2K47A

Solution structure of the c-terminal n-rna binding domain of the vesicular stomatitis virus phosphoprotein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the C-Terminal Nucleoprotein-RNA Binding Domain of the Vesicular Stomatitis Virus Phosphoprotein.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
molecule tags Replication
molecule keywords Phosphoprotein
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2k47A00
3HHWA 3HHZA 2K47A
chains in the Genus database with same CATH superfamily
3E9SA 4CHTB 3UMMA 4L4UA 2F5OA 3TWLA 4GEWA 3JR4A 3PXGA 2BWBA 2LHCA 3W0LB 5ITQA 4X62M 2XZUA 2KEBA 3ILKA 3PNVA 2KXEA 3TPZA 5EP1A 2XEPA 3L29A 3U60B 1QZMA 2LTUA 2V6ZM 3W67A 4DV5M 2O01F 3HU1A 4AZFA 4CIZA 3J80S 1WR1B 2R18A 4QNRA 2EKKA 4R7GA 1PGYA 2HKJA 1R2ZA 4G3OA 3GPPA 2V1UA 1HR0M 1N77A 1Z5AA 2B3TA 4LZZA 2DAMA 1IY0A 4DUYM 1ZV1A 1IXSB 2C9OA 3B7ZA 2QQ8A 3BOSA 3UK6A 5FTMA 4DV7M 2Z4RA 4OX9M 2OO9A 3HJSA 4FCTA 1JB0F 1YSYA 2QPAA 2BJWA 2LXEA 2ZM6M 2G3QA 3CF6E 3VLFB 1JR3E 4FVMA 1UFZA 4JI7M 1NVMA 2OOAA 3HGIA 2X8AA 2DHRA 1VG5A 3U6CA 3GLHE 2R44A 2YFQA 3WHLA 4Y28F 4D80A 2JY6B 4MGIE 4AQYM 2HHHM 1V34A 3ZH9B 2F4VM 2V1CA 1G3IA 4KT0F 3FRHA 2CV0A 3B9PA 3Q8GA 4G4RA 1IN8A 5IREB 2MR9A 4G6ZA 5L8RF 2WSEF 4P17A 1FJGM 1ZMUA 2E5LM 2QBYB 1G71A 3FTCA 3VDUA 4HLQA 1DGHA 3LQQA 5DYIA 2QZ4A 2YNMD 3RGSA 3VDPA 1NJFA 1QAOA 1ZQ9A 3KVWA 3W68A 1QQWA 4ITQA 1K82A 2XF3A 3GLGA 2LVPC 2R4JA 2RKOA 4JI4M 3LVWA 3KOXE 4IBDA 1L2BA 3PFIA 4WW0A 1XMQM 3U6PA 3CF0A 3J27B 2EJSA 2DXIA 4LFCM 2XZFA 4PDIA 1MU5A 5ITUA 8CATA 2R6FA 1IBKM 1V33A 2JY5A 4FWGA 3J81S 4I4LA 3SHFA 3NBIA 1DO2A 5EP2A 3L25A 3KP1E 1IM2A 1IFYA 2DAGA 3K92A 1NNJA 1CUKA 1VEJA 1E32A 2P5TA 5ITTA 4JI3M 2D7EA 5E6JA 4NSRA 1WHCA 1D2NA 2K9DA 3I4VA 4OVZA 3GQ3A 3CTWB 1N78A 3K9OA 1SXJD 1OQYA 2ZBKB 1QUSA 5BR8M 1DV0A 3A46A 1LTMA 1GL7A 3KW6A 3D8LA 2JY8A 4RF0A 3SAVA 2JP7A 2WZJA 3U6SA 1IXZA 4LF5M 1PJSA 2DAIA 2MROB 3R8FA 3WHKA 4DUZM 2HWJA 4NL4H 5DYGA 3K1JA 3T38A 2CHQA 1E9RA 3DZDA 1AUAA 2XGNA 2M5ZA 4QHTA 5LMNM 4G4QA 4FD2A 2HL7A 4NOOB 2BNKA 7CATA 1G8PA 3SHGB 4D82A 1GL6A 4DR5M 4JI2M 1IN4A 3MHVC 3C9PA 4QOZC 5EXPA 2LBCA 2KZSA 2X4AA 1FNNA 1DGBA 1N34M 1TH3A 2R46A 1J5EM 5JI2E 2DNAA 4JI1M 3FUUA 3GRVA 1GJSA 1MX0A 4KODA 1R7RA 3FTFA 4GIPA 4M0WA 3GQ4A 2LHGA 2KZUA 1T43A 1TTEA 1IY2A 2OPFA 4KO8A 5FTKA 5FLXS 5ITRA 3B74A 4B3RM 2CFOA 4KHPM 2F5NA 3FRIA 1SXJA 1DO0A 2QNJA 4QHSA 2ZAOA 1TH2A 1V92A 4DR1M 2ZTCA 4DV3M 1ORYB 3GLGE 1N32M 2K47A 3C3EA 1EIJA 4GMQA 3U5ZB 2C98A 2I7NA 1NV8A 4I5SA 4JXJA 5C1BA 1IXRC 1T3TA 3GQ5A 4G4OA 3I51A 1Z59A 5KPZA 3LQRA 2MH8A 3SBJA 1TR8A 1OKSA 2EA0A 2MJ5B 2DZLA 4II7A 1Q3BA 2LVOC 3KDSE 5H37D 4X65M 4JV5M 3LMMA 1Q02A 3GPXA 3SYLA 2L2DA 4LJ7A 4GKJM 4L16A 1HJPA 2KNAA 3KS4A 5FTNA 2JZ1A 2HAKA 2KDLA 3C58A 2QBYA 3GLFB 4CJ6A 3SASA 1Z6TA 2QP9X 1R6BX 1QANA 3FTDA 1K3XA 1GLNA 3MK6A 1NY6A 4LZJA 1KSFX 5FTLA 1QVRA 4LGYA 5DNYA 2RRUA 3FYDA 4MGYE 2LNHC 2XLJA 3L26A 4TUWA 1IQPA 1D0KA 3HU2A 1N75A 3GLIA 1R2YA 2KNVA 1HQYE 2HCBA 4AG5A 1IY1A 4LY6A 2Y0TA 1PJIA 4QOSA 4B3SM 2WSCF 2FFJA 3T15A 1K3WA 1DGGA 1OAIA 2YQZA 2CEAA 2AHMA 4LFAM 1NHGC 1QZEA 2K6BA 2X49A 4IBIA 2F5QA 1N33M 3VKHA 2ERCA 4CGYB 4FCWA 5KO3A 4LF6M 1XB2B 3D8BA 2O5RA 1XNQM 2K0BX 1KYIA 2CRUA 2F5PA 2JUJA 3SATA 2GQFA 2XFSA 1ZMWA 2A5YB 2EO2A 3OTOM 4DR7M 3GO8A 3J7BA 4DBGB 4Q7JA 3TWKA 4JI8M 4OW0A 4EIWA 3T6PA 2JY7A 4B3TM 1PRBA 4M9XA 2D7HA 2G5GX 2JA2A 5IWAM 4AW4A 3GP1A 4IBGA 1IBMM 2XSZA 1T6OA 2QSFX 3B7NA 3E46A 4YHHM 1IBLM 2Y21A 3H4MA 1J7KA 4IIWA 4NC6A 3VFDA 2DWNA 4QNMA 5EQTA 1SG9A 1XWIA 4LJAA 2R4EA 4L8RC 2JZ0A 