  4IJE A;  3FTF A;  3KOW E;  2C99 A;  1HQY E;  5EXS A;  2UXD M;  1N78 A;  2QPA A;  3PVS A;  3SAS A;  1NY5 A;  1XXH A;  2YQZ A;  4OVZ B;  1Z5A A;  3TWL A;  4G4N A;  1TDH A;  3SC3 A;  2YFQ A;  3SAV A;  3HHY A;  5EP2 A;  3GRV A;  1SXJ A;  3MJ5 A;  2ZM6 M;  1IN8 A;  5ITX A;  2UUA M;  1HNW M;  3ILK A;  3KP0 E;  4PT5 A;  4M0D A;  2FOI C;  4DV7 M;  2RKO A;  2KEB A;  3PFI A;  4CGY B;  1NNJ A;  3U5Z A;  3D8L A;  5ITU A;  1X37 A;  2LXE A;  3PNY A;  1KSF X;  1IN5 A;  1QAO A;  4LF5 M;  3ZCB B;  2CEA A;  4AG6 A;  1Q3C A;  3J2P B;  3GLH B;  1QAM A;  2BJV A;  3LQR A;  3GO8 A;  3DA1 A;  1QQW A;  3M6A A;  4DV1 M;  1MU5 A;  3BOS A;  1PJJ A;  3KS4 A;  3VLF B;  2EO2 A;  3AJI B;  1NHW C;  4G4O A;  3K92 A;  4AKH A;  1TH4 A;  4BLC A;  1TDZ A;  5ITQ A;  4MGI E;  4IBJ A;  1WXQ A;  4GKK M;  2A5Y B;  3GLI A;  1NVM A;  4DV6 M;  4JI7 M;  4LG2 A;  3W0F A;  1OJL A;  1NY6 A;  3FUX A;  3U6S A;  3T38 A;  4FCT A;  1HQC A;  1XWI A;  2KW0 A;  4NRW A;  2D7E A;  3L28 A;  4BB9 A;  5JI2 E;  4BBA A;  2DHR A;  5IWA M;  1QVR A;  4AKI A;  3AOE A;  1IY1 A;  1HR0 M;  4P16 A;  4EIW A;  2XEP A;  1DO2 A;  3FUU A;  3L27 A;  4REZ A;  5BPV A;  4FWD A;  4LY6 A;  1L8Q A;  4QHT A;  4LGY A;  3DZD A;  3QWL A;  2EA0 A;  2V1C A;  4YHH M;  2KRK A;  4II7 A;  2I7P A;  4NXN M;  4GC5 A;  2UXC M;  5FTK A;  2EUC A;  1GKI A;  3I4Y A;  4NSR A;  2YR0 A;  1VDD A;  1ZQ9 A;  3KOZ E;  4M9S A;  1XXH B;  2DWZ B;  2RGO A;  4CHT B;  1NNU C;  3HHX A;  1MX0 A;  5FTL A;  2K47 A;  4K0K M;  3L2A A;  3SYK A;  4PD2 A;  4DV0 M;  4G6Z A;  5EXP A;  3JR5 A;  4B7F A;  4WW0 A;  1TH2 A;  1Q39 A;  4I8O A;  5C18 A;  2G5G X;  2R4E A;  4PDI A;  1D2N A;  5GKN A;  3I51 A;  3FUW A;  3CF2 A;  1HNZ M;  4LF6 M;  1KFV A;  4PDG A;  1TH3 A;  1W5S A;  4LRT A;  4XGI A;  3T1H M;  1N77 A;  4B3T M;  2X8A A;  3GPP A;  4R7G A;  4DR5 M;  2Z7J A;  5EXT A;  1IBK M;  3WHK A;  2UUB M;  1QZM A;  2W82 A;  4LZZ A;  4LJ9 A;  8CAT A;  3C58 A;  4B3M M;  2R4J A;  1N32 M;  4S12 A;  3GLG A;  2F5P A;  2NQ8 C;  5BR8 M;  2UU9 M;  4TUW A;  3L25 A;  1R2Y A;  1N36 M;  4RF0 A;  4B3S M;  4GIT A;  3U60 A;  1C1K A;  1IXR C;  2CUZ A;  2ZAO A;  2ERC A;  5KPT A;  1DGB A;  4I81 A;  3GLF A;  4LF4 M;  3TQS A;  2HKJ A;  1L2D A;  2DWN A;  3VKH A;  5ITR A;  3MHV C;  2F5N A;  5EP1 A;  1DGF A;  4JI1 M;  2F5O A;  2XFS A;  1G4A E;  4PCZ A;  4JI8 M;  2C9C A;  3E4R A;  5DYI A;  3RGS A;  4JI6 M;  4JXJ A;  1I4W A;  3T1Y M;  1XNR M;  2VII A;  4X62 M;  1J7K A;  1YE9 A;  2C96 A;  3FD9 A;  1GL7 A;  4OW0 A;  3GQ4 A;  1TGU A;  3VK8 A;  4KLN A;  1OFH A;  2L7H A;  3HKP A;  4LF8 M;  3VK7 A;  2D7G A;  4HL4 A;  1DGH A;  1NSF A;  2OQ4 A;  4DUZ M;  3K2L A;  4GKJ M;  1SXJ E;  2J7N A;  4B08 A;  3GP1 A;  1K3X A;  1DO0 A;  4LZJ A;  5ITX E;  1IY2 A;  3FYC A;  4L15 A;  4JI0 M;  2HL7 A;  1W5T A;  3SHG B;  4XBO A;  3GQ3 A;  2LH0 A;  5LMU M;  4LJ5 A;  4LF9 M;  1J09 A;  4FD2 A;  4KOD A;  3J81 S;  3Q8X A;  4FW9 A;  4IBK A;  4LFA M;  3HU1 A;  3KVW A;  2R65 A;  4OX9 M;  4B3R M;  3DFZ A;  2DZN B;  4R3D A;  2G8L A;  1IM2 A;  1QAN A;  1Z5B A;  3D8B A;  3TL4 X;  4LRS A;  4DR3 M;  2QBY A;  2P5T A;  1Q3B A;  4MGK E;  2ZBK B;  4HLQ A;  2UXB M;  1IN7 A;  3U61 A;  3U6M A;  5KQ8 A;  3GPU A;  1HNX M;  2KXE A;  3AL0 C;  3ZH9 B;  4JI5 M;  1G59 A;  1R7R A;  1J5E M;  1IBM M;  3M0E A;  4GRI A;  4KO8 A;  3U6L A;  4AW4 A;  3GQ5 A;  5KQD A;  2Y20 A;  3GRY A;  3KSJ A;  1IN4 A;  3U6C A;  5IZ7 D;  4MM3 B;  2XGN A;  1OFI A;  3I4V A;  4DR4 M;  3VDU A;  4NL4 H;  3RGP A;  1FNN A;  1XHB A;  2F5S A;  4L78 A;  3GLG B;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...