2J5YA

Crystal structure of the ga module from f.magna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
LVPRGSHMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords PEPTOSTREPTOCOCCAL ALBUMIN-BINDING PROTEIN
publication title Crystal Structure of a Bacterial Albumin-Binding Domain at 1.4A Resolution.
pubmed doi rcsb
source organism Peptostreptococcus magnus
total genus 22
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2j5yA00
2JWSA 2N35A 1TF0B 2FS1A 1GABA 2KDLA 1GJSA 2MH8A 1GJTA 2LHCA 2VDBB 1PRBA 2J5YA 2LHGA
chains in the Genus database with same CATH superfamily
3TPZA 8CATA 2DHYA 2BWBA 4WW0A 1T43A 5EP1A 3RGSA 3UK6A 3A45A 1IN6A 1QANA 2L4EA 2VIIA 2LVPC 4IBKA 3TQSA 5FTLA 4S12A 3GQ3A 1OAOC 3GLHA 1L2DA 2O25A 4L16A 4GRIA 2DAGA 3KP1E 2DWLA 2MJ5B 2CEAA 3CTWB 1R2ZA 2ZAMA 3TWLA 1OFIA 1IN8A 1TH3A 4B3SM 1GL7A 1NNUC 1ZQ9A 2CRUA 2KNZA 2RGHA 4LF6M 3KSJA 4AZFA 1SXJC 5FTKA 1PM5A 1EFUB 1WR1B 3K9PA 3M6AA 2XLJA 1OTRA 1R6BX 1HQCA 1PGYA 2HCBA 4FCVA 2L7HA 2ZM6M 3L28A 1N36M 1SXJA 4M0DA 1HR0M 2UXBM 4NOOB 3FD9A 3K92A 2V6ZM 2WSEF 4JI6M 3LVVA 4DV5M 3B9PA 3GLIA 3W67A 4LJ7A 2FNAA 2XFSA 1V92A 2JNHA 4G4NA 3U6DA 3LMMA 5ITQA 3FYCA 2DWNA 5DYGA 1G41A 4DV4M 2LNHC 1Q02A 2QBYA 3GLGA 1IXSA 4LFBM 5C1BA 2ZTCA 3TE6A 1MX0A 3FUWA 3SC3A 4LF9M 4G4OA 2WSCF 2FE8A 1YSYA 1OIPA 1VEGA 1N34M 2L7IA 3SMSA 3GPYA 3CGWA 1R2YA 2V1UA 4LJ5A 1ZMVA 4M9ZA 1HNXM 1IFYA 3CF2A 3U5ZA 3QWLA 3U6LA 5FTJA 1XHBA 4AW4A 5EXXA 2JY5A 3GLFE 1GJTA 2G8LA 7CATA 1OAIA 2Z4RA 4IBCA 1SG9A 1NVMA 4OVZA 1E9RA 1NHWC 1NV8A 1SXJE 1WIVA 3I4YA 1QQWA 3L26A 2FS1A 3GLFB 1A5TA 2QCUA 3ILKA 5KPRA 1SXJB 1G3IA 1NV9A 2HKJA 4I8OA 4DUYM 2XZUA 3FTFA 2G3QA 4I81A 2CHVA 2A5YB 3VFDA 1IY0A 4I4LA 5EXPA 5ITXE 3VLFB 2Z3XA 1V34A 5ITRA 1NJFA 4LCBA 1N32M 2J5YA 4LJ9A 4B3RM 4M9XA 3NBIA 2R62A 2CV1A 4DR6M 4XK8F 3I4VA 4FWDA 3IECA 1W5SA 2QPAA 4LG2A 1UM8A 3T38A 2UXCM 1P3QQ 4PD2A 4GMQA 4KO8A 3Q8GA 3R8FA 1K82A 2D7GA 4QNRA 4D80A 5EP4A 3KOWE 1OJLA 3C9PA 3THGA 3WHKA 1EIJA 2LHGA 1QUTA 1GVNA 4W5WA 2EJSA 4WP2A 2B3TA 2G5GX 3GO8A 3GP1A 4DR4M 2RKOA 1YLAA 2XGNA 1QYRA 1VEJA 4TUWA 5IT9S 1RU3A 