3I01M 1N36M 2I7PA 4LF9M 2C9CA 1OTRA 3HKPA 4A3VB 4BLCA 3H4JA 4WP2A 3JAMS 2VF7A 2J7NA 3EIEA 4B7FA 1NJGA 1HQCA 4DV0M 1HNZM 1VDLA 1PM5A 4JI6M 2Q2EB 4I81A 2Z8YM 4LJ6A 4FWDA 1VEKA 1QDTA 3GRRA 2L4FA 3SFZA 1KFVA 4REZA 4NRWA 3J2PB 3TL4X 1LV7A 2LVQD 1Y8GA 1EFUB 4AKIA 2N35A 3MMPA 3B89A 4GHAA 4IJEA 3U5ZA 4I8OA 3E21A 4F1IA 4GITA 4IBBA 2UU9M 3U6EA 2XSZD 1H6UA 1WGLA 3CF2A 4X66M 2CWBA 2DAKA 4CISA 3LVVA 4M9SA 2J7OA 4G4NA 4IBEA 2LVNC 3SARA 1X37A 1Z5BA 1PJTA 5KQ8A 4UN2B 3SAWA 1I4WA 2LWXA 3AOEC 3AV0A 3AL0C 5EJCA 3U6MA 1SXJC 3F92A 4L15A 1WIVA 3QAUA 1NNUC 1L2DA 1I94M 4AKGA 5EXSA 1TDZA 1TH4A 4LRSA 2QENA 2JXNA 3DOAA 3LCUA 2Z7JA 4PD2A 1UM8A 2G8LA 2KNZA 1E94E 4XBOA 4IBCA 3HU3A 1W5TA 3ZCBB 3FE3A 4F2LA 2CP8A 1JR3D 1SXJE 2MGWA 3C3DA 1HT1E 1RU3A 3BBZA 3TE6A 3KOYE 5FTJA 3U61A 1QUTA 3VK7A 5GKNA 1JQJC 4S12A 1XMOM 3ZQJA 4AKHA 1OAOC 1ZAEA 3M6AA 2UUBM 1WGNA 5IT9S 2C5RA 1NO1A 3QYEA 4LRTA 4MB7A 2FE8A 2VQEM 3KOZE 3K2LA 3U6OA 4M0DA 4FWHA 4GC5A 3UJNA 3AFHA 3SAUA 2NQ8C 4OU7A 5FSWA 4B3MM 2QHOB 1G41A 2BWEA 4DV2M 4GC9A 5A2QS 4PCZA 4HL4A 4K0KM 3FTEA 3IECA 4GHLA 2LH0A 5KPRA 1W5SA 4X64M 2Z4SA 2KW0A 2Y0QA 3L2AA 1R5LA 3LW5F 3HZJA 2CV2A 3AJIB 2UXDM 1J09A 1MJGM 1XHBA 4NSOB 3KOWE 4W5WA 3GLGB 4WURA 3W0FA 3GLIE 2DENA 1OIPA 3PNYA 2O25A 4JI0M 1HNWM 4HEOA 2DKLA 1TDHA 1AIPC 3KP0E 2DWMA 2EUCA 1YE9A 2KHHA 2R65A 3FUVA 2DHYA 1JR3A 2YR0A 3DA1A 3HWSA 1XXHB 4LCBA 4P16A 3L28A 3MJ5A 1XXHE 4B7HA 4DV4M 3SMPA 4Z6YA 1HNXM 2W82A 3GLHA 2C99A 4NRVA 4LG2A 2GNOA 2L6OA 4FW9A 4NXMM 1GABA 5KPTA 3GLFE 4OVZB 3K8ZA 1L1ZA 4PDGA 3L27A 1XNRM 3KXEC 2RGHA 2CV1A 2XH9A 1G59A 2OOBA 1Z5CA 2F5SA 3V76A 2CE7A 2OQ4A 2KRUA 1NV9A 2QCUA 1WXQA 4MGKE 3I4YA 1L2CA 1S3SA 2R45A 1Q3CA 1QAMA 1TF0B 4GKKM 2J5YA 4LFBM 5EXXA 3HJ8A 1OIZA 3B7QA 2D7GA 4LJ5A 4RNAA 3HJQA 1L1TA 1NHWC 4IJFA 3R9XB 4L78A 1IN6A 3SYKA 2R62A 2R0IA 4M9ZA 4XGIA 3TQSA 4DR4M 2UUCM 1Q39A 3K9PA 3HHYA 4R3DA 5LMUM 1TGUA 4L6V6 3RE8A 3JR5A 1A5TA 3BXWA 5ITXE 3U60A 4LJ4A 1QYRA 4PT5A 5ITXA 5EP4A 3AKZA 3T1YM 4ZPXA 1XC8A 3AOGA 4DR2M 4YY3M 3FD9A 1GO5A 2LVAA 3GPUA 3IHPA 1R4GA 3IG5A 3KSJA 4JN6A 2CHVA 5E26A 4R71A 1PJJA 3KFUG 1SXJB 1IXSA 1OFHA 2Z3XA 3GLIB 3THGA 2ZTDA 4MGHA 5C18A 1YLAA 4DV6M 2Y20A 5KQDA 4GRIA 3VK8A 4JI5M 3AOEA 1DGFA 3GRUA 3U61B 4DR6M 2L7IA 2JWSA 4LJ9A 2DVWB 1QAQA 1G4AE 2CHGA 3U6DA 3SC3A 4AI6A 3KS8A 3TWMA 5EP3A 5ITYA 3M7GA 2DZOB 4BBAA 5BPVA 1GVNA 3NBXX 4IBKA 4NXNM 3PVSA 1IN5A 3VKGA 4RF1A 2L7HA 2VDBB 1OJLA 2FH0A 2C96A 2FNAA 1YUBA 3HX3A 5JI3E 4DV1M 1C7YA 1DGHB 3QWLA 3T1HM 3GLFA 2JNHA 2H5XA 3UGJA 2L09A 2VF8A 4KLNA 3GPYA 4LF8M 2RGOA 3U6QA 3RFWA 2DWLA 3FYCA 1D0LA 3HHWA 4FCVA 1GJTA 3A42A 4LGMA 4LJ8A 5F3WA 1MN3A 3Q8XA 3KSXA 3EIHA 3NWLA 3SMSA 4D81A 3FUWA 1ZMVA 5EXTA 2DZNB 2XFTA 2KA6B 2ZAMA 1OFIA 3HY5A 1L8QA 4B08A 3HHZA 2DAEA 4DR3M 2H1RA 1VDDA 1C1KA 4B7GA 2DI0A 3A98B 4IBJA 4JYAM 3CGWA 1XXHA 3FUTA 1P3QQ 4MH0E 1IN7A 3A45A 3DFZA 4IBFA 1E9SA 3ZC7B 3U6LA 3GLHB 4ANRA 2DWZB 3FUXA 4Z8XA 2M60A 2BJVA 4XK8F 4LF7M 1GKIA 1EE8A 1NSFA 3IG8A 1F4IA 4GH9A 2CUZA 3UZUA 4LF4M 2UXCM 2KRKA 3RGPA 2L4EA 1VEGA 3E4RA 5DFLA 2UXBM 3HHXA 2VIIA 1WJ7A 2ZANA 1BVSA 2WSFF 3LCVB 3J7AS 3QYBA 2FOIC 1VQ1A 5IZ7D 1QDRA 2EKFA 2FS1A 1PJQA 2VQFM 2UUAM 3M0EA 4MGZE 3I04M 1D0MA 1NY5A 3FKEA 4RKUF 2APLA 1HT2E 3GRYA 4BB9A 4AG6A 4MM3B
chains in the Genus database with same CATH topology
