2J5YA

Crystal structure of the ga module from f.magna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
b'LVPRGSHMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTOSTREPTOCOCCAL ALBUMIN-BINDING PROTEIN
publication title Crystal Structure of a Bacterial Albumin-Binding Domain at 1.4A Resolution.
pubmed doi rcsb
source organism Peptostreptococcus magnus
molecule tags Protein binding
total genus 22
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2j5yA00
2KDLA 2N35A 2FS1A 2LHGA 2MH8A 2J5YA 2LHCA 2JWSA 1PRBA 1GABA 2VDBB 1GJTA 1GJSA 1TF0B
chains in the Genus database with same CATH superfamily
2X4AA 3GRYA 3L26A 2NQ8C 1IFYA 3AKZA 1D0LA 3QYBA 5ITUA 3IG5A 3MJ5A 4L6V6 4NRVA 4LFAM 4I4LA 2VF7A 1JQJC 4AG6A 4L8RC 2Y21A 4LG2A 4Y28F 2O01F 4K0KM 2KHHA 2EKFA 2JY8A 4HEOA 4BLCA 3J81S 3W67A 2R46A 4R71A 2DZOB 2YNMD 2XH9A 2R4EA 3R8FA 1PM5A 2R18A 3RE8A 4M0DA 5DYIA 1F4IA 1RU3A 4Z6YA 5EP2A 3KSJA 3L28A 4GHAA 4P16A 4DR2M 1SXJC 4NC6A 4JI5M 3K8ZA 3U6DA 5ITTA 1KYIA 3GLHA 2DKLA 4ITQA 4GKJM 2KDLA 2OPFA 1VQ1A 3C58A 4KHPM 4IJFA 1HT1E 3THGA 4JN6A 5ITYA 2EJSA 2QPAA 4FVMA 5LMNM 4DR3M 2C99A 4XBOA 4NXNM 2K47A 4HLQA 5BPVA 2DWNA 4NXMM 2MR9A 2J7OA 2Z4SA 2UUCM 1G3IA 3C3EA 4B7HA 2K9DA 3MHVC 1PGYA 1ZMUA 2HAKA 3PXGA 2ZTDA 4LJ7A 3T6PA 2AHMA 1IBKM 3HJSA 5KQDA 3A42A 3IHPA 3MK6A 5KQ8A 3VLFB 3GQ4A 5DFLA 1NY6A 3IECA 3SMPA 3SAWA 3GQ3A 2O25A 1TTEA 1N36M 1TH3A 2W82A 2A5YB 3Q8XA 4LZZA 4NOOB 1Q3CA 4DV0M 1HQYE 3AV0A 5FTJA 1G41A 3FRHA 1ZQ9A 4PDGA 3GLHE 2E5LM 3B89A 2ZAOA 3U6CA 2EUCA 1HNWM 2UXBM 5ITRA 1HR0M 2L4EA 3TPZA 3T15A 3CGWA 4DV6M 5KPZA 1L8QA 2GQFA 4DV4M 3SFZA 1N34M 3RGSA 3E4RA 2Q2EB 2Z4RA 2C9CA 3KOWE 3B9PA 2FE8A 4F1IA 4G6ZA 2MROB 3KDSE 2DVWB 2JXNA 5EP1A 3KP0E 4D81A 1N75A 2F5SA 3RGPA 3JAMS 2XZUA 3M0EA 1IN5A 3GLIB 2HWJA 3T38A 2KXEA 1A5TA 3FRIA 4P17A 3CTWB 3RFWA 3B7QA 3FUXA 4OVZB 3KS8A 3GPPA 3L27A 2QP9X 4R3DA 5DNYA 4RF0A 3K92A 1GKIA 1VG5A 2CFOA 2L6OA 2CHVA 2OOBA 3DOAA 4LGYA 4PDIA 2LVQD 2DENA 2FOIC 1MX0A 2EKKA 3FTCA 4MGIE 3FTDA 2YQZA 5KO3A 2F5OA 5IT9S 1OTRA 3HGIA 1E9SA 4BBAA 1C7YA 4OVZA 2CHQA 3U6EA 2R62A 2DNAA 4M9SA 