2K47A

Solution structure of the c-terminal n-rna binding domain of the vesicular stomatitis virus phosphoprotein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Phosphoprotein
publication title Solution Structure of the C-Terminal Nucleoprotein-RNA Binding Domain of the Vesicular Stomatitis Virus Phosphoprotein.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2k47A00
2K47A 3HHZA 3HHWA
chains in the Genus database with same CATH superfamily
3AL0C 3FKEA 3U61A 4GHLA 3HJQA 4L6V6 1HT1E 4YHHM 3U6SA 3HWSA 3TWKA 1IBMM 2F5PA 1L2BA 4L15A 3GLFE 1Z5BA 5FTMA 4QNMA 3GLGA 2GNOA 4IBEA 2K47A 2CWBA 2L09A 5DYGA 1YLAA 3VKHA 1OTRA 1QYRA 5KPRA 1VDLA 3I4VA 2CRUA 5EQTA 1JR3D 2JY6B 2QPAA 1MN3A 1JQJC 1G71A 1Q39A 1WGLA 1H6UA 3U6EA 2CEAA 3C3EA 4MGKE 4LF9M 5EXSA 3VFDA 2I7NA 2C96A 1TH3A 1NSFA 3KP1E 3H4JA 4LGMA 1ZMWA 3Q8XA 4MGHA 4UN2B 5ITXE 5EP4A 3KOZE 4BLCA 1ZMUA 4I81A 2QSFX 1QDTA 5FTJA 3U6DA 1HQCA 4LRSA 1R4GA 3GPXA 2BNKA 4LGYA 1OFHA 2V1CA 2L7HA 3WHLA 2EKFA 4B7GA 4GH9A 4NSRA 1PRBA 1WJ7A 1JR3A 2A5YB 1XXHB 4XGIA 1LTMA 1XC8A 1TDZA 4QOSA 1D0LA 2C99A 2LVPC 2LH0A 3MHVC 3FTDA 1T3TA 2OOBA 4DUYM 2JUJA 2UU9M 4DV3M 3L2AA 4LZZA 3BOSA 4B3SM 2UUAM 4LF5M 2KRUA 2C98A 2ZTDA 3QYBA 4PCZA 3U61B 5FTNA 1IN7A 1GKIA 1NJFA 2CFOA 3V76A 3UGJA 3SHGB 2NQ8C 3GLGB 2R46A 4D80A 1HNZM 1V92A 3K9PA 1VQ1A 4RF1A 2D7GA 3WHKA 3B89A 3RE8A 2UXDM 2LHGA 5ITYA 4MGZE 3D8BA 3T38A 1N34M 1QZEA 4AKIA 4LF8M 1SXJC 3UK6A 1R7RA 3GLHE 3GLFA 2QNJA 4DR6M 3J2PB 1NY5A 1E9SA 3NBIA 4Y28F 5IWAM 4LY6A 3IHPA 3SC3A 3GPPA 1RU3A 2VF8A 2HWJA 3DOAA 2CHGA 4LF7M 2HL7A 2XF3A 2ERCA 4TUWA 2JZ1A 3GLGE 1Y8GA 2JY5A 5FSWA 2ZTCA 2QQ8A 1QVRA 1DO2A 2C9CA 2RKOA 3FYCA 3LQRA 1IXSA 2DHYA 5ITTA 2EA0A 1NNJA 1UFZA 3U6CA 2D7EA 4DR5M 4LJ7A 5KPZA 1QUTA 3AJIB 2F5NA 2DWNA 2F5OA 3AV0A 1N36M 2BWEA 3KOXE 