2K47A

Solution structure of the c-terminal n-rna binding domain of the vesicular stomatitis virus phosphoprotein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the C-Terminal Nucleoprotein-RNA Binding Domain of the Vesicular Stomatitis Virus Phosphoprotein.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
molecule tags Replication
molecule keywords Phosphoprotein
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2k47A00
3HHWA 2K47A 3HHZA
chains in the Genus database with same CATH superfamily
1GKIA 2C98A 3AOEC 4PD2A 3Q8GA 3FTFA 5FTKA 1QANA 1TH3A 1QAOA 1DV0A 2CFOA 2KNAA 2K9DA 3SMPA 1DGHB 1JB0F 1SXJB 1E94E 2NQ8C 3GRVA 4L78A 3U6QA 3GRUA 2QQ8A 3IG5A 4PCZA 1QAMA 1IY2A 1IBMM 1A5TA 2DAEA 2LTUA 4QOSA 2YQZA 1EIJA 1IBLM 4RF0A 1I4WA 5F3WA 5KPRA 2EA0A 3CGWA 4GEWA 4MGKE 2JUJA 3RGPA 5EP3A 3K9OA 3SAWA 1V34A 3AV0A 2QSFX 3ILKA 5EP2A 3RGSA 3I4YA 5IWAM 5ITUA 1QDRA 3U5ZA 1UM8A 2VDBB 4LRSA 4DUZM 2HL7A 4LJ9A 1ZMUA 1XHBA 2W82A 4F1IA 3GLGE 1HNXM 4QHSA 4LJ8A 2CWBA 4IBGA 3U61A 1XMOM 4NRWA 1Z5AA 2WSEF 2LVNC 3A45A 4GITA 4KLNA 2HKJA 2X49A 2JXNA 2XZFA 2FOIC 3UZUA 1QUTA 1MJGM 1ZMWA 2DHYA 1GVNA 4RKUF 3FUTA 4WURA 3U60A 2QBYA 4XK8F 1N78A 1S3SA 3GLHA 1XNQM 2F5QA 4D81A 4G3OA 5DNYA 3HHYA 3GRYA 2KRUA 2Y0TA 4I81A 5FTMA 3Q8XA 3SHGB 4KT0F 3T38A 2V6ZM 2RGOA 3KS4A 2JP7A 2R4JA 1D2NA 2CP8A 3U6EA 3TWLA 4L15A 3PXGA 2L4EA 4M9ZA 4B3TM 4GHAA 2Z7JA 3GLIA 4LF6M 3J7AS 3L29A 1ZQ9A 2DKLA 2EO2A 4G4RA 4JI0M 5DYIA 3T15A 1JR3A 4Z6YA 1HQCA 2JY6B 1NJFA 2HCBA 2M60A 3EIEA 1DO2A 1XWIA 3QYEA 4IBIA 2C96A 2CV2A 4R71A 2J7OA 2XSZA 1YLAA 4JI7M 1N33M 3C3DA 4LJ6A 3ZCBB 2APLA 3HJSA 1HJPA 1KSFX 4XGIA 4FVMA 4LRTA 4FD2A 3HHWA 4YHHM 1PJJA 4GRIA 4DBGB 4B08A 1HR0M 2RGHA 4LZJA 4DR1M 2R62A 4HEOA 4G4QA 1TR8A 1NY5A 7CATA 3TWKA 4DR6M 3IECA 3GLIB 3TPZA 2H5XA 4LJ5A 3T6PA 2XZUA 4KODA 4AZFA 4OW0A 3KOYE 4D80A 1IXSA 3PNYA 1Q02A 1YE9A 4GC9A 2GNOA 1GL6A 2LH0A 2XGNA 2LVPC 4NSRA 5FTJA 3L2AA 1CUKA 4PT5A 4L6V6 2QPAA 3GLGA 4DV2M 3GPXA 3BXWA 2WSFF 3T1YM 3VFDA 3W67A 2ZTCA 2Z4RA 4OVZA 3GP1A 3T1HM 2EKFA 2M5ZA 2ZTDA 3KSJA 2O25A 2JY7A 1IM2A 5EXXA 3DZDA 4G4NA 2QBYB 4LFCM 1LTMA 1NHGC 1W5TA 2ZAMA 4JI3M 1DO0A 2KZSA 2OO9A 4DR7M 2R65A 2Z3XA 2AHMA 3FUXA 4CGYB 2BJWA 4LF7M 2JY5A 5EP1A 2YR0A 3HWSA 3KP0E 2OPFA 4XBOA 1SG9A 1EFUB 3KOXE 1DGBA 2CHVA 1LV7A 3U5ZB 3HKPA 4GH9A 2C5RA 3AKZA 5FSWA 4DR2M 1NV8A 2N35A 2LNHC 1UFZA 1TH2A 2BJVA 4X64M 5EXPA 3HU3A 4IBJA 5EXSA 2MR9A 2DENA 2OOAA 4DV7M 3RFWA 1MN3A 2EKKA 2L7HA 1D0MA 1PJSA 1YUBA 3H4JA 3U6PA 4M9SA 2DAGA 2R45A 2QP9X 4I4LA 1OAIA 4X65M 1I94M 1E9SA 4R7GA 3GPYA 2F5OA 2CUZA 4JI5M 4B7FA 4FWGA 1WIVA 3CF2A 3FTCA 1SXJA 3HJ8A 4JI4M 4LG2A 5IT9S 2WSCF 2KEBA 2LVAA 1QYRA 4DV4M 1L2DA 1WGLA 1R7RA 2C9CA 2L6OA 4HL4A 3J81S 4MGHA 1R2ZA 1SXJE 1JR3D 3LQRA 3OTOM 1F4IA 3CF6E 4MGZE 3B7NA 4LF5M 2JNHA 1K3WA 4WP2A 2DI0A 3SATA 2XSZD 2VF7A 1HNWM 3K92A 4Q7JA 4AKIA 4JXJA 3UGJA 3GPPA 2CHQA 3BBZA 4NSOB 1D0KA 3DA1A 3E21A 3SYLA 4YY3M 2XFSA 4DV6M 3U6LA 2DVWB 3D8BA 4BBAA 1EE8A 3GLGB 4LJ7A 2D7GA 2QZ4A 4IBKA 1H6UA 2MJ5B 4QHTA 4GHLA 3GPUA 4DR5M 2UXBM 5L8RF 3QYBA 1HNZM 2F5NA 3FKEA 3NBXX 1QUSA 2CV1A 3SBJA 4D82A 3JR4A 4KHPM 4WW0A 1JR3E 2OOBA 4HLQA 3J7BA 2F5SA 3FTDA 1Z6TA 2G3QA 3LCUA 2OQ4A 3KW6A 3GLIE 4AW4A 2FFJA 2R44A 4W5WA 3A46A 1VEJA 3LVWA 2JZ1A 4L16A 5BR8M 2DXIA 4II7A 1NSFA 4MB7A 4QNMA 3KVWA 1GABA 1SXJC 2G5GX 1IQPA 1TGUA 4IBEA 4CIZA 2L4FA 3GQ5A 4B7HA 3B74A 1QZEA 3FUUA 2JY8A 1WXQA 4MH0E 2DWLA 4LGMA 1FJGM 1D0LA 1T6OA 3SFZA 1Y8GA 1T43A 4DUYM 3HU2A 3VDPA 4DV3M 4MGYE 4DV1M 1C7YA 1G71A 2JA2A 2DWMA 4GKJM 3CF0A 1OJLA 1NNUC 