3C3DA 3D8LA 3GO8A 4LFBM 3H4MA 1LTMA 4I5SA 1OJLA 4M0WA 8CATA 4MM3B 1JB0F 1NJFA 3U60B 1OKSA 1E94E 3LVVA 3GLGA 1G59A 4L4UA 1JR3A 2BNKA 4W5WA 2LVAA 2JY6B 4HL4A 1NHWC 3M7GA 1Q39A 3JR4A 1G8PA 4AW4A 3UGJA 2JA2A 2RGOA 2ZANA 2BWBA 3K9PA 2KRKA 5EXSA 1OQYA 1QAMA 1V34A 2EO2A 4FD2A 4GEWA 2XZFA 4M9ZA 3PVSA 3GRRA 1IY2A 5EQTA 2MH8A 2J7NA 4G4OA 4AKIA 3GP1A 2LHCA 4LZJA 2KEBA 4AG5A 3U60A 2R0IA 4TUWA 2V6ZM 2LH0A 3BXWA 3SATA 1WJ7A 5EP3A 4X66M 4G4RA 1R4GA 1V92A 4JI6M 3FTFA 2HCBA 2F4VM 1ZAEA 2WSEF 4WW0A 3AFHA 2BWEA 4YY3M 3BBZA 4LJ8A 1KSFX 1Z5CA 2DZLA 2XFSA 3GLHB 1GJTA 3ZH9B 2LVPC 2X8AA 1IN6A 1L2DA 4AKGA 2L4FA 4IBEA 2M60A 2G5GX 3A98B 3GLGE 3TWKA 1JR3E 2I7NA 1OFIA 4LGMA 5JI2E 2JY5A 1IXZA 1N78A 3GPXA 4AQYM 1IN8A 1JR3D 3HJQA 3HJ8A 1Y8GA 2P5TA 3JR5A 2QENA 1SG9A 4LJ6A 3W0FA 5A2QS 2C98A 2QCUA 4IBCA 3VFDA 3U6OA 3LCVB 3KSXA 2N35A 2YR0A 1GVNA 5E6JA 4LJ4A 4LJAA 1K3XA 3AOEC 1OAIA 2UUAM 3J7BA 1IXSB 4GC5A 3SAVA 1H6UA 4KT0F 3TWMA 4L16A 3V76A 2VDBB 3FUVA 2UXCM 4FCVA 1HNZM 2XEPA 2F5QA 4AI6A 4CJ6A 1NHGC 1NVMA 1V33A 1VEGA 3F92A 4FW9A 2FH0A 2LVOC 4OX9M 2G3QA 3CF2A 2LHGA 2KNVA 2MGWA 1Z59A 3CF6E 2ERCA 1IXSA 3I04M 4EIWA 1D2NA 1J5EM 2C96A 2QNJA 2CP8A 1MN3A 2JNHA 2V1UA 1PJIA 2CV1A 1S3SA 4XGIA 7CATA 4KLNA 2FFJA 5FSWA 1YUBA 1FNNA 4GRIA 4GHLA 2EA0A 5FTKA 2HKJA 4GH9A 1OAOC 4DR5M 1GJSA 2JZ1A 3KW6A 5FTNA 3SYKA 4MGHA 1IXRC 4ANRA 3MMPA 2QBYA 4LFCM 2JP7A 4NL4H 4IIWA 4RNAA 4UN2B 3SASA 5EXTA 3VDUA 5LMUM 3GLFA 1TDZA 3HKPA 1XC8A 2ZBKB 3I51A 2CEAA 3QAUA 2DZNB 2FS1A 1IM2A 1TR8A 4QNMA 2UXDM 2QZ4A 1EFUB 3M6AA 1ZMVA 2KRUA 1XXHE 2R45A 5KPRA 2Z3XA 3T1HM 3FUWA 2OQ4A 1E9RA 1DO2A 3H4JA 3J27B 1D0MA 3AJIB 2YFQA 4LRSA 3I01M 1NV9A 5BR8M 2QHOB 1R7RA 3GRVA 2KZSA 5KPTA 1NO1A 1BVSA 2LBCA 3DFZA 1NSFA 3SBJA 1ZMWA 4IJEA 4DR4M 2H1RA 1IBLM 2CV0A 2CE7A 4IBDA 4LF4M 4L15A 1WGLA 3B74A 1GO5A 1VEJA 1R5LA 1VEKA 3GLGB 1QQWA 3GPUA 2X49A 1WR1B 1QANA 3LQQA 4MGZE 3ZCBB 5L8RF 1XNQM 2QQ8A 4DV1M 4MB7A 3EIEA 2B3TA 1QUSA 1HNXM 2CHGA 2HL7A 1SXJE 4B7FA 3SARA 4LF8M 1L2CA 1QVRA 3PNYA 4PD2A 3L29A 4CIZA 3GLFE 1SXJD 2D7HA 2DAEA 3HU1A 4FWHA 4CHTB 1R2YA 4DUZM 1IY0A 1XWIA 3HHZA 2MJ5B 