3E9SA 4CHTB 3UMMA 4L4UA 2F5OA 3TWLA 3JR4A 3PXGA 3W0LB 5ITQA 4X62M 2XZUA 2KEBA 3ILKA 3PNVA 2KXEA 3TPZA 5EP1A 2XEPA 3L29A 3U60B 1QZMA 2V6ZM 4DV5M 4AZFA 3HU1A 3J80S 2R18A 4QNRA 4R7GA 2HKJA 1R2ZA 3GPPA 2V1UA 1HR0M 1N77A 1Z5AA 4LZZA 1IY0A 4DUYM 2C9OA 1IXSB 3BOSA 3UK6A 5FTMA 4DV7M 2Z4RA 4OX9M 3HJSA 4FCTA 1YSYA 2QPAA 2BJWA 2LXEA 2ZM6M 3CF6E 3VLFB 4JI7M 4FVMA 1NVMA 3HGIA 2X8AA 2DHRA 3U6CA 2YFQA 3WHLA 4D80A 4MGIE 4AQYM 2HHHM 3ZH9B 2F4VM 2V1CA 1G3IA 2CV0A 3B9PA 4G4RA 1IN8A 5IREB 1FJGM 4G6ZA 2E5LM 2QBYB 3FTCA 3VDUA 4HLQA 1DGHA 3LQQA 5DYIA 2QZ4A 2YNMD 3RGSA 3VDPA 1NJFA 1QAOA 1ZQ9A 3KVWA 1QQWA 4ITQA 1K82A 2XF3A 3GLGA 2R4JA 2RKOA 4JI4M 3LVWA 3KOXE 4IBDA 1L2BA 3PFIA 4WW0A 1XMQM 3U6PA 3CF0A 3J27B 2DXIA 4LFCM 2XZFA 4PDIA 1MU5A 5ITUA 8CATA 1IBKM 4FWGA 3J81S 4I4LA 3SHFA 3NBIA 1DO2A 5EP2A 3L25A 3KP1E 1IM2A 3K92A 1NNJA 2P5TA 1E32A 5ITTA 4JI3M 2D7EA 5E6JA 4NSRA 1D2NA 3I4VA 4OVZA 3GQ3A 3CTWB 1N78A 1SXJD 2ZBKB 5BR8M 3A46A 1GL7A 3KW6A 3D8LA 4RF0A 3SAVA 3U6SA 1IXZA 4LF5M 3R8FA 3WHKA 4DUZM 5DYGA 4NL4H 3T38A 3K1JA 2CHQA 1E9RA 3DZDA 2XGNA 2M5ZA 4QHTA 5LMNM 4G4QA 4FD2A 2HL7A 4NOOB 2BNKA 7CATA 1G8PA 3SHGB 4D82A 1GL6A 4DR5M 4JI2M 1IN4A 3MHVC 4QOZC 5EXPA 2KZSA 2X4AA 1FNNA 1DGBA 1N34M 1TH3A 2R46A 1J5EM 5JI2E 4JI1M 3FUUA 3GRVA 1MX0A 4KODA 1R7RA 3FTFA 4GIPA 4M0WA 3GQ4A 2KZUA 1IY2A 2OPFA 4KO8A 5FTKA 5FLXS 5ITRA 4B3RM 2CFOA 4KHPM 2F5NA 1SXJA 1DO0A 4QHSA 2ZAOA 1TH2A 4DR1M 4DV3M 1ORYB 1N32M 2K47A 4GMQA 3U5ZB 2C98A 2I7NA 4I5SA 5C1BA 4JXJA 3GQ5A 1IXRC 1T3TA 4G4OA 3I51A 1Z59A 5KPZA 3LQRA 3SBJA 2EA0A 4II7A 1Q3BA 3KDSE 5H37D 4X65M 4JV5M 3LMMA 3GPXA 3SYLA 4LJ7A 4GKJM 4L16A 5FTNA 3KS4A 3C58A 2QBYA 3GLFB 3SASA 1Z6TA 2QP9X 1R6BX 1QANA 3FTDA 1K3XA 1GLNA 3MK6A 1NY6A 4LZJA 1KSFX 5FTLA 1QVRA 4LGYA 5DNYA 3FYDA 4MGYE 2LNHC 2XLJA 3L26A 4TUWA 1IQPA 1R2YA 3HU2A 1N75A 3GLIA 1HQYE 2HCBA 4AG5A 1IY1A 4LY6A 2Y0TA 1PJIA 4QOSA 4B3SM 2FFJA 3T15A 1K3WA 1DGGA 2YQZA 2CEAA 2AHMA 4LFAM 1NHGC 2F5QA 2X49A 4IBIA 1N33M 3VKHA 2ERCA 4CGYB 4FCWA 5KO3A 4LF6M 3D8BA 2O5RA 1XNQM 1KYIA 2F5PA 3SATA 2XFSA 2A5YB 2EO2A 3OTOM 4DR7M 3GO8A 3J7BA 3TWKA 4JI8M 4OW0A 4EIWA 4B3TM 4M9XA 2D7HA 2G5GX 2JA2A 5IWAM 4AW4A 3GP1A 4IBGA 1IBMM 2XSZA 4YHHM 1IBLM 2Y21A 3H4MA 1J7KA 4IIWA 3VFDA 2DWNA 4QNMA 5EQTA 1XWIA 4LJAA 2R4EA 4L8RC 1N36M 2I7PA 4LF9M 2C9CA 4A3VB 3HKPA 4BLCA 3JAMS 2J7NA 3EIEA 4B7FA 1NJGA 1HQCA 4DV0M 1HNZM 1PM5A 4JI6M 2Q2EB 4I81A 4LJ6A 4FWDA 3GRRA 3SFZA 1KFVA 4REZA 4NRWA 3J2PB 3TL4X 1LV7A 4AKIA 4GHAA 4IJEA 3U5ZA 4I8OA 4GITA 4IBBA 2UU9M 3U6EA 2XSZD 1H6UA 3CF2A 4X66M 4CISA 3LVVA 4M9SA 2J7OA 4G4NA 4IBEA 3SARA 1X37A 1Z5BA 5KQ8A 3SAWA 1I4WA 2LWXA 3AOEC 3AV0A 3AL0C 5EJCA 3U6MA 1SXJC 4L15A 3QAUA 1NNUC 1L2DA 1I94M 4AKGA 5EXSA 1TDZA 1TH4A 4LRSA 2QENA 3DOAA 2Z7JA 4PD2A 1UM8A 2G8LA 1E94E 4XBOA 4IBCA 3HU3A 1W5TA 3ZCBB 1JR3D 1SXJE 1HT1E 3TE6A 3KOYE 5FTJA 3U61A 3VK7A 5GKNA 1JQJC 4S12A 1XMOM 4AKHA 1ZAEA 3M6AA 2UUBM 5IT9S 2C5RA 4LRTA 4MB7A 2FE8A 2VQEM 3KOZE 3K2LA 3U6OA 4M0DA 4FWHA 4GC5A 3UJNA 3AFHA 3SAUA 2NQ8C 4OU7A 5FSWA 4B3MM 1G41A 4DV2M 4GC9A 5A2QS 4PCZA 4HL4A 4K0KM 3FTEA 4GHLA 2LH0A 5KPRA 1W5SA 4X64M 2Z4SA 2KW0A 2Y0QA 3L2AA 2UXDM 2CV2A 3AJIB 1J09A 1XHBA 4NSOB 4W5WA 3KOWE 3GLGB 4WURA 3W0FA 3PNYA 4JI0M 1HNWM 3KP0E 1TDHA 2DWMA 2EUCA 1YE9A 2R65A 3FUVA 2YR0A 1JR3A 3DA1A 3HWSA 4LCBA 1XXHB 4P16A 4B7HA 3L28A 3MJ5A 4DV4M 1HNXM 3SMPA 4Z6YA 2W82A 3GLHA 2C99A 4NRVA 4LG2A 2L6OA 4FW9A 4NXMM 5KPTA 4OVZB 3K8ZA 1L1ZA 4PDGA 3L27A 1XNRM 3KXEC 2RGHA 2CV1A 2XH9A 1G59A 1Z5CA 2F5SA 2CE7A 2OQ4A 2KRUA 2QCUA 1WXQA 4MGKE 3I4YA 1L2CA 1S3SA 2R45A 1Q3CA 1QAMA 4GKKM 4LFBM 5EXXA 3HJ8A 2D7GA 4LJ5A 4RNAA 3HJQA 1L1TA 1NHWC 4IJFA 3R9XB 4L78A 1IN6A 3SYKA 2R62A 4M9ZA 4XGIA 3TQSA 4DR4M 2UUCM 1Q39A 3HHYA 4R3DA 5LMUM 1TGUA 3RE8A 3JR5A 5ITXE 3U60A 4LJ4A 1QYRA 4PT5A 5ITXA 5EP4A 3AKZA 3T1YM 