1VDLA 3AL0C 1VEGA 4P16A 4NXNM 1PM5A 2L2DA 2VQFM 3GLHB 2MGWA 2R4EA 3FYDA 4FCTA 4KO8A 3U60B 4MGIE 4ZPXA 3TWMA 2KRKA 3R9XB 2LHCA 1IXRC 1ZV1A 1VDDA 4F2LA 2QHOB 1QVRA 1PGYA 2DWNA 3A42A 1WHCA 2Y21A 4NRVA 2QNJA 1N34M 3W0FA 4IBBA 1E32A 2LHGA 5FTNA 4LFBM 3FRIA 2FE8A 3FYCA 4PDGA 5ITXA 1K3XA 4B3SM 3L25A 4B3RM 1YSYA 4L8RC 4JV5M 2O5RA 1AIPC 1OFHA 3PFIA 2R0IA 3MK6A 3L27A 3AOGA 3UJNA 1AUAA 1IN4A 1IXSB 1G8PA 5FTLA 4LZZA 4FCWA 3KFUG 1WR1B 1L1ZA 4JN6A 4UN2B 2QCUA 1Q3BA 3QWLA 2Q2EB 2J5YA 2LXEA 3L28A 2D7EA 3I51A 2Z4SA 2LWXA 3E9SA 3HX3A 5EQTA 4REZA 3I01M 5EP4A 5E6JA 3MHVC 1VQ1A 1OAOC 3HJQA 2UXDM 1QQWA 3AOEA 3GLFE 3SAUA 3PNVA 2UXCM 1IXZA 3FD9A 3I04M 4A3VB 3I4VA 4OU7A 5A2QS 1QDTA 4TUWA 4I5SA 1V92A 2CEAA 1GL7A 5ITXE 2ZM6M 4AI6A 4X62M 1P3QQ 2FS1A 3ZC7B 4NOOB 3C9PA 3FRHA 2KNZA 4IIWA 4CISA 3KXEC 5BPVA 4ITQA 1OFIA 4M0WA 2L7IA 2K47A 1DGFA 2XH9A 5GKNA 1VEKA 4CJ6A 1OTRA 2EUCA 2O01F 3DOAA 3ZH9B 1XXHE 2LVQD 1GO5A 5KPTA 3C3EA 4Y28F 1IY1A 2K6BA 3LVVA 2ZBKB 2KZUA 1G3IA 2CE7A 4FWHA 5JI3E 4EIWA 3GRRA 3HY5A 1N77A 3U6DA 3WHKA 2UUCM 1TH4A 2FNAA 3GLFA 2DAKA 3LCVB 1DGGA 2I7NA 1TDHA 1PJTA 3SMSA 4GIPA 2KNVA 3ZQJA 3KP1E 1XC8A 1N36M 2J7NA 1GLNA 1L2BA 5C1BA 4LGYA 4QNRA 3AFHA 4LJAA 1KYIA 5LMUM 1HQYE 3A98B 5KPZA 3H4MA 3U6MA 1J5EM 2Y0QA 5ITRA 1HT2E 4AG5A 4NL4H 5ITYA 3KOWE 1TDZA 1WGNA 2C9OA 1E9RA 1NY6A 4K0KM 1VG5A 2GQFA 1N32M 3HZJA 4OX9M 3K8ZA 3W68A 2DHRA 1Q39A 3UMMA 3TE6A 2XF3A 1QAQA 3SAVA 2ZAOA 2ERCA 4DR4M 2Y20A 1GJSA 5C18A 1WJ7A 1OIPA 4IBFA 2R6FA 4PDIA 4IJEA 3THGA 4FWDA 2CRUA 3GO8A 4AKGA 1K82A 1X37A 3EIHA 3VDUA 1L8QA 3K9PA 5ITQA 5EJCA 4X66M 4RF1A 1NVMA 2DZNB 2F4VM 3KS8A 4IJFA 3U6OA 1OQYA 4GMQA 2B3TA 3CTWB 2P5TA 4LF4M 1XB2B 2MROB 1Q3CA 3KSXA 4ANRA 1L2CA 2XLJA 1DGHA 1NO1A 1XNRM 2KA6B 1IN7A 2D7HA 5IZ7D 1R4GA 2VQEM 3LMMA 4BB9A 3M7GA 2R46A 1FNNA 2BWBA 1G41A 4LF9M 5JI2E 4OVZB 3VKGA 1TTEA 2DWZB 2R18A 4MM3B 3FTEA 3B9PA 4JYAM 2EJSA 4B3MM 2DNAA 1QZMA 1JQJC 2BNKA 3E46A 1L1TA 2L09A 3MJ5A 3WHLA 2H1RA 3UK6A 3W0LB 3LW5F 2DAMA 1GJTA 2V1CA 3VLFB 3VKHA 1PJIA 4Z8XA 1PRBA 3IHPA 1R5LA 1IFYA 4R3DA 4JI8M 1OKSA 3B89A 3MMPA 4DV0M 4I8OA 3SC3A 3BOSA 1OIZA 2FH0A 3HGIA 2KHHA 3KDSE 4FW9A 4P17A 3B7ZA 2RKOA 1J7KA 1XXHB 4LJ4A 3HHXA 4IBDA 1IY0A 2HAKA 2YNMD 4CHTB 2KW0A 2K0BX 5EXTA 4GKKM 2XFTA 1IN5A 3GQ3A 4JI2M 3SHFA 1PJQA 1G59A 2XEPA 1MU5A 1R6BX 3FE3A 5ITTA 3L26A 1Z5CA 2F5PA 4NC6A 3B7QA 3F92A 4NXMM 4M9XA 4FCVA 2C99A 1T3TA 4GC5A 3GLFB 3SYKA 2E5LM 3NBIA 1NHWC 5DYGA 3TQSA 3GLHE 1TF0B 2HWJA 2Z8YM 2BWEA 2RRUA 5LMNM 2UUAM 2ZANA 3TL4X 1KFVA 3VK8A 1SXJD 1NV9A 2I7PA 4G4OA 2UU9M 1NNJA 4DV5M 2DAIA 1IBKM 3JR5A 4LFAM 5KQDA 1V33A 2JZ0A 2UUBM 2WZJA 3K2LA 5FLXS 2LBCA 4QOZC 1C1KA 3SASA 1ORYB 3U61B 1NJGA 1R2YA 2A5YB 4M0DA 1XXHA 4LF8M 4DR3M 5E26A 3JAMS 3SARA 4JI1M 1HT1E 8CATA 3C58A 4G6ZA 4AG6A 1IN8A 1IN6A 3KOZE 5IREB 3R8FA 3DFZA 2QENA 1Z5BA 3QAUA 1BVSA 2DZLA 4LCBA 3U6SA 3RE8A 2VF8A 3D8LA 2KDLA 3V76A 2V1UA 2X8AA 3M0EA 1RU3A 3FUWA 4AQYM 1MX0A 2G8LA 3HHZA 1Z59A 1ZMVA 1ZAEA 3HU1A 3LQQA 1J09A 4LY6A 5DFLA 5KQ8A 3U6CA 3PVSA 3J80S 2YFQA 1XMQM 4S12A 2CHGA 3VK7A 2CV0A 2KXEA 1W5SA 3NWLA 4L4UA 3IG8A 3M6AA 4IBCA 4AKHA 3J27B 3K1JA 4BLCA 2DZOB 2JWSA 2LVOC 1N75A 4B7GA 3GQ4A 1G4AE 5H37D 4JI6M 3FUVA 2VIIA 3E4RA 2X4AA 4RNAA 5KO3A 3AJIB 3J2PB 2MH8A 2HHHM
chains in the Genus database with same CATH topology
