1IBLM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1iblM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1iblM02
1J5EM 3JR5A 1IBLM 4K0KM 2UXBM 2F5NA 1PJJA 1Z5CA 4PDGA 1N32M 3GP1A 1R2ZA 2UXCM 2HHHM 5A2QS 4LF9M 2XZUA 1Z5AA 4DV2M 5ITXE 4CISA 1Q3BA 4DV1M 1Z59A 1L1TA 3T1YM 4LF7M 4JYAM 3SARA 3GPXA 5BR8M 1HNWM 5ITUA 4X62M 3DOAA 4JI5M 4G4NA 4X66M 1L2CA 1IBKM 3SBJA 1K82A 2OQ4A 4MB7A 3U6EA 1XC8A 2F5SA 4JV5M 1NNJA 2F5OA 4JI3M 4YY3M 4DV7M 3U6CA 4B3MM 4JI0M 1Q3CA 2VQFM 4X65M 1XNQM 2UUCM 4LF4M 1R2YA 1KFVA 1I94M 1L1ZA 4YHHM 2HKJA 3GPYA 3GQ3A 5ITRA 4LFCM 4LF5M 4NXMM 2ZBKB 4JI4M 1Z5BA 4DR4M 3J7AS 4DR6M 4DV4M 3TWMA 3SAVA 3JR4A 5LMUM 1K3WA 4PCZA 3U6PA 1K3XA 4LF8M 4JI2M 1N34M 1N36M 2UUBM 1TDZA 4JI8M 4LF6M 1IBMM 3J80S 5FLXS 4LFAM 3W0FA 4DV0M 4DUYM 1HNXM 3GQ4A 4PDIA 1FJGM 4ITQA 4DR5M 3A46A 1HR0M 3U6SA 1TDHA 1HNZM 2UXDM 3U6MA 4B3TM 4DR1M 1MU5A 4DR2M 1XNRM 4DUZM 4NXNM 3VK8A 1L2BA 4B3RM 2F4VM 1MX0A 2F5PA 1N33M 3U6LA 3U6QA 4NRWA 5LMNM 1Q39A 4NRVA 1L2DA 3J81S 4LFBM 2F5QA 3TWLA 2EA0A 4GKJM 3A42A 4PD2A 3OTOM 3VK7A 4B3SM 3U6OA 4JI6M 4JI1M 3U6DA 2OPFA 5ITXA 5ITQA 4DV3M 2UU9M 5IT9S 5ITYA 3GPPA 3SAUA 4X64M 2XZFA 4DR7M 2Q2EB 3GQ5A 3TWKA 4DR3M 1XMOM 3GO8A 2VQEM 4DV5M 3GPUA 3SATA 2E5LM 4GKKM 4DV6M 3A45A 1EE8A 4G4QA 4JI7M 5ITTA 4G4OA 2UUAM 1PJIA 3SAWA 3SASA 4OX9M 1PM5A 1XMQM 3JAMS 4AQYM 4G4RA 4KHPM 3T1HM 3C58A 2ZM6M 5IWAM
chains in the Genus database with same CATH superfamily
5FSWA 4IBFA 4CJ6A 3I01M 4NOOB 1HT1E 2JZ0A 1N32M 2KXEA 2J7NA 1OKSA 1X37A 2UXCM 4WURA 1R6BX 1Z5AA 2QQ8A 1Q3BA 3I51A 3ZQJA 4LF7M 4LJ7A 2FH0A 5DFLA 3SARA 4AI6A 3GPXA 3KOZE 4IBDA 1DO0A 1NJFA 1IY1A 5BR8M 3VFDA 4P16A 2L4EA 2APLA 4I81A 4X66M 3K9OA 1QAOA 2EKKA 4B7HA 2CP8A 1YUBA 1SXJE 2CFOA 2KZSA 2XEPA 4GC9A 3LW5F 2KW0A 1N75A 3SHFA 4JV5M 3CF0A 3GLFE 4GHAA 2BJWA 2O01F 2Y20A 2LHCA 4JI3M 1C1KA 2BJVA 3FUTA 4YY3M 1L8QA 3DZDA 2KHHA 4DV7M 2DXIA 2WSFF 1QAQA 4RF0A 2R4EA 2EJSA 3HGIA 3GLGA 3GLIE 3KP0E 1SG9A 3KW6A 4HL4A 1R2YA 4FCVA 2CV1A 1I94M 4LF4M 1NNUC 4LY6A 4FWGA 1HJPA 2HKJA 4LRSA 3WHLA 3GQ3A 2EUCA 2RKOA 4RF1A 4AW4A 3K1JA 5KO3A 1R5LA 3HU1A 4LZJA 2CUZA 1Z5BA 3I04M 4LJAA 4JI4M 3J7AS 4DR6M 2L6OA 2C99A 2R62A 2KZUA 3GLHA 3TWMA 4QOSA 5EP2A 3JR4A 3R9XB 4Q7JA 3U6PA 3WHKA 1V33A 2G5GX 2Z8YM 3K2LA 3UGJA 1N36M 1TDZA 1S3SA 4OVZB 2CV2A 3PNVA 4LFAM 3FYCA 3W0FA 1IM2A 2DAEA 3KVWA 3GQ4A 1FJGM 4DR5M 3FRHA 3NBIA 2DZOB 3B9PA 1GVNA 4I8OA 1QYRA 3RE8A 2XFTA 1VEJA 3MJ5A 3M6AA 3U6SA 1HNZM 1VDDA 2CWBA 3U6MA 3FKEA 1MU5A 2DVWB 1G41A 2DWZB 1KSFX 1DV0A 4B3RM 5EQTA 1D0KA 1WXQA 1Q02A 3KP1E 4R3DA 4IIWA 4AZFA 1QAMA 1MX0A 4BB9A 3L26A 1N33M 1KYIA 3AOGA 3PVSA 5DYGA 3U6QA 2Z4SA 4NRVA 2CHVA 3HU3A 3EIHA 2DWMA 5F3WA 1WJ7A 2I7PA 3KOYE 3A42A 2LVNC 4FCTA 3OTOM 1TR8A 1XNQM 3SYKA 5JI2E 5FTKA 4JI6M 3U6DA 1EIJA 5EXPA 2H5XA 1Z6TA 4DV3M 5IZ7D 2UU9M 1G71A 3HJ8A 2LVQD 2XZFA 4DR7M 2VF7A 3FUUA 4D82A 1QUTA 1ZMWA 1W5SA 4MGIE 4DR3M 2LBCA 2VQEM 4L15A 1NJGA 1TTEA 1J09A 4IBBA 4QHTA 4B7GA 4TUWA 7CATA 1IQPA 3AFHA 4QNMA 4CGYB 2L2DA 2RGHA 2O5RA 4REZA 2JA2A 3HY5A 3KS8A 3SASA 4XK8F 1PM5A 4LGYA 1VQ1A 1XMQM 3HHYA 4M0DA 1XWIA 2YNMD 1IN7A 1SXJB 2NQ8C 4R7GA 4B3TM 3F92A 4LJ8A 2V6ZM 3JR5A 4K0KM 3CF2A 3FUVA 4G6ZA 2F5NA 1XHBA 1T3TA 3T15A 2QP9X 2C9CA 1PJJA 3I4YA 1JB0F 1IN4A 1XXHE 3GLIB 2R18A 3GRRA 5FTMA 5A2QS 2HHHM 1NV9A 3FTEA 4DV2M 2LNHC 3THGA 5ITXE 4JYAM 1D0MA 2CEAA 1G4AE 3VLFB 2LH0A 4M0WA 4M9XA 2XSZA 1HNWM 4X62M 2DNAA 3FTFA 2ERCA 2L09A 1DGGA 2O25A 2K9DA 3J2PB 1L2CA 3KSJA 1PGYA 2DZNB 5L8RF 3HHXA 4MB7A 1V92A 4M9ZA 1XC8A 2FOIC 2F5SA 1NNJA 4B7FA 2F5OA 3UZUA 3U5ZB 4FWHA 1NY6A 3IECA 1DGHA 1Q3CA 3EIEA 3KOWE 4BBAA 3E9SA 2CHGA 3HX3A 4XBOA 1SXJC 3BBZA 4Z8XA 1NHWC 1KFVA 2D7GA 4YHHM 4LFCM 3FE3A 1J7KA 4LF5M 4NXMM 1NVMA 3J7BA 1VG5A 2WSEF 2QCUA 1R7RA 3HHZA 4DBGB 1NV8A 2G3QA 2YQZA 3FD9A 5E6JA 1JQJC 5EP1A 3DFZA 3UMMA 2DKLA 5EP3A 1K3XA 1G59A 2WZJA 4JI8M 2UUBM 2CV0A 3KFUG 2DHYA 1IBMM 3J80S 1G3IA 4NSRA 