4GEWA 3FTEA 2L7IA 2KZSA 1HT2E 4HEOA 2DHRA 1PJQA 3KXEC 3HHXA 4X62M 2OPFA 4R71A 5KQDA 1VEKA 1S3SA 1D0MA 2Z8YM 2Y0QA 3GRYA 2VQFM 3SBJA 4LJ4A 2VDBB 4OW0A 1FNNA 3GQ4A 2ZANA 2LNHC 2BJVA 4BB9A 1C1KA 1QDRA 2R4JA 1XNRM 1PGYA 3KS4A 3ZC7B 4DR3M 1QQWA 4MM3B 1BVSA 2Z4SA 3L25A 4G4QA 2R45A 2X8AA 2O25A 3L28A 2Y0TA 4LF6M 1XNQM 4OVZA 1DGFA 5EP3A 2XLJA 1G4AE 1DO0A 5BR8M 1Z5CA 2F4VM 3IG8A 3W0LB 5KQ8A 2FNAA 1EE8A 1G59A 4DR4M 3GLFB 4FD2A 4KT0F 1R6BX 4FVMA 3FTFA 2D7HA 2X49A 4LJ6A 3TQSA 1KSFX 3J7BA 2K0BX 3E21A 1TH4A 3TE6A 1XMOM 4Q7JA 3EIEA 2C5RA 3GRVA 2K9DA 3LCUA 3VLFB 5LMUM 4GC5A 3GLHA 2L4FA 3HHZA 2KA6B 3A45A 1ZQ9A 3U6QA 4LZJA 4OU7A 2Q2EB 1IXSB 1T43A 4NL4H 4GITA 2ZAMA 2DNAA 2DKLA 3LQQA 3A46A 3M6AA 2Z4RA 4I5SA 3KW6A 3FRHA 3GPYA 3IG5A 1Z6TA 1HQYE 3D8LA 2HHHM 4DV5M 1G3IA 2FS1A 2QHOB 3CGWA 4IBDA 1IBKM 3PVSA 3E46A 1WXQA 3PNYA 2R4EA 3VK7A 3ZQJA 3AFHA 4JYAM 4QHSA 4AI6A 3I51A 1IXRC 4QNRA 3GLIE 2B3TA 3A42A 2GQFA 2LVAA 2R0IA 4B7HA 2JP7A 4G4RA 3TWMA 3UJNA 4LF4M 1QUSA 4D81A 5E26A 3HU2A 2XFTA 3SMPA 2JA2A 4RNAA 2LTUA 4JXJA 1Z5AA 2R6FA 1PJTA 2MJ5B 4GKKM 2CHQA 4FWHA 1N75A 5FTKA 2KDLA 4OVZB 3RGPA 3GPUA 1HNXM 3RGSA 4NOOB 1NHWC 2G8LA 1NV8A 3FE3A 1TF0B 2EKKA 2LVQD 3ZH9B 4DV1M 3SARA 1IQPA 1ZMVA 2J5YA 4ANRA 2CUZA 4A3VB 2BWBA 4MGYE 3T1HM 4IBCA 2R44A 4GHAA 3C9PA 3KSJA 3JR5A 4DV2M 2DWZB 2MR9A 2X4AA 3AOEC 4JI0M 3GLHB 4G4NA 4G6ZA 3BXWA 4PD2A 2ZAOA 5DNYA 2CV0A 4QHTA 4EIWA 4JI7M 2KW0A 1IXZA 3PNVA 4MGIE 3HU3A 2V1UA 1HJPA 3DFZA 2OOAA 2V6ZM 2WZJA 3J27B 3SAWA 2G5GX 4XK8F 4IIWA 3FD9A 1PJSA 1WHCA 3GQ3A 5ITQA 2FE8A 1DV0A 2K6BA 1NY6A 1MX0A 3QWLA 4FWGA 2HKJA 1OIZA 2M5ZA 1IN8A 4G4OA 2DWMA 3FTCA 4ITQA 4D82A 5EP1A 2CP8A 2JZ0A 2R18A 3M0EA 1PJJA 4R3DA 1Q02A 2R62A 1IN6A 1IBLM 4GKJM 2LHCA 2RRUA 2FH0A 2KZUA 2XFSA 3LMMA 4B3RM 5H37D 4G3OA 2ZM6M 2LXEA 5DFLA 