1QZMA 4JI1M 2JZ0A 2KNAA 2KZSA 4QOZC 2NQ8C 2Z8YM 2KZUA 2ZTDA 3D8BA 4I5SA 4DUZM 1IY1A 3IG5A 5JI2E 1S3SA 2VQFM 1Z59A 2F5PA 2QQ8A 3UZUA 4JN6A 1HJPA 2O5RA 3FRIA 1DV0A 3FUXA 2Y0TA 4XGIA 3E46A 3U6MA 1Z5CA 5EP3A 5FLXS 1MN3A 3AKZA 2CV0A 1NJGA 5EXTA 1JR3D 2APLA 3C58A 2F5OA 4Z8XA 1I94M 4IBIA 3Q8XA 4AI6A 3LQQA 2AHMA 2QNJA 4IBFA 4GITA 2I7PA 3EIEA 3KXEC 5F3WA 4QHSA 2LVQD 2UUBM 2CHQA 2KNVA 4R71A 2JY7A 5IWAM 1Y8GA 2MR9A 4YHHM 1TR8A 4HEOA 4LF7M 1Q3BA 1X37A 1QAOA 4GH9A 2JUJA 3FYDA 2LWXA 3HJSA 5C18A 3L27A 1XXHE 2V1CA 1V33A 2C9OA 3SHGB 2YQZA 4CJ6A 1TH2A 3SAUA 1XXHB 2KRUA 2GQFA 2XEPA 4NL4H 4DV1M 3VDUA 3DOAA 3J7BA 3FUTA 4II7A 2LVOC 1C7YA 3JR4A 3SAWA 3C3EA 2K6BA 1QZEA 4PT5A 3VDPA 3KFUG 3SASA 2L09A 1CUKA 1PJIA 2UUCM 2BNKA 1G71A 3UMMA 3ZCBB 3U60A 3GQ4A 1PJQA 4DR1M 3FKEA 2R44A 1T3TA 1FJGM 2CUZA 3W0LB 2EO2A 3J80S 5FTNA 4QHTA 3SBJA 4G3OA 1XMOM 4FW9A 2C99A 3NWLA 4JI5M 1R7RA 3SMPA 3L25A 3A42A 5EQTA 4AG5A 3HGIA 1NY6A 3HJ8A 1L1TA 2Q2EB 1VG5A 3HZJA 3L2AA 3FTEA 1L2BA 3B74A 1VDDA 3LCVB 5E26A 1F4IA 3A46A 5KPTA 1XMQM 5E6JA 4F2LA 2HHHM 4MGYE 2DHRA 3LVWA 3J2PB 4DV7M 1QAMA 3KOZE 4NRVA 4RKUF 1WHCA 1PJSA 3SATA 3H4MA 1L1ZA 1VEKA 2H1RA 3TL4X 3U6CA 2D7HA 3GLHE 5GKNA 2F4VM 3SHFA 3C3DA 3GLHB 4EIWA 5LMUM 3K1JA 3U6SA 3MK6A 3E21A 2CV2A 2VF8A 3QYBA 4BB9A 3GPUA 3GRVA 1Z5AA 4WURA 3BXWA 3FUVA 2O01F 2C98A 3WHLA 4CHTB 2XSZA 2VF7A 2XF3A 1MJGM 4MH0E 3E9SA 3TWMA 4L15A 4DV2M 1ZV1A 4DV6M 3GRYA 3FTCA 3NBXX 1J5EM 1JQJC 1IBMM 4OX9M 3D8LA 2F5QA 2DXIA 2CE7A 5JI3E 2EUCA 4LRTA 1WXQA 2DVWB 4MGKE 1H6UA 1LTMA 1ZMUA 3T6PA 5LMNM 2XZFA 1N33M 1N75A 2OQ4A 3KOYE 1D0KA 3J7AS 3CF6E 2MGWA 4AKHA 2Y21A 3GLIE 2UU9M 2R65A 3T15A 4DV0M 2N35A 4FWGA 4LY6A 3GLIB 1Q3CA 2Z4SA 1DO2A 3CF0A 3AV0A 3KVWA 3B7ZA 2WZJA 4D82A 5KO3A 4Y28F 4LF4M 2FH0A 3MMPA 1PJTA 3GLGE 4KHPM 1MU5A 4F1IA 3OTOM 3DFZA 1IXRC 3U6EA 2UUAM 2Z7JA 1DGHA 2R46A 3RFWA 3GLGB 3AOEA 1L8QA 2QBYB 4BBAA 1IXSB 1IN4A 3TWKA 3AL0C 1N78A 2L4FA 2FFJA 3M0EA 3A98B 4KODA 2QP9X 2R4JA 2HAKA 4YY3M 3KOXE 2DENA 3RE8A 3K8ZA 2DAMA 4ZPXA 2EKFA 4AG6A 3JAMS 2JWSA 2CFOA 3U5ZB 4L8RC 2DAEA 1W5TA 4L78A 4LZJA 4REZA 3GQ5A 2R4EA 1R5LA 