4DV0M 4DUYM 1HNXM 1VDLA 1ZMUA 3KS4A 2MROB 5KQ8A 1HR0M 1OFHA 1ORYB 1TDHA 2LVPC 4F1IA 1EFUB 3GRYA 3LVVA 3Q8GA 3K9PA 4LGMA 4RKUF 5C18A 3AKZA 1OJLA 2ZM6M 2UXDM 2WSCF 3DA1A 4DR1M 3K8ZA 1TGUA 1XNRM 1JR3A 3IG5A 1LV7A 2F5PA 3U6LA 4NRWA 3HHWA 4KODA 2QENA 2YR0A 1L2DA 3CF6E 4LFBM 4GC5A 2F5QA 4HLQA 1ZAEA 3VKGA 4IJFA 3TWLA 3PNYA 2LVOC 4PD2A 4FD2A 3VK7A 4AG5A 2DI0A 3NBXX 4MH0E 2KNAA 3SYLA 1BVSA 5IT9S 3SAUA 3HZJA 4I5SA 1UM8A 1GL6A 2Q2EB 1IXRC 3FTDA 2V1CA 3GO8A 1XXHB 4IJEA 4AKGA 3PFIA 3TPZA 2DWLA 2OOAA 3B7ZA 2GQFA 4GMQA 3SATA 5FTJA 1SXJA 4KLNA 4G4QA 4WW0A 3GLFA 4JI7M 4G4OA 1H6UA 3AOEC 1PJIA 3ZH9B 2C96A 1GABA 3TQSA 3C3DA 2HL7A 4IBKA 2JXNA 4G4RA 1T6OA 4P17A 3C58A 1QQWA 2G8LA 3GLIA 1J5EM 2UXBM 2FFJA 1QVRA 2A5YB 8CATA 2R45A 1DO2A 2KRUA 2DHRA 1NO1A 1Z5CA 4PDGA 1E32A 4RNAA 3R8FA 3VDPA 4M9SA 3T6PA 4LF9M 4ANRA 2XZUA 3HKPA 2XF3A 2LVAA 1OAIA 1Z59A 3LQRA 2HWJA 4MGHA 1OQYA 3FRIA 5EXSA 4MGZE 3T1YM 2AHMA 4LRTA 3L29A 3U60B 3GLGB 2L7HA 1PRBA 3LMMA 4BLCA 3I4VA 1C7YA 4QNRA 2QBYB 1UFZA 5EJCA 4MGKE 3ZCBB 1QANA 3U5ZA 2DAMA 5DYIA 1IBKM 5KPZA 3QYEA 2OQ4A 1OIZA 4GRIA 3RGSA 3AL0C 3U6EA 3Q8XA 1N77A 4LJ9A 3W67A 2EO2A 3GLHB 4L4UA 2ZANA 2EKFA 2DAKA 2DAIA 2MJ5B 3T38A 1F4IA 3U6CA 1PJQA 4JI0M 3H4MA 3U61B 1GO5A 2VQFM 2JWSA 2QPAA 4JXJA 2XLJA 2KNZA 3A98B 2UUCM 1L1ZA 1QZMA 2BWBA 3K92A 2XFSA 3RGPA 2ZBKB 3B7NA 4L8RC 4IBGA 2Y0TA 4DV4M 3SAVA 1K3WA 1GJTA 3B7QA 3AOEA 4QOZC 2JP7A 1OFIA 3FTCA 4LF6M 4IBIA 1VEKA 3B89A 5FLXS 3FUWA 2B3TA 4L6V6 4UN2B 2DAGA 3GRUA 3BXWA 3L27A 3UK6A 5BPVA 4ITQA 2L4FA 4IBJA 4B08A 4G3OA 3J27B 3A46A 3L2AA 3GRVA 2XSZD 2JUJA 2YFQA 2CE7A 5E26A 2J5YA 1P3QQ 4CHTB 2J7OA 1TH2A 3KOXE 2XH9A 4NXNM 4DUZM 2OO9A 3E4RA 3VK8A 4AG6A 2C9OA 1IXSB 3E46A 3H4JA 3IG8A 2ZTCA 4OVZA 2H1RA 3GLGE 3SHGB 2LXEA 1T43A 4S12A 1GLNA 4JN6A 1D0LA 1WIVA 3QYBA 2BNKA 1NSFA 3HJSA 4GKJM 4GITA 1WGLA 4HEOA 1WR1B 1ZV1A 2CHQA 1XXHA 4B3SM 3C9PA 3ILKA 4I4LA 2Y21A 4EIWA 4FVMA 2P5TA 2KEBA 2MR9A 2N35A 3GLHE 2X8AA 2BWEA 4QHSA 5ITYA 5ITXA 1TF0B 4X64M 3VKHA 1OAOC 3MK6A 5EP4A 5DNYA 3GQ5A 2QZ4A 3TWKA 4GHLA 3LVWA 4NSOB 1XMOM 1YLAA 2D7HA 4LJ5A 2Z3XA 1TH3A 3MMPA 1OIPA 2JZ1A 1V34A 4XGIA 1E94E 4GKKM 1D2NA 1PJSA 1IN6A 2VDBB 3A45A 3E21A 3MHVC 4DV6M 1AUAA 2L7IA 3B74A 3SMPA 2RGOA 5IREB 2RRUA 3TL4X 3UJNA 2UUAM 4LCBA 3SFZA 2ZTDA 2CRUA 3V76A 4OW0A 3FUXA 5IWAM 3QWLA 1IBLM 2VIIA 4OU7A 3PXGA 2FE8A 4LG2A 3HU2A 4NC6A 2JY8A 2QNJA 1JR3D 2K0BX 2R46A 5GKNA 2JY5A 2R4JA 1A5TA 3SC3A 3BOSA 1E9RA 3ZC7B 4KO8A 3LQQA 3W68A 5KPTA 3GP1A 3U60A 1R2ZA 2QBYA 3LCVB 2LTUA 3M7GA 4CISA 2R65A 4DV1M 2LHGA 1L1TA 3HJQA 3W0LB 4NL4H 2GNOA 4D80A 1DGHB 1QUSA 3KDSE 1IN5A 5ITUA 2ZAOA 3DOAA 4JI5M 3IHPA 4IBCA 4G4NA 1ZMVA 3SBJA 2M60A 3U61A 1K82A 3L28A 3AJIB 4AKIA 2M5ZA 3LCUA 2JY6B 2OOBA 2D7EA 3M0EA 4CIZA 1SXJD 5H37D 4B3MM 2K6BA 3RFWA 5EXTA 1MJGM 1VEGA 2KRKA 4X65M 2VF8A 1YSYA 2Z7JA 1GL7A 1WHCA 2ZAMA 4FWDA 1W5TA 2W82A 3GPYA 1GJSA 1PJTA 3C3EA 3D8BA 5ITRA 5FTLA 1I4WA 3VDUA 1R4GA 1WGNA 5EXXA 4DR4M 4LZZA 4GH9A 2JY7A 5LMUM 4PCZA 1IN8A 2JNHA 5JI3E 4D81A 2FNAA 1TH4A 1N34M 4JI2M 4LF8M 3L25A 2KNVA 4LJ4A 1LTMA 3CGWA 4ZPXA 1FNNA 1OTRA 4PDIA 1IXSA 1MN3A 1HQCA 4IBEA 1IY0A 4LJ6A 2HCBA 4MGYE 1QDTA 1ZQ9A 4A3VB 4DR2M 4F2LA 3HWSA 2K47A 1L2BA 2F4VM 1HT2E 2KDLA 2C98A 2QHOB 3D8LA 1NHGC 4Y28F 2LWXA 1Q39A 5FTNA 4L78A 5LMNM 2MH8A 1GKIA 4Z6YA 3J81S 4GIPA 1IY2A 1E9SA 2EA0A 5KQDA 1RU3A 1IXZA 3KXEC 2Y0QA 1YE9A 1G8PA 3GLFB 2MGWA 2R44A 3U6OA 4JI1M 4AKHA 3AV0A 4GEWA 4KT0F 2OPFA 5ITQA 1QDRA 3GPPA 1DGBA 4R71A 1CUKA 2DENA 4WP2A 5C1BA 1IFYA 1NY5A 1QZEA 2DZLA 1N78A 3QAUA 2C5RA 2X49A 3TE6A 4DV5M 1HQYE 3GPUA 2I7NA 3CTWB 2HAKA 2X4AA 2V1UA 3NWLA 2R0IA 4FW9A 2E5LM 4L16A 4MM3B 2KA6B 4II7A 1DGFA 1EE8A 1AIPC 1XB2B 3FYDA 5ITTA 2FS1A 4W5WA 2R6FA 3SAWA 2QSFX 4FCWA 4OX9M 2DWNA 4PT5A 3SMSA 3JAMS 5KPRA 4AQYM 1Y8GA 2XGNA 1JR3E 3T1HM 4KHPM 3KSXA 2Z4RA
chains in the Genus database with same CATH topology