4ZPXA 1XC8A 3AOGA 4DR2M 4YY3M 3FD9A 3GPUA 3IG5A 3KSJA 4JN6A 5E26A 2CHVA 1PJJA 3KFUG 1SXJB 1OFHA 2Z3XA 3GLIB 3THGA 4MGHA 5C18A 3VK8A 4DV6M 2Y20A 5KQDA 4GRIA 4JI5M 3AOEA 1DGFA 3GRUA 3U61B 4DR6M 2L7IA 4LJ9A 2DVWB 1QAQA 1G4AE 2CHGA 3U6DA 3SC3A 4AI6A 3KS8A 3TWMA 5EP3A 5ITYA 3M7GA 2DZOB 4BBAA 5BPVA 1GVNA 4IBKA 4NXNM 3PVSA 1IN5A 3VKGA 4RF1A 2L7HA 1OJLA 2FNAA 2C96A 4DV1M 1YUBA 5JI3E 1DGHB 3QWLA 3T1HM 3GLFA 3UGJA 2L09A 4KLNA 3GPYA 4LF8M 2RGOA 3U6QA 3RFWA 2DWLA 3FYCA 3HHWA 4FCVA 3A42A 4LGMA 4LJ8A 5F3WA 3Q8XA 3KSXA 3EIHA 3NWLA 3SMSA 4D81A 3FUWA 5EXTA 2DZNB 2XFTA 2KA6B 2ZAMA 1OFIA 3HHZA 1L8QA 4B08A 4DR3M 2H1RA 1VDDA 1C1KA 4B7GA 3A98B 4IBJA 4JYAM 3FUTA 1XXHA 4MH0E 1IN7A 3A45A 3DFZA 4IBFA 1E9SA 3ZC7B 3U6LA 3GLHB 2DWZB 3FUXA 4Z8XA 2M60A 2BJVA 4LF7M 1GKIA 1EE8A 1NSFA 3IG8A 4GH9A 2CUZA 3UZUA 4LF4M 2UXCM 2KRKA 3RGPA 3E4RA 2UXBM 3HHXA 2VIIA 2ZANA 3J7AS 2FOIC 5IZ7D 2UUAM 2VQFM 3M0EA 4MGZE 1NY5A 3FKEA 1HT2E 3GRYA 4BB9A 4AG6A 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHW A;  3HHZ A;  2K47 A; 
#chains in the Genus database with same CATH topology
 3E9S A;  4CHT B;  3UMM A;  4L4U A;  2F5O A;  3TWL A;  4GEW A;  3JR4 A;  3PXG A;  2BWB A;  2LHC A;  3W0L B;  5ITQ A;  4X62 M;  2XZU A;  2KEB A;  3ILK A;  3PNV A;  2KXE A;  3TPZ A;  5EP1 A;  2XEP A;  3L29 A;  3U60 B;  1QZM A;  2LTU A;  2V6Z M;  3W67 A;  4DV5 M;  2O01 F;  3HU1 A;  4AZF A;  4CIZ A;  3J80 S;  1WR1 B;  2R18 A;  4QNR A;  2EKK A;  4R7G A;  1PGY A;  2HKJ A;  1R2Z A;  4G3O A;  3GPP A;  2V1U A;  1HR0 M;  1N77 A;  1Z5A A;  2B3T A;  4LZZ A;  2DAM A;  1IY0 A;  4DUY M;  1ZV1 A;  1IXS B;  2C9O A;  3B7Z A;  2QQ8 A;  3BOS A;  3UK6 A;  5FTM A;  4DV7 M;  2Z4R A;  4OX9 M;  2OO9 A;  3HJS A;  4FCT A;  1JB0 F;  1YSY A;  2QPA A;  2BJW A;  2LXE A;  2ZM6 M;  2G3Q A;  3CF6 E;  3VLF B;  1JR3 E;  4FVM A;  1UFZ A;  4JI7 M;  1NVM A;  2OOA A;  3HGI A;  2X8A A;  2DHR A;  1VG5 A;  3U6C A;  3GLH E;  2R44 A;  2YFQ A;  3WHL A;  4Y28 F;  4D80 A;  2JY6 B;  4MGI E;  4AQY M;  2HHH M;  1V34 A;  3ZH9 B;  2F4V M;  2V1C A;  1G3I A;  4KT0 F;  3FRH A;  2CV0 A;  3B9P A;  3Q8G A;  4G4R A;  1IN8 A;  5IRE B;  2MR9 A;  4G6Z A;  5L8R F;  2WSE F;  4P17 A;  1FJG M;  1ZMU A;  2E5L M;  2QBY B;  1G71 A;  3FTC A;  3VDU A;  4HLQ A;  1DGH A;  3LQQ A;  5DYI A;  2QZ4 A;  2YNM D;  3RGS A;  3VDP A;  1NJF A;  1QAO A;  1ZQ9 A;  3KVW A;  3W68 A;  1QQW A;  4ITQ A;  1K82 A;  2XF3 A;  3GLG A;  2LVP C;  2R4J A;  2RKO A;  4JI4 M;  3LVW A;  3KOX E;  4IBD A;  1L2B A;  3PFI A;  4WW0 A;  1XMQ M;  3U6P A;  3CF0 A;  3J27 B;  2EJS A;  2DXI A;  4LFC M;  2XZF A;  4PDI A;  1MU5 A;  5ITU A;  8CAT A;  2R6F A;  1IBK M;  1V33 A;  2JY5 A;  4FWG A;  3J81 S;  4I4L A;  3SHF A;  3NBI A;  1DO2 A;  5EP2 A;  3L25 A;  3KP1 E;  1IM2 A;  1IFY A;  2DAG A;  3K92 A;  1NNJ A;  1CUK A;  1VEJ A;  1E32 A;  2P5T A;  5ITT A;  4JI3 M;  2D7E A;  5E6J A;  4NSR A;  1WHC A;  1D2N A;  2K9D A;  3I4V A;  4OVZ A;  3GQ3 A;  3CTW B;  1N78 A;  3K9O A;  1SXJ D;  1OQY A;  2ZBK B;  1QUS A;  5BR8 M;  1DV0 A;  3A46 A;  1LTM A;  1GL7 A;  3KW6 A;  3D8L A;  2JY8 A;  4RF0 A;  3SAV A;  2JP7 A;  2WZJ A;  3U6S A;  1IXZ A;  4LF5 M;  1PJS A;  2DAI A;  2MRO B;  3R8F A;  3WHK A;  4DUZ M;  2HWJ A;  4NL4 H;  5DYG A;  3K1J A;  3T38 A;  2CHQ A;  1E9R A;  3DZD A;  1AUA A;  2XGN A;  2M5Z A;  4QHT A;  5LMN M;  4G4Q A;  4FD2 A;  2HL7 A;  4NOO B;  2BNK A;  7CAT A;  1G8P A;  3SHG B;  4D82 A;  1GL6 A;  4DR5 M;  4JI2 M;  1IN4 A;  3MHV C;  3C9P A;  4QOZ C;  5EXP A;  2LBC A;  2KZS A;  2X4A A;  1FNN A;  1DGB A;  1N34 