3LVWA 1G8PA 3JAMS 3OTOM 3EIHA 3J7AS 2H1RA 5EP2A 2C9OA 3B9PA 2YNMD 3GLIA 2EJSA 3DZDA 3GO8A 2DENA 2LWXA 4NRVA 4GIPA 1IN5A 4WW0A 4F1IA 3J80S 1G41A 2HCBA 1IY2A 2R65A 5JI2E 3U5ZA 5EXPA 1V33A 2QBYA 1GLNA 1ZV1A 4IBGA 4DBGB 2J7NA 1L2DA 3BBZA 1IN4A 4LJ8A 2VIIA 1Z59A 3GQ5A 1VEJA 3L26A 3IECA 4CISA 1NHGC 4QOZC 2VQEM 1K3XA 4LCBA 2DZOB 2QCUA 3GRRA 4MH0E 8CATA 4DV6M 1NO1A 3QAUA 1GL7A 2M60A 1YSYA 3F92A 2XEPA 4P17A 1EFUB 1CUKA 2G3QA 3E9SA 1L1TA 1UM8A 1C7YA 2YFQA 2JXNA 1QAMA 2P5TA 4CGYB 1Q3BA 4HL4A 4K0KM 3LVVA 3RFWA 2CE7A 1N78A 1GO5A 1T6OA 1A5TA 4X66M 3R9XB 3E4RA 3TWLA 4X64M 3SYKA 2Z3XA 4JI2M 4GC9A 1I4WA 3B7ZA 3K9OA 1AIPC 3FRIA 4DR2M 1J09A 3K2LA 2EUCA 4JI8M 7CATA 3FUXA 1TDHA 4NXMM 1TTEA 3K8ZA 4F2LA 2KRKA 2JNHA 1ZAEA 1OKSA 3TPZA 4REZA 2YR0A 2CHVA 3C3DA 1SXJE 1OJLA 4S12A 2XGNA 4JI3M 1E9RA 4AW4A 2VF7A 2HAKA 3SAUA 4AQYM 3GLIB 4AKGA 4X65M 2DWLA 4RF0A 1MU5A 1HR0M 1EIJA 3MK6A 1KYIA 1LV7A 2YQZA 5ITUA 1NNUC 2QZ4A 4DR1M 2Y21A 1VEGA 1R5LA 4WURA 5BPVA 2RGOA 4LFBM 2JY7A 5C1BA 1XWIA 2CV2A 1L1ZA 3U5ZB 5EXTA 5EJCA 3FYDA 3A98B 5EXXA 1QANA 2QBYB 1WGNA 1N33M 3U60A 4LJAA 2QP9X 4LJ5A 5JI3E 3FUUA 4FWDA 3M7GA 1YE9A 3J81S 5IT9S 4M9XA 3C58A 2AHMA 2N35A 3HHWA 4OX9M 2DZLA 3I01M 3KFUG 4B3MM 2KXEA 2OQ4A 4W5WA 2LBCA 2LVNC 3K1JA 1WR1B 3HJ8A 3U6PA 1OAIA 1GJTA 3ILKA 3FUVA 1IM2A 3W68A 1SXJD 5F3WA 4L78A 2WSFF 3L27A 4IBKA 1KFVA 2DAIA 1GABA 2XZFA 3W67A 1XB2B 2MGWA 3B74A 4JI4M 2I7PA 1QZMA 2H5XA 3AOEA 5L8RF 1XMQM 4PDIA 1L2CA 4FCTA 2XZUA 3SASA 1QAQA 4FCWA 4IBBA 5A2QS 3JR4A 1W5TA 3GRUA 4M0WA 4XBOA 3GP1A 1DGGA 4P16A 4GRIA 3HZJA 3KOWE 4NC6A 2DXIA 4IBFA 5E6JA 3KSXA 4CIZA 4I8OA 1VG5A 2DVWB 1OIPA 4IJEA 2O01F 4NSOB 3T1YM 1SXJA 2XH9A 2APLA 1MJGM 1OFIA 3HJSA 3SFZA 1GJSA 2UUBM 4L8RC 3U6MA 4JV5M 3L29A 1Q3CA 2OO9A 3VKGA 5FTLA 2F5SA 3U60B 2UXCM 2JWSA 5ITRA 2WSEF 