4QNRA 1Z5BA 2L7IA 1LV7A 4G3OA 3I4YA 2DWZB 2ZM6M 4LF9M 3UK6A 1N77A 2DAKA 1QYRA 1TDHA 4FCTA 4B3TM 5FTMA 5GKNA 1P3QQ 3CF0A 3U61A 4AZFA 1DV0A 3UJNA 3U6SA 1QDTA 2DAMA 4JV5M 3VDPA 4WURA 1E32A 1Q3BA 4IBFA 3IG8A 4QOSA 1DGGA 3U6MA 1KFVA 4IBBA 1G71A 2XSZA 1DGBA 3KOZE 2VIIA 2ZTCA 2RKOA 1WGNA 2RRUA 4S12A 1D0KA 3BOSA 1QUTA 2R6FA 4KO8A 5EJCA 3TQSA 3GQ5A 5F3WA 1WXQA 2G8LA 1VDDA 2L09A 2KA6B 4GKKM 2RGHA 4FWDA 2DAIA 2R4JA 4OU7A 1IBMM 1PJQA 4IBIA 4X62M 4DBGB 3LQRA 2BJVA 1EE8A 3AOGA 3K2LA 5FLXS 4DV3M 3SAUA 4MGKE 3FYCA 3HHXA 3SHGB 3ZC7B 4GC9A 2Y20A 4LCBA 3DZDA 1XMOM 1IY1A 4FWGA 3GPYA 2CV2A 1CUKA 4D82A 1L1ZA 2VQEM 4PT5A 4D80A 3K9OA 4DV2M 2J5YA 3NWLA 3J2PB 1DGHA 3SYLA 1Z6TA 3FUTA 4LY6A 2XGNA 4LJ5A 2DXIA 2L2DA 1IN4A 3GRUA 4RKUF 4LF5M 1HT2E 2OO9A 2JWSA 1XXHB 4WP2A 1L1TA 4ZPXA 1HJPA 4JI0M 1NV8A 1I4WA 3KP1E 4JXJA 4X64M 2DHYA 2KW0A 2ZAMA 2OOAA 4Z8XA 3SMSA 3U6LA 2F5NA 3FKEA 4L78A 2XSZD 3B7ZA 1OFHA 2K6BA 4LF6M 4F2LA 3TWLA 3VK8A 4B3SM 1N33M 1VDLA 2F5PA 1W5TA 1XXHA 3C9PA 1QZEA 5C1BA 2CWBA 1XB2B 5FTLA 4G4QA 3VKGA 1FJGM 1AIPC 1PRBA 1OIPA 3J7AS 4B08A 4JI1M 2V1CA 4GMQA 1IN7A 3EIHA 2VF8A 3LMMA 4G4NA 2QBYB 2FNAA 3ILKA 1SXJB 2DAGA 2L7HA 1X37A 1PJTA 3FTEA 3A45A 3VKHA 1T43A 3GLFB 2QSFX 1GABA 1NNUC 4YHHM 2DWMA 4A3VB 4JI2M 4FCWA 2LVNC 2XFTA 5E26A 3KOXE 1TH4A 2JUJA 3VK7A 4DR7M 4I81A 1EIJA 1K3WA 2O5RA 2K0BX 1SXJA 1Q02A 2LWXA 3HU2A 4B3RM 1Z5AA 3FE3A 3FD9A 1R6BX 3HZJA 3QWLA 3A46A 1G4AE 1AUAA 2Z7JA 3Q8GA 4KODA 1L2BA 3W0LB 1TGUA 4MH0E 1XMQM 1HQCA 1NY5A 3NBXX 4DUYM 2Z8YM 4X65M 4NRWA 3UZUA 3AOEA 2HHHM 3KS4A 2XF3A 2BJWA 3L25A 4AKHA 5EXPA 3TE6A 2M5ZA 1DO0A 3NBIA 1WIVA 4IBKA 4M9XA 1ZV1A 4I8OA 1N32M 3U6QA 3W68A 3FUUA 1QAOA 1WHCA 5DYGA 1GL6A 1J09A 4QHTA 1NJGA 1ORYB 2DI0A 2CUZA 4NSOB 3R9XB 4CGYB 4QOZC 1T3TA 1GLNA 2H5XA 1QAQA 2LTUA 1UFZA 2WSFF 3HY5A 3KOYE 4LRTA 2R65A 1QZMA 2VQFM 1DGFA 1MU5A 3WHKA 1R2ZA 1OIZA 1YE9A 3SHFA 1IQPA 4IBGA 3U61B 3B7NA 5IWAM 4REZA 3E9SA 2UUBM 1PJSA 2D7EA 3U5ZB 3KFUG 1NNJA 2LXEA 2DHRA 1PJJA 3AL0C 4QHSA 4B7GA 1XHBA 3J80S 5ITXA 4II7A 3HWSA 3QYEA 2KZUA 4JI4M 1YLAA 4BB9A 4RF1A 1C1KA 4XK8F 4DR6M 1GL7A 2APLA 3FYDA 