2K47A

Solution structure of the c-terminal n-rna binding domain of the vesicular stomatitis virus phosphoprotein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoprotein
publication title Solution Structure of the C-Terminal Nucleoprotein-RNA Binding Domain of the Vesicular Stomatitis Virus Phosphoprotein.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
molecule tags Replication
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2k47A00
3HHZA 2K47A 3HHWA
chains in the Genus database with same CATH superfamily
4QOZC 3GP1A 3TE6A 4IIWA 3HU2A 2YFQA 1D0LA 2YR0A 3D8LA 3RGPA 4IBBA 3E21A 3GLHB 2C96A 4CGYB 4D80A 1IFYA 1SXJA 1L1ZA 1YUBA 1SXJC 3FUWA 1ZV1A 4QNMA 2UUAM 4K0KM 4B3TM 4LF4M 2Z3XA 4X65M 3AKZA 1I4WA 3SHGB 1WXQA 2G3QA 3VFDA 2O01F 2XFTA 1NO1A 4OU7A 4BBAA 4JI6M 1N77A 5C1BA 1N78A 2DWZB 3KOZE 1IXSA 4DR5M 4JI8M 4IBDA 3B89A 1G59A 4AKGA 3LQQA 1PRBA 3RFWA 3U5ZA 2K6BA 3Q8GA 5ITXE 7CATA 2NQ8C 2L09A 3JAMS 5LMNM 2X8AA 3J81S 2H5XA 3B9PA 1QDTA 2QZ4A 2F5PA 3CF6E 1OIPA 1IN5A 3J27B 4FWDA 2DAIA 2JY8A 3LVVA 3GLFA 3L26A 3K8ZA 3D8BA 1E9RA 3F92A 5KPRA 3IECA 4IBFA 1IBLM 2OOBA 2JZ1A 4I8OA 4D81A 1GLNA 1XB2B 2YNMD 1IBKM 4LF6M 2KEBA 2QHOB 1J7KA 4AW4A 4G4OA 1TDHA 1TH4A 4AG6A 2EA0A 2MJ5B 1AIPC 2L7HA 4MGZE 3U6MA 2APLA 4JI0M 2DWLA 1OAOC 1N75A 1YE9A 1E94E 1Z5AA 2EJSA 2F5SA 4GHAA 2JY7A 3HU3A 3L2AA 4B7HA 4MGIE 4LFCM 3DZDA 1SXJE 3A46A 4FWGA 4NOOB 1WJ7A 4QOSA 5DNYA 1ZQ9A 3K2LA 3K1JA 1H6UA 3LMMA 1KFVA 1HQYE 3KOWE 5ITTA 3JR5A 2RRUA 1HNWM 1S3SA 4KODA 1MX0A 4PD2A 3GRVA 1K82A 1E9SA 4OX9M 1D2NA 3LW5F 4IBIA 1NHGC 1IBMM 1N34M 3KP0E 5EP3A 1L2CA 4DV0M 3FUXA 2DAMA 3FUTA 4L8RC 5E6JA 4GKJM 2OO9A 3AOEA 2V6ZM 2LBCA 2JA2A 3AOEC 4L15A 3FD9A 4GHLA 3GLFE 2F5QA 2EO2A 4RF1A 2B3TA 3U6EA 2DENA 3TPZA 3U6QA 1LV7A 3SAVA 2O5RA 2K9DA 5JI3E 1G41A 4NSRA 2FFJA 4LCBA 1EE8A 1GO5A 1VEGA 2CHQA 3SC3A 2KNVA 4LJ8A 2CWBA 2Z4RA 2VF7A 3C9PA 3MK6A 2R4EA 4IBCA 5IT9S 3HHYA 5JI2E 1NJFA 4X62M 1IY0A 2QPAA 3WHLA 2N35A 1FJGM 1OJLA 1HNXM 3VDPA 4PDGA 1SXJD 4DV5M 4RNAA 2KNZA 3K9OA 4KHPM 4L4UA 1YSYA 3KFUG 3AV0A 1UFZA 3J2PB 2XLJA 2E5LM 1PJTA 3TQSA 1FNNA 2DHYA 3H4JA 2K0BX 4KT0F 1VDDA 3C58A 5FTKA 4LJ4A 4LJ5A 3LCVB 2G8LA 2CV0A 4NXMM 3SYKA 3VLFB 3FTDA 4M0DA 4LGYA 5KO3A 1K3WA 4PCZA 4FWHA 1PGYA 1J09A 1WIVA 4AKHA 3B7QA 3SMSA 2CV2A 3ZH9B 4DR7M 1XXHB 3HWSA 2ZTDA 5FTMA 3SBJA 2MGWA 2JP7A 3AFHA 3BXWA 4L78A 4FVMA 4S12A 3VKHA 1E32A 2CE7A 2DWNA 3PVSA 3UJNA 1I94M 3TWKA 1DO0A 4DUYM 3CF2A 3GPXA 1GL7A 3T6PA 4LF5M 2R18A 3AOGA 1GL6A 2KZUA 1GJTA 5ITYA 4MGYE 3HHZA 1IN6A 1V92A 2LVQD 1WGNA 4NL4H 4R71A 4IBJA 1NV9A 1HR0M 2KHHA 2LHCA 3HHXA 1OFHA 5H37D 1R5LA 4LZJA 1G8PA 3FUUA 1XWIA 3H4MA 1Z59A 1VEJA 3SMPA 3SFZA 4EIWA 3PNYA 1DO2A 2OOAA 4WURA 2DVWB 3ILKA 4MGKE 3HY5A 5IZ7D 4FCVA 1QZMA 1ZMVA 2R6FA 1SXJB 1R4GA 1TH3A 4LRTA 1OIZA 3RE8A 2DAKA 3A42A 1Q3BA 5EXTA 4WW0A 4JI2M 4YHHM 1HQCA 1D0MA 1L2DA 1NY6A 1TH2A 2XGNA 2Y0QA 4HL4A 1NY5A 2Z4SA 3T38A 4GC9A 2QENA 2R4JA 3NBIA 4P17A 1KSFX 2JNHA 1XXHE 2FNAA 1IXSB 3KDSE 3L25A 3DOAA 2XSZA 1T6OA 4MGHA 4X64M 4ITQA 1QUTA 1T3TA 1AUAA 4XGIA 3U5ZB 1C1KA 2D7GA 2P5TA 4MM3B 4AI6A 4CIZA 2MR9A 2LNHC 2VDBB 3C3DA 4G4NA 3HJSA 4G6ZA 2ZANA 2KRKA 1T43A 1Y8GA 4OW0A 1QAOA 4OVZB 3GLFB 2R46A 4OVZA 5LMUM 4D82A 2KXEA 3PFIA 2BNKA 2JZ0A 2RKOA 3GRUA 3FYCA 1DGHA 2DHRA 2R45A 3MMPA 2O25A 1P3QQ 1SG9A 3K9PA 4B7GA 4DV7M 4M0WA 2DNAA 4Z6YA 5KQ8A 4JI4M 1IY1A 1VG5A 2KNAA 2QNJA 1WR1B 2LVAA 3B74A 4FCWA 2ZBKB 2W82A 4LG2A 1QVRA 3U6OA 1TDZA 2OPFA 3SATA 3L27A 4FW9A 1JR3D 3KS4A 4IJFA 2HAKA 3ZQJA 3HGIA 1ZMWA 2ZAOA 4LJ6A 1Z5CA 2D7HA 3LQRA 2GNOA 