4AKGA 4MGZE 3FE3A 1IN5A 4JI8M 4OVZB 2P5TA 1SXJD 3IHPA 5A2QS 3HY5A 1HNZM 4DR2M 1Q39A 4NXNM 4NRWA 5DNYA 4FCWA 4M9SA 4JI4M 2OOBA 2CHGA 4IBBA 4LFAM 1D0LA 1NNJA 2KRKA 2YNMD 4RNAA 1T6OA 3KS4A 3BOSA 2M60A 3PNYA 4IBEA 4MM3B 4RF1A 4R7GA 4B3MM 2K9DA 2VQEM 5DYIA 2DWZB 3L29A 3W68A 3HU2A 2FOIC 2R6FA 3FRHA 3LQRA 3W0FA 3UGJA 4NSRA 2X49A 1ZAEA 1XNRM 2DAKA 3HHXA 3U61A 1Z6TA 3PXGA 3GRUA 4BLCA 4R3DA 1HNWM 2CP8A 2F5SA 3VK7A 4GKJM 4LGMA 4JI3M 1PJJA 3K2LA 2KHHA 3AFHA 1VDLA 3I01M 4ANRA 3KSXA 3T1YM 3K9OA 2BJVA 2KA6B 4HL4A 3I04M 3J81S 2LVNC 1QUSA 1GO5A 1YUBA 3VKHA 1KYIA 4NC6A 2QZ4A 3AJIB 4IJFA 5ITYA 1E94E 1TF0B 3GRRA 1AUAA 1QAQA 5BR8M 4LJAA 1HT2E 3QAUA 1NHGC 3FUUA 1C1KA 4HLQA 2R45A 3U6QA 4LF5M 2D7EA 4LGYA 4LF8M 2RGOA 2OPFA 3B89A 1TH4A 2K47A 3HHYA 3SYKA 2VDBB 2WSFF 2X8AA 1NO1A 2QSFX 3F92A 1Z5BA 4IIWA 4UN2B 4IBJA 1WGLA 1PRBA 4LJ8A 2YR0A 4FVMA 3PVSA 4A3VB 2C96A 4IBGA 3DZDA 4JXJA 4KT0F 3H4JA 2ZANA 2BJWA 5ITUA 4CISA 3B7NA 4JYAM 2JXNA 4IBDA 4Q7JA 2LH0A 4Z6YA 3T1HM 3RGPA 1GL6A 4G6ZA 4G4QA 3VK8A 4GC5A 3ZH9B 2Y20A 1K3WA 5EP2A 4DBGB 4AQYM 4LJ6A 4D81A 4B7GA 2HL7A 1N77A 5EXSA 3V76A 4LJ4A 5IREB 1UFZA 1NSFA 3GLFA 4MB7A 1WGNA 5FSWA 1KFVA 1JB0F 1TTEA 3U60B 4GC9A 4P16A 1OKSA 4XBOA 1L2CA 3HU1A 5KPZA 3UJNA 3JR5A 2M5ZA 4LFCM 2XH9A 2XFTA 4OW0A 1TDZA 4GHLA 4NXMM 5KQ8A 2C9CA 5BPVA 1J09A 1TGUA 1XWIA 1I4WA 4B7HA 4P17A 4L6V6 2W82A 1JR3A 5ITXA 4DV3M 2JA2A 1YE9A 2R18A 4QOSA 1GKIA 1IXZA 4DR3M 2MH8A 1TDHA 2K0BX 4GEWA 1HT1E 3E4RA 3HWSA 1KSFX 1G4AE 1HQYE 4FWHA 4QNMA 5L8RF 4X62M 1E9SA 3I51A 3KW6A 1G8PA 2JY8A 3KDSE 3U6PA 4JI7M 2RRUA 2JY6B 4G4RA 3AOEC 4JV5M 3HHWA 1IM2A 1OIZA 1IQPA 2KDLA 2DZNB 4KLNA 1EE8A 1IY2A 3GPXA 4PDIA 4LZZA 3ZC7B 2I7NA 3BBZA 1ZMWA 2UXDM 1XB2B 2R0IA 4NSOB 1K3XA 3M7GA 2DAIA 1XNQM 2KW0A 2KXEA 2MROB 2ZBKB 5IZ7D 4ITQA 4GHAA 3GPPA 1QDRA 2ZAOA 2BWEA 2LHCA 5KQDA 2JZ1A 1IBKM 2LVAA 1JR3E 2YFQA 3SAVA 1DGBA 4B7FA 2CWBA 2F5NA 2DZLA 2X4AA 2DI0A 2DZOB 2GNOA 2LTUA 3EIHA 5FTMA 2L6OA 3PNVA 1XC8A 3IG8A 3HHZA 4X64M 1NY5A 4MGIE 1G59A 1OFHA 1D2NA 4GIPA 4M0WA 3ZQJA 2JP7A 4FCTA 3SARA 2E5LM 3VKGA 2OOAA 3J27B 2QENA 3SFZA 1VQ1A 3DA1A 2DNAA 