1IBLM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1iblM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1iblM02
3J80S 1XMOM 3JR5A 4LFCM 4LF6M 3GP1A 3GQ4A 3TWLA 2EA0A 2XZFA 1K3XA 2HHHM 1PJIA 4X64M 4JI5M 4LFAM 2F5SA 4LF9M 2F5QA 2UUCM 1N32M 4LF8M 4OX9M 4LFBM 1TDZA 2Q2EB 4JI7M 5A2QS 3GPUA 3U6QA 4JV5M 2UXBM 2VQEM 1MX0A 4DR6M 4JI3M 5LMUM 4DV0M 3SBJA 2VQFM 3W0FA 4DV1M 1XMQM 2UXDM 1L1ZA 2ZBKB 2UUBM 1R2ZA 1FJGM 1N33M 4NXMM 3SAVA 5LMNM 3VK7A 1HNZM 2F5NA 4B3MM 1MU5A 1PJJA 4G4NA 5BR8M 4DR3M 4DV6M 4K0KM 1Q3CA 3U6MA 3JR4A 5ITXA 3U6SA 4LF4M 3A45A 1J5EM 3VK8A 2OPFA 2F5OA 3SATA 4X62M 3SARA 3DOAA 3U6CA 3JAMS 1L2BA 1NNJA 4ITQA 3GO8A 1IBMM 4PD2A 1R2YA 4KHPM 4JI8M 1Q3BA 3SAWA 4X65M 4YHHM 4G4QA 4DV3M 4G4OA 3T1YM 4DUYM 4B3SM 4PCZA 1IBKM 1Z5CA 5ITRA 3C58A 3SASA 4G4RA 3J81S 5ITUA 3U6LA 3U6PA 4JI6M 5ITYA 1Z5BA 4DV5M 1TDHA 1I94M 3SAUA 4MB7A 3GQ3A 3OTOM 1PM5A 1XNRM 1L2DA 3J7AS 4JI1M 4DUZM 2UU9M 2UXCM 1XNQM 1N34M 2ZM6M 4X66M 2F5PA 4DV2M 1L1TA 1IBLM 1XC8A 4DR7M 4LF5M 2HKJA 4PDGA 2OQ4A 4LF7M 4B3TM 5IT9S 2F4VM 3GQ5A 4NRVA 3T1HM 4JI2M 1K3WA 4JI4M 1HNWM 4DR1M 4DR5M 2E5LM 4DR2M 4DV4M 5FLXS 4CISA 5ITTA 3GPXA 4GKJM 3GPPA 4JI0M 4GKKM 1Q39A 4PDIA 1KFVA 3U6OA 2XZUA 5ITXE 4DR4M 1Z5AA 4AQYM 4NXNM 3A42A 2UUAM 4B3RM 1K82A 1HNXM 4DV7M 4YY3M 1Z59A 1N36M 1L2CA 1HR0M 4NRWA 3A46A 5ITQA 3GPYA 1EE8A 3U6DA 3TWMA 3TWKA 4JYAM 3U6EA 5IWAM
chains in the Genus database with same CATH superfamily
1E9SA 4RF0A 1XMOM 3GLGB 3U61A 2XFTA 5E26A 3KS8A 4LFCM 1PJQA 1VDDA 5E6JA 5KPRA 3VLFB 2DZNB 1SG9A 2XFSA 4I4LA 1L8QA 2XF3A 3MHVC 4LFAM 1N32M 2F5QA 2UUCM 1DO2A 2JY6B 1PJSA 3A98B 4NL4H 4Z6YA 2EO2A 2M5ZA 2XSZD 1YUBA 2HL7A 4FCWA 5EP3A 3RFWA 3L29A 4NSRA 1JQJC 3GPUA 3U6QA 2VF7A 4DV0M 4DBGB 1XMQM 3EIEA 3W0FA 4DV1M 2UXDM 3VKGA 1OIPA 2ZBKB 2LNHC 1NY6A 1FJGM 4AKHA 2V1UA 2G5GX 1SXJE 3LVVA 3FRHA 2BWBA 3K2LA 3KW6A 1R5LA 4L78A 5DFLA 4B3MM 4CGYB 2RRUA 5BR8M 2R45A 5FTLA 3ZCBB 3E9SA 2L09A 1Q3CA 5ITXA 2A5YB 3GLHB 4IBKA 1J5EM 5IREB 2QENA 3WHKA 1QZMA 2D7HA 3MK6A 2J5YA 3DOAA 3HHXA 2DWNA 2QSFX 2DAGA 1NNJA 3ZC7B 1NVMA 4KHPM 1G3IA 2WSEF 2CV2A 1QDRA 4G6ZA 2MGWA 3FUWA 4G3OA 2LVQD 4M9XA 4RNAA 3IG8A 3I51A 2QHOB 2R0IA 4PCZA 5EXTA 4ANRA 2LVPC 1Z5CA 1XWIA 5ITRA 3C58A 4A3VB 4I8OA 2MJ5B 3GLIA 2O25A 3T6PA 2N35A 2XEPA 4LJAA 2QZ4A 5ITUA 1TF0B 1V92A 3C9PA 2DWZB 1T43A 1ZQ9A 2L4FA 2FH0A 2QNJA 5KQDA 2DZOB 2R4EA 4QHTA 2UU9M 1XNQM 1N34M 3FUVA 1GL6A 1OKSA 5KPZA 1NNUC 2ZAOA 4GITA 4JI6M 4X66M 3FYCA 4OVZB 4DV2M 2YNMD 2AHMA 1XC8A 2GQFA 5EP1A 2KW0A 3AOGA 3LW5F 1NJGA 1TH4A 4LF5M 1ZMWA 4PDGA 1G4AE 4B3TM 2CE7A 4GHLA 2WSFF 5FTNA 3KFUG 3GQ5A 3TL4X 4FD2A 4JI4M 1F4IA 4FVMA 3D8BA 1HT1E 3HU1A 3GLFB 1GVNA 1VQ1A 3AOEC 4P17A 4GEWA 3GLIE 4CISA 1VEJA 1H6UA 3B7NA 4HL4A 1HQYE 4CHTB 3GPPA 2KNVA 4GKKM 3Q8GA 3U6OA 4F1IA 2XZUA 3FUXA 4DR4M 5EXSA 1G71A 1QZEA 1WGLA 3A42A 1XXHB 3IG5A 1OFHA 4B7FA 2CRUA 2DWLA 2DZLA 2L4EA 1T6OA 4KT0F 1HNXM 4AKIA 4M9ZA 4MGYE 2KZUA 4DV7M 4IBIA 3PVSA 3BBZA 1IM2A 2K47A 3FD9A 1QUSA 2FOIC 1FNNA 1ORYB 5KPTA 4NRWA 1IXSA 4ZPXA 3VDUA 2JZ0A 3DA1A 5ITQA 1ZMVA 3TWMA 2QCUA 4L4UA 2XSZA 5EXPA 1AUAA 3UK6A 3J80S 4XGIA 3HU3A 5KQ8A 2D7EA 1KSFX 3L27A 1V33A 2QP9X 3VDPA 1NV8A 1OJLA 2EKFA 4GC5A 3H4JA 2DWMA 4FCVA 3TWLA 2XZFA 2V1CA 1N75A 1NHWC 1OQYA 1Q02A 1DGHB 3DFZA 4JI5M 4M9SA 2F5SA 2R6FA 2X4AA 4PT5A 3KOWE 2C96A 1TDZA 5EQTA 1IY2A 1EFUB 2RGOA 1LTMA 4JI7M 4QNMA 5A2QS 3QYBA 4JV5M 2UXBM 3L28A 4HEOA 3K9PA 1NHGC 5LMUM 2K6BA 2VQFM 4OW0A 3TQSA 3AOEA 1N33M 4IBGA 2O01F 1D0MA 5LMNM 4GRIA 3H4MA 3R9XB 1NY5A 2ERCA 2F5NA 1E9RA 2CEAA 3KXEC 4G4NA 3FKEA 3KOXE 5EP2A 1IN7A 1D0LA 4MH0E 1V34A 4FCTA 3GRVA 4WP2A 4DR3M 2JNHA 4L8RC 8CATA 3U6MA 2MR9A 2LHGA 3LQRA 1IQPA 3U6SA 1G8PA 4LF4M 3A45A 2HAKA 1WIVA 1Y8GA 4R71A 3B74A 4QNRA 4X62M 2QBYA 4GHAA 3SMSA 4ITQA 2Y0TA 4IBEA 3SAWA 4Z8XA 2KRKA 2WZJA 4LRSA 3LMMA 2V6ZM 1AIPC 3BOSA 4LJ7A 2YFQA 3NBXX 4G4OA 4MGHA 1QYRA 4I81A 5DYIA 2EJSA 2R44A 3ZQJA 