1GKIA 2C98A 3AOEC 4PD2A 3FTFA 5FTKA 1QANA 1TH3A 1QAOA 2CFOA 3SMPA 1DGHB 2NQ8C 1SXJB 1E94E 3GRVA 4L78A 3U6QA 3GRUA 3IG5A 4PCZA 1QAMA 1IY2A 1IBMM 4QOSA 2YQZA 1IBLM 4RF0A 1I4WA 5F3WA 5KPRA 2EA0A 4MGKE 3RGPA 5EP3A 3SAWA 3AV0A 3ILKA 5EP2A 3RGSA 3I4YA 5IWAM 5ITUA 3U5ZA 1UM8A 4LRSA 4DUZM 2HL7A 4LJ9A 1XHBA 2W82A 1HNXM 4QHSA 4LJ8A 1XMOM 4IBGA 3U61A 4NRWA 1Z5AA 3A45A 4GITA 4KLNA 2HKJA 2X49A 2XZFA 2FOIC 3UZUA 1GVNA 3FUTA 4WURA 3U60A 2QBYA 1N78A 1S3SA 3GLHA 1XNQM 2F5QA 4D81A 5DNYA 3HHYA 3GRYA 2KRUA 2Y0TA 4I81A 5FTMA 3Q8XA 3SHGB 3T38A 1L2BA 2V6ZM 2RGOA 3KS4A 2R4JA 1D2NA 3U6EA 3TWLA 4L15A 3PXGA 4M9ZA 4B3TM 4GHAA 2Z7JA 3GLIA 4LF6M 3J7AS 3L29A 1ZQ9A 2EO2A 4G4RA 4JI0M 5DYIA 3T15A 1JR3A 4Z6YA 1HQCA 1NJFA 2HCBA 2M60A 3EIEA 1DO2A 1XWIA 4IBIA 2C96A 2CV2A 2J7OA 2XSZA 4JI7M 1N33M 4LJ6A 3ZCBB 3HJSA 1KSFX 4XGIA 4FVMA 4LRTA 4FD2A 3HHWA 4YHHM 1PJJA 4GRIA 4B08A 1HR0M 2RGHA 4LZJA 4DR1M 2R62A 4G4QA 1NY5A 7CATA 3TWKA 4DR6M 3GLIB 3TPZA 2XZUA 4LJ5A 4KODA 4AZFA 4OW0A 3KOYE 4D80A 3PNYA 1YE9A 4GC9A 2XGNA 1GL6A 2LH0A 4NSRA 5FTJA 4DV2M 3L2AA 4PT5A 2QPAA 3GLGA 3GPXA 3T1YM 3VFDA 2Z4RA 4OVZA 3GP1A 3T1HM 2DWMA 2M5ZA 3KSJA 5EXXA 2QBYB 1IM2A 3DZDA 4G4NA 4LFCM 2ZAMA 1NHGC 1W5TA 4JI3M 1DO0A 2KZSA 4DR7M 2R65A 2Z3XA 2AHMA 3FUXA 4CGYB 2BJWA 4LF7M 5EP1A 2YR0A 3HWSA 3KP0E 2OPFA 4XBOA 3KOXE 1DGBA 2CHVA 1LV7A 3U5ZB 3HKPA 4GH9A 2C5RA 3AKZA 5FSWA 4DR2M 2LNHC 1TH2A 2BJVA 4X64M 5EXPA 3HU3A 4IBJA 5EXSA 4DV7M 3RFWA 2L7HA 1YUBA 3U6PA 4M9SA 2R45A 2QP9X 4I4LA 4X65M 1I94M 1E9SA 4R7GA 3GPYA 2F5OA 2CUZA 4JI5M 4B7FA 4FWGA 3CF2A 3FTCA 1SXJA 3HJ8A 4JI4M 4LG2A 5IT9S 2KEBA 1QYRA 4DV4M 1L2DA 1R7RA 2C9CA 2L6OA 4HL4A 3J81S 4MGHA 1R2ZA 1SXJE 1JR3D 3LQRA 3OTOM 3CF6E 4MGZE 4LF5M 1K3WA 3SATA 1HNWM 2XSZD 3K92A 4AKIA 4JXJA 3UGJA 3GPPA 2CHQA 4NSOB 3SYLA 3DA1A 4YY3M 4DV6M 3U6LA 4B3MM 2XFSA 2DVWB 3D8BA 4BBAA 1EE8A 3GLGB 4LJ7A 2D7GA 2QZ4A 4IBKA 1H6UA 4QHTA 4GHLA 2UXBM 3GPUA 4DR5M 2F5NA 1HNZM 3FKEA 2CV1A 3SBJA 4D82A 3JR4A 4KHPM 4WW0A 4HLQA 3J7BA 2F5SA 3FTDA 1Z6TA 2OQ4A 3KW6A 4AW4A 2FFJA 4W5WA 3A46A 3LVWA 4L16A 5BR8M 2DXIA 4II7A 1NSFA 4MB7A 4QNMA 3KVWA 1SXJC 2G5GX 1IQPA 1TGUA 4IBEA 3GQ5A 4B7HA 3FUUA 1WXQA 4MH0E 2DWLA 4LGMA 1FJGM 3SFZA 4DUYM 3HU2A 3VDPA 4DV3M 4MGYE 4DV1M 4GKJM 2JA2A 3CF0A 1OJLA 1NNUC 3AL0C 4NXNM 4P16A 1PM5A 2VQFM 3GLHB 4FCTA 2R4EA 3FYDA 4KO8A 3U60B 4MGIE 4ZPXA 3TWMA 2KRKA 3R9XB 1IXRC 1VDDA 1QVRA 2DWNA 3A42A 2Y21A 4NRVA 1N34M 3W0FA 4IBBA 1E32A 5FTNA 4LFBM 2FE8A 3FYCA 4PDGA 5ITXA 4B3SM 3L25A 4B3RM 1YSYA 4L8RC 4JV5M 2O5RA 1OFHA 3PFIA 3MK6A 3L27A 3AOGA 3UJNA 1IXSB 1IN4A 5FTLA 1G8PA 4LZZA 4FCWA 3KFUG 1L1ZA 4JN6A 2QCUA 1Q3BA 3QWLA 2Q2EB 2LXEA 3L28A 2D7EA 3I51A 2Z4SA 2LWXA 3E9SA 5EQTA 4REZA 5EP4A 5E6JA 3MHVC 3HJQA 2UXDM 1QQWA 3AOEA 3SAUA 2UXCM 3PNVA 1IXZA 3FD9A 4A3VB 4OU7A 3I4VA 5A2QS 4TUWA 4I5SA 2CEAA 1GL7A 5ITXE 2ZM6M 4AI6A 4X62M 4JI8M 3ZC7B 4NOOB 4IIWA 4CISA 4ITQA 3KXEC 5BPVA 1OFIA 4M0WA 2L7IA 2K47A 1DGFA 2XH9A 5GKNA 2EUCA 3DOAA 3ZH9B 5KPTA 1IY1A 3LVVA 2ZBKB 2KZUA 1G3IA 2CE7A 4FWHA 5JI3E 4EIWA 3GRRA 1N77A 3U6DA 3WHKA 2UUCM 1TH4A 2FNAA 3GLFA 1DGGA 2I7NA 1TDHA 3SMSA 4GIPA 3KP1E 1XC8A 1N36M 2J7NA 1GLNA 5C1BA 4LGYA 4QNRA 3AFHA 4LJAA 1KYIA 5LMUM 1HQYE 3A98B 5KPZA 3H4MA 3U6MA 1J5EM 2Y0QA 5ITRA 1HT2E 4AG5A 4NL4H 5ITYA 3KOWE 1TDZA 2C9OA 4K0KM 1E9RA 1NY6A 1N32M 4OX9M 3K8ZA 2DHRA 1Q39A 3UMMA 3TE6A 2XF3A 1QAQA 3SAVA 2ZAOA 2ERCA 4DR4M 2Y20A 5C18A 4IBFA 4PDIA 4IJEA 3THGA 4FWDA 3GO8A 4AKGA 1K82A 1X37A 3EIHA 3VDUA 1L8QA 5ITQA 5EJCA 4X66M 4RF1A 1NVMA 2DZNB 2F4VM 3KS8A 4IJFA 3U6OA 4GMQA 3CTWB 2P5TA 4LF4M 1Q3CA 3KSXA 1L2CA 2XLJA 1DGHA 1XNRM 2KA6B 1IN7A 2D7HA 5IZ7D 2VQEM 3LMMA 4BB9A 3M7GA 2R46A 1FNNA 4LF9M 1G41A 5JI2E 4OVZB 3VKGA 2DWZB 2R18A 3FTEA 4MM3B 3B9PA 4JYAM 1QZMA 1JQJC 2BNKA 1L1TA 2L09A 3MJ5A 3WHLA 2H1RA 3UK6A 3W0LB 2V1CA 3VLFB 3VKHA 