4HEOA 4UN2B 2DKLA 2LVNC 3I01M 3GLIA 2CFOA 3GRYA 4DR6M 3FYDA 1TGUA 4MB7A 3SHFA 4DR4M 5E26A 4I5SA 1L8QA 4R7GA 3PXGA 5BPVA 3HJ8A 2J7NA 3EIEA 4NRWA 3GQ5A 8CATA 2CP8A 4Q7JA 3W68A 1WHCA 2DI0A 1G71A 4FCTA 1NNUC 4GMQA 1V34A 2C5RA 2K47A 3KXEC 4M9SA 5EXSA 4X66M 1ORYB 3HU1A 2HKJA 2L2DA 3KVWA 5KQDA 4DR3M 4JYAM 2I7PA 1KYIA 3DFZA 1GABA 3SARA 3W67A 1R7RA 3MHVC 5FTNA 3U6DA 4LRSA 4WP2A 1NJGA 4BLCA 3FRHA 5DYGA 4B7FA 4LJ9A 2LTUA 5IREB 4TUWA 3LVWA 3NWLA 4M9XA 1IQPA 2EKKA 1QDRA 1L1TA 3CF0A 1GJSA 4I81A 4MH0E 2DZNB 4DR1M 1V33A 3J7BA 4RF0A 4PDIA 4G4RA 2JUJA 3FTFA 2KW0A 2HWJA 1MJGM 3GLIE 1XNRM 2UXCM 1HT2E 2CHGA 2LXEA 2XSZD 3A98B 2QBYA 3BBZA 2ZM6M 2DWMA 4LF8M 3MJ5A 3SAWA 2DXIA 3AL0C 2UUCM 4G4QA 1JR3A 3GPYA 2L4EA 4DV1M 2GQFA 2DZLA 2R44A 1VDLA 1Z5BA 1LTMA 2RGOA 2LVOC 4JI1M 4IBEA 3GRRA 3QYBA 4JXJA 1QZEA 4LY6A 1R6BX 3I4VA 3KOXE 1MN3A 4Y28F 1IY2A 4AG5A 1TR8A 1TTEA 1QYRA 3GLGA 3UMMA 3GPUA 4AQYM 2XH9A 2Z8YM 2YQZA 3VDUA 1DGGA 3KSJA 3UZUA 1WGLA 3GPPA 5EXPA 2JY5A 4YY3M 2L6OA 4GIPA 3JR4A 3KS8A 2F4VM 3FTCA 4M9ZA 2A5YB 3L28A 4XK8F 3W0LB 4B3RM 5EP4A 2DZOB 2Q2EB 3I04M 3KW6A 4GEWA 5KPTA 1XMQM 4G3OA 4PT5A 5FSWA 2EKFA 2EUCA 5GKNA 1F4IA 2CUZA 2MROB 5KPZA 3VKGA 2ZTCA 4LFBM 4B3SM 1JR3E 1IN8A 1XHBA 2CEAA 4KLNA 2XZUA 1MU5A 2KZSA 2R62A 3FRIA 3VK8A 1QAQA 2L7IA 3R9XB 2VQEM 4NC6A 1G3IA 4DV4M 2J5YA 4DR2M 1QUSA 3B7NA 1TF0B 1L2BA 2M5ZA 3TWLA 1OFIA 3U60A 2JY6B 4XBOA 1VEKA 5DFLA 2Y20A 5C18A 4B3MM 4IBGA 3GQ4A 4JI3M 3SASA 2HCBA 4B08A 3GLGE 4P16A 2G5GX 3GLHA 3TWMA 4HLQA 3TL4X 5ITUA 1BVSA 3EIHA 1HNZM 2J7OA 4GKKM 2FOIC 1XNQM 4IBKA 1DGHB 1N32M 1VQ1A 2XFSA 1CUKA 1NVMA 4KO8A 4ANRA 5EP2A 4W5WA 2R65A 3RGSA 4REZA 4F2LA 2C9CA 1J5EM 1QANA 2C99A 1PJQA 3UK6A 3U6SA 2BWEA 2XZFA 3ZC7B 2KA6B 4GC5A 3U6LA 5F3WA 3VK7A 2XF3A 2LH0A 1NV8A 2M60A 2X4AA 3A45A 2UU9M 4LZZA 1NHWC 3KSXA 4QHSA 4NXNM 1G4AE 3M7GA 4BB9A 2ERCA 1ZAEA 1RU3A 3IG5A 5FLXS 3GLIB 4JI5M 4LF9M 3NBXX 1IN7A 3FTEA 3R8FA 5FTLA 1OAIA 2F5OA 1K3XA 2C98A 2D7EA 3QWLA 4Z8XA 4AZFA 5DYIA 1QAMA 2DAGA 1GKIA 2WZJA 2UXBM 1Q39A 2LVPC 5FTJA 3GLHE 5ITQA 3W0FA 1IXRC 3UGJA 3I4YA 3KOYE 3DA1A 4DV6M 1W5SA 4II7A 4GH9A 2CHVA 3C3EA 2LWXA 3OTOM 1W5TA 3M0EA 2R0IA 1XMOM 1IXZA 2JXNA 4RKUF 3AJIB 2QQ8A 2Y0TA 3K92A 2UXDM 4L6V6 3WHKA 3T1HM 1R2ZA 2CV1A 3J80S 1PJIA 3E4RA 3FE3A 3SAUA 1D0KA 1OQYA 5IWAM 3KP1E 1NNJA 1DGFA 2BJWA 3HZJA 3FUVA 3HKPA 2BJVA 3I51A 3HJQA 4CISA 3U6CA 4JI7M 2BWBA 1HJPA 1Z6TA 3CGWA 2H1RA 2QSFX 4CHTB 1Q02A 3Q8XA 4A3VB 2QBYB 3L29A 4AKIA 2VIIA 1PJJA 2WSFF 4DUZM 3THGA 3U6PA 4DBGB 1IN4A 3GQ3A 1EFUB 1EIJA 5EP1A 2FS1A 1X37A 2OQ4A 2V1UA 4GRIA 4NRVA 3B7ZA 1PM5A 2FH0A 3HX3A 4L16A 2DAEA 3PNVA 1UM8A 3E46A 2X49A 2RGHA 3GO8A 4LJAA 2F5NA 2UUBM 3SYLA 4JV5M 1N33M 1JQJC 2KRUA 3LCUA 1A5TA 3QAUA 3M6AA 2HHHM 2KDLA 3GLGB 4DV3M 2QCUA 3CTWB 4IJEA 4ZPXA 2Z7JA 5L8RF 2WSEF 4DV2M 1HT1E 2ZAMA 4LFAM 4QHTA 3T15A 2AHMA 2C9OA 4GITA 1IM2A 3V76A 1QQWA 1PJSA 3QYEA 4CJ6A 2VF8A 1ZMUA 4LJ7A 1OTRA 5EJCA 4LGMA 1JB0F 2XEPA 1R2YA 2CRUA 5EQTA 2V1CA 3T1YM 1XXHA 5EXXA 4F1IA 2HL7A 4LF7M 3IHPA 2L4FA 5A2QS 1DGBA 5BR8M 2VQFM 2WSCF 2Y21A 5ITXA 1DV0A 2MH8A 1NSFA 1YLAA 2QP9X 4JN6A 3BOSA 1XC8A 3J7AS 3FKEA 1N36M 2I7NA 2JWSA 1GVNA 3HHWA 1Q3CA 5ITRA 4QNRA 1OKSA 3U61B 4I4LA 2FE8A 4NSOB 3U61A 3U60B 2LHGA 1C7YA 3ZCBB 3IG8A 4R3DA 3E9SA 4FD2A
chains in the Genus database with same CATH topology