3PFIA 3HHYA 4JI7M 4GITA 4JI8M 3GLIA 2I7PA 2LNHC 4NSRA 4JYAM 3LCUA 2D7GA 3LW5F 1T6OA 2GNOA 3K1JA 5JI3E 1K82A 4R7GA 4OW0A 2XLJA 3U6PA 3U5ZA 2Y0TA 1I94M 2R44A 1W5SA 1TH2A 5EXXA 1XNRM 5IZ7D 3OTOM 1TF0B 4LF7M 1QDRA 2WZJA 3T1YM 1YSYA 3HX3A 5EP4A 1MJGM 4LJ9A 3LVWA 5C18A 4PCZA 2UU9M 2Y0QA 3UMMA 2WSCF 3E46A 1UM8A 1DGHB 2C9OA 3HHWA 3KVWA 4DR1M 5ITQA 2KNAA 3KXEC 3I4VA 3DA1A 3HU3A 3PNVA 4CISA 4IBJA 3L2AA 3D8BA 2C5RA 1J7KA 5IREB 4GIPA 4DV5M 2KNZA 2DWLA 4B3MM 4MGYE 5ITXE 4JI3M 3SC3A 2CRUA 2JY7A 4DV7M 2JZ0A 3TL4X 3WHLA 4Q7JA 3E21A 3ZQJA 5H37D 3GLIE
chains in the Genus database with same CATH topology
2KDLA 2N35A 2FS1A 2LHGA 2MH8A 2J5YA 2LHCA 2JWSA 1PRBA 1GABA 2VDBB 1GJTA 1GJSA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDL A;  2N35 A;  2FS1 A;  2LHG A;  2MH8 A;  2J5Y A;  2LHC A;  2JWS A;  1PRB A;  1GAB A;  2VDB B;  1GJT A;  1GJS A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 2X4A A;  3GRY A;  3L26 A;  2NQ8 C;  1IFY A;  3AKZ A;  1D0L A;  3QYB A;  5ITU A;  3IG5 A;  3MJ5 A;  4L6V 6;  4NRV A;  4LFA M;  4I4L A;  2VF7 A;  1JQJ C;  4AG6 A;  4L8R C;  2Y21 A;  4LG2 A;  4Y28 F;  2O01 F;  4K0K M;  2KHH A;  2EKF A;  2JY8 A;  4HEO A;  4BLC A;  3J81 S;  3W67 A;  2R46 A;  4R71 A;  2DZO B;  2YNM D;  2XH9 A;  2R4E A;  3R8F A;  1PM5 A;  2R18 A;  3RE8 A;  4M0D A;  5DYI A;  1F4I A;  1RU3 A;  4Z6Y A;  5EP2 A;  3KSJ A;  3L28 A;  4GHA A;  4P16 A;  4DR2 M;  1SXJ C;  4NC6 A;  4JI5 M;  3K8Z A;  3U6D A;  5ITT A;  1KYI A;  3GLH A;  2DKL A;  4ITQ A;  4GKJ M;  2KDL A;  2OPF A;  1VQ1 A;  3C58 A;  4KHP M;  4IJF A;  1HT1 E;  3THG A;  4JN6 A;  5ITY A;  2EJS A;  2QPA A;  4FVM A;  5LMN M;  4DR3 M;  2C99 A;  4XBO A;  4NXN M;  2K47 A;  4HLQ A;  5BPV A;  2DWN A;  4NXM M;  2MR9 A;  2J7O A;  2Z4S A;  2UUC M;  1G3I A;  3C3E A;  4B7H A;  2K9D A;  3MHV C;  1PGY A;  1ZMU A;  2HAK A;  3PXG A;  2ZTD A;  4LJ7 A;  3T6P A;  2AHM A;  1IBK M;  3HJS A;  5KQD A;  3A42 A;  3IHP A;  3MK6 A;  5KQ8 A;  3VLF B;  3GQ4 A;  5DFL A;  1NY6 A;  3IEC A;  3SMP A;  3SAW A;  3GQ3 A;  2O25 A;  1TTE A;  1N36 M;  1TH3 A;  2W82 A;  2A5Y B;  3Q8X