4LRSA 1GABA 1DO0A 4IJEA 5ITTA 1OQYA 1XXHA 1J7KA 4JI0M 3LW5F 1DGGA 5DFLA 1DGHB 1GLNA 4DR5M 2KEBA 4CGYB 2EKKA 3KS8A 2H5XA 1IBLM 2LXEA 1BVSA 4GKKM 4CIZA 1QDTA 1GJSA 2XSZD 3FTDA 2J7OA 1IN7A 4L4UA 4RF0A 2J7NA 1R4GA 2Y0QA 2DWMA 4K0KM 1AIPC 1D0MA 2EA0A 5H37D 3R9XB 3SYLA 1FNNA 4OU7A 3HKPA 3PFIA 3HU3A 2OO9A 3QYEA 2DKLA 2C5RA 4MGHA 1E32A 2QHOB 3HJQA 4PDGA 2LBCA 4JI2M 4AKIA 3MJ5A 4B08A 2ERCA 1LV7A 4X65M 1WJ7A 1ORYB 3KP0E 3LCUA 4DR7M 1DGFA 3U6OA 4PCZA 4FD2A 3HX3A 4X66M 3AOGA 2HWJA 3B7QA 3MHVC 1QVRA 5EJCA 4B3TM 3U61B 2L2DA
chains in the Genus database with same CATH topology
2JWSA 2N35A 1TF0B 2FS1A 1GABA 2KDLA 1GJSA 2MH8A 1GJTA 2LHCA 2VDBB 1PRBA 2J5YA 2LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  2N35 A;  1TF0 B;  2FS1 A;  1GAB A;  2KDL A;  1GJS A;  2MH8 A;  1GJT A;  2LHC A;  2VDB B;  1PRB A;  2J5Y A;  2LHG A; 
#chains in the Genus database with same CATH topology
 3TPZ A;  8CAT A;  2DHY A;  2BWB A;  4WW0 A;  1T43 A;  5EP1 A;  3RGS A;  3UK6 A;  3A45 A;  1IN6 A;  1QAN A;  2L4E A;  2VII A;  2LVP C;  4IBK A;  3TQS A;  5FTL A;  4S12 A;  3GQ3 A;  1OAO C;  3GLH A;  1L2D A;  2O25 A;  4L16 A;  4GRI A;  2DAG A;  3KP1 E;  2DWL A;  2MJ5 B;  2CEA A;  3CTW B;  1R2Z A;  2ZAM A;  3TWL A;  1OFI A;  1IN8 A;  1TH3 A;  4B3S M;  1GL7 A;  1NNU C;  1ZQ9 A;  2CRU A;  2KNZ A;  2RGH A;  4LF6 M;  3KSJ A;  4AZF A;  1SXJ C;  5FTK A;  1PM5 A;  1EFU B;  1WR1 B;  3K9P A;  3M6A A;  2XLJ A;  1OTR A;  1R6B X;  1HQC A;  1PGY A;  2HCB A;  4FCV A;  2L7H A;  2ZM6 M;  3L28 A;  1N36 M;  1SXJ A;  4M0D A;  1HR0 M;  2UXB M;  4NOO B;  3FD9 A;  3K92 A;  2V6Z M;  2WSE F;  4JI6 M;  3LVV A;  4DV5 M;  3B9P A;  3GLI A;  3W67 A;  4LJ7 A;  2FNA A;  2XFS A;  1V92 A;  2JNH A;  4G4N A;  3U6D A;  3LMM A;  5ITQ A;  3FYC A;  2DWN A;  5DYG A;  1G41 A;  4DV4 M;  2LNH C;  1Q02 A;  2QBY A;  3GLG A;  1IXS A;  4LFB M;  5C1B A;  2ZTC A;  3TE6 A;  1MX0 A;  3FUW A;  3SC3 A;  4LF9 M;  4G4O A;  2WSC F;  2FE8 A;  1YSY A;  1OIP A;  1VEG A;  1N34 M;  2L7I A;  3SMS A;  3GPY A;  3CGW A;  1R2Y A;  2V1U A;  4LJ5 A;  1ZMV A;  4M9Z A;  1HNX M;  1IFY