5FTJA 2XGNA 5ITYA 1Z5BA 1TDHA 2I7NA 3SAUA 1LV7A 1PM5A 3LVWA 1XNRM 2G8LA 3SC3A 3J7AS 4DUZM 2JY5A 1N77A 1P3QQ 1DO0A 1XB2B 2YQZA 1IXRC 2Y21A 4II7A 1ZV1A 3RGPA 3AKZA 3GLGA 4UN2B 3CF6E 4AKGA 1OFIA 5KO3A 2OOAA 3PXGA 4B7GA 4DR7M 3SMPA 2LBCA 2HKJA 3V76A 2OQ4A 3UZUA 2B3TA 3I01M 3U6LA 2RKOA 4NRVA 4BLCA 1K3WA 1IY1A 3FTEA 4DR5M 2E5LM 1VEKA 2LVAA 4KODA 5ITTA 4WW0A 1Z6TA 2OOBA 2BWEA 1KFVA 3U60B 4QOZC 1NO1A 5ITXE 1QUTA 2OO9A 3W67A 2O5RA 2Z4SA 4B3RM 1OIZA 2CWBA 3CTWB 2R65A 3M0EA 4XBOA 2NQ8C 4LZZA 3QYEA 3KVWA 5FTMA 1TGUA 3GLHA 2FFJA 4KLNA 2J7OA 4W5WA 4R3DA 3U6EA 3AL0C 3ILKA 4GIPA 3A46A 1BVSA 2LHCA 2JZ1A 3K9OA 3WHLA 4JYAM 2CUZA 4M0DA 1QVRA 5IWAM 3F92A 1MJGM 4IJFA 2C98A 4LJ8A 4GH9A 1G59A 1JB0F 4GMQA 3BXWA 4LF6M 3GP1A 4LGMA 3IHPA 1HJPA 1WXQA 2FS1A 1K3XA 3K8ZA 4JN6A 3PNYA 1PJIA 4X64M 4P16A 3FTDA 2HHHM 4LF9M 1OTRA 4LF8M 3GRUA 1G41A 4LJ4A 2BJVA 2CHQA 3GLHE 4FWHA 4D80A 2W82A 5EP4A 2ZTCA 2DAEA 2JP7A 4JI3M 1J09A 3SBJA 1L1ZA 4NC6A 2UUBM 3K92A 4OVZA 1XHBA 4NXMM 4IBBA 2KHHA 3VK7A 4IBDA 1IN8A 2KRUA 2JY8A 2R62A 1A5TA 1HNZM 4MGZE 1MU5A 2FE8A 4AZFA 1X37A 2GNOA 2QPAA 3VFDA 1QAQA 2G3QA 3FTFA 2M60A 3HHWA 1D2NA 2ZANA 3KOYE 5DYGA 4XK8F 4IBFA 3JR4A 4M0WA 2LVOC 1IN5A 2J7NA 3L26A 3GLFA 1MN3A 3L2AA 3VK8A 2OPFA 3HGIA 2F5OA 2K9DA 4QHSA 4QOSA 3SARA 5H37D 3U6CA 1WHCA 4Y28F 3JAMS 3MJ5A 4F2LA 2DHRA 3GO8A 2D7GA 2C9OA 4PD2A 3I04M 1R2YA 2LH0A 1SXJB 1TH2A 2EUCA 1XXHA 2L7HA 2RGHA 4FW9A 4AG5A 5F3WA 3HY5A 3B89A 1NSFA 2R18A 3U61B 2DAMA 1DV0A 3B7ZA 4LJ9A 2L6OA 4G4QA 3KP1E 4R7GA 1GLNA 5IZ7D 4DV3M 1VDLA 4DUYM 2DAIA 2BNKA 1IBKM 3T38A 4LJ5A 3GRRA 3U6PA 5JI3E 1IXZA 1I94M 3GLFE 1NJFA 1KYIA 2FNAA 3HJSA 4MB7A 3OTOM 1RU3A 3GQ3A 1L2DA 4JI1M 5FTKA 2UXCM 2P5TA 3HWSA 4L6V6 2H5XA 2LWXA 2R4JA 1WGNA 3CF2A 5FSWA 2F5PA 3FYDA 2DI0A 2WSCF 1L1TA 1IBLM 1TH3A 1OAIA 4CJ6A 1XXHE 2CHGA 2I7PA 1DGHA 3J2PB 3SHFA 1QAOA 1VEGA 3UGJA 2MROB 5IT9S 2LXEA 3K1JA 1VG5A 4JI2M 4I5SA 1E32A 3RE8A 1JR3D 3LQQA 1TR8A 2CP8A 2DNAA 3PFIA 3KOZE 1QAMA 2MH8A 4REZA 5FLXS 2HCBA 1T3TA 3MMPA 1PGYA 2XLJA 4JI0M 1Q39A 4AG6A 4NOOB 2EKKA 3DZDA 1Z5AA 3LCUA 4NXNM 4GC9A 1QQWA 4NSOB 1OAOC 1IY0A 2UUAM 1YSYA 1PJTA 1GJTA 3QAUA 3ZH9B 3FRIA 2DXIA 3AV0A 3U5ZA 1K82A 3L25A 2KZSA 4BB9A 2C5RA 3KDSE 4LCBA 3SHGB 2Z7JA 1YLAA 2VF8A 2DAKA 1IN4A 1GL7A 3CGWA 1Z59A 1L2CA 3FUTA 3U5ZB 2KXEA 3RGSA 3GLIB 4TUWA 2JXNA 3U6DA 2ZTDA 2Z4RA 4GKJM 3J27B 3FUUA 3EIHA 4AI6A 2LVNC 2ZAMA 2JUJA 3JR5A 3AJIB 2KEBA 2VDBB 2K0BX 3GQ4A 2EA0A 3IECA 4CIZA 3R8FA 1QDTA 1GO5A 1R6BX 5DNYA 3GLGE 2JY7A 4OX9M 1DGBA 4LFBM 1N78A 3I4YA 2Q2EB 1WJ7A 4IIWA 4L16A 4LY6A 3W68A 1SXJD 1CUKA 3LCVB 2VQEM 1MX0A 4IBJA 3C3DA 4DR6M 4KO8A 2XH9A 3M6AA 1E94E 3SYKA 1R2ZA 2QQ8A 2CV1A 3UJNA 3SAVA 1WR1B 3FE3A 2JA2A 4FWDA 3HJQA 2DENA 3NWLA 4LZJA 1GKIA 4Q7JA 3T15A 1PJJA 4MGKE 1IN6A 2KDLA 1R7RA 1W5TA 4DV6M 4K0KM 7CATA 4FWGA 1PRBA 4EIWA 1S3SA 3HX3A 2C9CA 4WURA 2JWSA 1ZMUA 3SATA 1IXSB 4MGIE 2X8AA 5C18A 1L2BA 3U60A 4LJ6A 2CHVA 5EJCA 4OU7A 5C1BA 1IBMM 2KA6B 3M7GA 4JI8M 1Q3BA 4X65M 1DGGA 2DHYA 4YHHM 4L15A 5BPVA 3KS4A 4D81A 1NV9A 3FTCA 4IBCA 3HU2A 1QANA 3T1YM 4B3SM 3HKPA 3KSJA 1GABA 1HT2E 3SYLA 3SASA 4RKUF 4G4RA 3HJ8A 3J81S 3CF0A 1ZAEA 3QWLA 3HZJA 1SXJC 4DV5M 4AW4A 3E21A 2L2DA 3E4RA 2KNAA 3C3EA 1JR3A 2H1RA 5GKNA 1YE9A 3NBIA 2DVWB 3KP0E 5EXXA 1C7YA 2ZM6M 4LRTA 4S12A 3AFHA 4HLQA 4D82A 2YR0A 2CV0A 1C1KA 2Y0QA 2Z3XA 3B9PA 1DGFA 1UFZA 4LF7M 3KSXA 3VKHA 2X49A 2F4VM 4BBAA 2LTUA 3UMMA 3T1HM 1HNWM 1W5SA 4RF1A 3W0LB 2KNZA 4DR1M 1TTEA 3THGA 2R46A 4DR2M 3GRYA 3TPZA 4DV4M 4LG2A 3GPXA 4JXJA 2Z8YM 2VIIA 2L7IA 3HHZA 2QBYB 4B7HA 1D0KA 1HQCA 1JR3E 3I4VA 4IJEA 1J7KA 3TE6A 4PDIA 2APLA 4AQYM 2Y20A 1EIJA 3HHYA 1IFYA 3SFZA 3D8LA 3B7QA 1GJSA 4MM3B 3Q8XA 5L8RF 4YY3M 1I4WA 1HR0M 1N36M 2CFOA 2HWJA 3E46A 3J7BA 2DKLA 1R4GA 1UM8A 4LGYA 3GPYA 1EE8A 4B08A 5JI2E 3TWKA 2BJWA 3PNVA 2C99A 1SXJA
chains in the Genus database with same CATH topology