5FSWA 4IBFA 4NOOB 1HT1E 1N32M 2KXEA 2J7NA 1X37A 2UXCM 4WURA 1R6BX 1Z5AA 1Q3BA 3I51A 4LF7M 4LJ7A 3SARA 4AI6A 3GPXA 3KOZE 4IBDA 1DO0A 1NJFA 1IY1A 5BR8M 3VFDA 4P16A 4I81A 4X66M 4B7HA 1QAOA 2KZSA 1YUBA 1SXJE 2CFOA 4GC9A 2XEPA 2KW0A 1N75A 3SHFA 4JV5M 3CF0A 4GHAA 2BJWA 2Y20A 4JI3M 1C1KA 2BJVA 3FUTA 4YY3M 1L8QA 3DZDA 4DV7M 2DXIA 1QAQA 4RF0A 2R4EA 3HGIA 3GLGA 3KP0E 4LF4M 3KW6A 4HL4A 1R2YA 4FCVA 2CV1A 1I94M 1XNQM 1NNUC 4LY6A 4FWGA 4LRSA 2HKJA 3WHLA 3GQ3A 2EUCA 2RKOA 4RF1A 4AW4A 3K1JA 5KO3A 3HU1A 4LZJA 2CUZA 1Z5BA 4LJAA 4JI4M 3J7AS 4DR6M 2L6OA 2C99A 2R62A 2KZUA 3GLHA 3TWMA 4QOSA 5EP2A 3JR4A 3R9XB 3U6PA 3WHKA 2G5GX 3UGJA 3K2LA 1N36M 1TDZA 1S3SA 4OVZB 2CV2A 3PNVA 4LFAM 3FYCA 3W0FA 1IM2A 3KVWA 3GQ4A 1FJGM 4DR5M 3NBIA 2DZOB 3B9PA 1GVNA 4I8OA 1QYRA 3RE8A 2XFTA 3MJ5A 3U6SA 3M6AA 1HNZM 1VDDA 3U6MA 3FKEA 1MU5A 2DVWB 1G41A 2DWZB 1KSFX 4B3RM 5EQTA 1WXQA 3KP1E 4R3DA 4AZFA 4IIWA 4BB9A 1QAMA 1MX0A 3L26A 1N33M 1KYIA 3AOGA 3PVSA 5DYGA 3U6QA 2Z4SA 4NRVA 2CHVA 3HU3A 3EIHA 2DWMA 5F3WA 2I7PA 3KOYE 3A42A 4FCTA 3OTOM 3SYKA 5JI2E 5FTKA 4JI6M 3U6DA 5EXPA 1Z6TA 4DV3M 5IZ7D 2UU9M 3HJ8A 2XZFA 4DR7M 3FUUA 4D82A 4DR3M 1W5SA 4MGIE 2VQEM 4L15A 1NJGA 4QHTA 1J09A 4IBBA 4TUWA 4B7GA 7CATA 1IQPA 3AFHA 4QNMA 4CGYB 2RGHA 2O5RA 4REZA 2JA2A 3KS8A 3SASA 1PM5A 4LGYA 1XMQM 3HHYA 4M0DA 1XWIA 2YNMD 1IN7A 1SXJB 2NQ8C 4R7GA 4B3TM 4LJ8A 2V6ZM 3JR5A 4K0KM 3CF2A 3FUVA 4G6ZA 2F5NA 1XHBA 1T3TA 3T15A 2QP9X 2C9CA 1PJJA 3I4YA 1IN4A 3GLIB 2R18A 3GRRA 5FTMA 5A2QS 2HHHM 3FTEA 4DV2M 2LNHC 3THGA 5ITXE 4JYAM 2CEAA 3VLFB 1G4AE 2LH0A 4M0WA 4M9XA 2XSZA 1HNWM 4X62M 3FTFA 2ERCA 2L09A 1DGGA 3J2PB 1L2CA 3KSJA 2DZNB 3HHXA 4MB7A 4M9ZA 1XC8A 2FOIC 2F5SA 1NNJA 4B7FA 2F5OA 3UZUA 3U5ZB 4FWHA 1NY6A 1DGHA 1Q3CA 3EIEA 3KOWE 4BBAA 3E9SA 2CHGA 4XBOA 4Z8XA 1SXJC 1KFVA 1NHWC 2D7GA 4YHHM 4LFCM 1J7KA 4LF5M 4NXMM 1NVMA 3J7BA 2QCUA 1R7RA 3HHZA 2YQZA 3FD9A 5E6JA 1JQJC 5EP1A 3DFZA 3UMMA 1K3XA 5EP3A 1G59A 3KFUG 4JI8M 2UUBM 2CV0A 1IBMM 3J80S 1G3IA 4NSRA 4DV0M 4DUYM 1HNXM 3KS4A 5KQ8A 1HR0M 1OFHA 1ORYB 1TDHA 3LVVA 3GRYA 2UXDM 4LGMA 5C18A 3AKZA 1OJLA 2ZM6M 4DR1M 3DA1A 3K8ZA 1TGUA 1XNRM 1JR3A 3IG5A 1LV7A 2F5PA 3U6LA 4NRWA 3HHWA 4KODA 2QENA 2YR0A 1L2DA 3CF6E 4LFBM 4GC5A 2F5QA 4HLQA 1ZAEA 3VKGA 4IJFA 3TWLA 3PNYA 4PD2A 4FD2A 3VK7A 4AG5A 4MH0E 3SYLA 5IT9S 3SAUA 4I5SA 1UM8A 1GL6A 2Q2EB 1IXRC 3FTDA 2V1CA 3GO8A 1XXHB 4IJEA 4AKGA 3PFIA 3TPZA 4GMQA 3SATA 5FTJA 1SXJA 4KLNA 4G4QA 4WW0A 3GLFA 4JI7M 4G4OA 1H6UA 3AOEC 1PJIA 3ZH9B 2C96A 3TQSA 2HL7A 4IBKA 4G4RA 3C58A 1QQWA 2G8LA 3GLIA 1J5EM 2UXBM 2FFJA 1QVRA 2A5YB 8CATA 2R45A 1DO2A 2KRUA 2DHRA 1Z5CA 4PDGA 1E32A 4RNAA 3R8FA 3VDPA 4M9SA 4LF9M 2XZUA 3HKPA 2XF3A 1Z59A 3LQRA 4MGHA 3T1YM 5EXSA 4MGZE 2AHMA 4LRTA 3L29A 3U60B 3GLGB 2L7HA 3LMMA 4BLCA 3I4VA 4QNRA 2QBYB 5EJCA 4MGKE 3ZCBB 1QANA 3U5ZA 5DYIA 1IBKM 5KPZA 2OQ4A 4GRIA 3RGSA 3AL0C 3U6EA 3Q8XA 1N77A 4LJ9A 2EO2A 3GLHB 4L4UA 2ZANA 3T38A 3U6CA 4JI0M 3H4MA 3U61B 2VQFM 2QPAA 4JXJA 2XLJA 2UUCM 3A98B 1L1ZA 1QZMA 3K92A 2XFSA 3RGPA 2ZBKB 4L8RC 4IBGA 2Y0TA 4DV4M 3SAVA 1K3WA 3AOEA 4QOZC 1OFIA 3FTCA 4LF6M 4IBIA 5FLXS 3FUWA 3GRUA 3L27A 3UK6A 5BPVA 4ITQA 4IBJA 4B08A 3A46A 3J27B 3L2AA 3GRVA 2XSZD 2YFQA 2CE7A 5E26A 4CHTB 2J7OA 1TH2A 3KOXE 2XH9A 4NXNM 4DUZM 3VK8A 3E4RA 4AG6A 2C9OA 1IXSB 3IG8A 4OVZA 2H1RA 3SHGB 2LXEA 4S12A 1GLNA 4JN6A 2BNKA 1NSFA 3HJSA 4GKJM 4GITA 2CHQA 1XXHA 4B3SM 3ILKA 4I4LA 2Y21A 4EIWA 4FVMA 2P5TA 2KEBA 5ITXA 2DWLA 2X8AA 5ITYA 4QHSA 4X64M 3VKHA 3MK6A 5EP4A 5DNYA 3GQ5A 2QZ4A 3TWKA 4GHLA 3LVWA 4NSOB 1XMOM 2D7HA 4LJ5A 2Z3XA 1TH3A 4XGIA 1E94E 4GKKM 1D2NA 1IN6A 3MHVC 3A45A 4DV6M 3TL4X 2L7IA 3UJNA 3SMPA 2RGOA 5IREB 2UUAM 4LCBA 3SFZA 4OW0A 3FUXA 5IWAM 3QWLA 1IBLM 2VIIA 4OU7A 3PXGA 2FE8A 4LG2A 3HU2A 1JR3D 5GKNA 2R46A 2R4JA 3SC3A 3ZC7B 3BOSA 1E9RA 4KO8A 3LQQA 3U60A 5KPTA 3GP1A 1R2ZA 2QBYA 3M7GA 4CISA 2R65A 4DV1M 1L1TA 3HJQA 3W0LB 4NL4H 4D80A 1DGHB 3KDSE 1IN5A 5ITUA 2ZAOA 3DOAA 4JI5M 4G4NA 4IBCA 