A;  3CF2 A;  3U5Z A;  3QWL A;  3U6L A;  5FTJ A;  1XHB A;  4AW4 A;  5EXX A;  2JY5 A;  3GLF E;  1GJT A;  2G8L A;  7CAT A;  1OAI A;  2Z4R A;  4IBC A;  1SG9 A;  1NVM A;  4OVZ A;  1E9R A;  1NHW C;  1NV8 A;  1SXJ E;  1WIV A;  3I4Y A;  1QQW A;  3L26 A;  2FS1 A;  3GLF B;  1A5T A;  2QCU A;  3ILK A;  5KPR A;  1SXJ B;  1G3I A;  1NV9 A;  2HKJ A;  4I8O A;  4DUY M;  2XZU A;  3FTF A;  2G3Q A;  4I81 A;  2CHV A;  2A5Y B;  3VFD A;  1IY0 A;  4I4L A;  5EXP A;  5ITX E;  3VLF B;  2Z3X A;  1V34 A;  5ITR A;  1NJF A;  4LCB A;  1N32 M;  2J5Y A;  4LJ9 A;  4B3R M;  4M9X A;  3NBI A;  2R62 A;  2CV1 A;  4DR6 M;  4XK8 F;  3I4V A;  4FWD A;  3IEC A;  1W5S A;  2QPA A;  4LG2 A;  1UM8 A;  3T38 A;  2UXC M;  1P3Q Q;  4PD2 A;  4GMQ A;  4KO8 A;  3Q8G A;  3R8F A;  1K82 A;  2D7G A;  4QNR A;  4D80 A;  5EP4 A;  3KOW E;  1OJL A;  3C9P A;  3THG A;  3WHK A;  1EIJ A;  2LHG A;  1QUT A;  1GVN A;  4W5W A;  2EJS A;  4WP2 A;  2B3T A;  2G5G X;  3GO8 A;  3GP1 A;  4DR4 M;  2RKO A;  1YLA A;  2XGN A;  1QYR A;  1VEJ A;  4TUW A;  5IT9 S;  1RU3 A;  1QZM A;  4JI1 M;  2JZ0 A;  2KNA A;  2KZS A;  4QOZ C;  2NQ8 C;  2Z8Y M;  2KZU A;  2ZTD A;  3D8B A;  4I5S A;  4DUZ M;  1IY1 A;  3IG5 A;  5JI2 E;  1S3S A;  2VQF M;  1Z59 A;  2F5P A;  2QQ8 A;  3UZU A;  4JN6 A;  1HJP A;  2O5R A;  3FRI A;  1DV0 A;  3FUX A;  2Y0T A;  4XGI A;  3E46 A;  3U6M A;  1Z5C A;  5EP3 A;  5FLX S;  1MN3 A;  3AKZ A;  2CV0 A;  1NJG A;  5EXT A;  1JR3 D;  2APL A;  3C58 A;  2F5O A;  4Z8X A;  1I94 M;  4IBI A;  3Q8X A;  4AI6 A;  3LQQ A;  2AHM A;  2QNJ A;  4IBF A;  4GIT A;  2I7P A;  3EIE A;  3KXE C;  5F3W A;  4QHS A;  2LVQ D;  2UUB M;  2CHQ A;  2KNV A;  4R71 A;  2JY7 A;  5IWA M;  1Y8G A;  2MR9 A;  4YHH M;  1TR8 A;  4HEO A;  4LF7 M;  1Q3B A;  1X37 A;  1QAO A;  4GH9 A;  2JUJ A;  3FYD A;  2LWX A;  3HJS A;  5C18 A;  3L27 A;  1XXH E;  2V1C A;  1V33 A;  2C9O A;  3SHG B;  2YQZ A;  4CJ6 A;  1TH2 A;  3SAU A;  1XXH B;  2KRU A;  2GQF A;  2XEP A;  4NL4 H;  4DV1 M;  3VDU A;  3DOA A;  3J7B A;  3FUT A;  4II7 A;  2LVO C;  1C7Y A;  3JR4 A;  3SAW A;  3C3E A;  2K6B A;  1QZE A;  4PT5 A;  3VDP A;  3KFU G;  