M;  1TH3 A;  2R46 A;  1J5E M;  5JI2 E;  2DNA A;  4JI1 M;  3FUU A;  3GRV A;  1GJS A;  1MX0 A;  4KOD A;  1R7R A;  3FTF A;  4GIP A;  4M0W A;  3GQ4 A;  2LHG A;  2KZU A;  1T43 A;  1TTE A;  1IY2 A;  2OPF A;  4KO8 A;  5FTK A;  5FLX S;  5ITR A;  3B74 A;  4B3R M;  2CFO A;  4KHP M;  2F5N A;  3FRI A;  1SXJ A;  1DO0 A;  2QNJ A;  4QHS A;  2ZAO A;  1TH2 A;  1V92 A;  4DR1 M;  2ZTC A;  4DV3 M;  1ORY B;  3GLG E;  1N32 M;  2K47 A;  3C3E A;  1EIJ A;  4GMQ A;  3U5Z B;  2C98 A;  2I7N A;  1NV8 A;  4I5S A;  4JXJ A;  5C1B A;  1IXR C;  1T3T A;  3GQ5 A;  4G4O A;  3I51 A;  1Z59 A;  5KPZ A;  3LQR A;  2MH8 A;  3SBJ A;  1TR8 A;  1OKS A;  2EA0 A;  2MJ5 B;  2DZL A;  4II7 A;  1Q3B A;  2LVO C;  3KDS E;  5H37 D;  4X65 M;  4JV5 M;  3LMM A;  1Q02 A;  3GPX A;  3SYL A;  2L2D A;  4LJ7 A;  4GKJ M;  4L16 A;  1HJP A;  2KNA A;  3KS4 A;  5FTN A;  2JZ1 A;  2HAK A;  2KDL A;  3C58 A;  2QBY A;  3GLF B;  4CJ6 A;  3SAS A;  1Z6T A;  2QP9 X;  1R6B X;  1QAN A;  3FTD A;  1K3X A;  1GLN A;  3MK6 A;  1NY6 A;  4LZJ A;  1KSF X;  5FTL A;  1QVR A;  4LGY A;  5DNY A;  2RRU A;  3FYD A;  4MGY E;  2LNH C;  2XLJ A;  3L26 A;  4TUW A;  1IQP A;  1D0K A;  3HU2 A;  1N75 A;  3GLI A;  1R2Y A;  2KNV A;  1HQY E;  2HCB A;  4AG5 A;  1IY1 A;  4LY6 A;  2Y0T A;  1PJI A;  4QOS A;  4B3S M;  2WSC F;  2FFJ A;  3T15 A;  1K3W A;  1DGG A;  1OAI A;  2YQZ A;  2CEA A;  2AHM A;  4LFA M;  1NHG C;  1QZE A;  2K6B A;  2X49 A;  4IBI A;  2F5Q A;  1N33 M;  3VKH A;  2ERC A;  4CGY B;  4FCW A;  5KO3 A;  4LF6 M;  1XB2 B;  3D8B A;  2O5R A;  1XNQ M;  2K0B X;  1KYI A;  2CRU A;  2F5P A;  2JUJ A;  3SAT A;  2GQF A;  2XFS A;  1ZMW A;  2A5Y B;  2EO2 A;  3OTO M;  4DR7 M;  3GO8 A;  3J7B A;  4DBG B;  4Q7J A;  3TWK A;  4JI8 M;  4OW0 A;  4EIW A;  3T6P A;  2JY7 A;  4B3T M;  1PRB A;  4M9X A;  2D7H A;  2G5G X;  2JA2 A;  5IWA M;  4AW4 A;  3GP1 A;  4IBG A;  1IBM M;  2XSZ A;  1T6O A;  2QSF X;  3B7N A;  3E46 A;  4YHH M;  1IBL M;  2Y21 A;  3H4M A;  1J7K A;  4IIW A;  4NC6 A;  3VFD A;  2DWN A;  4QNM A;  5EQT A;  1SG9 A;  1XWI A;  4LJA A;  2R4E A;  4L8R C;  2JZ0 A;  3I01 M;  1N36 M;  2I7P A;  4LF9 M;  2C9C A;  1OTR A;  3HKP A;  4A3V B;  4BLC A;  3H4J A;  4WP2 A;  3JAM S;  2VF7 A;  2J7N A;  3EIE A;  4B7F A;  1NJG A;  1HQC A;  4DV0 M;  1HNZ M;  1VDL A;  1PM5 A;  4JI6 M;  2Q2E B;  4I81 A;  2Z8Y M;  4LJ6 A;  4FWD A;  1VEK A;  1QDT A;  3GRR A;  2L4F A;  3SFZ A;  1KFV A;  4REZ A;  4NRW A;  3J2P B;  3TL4 X;  1LV7 A;  2LVQ D;  1Y8G A;  1EFU B;  4AKI A;  2N35 A;  3MMP A;  3B89 A;  4GHA A;  4IJE A;  3U5Z A;  4I8O A;  3E21 A;  4F1I A;  4GIT A;  4IBB A;  2UU9 M;  3U6E A;  2XSZ D;  1H6U A;  1WGL A;  3CF2 A;  4X66 M;  2CWB A;  2DAK A;  4CIS A;  3LVV A;  4M9S A;  2J7O A;  4G4N A;  4IBE A;  2LVN C;  3SAR A;  1X37 A;  1Z5B A;  1PJT A;  5KQ8 A;  4UN2 B;  3SAW A;  1I4W A;  2LWX A;  3AOE C;  3AV0 A;  3AL0 C;  5EJC A;  3U6M A;  1SXJ C;  3F92 A;  4L15 A;  1WIV A;  3QAU A;  1NNU C;  1L2D A;  1I94 M;  4AKG A;  5EXS A;  1TDZ A;  1TH4 A;  4LRS A;  2QEN A;  2JXN A;  3DOA A;  3LCU A;  2Z7J A;  4PD2 A;  1UM8 A;  2G8L A;  2KNZ A;  1E94 E;  4XBO A;  4IBC A;  3HU3 A;  1W5T A;  3ZCB B;  3FE3 A;  4F2L A;  2CP8 A;  1JR3 D;  1SXJ E;  2MGW A;  3C3D A;  1HT1 E;  1RU3 A;  3BBZ A;  3TE6 A;  3KOY E;  5FTJ A;  3U61 A;  1QUT A;  3VK7 A;  5GKN A;  1JQJ C;  4S12 A;  1XMO M;  3ZQJ A;  4AKH A;  1OAO C;  1ZAE A;  3M6A A;  2UUB M;  1WGN A;  5IT9 S;  2C5R A;  1NO1 A;  3QYE A;  4LRT A;  4MB7 A;  2FE8 A;  2VQE M;  3KOZ E;  3K2L A;  3U6O A;  4M0D A;  4FWH A;  4GC5 A;  3UJN A;  3AFH A;  3SAU A;  