A;  4LZZ A;  4NOO B;  1Q3C A;  4DV0 M;  1HQY E;  3AV0 A;  5FTJ A;  1G41 A;  3FRH A;  1ZQ9 A;  4PDG A;  3GLH E;  2E5L M;  3B89 A;  2ZAO A;  3U6C A;  2EUC A;  1HNW M;  2UXB M;  5ITR A;  1HR0 M;  2L4E A;  3TPZ A;  3T15 A;  3CGW A;  4DV6 M;  5KPZ A;  1L8Q A;  2GQF A;  4DV4 M;  3SFZ A;  1N34 M;  3RGS A;  3E4R A;  2Q2E B;  2Z4R A;  2C9C A;  3KOW E;  3B9P A;  2FE8 A;  4F1I A;  4G6Z A;  2MRO B;  3KDS E;  2DVW B;  2JXN A;  5EP1 A;  3KP0 E;  4D81 A;  1N75 A;  2F5S A;  3RGP A;  3JAM S;  2XZU A;  3M0E A;  1IN5 A;  3GLI B;  2HWJ A;  3T38 A;  2KXE A;  1A5T A;  3FRI A;  4P17 A;  3CTW B;  3RFW A;  3B7Q A;  3FUX A;  4OVZ B;  3KS8 A;  3GPP A;  3L27 A;  2QP9 X;  4R3D A;  5DNY A;  4RF0 A;  3K92 A;  1GKI A;  1VG5 A;  2CFO A;  2L6O A;  2CHV A;  2OOB A;  3DOA A;  4LGY A;  4PDI A;  2LVQ D;  2DEN A;  2FOI C;  1MX0 A;  2EKK A;  3FTC A;  4MGI E;  3FTD A;  2YQZ A;  5KO3 A;  2F5O A;  5IT9 S;  1OTR A;  3HGI A;  1E9S A;  4BBA A;  1C7Y A;  4OVZ A;  2CHQ A;  3U6E A;  2R62 A;  2DNA A;  4M9S A;  3C3D A;  3D8L A;  3GO8 A;  4LFB M;  3H4M A;  1LTM A;  4I5S A;  1OJL A;  4M0W A;  8CAT A;  4MM3 B;  1JB0 F;  1NJF A;  3U60 B;  1OKS A;  1E94 E;  3LVV A;  3GLG A;  1G59 A;  4L4U A;  1JR3 A;  2BNK A;  4W5W A;  2LVA A;  2JY6 B;  4HL4 A;  1NHW C;  3M7G A;  1Q39 A;  3JR4 A;  1G8P A;  4AW4 A;  3UGJ A;  2JA2 A;  2RGO A;  2ZAN A;  2BWB A;  3K9P A;  2KRK A;  5EXS A;  1OQY A;  1QAM A;  1V34 A;  2EO2 A;  4FD2 A;  4GEW A;  2XZF A;  4M9Z A;  3PVS A;  3GRR A;  1IY2 A;  5EQT A;  2MH8 A;  2J7N A;  4G4O A;  4AKI A;  3GP1 A;  2LHC A;  4LZJ A;  2KEB A;  4AG5 A;  3U60 A;  2R0I A;  4TUW A;  2V6Z M;  2LH0 A;  3BXW A;  3SAT A;  1WJ7 A;  5EP3 A;  4X66 M;  4G4R A;  1R4G A;  1V92 A;  4JI6 M;  3FTF A;  2HCB A;  2F4V M;  1ZAE A;  2WSE F;  4WW0 A;  3AFH A;  2BWE A;  4YY3 M;  3BBZ A;  4LJ8 A;  1KSF X;  1Z5C A;  2DZL A;  2XFS A;  3GLH B;  1GJT A;  3ZH9 B;  2LVP C;  2X8A A;  1IN6 A;  1L2D A;  4AKG A;  2L4F A;  4IBE A;  2M60 A;  2G5G X;  3A98 B;  3GLG E;  3TWK A;  1JR3 E;  2I7N A;  1OFI A;  4LGM A;  5JI2 E;  2JY5 A;  1IXZ A;  1N78 A;  3GPX A;  4AQY M;  