3SBJA 2M60A 3U61A 1K82A 3L28A 3AJIB 4AKIA 2M5ZA 2D7EA 3M0EA 5H37D 1SXJD 4B3MM 3RFWA 5EXTA 2KRKA 4X65M 1YSYA 2Z7JA 1GL7A 2ZAMA 4FWDA 1W5TA 2W82A 3GPYA 3D8BA 5ITRA 5FTLA 1I4WA 3VDUA 5EXXA 4DR4M 4LZZA 4GH9A 5LMUM 4PCZA 1IN8A 5JI3E 4D81A 2FNAA 1TH4A 1N34M 4JI2M 4LF8M 3L25A 4LJ4A 4ZPXA 1FNNA 4PDIA 4IBEA 1HQCA 1IY0A 4LJ6A 2HCBA 4MGYE 1ZQ9A 4A3VB 4DR2M 3HWSA 2K47A 1L2BA 2F4VM 1HT2E 2C98A 3D8LA 1NHGC 5LMNM 2LWXA 1Q39A 5FTNA 4L78A 4Z6YA 1GKIA 3J81S 4GIPA 1IY2A 1E9SA 2EA0A 5KQDA 1IXZA 3KXEC 2Y0QA 1YE9A 1G8PA 3GLFB 3U6OA 4JI1M 4AKHA 3AV0A 2OPFA 5ITQA 3GPPA 1DGBA 5C1BA 1NY5A 1N78A 3QAUA 2C5RA 2X49A 3TE6A 4DV5M 1HQYE 3GPUA 2I7NA 3CTWB 2X4AA 2V1UA 3NWLA 4FW9A 2E5LM 4L16A 4MM3B 2KA6B 4II7A 1DGFA 1EE8A 3FYDA 5ITTA 4W5WA 3SAWA 4FCWA 4OX9M 2DWNA 4PT5A 3SMSA 3JAMS 5KPRA 4AQYM 4KHPM 2XGNA 3T1HM 3KSXA 2Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E M;  3JR5 A;  1IBL M;  4K0K M;  2UXB M;  2F5N A;  1PJJ A;  1Z5C A;  4PDG A;  1N32 M;  3GP1 A;  1R2Z A;  2UXC M;  2HHH M;  5A2Q S;  4LF9 M;  2XZU A;  1Z5A A;  4DV2 M;  5ITX E;  4CIS A;  1Q3B A;  4DV1 M;  1Z59 A;  1L1T A;  3T1Y M;  4LF7 M;  4JYA M;  3SAR A;  3GPX A;  5BR8 M;  1HNW M;  5ITU A;  4X62 M;  3DOA A;  4JI5 M;  4G4N A;  4X66 M;  1L2C A;  1IBK M;  3SBJ A;  1K82 A;  2OQ4 A;  4MB7 A;  3U6E A;  1XC8 A;  2F5S A;  4JV5 M;  1NNJ A;  2F5O A;  4JI3 M;  4YY3 M;  4DV7 M;  3U6C A;  4B3M M;  4JI0 M;  1Q3C A;  2VQF M;  4X65 M;  1XNQ M;  2UUC M;  4LF4 M;  1R2Y A;  1KFV A;  1I94 M;  1L1Z A;  4YHH M;  2HKJ A;  3GPY A;  3GQ3 A;  5ITR A;  4LFC M;  4LF5 M;  4NXM M;  2ZBK B;  4JI4 M;  1Z5B A;  4DR4 M;  3J7A S;  4DR6 M;  4DV4 M;  3TWM A;  3SAV A;  3JR4 A;  5LMU M;  1K3W A;  4PCZ A;  3U6P A;  1K3X A;  4LF8 M;  4JI2 M;  1N34 M;  1N36 M;  2UUB M;  1TDZ A;  4JI8 M;  4LF6 M;  1IBM M;  3J80 S;  5FLX S;  4LFA M;  3W0F A;  4DV0 M;  4DUY M;  1HNX M;  3GQ4 A;  4PDI A;  1FJG M;  4ITQ A;  4DR5 M;  3A46 A;  1HR0 M;  3U6S A;  1TDH A;  1HNZ M;  2UXD M;  3U6M A;  4B3T M;  4DR1 M;  1MU5 A;  4DR2 M;  1XNR M;  4DUZ M;  4NXN M;  3VK8 A;  1L2B A;  4B3R M;  2F4V M;  1MX0 A;  2F5P A;  1N33 M;  3U6L A;  3U6Q A;  4NRW A;  5LMN M;  1Q39 A;  4NRV A;  1L2D A;  3J81 S;  4LFB M;  2F5Q A;  3TWL A;  2EA0 A;  4GKJ M;  3A42 A;  4PD2 A;  3OTO M;  3VK7 A;  4B3S M;  3U6O A;  4JI6 M;  4JI1 M;  3U6D A;  2OPF A;  5ITX A;  5ITQ A;  4DV3 M;  2UU9 M;  5IT9 S;  5ITY A;  3GPP A;  3SAU A;  4X64 M;  2XZF A;  4DR7 M;  2Q2E B;  3GQ5 A;  3TWK A;  4DR3 M;  1XMO M;  3GO8 A;  2VQE M;  4DV5 M;  3GPU A;  3SAT A;  2E5L M;  4GKK M;  4DV6 M;  3A45 A;  1EE8 A;  4G4Q A;  4JI7 M;  5ITT A;  4G4O A;  2UUA M;  1PJI A;  3SAW A;  3SAS A;  4OX9 M;  1PM5 A;  1XMQ M;  3JAM S;  4AQY M;  4G4R A;  4KHP M;  3T1H M;  3C58 A;  2ZM6 M;  5IWA M; 
#chains in the Genus database with same CATH topology
 5FSW A;  4IBF A;  4CJ6 A;  3I01 M;  4NOO B;  1HT1 E;  2JZ0 A;  1N32 M;  2KXE A;  2J7N A;  1OKS A;  1X37 A;  2UXC M;  4WUR A;  1R6B X;  1Z5A A;  2QQ8 A;  1Q3B A;  3I51 A;  3ZQJ A;  4LF7 M;  4LJ7 A;  2FH0 A;  5DFL A;  3SAR A;  4AI6 A;  3GPX A;  3KOZ E;  4IBD A;  1DO0 A;  1NJF A;  1IY1 A;  5BR8 M;  3VFD A;  4P16 A;  2L4E A;  2APL A;  4I81 A;  4X66 M;  3K9O A;  1QAO A;  2EKK A;  4B7H A;  2CP8 A;  1YUB A;  1SXJ E;  2CFO A;  2KZS A;  2XEP A;  4GC9 A;  3LW5 F;  2KW0 A;  1N75 A;  3SHF A;  4JV5 M;  3CF0 A;  3GLF E;  4GHA A;  2BJW A;  2O01 F;  2Y20 A;  2LHC A;  4JI3 M;  1C1K A;  2BJV A;  3FUT A;  4YY3 M;  1L8Q A;  3DZD A;  2KHH A;  4DV7 M;  2DXI A;  2WSF F;  1QAQ A;  4RF0 A;  2R4E A;  2EJS A;  3HGI A;  3GLG A;  3GLI E;  3KP0 E;  1SG9 A;  3KW6 A;  4HL4 A;  1R2Y A;  4FCV A;  2CV1 A;  1I94 M;  4LF4 M;  1NNU C;  4LY6 A;  4FWG A;  1HJP A;  2HKJ A;  4LRS A;  3WHL A;  3GQ3 A;  2EUC A;  2RKO A;  4RF1 A;  4AW4 A;  3K1J A;  5KO3 A;  1R5L A;  3HU1 A;  4LZJ A;  2CUZ A;  1Z5B A;  3I04 M;  4LJA A;  4JI4 M;  3J7A S;  4DR6 M;  