5LMNM 2MH8A 3HU1A 3I04M 4IBJA 1NVMA 3HKPA 3I4YA 4KODA 2KNZA 3KOYE 4B08A 3T6PA 4CHTB 1IY0A 1DGHA 1GVNA 3SYLA 3VDPA 1XXHE 1IY1A 3B7QA 3SHFA 4NXNM 1K82A 1P3QQ 1TH2A 2O5RA 5IREB 1TR8A 3W0FA 1V34A 2DAEA 2UUCM 2XSZD 3UZUA 1R2ZA 3H4MA 4AG5A 4DR7M 4L4UA 2DAMA 4PT5A 4CJ6A 4LFAM 4LG2A 1AUAA 2FOIC 1N32M 1JB0F 3VK8A 2E5LM 2DAGA 2KNVA 4KLNA 1YUBA 5GKNA 3QYEA 2L4EA 4Z6YA 4KHPM 1DGBA 1ORYB 3LW5F 4ZPXA 2ZBKB 2MROB 2Z7JA 4R7GA 4M9ZA 1FJGM 2F5QA 3KP0E 2LVOC 2FFJA 5IZ7D 4MB7A 2BJWA 1WIVA 5C18A 4GMQA 4BBAA 2J7OA 3U6OA 1K3WA 3KVWA 2EO2A 3PFIA 1J7KA 1SG9A 5FLXS 3LCVB 2XSZA 3K92A 3NWLA 4B3TM 1PM5A 4AKHA 4DV4M 3PXGA 2L6OA 3AKZA 1D2NA 1NJGA 1IFYA 4LFCM 4II7A 3CF0A 1D0KA 3HGIA 1GL6A 2L2DA 2Y20A 2KNAA 4Z8XA 3T15A 1OAOC 3R8FA 3U6LA 3HY5A 1F4IA 1HNWM 4IBIA 4M0DA 5DYIA 1XHBA 5ITXA 1VDDA 3TL4X 4DV7M 1SXJB 3DA1A 2RGHA 4JN6A 3Q8GA 3AOGA 3CF2A 5KPTA 3KS8A 1QAOA 4KO8A 1OQYA 2DI0A 1L8QA 1NV9A 5KO3A 4JI6M 4AZFA 4B7FA 3VDUA 2KEBA 4FCVA 1N77A 4HLQA 4LJ9A 2CV1A 3HHYA 3THGA 3HX3A 3B7NA 4FW9A 4LRTA 3SAVA 2QENA 1TGUA 1R2YA 3FUTA 2DAKA 3CTWB 1PJIA 4I4LA 1DGHB 1W5SA 2WSCF 1JR3E 1X37A 3KDSE 4AG6A 1E32A 3UMMA 3CF6E 3SATA 1J5EM 4NRWA 3FUWA 4JI1M 2W82A 3SMSA 4JI5M 4PDGA 2DZNB 1XXHA 1I94M 3NBXX 4M9SA 2KHHA 4L16A 1E94E 4YY3M 3MMPA 4DUZM 2UXBM 4WP2A 2JY8A 4IJFA 4RKUF 3MJ5A 4DV0M 3ZCBB
chains in the Genus database with same CATH topology
3AL0C 3FKEA 3U61A 4GHLA 3HJQA 1HT1E 4YHHM 3U6SA 3HWSA 3TWKA 1IBMM 2F5PA 1L2BA 4L15A 1Z5BA 5FTMA 4QNMA 3GLGA 4IBEA 2K47A 2L09A 5DYGA 1QYRA 5KPRA 3I4VA 5EQTA 1JR3D 2QPAA 1JQJC 1Q39A 4LF9M 1H6UA 3U6EA 2CEAA 4MGKE 5EXSA 3VFDA 2I7NA 2C96A 1TH3A 1NSFA 3KP1E 4LGMA 3Q8XA 4MGHA 5ITXE 5EP4A 3KOZE 4BLCA 4I81A 3U6DA 5FTJA 1HQCA 4LRSA 3GPXA 2BNKA 4LGYA 1OFHA 2V1CA 2L7HA 3WHLA 4B7GA 4GH9A 4NSRA 2A5YB 4XGIA 1JR3A 1TDZA 1XXHB 