4QOZC 3GP1A 3TE6A 4IIWA 3HU2A 2YFQA 2YR0A 3D8LA 3RGPA 4IBBA 3GLHB 2C96A 4CGYB 4D80A 1SXJA 1L1ZA 1YUBA 1SXJC 3FUWA 4QNMA 2UUAM 4K0KM 4B3TM 4LF4M 2Z3XA 4X65M 3AKZA 1I4WA 3SHGB 1WXQA 3VFDA 2XFTA 4OU7A 4BBAA 4JI6M 1N77A 5C1BA 1N78A 2DWZB 3KOZE 4DR5M 4JI8M 4IBDA 1G59A 4AKGA 3LQQA 3RFWA 3U5ZA 5ITXE 7CATA 2NQ8C 2L09A 3JAMS 5LMNM 2X8AA 3J81S 3B9PA 2QZ4A 2F5PA 3CF6E 1IN5A 3J27B 4FWDA 3LVVA 3GLFA 3L26A 3K8ZA 3D8BA 1E9RA 5KPRA 4IBFA 1IBLM 1IBKM 4I8OA 4D81A 1GLNA 2YNMD 4LF6M 2KEBA 1J7KA 4AW4A 4G4OA 1TDHA 1TH4A 4AG6A 2EA0A 2L7HA 4MGZE 3U6MA 4JI0M 2DWLA 1YE9A 1N75A 1Z5AA 1E94E 2F5SA 4GHAA 3HU3A 3L2AA 4B7HA 4MGIE 4LFCM 3DZDA 1SXJE 3A46A 4FWGA 4NOOB 4QOSA 5DNYA 1ZQ9A 3K2LA 3K1JA 1H6UA 3LMMA 1KFVA 1HQYE 3KOWE 5ITTA 3JR5A 1HNWM 1S3SA 4KODA 1MX0A 4PD2A 3GRVA 1K82A 1E9SA 4OX9M 1D2NA 4IBIA 1NHGC 1N34M 3KP0E 5EP3A 1L2CA 4DV0M 3FUXA 3FUTA 4L8RC 5E6JA 4GKJM 3AOEA 2V6ZM 2JA2A 3AOEC 4L15A 3FD9A 4GHLA 2F5QA 2EO2A 4RF1A 3U6EA 3TPZA 3U6QA 1LV7A 3SAVA 2O5RA 5JI3E 1G41A 4NSRA 2FFJA 4LCBA 1EE8A 2CHQA 3SC3A 4LJ8A 2Z4RA 3MK6A 2R4EA 4IBCA 5IT9S 3HHYA 5JI2E 1NJFA 4X62M 1IY0A 2QPAA 3WHLA 1FJGM 1OJLA 1HNXM 3VDPA 4PDGA 1SXJD 4DV5M 4RNAA 4KHPM 4L4UA 1YSYA 3KFUG 3AV0A 2XLJA 3J2PB 2E5LM 3TQSA 1FNNA 1VDDA 3C58A 5FTKA 4LJ4A 4LJ5A 2G8LA 2CV0A 4NXMM 3SYKA 3VLFB 3FTDA 4M0DA 4LGYA 5KO3A 1K3WA 4PCZA 4FWHA 1J09A 4AKHA 2CV2A 3SMSA 4DR7M 3ZH9B 1XXHB 3HWSA 5FTMA 3SBJA 3AFHA 4L78A 4FVMA 4S12A 3VKHA 1E32A 2CE7A 2DWNA 3PVSA 3UJNA 1I94M 3TWKA 1DO0A 4DUYM 3CF2A 3GPXA 1GL7A 4LF5M 2R18A 3AOGA 1GL6A 2KZUA 5ITYA 4MGYE 3HHZA 1IN6A 4NL4H 4IBJA 1HR0M 3HHXA 1OFHA 5H37D 4LZJA 1G8PA 3FUUA 1XWIA 3H4MA 1Z59A 3SMPA 3SFZA 4EIWA 3PNYA 1DO2A 4WURA 2DVWB 3ILKA 4MGKE 5IZ7D 4FCVA 1QZMA 1SXJB 1TH3A 4LRTA 3RE8A 3A42A 1Q3BA 5EXTA 4WW0A 4JI2M 4YHHM 1HQCA 1L2DA 1NY6A 1TH2A 2XGNA 2Y0QA 4HL4A 1NY5A 2Z4SA 3T38A 4GC9A 2QENA 2R4JA 3NBIA 1KSFX 3KDSE 2FNAA 1IXSB 3L25A 3DOAA 2XSZA 4MGHA 4X64M 4ITQA 1T3TA 4XGIA 3U5ZB 1C1KA 2D7GA 2P5TA 4MM3B 4AI6A 2LNHC 4G4NA 3HJSA 4G6ZA 2ZANA 2KRKA 4OW0A 1QAOA 4OVZB 3GLFB 2R46A 4OVZA 5LMUM 4D82A 2KXEA 3PFIA 2BNKA 2RKOA 3GRUA 3FYCA 1DGHA 2DHRA 2R45A 4B7GA 4DV7M 4M0WA 5KQ8A 4Z6YA 4JI4M 1IY1A 4FCWA 2ZBKB 2W82A 4LG2A 1QVRA 3U6OA 1TDZA 2OPFA 3SATA 3L27A 4FW9A 1JR3D 3KS4A 4IJFA 3HGIA 2ZAOA 4LJ6A 1Z5CA 2D7HA 3LQRA 3GLIA 2CFOA 3GRYA 4DR6M 3FYDA 1TGUA 4MB7A 3SHFA 4DR4M 5E26A 4I5SA 1L8QA 4R7GA 3PXGA 5BPVA 3HJ8A 2J7NA 3EIEA 4NRWA 3GQ5A 8CATA 4GMQA 4FCTA 1NNUC 2C5RA 2K47A 3KXEC 4M9SA 5EXSA 4X66M 1ORYB 3HU1A 2HKJA 3KVWA 5KQDA 4DR3M 4JYAM 2I7PA 1KYIA 3DFZA 3SARA 1R7RA 3MHVC 5FTNA 3U6DA 4LRSA 1NJGA 4BLCA 5DYGA 4B7FA 4LJ9A 5IREB 4TUWA 3LVWA 3NWLA 4M9XA 1IQPA 1L1TA 3CF0A 4I81A 4MH0E 2DZNB 4DR1M 3J7BA 4RF0A 4PDIA 4G4RA 3FTFA 2KW0A 1XNRM 2UXCM 1HT2E 2CHGA 2LXEA 2XSZD 3A98B 2QBYA 2ZM6M 2DWMA 4LF8M 3MJ5A 3SAWA 2DXIA 3AL0C 2UUCM 4G4QA 1JR3A 3GPYA 4DV1M 1Z5BA 2RGOA 4JI1M 4IBEA 3GRRA 4JXJA 4LY6A 1R6BX 3KOXE 3I4VA 4AG5A 1IY2A 1QYRA 3GLGA 3UMMA 3GPUA 4AQYM 2XH9A 2YQZA 3VDUA 1DGGA 3KSJA 3UZUA 3GPPA 5EXPA 4YY3M 2L6OA 4GIPA 3JR4A 3KS8A 2F4VM 3FTCA 4M9ZA 2A5YB 3L28A 3W0LB 4B3RM 5EP4A 2DZOB 2Q2EB 5KPTA 3KW6A 1XMQM 4PT5A 5FSWA 5GKNA 2EUCA 2CUZA 5KPZA 3VKGA 4LFBM 4B3SM 1IN8A 1XHBA 2CEAA 4KLNA 2XZUA 1MU5A 2KZSA 2R62A 3VK8A 3R9XB 1QAQA 2L7IA 2VQEM 4DR2M 1G3IA 4DV4M 1L2BA 2M5ZA 3TWLA 1OFIA 3U60A 4XBOA 2Y20A 5C18A 4B3MM 4IBGA 3GQ4A 4JI3M 3SASA 2HCBA 4B08A 4P16A 2G5GX 3GLHA 3TWMA 4HLQA 3TL4X 5ITUA 3EIHA 1HNZM 2J7OA 4GKKM 2FOIC 1XNQM 4IBKA 1DGHB 1N32M 2XFSA 1NVMA 4KO8A 1IBMM 5EP2A 4W5WA 2R65A 3RGSA 4REZA 2C9CA 1J5EM 1QANA 2C99A 3U6SA 3UK6A 2XZFA 3ZC7B 2KA6B 4GC5A 3U6LA 5F3WA 3VK7A 2XF3A 2LH0A 2M60A 2X4AA 3A45A 2UU9M 4LZZA 1NHWC 3KSXA 4QHSA 4NXNM 1G4AE 3M7GA 4BB9A 2ERCA 1ZAEA 3IG5A 5FLXS 3GLIB 4JI5M 4LF9M 1IN7A 3FTEA 3R8FA 5FTLA 2F5OA 