3SAS A;  2L09 A;  1CUK A;  1PJI A;  2UUC M;  2BNK A;  1G71 A;  3UMM A;  3ZCB B;  3U60 A;  3GQ4 A;  1PJQ A;  4DR1 M;  3FKE A;  2R44 A;  1T3T A;  1FJG M;  2CUZ A;  3W0L B;  2EO2 A;  3J80 S;  5FTN A;  4QHT A;  3SBJ A;  4G3O A;  1XMO M;  4FW9 A;  2C99 A;  3NWL A;  4JI5 M;  1R7R A;  3SMP A;  3L25 A;  3A42 A;  5EQT A;  4AG5 A;  3HGI A;  1NY6 A;  3HJ8 A;  1L1T A;  2Q2E B;  1VG5 A;  3HZJ A;  3L2A A;  3FTE A;  1L2B A;  3B74 A;  1VDD A;  3LCV B;  5E26 A;  1F4I A;  3A46 A;  5KPT A;  1XMQ M;  5E6J A;  4F2L A;  2HHH M;  4MGY E;  2DHR A;  3LVW A;  3J2P B;  4DV7 M;  1QAM A;  3KOZ E;  4NRV A;  4RKU F;  1WHC A;  1PJS A;  3SAT A;  3H4M A;  1L1Z A;  1VEK A;  2H1R A;  3TL4 X;  3U6C A;  2D7H A;  3GLH E;  5GKN A;  2F4V M;  3SHF A;  3C3D A;  3GLH B;  4EIW A;  5LMU M;  3K1J A;  3U6S A;  3MK6 A;  3E21 A;  2CV2 A;  2VF8 A;  3QYB A;  4BB9 A;  3GPU A;  3GRV A;  1Z5A A;  4WUR A;  3BXW A;  3FUV A;  2O01 F;  2C98 A;  3WHL A;  4CHT B;  2XSZ A;  2VF7 A;  2XF3 A;  1MJG M;  4MH0 E;  3E9S A;  3TWM A;  4L15 A;  4DV2 M;  1ZV1 A;  4DV6 M;  3GRY A;  3FTC A;  3NBX X;  1J5E M;  1JQJ C;  1IBM M;  4OX9 M;  3D8L A;  2F5Q A;  2DXI A;  2CE7 A;  5JI3 E;  2EUC A;  4LRT A;  1WXQ A;  2DVW B;  4MGK E;  1H6U A;  1LTM A;  1ZMU A;  3T6P A;  5LMN M;  2XZF A;  1N33 M;  1N75 A;  2OQ4 A;  3KOY E;  1D0K A;  3J7A S;  3CF6 E;  2MGW A;  4AKH A;  2Y21 A;  3GLI E;  2UU9 M;  2R65 A;  3T15 A;  4DV0 M;  2N35 A;  4FWG A;  4LY6 A;  3GLI B;  1Q3C A;  2Z4S A;  1DO2 A;  3CF0 A;  3AV0 A;  3KVW A;  3B7Z A;  2WZJ A;  4D82 A;  5KO3 A;  4Y28 F;  4LF4 M;  2FH0 A;  3MMP A;  1PJT A;  3GLG E;  4KHP M;  1MU5 A;  4F1I A;  3OTO M;  3DFZ A;  1IXR C;  3U6E A;  2UUA M;  2Z7J A;  1DGH A;  2R46 A;  3RFW A;  3GLG B;  3AOE A;  1L8Q A;  2QBY B;  4BBA A;  1IXS B;  1IN4 A;  3TWK A;  3AL0 C;  1N78 A;  2L4F A;  2FFJ A;  3M0E A;  3A98 B;  4KOD A;  2QP9 X;  2R4J A;  2HAK A;  4YY3 M;  3KOX E;  2DEN A;  3RE8 A;  3K8Z A;  2DAM A;  4ZPX A;  2EKF A;  4AG6 A;  3JAM S;  2JWS A;  2CFO A;  3U5Z B;  4L8R C;  2DAE A;  1W5T A;  4L78 A;  4LZJ A;  4REZ A;  3GQ5 A;  2R4E A;  1R5L A;  