2L6O A;  2C99 A;  2R62 A;  2KZU A;  3GLH A;  3TWM A;  4QOS A;  5EP2 A;  3JR4 A;  3R9X B;  4Q7J A;  3U6P A;  3WHK A;  1V33 A;  2G5G X;  2Z8Y M;  3K2L A;  3UGJ A;  1N36 M;  1TDZ A;  1S3S A;  4OVZ B;  2CV2 A;  3PNV A;  4LFA M;  3FYC A;  3W0F A;  1IM2 A;  2DAE A;  3KVW A;  3GQ4 A;  1FJG M;  4DR5 M;  3FRH A;  3NBI A;  2DZO B;  3B9P A;  1GVN A;  4I8O A;  1QYR A;  3RE8 A;  2XFT A;  1VEJ A;  3MJ5 A;  3M6A A;  3U6S A;  1HNZ M;  1VDD A;  2CWB A;  3U6M A;  3FKE A;  1MU5 A;  2DVW B;  1G41 A;  2DWZ B;  1KSF X;  1DV0 A;  4B3R M;  5EQT A;  1D0K A;  1WXQ A;  1Q02 A;  3KP1 E;  4R3D A;  4IIW A;  4AZF A;  1QAM A;  1MX0 A;  4BB9 A;  3L26 A;  1N33 M;  1KYI A;  3AOG A;  3PVS A;  5DYG A;  3U6Q A;  2Z4S A;  4NRV A;  2CHV A;  3HU3 A;  3EIH A;  2DWM A;  5F3W A;  1WJ7 A;  2I7P A;  3KOY E;  3A42 A;  2LVN C;  4FCT A;  3OTO M;  1TR8 A;  1XNQ M;  3SYK A;  5JI2 E;  5FTK A;  4JI6 M;  3U6D A;  1EIJ A;  5EXP A;  2H5X A;  1Z6T A;  4DV3 M;  5IZ7 D;  2UU9 M;  1G71 A;  3HJ8 A;  2LVQ D;  2XZF A;  4DR7 M;  2VF7 A;  3FUU A;  4D82 A;  1QUT A;  1ZMW A;  1W5S A;  4MGI E;  4DR3 M;  2LBC A;  2VQE M;  4L15 A;  1NJG A;  1TTE A;  1J09 A;  4IBB A;  4QHT A;  4B7G A;  4TUW A;  7CAT A;  1IQP A;  3AFH A;  4QNM A;  4CGY B;  2L2D A;  2RGH A;  2O5R A;  4REZ A;  2JA2 A;  3HY5 A;  3KS8 A;  3SAS A;  4XK8 F;  1PM5 A;  4LGY A;  1VQ1 A;  1XMQ M;  3HHY A;  4M0D A;  1XWI A;  2YNM D;  1IN7 A;  1SXJ B;  2NQ8 C;  4R7G A;  4B3T M;  3F92 A;  4LJ8 A;  2V6Z M;  3JR5 A;  4K0K M;  3CF2 A;  3FUV A;  4G6Z A;  2F5N A;  1XHB A;  1T3T A;  3T15 A;  2QP9 X;  2C9C A;  1PJJ A;  3I4Y A;  1JB0 F;  1IN4 A;  1XXH E;  3GLI B;  2R18 A;  3GRR A;  5FTM A;  5A2Q S;  2HHH M;  1NV9 A;  3FTE A;  4DV2 M;  2LNH C;  3THG A;  5ITX E;  4JYA M;  1D0M A;  2CEA A;  1G4A E;  3VLF B;  2LH0 A;  4M0W A;  4M9X A;  2XSZ A;  1HNW M;  4X62 M;  2DNA A;  3FTF A;  2ERC A;  2L09 A;  1DGG A;  2O25 A;  2K9D A;  3J2P B;  1L2C A;  3KSJ A;  1PGY A;  2DZN B;  5L8R F;  3HHX A;  4MB7 A;  1V92 A;  4M9Z A;  1XC8 A;  2FOI C;  2F5S A;  1NNJ A;  4B7F A;  2F5O A;  3UZU A;  3U5Z B;  4FWH A;  1NY6 A;  3IEC A;  1DGH A;  1Q3C A;  3EIE A;  3KOW E;  4BBA A;  3E9S A;  2CHG A;  3HX3 A;  4XBO A;  1SXJ C;  3BBZ A;  4Z8X A;  1NHW C;  1KFV A;  2D7G A;  4YHH M;  4LFC M;  3FE3 A;  1J7K A;  4LF5 M;  4NXM M;  1NVM A;  3J7B A;  1VG5 A;  2WSE F;  2QCU A;  1R7R A;  3HHZ A;  4DBG B;  1NV8 A;  2G3Q A;  2YQZ A;  3FD9 A;  5E6J A;  1JQJ C;  5EP1 A;  3DFZ A;  3UMM A;  2DKL A;  5EP3 A;  1K3X A;  1G59 A;  2WZJ A;  4JI8 M;  2UUB M;  2CV0 A;  3KFU G;  2DHY A;  1IBM M;  3J80 S;  1G3I A;  4NSR A;  4DV0 M;  4DUY M;  1HNX M;  1VDL A;  1ZMU A;  3KS4 A;  2MRO B;  5KQ8 A;  1HR0 M;  1OFH A;  1ORY B;  1TDH A;  2LVP C;  4F1I A;  1EFU B;  3GRY A;  3LVV A;  3Q8G A;  3K9P A;  4LGM A;  4RKU F;  5C18 A;  3AKZ A;  1OJL A;  2ZM6 M;  2UXD M;  2WSC F;  3DA1 A;  4DR1 M;  3K8Z A;  1TGU A;  1XNR M;  1JR3 A;  3IG5 A;  1LV7 A;  2F5P A;  3U6L A;  4NRW A;  3HHW A;  4KOD A;  2QEN A;  2YR0 A;  1L2D A;  3CF6 E;  4LFB M;  4GC5 A;  2F5Q A;  4HLQ A;  1ZAE A;  3VKG A;  4IJF A;  3TWL A;  3PNY A;  2LVO C;  4PD2 A;  4FD2 A;  3VK7 A;  4AG5 A;  2DI0 A;  3NBX X;  4MH0 E;  2KNA A;  3SYL A;  1BVS A;  5IT9 S;  3SAU A;  3HZJ A;  4I5S A;  1UM8 A;  1GL6 A;  2Q2E B;  1IXR C;  3FTD A;  2V1C A;  3GO8 A;  1XXH B;  4IJE A;  4AKG A;  3PFI A;  3TPZ A;  2DWL A;  2OOA A;  3B7Z A;  2GQF A;  4GMQ A;  3SAT A;  5FTJ A;  1SXJ A;  4KLN A;  4G4Q A;  4WW0 A;  3GLF A;  4JI7 M;  4G4O A;  1H6U A;  3AOE C;  1PJI A;  3ZH9 B;  2C96 A;  1GAB A;  3TQS A;  3C3D A;  2HL7 A;  4IBK A;  2JXN A;  4G4R A;  1T6O A;  4P17 A;  3C58 A;  1QQW A;  2G8L A;  3GLI A;  1J5E M;  2UXB M;  2FFJ A;  1QVR A;  2A5Y B;  8CAT A;  2R45 A;  1DO2 A;  2KRU A;  2DHR A;  1NO1 A;  1Z5C A;  4PDG A;  1E32 A;  4RNA A;  3R8F A;  3VDP A;  4M9S A;  3T6P A;  4LF9 M;  4ANR A;  2XZU A;  3HKP A;  2XF3 