2NQ8 C;  4OU7 A;  5FSW A;  4B3M M;  2QHO B;  1G41 A;  2BWE A;  4DV2 M;  4GC9 A;  5A2Q S;  4PCZ A;  4HL4 A;  4K0K M;  3FTE A;  3IEC A;  4GHL A;  2LH0 A;  5KPR A;  1W5S A;  4X64 M;  2Z4S A;  2KW0 A;  2Y0Q A;  3L2A A;  1R5L A;  3LW5 F;  3HZJ A;  2CV2 A;  3AJI B;  2UXD M;  1J09 A;  1MJG M;  1XHB A;  4NSO B;  3KOW E;  4W5W A;  3GLG B;  4WUR A;  3W0F A;  3GLI E;  2DEN A;  1OIP A;  3PNY A;  2O25 A;  4JI0 M;  1HNW M;  4HEO A;  2DKL A;  1TDH A;  1AIP C;  3KP0 E;  2DWM A;  2EUC A;  1YE9 A;  2KHH A;  2R65 A;  3FUV A;  2DHY A;  1JR3 A;  2YR0 A;  3DA1 A;  3HWS A;  1XXH B;  4LCB A;  4P16 A;  3L28 A;  3MJ5 A;  1XXH E;  4B7H A;  4DV4 M;  3SMP A;  4Z6Y A;  1HNX M;  2W82 A;  3GLH A;  2C99 A;  4NRV A;  4LG2 A;  2GNO A;  2L6O A;  4FW9 A;  4NXM M;  1GAB A;  5KPT A;  3GLF E;  4OVZ B;  3K8Z A;  1L1Z A;  4PDG A;  3L27 A;  1XNR M;  3KXE C;  2RGH A;  2CV1 A;  2XH9 A;  1G59 A;  2OOB A;  1Z5C A;  2F5S A;  3V76 A;  2CE7 A;  2OQ4 A;  2KRU A;  1NV9 A;  2QCU A;  1WXQ A;  4MGK E;  3I4Y A;  1L2C A;  1S3S A;  2R45 A;  1Q3C A;  1QAM A;  1TF0 B;  4GKK M;  2J5Y A;  4LFB M;  5EXX A;  3HJ8 A;  1OIZ A;  3B7Q A;  2D7G A;  4LJ5 A;  4RNA A;  3HJQ A;  1L1T A;  1NHW C;  4IJF A;  3R9X B;  4L78 A;  1IN6 A;  3SYK A;  2R62 A;  2R0I A;  4M9Z A;  4XGI A;  3TQS A;  4DR4 M;  2UUC M;  1Q39 A;  3K9P A;  3HHY A;  4R3D A;  5LMU M;  1TGU A;  4L6V 6;  3RE8 A;  3JR5 A;  1A5T A;  3BXW A;  5ITX E;  3U60 A;  4LJ4 A;  1QYR A;  4PT5 A;  5ITX A;  5EP4 A;  3AKZ A;  3T1Y M;  4ZPX A;  1XC8 A;  3AOG A;  4DR2 M;  4YY3 M;  3FD9 A;  1GO5 A;  2LVA A;  3GPU A;  3IHP A;  1R4G A;  3IG5 A;  3KSJ A;  4JN6 A;  2CHV A;  5E26 A;  4R71 A;  1PJJ A;  3KFU G;  1SXJ B;  1IXS A;  1OFH A;  2Z3X A;  3GLI B;  3THG A;  2ZTD A;  4MGH A;  5C18 A;  1YLA A;  4DV6 M;  2Y20 A;  5KQD A;  4GRI A;  3VK8 A;  4JI5 M;  3AOE A;  1DGF A;  3GRU A;  3U61 B;  4DR6 M;  2L7I A;  2JWS A;  4LJ9 A;  2DVW B;  1QAQ A;  1G4A E;  2CHG A;  3U6D A;  3SC3 A;  4AI6 A;  3KS8 A;  3TWM A;  5EP3 A;  5ITY A;  3M7G A;  2DZO B;  4BBA A;  5BPV A;  1GVN A;  3NBX X;  4IBK A;  4NXN M;  3PVS A;  1IN5 A;  3VKG A;  4RF1 A;  2L7H A;  2VDB B;  1OJL A;  2FH0 A;  2C96 A;  2FNA A;  1YUB A;  3HX3 A;  5JI3 E;  4DV1 M;  1C7Y A;  1DGH B;  3QWL A;  3T1H M;  3GLF A;  2JNH A;  2H5X A;  3UGJ A;  2L09 A;  2VF8 A;  4KLN A;  3GPY A;  4LF8 M;  2RGO A;  3U6Q A;  3RFW A;  2DWL A;  3FYC A;  1D0L A;  3HHW A;  4FCV A;  1GJT A;  3A42 A;  4LGM A;  4LJ8 A;  5F3W A;  1MN3 A;  3Q8X A;  3KSX A;  3EIH A;  3NWL A;  3SMS A;  4D81 A;  3FUW A;  1ZMV A;  5EXT A;  2DZN B;  2XFT A;  2KA6 B;  2ZAM A;  1OFI A;  3HY5 A;  1L8Q A;  4B08 A;  3HHZ A;  2DAE A;  4DR3 M;  2H1R A;  1VDD A;  1C1K A;  4B7G A;  2DI0 A;  3A98 B;  4IBJ A;  4JYA M;  3CGW A;  1XXH A;  3FUT A;  1P3Q Q;  4MH0 E;  1IN7 A;  3A45 A;  3DFZ A;  4IBF A;  1E9S A;  3ZC7 B;  3U6L A;  3GLH B;  4ANR A;  2DWZ B;  3FUX A;  4Z8X A;  2M60 A;  2BJV A;  4XK8 F;  4LF7 M;  1GKI A;  1EE8 A;  1NSF A;  3IG8 A;  1F4I A;  4GH9 A;  2CUZ A;  3UZU A;  4LF4 M;  2UXC M;  2KRK A;  3RGP A;  2L4E A;  1VEG A;  3E4R A;  5DFL A;  2UXB M;  3HHX A;  2VII A;  1WJ7 A;  2ZAN A;  1BVS A;  2WSF F;  3LCV B;  3J7A S;  3QYB A;  2FOI C;  1VQ1 A;  5IZ7 D;  1QDR A;  2EKF A;  2FS1 A;  1PJQ A;  2VQF M;  2UUA M;  3M0E A;  4MGZ E;  3I04 M;  1D0M A;  1NY5 A;  3FKE A;  4RKU F;  2APL A;  1HT2 E;  3GRY A;  4BB9 A;  4AG6 A;  4MM3 B; 
#chains in the Genus database with same CATH homology