1K3XA 2C98A 2D7EA 3QWLA 4Z8XA 4AZFA 5DYIA 1QAMA 1GKIA 2UXBM 1Q39A 5FTJA 5ITQA 3UGJA 3W0FA 1IXRC 3I4YA 3KOYE 3DA1A 4DV6M 1W5SA 4II7A 4GH9A 2CHVA 2LWXA 3OTOM 1W5TA 3M0EA 1XMOM 1IXZA 3AJIB 2Y0TA 3K92A 2UXDM 3WHKA 3T1HM 1R2ZA 2CV1A 3J80S 1PJIA 3E4RA 3SAUA 5IWAM 3KP1E 1NNJA 1DGFA 2BJWA 3FUVA 3HKPA 2BJVA 3I51A 3HJQA 4CISA 3U6CA 4JI7M 1Z6TA 2H1RA 4CHTB 3Q8XA 4A3VB 2QBYB 3L29A 4AKIA 2VIIA 1PJJA 4DUZM 3THGA 3U6PA 1IN4A 3GQ3A 5EP1A 1X37A 2OQ4A 2V1UA 4GRIA 4NRVA 1PM5A 4L16A 3GO8A 3PNVA 1UM8A 2X49A 2RGHA 2F5NA 4LJAA 2UUBM 3SYLA 4JV5M 1N33M 1JQJC 2KRUA 3QAUA 3M6AA 2HHHM 3GLGB 4DV3M 2QCUA 3CTWB 4IJEA 4ZPXA 2Z7JA 4DV2M 1HT1E 2ZAMA 4LFAM 4QHTA 3T15A 2AHMA 2C9OA 4GITA 1IM2A 1QQWA 4LJ7A 5EJCA 4LGMA 2XEPA 1R2YA 5EQTA 2V1CA 3T1YM 1XXHA 5EXXA 4LF7M 2HL7A 5A2QS 1DGBA 5BR8M 2VQFM 2Y21A 5ITXA 1NSFA 2QP9X 4JN6A 3BOSA 1XC8A 3J7AS 3FKEA 1N36M 2I7NA 1GVNA 3HHWA 1Q3CA 5ITRA 4QNRA 3U61B 4I4LA 2FE8A 4NSOB 3U61A 3U60B 3ZCBB 3IG8A 4R3DA 3E9SA 4FD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHZ A;  2K47 A;  3HHW A; 
#chains in the Genus database with same CATH topology
 4QOZ C;  3GP1 A;  3TE6 A;  4IIW A;  3HU2 A;  2YFQ A;  1D0L A;  2YR0 A;  3D8L A;  3RGP A;  4IBB A;  3E21 A;  3GLH B;  2C96 A;  4CGY B;  4D80 A;  1IFY A;  1SXJ A;  1L1Z A;  1YUB A;  1SXJ C;  3FUW A;  1ZV1 A;  4QNM A;  2UUA M;  4K0K M;  4B3T M;  4LF4 M;  2Z3X A;  4X65 M;  3AKZ A;  1I4W A;  3SHG B;  1WXQ A;  2G3Q A;  3VFD A;  2O01 F;  2XFT A;  1NO1 A;  4OU7 A;  4BBA A;  4JI6 M;  1N77 A;  5C1B A;  1N78 A;  2DWZ B;  3KOZ E;  1IXS A;  4DR5 M;  4JI8 M;  4IBD A;  3B89 A;  1G59 A;  4AKG A;  3LQQ A;  1PRB A;  3RFW A;  3U5Z A;  2K6B A;  3Q8G A;  5ITX E;  7CAT A;  2NQ8 C;  2L09 A;  3JAM S;  5LMN M;  2X8A A;  3J81 S;  2H5X A;  3B9P A;  1QDT A;  2QZ4 A;  2F5P A;  3CF6 E;  1OIP A;  1IN5 A;  3J27 B;  4FWD A;  2DAI A;  2JY8 A;  3LVV A;  3GLF A;  3L26 A;  3K8Z A;  3D8B A;  1E9R A;  3F92 A;  5KPR A;  3IEC A;  4IBF A;  1IBL M;  2OOB A;  2JZ1 A;  4I8O A;  4D81 A;  1GLN A;  1XB2 B;  2YNM D;  1IBK M;  4LF6 M;  2KEB A;  2QHO B;  1J7K A;  4AW4 A;  4G4O A;  1TDH A;  1TH4 A;  4AG6 A;  2EA0 A;  2MJ5 B;  1AIP C;  2L7H A;  4MGZ E;  3U6M A;  2APL A;  4JI0 M;  2DWL A;  1OAO C;  1N75 A;  1YE9 A;  1E94 E;  1Z5A A;  2EJS A;  2F5S A;  4GHA A;  2JY7 A;  3HU3 A;  3L2A A;  4B7H A;  4MGI E;  4LFC M;  3DZD A;  1SXJ E;  3A46 A;  4FWG A;  4NOO B;  1WJ7 A;  4QOS A;  5DNY A;  1ZQ9 A;  3K2L A;  3K1J A;  1H6U A;  3LMM A;  1KFV A;  1HQY E;  3KOW E;  5ITT A;  3JR5 A;  2RRU A;  1HNW M;  1S3S A;  4KOD A;  1MX0 A;  4PD2 A;  3GRV A;  1K82 A;  1E9S A;  4OX9 M;  1D2N A;  3LW5 F;  4IBI A;  1NHG C;  1IBM M;  1N34 M;  3KP0 E;  5EP3 A;  1L2C A;  4DV0 M;  3FUX A;  2DAM A;  3FUT A;  4L8R C;  5E6J A;  4GKJ M;  2OO9 A;  3AOE A;  2V6Z M;  2LBC A;  2JA2 A;  3AOE C;  4L15 A;  3FD9 A;  4GHL A;  3GLF E;  2F5Q A;  2EO2 A;  4RF1 A;  2B3T A;  3U6E A;  2DEN A;  3TPZ A;  3U6Q A;  1LV7 A;  3SAV A;  2O5R A;  2K9D A;  5JI3 E;  1G41 A;  4NSR A;  2FFJ A;  4LCB A;  1EE8 A;  1GO5 A;  1VEG A;  2CHQ A;  3SC3 A;  2KNV A;  4LJ8 A;  2CWB A;  2Z4R A;  2VF7 A;  3C9P A;  3MK6 A;  2R4E A;  4IBC A;  5IT9 S;  3HHY A;  5JI2 E;  1NJF A;  4X62 M;  1IY0 A;  2QPA A;  3WHL A;  2N35 A;  1FJG M;  1OJL A;  1HNX M;  3VDP A;  4PDG A;  1SXJ D;  4DV5 M;  4RNA A;  2KNZ A;  3K9O A;  4KHP M;  4L4U A;  1YSY A;  3KFU G;  3AV0 A;  1UFZ A;  3J2P B;  2XLJ A;  2E5L M;  1PJT A;  3TQS A;  1FNN A;  2DHY A;  3H4J A;  2K0B X;  4KT0 F;  1VDD A;  3C58 A;  5FTK A;  4LJ4 A;  4LJ5 A;  3LCV B;  2G8L A;  