1E9SA 4RF0A 1XMOM 3GLGB 3U61A 2XFTA 5E26A 3KS8A 4LFCM 1VDDA 5E6JA 5KPRA 3VLFB 2DZNB 2XFSA 4I4LA 1L8QA 2XF3A 3MHVC 4LFAM 1N32M 2F5QA 2UUCM 1DO2A 3A98B 4NL4H 4Z6YA 2EO2A 2M5ZA 2XSZD 1YUBA 2HL7A 4FCWA 5EP3A 3RFWA 3L29A 4NSRA 1JQJC 3GPUA 3U6QA 4DV0M 1XMQM 3EIEA 3W0FA 4DV1M 2UXDM 3VKGA 2ZBKB 2LNHC 1NY6A 1FJGM 4AKHA 2V1UA 2G5GX 1SXJE 3LVVA 3K2LA 3KW6A 4L78A 4B3MM 4CGYB 5BR8M 2R45A 5FTLA 3ZCBB 3E9SA 2L09A 1Q3CA 5ITXA 2A5YB 3GLHB 4IBKA 1J5EM 5IREB 2QENA 3WHKA 1QZMA 2D7HA 3MK6A 3DOAA 3HHXA 2DWNA 1NNJA 3ZC7B 1NVMA 4KHPM 1G3IA 2CV2A 4G6ZA 3FUWA 4M9XA 4RNAA 3IG8A 3I51A 4PCZA 5EXTA 1Z5CA 1XWIA 5ITRA 3C58A 4A3VB 4I8OA 3GLIA 3U5ZA 2XEPA 5ITUA 4LJAA 2QZ4A 3U6LA 5KQDA 4JI6M 2DWZB 1ZQ9A 2DZOB 2R4EA 4QHTA 2UU9M 1XNQM 1N34M 3FUVA 1GL6A 5KPZA 1NNUC 2ZAOA 4GITA 4X66M 3FYCA 4OVZB 4DV2M 2YNMD 2AHMA 1XC8A 5EP1A 2KW0A 3AOGA 1NJGA 1TH4A 4LF5M 4PDGA 1G4AE 4B3TM 2CE7A 4GHLA 5FTNA 3KFUG 3GQ5A 3TL4X 4FD2A 4JI4M 4FVMA 3D8BA 1HT1E 3HU1A 3GLFB 1GVNA 3AOEC 4CISA 1H6UA 4HL4A 3GPPA 1HQYE 4CHTB 4GKKM 3U6OA 2XZUA 4DR4M 3FUXA 5EXSA 3A42A 1XXHB 3IG5A 1OFHA 4B7FA 2DWLA 1HNXM 4AKIA 4M9ZA 4MGYE 2KZUA 4DV7M 4IBIA 3PVSA 1IM2A 2K47A 3FD9A 2FOIC 1FNNA 1ORYB 5KPTA 4NRWA 4ZPXA 3VDUA 3DA1A 5ITQA 3TWMA 2QCUA 4L4UA 2XSZA 5EXPA 3UK6A 3J80S 4XGIA 3HU3A 5KQ8A 2D7EA 1KSFX 3L27A 2QP9X 3VDPA 1OJLA 4GC5A 2DWMA 4FCVA 3TWLA 2XZFA 2V1CA 1N75A 1NHWC 1DGHB 3DFZA 4JI5M 4M9SA 2F5SA 2X4AA 4PT5A 3KOWE 2C96A 1TDZA 5EQTA 1IY2A 2RGOA 4JI7M 4QNMA 5A2QS 4JV5M 2UXBM 3L28A 5LMUM 1NHGC 2VQFM 4OW0A 3TQSA 3AOEA 1N33M 4IBGA 5LMNM 4GRIA 3H4MA 3R9XB 1NY5A 2ERCA 2F5NA 1E9RA 2CEAA 3KXEC 4G4NA 3FKEA 3KOXE 5EP2A 1IN7A 4MH0E 4FCTA 3GRVA 4DR3M 4L8RC 8CATA 3U6MA 3LQRA 1IQPA 3U6SA 1G8PA 4LF4M 3A45A 4QNRA 4X62M 2QBYA 4GHAA 3SMSA 4ITQA 2Y0TA 4IBEA 3SAWA 4Z8XA 2KRKA 4LRSA 3LMMA 2V6ZM 3BOSA 4LJ7A 2YFQA 4G4OA 4MGHA 1QYRA 4I81A 5DYIA 5FTJA 2XGNA 5ITYA 1Z5BA 1TDHA 2I7NA 3SAUA 1LV7A 1PM5A 3LVWA 1XNRM 2G8LA 3SC3A 3J7AS 4DUZM 1N77A 1DO0A 2YQZA 1IXRC 2Y21A 4II7A 3RGPA 3AKZA 3GLGA 3CF6E 4AKGA 1OFIA 5KO3A 3PXGA 4B7GA 4DR7M 3SMPA 2HKJA 2OQ4A 3UZUA 2RKOA 4NRVA 4BLCA 1K3WA 1IY1A 3FTEA 4DR5M 2E5LM 4KODA 5ITTA 4WW0A 1Z6TA 1KFVA 3U60B 4QOZC 5ITXE 2O5RA 2Z4SA 4B3RM 3CTWB 2R65A 3M0EA 4XBOA 2NQ8C 4LZZA 3KVWA 5FTMA 1TGUA 3GLHA 2FFJA 4KLNA 2J7OA 4W5WA 4R3DA 3U6EA 3AL0C 3ILKA 4GIPA 3A46A 3WHLA 4JYAM 2CUZA 4M0DA 1QVRA 5IWAM 4IJFA 2C98A 4LJ8A 4GH9A 1G59A 4GMQA 4LF6M 3GP1A 4LGMA 1WXQA 1K3XA 3K8ZA 4JN6A 3PNYA 1PJIA 4X64M 4P16A 3FTDA 2HHHM 4LF9M 4LF8M 3GRUA 1G41A 4LJ4A 2BJVA 2CHQA 4D80A 4FWHA 2W82A 5EP4A 4JI3M 3SBJA 1J09A 1L1ZA 2UUBM 3K92A 4OVZA 1XHBA 4NXMM 4IBBA 3VK7A 4IBDA 1IN8A 2KRUA 1HNZM 2R62A 4MGZE 1MU5A 2FE8A 4AZFA 1X37A 2QPAA 3VFDA 1QAQA 3FTFA 2M60A 3HHWA 1D2NA 2ZANA 3KOYE 5DYGA 4IBFA 3JR4A 4M0WA 2J7NA 1IN5A 3L26A 3GLFA 3L2AA 3VK8A 2OPFA 3HGIA 2F5OA 4QHSA 4QOSA 3SARA 5H37D 3U6CA 3JAMS 3MJ5A 2DHRA 3GO8A 2D7GA 2C9OA 4PD2A 1R2YA 2LH0A 1SXJB 1TH2A 2EUCA 1XXHA 2L7HA 2RGHA 4FW9A 4AG5A 5F3WA 1NSFA 2R18A 3U61B 4LJ9A 2L6OA 4G4QA 3KP1E 4R7GA 1GLNA 5IZ7D 4DV3M 4DUYM 2BNKA 1IBKM 3T38A 4LJ5A 3GRRA 3U6PA 5JI3E 1IXZA 1I94M 1NJFA 1KYIA 2FNAA 3HJSA 4MB7A 3OTOM 3GQ3A 1L2DA 4JI1M 5FTKA 2UXCM 2P5TA 3HWSA 2LWXA 2R4JA 3CF2A 5FSWA 2F5PA 3FYDA 1L1TA 1IBLM 1TH3A 2CHGA 2I7PA 1DGHA 3J2PB 3SHFA 1QAOA 3UGJA 5IT9S 2LXEA 3K1JA 4JI2M 4I5SA 1E32A 3RE8A 1JR3D 3LQQA 3PFIA 3KOZE 1QAMA 4REZA 5FLXS 2HCBA 1T3TA 2XLJA 4JI0M 1Q39A 4AG6A 4NOOB 3DZDA 1Z5AA 4NXNM 4GC9A 1QQWA 4NSOB 1IY0A 2UUAM 1YSYA 3QAUA 3ZH9B 2DXIA 3AV0A 3L25A 1K82A 2KZSA 4BB9A 2C5RA 3KDSE 4LCBA 3SHGB 2Z7JA 1IN4A 1GL7A 1Z59A 1L2CA 3FUTA 3U5ZB 2KXEA 3RGSA 3GLIB 4TUWA 3U6DA 2Z4RA 4GKJM 3J27B 3FUUA 3EIHA 4AI6A 2ZAMA 3JR5A 3AJIB 2KEBA 3GQ4A 2EA0A 3R8FA 1R6BX 5DNYA 4OX9M 1DGBA 4LFBM 1N78A 3I4YA 2Q2EB 4IIWA 4L16A 4LY6A 1SXJD 2VQEM 1MX0A 4IBJA 4DR6M 4KO8A 2XH9A 3M6AA 1E94E 3SYKA 1R2ZA 2CV1A 3UJNA 3SAVA 2JA2A 4FWDA 3HJQA 4LZJA 3NWLA 1GKIA 3T15A 1PJJA 4MGKE 1IN6A 