1PJIA 4Z8XA 4R3DA 4DV0M 4I8OA 3SC3A 3BOSA 3HGIA 4FW9A 3KDSE 2RKOA 1J7KA 1XXHB 4LJ4A 3HHXA 4IBDA 1IY0A 2YNMD 4CHTB 2KW0A 5EXTA 4GKKM 2XFTA 1IN5A 3GQ3A 4JI2M 3SHFA 1G59A 2XEPA 1MU5A 1R6BX 5ITTA 3L26A 1Z5CA 2F5PA 4NXMM 4M9XA 4FCVA 2C99A 1T3TA 4GC5A 3GLFB 3SYKA 2E5LM 3NBIA 1NHWC 5DYGA 3TQSA 5LMNM 2UUAM 2ZANA 3TL4X 1KFVA 3VK8A 1SXJD 2I7PA 4G4OA 2UU9M 1NNJA 4DV5M 1IBKM 3JR5A 4LFAM 5KQDA 2UUBM 3K2LA 5FLXS 4QOZC 1C1KA 3SASA 1ORYB 3U61B 1NJGA 1R2YA 2A5YB 4M0DA 1XXHA 4LF8M 4DR3M 5E26A 3JAMS 3SARA 4JI1M 1HT1E 8CATA 3C58A 4G6ZA 4AG6A 1IN8A 1IN6A 3KOZE 5IREB 3R8FA 3DFZA 2QENA 1Z5BA 3QAUA 3U6SA 4LCBA 1K3XA 2V1UA 3RE8A 3D8LA 2X8AA 3M0EA 3FUWA 4AQYM 1MX0A 2G8LA 3HHZA 1Z59A 4LY6A 1ZAEA 3HU1A 3LQQA 1J09A 5KQ8A 3U6CA 3PVSA 3J80S 2YFQA 1XMQM 4S12A 2CHGA 3VK7A 2CV0A 2KXEA 1W5SA 3NWLA 4L4UA 3IG8A 3M6AA 4IBCA 4AKHA 3J27B 3K1JA 4BLCA 2DZOB 1N75A 4B7GA 3GQ4A 1G4AE 5H37D 4JI6M 3FUVA 2VIIA 3E4RA 2X4AA 4RNAA 5KO3A 3AJIB 3J2PB 2HHHM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHW A;  2K47 A;  3HHZ A; 
#chains in the Genus database with same CATH topology
 1GKI A;  2C98 A;  3AOE C;  4PD2 A;  3Q8G A;  3FTF A;  5FTK A;  1QAN A;  1TH3 A;  1QAO A;  1DV0 A;  2CFO A;  2KNA A;  2K9D A;  3SMP A;  1DGH B;  1JB0 F;  1SXJ B;  1E94 E;  2NQ8 C;  3GRV A;  4L78 A;  3U6Q A;  3GRU A;  2QQ8 A;  3IG5 A;  4PCZ A;  1QAM A;  1IY2 A;  1IBM M;  1A5T A;  2DAE A;  2LTU A;  4QOS A;  2YQZ A;  1EIJ A;  1IBL M;  4RF0 A;  1I4W A;  5F3W A;  5KPR A;  2EA0 A;  3CGW A;  4GEW A;  4MGK E;  2JUJ A;  3RGP A;  5EP3 A;  3K9O A;  3SAW A;  1V34 A;  3AV0 A;  2QSF X;  3ILK A;  5EP2 A;  3RGS A;  3I4Y A;  5IWA M;  5ITU A;  1QDR A;  3U5Z A;  1UM8 A;  2VDB B;  4LRS A;  4DUZ M;  2HL7 A;  4LJ9 A;  1ZMU A;  1XHB A;  2W82 A;  4F1I A;  3GLG E;  1HNX M;  4QHS A;  4LJ8 A;  2CWB A;  4IBG A;  3U61 A;  1XMO M;  4NRW A;  1Z5A A;  2WSE F;  2LVN C;  3A45 A;  4GIT A;  4KLN A;  2HKJ A;  2X49 A;  2JXN A;  2XZF A;  2FOI C;  3UZU A;  1QUT A;  1MJG M;  1ZMW A;  2DHY A;  1GVN A;  4RKU F;  3FUT A;  4WUR A;  3U60 A;  2QBY A;  4XK8 F;  1N78 A;  1S3S A;  3GLH A;  1XNQ M;  2F5Q A;  4D81 A;  4G3O A;  5DNY A;  3HHY A;  3GRY A;  2KRU A;  2Y0T A;  4I81 A;  5FTM A;  3Q8X A;  3SHG B;  4KT0 F;  3T38 A;  2V6Z M;  2RGO A;  3KS4 A;  2JP7 A;  2R4J A;  1D2N A;  2CP8 A;  3U6E A;  3TWL A;  4L15 A;  3PXG A;  2L4E A;  4M9Z A;  4B3T M;  4GHA A;  2Z7J A;  3GLI A;  4LF6 M;  3J7A S;  3L29 A;  1ZQ9 A;  2DKL A;  2EO2 A;  4G4R A;  4JI0 M;  5DYI A;  3T15 A;  1JR3 A;  4Z6Y A;  1HQC A;  2JY6 B;  1NJF A;  2HCB A;  2M60 A;  3EIE A;  1DO2 A;  1XWI A;  3QYE A;  4IBI A;  2C96 A;  2CV2 A;  4R71 A;  2J7O A;  2XSZ A;  1YLA A;  4JI7 M;  1N33 M;  3C3D A;  4LJ6 A;  3ZCB B;  2APL A;  3HJS A;  1HJP A;  1KSF X;  4XGI A;  4FVM A;  4LRT A;  4FD2 A;  3HHW A;  4YHH M;  1PJJ A;  4GRI A;  4DBG B;  4B08 A;  1HR0 M;  2RGH A;  4LZJ A;  4DR1 M;  2R62 A;  4HEO A;  4G4Q A;  1TR8 A;  1NY5 A;  7CAT A;  3TWK A;  4DR6 M;  3IEC A;  3GLI B;  3TPZ A;  2H5X A;  4LJ5 A;  3T6P A;  2XZU A;  4KOD A;  4AZF A;  4OW0 A;  3KOY E;  4D80 A;  1IXS A;  3PNY A;  1Q02 A;  1YE9 A;  4GC9 A;  2GNO A;  1GL6 A;  2LH0 A;  2XGN A;  2LVP C;  4NSR A;  5FTJ A;  3L2A A;  1CUK A;  4PT5 A;  4L6V 6;  2QPA A;  3GLG A;  4DV2 M;  3GPX A;  3BXW A;  2WSF F;  3T1Y M;  3VFD A;  3W67 A;  2ZTC A;  2Z4R A;  4OVZ A;  3GP1 A;  3T1H M;  2EKF A;  2M5Z A;  2ZTD A;  3KSJ A;  2O25 A;  2JY7 A;  1IM2 A;  5EXX A;  3DZD A;  4G4N A;  2QBY B;  4LFC M;  1LTM A;  1NHG C;  1W5T A;  2ZAM A;  4JI3 M;  1DO0 A;  2KZS A;  2OO9 A;  