1XC8A 4QOSA 2C99A 2LH0A 3MHVC 3FTDA 1T3TA 4DUYM 2UU9M 3L2AA 4LZZA 3BOSA 4B3SM 2UUAM 4LF5M 2KRUA 2C98A 4PCZA 3U61B 5FTNA 1IN7A 1GKIA 1NJFA 2CFOA 3UGJA 3SHGB 2NQ8C 3GLGB 2R46A 4D80A 1HNZM 4RF1A 3WHKA 2D7GA 3RE8A 2UXDM 5ITYA 4MGZE 3D8BA 3T38A 1N34M 4AKIA 4LF8M 1SXJC 3UK6A 1R7RA 3GLFA 4DR6M 3J2PB 1NY5A 1E9SA 3NBIA 5IWAM 4LY6A 3SC3A 3GPPA 3DOAA 2CHGA 4LF7M 2HL7A 2XF3A 2ERCA 4TUWA 5FSWA 1QVRA 1DO2A 2C9CA 2RKOA 3FYCA 3LQRA 5ITTA 2EA0A 1NNJA 3U6CA 2D7EA 4DR5M 4LJ7A 5KPZA 3AJIB 2F5NA 2DWNA 2F5OA 3AV0A 1N36M 3KOXE 3FTEA 2L7IA 2KZSA 1HT2E 2DHRA 3KXEC 3HHXA 4X62M 2OPFA 5KQDA 1S3SA 3GRYA 2Y0QA 2VQFM 3SBJA 4LJ4A 4OW0A 1FNNA 3GQ4A 2ZANA 2LNHC 2BJVA 1C1KA 2R4JA 1XNRM 3KS4A 3ZC7B 4DR3M 1QQWA 4MM3B 2Z4SA 3L25A 4G4QA 2R45A 2X8AA 3L28A 2Y0TA 4LF6M 1XNQM 4OVZA 1DGFA 5EP3A 2XLJA 1G4AE 1DO0A 5BR8M 1Z5CA 2F4VM 3IG8A 3W0LB 5KQ8A 2FNAA 1EE8A 1G59A 4DR4M 3GLFB 4FD2A 1R6BX 4FVMA 3FTFA 2D7HA 2X49A 4LJ6A 3TQSA 1KSFX 3J7BA 1TH4A 3TE6A 1XMOM 3EIEA 2C5RA 3GRVA 3VLFB 5LMUM 4GC5A 3GLHA 3HHZA 2KA6B 3A45A 1ZQ9A 3U6QA 4LZJA 4OU7A 2Q2EB 1IXSB 4NL4H 4GITA 2ZAMA 3LQQA 3A46A 3M6AA 2Z4RA 4I5SA 3KW6A 3GPYA 3IG5A 1Z6TA 1HQYE 3D8LA 2HHHM 4DV5M 1G3IA 4IBDA 1IBKM 3PVSA 3PNYA 1WXQA 3VK7A 2R4EA 3AFHA 4JYAM 4QHSA 4AI6A 3I51A 1IXRC 4QNRA 3A42A 4B7HA 3TWMA 4G4RA 3UJNA 4LF4M 4D81A 5E26A 3HU2A 2XFTA 3SMPA 2JA2A 4RNAA 4JXJA 1Z5AA 4GKKM 2CHQA 4FWHA 1N75A 5FTKA 4OVZB 3RGPA 3GPUA 1HNXM 3RGSA 4NOOB 1NHWC 2G8LA 3ZH9B 4DV1M 3SARA 1IQPA 2CUZA 4A3VB 4MGYE 3T1HM 4IBCA 4GHAA 3KSJA 3JR5A 4DV2M 2DWZB 2X4AA 3AOEC 4G4NA 4JI0M 3GLHB 4G6ZA 4PD2A 5DNYA 2ZAOA 2CV0A 4JI7M 4QHTA 4EIWA 2KW0A 1IXZA 3PNVA 4MGIE 3HU3A 2V1UA 3DFZA 2V6ZM 3J27B 3SAWA 2G5GX 4IIWA 3FD9A 3GQ3A 5ITQA 2FE8A 1NY6A 1MX0A 3QWLA 4FWGA 2HKJA 2M5ZA 4G4OA 1IN8A 2DWMA 4ITQA 3FTCA 4D82A 5EP1A 2R18A 