1IN8 A;  1JR3 D;  3HJQ A;  3HJ8 A;  1Y8G A;  2P5T A;  3JR5 A;  2QEN A;  1SG9 A;  4LJ6 A;  3W0F A;  5A2Q S;  2C98 A;  2QCU A;  4IBC A;  3VFD A;  3U6O A;  3LCV B;  3KSX A;  2N35 A;  2YR0 A;  1GVN A;  5E6J A;  4LJ4 A;  4LJA A;  1K3X A;  3AOE C;  1OAI A;  2UUA M;  3J7B A;  1IXS B;  4GC5 A;  3SAV A;  1H6U A;  4KT0 F;  3TWM A;  4L16 A;  3V76 A;  2VDB B;  3FUV A;  2UXC M;  4FCV A;  1HNZ M;  2XEP A;  2F5Q A;  4AI6 A;  4CJ6 A;  1NHG C;  1NVM A;  1V33 A;  1VEG A;  3F92 A;  4FW9 A;  2FH0 A;  2LVO C;  4OX9 M;  2G3Q A;  3CF2 A;  2LHG A;  2KNV A;  2MGW A;  1Z59 A;  3CF6 E;  2ERC A;  1IXS A;  3I04 M;  4EIW A;  1D2N A;  1J5E M;  2C96 A;  2QNJ A;  2CP8 A;  1MN3 A;  2JNH A;  2V1U A;  1PJI A;  2CV1 A;  1S3S A;  4XGI A;  7CAT A;  4KLN A;  2FFJ A;  5FSW A;  1YUB A;  1FNN A;  4GRI A;  4GHL A;  2EA0 A;  5FTK A;  2HKJ A;  4GH9 A;  1OAO C;  4DR5 M;  1GJS A;  2JZ1 A;  3KW6 A;  5FTN A;  3SYK A;  4MGH A;  1IXR C;  4ANR A;  3MMP A;  2QBY A;  4LFC M;  2JP7 A;  4NL4 H;  4IIW A;  4RNA A;  4UN2 B;  3SAS A;  5EXT A;  3VDU A;  5LMU M;  3GLF A;  1TDZ A;  3HKP A;  1XC8 A;  2ZBK B;  3I51 A;  2CEA A;  3QAU A;  2DZN B;  2FS1 A;  1IM2 A;  1TR8 A;  4QNM A;  2UXD M;  2QZ4 A;  1EFU B;  3M6A A;  1ZMV A;  2KRU A;  1XXH E;  2R45 A;  5KPR A;  2Z3X A;  3T1H M;  3FUW A;  2OQ4 A;  1E9R A;  1DO2 A;  3H4J A;  3J27 B;  1D0M A;  3AJI B;  2YFQ A;  4LRS A;  3I01 M;  1NV9 A;  5BR8 M;  2QHO B;  1R7R A;  3GRV A;  2KZS A;  5KPT A;  1NO1 A;  1BVS A;  2LBC A;  3DFZ A;  1NSF A;  3SBJ A;  1ZMW A;  4IJE A;  4DR4 M;  2H1R A;  1IBL M;  2CV0 A;  2CE7 A;  4IBD A;  4LF4 M;  4L15 A;  1WGL A;  3B74 A;  1GO5 A;  1VEJ A;  1R5L A;  1VEK A;  3GLG B;  1QQW A;  3GPU A;  2X49 A;  1WR1 B;  1QAN A;  3LQQ A;  4MGZ E;  3ZCB B;  5L8R F;  1XNQ M;  2QQ8 A;  4DV1 M;  4MB7 A;  3EIE A;  2B3T A;  1QUS A;  1HNX M;  2CHG A;  2HL7 A;  1SXJ E;  4B7F A;  3SAR A;  4LF8 M;  1L2C A;  1QVR A;  3PNY A;  4PD2 A;  3L29 A;  4CIZ A;  3GLF E;  1SXJ D;  2D7H A;  2DAE A;  3HU1 A;  4FWH A;  4CHT B;  1R2Y A;  4DUZ M;  1IY0 A;  1XWI A;  3HHZ A;  2MJ5 B;  4QNR A;  1Z5B A;  2L7I A;  1LV7 