1R7RA 1W5TA 4DV6M 4K0KM 7CATA 4FWGA 4EIWA 1S3SA 2C9CA 4WURA 3SATA 1IXSB 4MGIE 2X8AA 5C18A 1L2BA 3U60A 4LJ6A 2CHVA 5EJCA 4OU7A 5C1BA 1IBMM 2KA6B 3M7GA 4JI8M 1Q3BA 4X65M 1DGGA 4YHHM 4L15A 5BPVA 3KS4A 4D81A 3FTCA 4IBCA 3HU2A 1QANA 3T1YM 4B3SM 3HKPA 3KSJA 1HT2E 3SYLA 3SASA 4G4RA 3HJ8A 3J81S 3CF0A 1ZAEA 3QWLA 1SXJC 4DV5M 4AW4A 3E4RA 1JR3A 2H1RA 5GKNA 1YE9A 3NBIA 2DVWB 3KP0E 5EXXA 2ZM6M 4LRTA 4S12A 3AFHA 4HLQA 4D82A 2YR0A 2CV0A 1C1KA 2Y0QA 2Z3XA 3B9PA 1DGFA 4LF7M 3KSXA 3VKHA 2X49A 2F4VM 4BBAA 3UMMA 3T1HM 1HNWM 1W5SA 4RF1A 3W0LB 4DR1M 3THGA 2R46A 4DR2M 3GRYA 3TPZA 4DV4M 4LG2A 3GPXA 4JXJA 2VIIA 2L7IA 3HHZA 2QBYB 4B7HA 1HQCA 3I4VA 3TE6A 4IJEA 1J7KA 4PDIA 4AQYM 2Y20A 3HHYA 3SFZA 3D8LA 4MM3B 3Q8XA 4YY3M 1I4WA 1HR0M 1N36M 2CFOA 3J7BA 1UM8A 4LGYA 3GPYA 1EE8A 4B08A 5JI2E 3TWKA 2BJWA 3PNVA 2C99A 1SXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 S;  1XMO M;  3JR5 A;  4LFC M;  4LF6 M;  3GP1 A;  3GQ4 A;  3TWL A;  2EA0 A;  2XZF A;  1K3X A;  2HHH M;  1PJI A;  4X64 M;  4JI5 M;  4LFA M;  2F5S A;  4LF9 M;  2F5Q A;  2UUC M;  1N32 M;  4LF8 M;  4OX9 M;  4LFB M;  1TDZ A;  2Q2E B;  4JI7 M;  5A2Q S;  3GPU A;  3U6Q A;  4JV5 M;  2UXB M;  2VQE M;  1MX0 A;  4DR6 M;  4JI3 M;  5LMU M;  4DV0 M;  3SBJ A;  2VQF M;  3W0F A;  4DV1 M;  1XMQ M;  2UXD M;  1L1Z A;  2ZBK B;  2UUB M;  1R2Z A;  1FJG M;  1N33 M;  4NXM M;  3SAV A;  5LMN M;  3VK7 A;  1HNZ M;  2F5N A;  4B3M M;  1MU5 A;  1PJJ A;  4G4N A;  5BR8 M;  4DR3 M;  4DV6 M;  4K0K M;  1Q3C A;  3U6M A;  3JR4 A;  5ITX A;  3U6S A;  4LF4 M;  3A45 A;  1J5E M;  3VK8 A;  2OPF A;  2F5O A;  3SAT A;  4X62 M;  3SAR A;  3DOA A;  3U6C A;  3JAM S;  1L2B A;  1NNJ A;  4ITQ A;  3GO8 A;  1IBM M;  4PD2 A;  1R2Y A;  4KHP M;  4JI8 M;  1Q3B A;  3SAW A;  4X65 M;  4YHH M;  4G4Q A;  4DV3 M;  4G4O A;  3T1Y M;  4DUY M;  4B3S M;  4PCZ A;  1IBK M;  1Z5C A;  5ITR A;  3C58 A;  3SAS A;  4G4R A;  3J81 S;  5ITU A;  3U6L A;  3U6P A;  4JI6 M;  5ITY A;  1Z5B A;  4DV5 M;  1TDH A;  1I94 M;  3SAU A;  4MB7 A;  3GQ3 A;  3OTO M;  1PM5 A;  1XNR M;  1L2D A;  3J7A S;  4JI1 M;  4DUZ M;  2UU9 M;  2UXC M;  1XNQ M;  1N34 M;  2ZM6 M;  4X66 M;  2F5P A;  4DV2 M;  1L1T A;  1IBL M;  1XC8 A;  4DR7 M;  4LF5 M;  2HKJ A;  4PDG A;  2OQ4 A;  4LF7 M;  4B3T M;  5IT9 S;  2F4V M;  3GQ5 A;  4NRV A;  3T1H M;  4JI2 M;  1K3W A;  4JI4 M;  1HNW M;  4DR1 M;  4DR5 M;  2E5L M;  4DR2 M;  4DV4 M;  5FLX S;  4CIS A;  5ITT A;  3GPX A;  4GKJ M;  3GPP A;  4JI0 M;  4GKK M;  1Q39 A;  4PDI A;  1KFV A;  3U6O A;  2XZU A;  5ITX E;  4DR4 M;  1Z5A A;  4AQY M;  4NXN M;  3A42 A;  2UUA M;  4B3R M;  1K82 A;  1HNX M;  4DV7 M;  4YY3 M;  1Z59 A;  1N36 M;  1L2C A;  1HR0 M;  4NRW A;  3A46 A;  5ITQ A;  3GPY A;  1EE8 A;  3U6D A;  3TWM A;  3TWK A;  4JYA M;  3U6E A;  5IWA M; 
#chains in the Genus database with same CATH topology
 1E9S A;  4RF0 A;  1XMO M;  3GLG B;  3U61 A;  2XFT A;  5E26 A;  3KS8 A;  4LFC M;  1PJQ A;  1VDD A;  5E6J A;  5KPR A;  3VLF B;  2DZN B;  1SG9 A;  2XFS A;  4I4L A;  1L8Q A;  2XF3 A;  3MHV C;  4LFA M;  1N32 M;  2F5Q A;  2UUC M;  1DO2 A;  2JY6 B;  1PJS A;  3A98 B;  4NL4 H;  4Z6Y A;  2EO2 A;  2M5Z A;  2XSZ D;  1YUB A;  2HL7 A;  4FCW A;  5EP3 A;  3RFW A;  3L29 A;  4NSR A;  1JQJ C;  3GPU A;  3U6Q A;  2VF7 A;  4DV0 M;  4DBG B;  1XMQ M;  3EIE A;  3W0F A;  4DV1 M;  2UXD M;  3VKG A;  1OIP A;  2ZBK B;  2LNH C;  1NY6 A;  1FJG M;  4AKH A;  2V1U A;  2G5G X;  1SXJ E;  3LVV A;  3FRH A;  2BWB A;  3K2L A;  3KW6 A;  1R5L A;  4L78 A;  5DFL A;  4B3M M;  4CGY B;  2RRU A;  5BR8 M;  2R45 A;  5FTL A;  3ZCB B;  3E9S A;  2L09 A;  1Q3C A;  5ITX A;  2A5Y B;  3GLH B;  4IBK A;  1J5E M;  5IRE B;  2QEN A;  3WHK A;  1QZM A;  2D7H A;  3MK6 A;  2J5Y A;  3DOA A;  3HHX A;  2DWN A;  2QSF X;  2DAG A;  1NNJ A;  3ZC7 B;  1NVM A;  4KHP M;  1G3I A;  2WSE F;  2CV2 A;  1QDR A;  4G6Z A;  2MGW A;  3FUW A;  4G3O A;  2LVQ D;  4M9X A;  4RNA A;  3IG8 A;  