3M0EA 1PJJA 4R3DA 2R62A 1IN6A 1IBLM 4GKJM 2KZUA 2XFSA 3LMMA 4B3RM 5H37D 2ZM6M 2LXEA 3LVWA 1G8PA 3JAMS 3OTOM 3EIHA 3J7AS 2H1RA 5EP2A 2C9OA 3B9PA 2YNMD 3GLIA 3DZDA 3GO8A 2LWXA 4NRVA 4GIPA 1IN5A 4WW0A 3J80S 1G41A 2HCBA 1IY2A 2R65A 5JI2E 3U5ZA 5EXPA 2QBYA 1GLNA 4IBGA 2J7NA 1L2DA 4LJ8A 1IN4A 2VIIA 1Z59A 3GQ5A 3L26A 4CISA 4QOZC 1NHGC 2VQEM 1K3XA 4LCBA 2DZOB 2QCUA 3GRRA 4MH0E 8CATA 4DV6M 3QAUA 1GL7A 2M60A 1YSYA 2XEPA 3E9SA 1L1TA 1UM8A 2YFQA 1QAMA 2P5TA 4CGYB 1Q3BA 4HL4A 4K0KM 3LVVA 3RFWA 2CE7A 1N78A 4X66M 3R9XB 3E4RA 3TWLA 4X64M 3SYKA 2Z3XA 4JI2M 4GC9A 1I4WA 4DR2M 1J09A 3K2LA 2EUCA 4JI8M 7CATA 3FUXA 1TDHA 4NXMM 3K8ZA 2KRKA 3TPZA 1ZAEA 4REZA 2YR0A 2CHVA 1SXJE 1OJLA 4S12A 2XGNA 4JI3M 1E9RA 4AW4A 3SAUA 4AKGA 4AQYM 3GLIB 4X65M 2DWLA 4RF0A 1MU5A 1HR0M 3MK6A 1KYIA 1LV7A 2YQZA 5ITUA 1NNUC 2QZ4A 4DR1M 2Y21A 4WURA 5BPVA 2RGOA 4LFBM 5C1BA 1XWIA 2CV2A 1L1ZA 3U5ZB 5EXTA 5EJCA 3FYDA 3A98B 5EXXA 1QANA 2QBYB 1N33M 3U60A 4LJAA 2QP9X 4LJ5A 5JI3E 3FUUA 4FWDA 3M7GA 1YE9A 3J81S 5IT9S 4M9XA 3C58A 2AHMA 4OX9M 3HHWA 3KFUG 4B3MM 2KXEA 2OQ4A 4W5WA 3K1JA 3HJ8A 3U6PA 3ILKA 3FUVA 1IM2A 1SXJD 5F3WA 4L78A 3L27A 4IBKA 1KFVA 2XZFA 4JI4M 2I7PA 1QZMA 3AOEA 1XMQM 4PDIA 1L2CA 4FCTA 2XZUA 3SASA 1QAQA 4FCWA 4IBBA 5A2QS 3JR4A 1W5TA 3GRUA 4M0WA 4XBOA 3GP1A 1DGGA 4P16A 4GRIA 3KOWE 2DXIA 4IBFA 5E6JA 3KSXA 4I8OA 2DVWB 4IJEA 3T1YM 4NSOB 1SXJA 2XH9A 1OFIA 3HJSA 3SFZA 2UUBM 4L8RC 3U6MA 4JV5M 3L29A 1Q3CA 3VKGA 5FTLA 2F5SA 3U60B 2UXCM 5ITRA 3HU1A 4BB9A 4IBJA 4KODA 1NVMA 3HKPA 3I4YA 4B08A 3KOYE 4DV3M 4CHTB 1IY0A 1DGHA 1GVNA 3SYLA 3VDPA 1IY1A 3SHFA 4NXNM 1K82A 1TH2A 5IREB 2O5RA 3W0FA 2UUCM 2XSZD 3UZUA 1R2ZA 3H4MA 4AG5A 4DR7M 4L4UA 4PT5A 4LFAM 4LG2A 2FOIC 1N32M 3VK8A 2E5LM 4KLNA 1YUBA 5GKNA 4Z6YA 4KHPM 1DGBA 1ORYB 4ZPXA 2ZBKB 2Z7JA 4R7GA 4M9ZA 1FJGM 