2CV0 A;  4NXM M;  3SYK A;  3VLF B;  3FTD A;  4M0D A;  4LGY A;  5KO3 A;  1K3W A;  4PCZ A;  4FWH A;  1PGY A;  1J09 A;  1WIV A;  4AKH A;  3B7Q A;  3SMS A;  2CV2 A;  3ZH9 B;  4DR7 M;  1XXH B;  3HWS A;  2ZTD A;  5FTM A;  3SBJ A;  2MGW A;  2JP7 A;  3AFH A;  3BXW A;  4L78 A;  4FVM A;  4S12 A;  3VKH A;  1E32 A;  2CE7 A;  2DWN A;  3PVS A;  3UJN A;  1I94 M;  3TWK A;  1DO0 A;  4DUY M;  3CF2 A;  3GPX A;  1GL7 A;  3T6P A;  4LF5 M;  2R18 A;  3AOG A;  1GL6 A;  2KZU A;  1GJT A;  5ITY A;  4MGY E;  3HHZ A;  1IN6 A;  1V92 A;  2LVQ D;  1WGN A;  4NL4 H;  4R71 A;  4IBJ A;  1NV9 A;  1HR0 M;  2KHH A;  2LHC A;  3HHX A;  1OFH A;  5H37 D;  1R5L A;  4LZJ A;  1G8P A;  3FUU A;  1XWI A;  3H4M A;  1Z59 A;  1VEJ A;  3SMP A;  3SFZ A;  4EIW A;  3PNY A;  1DO2 A;  2OOA A;  4WUR A;  2DVW B;  3ILK A;  4MGK E;  3HY5 A;  5IZ7 D;  4FCV A;  1QZM A;  1ZMV A;  2R6F A;  1SXJ B;  1R4G A;  1TH3 A;  4LRT A;  1OIZ A;  3RE8 A;  2DAK A;  3A42 A;  1Q3B A;  5EXT A;  4WW0 A;  4JI2 M;  4YHH M;  1HQC A;  1D0M A;  1L2D A;  1NY6 A;  1TH2 A;  2XGN A;  2Y0Q A;  4HL4 A;  1NY5 A;  2Z4S A;  3T38 A;  4GC9 A;  2QEN A;  2R4J A;  3NBI A;  4P17 A;  1KSF X;  2JNH A;  1XXH E;  2FNA A;  1IXS B;  3KDS E;  3L25 A;  3DOA A;  2XSZ A;  1T6O A;  4MGH A;  4X64 M;  4ITQ A;  1QUT A;  1T3T A;  1AUA A;  4XGI A;  3U5Z B;  1C1K A;  2D7G A;  2P5T A;  4MM3 B;  4AI6 A;  4CIZ A;  2MR9 A;  2LNH C;  2VDB B;  3C3D A;  4G4N A;  3HJS A;  4G6Z A;  2ZAN A;  2KRK A;  1T43 A;  1Y8G A;  4OW0 A;  1QAO A;  4OVZ B;  3GLF B;  2R46 A;  4OVZ A;  5LMU M;  4D82 A;  2KXE A;  3PFI A;  2BNK A;  2JZ0 A;  2RKO A;  3GRU A;  3FYC A;  1DGH A;  2DHR A;  2R45 A;  3MMP A;  2O25 A;  1P3Q Q;  1SG9 A;  3K9P A;  4B7G A;  4DV7 M;  4M0W A;  2DNA A;  4Z6Y A;  5KQ8 A;  4JI4 M;  1IY1 A;  1VG5 A;  2KNA A;  2QNJ A;  1WR1 B;  2LVA A;  3B74 A;  4FCW A;  2ZBK B;  2W82 A;  4LG2 A;  1QVR A;  3U6O A;  1TDZ A;  2OPF A;  3SAT A;  3L27 A;  4FW9 A;  1JR3 D;  3KS4 A;  4IJF A;  2HAK A;  3ZQJ A;  3HGI A;  1ZMW A;  2ZAO A;  4LJ6 A;  1Z5C A;  2D7H A;  3LQR A;  2GNO A;  4HEO A;  4UN2 B;  2DKL A;  2LVN C;  3I01 M;  3GLI A;  2CFO A;  3GRY A;  4DR6 M;  3FYD A;  1TGU A;  4MB7 A;  3SHF A;  4DR4 M;  5E26 A;  4I5S A;  1L8Q A;  4R7G A;  3PXG A;  5BPV A;  3HJ8 A;  2J7N A;  3EIE A;  4NRW A;  3GQ5 A;  8CAT A;  2CP8 A;  4Q7J A;  3W68 A;  1WHC A;  2DI0 A;  1G71 A;  4FCT A;  1NNU C;  4GMQ A;  1V34 A;  2C5R A;  2K47 A;  3KXE C;  4M9S A;  5EXS A;  4X66 M;  1ORY B;  3HU1 A;  2HKJ A;  2L2D A;  3KVW A;  5KQD A;  4DR3 M;  4JYA M;  2I7P A;  1KYI A;  3DFZ A;  1GAB A;  3SAR A;  3W67 A;  1R7R A;  3MHV C;  5FTN A;  3U6D A;  4LRS A;  4WP2 A;  1NJG A;  4BLC A;  3FRH A;  5DYG A;  4B7F A;  4LJ9 A;  2LTU A;  5IRE B;  4TUW A;  3LVW A;  3NWL A;  4M9X A;  1IQP A;  2EKK A;  1QDR A;  1L1T A;  3CF0 A;  1GJS A;  4I81 A;  4MH0 E;  2DZN B;  4DR1 M;  1V33 A;  3J7B A;  4RF0 A;  4PDI A;  4G4R A;  2JUJ A;  3FTF A;  2KW0 A;  2HWJ A;  1MJG M;  3GLI E;  1XNR M;  2UXC M;  1HT2 E;  2CHG A;  2LXE A;  2XSZ D;  3A98 B;  2QBY A;  3BBZ A;  2ZM6 M;  2DWM A;  4LF8 M;  3MJ5 A;  3SAW A;  2DXI A;  3AL0 C;  2UUC M;  4G4Q A;  1JR3 A;  3GPY A;  2L4E A;  4DV1 M;  2GQF A;  2DZL A;  2R44 A;  1VDL A;  1Z5B A;  1LTM A;  2RGO A;  2LVO C;  4JI1 M;  4IBE A;  3GRR A;  3QYB A;  4JXJ A;  1QZE A;  4LY6 A;  1R6B X;  3I4V A;  3KOX E;  1MN3 A;  4Y28 F;  1IY2 A;  4AG5 A;  1TR8 A;  1TTE A;  1QYR A;  3GLG A;  3UMM A;  3GPU A;  4AQY M;  2XH9 A;  2Z8Y M;  2YQZ A;  3VDU A;  1DGG A;  3KSJ A;  3UZU A;  1WGL A;  3GPP A;  5EXP A;  2JY5 A;  4YY3 