3I51 A;  2QHO B;  2R0I A;  4PCZ A;  5EXT A;  4ANR A;  2LVP C;  1Z5C A;  1XWI A;  5ITR A;  3C58 A;  4A3V B;  4I8O A;  2MJ5 B;  3GLI A;  2O25 A;  3T6P A;  2N35 A;  2XEP A;  4LJA A;  2QZ4 A;  5ITU A;  1TF0 B;  1V92 A;  3C9P A;  2DWZ B;  1T43 A;  1ZQ9 A;  2L4F A;  2FH0 A;  2QNJ A;  5KQD A;  2DZO B;  2R4E A;  4QHT A;  2UU9 M;  1XNQ M;  1N34 M;  3FUV A;  1GL6 A;  1OKS A;  5KPZ A;  1NNU C;  2ZAO A;  4GIT A;  4JI6 M;  4X66 M;  3FYC A;  4OVZ B;  4DV2 M;  2YNM D;  2AHM A;  1XC8 A;  2GQF A;  5EP1 A;  2KW0 A;  3AOG A;  3LW5 F;  1NJG A;  1TH4 A;  4LF5 M;  1ZMW A;  4PDG A;  1G4A E;  4B3T M;  2CE7 A;  4GHL A;  2WSF F;  5FTN A;  3KFU G;  3GQ5 A;  3TL4 X;  4FD2 A;  4JI4 M;  1F4I A;  4FVM A;  3D8B A;  1HT1 E;  3HU1 A;  3GLF B;  1GVN A;  1VQ1 A;  3AOE C;  4P17 A;  4GEW A;  3GLI E;  4CIS A;  1VEJ A;  1H6U A;  3B7N A;  4HL4 A;  1HQY E;  4CHT B;  3GPP A;  2KNV A;  4GKK M;  3Q8G A;  3U6O A;  4F1I A;  2XZU A;  3FUX A;  4DR4 M;  5EXS A;  1G71 A;  1QZE A;  1WGL A;  3A42 A;  1XXH B;  3IG5 A;  1OFH A;  4B7F A;  2CRU A;  2DWL A;  2DZL A;  2L4E A;  1T6O A;  4KT0 F;  1HNX M;  4AKI A;  4M9Z A;  4MGY E;  2KZU A;  4DV7 M;  4IBI A;  3PVS A;  3BBZ A;  1IM2 A;  2K47 A;  3FD9 A;  1QUS A;  2FOI C;  1FNN A;  1ORY B;  5KPT A;  4NRW A;  1IXS A;  4ZPX A;  3VDU A;  2JZ0 A;  3DA1 A;  5ITQ A;  1ZMV A;  3TWM A;  2QCU A;  4L4U A;  2XSZ A;  5EXP A;  1AUA A;  3UK6 A;  3J80 S;  4XGI A;  3HU3 A;  5KQ8 A;  2D7E A;  1KSF X;  3L27 A;  1V33 A;  2QP9 X;  3VDP A;  1NV8 A;  1OJL A;  2EKF A;  4GC5 A;  3H4J A;  2DWM A;  4FCV A;  3TWL A;  2XZF A;  2V1C A;  1N75 A;  1NHW C;  1OQY A;  1Q02 A;  1DGH B;  3DFZ A;  4JI5 M;  4M9S A;  2F5S A;  2R6F A;  2X4A A;  4PT5 A;  3KOW E;  2C96 A;  1TDZ A;  5EQT A;  1IY2 A;  1EFU B;  2RGO A;  1LTM A;  4JI7 M;  4QNM A;  5A2Q S;  3QYB A;  4JV5 M;  2UXB M;  3L28 A;  4HEO A;  3K9P A;  1NHG C;  5LMU M;  2K6B A;  2VQF M;  4OW0 A;  3TQS A;  3AOE A;  1N33 M;  4IBG A;  2O01 F;  1D0M A;  5LMN M;  4GRI A;  3H4M A;  3R9X B;  1NY5 A;  2ERC A;  2F5N A;  1E9R A;  2CEA A;  3KXE C;  4G4N A;  3FKE A;  3KOX E;  5EP2 A;  1IN7 A;  1D0L A;  4MH0 E;  1V34 A;  4FCT A;  3GRV A;  4WP2 A;  4DR3 M;  2JNH A;  4L8R C;  8CAT A;  3U6M A;  2MR9 A;  2LHG A;  3LQR A;  1IQP A;  3U6S A;  1G8P A;  4LF4 M;  3A45 A;  2HAK A;  1WIV A;  1Y8G A;  4R71 A;  3B74 A;  4QNR A;  4X62 M;  2QBY A;  4GHA A;  3SMS A;  4ITQ A;  2Y0T A;  4IBE A;  3SAW A;  4Z8X A;  2KRK A;  2WZJ A;  4LRS A;  3LMM A;  2V6Z M;  1AIP C;  3BOS A;  4LJ7 A;  2YFQ A;  3NBX X;  4G4O A;  4MGH A;  1QYR A;  4I81 A;  5DYI A;  2EJS A;  2R44 A;  3ZQJ A;  5FTJ A;  2XGN A;  5ITY A;  1Z5B A;  1TDH A;  2I7N A;  3SAU A;  1LV7 A;  1PM5 A;  3LVW A;  1XNR M;  2G8L A;  3SC3 A;  3J7A S;  4DUZ M;  2JY5 A;  1N77 A;  1P3Q Q;  1DO0 A;  1XB2 B;  2YQZ A;  1IXR C;  2Y21 A;  4II7 A;  1ZV1 A;  3RGP A;  3AKZ A;  3GLG A;  4UN2 B;  3CF6 E;  4AKG A;  1OFI A;  5KO3 A;  2OOA A;  3PXG A;  4B7G A;  4DR7 M;  3SMP A;  2LBC A;  2HKJ A;  3V76 A;  2OQ4 A;  3UZU A;  2B3T A;  3I01 M;  3U6L A;  2RKO A;  4NRV A;  4BLC A;  1K3W A;  1IY1 A;  3FTE A;  4DR5 M;  2E5L M;  1VEK A;  2LVA A;  4KOD A;  5ITT A;  4WW0 A;  1Z6T A;  2OOB A;  2BWE A;  1KFV A;  3U60 B;  4QOZ C;  1NO1 A;  5ITX E;  1QUT A;  2OO9 A;  3W67 A;  2O5R A;  2Z4S A;  4B3R M;  1OIZ A;  2CWB A;  3CTW B;  2R65 A;  3M0E A;  4XBO A;  2NQ8 C;  4LZZ A;  3QYE A;  3KVW A;  5FTM A;  1TGU A;  3GLH A;  2FFJ A;  4KLN A;  2J7O A;  4W5W A;  4R3D A;  3U6E A;  3AL0 C;  3ILK A;  4GIP A;  3A46 A;  1BVS A;  2LHC A;  2JZ1 A;  3K9O A;  3WHL A;  4JYA M;  2CUZ A;  4M0D A;  1QVR A;  5IWA M;  3F92 A;  1MJG M;  4IJF A;  2C98 A;  4LJ8 A;  4GH9 A;  1G59 A;  1JB0 F;  4GMQ A;  3BXW A;  4LF6 M;  3GP1 A;  4LGM A;  3IHP A;  1HJP A;  1WXQ A;  2FS1 A;  1K3X A;  3K8Z A;  4JN6 A;  3PNY A;  1PJI A;  4X64 M;  4P16 A;  3FTD A;  2HHH M;  4LF9 M;  1OTR A;  4LF8 M;  3GRU A;  