 3E9S A;  4CHT B;  3UMM A;  4L4U A;  2F5O A;  3TWL A;  3JR4 A;  3PXG A;  3W0L B;  5ITQ A;  4X62 M;  2XZU A;  2KEB A;  3ILK A;  3PNV A;  2KXE A;  3TPZ A;  5EP1 A;  2XEP A;  3L29 A;  3U60 B;  1QZM A;  2V6Z M;  4DV5 M;  4AZF A;  3HU1 A;  3J80 S;  2R18 A;  4QNR A;  4R7G A;  2HKJ A;  1R2Z A;  3GPP A;  2V1U A;  1HR0 M;  1N77 A;  1Z5A A;  4LZZ A;  1IY0 A;  4DUY M;  2C9O A;  1IXS B;  3BOS A;  3UK6 A;  5FTM A;  4DV7 M;  2Z4R A;  4OX9 M;  3HJS A;  4FCT A;  1YSY A;  2QPA A;  2BJW A;  2LXE A;  2ZM6 M;  3CF6 E;  3VLF B;  4JI7 M;  4FVM A;  1NVM A;  3HGI A;  2X8A A;  2DHR A;  3U6C A;  2YFQ A;  3WHL A;  4D80 A;  4MGI E;  4AQY M;  2HHH M;  3ZH9 B;  2F4V M;  2V1C A;  1G3I A;  2CV0 A;  3B9P A;  4G4R A;  1IN8 A;  5IRE B;  1FJG M;  4G6Z A;  2E5L M;  2QBY B;  3FTC A;  3VDU A;  4HLQ A;  1DGH A;  3LQQ A;  5DYI A;  2QZ4 A;  2YNM D;  3RGS A;  3VDP A;  1NJF A;  1QAO A;  1ZQ9 A;  3KVW A;  1QQW A;  4ITQ A;  1K82 A;  2XF3 A;  3GLG A;  2R4J A;  2RKO A;  4JI4 M;  3LVW A;  3KOX E;  4IBD A;  1L2B A;  3PFI A;  4WW0 A;  1XMQ M;  3U6P A;  3CF0 A;  3J27 B;  2DXI A;  4LFC M;  2XZF A;  4PDI A;  1MU5 A;  5ITU A;  8CAT A;  1IBK M;  4FWG A;  3J81 S;  4I4L A;  3SHF A;  3NBI A;  1DO2 A;  5EP2 A;  3L25 A;  3KP1 E;  1IM2 A;  3K92 A;  1NNJ A;  2P5T A;  1E32 A;  5ITT A;  4JI3 M;  2D7E A;  5E6J A;  4NSR A;  1D2N A;  3I4V A;  4OVZ A;  3GQ3 A;  3CTW B;  1N78 A;  1SXJ D;  2ZBK B;  5BR8 M;  3A46 A;  1GL7 A;  3KW6 A;  3D8L A;  4RF0 A;  3SAV A;  3U6S A;  1IXZ A;  4LF5 M;  3R8F A;  3WHK A;  4DUZ M;  5DYG A;  4NL4 H;  3T38 A;  3K1J A;  2CHQ A;  1E9R A;  3DZD A;  2XGN A;  2M5Z A;  4QHT A;  5LMN M;  4G4Q A;  4FD2 A;  2HL7 A;  4NOO B;  2BNK A;  7CAT A;  1G8P A;  3SHG B;  4D82 A;  1GL6 A;  4DR5 M;  4JI2 M;  1IN4 A;  3MHV C;  4QOZ C;  5EXP A;  2KZS A;  2X4A A;  1FNN A;  1DGB A;  1N34 M;  1TH3 A;  2R46 A;  1J5E M;  5JI2 E;  4JI1 M;  3FUU A;  3GRV A;  1MX0 A;  4KOD A;  1R7R A;  3FTF A;  4GIP A;  4M0W A;  3GQ4 A;  2KZU A;  1IY2 A;  2OPF A;  4KO8 A;  5FTK A;  5FLX S;  5ITR A;  4B3R M;  2CFO A;  4KHP M;  2F5N A;  1SXJ A;  1DO0 A;  4QHS A;  2ZAO A;  1TH2 A;  4DR1 M;  4DV3 M;  1ORY B;  1N32 M;  2K47 A;  4GMQ A;  3U5Z B;  2C98 A;  2I7N A;  4I5S A;  5C1B A;  4JXJ A;  3GQ5 A;  1IXR C;  1T3T A;  4G4O A;  3I51 A;  1Z59 A;  5KPZ A;  3LQR A;  3SBJ A;  2EA0 A;  4II7 A;  1Q3B A;  3KDS E;  5H37 D;  4X65 M;  4JV5 M;  3LMM A;  3GPX A;  3SYL A;  4LJ7 A;  4GKJ M;  4L16 A;  5FTN A;  3KS4 A;  3C58 A;  2QBY A;  3GLF B;  3SAS A;  1Z6T A;  2QP9 X;  1R6B X;  1QAN A;  3FTD A;  1K3X A;  1GLN A;  3MK6 A;  1NY6 A;  4LZJ A;  1KSF X;  5FTL A;  1QVR A;  4LGY A;  5DNY A;  3FYD A;  4MGY E;  2LNH C;  2XLJ A;  3L26 A;  4TUW A;  1IQP A;  1R2Y A;  3HU2 A;  1N75 A;  3GLI A;  1HQY E;  2HCB A;  4AG5 A;  1IY1 A;  4LY6 A;  2Y0T A;  1PJI A;  4QOS A;  4B3S M;  2FFJ A;  3T15 A;  1K3W A;  1DGG A;  2YQZ A;  2CEA A;  2AHM A;  4LFA M;  1NHG C;  2F5Q A;  2X49 A;  4IBI A;  1N33 M;  3VKH A;  2ERC A;  4CGY B;  4FCW A;  5KO3 A;  4LF6 M;  3D8B A;  2O5R A;  1XNQ M;  1KYI A;  2F5P A;  3SAT A;  2XFS A;  2A5Y B;  2EO2 A;  3OTO M;  4DR7 M;  3GO8 A;  3J7B A;  3TWK A;  4JI8 M;  4OW0 A;  4EIW A;  4B3T M;  4M9X A;  2D7H A;  2G5G X;  2JA2 A;  5IWA M;  4AW4 A;  3GP1 A;  4IBG A;  1IBM M;  2XSZ A;  4YHH M;  1IBL M;  2Y21 A;  3H4M A;  1J7K A;  4IIW A;  3VFD A;  2DWN A;  4QNM A;  5EQT A;  1XWI A;  4LJA A;  2R4E A;  4L8R C;  1N36 M;  2I7P A;  4LF9 M;  2C9C A;  4A3V B;  3HKP A;  4BLC A;  3JAM S;  2J7N A;  3EIE A;  4B7F A;  1NJG A;  1HQC A;  4DV0 M;  1HNZ M;  1PM5 A;  4JI6 M;  2Q2E B;  4I81 A;  4LJ6 A;  4FWD A;  3GRR A;  3SFZ A;  1KFV A;  4REZ A;  4NRW A;  3J2P B;  3TL4 X;  1LV7 A;  4AKI A;  4GHA A;  4IJE A;  3U5Z A;  4I8O A;  4GIT A;  4IBB A;  2UU9 M;  3U6E A;  2XSZ D;  1H6U A;  3CF2 A;  4X66 M;  4CIS A;  3LVV A;  4M9S A;  2J7O A;  4G4N A;  4IBE A;  3SAR A;  1X37 A;  1Z5B A;  5KQ8 A;  3SAW A;  1I4W A;  2LWX A;  3AOE C;  3AV0 A;  3AL0 C;  5EJC A;  3U6M A;  1SXJ C;  4L15 A;  3QAU A;  1NNU C;  1L2D A;  1I94 M;  4AKG A;  5EXS A;  1TDZ A;  1TH4 A;  4LRS A;  2QEN A;  3DOA A;  2Z7J A;  4PD2 A;  1UM8 A;  2G8L A;  1E94 E;  4XBO A;  4IBC A;  3HU3 A;  1W5T A;  3ZCB B;  1JR3 D;  1SXJ E;  1HT1 E;  3TE6 A;  3KOY E;  5FTJ A;  3U61 A;  3VK7 A;  5GKN A;  1JQJ C;  4S12 A;  1XMO M;  4AKH A;  1ZAE A;  3M6A A;  2UUB M;  5IT9 S;  2C5R A;  4LRT A;  4MB7 A;  2FE8 A;  2VQE M;  3KOZ E;  3K2L A;  3U6O A;  4M0D A;  4FWH A;  4GC5 A;  3UJN A;  3AFH A;  3SAU A;  2NQ8 C;  4OU7 A;  5FSW A;  4B3M M;  1G41 A;  4DV2 M;  4GC9 A;  5A2Q S;  4PCZ A;  4HL4 A;  4K0K M;  3FTE A;  4GHL A;  2LH0 A;  5KPR A;  1W5S A;  4X64 M;  2Z4S A;  2KW0 A;  2Y0Q A;  3L2A A;  2UXD M;  2CV2 A;  3AJI B;  1J09 A;  1XHB A;  4NSO B;  4W5W A;  3KOW E;  3GLG B;  4WUR A;  3W0F A;  3PNY A;  4JI0 M;  1HNW M;  3KP0 E;  1TDH A;  2DWM A;  2EUC A;  1YE9 A;  2R65 A;  3FUV A;  2YR0 A;  1JR3 A;  3DA1 A;  3HWS A;  4LCB A;  1XXH B;  4P16 A;  4B7H A;  3L28 A;  3MJ5 A;  4DV4 M;  1HNX M;  3SMP A;  4Z6Y A;  2W82 A;  3GLH A;  2C99 A;  4NRV A;  4LG2 A;  2L6O A;  4FW9 A;  4NXM M;  5KPT A;  4OVZ B;  3K8Z A;  1L1Z A;  4PDG A;  3L27 A;  1XNR M;  3KXE C;  2RGH A;  2CV1 A;  2XH9 A;  1G59 A;  1Z5C A;  2F5S A;  2CE7 A;  2OQ4 A;  2KRU A;  2QCU A;  1WXQ A;  4MGK E;  3I4Y A;  1L2C A;  1S3S A;  2R45 A;  1Q3C A;  1QAM A;  4GKK M;  4LFB M;  5EXX A;  3HJ8 A;  2D7G A;  4LJ5 A;  4RNA A;  3HJQ A;  1L1T A;  1NHW C;  4IJF A;  3R9X B;  4L78 A;  1IN6 A;  3SYK A;  2R62 A;  4M9Z A;  4XGI A;  3TQS A;  4DR4 M;  2UUC M;  1Q39 A;  3HHY A;  4R3D A;  5LMU M;  1TGU A;  3RE8 A;  3JR5 A;  5ITX E;  3U60 A;  4LJ4 A;  1QYR A;  4PT5 A;  5ITX A;  5EP4 A;  3AKZ A;  3T1Y M;  4ZPX A;  1XC8 A;  3AOG A;  4DR2 M;  4YY3 M;  3FD9 A;  3GPU A;  3IG5 A;  3KSJ A;  4JN6 A;  5E26 A;  2CHV A;  1PJJ A;  3KFU G;  1SXJ B;  1OFH A;  2Z3X A;  3GLI B;  3THG A;  4MGH A;  5C18 A;  3VK8 A;  4DV6 M;  2Y20 A;  5KQD A;  4GRI A;  4JI5 M;  3AOE A;  1DGF A;  3GRU A;  3U61 B;  4DR6 M;  2L7I A;  4LJ9 A;  2DVW B;  1QAQ A;  1G4A E;  2CHG A;  3U6D A;  3SC3 A;  4AI6 A;  3KS8 A;  3TWM A;  5EP3 A;  5ITY A;  3M7G A;  2DZO B;  4BBA A;  5BPV A;  1GVN A;  4IBK A;  4NXN M;  3PVS A;  1IN5 A;  3VKG A;  4RF1 A;  2L7H A;  1OJL A;  2FNA A;  2C96 A;  4DV1 M;  1YUB A;  5JI3 E;  1DGH B;  3QWL A;  3T1H M;  3GLF A;  3UGJ A;  2L09 A;  4KLN A;  3GPY A;  4LF8 M;  2RGO A;  3U6Q A;  3RFW A;  2DWL A;  3FYC A;  3HHW A;  4FCV A;  3A42 A;  4LGM A;  4LJ8 A;  5F3W A;  3Q8X A;  3KSX A;  3EIH A;  3NWL A;  3SMS A;  4D81 A;  3FUW A;  5EXT A;  2DZN B;  2XFT A;  2KA6 B;  2ZAM A;  1OFI A;  3HHZ A;  1L8Q A;  4B08 A;  4DR3 M;  2H1R A;  1VDD A;  1C1K A;  4B7G A;  3A98 B;  4IBJ A;  4JYA M;  3FUT A;  1XXH A;  4MH0 E;  1IN7 A;  3A45 A;  3DFZ A;  4IBF A;  1E9S A;  3ZC7 B;  3U6L A;  3GLH B;  2DWZ B;  3FUX A;  4Z8X A;  2M60 A;  2BJV A;  4LF7 M;  1GKI A;  1EE8 A;  1NSF A;  3IG8 A;  4GH9 A;  2CUZ A;  3UZU A;  4LF4 M;  2UXC M;  2KRK A;  3RGP A;  3E4R A;  2UXB M;  3HHX A;  2VII A;  2ZAN A;  3J7A S;  2FOI C;  5IZ7 D;  2UUA M;  2VQF M;  3M0E A;  4MGZ E;  1NY5 A;  3FKE A;  1HT2 E;  3GRY A;  4BB9 A;  4AG6 A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...