A;  2LVA A;  1OAI A;  1Z59 A;  3LQR A;  2HWJ A;  4MGH A;  1OQY A;  3FRI A;  5EXS A;  4MGZ E;  3T1Y M;  2AHM A;  4LRT A;  3L29 A;  3U60 B;  3GLG B;  2L7H A;  1PRB A;  3LMM A;  4BLC A;  3I4V A;  1C7Y A;  4QNR A;  2QBY B;  1UFZ A;  5EJC A;  4MGK E;  3ZCB B;  1QAN A;  3U5Z A;  2DAM A;  5DYI A;  1IBK M;  5KPZ A;  3QYE A;  2OQ4 A;  1OIZ A;  4GRI A;  3RGS A;  3AL0 C;  3U6E A;  3Q8X A;  1N77 A;  4LJ9 A;  3W67 A;  2EO2 A;  3GLH B;  4L4U A;  2ZAN A;  2EKF A;  2DAK A;  2DAI A;  2MJ5 B;  3T38 A;  1F4I A;  3U6C A;  1PJQ A;  4JI0 M;  3H4M A;  3U61 B;  1GO5 A;  2VQF M;  2JWS A;  2QPA A;  4JXJ A;  2XLJ A;  2KNZ A;  3A98 B;  2UUC M;  1L1Z A;  1QZM A;  2BWB A;  3K92 A;  2XFS A;  3RGP A;  2ZBK B;  3B7N A;  4L8R C;  4IBG A;  2Y0T A;  4DV4 M;  3SAV A;  1K3W A;  1GJT A;  3B7Q A;  3AOE A;  4QOZ C;  2JP7 A;  1OFI A;  3FTC A;  4LF6 M;  4IBI A;  1VEK A;  3B89 A;  5FLX S;  3FUW A;  2B3T A;  4L6V 6;  4UN2 B;  2DAG A;  3GRU A;  3BXW A;  3L27 A;  3UK6 A;  5BPV A;  4ITQ A;  2L4F A;  4IBJ A;  4B08 A;  4G3O A;  3J27 B;  3A46 A;  3L2A A;  3GRV A;  2XSZ D;  2JUJ A;  2YFQ A;  2CE7 A;  5E26 A;  2J5Y A;  1P3Q Q;  4CHT B;  2J7O A;  1TH2 A;  3KOX E;  2XH9 A;  4NXN M;  4DUZ M;  2OO9 A;  3E4R A;  3VK8 A;  4AG6 A;  2C9O A;  1IXS B;  3E46 A;  3H4J A;  3IG8 A;  2ZTC A;  4OVZ A;  2H1R A;  3GLG E;  3SHG B;  2LXE A;  1T43 A;  4S12 A;  1GLN A;  4JN6 A;  1D0L A;  1WIV A;  3QYB A;  2BNK A;  1NSF A;  3HJS A;  4GKJ M;  4GIT A;  1WGL A;  4HEO A;  1WR1 B;  1ZV1 A;  2CHQ A;  1XXH A;  4B3S M;  3C9P A;  3ILK A;  4I4L A;  2Y21 A;  4EIW A;  4FVM A;  2P5T A;  2KEB A;  2MR9 A;  2N35 A;  3GLH E;  2X8A A;  2BWE A;  4QHS A;  5ITY A;  5ITX A;  1TF0 B;  4X64 M;  3VKH A;  1OAO C;  3MK6 A;  5EP4 A;  5DNY A;  3GQ5 A;  2QZ4 A;  3TWK A;  4GHL A;  3LVW A;  4NSO B;  1XMO M;  1YLA A;  2D7H A;  4LJ5 A;  2Z3X A;  1TH3 A;  3MMP A;  1OIP A;  2JZ1 A;  1V34 A;  4XGI A;  1E94 E;  4GKK M;  1D2N A;  1PJS A;  1IN6 A;  2VDB B;  3A45 A;  3E21 A;  3MHV C;  4DV6 M;  1AUA A;  2L7I A;  3B74 A;  3SMP A;  2RGO A;  5IRE B;  2RRU A;  3TL4 X;  3UJN A;  2UUA M;  4LCB A;  3SFZ A;  2ZTD A;  2CRU A;  3V76 A;  4OW0 A;  3FUX A;  5IWA M;  3QWL A;  1IBL M;  2VII A;  4OU7 A;  3PXG A;  2FE8 A;  4LG2 A;  3HU2 A;  4NC6 A;  2JY8 A;  2QNJ A;  1JR3 D;  2K0B X;  2R46 A;  5GKN A;  2JY5 A;  2R4J A;  1A5T A;  3SC3 A;  3BOS A;  1E9R A;  3ZC7 B;  4KO8 A;  3LQQ A;  3W68 A;  5KPT A;  3GP1 A;  3U60 A;  1R2Z A;  2QBY A;  3LCV B;  2LTU A;  3M7G A;  4CIS A;  2R65 A;  4DV1 M;  2LHG A;  1L1T A;  3HJQ A;  3W0L B;  4NL4 H;  2GNO A;  4D80 A;  1DGH B;  1QUS A;  3KDS E;  1IN5 A;  5ITU A;  2ZAO A;  3DOA A;  4JI5 M;  3IHP A;  4IBC A;  4G4N A;  1ZMV A;  3SBJ A;  2M60 A;  3U61 A;  1K82 A;  3L28 A;  3AJI B;  4AKI A;  2M5Z A;  3LCU A;  2JY6 B;  2OOB A;  2D7E A;  3M0E A;  4CIZ A;  1SXJ D;  5H37 D;  4B3M M;  2K6B A;  3RFW A;  5EXT A;  1MJG M;  1VEG A;  2KRK A;  4X65 M;  2VF8 A;  1YSY A;  2Z7J A;  1GL7 A;  1WHC A;  2ZAM A;  4FWD A;  1W5T A;  2W82 A;  3GPY A;  1GJS A;  1PJT A;  3C3E A;  3D8B A;  5ITR A;  5FTL A;  1I4W A;  3VDU A;  1R4G A;  1WGN A;  5EXX A;  4DR4 M;  4LZZ A;  4GH9 A;  2JY7 A;  5LMU M;  4PCZ A;  1IN8 A;  2JNH A;  5JI3 E;  4D81 A;  2FNA A;  1TH4 A;  1N34 M;  4JI2 M;  4LF8 M;  3L25 A;  2KNV A;  4LJ4 A;  1LTM A;  3CGW A;  4ZPX A;  1FNN A;  1OTR A;  4PDI A;  1IXS A;  1MN3 A;  1HQC A;  4IBE A;  1IY0 A;  4LJ6 A;  2HCB A;  4MGY E;  1QDT A;  1ZQ9 A;  4A3V B;  4DR2 M;  4F2L A;  3HWS A;  2K47 A;  1L2B A;  2F4V M;  1HT2 E;  2KDL A;  2C98 A;  2QHO B;  3D8L A;  1NHG C;  4Y28 F;  2LWX A;  1Q39 A;  5FTN A;  4L78 A;  5LMN M;  2MH8 A;  1GKI A;  4Z6Y A;  3J81 S;  4GIP A;  1IY2 A;  1E9S A;  2EA0 A;  5KQD A;  1RU3 A;  1IXZ A;  3KXE C;  2Y0Q A;  1YE9 A;  1G8P A;  3GLF B;  2MGW A;  2R44 A;  3U6O A;  4JI1 M;  4AKH A;  3AV0 A;  4GEW A;  4KT0 F;  2OPF A;  5ITQ A;  1QDR A;  3GPP A;  1DGB A;  4R71 A;  1CUK A;  2DEN A;  4WP2 A;  5C1B A;  1IFY A;  1NY5 A;  1QZE A;  2DZL A;  1N78 A;  3QAU A;  2C5R A;  2X49 A;  3TE6 A;  4DV5 M;  1HQY E;  3GPU A;  2I7N A;  3CTW B;  2HAK A;  2X4A A;  2V1U A;  3NWL A;  2R0I A;  4FW9 A;  2E5L M;  4L16 A;  4MM3 B;  2KA6 B;  4II7 A;  1DGF A;  1EE8 A;  1AIP C;  1XB2 B;  3FYD A;  5ITT A;  2FS1 A;  4W5W A;  2R6F A;  3SAW A;  2QSF X;  4FCW A;  4OX9 M;  2DWN A;  4PT5 A;  3SMS A;  3JAM S;  5KPR A;  4AQY M;  1Y8G A;  2XGN A;  1JR3 E;  3T1H M;  4KHP M;  3KSX A;  2Z4R A; 