1G41 A;  4LJ4 A;  2BJV A;  2CHQ A;  3GLH E;  4FWH A;  4D80 A;  2W82 A;  5EP4 A;  2ZTC A;  2DAE A;  2JP7 A;  4JI3 M;  1J09 A;  3SBJ A;  1L1Z A;  4NC6 A;  2UUB M;  3K92 A;  4OVZ A;  1XHB A;  4NXM M;  4IBB A;  2KHH A;  3VK7 A;  4IBD A;  1IN8 A;  2KRU A;  2JY8 A;  2R62 A;  1A5T A;  1HNZ M;  4MGZ E;  1MU5 A;  2FE8 A;  4AZF A;  1X37 A;  2GNO A;  2QPA A;  3VFD A;  1QAQ A;  2G3Q A;  3FTF A;  2M60 A;  3HHW A;  1D2N A;  2ZAN A;  3KOY E;  5DYG A;  4XK8 F;  4IBF A;  3JR4 A;  4M0W A;  2LVO C;  1IN5 A;  2J7N A;  3L26 A;  3GLF A;  1MN3 A;  3L2A A;  3VK8 A;  2OPF A;  3HGI A;  2F5O A;  2K9D A;  4QHS A;  4QOS A;  3SAR A;  5H37 D;  3U6C A;  1WHC A;  4Y28 F;  3JAM S;  3MJ5 A;  4F2L A;  2DHR A;  3GO8 A;  2D7G A;  2C9O A;  4PD2 A;  3I04 M;  1R2Y A;  2LH0 A;  1SXJ B;  1TH2 A;  2EUC A;  1XXH A;  2L7H A;  2RGH A;  4FW9 A;  4AG5 A;  5F3W A;  3HY5 A;  3B89 A;  1NSF A;  2R18 A;  3U61 B;  2DAM A;  1DV0 A;  3B7Z A;  4LJ9 A;  2L6O A;  4G4Q A;  3KP1 E;  4R7G A;  1GLN A;  5IZ7 D;  4DV3 M;  1VDL A;  4DUY M;  2DAI A;  2BNK A;  1IBK M;  3T38 A;  4LJ5 A;  3GRR A;  3U6P A;  5JI3 E;  1IXZ A;  1I94 M;  3GLF E;  1NJF A;  1KYI A;  2FNA A;  3HJS A;  4MB7 A;  3OTO M;  1RU3 A;  3GQ3 A;  1L2D A;  4JI1 M;  5FTK A;  2UXC M;  2P5T A;  3HWS A;  4L6V 6;  2H5X A;  2LWX A;  2R4J A;  1WGN A;  3CF2 A;  5FSW A;  2F5P A;  3FYD A;  2DI0 A;  2WSC F;  1L1T A;  1IBL M;  1TH3 A;  1OAI A;  4CJ6 A;  1XXH E;  2CHG A;  2I7P A;  1DGH A;  3J2P B;  3SHF A;  1QAO A;  1VEG A;  3UGJ A;  2MRO B;  5IT9 S;  2LXE A;  3K1J A;  1VG5 A;  4JI2 M;  4I5S A;  1E32 A;  3RE8 A;  1JR3 D;  3LQQ A;  1TR8 A;  2CP8 A;  2DNA A;  3PFI A;  3KOZ E;  1QAM A;  2MH8 A;  4REZ A;  5FLX S;  2HCB A;  1T3T A;  3MMP A;  1PGY A;  2XLJ A;  4JI0 M;  1Q39 A;  4AG6 A;  4NOO B;  2EKK A;  3DZD A;  1Z5A A;  3LCU A;  4NXN M;  4GC9 A;  1QQW A;  4NSO B;  1OAO C;  1IY0 A;  2UUA M;  1YSY A;  1PJT A;  1GJT A;  3QAU A;  3ZH9 B;  3FRI A;  2DXI A;  3AV0 A;  3U5Z A;  1K82 A;  3L25 A;  2KZS A;  4BB9 A;  2C5R A;  3KDS E;  4LCB A;  3SHG B;  2Z7J A;  1YLA A;  2VF8 A;  2DAK A;  1IN4 A;  1GL7 A;  3CGW A;  1Z59 A;  1L2C A;  3FUT A;  3U5Z B;  2KXE A;  3RGS A;  3GLI B;  4TUW A;  2JXN A;  3U6D A;  2ZTD A;  2Z4R A;  4GKJ M;  3J27 B;  3FUU A;  3EIH A;  4AI6 A;  2LVN C;  2ZAM A;  2JUJ A;  3JR5 A;  3AJI B;  2KEB A;  2VDB B;  2K0B X;  3GQ4 A;  2EA0 A;  3IEC A;  4CIZ A;  3R8F A;  1QDT A;  1GO5 A;  1R6B X;  5DNY A;  3GLG E;  2JY7 A;  4OX9 M;  1DGB A;  4LFB M;  1N78 A;  3I4Y A;  2Q2E B;  1WJ7 A;  4IIW A;  4L16 A;  4LY6 A;  3W68 A;  1SXJ D;  1CUK A;  3LCV B;  2VQE M;  1MX0 A;  4IBJ A;  3C3D A;  4DR6 M;  4KO8 A;  2XH9 A;  3M6A A;  1E94 E;  3SYK A;  1R2Z A;  2QQ8 A;  2CV1 A;  3UJN A;  3SAV A;  1WR1 B;  3FE3 A;  2JA2 A;  4FWD A;  3HJQ A;  2DEN A;  3NWL A;  4LZJ A;  1GKI A;  4Q7J A;  3T15 A;  1PJJ A;  4MGK E;  1IN6 A;  2KDL A;  1R7R A;  1W5T A;  4DV6 M;  4K0K M;  7CAT A;  4FWG A;  1PRB A;  4EIW A;  1S3S A;  3HX3 A;  2C9C A;  4WUR A;  2JWS A;  1ZMU A;  3SAT A;  1IXS B;  4MGI E;  2X8A A;  5C18 A;  1L2B A;  3U60 A;  4LJ6 A;  2CHV A;  5EJC A;  4OU7 A;  5C1B A;  1IBM M;  2KA6 B;  3M7G A;  4JI8 M;  1Q3B A;  4X65 M;  1DGG A;  2DHY A;  4YHH M;  4L15 A;  5BPV A;  3KS4 A;  4D81 A;  1NV9 A;  3FTC A;  4IBC A;  3HU2 A;  1QAN A;  3T1Y M;  4B3S M;  3HKP A;  3KSJ A;  1GAB A;  1HT2 E;  3SYL A;  3SAS A;  4RKU F;  4G4R A;  3HJ8 A;  3J81 S;  3CF0 A;  1ZAE A;  3QWL A;  3HZJ A;  1SXJ C;  4DV5 M;  4AW4 A;  3E21 A;  2L2D A;  3E4R A;  2KNA A;  3C3E A;  1JR3 A;  2H1R A;  5GKN A;  1YE9 A;  3NBI A;  2DVW B;  3KP0 E;  5EXX A;  1C7Y A;  2ZM6 M;  4LRT A;  4S12 A;  3AFH A;  4HLQ A;  4D82 A;  2YR0 A;  2CV0 A;  1C1K A;  2Y0Q A;  2Z3X A;  3B9P A;  1DGF A;  1UFZ A;  4LF7 M;  3KSX A;  3VKH A;  2X49 A;  2F4V M;  4BBA A;  2LTU A;  3UMM A;  3T1H M;  1HNW M;  1W5S A;  4RF1 A;  3W0L B;  2KNZ A;  4DR1 M;  1TTE A;  3THG A;  2R46 A;  4DR2 M;  3GRY A;  3TPZ A;  4DV4 M;  4LG2 A;  3GPX A;  4JXJ A;  2Z8Y M;  2VII A;  2L7I A;  3HHZ A;  2QBY B;  4B7H A;  1D0K A;  1HQC A;  1JR3 E;  3I4V A;  4IJE A;  1J7K A;  3TE6 A;  4PDI A;  2APL A;  4AQY M;  2Y20 A;  1EIJ A;  3HHY A;  1IFY A;  3SFZ A;  3D8L A;  3B7Q A;  1GJS A;  4MM3 B;  3Q8X A;  5L8R F;  4YY3 M;  1I4W A;  1HR0 M;  1N36 M;  2CFO A;  2HWJ A;  3E46 A;  3J7B A;  2DKL A;  1R4G A;  1UM8 A;  4LGY A;  3GPY A;  1EE8 A;  4B08 A;  5JI2 E;  3TWK A;  2BJW A;  3PNV A;  2C99 A;  1SXJ A; 