A;  4G3O A;  3I4Y A;  2DWZ B;  2ZM6 M;  4LF9 M;  3UK6 A;  1N77 A;  2DAK A;  1QYR A;  1TDH A;  4FCT A;  4B3T M;  5FTM A;  5GKN A;  1P3Q Q;  3CF0 A;  3U61 A;  4AZF A;  1DV0 A;  3UJN A;  3U6S A;  1QDT A;  2DAM A;  4JV5 M;  3VDP A;  4WUR A;  1E32 A;  1Q3B A;  4IBF A;  3IG8 A;  4QOS A;  1DGG A;  3U6M A;  1KFV A;  4IBB A;  1G71 A;  2XSZ A;  1DGB A;  3KOZ E;  2VII A;  2ZTC A;  2RKO A;  1WGN A;  2RRU A;  4S12 A;  1D0K A;  3BOS A;  1QUT A;  2R6F A;  4KO8 A;  5EJC A;  3TQS A;  3GQ5 A;  5F3W A;  1WXQ A;  2G8L A;  1VDD A;  2L09 A;  2KA6 B;  4GKK M;  2RGH A;  4FWD A;  2DAI A;  2R4J A;  4OU7 A;  1IBM M;  1PJQ A;  4IBI A;  4X62 M;  4DBG B;  3LQR A;  2BJV A;  1EE8 A;  3AOG A;  3K2L A;  5FLX S;  4DV3 M;  3SAU A;  4MGK E;  3FYC A;  3HHX A;  3SHG B;  3ZC7 B;  4GC9 A;  2Y20 A;  4LCB A;  3DZD A;  1XMO M;  1IY1 A;  4FWG A;  3GPY A;  2CV2 A;  1CUK A;  4D82 A;  1L1Z A;  2VQE M;  4PT5 A;  4D80 A;  3K9O A;  4DV2 M;  2J5Y A;  3NWL A;  3J2P B;  1DGH A;  3SYL A;  1Z6T A;  3FUT A;  4LY6 A;  2XGN A;  4LJ5 A;  2DXI A;  2L2D A;  1IN4 A;  3GRU A;  4RKU F;  4LF5 M;  1HT2 E;  2OO9 A;  2JWS A;  1XXH B;  4WP2 A;  1L1T A;  4ZPX A;  1HJP A;  4JI0 M;  1NV8 A;  1I4W A;  3KP1 E;  4JXJ A;  4X64 M;  2DHY A;  2KW0 A;  2ZAM A;  2OOA A;  4Z8X A;  3SMS A;  3U6L A;  2F5N A;  3FKE A;  4L78 A;  2XSZ D;  3B7Z A;  1OFH A;  2K6B A;  4LF6 M;  4F2L A;  3TWL A;  3VK8 A;  4B3S M;  1N33 M;  1VDL A;  2F5P A;  1W5T A;  1XXH A;  3C9P A;  1QZE A;  5C1B A;  2CWB A;  1XB2 B;  5FTL A;  4G4Q A;  3VKG A;  1FJG M;  1AIP C;  1PRB A;  1OIP A;  3J7A S;  4B08 A;  4JI1 M;  2V1C A;  4GMQ A;  1IN7 A;  3EIH A;  2VF8 A;  3LMM A;  4G4N A;  2QBY B;  2FNA A;  3ILK A;  1SXJ B;  2DAG A;  2L7H A;  1X37 A;  1PJT A;  3FTE A;  3A45 A;  3VKH A;  1T43 A;  3GLF B;  2QSF X;  1GAB A;  1NNU C;  4YHH M;  2DWM A;  4A3V B;  4JI2 M;  4FCW A;  2LVN C;  2XFT A;  5E26 A;  3KOX E;  1TH4 A;  2JUJ A;  3VK7 A;  4DR7 M;  4I81 A;  1EIJ A;  1K3W A;  2O5R A;  2K0B X;  1SXJ A;  1Q02 A;  2LWX A;  3HU2 A;  4B3R M;  1Z5A A;  3FE3 A;  3FD9 A;  1R6B X;  3HZJ A;  3QWL A;  3A46 A;  1G4A