4AKG A;  4MGZ E;  3FE3 A;  1IN5 A;  4JI8 M;  4OVZ B;  2P5T A;  1SXJ D;  3IHP A;  5A2Q S;  3HY5 A;  1HNZ M;  4DR2 M;  1Q39 A;  4NXN M;  4NRW A;  5DNY A;  4FCW A;  4M9S A;  4JI4 M;  2OOB A;  2CHG A;  4IBB A;  4LFA M;  1D0L A;  1NNJ A;  2KRK A;  2YNM D;  4RNA A;  1T6O A;  3KS4 A;  3BOS A;  2M60 A;  3PNY A;  4IBE A;  4MM3 B;  4RF1 A;  4R7G A;  4B3M M;  2K9D A;  2VQE M;  5DYI A;  2DWZ B;  3L29 A;  3W68 A;  3HU2 A;  2FOI C;  2R6F A;  3FRH A;  3LQR A;  3W0F A;  3UGJ A;  4NSR A;  2X49 A;  1ZAE A;  1XNR M;  2DAK A;  3HHX A;  3U61 A;  1Z6T A;  3PXG A;  3GRU A;  4BLC A;  4R3D A;  1HNW M;  2CP8 A;  2F5S A;  3VK7 A;  4GKJ M;  4LGM A;  4JI3 M;  1PJJ A;  3K2L A;  2KHH A;  3AFH A;  1VDL A;  3I01 M;  4ANR A;  3KSX A;  3T1Y M;  3K9O A;  2BJV A;  2KA6 B;  4HL4 A;  3I04 M;  3J81 S;  2LVN C;  1QUS A;  1GO5 A;  1YUB A;  3VKH A;  1KYI A;  4NC6 A;  2QZ4 A;  3AJI B;  4IJF A;  5ITY A;  1E94 E;  1TF0 B;  3GRR A;  1AUA A;  1QAQ A;  5BR8 M;  4LJA A;  1HT2 E;  3QAU A;  1NHG C;  3FUU A;  1C1K A;  4HLQ A;  2R45 A;  3U6Q A;  4LF5 M;  2D7E A;  4LGY A;  4LF8 M;  2RGO A;  2OPF A;  3B89 A;  1TH4 A;  2K47 A;  3HHY A;  3SYK A;  2VDB B;  2WSF F;  2X8A A;  1NO1 A;  2QSF X;  3F92 A;  1Z5B A;  4IIW A;  4UN2 B;  4IBJ A;  1WGL A;  1PRB A;  4LJ8 A;  2YR0 A;  4FVM A;  3PVS A;  4A3V B;  2C96 A;  4IBG A;  3DZD A;  4JXJ A;  4KT0 F;  3H4J A;  2ZAN A;  2BJW A;  5ITU A;  4CIS A;  3B7N A;  4JYA M;  2JXN A;  4IBD A;  4Q7J A;  2LH0 A;  4Z6Y A;  3T1H M;  3RGP A;  1GL6 A;  4G6Z A;  4G4Q A;  3VK8 A;  4GC5 A;  3ZH9 B;  2Y20 A;  1K3W A;  5EP2 A;  4DBG B;  4AQY M;  4LJ6 A;  4D81 A;  4B7G A;  2HL7 A;  1N77 A;  5EXS A;  3V76 A;  4LJ4 A;  5IRE B;  1UFZ A;  1NSF A;  3GLF A;  4MB7 A;  1WGN A;  5FSW A;  1KFV A;  1JB0 F;  1TTE A;  3U60 B;  4GC9 A;  4P16 A;  1OKS A;  4XBO A;  1L2C A;  3HU1 A;  5KPZ A;  3UJN A;  3JR5 A;  2M5Z A;  4LFC M;  2XH9 A;  2XFT A;  4OW0 A;  1TDZ A;  4GHL A;  4NXM M;  5KQ8 A;  2C9C A;  5BPV A;  1J09 A;  1TGU A;  1XWI A;  1I4W A;  4B7H A;  4P17 A;  4L6V 6;  2W82 A;  1JR3 A;  5ITX A;  4DV3 M;  2JA2 A;  1YE9 A;  2R18 A;  4QOS