4DR7 M;  2R65 A;  2Z3X A;  2AHM A;  3FUX A;  4CGY B;  2BJW A;  4LF7 M;  2JY5 A;  5EP1 A;  2YR0 A;  3HWS A;  3KP0 E;  2OPF A;  4XBO A;  1SG9 A;  1EFU B;  3KOX E;  1DGB A;  2CHV A;  1LV7 A;  3U5Z B;  3HKP A;  4GH9 A;  2C5R A;  3AKZ A;  5FSW A;  4DR2 M;  1NV8 A;  2N35 A;  2LNH C;  1UFZ A;  1TH2 A;  2BJV A;  4X64 M;  5EXP A;  3HU3 A;  4IBJ A;  5EXS A;  2MR9 A;  2DEN A;  2OOA A;  4DV7 M;  3RFW A;  1MN3 A;  2EKK A;  2L7H A;  1D0M A;  1PJS A;  1YUB A;  3H4J A;  3U6P A;  4M9S A;  2DAG A;  2R45 A;  2QP9 X;  4I4L A;  1OAI A;  4X65 M;  1I94 M;  1E9S A;  4R7G A;  3GPY A;  2F5O A;  2CUZ A;  4JI5 M;  4B7F A;  4FWG A;  1WIV A;  3CF2 A;  3FTC A;  1SXJ A;  3HJ8 A;  4JI4 M;  4LG2 A;  5IT9 S;  2WSC F;  2KEB A;  2LVA A;  1QYR A;  4DV4 M;  1L2D A;  1WGL A;  1R7R A;  2C9C A;  2L6O A;  4HL4 A;  3J81 S;  4MGH A;  1R2Z A;  1SXJ E;  1JR3 D;  3LQR A;  3OTO M;  1F4I A;  3CF6 E;  4MGZ E;  3B7N A;  4LF5 M;  2JNH A;  1K3W A;  4WP2 A;  2DI0 A;  3SAT A;  2XSZ D;  2VF7 A;  1HNW M;  3K92 A;  4Q7J A;  4AKI A;  4JXJ A;  3UGJ A;  3GPP A;  2CHQ A;  3BBZ A;  4NSO B;  1D0K A;  3DA1 A;  3E21 A;  3SYL A;  4YY3 M;  2XFS A;  4DV6 M;  3U6L A;  2DVW B;  3D8B A;  4BBA A;  1EE8 A;  3GLG B;  4LJ7 A;  2D7G A;  2QZ4 A;  4IBK A;  1H6U A;  2MJ5 B;  4QHT A;  4GHL A;  3GPU A;  4DR5 M;  2UXB M;  5L8R F;  3QYB A;  1HNZ M;  2F5N A;  3FKE A;  3NBX X;  1QUS A;  2CV1 A;  3SBJ A;  4D82 A;  3JR4 A;  4KHP M;  4WW0 A;  1JR3 E;  2OOB A;  4HLQ A;  3J7B A;  2F5S A;  3FTD A;  1Z6T A;  2G3Q A;  3LCU A;  2OQ4 A;  3KW6 A;  3GLI E;  4AW4 A;  2FFJ A;  2R44 A;  4W5W A;  3A46 A;  1VEJ A;  3LVW A;  2JZ1 A;  4L16 A;  5BR8 M;  2DXI A;  4II7 A;  1NSF A;  4MB7 A;  4QNM A;  3KVW A;  1GAB A;  1SXJ C;  2G5G X;  1IQP A;  1TGU A;  4IBE A;  4CIZ A;  2L4F A;  3GQ5 A;  4B7H A;  3B74 A;  1QZE A;  3FUU A;  2JY8 A;  1WXQ A;  4MH0 E;  2DWL A;  4LGM A;  1FJG M;  1D0L A;  1T6O A;  3SFZ A;  1Y8G A;  1T43 A;  4DUY M;  3HU2 A;  3VDP A;  4DV3 M;  4MGY E;  4DV1 M;  1C7Y A;  1G71 A;  2JA2 A;  2DWM A;  4GKJ M;  3CF0 A;  1OJL A;  1NNU C;  1VDL A;  3AL0 C;  1VEG A;  4P16 A;  4NXN M;  1PM5 A;  2L2D A;  2VQF M;  3GLH B;  2MGW A;  2R4E A;  3FYD A;  4FCT A;  4KO8 A;  3U60 B;  4MGI E;  4ZPX A;  3TWM A;  2KRK A;  3R9X B;  2LHC A;  1IXR C;  1ZV1 A;  1VDD A;  4F2L A;  2QHO B;  1QVR A;  1PGY A;  2DWN A;  3A42 A;  1WHC A;  2Y21 A;  4NRV A;  2QNJ A;  1N34 M;  3W0F A;  4IBB A;  1E32 A;  2LHG A;  5FTN A;  4LFB M;  3FRI A;  2FE8 A;  3FYC A;  4PDG A;  5ITX A;  1K3X A;  4B3S M;  3L25 A;  4B3R M;  1YSY A;  4L8R C;  4JV5 M;  2O5R A;  1AIP C;  1OFH A;  3PFI A;  2R0I A;  3MK6 A;  3L27 A;  3AOG A;  3UJN A;  1AUA A;  1IN4 A;  1IXS B;  1G8P A;  5FTL A;  4LZZ A;  4FCW A;  3KFU G;  1WR1 B;  1L1Z A;  4JN6 A;  4UN2 B;  2QCU A;  1Q3B A;  3QWL A;  2Q2E B;  2J5Y A;  2LXE A;  3L28 A;  2D7E A;  3I51 A;  2Z4S A;  2LWX A;  3E9S A;  3HX3 A;  5EQT A;  4REZ A;  3I01 M;  5EP4 A;  5E6J A;  3MHV C;  1VQ1 A;  1OAO C;  3HJQ A;  2UXD M;  1QQW A;  3AOE A;  3GLF E;  3SAU A;  3PNV A;  2UXC M;  1IXZ A;  3FD9 A;  3I04 M;  4A3V B;  3I4V A;  4OU7 A;  5A2Q S;  1QDT A;  4TUW A;  4I5S A;  1V92 A;  2CEA A;  1GL7 A;  5ITX E;  2ZM6 M;  4AI6 A;  4X62 M;  1P3Q Q;  2FS1 A;  3ZC7 B;  4NOO B;  3C9P A;  3FRH A;  2KNZ A;  4IIW A;  4CIS A;  3KXE C;  5BPV A;  4ITQ A;  1OFI A;  4M0W A;  2L7I A;  2K47 A;  1DGF A;  2XH9 A;  5GKN A;  1VEK A;  4CJ6 A;  1OTR A;  2EUC A;  2O01 F;  3DOA A;  3ZH9 B;  1XXH E;  2LVQ D;  1GO5 A;  5KPT A;  3C3E A;  4Y28 F;  1IY1 A;  2K6B A;  3LVV A;  2ZBK B;  2KZU A;  1G3I A;  2CE7 A;  4FWH A;  5JI3 E;  4EIW A;  3GRR A;  3HY5 A;  1N77 A;  3U6D A;  3WHK A;  2UUC M;  1TH4 A;  2FNA A;  3GLF A;  2DAK A;  3LCV B;  1DGG A;  2I7N A;  1TDH A;  1PJT A;  3SMS A;  4GIP A;  2KNV A;  3ZQJ A;  3KP1 E;  1XC8 A;  1N36 M;  2J7N A;  1GLN A;  1L2B A;  5C1B A;  4LGY A;  4QNR A;  3AFH A;  4LJA A;  1KYI A;  5LMU M;  1HQY E;  3A98 B;  5KPZ A;  3H4M A;  3U6M A;  1J5E M;  2Y0Q A;  5ITR A;  1HT2 E;  4AG5 A;  4NL4 H;  5ITY A;  3KOW E;  1TDZ A;  1WGN A;  2C9O A;  1E9R A;  1NY6 A;  4K0K M;  1VG5 A;  2GQF A;  1N32 M;  3HZJ A;  4OX9 M;  3K8Z A;  3W68 A;  2DHR A;  1Q39 A;  3UMM A;  3TE6 A;  2XF3 A;  1QAQ A;  3SAV A;  2ZAO A;  2ERC A;  4DR4 M;  2Y20 A;  1GJS A;  5C18 A;  1WJ7 A;  1OIP A;  4IBF A;  2R6F A;  4PDI A;  4IJE A;  3THG A;  4FWD A;  2CRU A;  3GO8 A;  4AKG A;  1K82 A;  1X37 A;  3EIH A;  3VDU A;  1L8Q A;  3K9P A;  5ITQ A;  5EJC A;  4X66 M;  4RF1 A;  1NVM A;  2DZN B;  2F4V M;  3KS8 A;  4IJF A;  3U6O A;  1OQY A;  4GMQ A;  2B3T A;  3CTW B;  2P5T A;  4LF4 M;  1XB2 B;  2MRO B;  1Q3C A;  3KSX A;  4ANR A;  1L2C A;  2XLJ A;  1DGH A;  1NO1 A;  1XNR M;  2KA6 B;  1IN7 A;  2D7H A;  5IZ7 D;  1R4G A;  2VQE M;  3LMM A;  4BB9 A;  3M7G A;  2R46 A;  1FNN A;  2BWB A;  1G41 A;  4LF9 M;  5JI2 E;  4OVZ B;  3VKG A;  1TTE A;  2DWZ B;  2R18 A;  4MM3 B;  3FTE A;  3B9P A;  4JYA M;  2EJS A;  4B3M M;  2DNA A;  1QZM A;  1JQJ C;  2BNK A;  3E46 A;  1L1T A;  2L09 A;  3MJ5 A;  3WHL A;  2H1R A;  3UK6 A;  3W0L B;  3LW5 F;  2DAM A;  1GJT A;  2V1C A;  3VLF B;  3VKH A;  1PJI A;  4Z8X A;  1PRB A;  3IHP A;  1R5L A;  1IFY A;  4R3D A;  4JI8 M;  1OKS A;  3B89 A;  3MMP A;  4DV0 M;  4I8O A;  3SC3 A;  3BOS A;  1OIZ A;  2FH0 A;  3HGI A;  2KHH A;  3KDS E;  4FW9 A;  4P17 A;  3B7Z A;  2RKO A;  1J7K A;  1XXH B;  4LJ4 A;  3HHX A;  4IBD A;  1IY0 A;  2HAK A;  2YNM D;  4CHT B;  2KW0 A;  2K0B X;  5EXT A;  4GKK M;  2XFT A;  1IN5 A;  3GQ3 A;  4JI2 M;  3SHF A;  1PJQ A;  1G59 A;  2XEP A;  1MU5 A;  1R6B X;  3FE3 A;  5ITT A;  3L26 A;  1Z5C A;  2F5P A;  4NC6 A;  3B7Q A;  3F92 A;  4NXM M;  4M9X A;  4FCV A;  2C99 A;  1T3T A;  4GC5 A;  3GLF B;  3SYK A;  2E5L M;  3NBI A;  1NHW C;  5DYG A;  3TQS A;  3GLH E;  1TF0 B;  2HWJ A;  2Z8Y M;  2BWE A;  2RRU A;  5LMN M;  2UUA M;  2ZAN A;  3TL4 X;  1KFV A;  3VK8 A;  1SXJ D;  1NV9 A;  2I7P A;  4G4O A;  2UU9 M;  1NNJ A;  4DV5 M;  2DAI A;  1IBK M;  3JR5 A;  4LFA M;  5KQD A;  1V33 A;  2JZ0 A;  2UUB M;  2WZJ A;  3K2L A;  5FLX S;  2LBC A;  4QOZ C;  1C1K A;  3SAS A;  1ORY B;  3U61 B;  1NJG A;  1R2Y A;  2A5Y B;  4M0D A;  1XXH A;  4LF8 M;  4DR3 M;  5E26 A;  3JAM S;  3SAR A;  4JI1 M;  1HT1 E;  8CAT A;  3C58 A;  4G6Z A;  4AG6 A;  1IN8 A;  1IN6 A;  3KOZ E;  5IRE B;  3R8F A;  3DFZ A;  2QEN A;  1Z5B A;  3QAU A;  1BVS A;  2DZL A;  4LCB A;  3U6S A;  3RE8 A;  2VF8 A;  3D8L A;  2KDL A;  3V76 A;  2V1U A;  2X8A A;  3M0E A;  1RU3 A;  3FUW A;  4AQY M;  1MX0 A;  2G8L A;  3HHZ A;  1Z59 A;  1ZMV A;  1ZAE A;  3HU1 A;  3LQQ A;  1J09 A;  4LY6 A;  5DFL A;  5KQ8 A;  3U6C A;  3PVS A;  3J80 S;  2YFQ A;  1XMQ M;  4S12 A;  2CHG A;  3VK7 A;  2CV0 A;  2KXE A;  1W5S A;  3NWL A;  4L4U A;  3IG8 A;  3M6A A;  4IBC A;  4AKH A;  3J27 B;  3K1J A;  4BLC A;  2DZO B;  2JWS A;  2LVO C;  1N75 A;  4B7G A;  3GQ4 A;  1G4A E;  5H37 D;  4JI6 M;  3FUV A;  2VII A;  3E4R A;  2X4A A;  4RNA A;  5KO3 A;  3AJI B;  3J2P B;  2MH8 A;  2HHH M; 
#chains in the Genus database with same CATH homology