#chains in the Genus database with same CATH homology
 1E9S A;  4RF0 A;  1XMO M;  3GLG B;  3U61 A;  2XFT A;  5E26 A;  3KS8 A;  4LFC M;  1VDD A;  5E6J A;  5KPR A;  3VLF B;  2DZN B;  2XFS A;  4I4L A;  1L8Q A;  2XF3 A;  3MHV C;  4LFA M;  1N32 M;  2F5Q A;  2UUC M;  1DO2 A;  3A98 B;  4NL4 H;  4Z6Y A;  2EO2 A;  2M5Z A;  2XSZ D;  1YUB A;  2HL7 A;  4FCW A;  5EP3 A;  3RFW A;  3L29 A;  4NSR A;  1JQJ C;  3GPU A;  3U6Q A;  4DV0 M;  1XMQ M;  3EIE A;  3W0F A;  4DV1 M;  2UXD M;  3VKG A;  2ZBK B;  2LNH C;  1NY6 A;  1FJG M;  4AKH A;  2V1U A;  2G5G X;  1SXJ E;  3LVV A;  3K2L A;  3KW6 A;  4L78 A;  4B3M M;  4CGY B;  5BR8 M;  2R45 A;  5FTL A;  3ZCB B;  3E9S A;  2L09 A;  1Q3C A;  5ITX A;  2A5Y B;  3GLH B;  4IBK A;  1J5E M;  5IRE B;  2QEN A;  3WHK A;  1QZM A;  2D7H A;  3MK6 A;  3DOA A;  3HHX A;  2DWN A;  1NNJ A;  3ZC7 B;  1NVM A;  4KHP M;  1G3I A;  2CV2 A;  4G6Z A;  3FUW A;  4M9X A;  4RNA A;  3IG8 A;  3I51 A;  4PCZ A;  5EXT A;  1Z5C A;  1XWI A;  5ITR A;  3C58 A;  4A3V B;  4I8O A;  3GLI A;  3U5Z A;  2XEP A;  5ITU A;  4LJA A;  2QZ4 A;  3U6L A;  5KQD A;  4JI6 M;  2DWZ B;  1ZQ9 A;  2DZO B;  2R4E A;  4QHT A;  2UU9 M;  1XNQ M;  1N34 M;  3FUV A;  1GL6 A;  5KPZ A;  1NNU C;  2ZAO A;  4GIT A;  4X66 M;  3FYC A;  4OVZ B;  4DV2 M;  2YNM D;  2AHM A;  1XC8 A;  5EP1 A;  2KW0 A;  3AOG A;  1NJG A;  1TH4 A;  4LF5 M;  4PDG A;  1G4A E;  4B3T M;  2CE7 A;  4GHL A;  5FTN A;  3KFU G;  3GQ5 A;  3TL4 X;  4FD2 A;  4JI4 M;  4FVM A;  3D8B A;  1HT1 E;  3HU1 A;  3GLF B;  1GVN A;  3AOE C;  4CIS A;  1H6U A;  4HL4 A;  3GPP A;  1HQY E;  4CHT B;  4GKK M;  3U6O A;  2XZU A;  4DR4 M;  3FUX A;  5EXS A;  3A42 A;  1XXH B;  3IG5 A;  1OFH A;  4B7F A;  2DWL A;  1HNX M;  4AKI A;  4M9Z A;  4MGY E;  2KZU A;  4DV7 M;  4IBI A;  3PVS A;  1IM2 A;  2K47 A;  3FD9 A;  2FOI C;  1FNN A;  1ORY B;  5KPT A;  4NRW A;  4ZPX A;  3VDU A;  3DA1 A;  5ITQ A;  3TWM A;  2QCU A;  4L4U A;  2XSZ A;  5EXP A;  3UK6 A;  3J80 S;  4XGI A;  3HU3 A;  5KQ8 A;  2D7E A;  1KSF X;  3L27 A;  2QP9 X;  3VDP A;  1OJL A;  4GC5 A;  2DWM A;  4FCV A;  3TWL A;  2XZF A;  2V1C A;  1N75 A;  1NHW C;  1DGH B;  3DFZ A;  4JI5 M;  4M9S A;  2F5S A;  2X4A A;  4PT5 A;  3KOW E;  2C96 A;  1TDZ A;  5EQT A;  1IY2 A;  2RGO A;  4JI7 M;  4QNM A;  5A2Q S;  4JV5 M;  2UXB M;  3L28 A;  5LMU M;  1NHG C;  2VQF M;  4OW0 A;  3TQS A;  3AOE A;  1N33 M;  4IBG A;  5LMN M;  4GRI A;  3H4M A;  3R9X B;  1NY5 A;  2ERC A;  2F5N A;  1E9R A;  2CEA A;  3KXE C;  4G4N A;  3FKE A;  3KOX E;  5EP2 A;  1IN7 A;  4MH0 E;  4FCT A;  3GRV A;  4DR3 M;  4L8R C;  8CAT A;  3U6M A;  3LQR A;  1IQP A;  3U6S A;  1G8P A;  4LF4 M;  3A45 A;  4QNR A;  4X62 M;  2QBY A;  4GHA A;  3SMS A;  4ITQ A;  2Y0T A;  4IBE A;  3SAW A;  4Z8X A;  2KRK A;  4LRS A;  3LMM A;  2V6Z M;  3BOS A;  4LJ7 A;  2YFQ A;  4G4O A;  4MGH A;  1QYR A;  4I81 A;  5DYI A;  5FTJ A;  2XGN A;  5ITY A;  1Z5B A;  1TDH A;  2I7N A;  3SAU A;  1LV7 A;  1PM5 A;  3LVW A;  1XNR M;  2G8L A;  3SC3 A;  3J7A S;  4DUZ M;  1N77 A;  1DO0 A;  2YQZ A;  1IXR C;  2Y21 A;  4II7 A;  3RGP A;  3AKZ A;  3GLG A;  3CF6 E;  4AKG A;  1OFI A;  5KO3 A;  3PXG A;  4B7G A;  4DR7 M;  3SMP A;  2HKJ A;  2OQ4 A;  3UZU A;  2RKO A;  4NRV A;  4BLC A;  1K3W A;  1IY1 A;  3FTE A;  4DR5 M;  2E5L M;  4KOD A;  5ITT A;  4WW0 A;  1Z6T A;  1KFV A;  3U60 B;  4QOZ C;  5ITX E;  2O5R A;  2Z4S A;  4B3R M;  3CTW