#chains in the Genus database with same CATH homology
 5FSW A;  4IBF A;  4NOO B;  1HT1 E;  1N32 M;  2KXE A;  2J7N A;  1X37 A;  2UXC M;  4WUR A;  1R6B X;  1Z5A A;  1Q3B A;  3I51 A;  4LF7 M;  4LJ7 A;  3SAR A;  4AI6 A;  3GPX A;  3KOZ E;  4IBD A;  1DO0 A;  1NJF A;  1IY1 A;  5BR8 M;  3VFD A;  4P16 A;  4I81 A;  4X66 M;  4B7H A;  1QAO A;  2KZS A;  1YUB A;  1SXJ E;  2CFO A;  4GC9 A;  2XEP A;  2KW0 A;  1N75 A;  3SHF A;  4JV5 M;  3CF0 A;  4GHA A;  2BJW A;  2Y20 A;  4JI3 M;  1C1K A;  2BJV A;  3FUT A;  4YY3 M;  1L8Q A;  3DZD A;  4DV7 M;  2DXI A;  1QAQ A;  4RF0 A;  2R4E A;  3HGI A;  3GLG A;  3KP0 E;  4LF4 M;  3KW6 A;  4HL4 A;  1R2Y A;  4FCV A;  2CV1 A;  1I94 M;  1XNQ M;  1NNU C;  4LY6 A;  4FWG A;  4LRS A;  2HKJ A;  3WHL A;  3GQ3 A;  2EUC A;  2RKO A;  4RF1 A;  4AW4 A;  3K1J A;  5KO3 A;  3HU1 A;  4LZJ A;  2CUZ A;  1Z5B A;  4LJA A;  4JI4 M;  3J7A S;  4DR6 M;  2L6O A;  2C99 A;  2R62 A;  2KZU A;  3GLH A;  3TWM A;  4QOS A;  5EP2 A;  3JR4 A;  3R9X B;  3U6P A;  3WHK A;  2G5G X;  3UGJ A;  3K2L A;  1N36 M;  1TDZ A;  1S3S A;  4OVZ B;  2CV2 A;  3PNV A;  4LFA M;  3FYC A;  3W0F A;  1IM2 A;  3KVW A;  3GQ4 A;  1FJG M;  4DR5 M;  3NBI A;  2DZO B;  3B9P A;  1GVN A;  4I8O A;  1QYR A;  3RE8 A;  2XFT A;  3MJ5 A;  3U6S A;  3M6A A;  1HNZ M;  1VDD A;  3U6M A;  3FKE A;  1MU5 A;  2DVW B;  1G41 A;  2DWZ B;  1KSF X;  4B3R M;  5EQT A;  1WXQ A;  3KP1 E;  4R3D A;  4AZF A;  4IIW A;  4BB9 A;  1QAM A;  1MX0 A;  3L26 A;  1N33 M;  1KYI A;  3AOG A;  3PVS A;  5DYG A;  3U6Q A;  2Z4S A;  4NRV A;  2CHV A;  3HU3 A;  3EIH A;  2DWM A;  5F3W A;  2I7P A;  3KOY E;  3A42 A;  4FCT A;  3OTO M;  3SYK A;  5JI2 E;  5FTK A;  4JI6 M;  3U6D A;  5EXP A;  1Z6T A;  4DV3 M;  5IZ7 D;  2UU9 M;  3HJ8 A;  2XZF A;  4DR7 M;  3FUU A;  4D82 A;  4DR3 M;  1W5S A;  4MGI E;  2VQE M;  4L15 A;  1NJG A;  4QHT A;  1J09 A;  4IBB A;  4TUW A;  4B7G A;  7CAT A;  1IQP A;  3AFH A;  4QNM A;  4CGY B;  2RGH A;  2O5R A;  4REZ A;  2JA2 A;  3KS8 A;  3SAS A;  1PM5 A;  4LGY A;  1XMQ M;  3HHY A;  4M0D A;  1XWI A;  2YNM D;  1IN7 A;  1SXJ B;  2NQ8 C;  4R7G A;  4B3T M;  4LJ8 A;  2V6Z M;  3JR5 A;  4K0K M;  3CF2 A;  3FUV A;  4G6Z A;  2F5N A;  1XHB A;  1T3T A;  3T15 A;  2QP9 X;  2C9C A;  1PJJ A;  3I4Y A;  1IN4 A;  3GLI B;  2R18 A;  3GRR A;  5FTM A;  5A2Q S;  2HHH M;  3FTE A;  4DV2 M;  2LNH C;  3THG A;  5ITX E;  4JYA M;  2CEA A;  3VLF B;  1G4A E;  2LH0 A;  4M0W A;  4M9X A;  2XSZ A;  1HNW M;  4X62 M;  3FTF A;  2ERC A;  2L09 A;  1DGG A;  3J2P B;  1L2C A;  3KSJ A;  2DZN B;  3HHX A;  4MB7 A;  4M9Z A;  1XC8 A;  2FOI C;  2F5S A;  1NNJ A;  4B7F A;  2F5O A;  3UZU A;  3U5Z B;  4FWH A;  1NY6 A;  1DGH A;  1Q3C A;  3EIE A;  3KOW E;  4BBA A;  3E9S A;  2CHG A;  4XBO A;  4Z8X A;  1SXJ C;  1KFV A;  1NHW C;  2D7G A;  4YHH M;  4LFC M;  1J7K A;  4LF5 M;  4NXM M;  1NVM A;  3J7B A;  2QCU A;  1R7R A;  3HHZ A;  2YQZ A;  3FD9 A;  5E6J A;  1JQJ C;  5EP1 A;  3DFZ A;  3UMM A;  1K3X A;  5EP3 A;  1G59 A;  3KFU G;  4JI8 M;  2UUB M;  2CV0 A;  1IBM M;  3J80 S;  1G3I A;  4NSR A;  4DV0 M;  4DUY M;  1HNX M;  3KS4 A;  5KQ8 A;  1HR0 M;  1OFH A;  1ORY B;  1TDH A;  3LVV A;  3GRY A;  2UXD M;  4LGM A;  5C18 A;  3AKZ A;  1OJL A;  2ZM6 M;  4DR1 M;  3DA1 A;  3K8Z A;  1TGU A;  1XNR M;  1JR3 A;  3IG5 A;  1LV7 A;  2F5P A;  3U6L A;  4NRW A;  3HHW A;  4KOD A;  2QEN A;  2YR0 A;  1L2D A;  3CF6 E;  4LFB