 1GKI A;  2C98 A;  3AOE C;  4PD2 A;  3FTF A;  5FTK A;  1QAN A;  1TH3 A;  1QAO A;  2CFO A;  3SMP A;  1DGH B;  2NQ8 C;  1SXJ B;  1E94 E;  3GRV A;  4L78 A;  3U6Q A;  3GRU A;  3IG5 A;  4PCZ A;  1QAM A;  1IY2 A;  1IBM M;  4QOS A;  2YQZ A;  1IBL M;  4RF0 A;  1I4W A;  5F3W A;  5KPR A;  2EA0 A;  4MGK E;  3RGP A;  5EP3 A;  3SAW A;  3AV0 A;  3ILK A;  5EP2 A;  3RGS A;  3I4Y A;  5IWA M;  5ITU A;  3U5Z A;  1UM8 A;  4LRS A;  4DUZ M;  2HL7 A;  4LJ9 A;  1XHB A;  2W82 A;  1HNX M;  4QHS A;  4LJ8 A;  1XMO M;  4IBG A;  3U61 A;  4NRW A;  1Z5A A;  3A45 A;  4GIT A;  4KLN A;  2HKJ A;  2X49 A;  2XZF A;  2FOI C;  3UZU A;  1GVN A;  3FUT A;  4WUR A;  3U60 A;  2QBY A;  1N78 A;  1S3S A;  3GLH A;  1XNQ M;  2F5Q A;  4D81 A;  5DNY A;  3HHY A;  3GRY A;  2KRU A;  2Y0T A;  4I81 A;  5FTM A;  3Q8X A;  3SHG B;  3T38 A;  1L2B A;  2V6Z M;  2RGO A;  3KS4 A;  2R4J A;  1D2N A;  3U6E A;  3TWL A;  4L15 A;  3PXG A;  4M9Z A;  4B3T M;  4GHA A;  2Z7J A;  3GLI A;  4LF6 M;  3J7A S;  3L29 A;  1ZQ9 A;  2EO2 A;  4G4R A;  4JI0 M;  5DYI A;  3T15 A;  1JR3 A;  4Z6Y A;  1HQC A;  1NJF A;  2HCB A;  2M60 A;  3EIE A;  1DO2 A;  1XWI A;  4IBI A;  2C96 A;  2CV2 A;  2J7O A;  2XSZ A;  4JI7 M;  1N33 M;  4LJ6 A;  3ZCB B;  3HJS A;  1KSF X;  4XGI A;  4FVM A;  4LRT A;  4FD2 A;  3HHW A;  4YHH M;  1PJJ A;  4GRI A;  4B08 A;  1HR0 M;  2RGH A;  4LZJ A;  4DR1 M;  2R62 A;  4G4Q A;  1NY5 A;  7CAT A;  3TWK A;  4DR6 M;  3GLI B;  3TPZ A;  2XZU A;  4LJ5 A;  4KOD A;  4AZF A;  4OW0 A;  3KOY E;  4D80 A;  3PNY A;  1YE9 A;  4GC9 A;  2XGN A;  1GL6 A;  2LH0 A;  4NSR A;  5FTJ A;  4DV2 M;  3L2A A;  4PT5 A;  2QPA A;  3GLG A;  3GPX A;  3T1Y M;  3VFD A;  2Z4R A;  4OVZ A;  3GP1 A;  3T1H M;  2DWM A;  2M5Z A;  3KSJ A;  5EXX A;  2QBY B;  1IM2 A;  3DZD A;  4G4N A;  4LFC M;  2ZAM A;  1NHG C;  1W5T A;  4JI3 M;  1DO0 A;  2KZS A;  4DR7 M;  2R65 A;  2Z3X A;  2AHM A;  3FUX A;  4CGY B;  2BJW A;  4LF7 M;  5EP1 A;  2YR0 A;  3HWS A;  3KP0 E;  2OPF A;  4XBO A;  3KOX E;  1DGB A;  2CHV A;  1LV7 A;  3U5Z B;  3HKP A;  4GH9 A;  2C5R A;  3AKZ A;  5FSW A;  4DR2 M;  2LNH C;  1TH2 A;  2BJV A;  4X64 M;  5EXP A;  3HU3 A;  4IBJ A;  5EXS A;  4DV7 M;  3RFW A;  2L7H A;  1YUB A;  3U6P A;  4M9S A;  2R45 A;  2QP9 X;  4I4L A;  4X65 M;  1I94 M;  1E9S A;  4R7G A;  3GPY A;  2F5O A;  2CUZ A;  4JI5 M;  4B7F A;  4FWG A;  3CF2 A;  3FTC A;  1SXJ A;  3HJ8 A;  4JI4 M;  4LG2 A;  5IT9 S;  2KEB A;  1QYR A;  4DV4 M;  1L2D A;  1R7R A;  2C9C A;  2L6O A;  4HL4 A;  3J81 S;  4MGH A;  1R2Z A;  1SXJ E;  1JR3 D;  3LQR A;  3OTO M;  3CF6 E;  4MGZ E;  4LF5 M;  1K3W A;  3SAT A;  1HNW M;  2XSZ D;  3K92 A;  4AKI A;  4JXJ A;  3UGJ A;  3GPP A;  2CHQ A;  4NSO B;  3SYL A;  3DA1 A;  4YY3 M;  4DV6 M;  3U6L A;  4B3M M;  2XFS A;  2DVW B;  3D8B A;  4BBA A;  1EE8 A;  3GLG B;  4LJ7 A;  2D7G A;  2QZ4 A;  4IBK A;  1H6U A;  4QHT A;  4GHL A;  2UXB M;  3GPU A;  4DR5 M;  2F5N A;  1HNZ M;  3FKE A;  2CV1 A;  3SBJ A;  4D82 A;  3JR4 A;  4KHP M;  4WW0 A;  4HLQ A;  3J7B A;  2F5S A;  3FTD A;  1Z6T A;  2OQ4 A;  3KW6 A;  4AW4 A;  2FFJ A;  4W5W A;  3A46 A;  3LVW A;  4L16 A;  5BR8 M;  2DXI A;  4II7 A;  1NSF A;  4MB7 A;  4QNM A;  3KVW A;  1SXJ C;  2G5G X;  1IQP A;  1TGU A;  4IBE A;  3GQ5 A;  4B7H A;  3FUU A;  1WXQ A;  4MH0 E;  2DWL A;  4LGM A;  1FJG M;  3SFZ A;  4DUY M;  3HU2 A;  3VDP A;  4DV3 M;  4MGY E;  4DV1 M;  4GKJ M;  2JA2 A;  3CF0 A;  1OJL A;  1NNU C;  3AL0 C;  4NXN M;  4P16 A;  1PM5 A;  2VQF M;  3GLH B;  4FCT A;  2R4E A;  3FYD A;  4KO8 A;  3U60 B;  4MGI E;  4ZPX A;  3TWM A;  2KRK A;  3R9X B;  1IXR C;  1VDD A;  1QVR A;  2DWN A;  3A42 A;  2Y21 A;  4NRV A;  1N34 M;  3W0F A;  4IBB A;  1E32 A;  5FTN