B;  2R65 A;  3M0E A;  4XBO A;  2NQ8 C;  4LZZ A;  3KVW A;  5FTM A;  1TGU A;  3GLH A;  2FFJ A;  4KLN A;  2J7O A;  4W5W A;  4R3D A;  3U6E A;  3AL0 C;  3ILK A;  4GIP A;  3A46 A;  3WHL A;  4JYA M;  2CUZ A;  4M0D A;  1QVR A;  5IWA M;  4IJF A;  2C98 A;  4LJ8 A;  4GH9 A;  1G59 A;  4GMQ A;  4LF6 M;  3GP1 A;  4LGM A;  1WXQ A;  1K3X A;  3K8Z A;  4JN6 A;  3PNY A;  1PJI A;  4X64 M;  4P16 A;  3FTD A;  2HHH M;  4LF9 M;  4LF8 M;  3GRU A;  1G41 A;  4LJ4 A;  2BJV A;  2CHQ A;  4D80 A;  4FWH A;  2W82 A;  5EP4 A;  4JI3 M;  3SBJ A;  1J09 A;  1L1Z A;  2UUB M;  3K92 A;  4OVZ A;  1XHB A;  4NXM M;  4IBB A;  3VK7 A;  4IBD A;  1IN8 A;  2KRU A;  1HNZ M;  2R62 A;  4MGZ E;  1MU5 A;  2FE8 A;  4AZF A;  1X37 A;  2QPA A;  3VFD A;  1QAQ A;  3FTF A;  2M60 A;  3HHW A;  1D2N A;  2ZAN A;  3KOY E;  5DYG A;  4IBF A;  3JR4 A;  4M0W A;  2J7N A;  1IN5 A;  3L26 A;  3GLF A;  3L2A A;  3VK8 A;  2OPF A;  3HGI A;  2F5O A;  4QHS A;  4QOS A;  3SAR A;  5H37 D;  3U6C A;  3JAM S;  3MJ5 A;  2DHR A;  3GO8 A;  2D7G A;  2C9O A;  4PD2 A;  1R2Y A;  2LH0 A;  1SXJ B;  1TH2 A;  2EUC A;  1XXH A;  2L7H A;  2RGH A;  4FW9 A;  4AG5 A;  5F3W A;  1NSF A;  2R18 A;  3U61 B;  4LJ9 A;  2L6O A;  4G4Q A;  3KP1 E;  4R7G A;  1GLN A;  5IZ7 D;  4DV3 M;  4DUY M;  2BNK A;  1IBK M;  3T38 A;  4LJ5 A;  3GRR A;  3U6P A;  5JI3 E;  1IXZ A;  1I94 M;  1NJF A;  1KYI A;  2FNA A;  3HJS A;  4MB7 A;  3OTO M;  3GQ3 A;  1L2D A;  4JI1 M;  5FTK A;  2UXC M;  2P5T A;  3HWS A;  2LWX A;  2R4J A;  3CF2 A;  5FSW A;  2F5P A;  3FYD A;  1L1T A;  1IBL M;  1TH3 A;  2CHG A;  2I7P A;  1DGH A;  3J2P B;  3SHF A;  1QAO A;  3UGJ A;  5IT9 S;  2LXE A;  3K1J A;  4JI2 M;  4I5S A;  1E32 A;  3RE8 A;  1JR3 D;  3LQQ A;  3PFI A;  3KOZ E;  1QAM A;  4REZ A;  5FLX S;  2HCB A;  1T3T A;  2XLJ A;  4JI0 M;  1Q39 A;  4AG6 A;  4NOO B;  3DZD A;  1Z5A A;  4NXN M;  4GC9 A;  1QQW A;  4NSO B;  1IY0 A;  2UUA M;  1YSY A;  3QAU A;  3ZH9 B;  2DXI A;  3AV0 A;  3L25 A;  1K82 A;  2KZS A;  4BB9 A;  2C5R A;  3KDS E;  4LCB A;  3SHG B;  2Z7J A;  1IN4 A;  1GL7 A;  1Z59 A;  1L2C A;  3FUT A;  3U5Z B;  2KXE A;  3RGS A;  3GLI B;  4TUW A;  3U6D A;  2Z4R A;  4GKJ M;  3J27 B;  3FUU A;  3EIH A;  4AI6 A;  2ZAM A;  3JR5 A;  3AJI B;  2KEB A;  3GQ4 A;  2EA0 A;  3R8F A;  1R6B X;  5DNY A;  4OX9 M;  1DGB A;  4LFB M;  1N78 A;  3I4Y A;  2Q2E B;  4IIW A;  4L16 A;  4LY6 A;  1SXJ D;  2VQE M;  1MX0 A;  4IBJ A;  4DR6 M;  4KO8 A;  2XH9 A;  3M6A A;  1E94 E;  3SYK A;  1R2Z A;  2CV1 A;  3UJN A;  3SAV A;  2JA2 A;  4FWD A;  3HJQ A;  4LZJ A;  3NWL A;  1GKI A;  3T15 A;  1PJJ A;  4MGK E;  1IN6 A;  1R7R A;  1W5T A;  4DV6 M;  4K0K M;  7CAT A;  4FWG A;  4EIW A;  1S3S A;  2C9C A;  4WUR A;  3SAT A;  1IXS B;  4MGI E;  2X8A A;  5C18 A;  1L2B A;  3U60 A;  4LJ6 A;  2CHV A;  5EJC A;  4OU7 A;  5C1B A;  1IBM M;  2KA6 B;  3M7G A;  4JI8 M;  1Q3B A;  4X65 M;  1DGG A;  4YHH M;  4L15 A;  5BPV A;  3KS4 A;  4D81 A;  3FTC A;  4IBC A;  3HU2 A;  1QAN A;  3T1Y M;  4B3S M;  3HKP A;  3KSJ A;  1HT2 E;  3SYL A;  3SAS A;  4G4R A;  3HJ8 A;  3J81 S;  3CF0 A;  1ZAE A;  3QWL A;  1SXJ C;  4DV5 M;  4AW4 A;  3E4R A;  1JR3 A;  2H1R A;  5GKN A;  1YE9 A;  3NBI A;  2DVW B;  3KP0 E;  5EXX A;  2ZM6 M;  4LRT A;  4S12 A;  3AFH A;  4HLQ A;  4D82 A;  2YR0 A;  2CV0 A;  1C1K A;  2Y0Q A;  2Z3X A;  3B9P A;  1DGF A;  4LF7 M;  3KSX A;  3VKH A;  2X49 A;  2F4V M;  4BBA A;  3UMM A;  3T1H M;  1HNW M;  1W5S A;  4RF1 A;  3W0L B;  4DR1 M;  3THG A;  2R46 A;  4DR2 M;  3GRY A;  3TPZ A;  4DV4 M;  4LG2 A;  3GPX A;  4JXJ A;  2VII A;  2L7I A;  3HHZ A;  2QBY B;  4B7H A;  1HQC A;  3I4V A;  3TE6 A;  4IJE A;  1J7K A;  4PDI A;  4AQY M;  2Y20 A;  3HHY A;  3SFZ A;  3D8L A;  4MM3 B;  3Q8X A;  4YY3 M;  1I4W A;  1HR0 M;  1N36 M;  2CFO A;  3J7B A;  1UM8 A;  4LGY A;  3GPY A;  1EE8 A;  4B08 A;  5JI2 E;  3TWK A;  2BJW A;  3PNV A;  2C99 A;  1SXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...