M;  2L6O A;  4GIP A;  3JR4 A;  3KS8 A;  2F4V M;  3FTC A;  4M9Z A;  2A5Y B;  3L28 A;  4XK8 F;  3W0L B;  4B3R M;  5EP4 A;  2DZO B;  2Q2E B;  3I04 M;  3KW6 A;  4GEW A;  5KPT A;  1XMQ M;  4G3O A;  4PT5 A;  5FSW A;  2EKF A;  2EUC A;  5GKN A;  1F4I A;  2CUZ A;  2MRO B;  5KPZ A;  3VKG A;  2ZTC A;  4LFB M;  4B3S M;  1JR3 E;  1IN8 A;  1XHB A;  2CEA A;  4KLN A;  2XZU A;  1MU5 A;  2KZS A;  2R62 A;  3FRI A;  3VK8 A;  1QAQ A;  2L7I A;  3R9X B;  2VQE M;  4NC6 A;  1G3I A;  4DV4 M;  2J5Y A;  4DR2 M;  1QUS A;  3B7N A;  1TF0 B;  1L2B A;  2M5Z A;  3TWL A;  1OFI A;  3U60 A;  2JY6 B;  4XBO A;  1VEK A;  5DFL A;  2Y20 A;  5C18 A;  4B3M M;  4IBG A;  3GQ4 A;  4JI3 M;  3SAS A;  2HCB A;  4B08 A;  3GLG E;  4P16 A;  2G5G X;  3GLH A;  3TWM A;  4HLQ A;  3TL4 X;  5ITU A;  1BVS A;  3EIH A;  1HNZ M;  2J7O A;  4GKK M;  2FOI C;  1XNQ M;  4IBK A;  1DGH B;  1N32 M;  1VQ1 A;  2XFS A;  1CUK A;  1NVM A;  4KO8 A;  4ANR A;  5EP2 A;  4W5W A;  2R65 A;  3RGS A;  4REZ A;  4F2L A;  2C9C A;  1J5E M;  1QAN A;  2C99 A;  1PJQ A;  3UK6 A;  3U6S A;  2BWE A;  2XZF A;  3ZC7 B;  2KA6 B;  4GC5 A;  3U6L A;  5F3W A;  3VK7 A;  2XF3 A;  2LH0 A;  1NV8 A;  2M60 A;  2X4A A;  3A45 A;  2UU9 M;  4LZZ A;  1NHW C;  3KSX A;  4QHS A;  4NXN M;  1G4A E;  3M7G A;  4BB9 A;  2ERC A;  1ZAE A;  1RU3 A;  3IG5 A;  5FLX S;  3GLI B;  4JI5 M;  4LF9 M;  3NBX X;  1IN7 A;  3FTE A;  3R8F A;  5FTL A;  1OAI A;  2F5O A;  1K3X A;  2C98 A;  2D7E A;  3QWL A;  4Z8X A;  4AZF A;  5DYI A;  1QAM A;  2DAG A;  1GKI A;  2WZJ A;  2UXB M;  1Q39 A;  2LVP C;  5FTJ A;  3GLH E;  5ITQ A;  3W0F A;  1IXR C;  3UGJ A;  3I4Y A;  3KOY E;  3DA1 A;  4DV6 M;  1W5S A;  4II7 A;  4GH9 A;  2CHV A;  3C3E A;  2LWX A;  3OTO M;  1W5T A;  3M0E A;  2R0I A;  1XMO M;  1IXZ A;  2JXN A;  4RKU F;  3AJI B;  2QQ8 A;  2Y0T A;  3K92 A;  2UXD M;  4L6V 6;  3WHK A;  3T1H M;  1R2Z A;  2CV1 A;  3J80 S;  1PJI A;  3E4R A;  3FE3 A;  3SAU A;  1D0K A;  1OQY A;  5IWA M;  3KP1 E;  1NNJ A;  1DGF A;  2BJW A;  3HZJ A;  3FUV A;  3HKP A;  2BJV A;  3I51 A;  3HJQ A;  4CIS A;  3U6C A;  4JI7 M;  2BWB A;  1HJP A;  1Z6T A;  3CGW A;  2H1R A;  2QSF X;  4CHT B;  1Q02 A;  3Q8X A;  4A3V B;  2QBY B;  3L29 A;  4AKI A;  2VII A;  1PJJ A;  2WSF F;  4DUZ M;  3THG A;  3U6P A;  4DBG B;  1IN4 A;  3GQ3 A;  1EFU B;  1EIJ A;  5EP1 A;  2FS1 A;  1X37 A;  2OQ4 A;  2V1U A;  4GRI A;  4NRV A;  3B7Z A;  1PM5 A;  2FH0 A;  3HX3 A;  4L16 A;  2DAE A;  3PNV A;  1UM8 A;  3E46 A;  2X49 A;  2RGH A;  3GO8 A;  4LJA A;  2F5N A;  2UUB M;  3SYL A;  4JV5 M;  1N33 M;  1JQJ C;  2KRU A;  3LCU A;  1A5T A;  3QAU A;  3M6A A;  2HHH M;  2KDL A;  3GLG B;  4DV3 M;  2QCU A;  3CTW B;  4IJE A;  4ZPX A;  2Z7J A;  5L8R F;  2WSE F;  4DV2 M;  1HT1 E;  2ZAM A;  4LFA M;  4QHT A;  3T15 A;  2AHM A;  2C9O A;  4GIT A;  1IM2 A;  3V76 A;  1QQW A;  1PJS A;  3QYE A;  4CJ6 A;  2VF8 A;  1ZMU A;  4LJ7 A;  1OTR A;  5EJC A;  4LGM A;  1JB0 F;  2XEP A;  1R2Y A;  2CRU A;  5EQT A;  2V1C A;  3T1Y M;  1XXH A;  5EXX A;  4F1I A;  2HL7 A;  4LF7 M;  3IHP A;  2L4F A;  5A2Q S;  1DGB A;  5BR8 M;  2VQF M;  2WSC F;  2Y21 A;  5ITX A;  1DV0 A;  2MH8 A;  1NSF A;  1YLA A;  2QP9 X;  4JN6 A;  3BOS A;  1XC8 A;  3J7A S;  3FKE A;  1N36 M;  2I7N A;  2JWS A;  1GVN A;  3HHW A;  1Q3C A;  5ITR A;  4QNR A;  1OKS A;  3U61 B;  4I4L A;  2FE8 A;  4NSO B;  3U61 A;  3U60 B;  2LHG A;  1C7Y A;  3ZCB B;  3IG8 A;  4R3D A;  3E9S A;  4FD2 A; 
#chains in the Genus database with same CATH homology