A;  4LFB M;  2FE8 A;  3FYC A;  4PDG A;  5ITX A;  4B3S M;  3L25 A;  4B3R M;  1YSY A;  4L8R C;  4JV5 M;  2O5R A;  1OFH A;  3PFI A;  3MK6 A;  3L27 A;  3AOG A;  3UJN A;  1IXS B;  1IN4 A;  5FTL A;  1G8P A;  4LZZ A;  4FCW A;  3KFU G;  1L1Z A;  4JN6 A;  2QCU A;  1Q3B A;  3QWL A;  2Q2E B;  2LXE A;  3L28 A;  2D7E A;  3I51 A;  2Z4S A;  2LWX A;  3E9S A;  5EQT A;  4REZ A;  5EP4 A;  5E6J A;  3MHV C;  3HJQ A;  2UXD M;  1QQW A;  3AOE A;  3SAU A;  2UXC M;  3PNV A;  1IXZ A;  3FD9 A;  4A3V B;  4OU7 A;  3I4V A;  5A2Q S;  4TUW A;  4I5S A;  2CEA A;  1GL7 A;  5ITX E;  2ZM6 M;  4AI6 A;  4X62 M;  4JI8 M;  3ZC7 B;  4NOO B;  4IIW A;  4CIS A;  4ITQ A;  3KXE C;  5BPV A;  1OFI A;  4M0W A;  2L7I A;  2K47 A;  1DGF A;  2XH9 A;  5GKN A;  2EUC A;  3DOA A;  3ZH9 B;  5KPT A;  1IY1 A;  3LVV A;  2ZBK B;  2KZU A;  1G3I A;  2CE7 A;  4FWH A;  5JI3 E;  4EIW A;  3GRR A;  1N77 A;  3U6D A;  3WHK A;  2UUC M;  1TH4 A;  2FNA A;  3GLF A;  1DGG A;  2I7N A;  1TDH A;  3SMS A;  4GIP A;  3KP1 E;  1XC8 A;  1N36 M;  2J7N A;  1GLN A;  5C1B A;  4LGY A;  4QNR A;  3AFH A;  4LJA A;  1KYI A;  5LMU M;  1HQY E;  3A98 B;  5KPZ A;  3H4M A;  3U6M A;  1J5E M;  2Y0Q A;  5ITR A;  1HT2 E;  4AG5 A;  4NL4 H;  5ITY A;  3KOW E;  1TDZ A;  2C9O A;  4K0K M;  1E9R A;  1NY6 A;  1N32 M;  4OX9 M;  3K8Z A;  2DHR A;  1Q39 A;  3UMM A;  3TE6 A;  2XF3 A;  1QAQ A;  3SAV A;  2ZAO A;  2ERC A;  4DR4 M;  2Y20 A;  5C18 A;  4IBF A;  4PDI A;  4IJE A;  3THG A;  4FWD A;  3GO8 A;  4AKG A;  1K82 A;  1X37 A;  3EIH A;  3VDU A;  1L8Q A;  5ITQ A;  5EJC A;  4X66 M;  4RF1 A;  1NVM A;  2DZN B;  2F4V M;  3KS8 A;  4IJF A;  3U6O A;  4GMQ A;  3CTW B;  2P5T A;  4LF4 M;  1Q3C A;  3KSX A;  1L2C A;  2XLJ A;  1DGH A;  1XNR M;  2KA6 B;  1IN7 A;  2D7H A;  5IZ7 D;  2VQE M;  3LMM A;  4BB9 A;  3M7G A;  2R46 A;  1FNN A;  4LF9 M;  1G41 A;  5JI2 E;  4OVZ B;  3VKG A;  2DWZ B;  2R18 A;  3FTE A;  4MM3 B;  3B9P A;  4JYA M;  1QZM A;  1JQJ C;  2BNK A;  1L1T A;  2L09 A;  3MJ5 A;  3WHL A;  2H1R A;  3UK6 A;  3W0L B;  2V1C A;  3VLF B;  3VKH A;  1PJI A;  4Z8X A;  4R3D A;  4DV0 M;  4I8O A;  3SC3 A;  3BOS A;  3HGI A;  4FW9 A;  3KDS E;  2RKO A;  1J7K A;  1XXH B;  4LJ4 A;  3HHX A;  4IBD A;  1IY0 A;  2YNM D;  4CHT B;  2KW0 A;  5EXT A;  4GKK M;  2XFT A;  1IN5 A;  3GQ3 A;  4JI2 M;  3SHF A;  1G59 A;  2XEP A;  1MU5 A;  1R6B X;  5ITT A;  3L26 A;  1Z5C A;  2F5P A;  4NXM M;  4M9X A;  4FCV A;  2C99 A;  1T3T A;  4GC5 A;  3GLF B;  3SYK A;  2E5L M;  3NBI A;  1NHW C;  5DYG A;  3TQS A;  5LMN M;  2UUA M;  2ZAN A;  3TL4 X;  1KFV A;  3VK8 A;  1SXJ D;  2I7P A;  4G4O A;  2UU9 M;  1NNJ A;  4DV5 M;  1IBK M;  3JR5 A;  4LFA M;  5KQD A;  2UUB M;  3K2L A;  5FLX S;  4QOZ C;  1C1K A;  3SAS A;  1ORY B;  3U61 B;  1NJG A;  1R2Y A;  2A5Y B;  4M0D A;  1XXH A;  4LF8 M;  4DR3 M;  5E26 A;  3JAM S;  3SAR A;  4JI1 M;  1HT1 E;  8CAT A;  3C58 A;  4G6Z A;  4AG6 A;  1IN8 A;  1IN6 A;  3KOZ E;  5IRE B;  3R8F A;  3DFZ A;  2QEN A;  1Z5B A;  3QAU A;  3U6S A;  4LCB A;  1K3X A;  2V1U A;  3RE8 A;  3D8L A;  2X8A A;  3M0E A;  3FUW A;  4AQY M;  1MX0 A;  2G8L A;  3HHZ A;  1Z59 A;  4LY6 A;  1ZAE A;  3HU1 A;  3LQQ A;  1J09 A;  5KQ8 A;  3U6C A;  3PVS A;  3J80 S;  2YFQ A;  1XMQ M;  4S12 A;  2CHG A;  3VK7 A;  2CV0 A;  2KXE A;  1W5S A;  3NWL A;  4L4U A;  3IG8 A;  3M6A A;  4IBC A;  4AKH A;  3J27 B;  3K1J A;  4BLC A;  2DZO B;  1N75 A;  4B7G A;  3GQ4 A;  1G4A E;  5H37 D;  4JI6 M;  3FUV A;  2VII A;  3E4R A;  2X4A A;  4RNA A;  5KO3 A;  3AJI B;  3J2P B;  2HHH M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...