M;  4GC5 A;  2F5Q A;  4HLQ A;  1ZAE A;  3VKG A;  4IJF A;  3TWL A;  3PNY A;  4PD2 A;  4FD2 A;  3VK7 A;  4AG5 A;  4MH0 E;  3SYL A;  5IT9 S;  3SAU A;  4I5S A;  1UM8 A;  1GL6 A;  2Q2E B;  1IXR C;  3FTD A;  2V1C A;  3GO8 A;  1XXH B;  4IJE A;  4AKG A;  3PFI A;  3TPZ A;  4GMQ A;  3SAT A;  5FTJ A;  1SXJ A;  4KLN A;  4G4Q A;  4WW0 A;  3GLF A;  4JI7 M;  4G4O A;  1H6U A;  3AOE C;  1PJI A;  3ZH9 B;  2C96 A;  3TQS A;  2HL7 A;  4IBK A;  4G4R A;  3C58 A;  1QQW A;  2G8L A;  3GLI A;  1J5E M;  2UXB M;  2FFJ A;  1QVR A;  2A5Y B;  8CAT A;  2R45 A;  1DO2 A;  2KRU A;  2DHR A;  1Z5C A;  4PDG A;  1E32 A;  4RNA A;  3R8F A;  3VDP A;  4M9S A;  4LF9 M;  2XZU A;  3HKP A;  2XF3 A;  1Z59 A;  3LQR A;  4MGH A;  3T1Y M;  5EXS A;  4MGZ E;  2AHM A;  4LRT A;  3L29 A;  3U60 B;  3GLG B;  2L7H A;  3LMM A;  4BLC A;  3I4V A;  4QNR A;  2QBY B;  5EJC A;  4MGK E;  3ZCB B;  1QAN A;  3U5Z A;  5DYI A;  1IBK M;  5KPZ A;  2OQ4 A;  4GRI A;  3RGS A;  3AL0 C;  3U6E A;  3Q8X A;  1N77 A;  4LJ9 A;  2EO2 A;  3GLH B;  4L4U A;  2ZAN A;  3T38 A;  3U6C A;  4JI0 M;  3H4M A;  3U61 B;  2VQF M;  2QPA A;  4JXJ A;  2XLJ A;  2UUC M;  3A98 B;  1L1Z A;  1QZM A;  3K92 A;  2XFS A;  3RGP A;  2ZBK B;  4L8R C;  4IBG A;  2Y0T A;  4DV4 M;  3SAV A;  1K3W A;  3AOE A;  4QOZ C;  1OFI A;  3FTC A;  4LF6 M;  4IBI A;  5FLX S;  3FUW A;  3GRU A;  3L27 A;  3UK6 A;  5BPV A;  4ITQ A;  4IBJ A;  4B08 A;  3A46 A;  3J27 B;  3L2A A;  3GRV A;  2XSZ D;  2YFQ A;  2CE7 A;  5E26 A;  4CHT B;  2J7O A;  1TH2 A;  3KOX E;  2XH9 A;  4NXN M;  4DUZ M;  3VK8 A;  3E4R A;  4AG6 A;  2C9O A;  1IXS B;  3IG8 A;  4OVZ A;  2H1R A;  3SHG B;  2LXE A;  4S12 A;  1GLN A;  4JN6 A;  2BNK A;  1NSF A;  3HJS A;  4GKJ M;  4GIT A;  2CHQ A;  1XXH A;  4B3S M;  3ILK A;  4I4L A;  2Y21 A;  4EIW A;  4FVM A;  2P5T A;  2KEB A;  5ITX A;  2DWL A;  2X8A A;  5ITY A;  4QHS A;  4X64 M;  3VKH A;  3MK6 A;  5EP4 A;  5DNY A;  3GQ5 A;  2QZ4 A;  3TWK A;  4GHL A;  3LVW A;  4NSO B;  1XMO M;  2D7H A;  4LJ5 A;  2Z3X A;  1TH3 A;  4XGI A;  1E94 E;  4GKK M;  1D2N A;  1IN6 A;  3MHV C;  3A45 A;  4DV6 M;  3TL4 X;  2L7I A;  3UJN A;  3SMP A;  2RGO A;  5IRE B;  2UUA M;  4LCB A;  3SFZ A;  4OW0 A;  3FUX A;  5IWA M;  3QWL A;  1IBL M;  2VII A;  4OU7 A;  3PXG A;  2FE8 A;  4LG2 A;  3HU2 A;  1JR3 D;  5GKN A;  2R46 A;  2R4J A;  3SC3 A;  3ZC7 B;  3BOS A;  1E9R A;  4KO8 A;  3LQQ A;  3U60 A;  5KPT A;  3GP1 A;  1R2Z A;  2QBY A;  3M7G A;  4CIS A;  2R65 A;  4DV1 M;  1L1T A;  3HJQ A;  3W0L B;  4NL4 H;  4D80 A;  1DGH B;  3KDS E;  1IN5 A;  5ITU A;  2ZAO A;  3DOA A;  4JI5 M;  4G4N A;  4IBC A;  3SBJ A;  2M60 A;  3U61 A;  1K82 A;  3L28 A;  3AJI B;  4AKI A;  2M5Z A;  2D7E A;  3M0E A;  5H37 D;  1SXJ D;  4B3M M;  3RFW A;  5EXT A;  2KRK A;  4X65 M;  1YSY A;  2Z7J A;  1GL7 A;  2ZAM A;  4FWD A;  1W5T A;  2W82 A;  3GPY A;  3D8B A;  5ITR A;  5FTL A;  1I4W A;  3VDU A;  5EXX A;  4DR4 M;  4LZZ A;  4GH9 A;  5LMU M;  4PCZ A;  1IN8 A;  5JI3 E;  4D81 A;  2FNA A;  1TH4 A;  1N34 M;  4JI2 M;  4LF8 M;  3L25 A;  4LJ4 A;  4ZPX A;  1FNN A;  4PDI A;  4IBE A;  1HQC A;  1IY0 A;  4LJ6 A;  2HCB A;  4MGY E;  1ZQ9 A;  4A3V B;  4DR2 M;  3HWS A;  2K47 A;  1L2B A;  2F4V M;  1HT2 E;  2C98 A;  3D8L A;  1NHG C;  5LMN M;  2LWX A;  1Q39 A;  5FTN A;  4L78 A;  4Z6Y A;  1GKI A;  3J81 S;  4GIP A;  1IY2 A;  1E9S A;  2EA0 A;  5KQD A;  1IXZ A;  3KXE C;  2Y0Q A;  1YE9 A;  1G8P A;  3GLF B;  3U6O A;  4JI1 M;  4AKH A;  3AV0 A;  2OPF A;  5ITQ A;  3GPP A;  1DGB A;  5C1B A;  1NY5 A;  1N78 A;  3QAU A;  2C5R A;  2X49 A;  3TE6 A;  4DV5 M;  1HQY E;  3GPU A;  2I7N A;  3CTW B;  2X4A A;  2V1U A;  3NWL A;  4FW9 A;  2E5L M;  4L16 A;  4MM3 B;  2KA6 B;  4II7 A;  1DGF A;  1EE8 A;  3FYD A;  5ITT A;  4W5W A;  3SAW A;  4FCW A;  4OX9 M;  2DWN A;  4PT5 A;  3SMS A;  3JAM S;  5KPR A;  4AQY M;  4KHP M;  2XGN A;  3T1H M;  3KSX A;  2Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...