 4QOZ C;  3GP1 A;  3TE6 A;  4IIW A;  3HU2 A;  2YFQ A;  2YR0 A;  3D8L A;  3RGP A;  4IBB A;  3GLH B;  2C96 A;  4CGY B;  4D80 A;  1SXJ A;  1L1Z A;  1YUB A;  1SXJ C;  3FUW A;  4QNM A;  2UUA M;  4K0K M;  4B3T M;  4LF4 M;  2Z3X A;  4X65 M;  3AKZ A;  1I4W A;  3SHG B;  1WXQ A;  3VFD A;  2XFT A;  4OU7 A;  4BBA A;  4JI6 M;  1N77 A;  5C1B A;  1N78 A;  2DWZ B;  3KOZ E;  4DR5 M;  4JI8 M;  4IBD A;  1G59 A;  4AKG A;  3LQQ A;  3RFW A;  3U5Z A;  5ITX E;  7CAT A;  2NQ8 C;  2L09 A;  3JAM S;  5LMN M;  2X8A A;  3J81 S;  3B9P A;  2QZ4 A;  2F5P A;  3CF6 E;  1IN5 A;  3J27 B;  4FWD A;  3LVV A;  3GLF A;  3L26 A;  3K8Z A;  3D8B A;  1E9R A;  5KPR A;  4IBF A;  1IBL M;  1IBK M;  4I8O A;  4D81 A;  1GLN A;  2YNM D;  4LF6 M;  2KEB A;  1J7K A;  4AW4 A;  4G4O A;  1TDH A;  1TH4 A;  4AG6 A;  2EA0 A;  2L7H A;  4MGZ E;  3U6M A;  4JI0 M;  2DWL A;  1YE9 A;  1N75 A;  1Z5A A;  1E94 E;  2F5S A;  4GHA A;  3HU3 A;  3L2A A;  4B7H A;  4MGI E;  4LFC M;  3DZD A;  1SXJ E;  3A46 A;  4FWG A;  4NOO B;  4QOS A;  5DNY A;  1ZQ9 A;  3K2L A;  3K1J A;  1H6U A;  3LMM A;  1KFV A;  1HQY E;  3KOW E;  5ITT A;  3JR5 A;  1HNW M;  1S3S A;  4KOD A;  1MX0 A;  4PD2 A;  3GRV A;  1K82 A;  1E9S A;  4OX9 M;  1D2N A;  4IBI A;  1NHG C;  1N34 M;  3KP0 E;  5EP3 A;  1L2C A;  4DV0 M;  3FUX A;  3FUT A;  4L8R C;  5E6J A;  4GKJ M;  3AOE A;  2V6Z M;  2JA2 A;  3AOE C;  4L15 A;  3FD9 A;  4GHL A;  2F5Q A;  2EO2 A;  4RF1 A;  3U6E A;  3TPZ A;  3U6Q A;  1LV7 A;  3SAV A;  2O5R A;  5JI3 E;  1G41 A;  4NSR A;  2FFJ A;  4LCB A;  1EE8 A;  2CHQ A;  3SC3 A;  4LJ8 A;  2Z4R A;  3MK6 A;  2R4E A;  4IBC A;  5IT9 S;  3HHY A;  5JI2 E;  1NJF A;  4X62 M;  1IY0 A;  2QPA A;  3WHL A;  1FJG M;  1OJL A;  1HNX M;  3VDP A;  4PDG A;  1SXJ D;  4DV5 M;  4RNA A;  4KHP M;  4L4U A;  1YSY A;  3KFU G;  3AV0 A;  2XLJ A;  3J2P B;  2E5L M;  3TQS A;  1FNN A;  1VDD A;  3C58 A;  5FTK A;  4LJ4 A;  4LJ5 A;  2G8L A;  2CV0 A;  4NXM M;  3SYK A;  3VLF B;  3FTD A;  4M0D A;  4LGY A;  5KO3 A;  1K3W A;  4PCZ A;  4FWH A;  1J09 A;  4AKH A;  2CV2 A;  3SMS A;  4DR7 M;  3ZH9 B;  1XXH B;  3HWS A;  5FTM A;  3SBJ A;  3AFH A;  4L78 A;  4FVM A;  4S12 A;  3VKH A;  1E32 A;  2CE7 A;  2DWN A;  3PVS A;  3UJN A;  1I94 M;  3TWK A;  1DO0 A;  4DUY M;  3CF2 A;  3GPX A;  1GL7 A;  4LF5 M;  2R18 A;  3AOG A;  1GL6 A;  2KZU A;  5ITY A;  4MGY E;  3HHZ A;  1IN6 A;  4NL4 H;  4IBJ A;  1HR0 M;  3HHX A;  1OFH A;  5H37 D;  4LZJ A;  1G8P A;  3FUU A;  1XWI A;  3H4M A;  1Z59 A;  3SMP A;  3SFZ A;  4EIW A;  3PNY A;  1DO2 A;  4WUR A;  2DVW B;  3ILK A;  4MGK E;  5IZ7 D;  4FCV A;  1QZM A;  1SXJ B;  1TH3 A;  4LRT A;  3RE8 A;  3A42 A;  1Q3B A;  5EXT A;  4WW0 A;  4JI2 M;  4YHH M;  1HQC A;  1L2D A;  1NY6 A;  1TH2 A;  2XGN A;  2Y0Q A;  4HL4 A;  1NY5 A;  2Z4S A;  3T38 A;  4GC9 A;  2QEN A;  2R4J A;  3NBI A;  1KSF X;  3KDS E;  2FNA A;  1IXS B;  3L25 A;  3DOA A;  2XSZ A;  4MGH A;  4X64 M;  4ITQ A;  1T3T A;  4XGI A;  3U5Z B;  1C1K A;  2D7G A;  2P5T A;  4MM3 B;  4AI6 A;  2LNH C;  4G4N A;  3HJS A;  4G6Z A;  2ZAN A;  2KRK A;  4OW0 A;  1QAO A;  4OVZ B;  3GLF B;  2R46 A;  4OVZ A;  5LMU M;  4D82 A;  2KXE A;  3PFI A;  2BNK A;  2RKO A;  3GRU A;  3FYC A;  1DGH A;  2DHR A;  2R45 A;  4B7G A;  4DV7 M;  4M0W A;  5KQ8 A;  4Z6Y A;  4JI4 M;  1IY1 A;  4FCW A;  2ZBK B;  2W82 A;  4LG2 A;  1QVR A;  3U6O A;  1TDZ A;  2OPF A;  3SAT A;  3L27 A;  4FW9 A;  1JR3 D;  3KS4 A;  4IJF A;  3HGI A;  2ZAO A;  4LJ6 A;  1Z5C A;  2D7H A;  3LQR A;  3GLI A;  2CFO A;  3GRY A;  4DR6 M;  3FYD A;  1TGU A;  4MB7 A;  3SHF A;  4DR4 M;  5E26 A;  4I5S A;  1L8Q A;  4R7G A;  3PXG A;  5BPV A;  3HJ8 A;  2J7N A;  3EIE A;  4NRW A;  3GQ5 A;  8CAT A;  