E;  1AUA A;  2Z7J A;  3Q8G A;  4KOD A;  1L2B A;  3W0L B;  1TGU A;  4MH0 E;  1XMQ M;  1HQC A;  1NY5 A;  3NBX X;  4DUY M;  2Z8Y M;  4X65 M;  4NRW A;  3UZU A;  3AOE A;  2HHH M;  3KS4 A;  2XF3 A;  2BJW A;  3L25 A;  4AKH A;  5EXP A;  3TE6 A;  2M5Z A;  1DO0 A;  3NBI A;  1WIV A;  4IBK A;  4M9X A;  1ZV1 A;  4I8O A;  1N32 M;  3U6Q A;  3W68 A;  3FUU A;  1QAO A;  1WHC A;  5DYG A;  1GL6 A;  1J09 A;  4QHT A;  1NJG A;  1ORY B;  2DI0 A;  2CUZ A;  4NSO B;  3R9X B;  4CGY B;  4QOZ C;  1T3T A;  1GLN A;  2H5X A;  1QAQ A;  2LTU A;  1UFZ A;  2WSF F;  3HY5 A;  3KOY E;  4LRT A;  2R65 A;  1QZM A;  2VQF M;  1DGF A;  1MU5 A;  3WHK A;  1R2Z A;  1OIZ A;  1YE9 A;  3SHF A;  1IQP A;  4IBG A;  3U61 B;  3B7N A;  5IWA M;  4REZ A;  3E9S A;  2UUB M;  1PJS A;  2D7E A;  3U5Z B;  3KFU G;  1NNJ A;  2LXE A;  2DHR A;  1PJJ A;  3AL0 C;  4QHS A;  4B7G A;  1XHB A;  3J80 S;  5ITX A;  4II7 A;  3HWS A;  3QYE A;  2KZU A;  4JI4 M;  1YLA A;  4BB9 A;  4RF1 A;  1C1K A;  4XK8 F;  4DR6 M;  1GL7 A;  2APL A;  3FYD A;  3PFI A;  3HHY A;  4JI7 M;  4GIT A;  4JI8 M;  3GLI A;  2I7P A;  2LNH C;  4NSR A;  4JYA M;  3LCU A;  2D7G A;  3LW5 F;  1T6O A;  2GNO A;  3K1J A;  5JI3 E;  1K82 A;  4R7G A;  4OW0 A;  2XLJ A;  3U6P A;  3U5Z A;  2Y0T A;  1I94 M;  2R44 A;  1W5S A;  1TH2 A;  5EXX A;  1XNR M;  5IZ7 D;  3OTO M;  1TF0 B;  4LF7 M;  1QDR A;  2WZJ A;  3T1Y M;  1YSY A;  3HX3 A;  5EP4 A;  1MJG M;  4LJ9 A;  3LVW A;  5C18 A;  4PCZ A;  2UU9 M;  2Y0Q A;  3UMM A;  2WSC F;  3E46 A;  1UM8 A;  1DGH B;  2C9O A;  3HHW A;  3KVW A;  4DR1 M;  5ITQ A;  2KNA A;  3KXE C;  3I4V A;  3DA1 A;  3HU3 A;  3PNV A;  4CIS A;  4IBJ A;  3L2A A;  3D8B A;  2C5R A;  1J7K A;  5IRE B;  4GIP A;  4DV5 M;  2KNZ A;  2DWL A;  4B3M M;  4MGY E;  5ITX E;  4JI3 M;  3SC3 A;  2CRU A;  2JY7 A;  4DV7 M;  2JZ0 A;  3TL4 X;  3WHL A;  4Q7J A;  3E21 A;  3ZQJ A;  5H37 D;  3GLI E; 
#chains in the Genus database with same CATH homology
 2KDL A;  2N35 A;  2FS1 A;  2LHG A;  2MH8 A;  2J5Y A;  2LHC A;  2JWS A;  1PRB A;  1GAB A;  2VDB B;  1GJT A;  1GJS A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...