A;  1GKI A;  1IXZ A;  4DR3 M;  2MH8 A;  1TDH A;  2K0B X;  4GEW A;  1HT1 E;  3E4R A;  3HWS A;  1KSF X;  1G4A E;  1HQY E;  4FWH A;  4QNM A;  5L8R F;  4X62 M;  1E9S A;  3I51 A;  3KW6 A;  1G8P A;  2JY8 A;  3KDS E;  3U6P A;  4JI7 M;  2RRU A;  2JY6 B;  4G4R A;  3AOE C;  4JV5 M;  3HHW A;  1IM2 A;  1OIZ A;  1IQP A;  2KDL A;  2DZN B;  4KLN A;  1EE8 A;  1IY2 A;  3GPX A;  4PDI A;  4LZZ A;  3ZC7 B;  2I7N A;  3BBZ A;  1ZMW A;  2UXD M;  1XB2 B;  2R0I A;  4NSO B;  1K3X A;  3M7G A;  2DAI A;  1XNQ M;  2KW0 A;  2KXE A;  2MRO B;  2ZBK B;  5IZ7 D;  4ITQ A;  4GHA A;  3GPP A;  1QDR A;  2ZAO A;  2BWE A;  2LHC A;  5KQD A;  2JZ1 A;  1IBK M;  2LVA A;  1JR3 E;  2YFQ A;  3SAV A;  1DGB A;  4B7F A;  2CWB A;  2F5N A;  2DZL A;  2X4A A;  2DI0 A;  2DZO B;  2GNO A;  2LTU A;  3EIH A;  5FTM A;  2L6O A;  3PNV A;  1XC8 A;  3IG8 A;  3HHZ A;  4X64 M;  1NY5 A;  4MGI E;  1G59 A;  1OFH A;  1D2N A;  4GIP A;  4M0W A;  3ZQJ A;  2JP7 A;  4FCT A;  3SAR A;  2E5L M;  3VKG A;  2OOA A;  3J27 B;  2QEN A;  3SFZ A;  1VQ1 A;  3DA1 A;  2DNA A;  4LRS A;  1GAB A;  1DO0 A;  4IJE A;  5ITT A;  1OQY A;  1XXH A;  1J7K A;  4JI0 M;  3LW5 F;  1DGG A;  5DFL A;  1DGH B;  1GLN A;  4DR5 M;  2KEB A;  4CGY B;  2EKK A;  3KS8 A;  2H5X A;  1IBL M;  2LXE A;  1BVS A;  4GKK M;  4CIZ A;  1QDT A;  1GJS A;  2XSZ D;  3FTD A;  2J7O A;  1IN7 A;  4L4U A;  4RF0 A;  2J7N A;  1R4G A;  2Y0Q A;  2DWM A;  4K0K M;  1AIP C;  1D0M A;  2EA0 A;  5H37 D;  3R9X B;  3SYL A;  1FNN A;  4OU7 A;  3HKP A;  3PFI A;  3HU3 A;  2OO9 A;  3QYE A;  2DKL A;  2C5R A;  4MGH A;  1E32 A;  2QHO B;  3HJQ A;  4PDG A;  2LBC A;  4JI2 M;  4AKI A;  3MJ5 A;  4B08 A;  2ERC A;  1LV7 A;  4X65 M;  1WJ7 A;  1ORY B;  3KP0 E;  3LCU A;  4DR7 M;  1DGF A;  3U6O A;  4PCZ A;  4FD2 A;  3HX3 A;  4X66 M;  3AOG A;  2HWJ A;  3B7Q A;  3MHV C;  1QVR A;  5EJC A;  4B3T M;  3U61 B;  2L2D A; 
#chains in the Genus database with same CATH homology
 2JWS A;  2N35 A;  1TF0 B;  2FS1 A;  1GAB A;  2KDL A;  1GJS A;  2MH8 A;  1GJT A;  2LHC A;  2VDB B;  1PRB A;  2J5Y A;  2LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...