4GMQ A;  4FCT A;  1NNU C;  2C5R A;  2K47 A;  3KXE C;  4M9S A;  5EXS A;  4X66 M;  1ORY B;  3HU1 A;  2HKJ A;  3KVW A;  5KQD A;  4DR3 M;  4JYA M;  2I7P A;  1KYI A;  3DFZ A;  3SAR A;  1R7R A;  3MHV C;  5FTN A;  3U6D A;  4LRS A;  1NJG A;  4BLC A;  5DYG A;  4B7F A;  4LJ9 A;  5IRE B;  4TUW A;  3LVW A;  3NWL A;  4M9X A;  1IQP A;  1L1T A;  3CF0 A;  4I81 A;  4MH0 E;  2DZN B;  4DR1 M;  3J7B A;  4RF0 A;  4PDI A;  4G4R A;  3FTF A;  2KW0 A;  1XNR M;  2UXC M;  1HT2 E;  2CHG A;  2LXE A;  2XSZ D;  3A98 B;  2QBY A;  2ZM6 M;  2DWM A;  4LF8 M;  3MJ5 A;  3SAW A;  2DXI A;  3AL0 C;  2UUC M;  4G4Q A;  1JR3 A;  3GPY A;  4DV1 M;  1Z5B A;  2RGO A;  4JI1 M;  4IBE A;  3GRR A;  4JXJ A;  4LY6 A;  1R6B X;  3KOX E;  3I4V A;  4AG5 A;  1IY2 A;  1QYR A;  3GLG A;  3UMM A;  3GPU A;  4AQY M;  2XH9 A;  2YQZ A;  3VDU A;  1DGG A;  3KSJ A;  3UZU A;  3GPP A;  5EXP A;  4YY3 M;  2L6O A;  4GIP A;  3JR4 A;  3KS8 A;  2F4V M;  3FTC A;  4M9Z A;  2A5Y B;  3L28 A;  3W0L B;  4B3R M;  5EP4 A;  2DZO B;  2Q2E B;  5KPT A;  3KW6 A;  1XMQ M;  4PT5 A;  5FSW A;  5GKN A;  2EUC A;  2CUZ A;  5KPZ A;  3VKG A;  4LFB M;  4B3S M;  1IN8 A;  1XHB A;  2CEA A;  4KLN A;  2XZU A;  1MU5 A;  2KZS A;  2R62 A;  3VK8 A;  3R9X B;  1QAQ A;  2L7I A;  2VQE M;  4DR2 M;  1G3I A;  4DV4 M;  1L2B A;  2M5Z A;  3TWL A;  1OFI A;  3U60 A;  4XBO A;  2Y20 A;  5C18 A;  4B3M M;  4IBG A;  3GQ4 A;  4JI3 M;  3SAS A;  2HCB A;  4B08 A;  4P16 A;  2G5G X;  3GLH A;  3TWM A;  4HLQ A;  3TL4 X;  5ITU A;  3EIH A;  1HNZ M;  2J7O A;  4GKK M;  2FOI C;  1XNQ M;  4IBK A;  1DGH B;  1N32 M;  2XFS A;  1NVM A;  4KO8 A;  1IBM M;  5EP2 A;  4W5W A;  2R65 A;  3RGS A;  4REZ A;  2C9C A;  1J5E M;  1QAN A;  2C99 A;  3U6S A;  3UK6 A;  2XZF A;  3ZC7 B;  2KA6 B;  4GC5 A;  3U6L A;  5F3W A;  3VK7 A;  2XF3 A;  2LH0 A;  2M60 A;  2X4A A;  3A45 A;  2UU9 M;  4LZZ A;  1NHW C;  3KSX A;  4QHS A;  4NXN M;  1G4A E;  3M7G A;  4BB9 A;  2ERC A;  1ZAE A;  3IG5 A;  5FLX S;  3GLI B;  4JI5 M;  4LF9 M;  1IN7 A;  3FTE A;  3R8F A;  5FTL A;  2F5O A;  1K3X A;  2C98 A;  2D7E A;  3QWL A;  4Z8X A;  4AZF A;  5DYI A;  1QAM A;  1GKI A;  2UXB M;  1Q39 A;  5FTJ A;  5ITQ A;  3UGJ A;  3W0F A;  1IXR C;  3I4Y A;  3KOY E;  3DA1 A;  4DV6 M;  1W5S A;  4II7 A;  4GH9 A;  2CHV A;  2LWX A;  3OTO M;  1W5T A;  3M0E A;  1XMO M;  1IXZ A;  3AJI B;  2Y0T A;  3K92 A;  2UXD M;  3WHK A;  3T1H M;  1R2Z A;  2CV1 A;  3J80 S;  1PJI A;  3E4R A;  3SAU A;  5IWA M;  3KP1 E;  1NNJ A;  1DGF A;  2BJW A;  3FUV A;  3HKP A;  2BJV A;  3I51 A;  3HJQ A;  4CIS A;  3U6C A;  4JI7 M;  1Z6T A;  2H1R A;  4CHT B;  3Q8X A;  4A3V B;  2QBY B;  3L29 A;  4AKI A;  2VII A;  1PJJ A;  4DUZ M;  3THG A;  3U6P A;  1IN4 A;  3GQ3 A;  5EP1 A;  1X37 A;  2OQ4 A;  2V1U A;  4GRI A;  4NRV A;  1PM5 A;  4L16 A;  3GO8 A;  3PNV A;  1UM8 A;  2X49 A;  2RGH A;  2F5N A;  4LJA A;  2UUB M;  3SYL A;  4JV5 M;  1N33 M;  1JQJ C;  2KRU A;  3QAU A;  3M6A A;  2HHH M;  3GLG B;  4DV3 M;  2QCU A;  3CTW B;  4IJE A;  4ZPX A;  2Z7J A;  4DV2 M;  1HT1 E;  2ZAM A;  4LFA M;  4QHT A;  3T15 A;  2AHM A;  2C9O A;  4GIT A;  1IM2 A;  1QQW A;  4LJ7 A;  5EJC A;  4LGM A;  2XEP A;  1R2Y A;  5EQT A;  2V1C A;  3T1Y M;  1XXH A;  5EXX A;  4LF7 M;  2HL7 A;  5A2Q S;  1DGB A;  5BR8 M;  2VQF M;  2Y21 A;  5ITX A;  1NSF A;  2QP9 X;  4JN6 A;  3BOS A;  1XC8 A;  3J7A S;  3FKE A;  1N36 M;  2I7N A;  1GVN A;  3HHW A;  1Q3C A;  5ITR A;  4QNR A;  3U61 B;  4I4L A;  2FE8 A;  4NSO B;  3U61 A;  3U60 B;  3ZCB B;  3IG8 A;  4R3D A;  3E9S A;  4FD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...