2F5QA 3KP0E 2FFJA 5IZ7D 4MB7A 2BJWA 5C18A 4GMQA 4BBAA 2J7OA 3U6OA 1K3WA 3KVWA 2EO2A 3PFIA 1J7KA 5FLXS 2XSZA 3K92A 3NWLA 4B3TM 1PM5A 4AKHA 4DV4M 3PXGA 2L6OA 3AKZA 1D2NA 1NJGA 4LFCM 4II7A 3CF0A 3HGIA 3T15A 1GL6A 2Y20A 4Z8XA 3R8FA 3VKHA 3U6LA 1HNWM 4IBIA 4M0DA 5DYIA 1XHBA 5ITXA 1VDDA 3TL4X 4DV7M 1SXJB 3DA1A 2RGHA 4JN6A 3AOGA 3CF2A 5KPTA 3KS8A 1QAOA 4KO8A 1L8QA 5KO3A 4JI6M 4AZFA 4B7FA 3VDUA 2KEBA 4FCVA 1N77A 4HLQA 4LJ9A 2CV1A 3HHYA 3THGA 4FW9A 4LRTA 3SAVA 2QENA 1TGUA 1R2YA 3FUTA 3CTWB 1PJIA 4I4LA 1DGHB 1W5SA 1X37A 3KDSE 4AG6A 1E32A 3UMMA 3CF6E 3SATA 1J5EM 4NRWA 3FUWA 4JI1M 2W82A 3SMSA 4JI5M 4PDGA 2DZNB 1XXHA 1I94M 4M9SA 4L16A 1E94E 4YY3M 4DUZM 2UXBM 4IJFA 5LMNM 3MJ5A 4DV0M 3ZCBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K47 A;  3HHZ A;  3HHW A; 
#chains in the Genus database with same CATH topology
 3AL0 C;  3FKE A;  3U61 A;  4GHL A;  3HJQ A;  4L6V 6;  1HT1 E;  4YHH M;  3U6S A;  3HWS A;  3TWK A;  1IBM M;  2F5P A;  1L2B A;  4L15 A;  3GLF E;  1Z5B A;  5FTM A;  4QNM A;  3GLG A;  2GNO A;  4IBE A;  2K47 A;  2CWB A;  2L09 A;  5DYG A;  1YLA A;  3VKH A;  1OTR A;  1QYR A;  5KPR A;  1VDL A;  3I4V A;  2CRU A;  5EQT A;  1JR3 D;  2JY6 B;  2QPA A;  1MN3 A;  1JQJ C;  1G71 A;  1Q39 A;  1WGL A;  1H6U A;  3U6E A;  2CEA A;  3C3E A;  4MGK E;  4LF9 M;  5EXS A;  3VFD A;  2I7N A;  2C96 A;  1TH3 A;  1NSF A;  3KP1 E;  3H4J A;  4LGM A;  1ZMW A;  3Q8X A;  4MGH A;  4UN2 B;  5ITX E;  5EP4 A;  3KOZ E;  4BLC A;  1ZMU A;  4I81 A;  2QSF X;  1QDT A;  5FTJ A;  3U6D A;  1HQC A;  4LRS A;  1R4G A;  3GPX A;  2BNK A;  4LGY A;  1OFH A;  2V1C A;  2L7H A;  3WHL A;  2EKF A;  4B7G A;  4GH9 A;  4NSR A;  1PRB A;  1WJ7 A;  1JR3 A;  2A5Y B;  1XXH B;  4XGI A;  1LTM A;  1XC8 A;  1TDZ A;  4QOS A;  1D0L A;  2C99 A;  2LVP C;  2LH0 A;  3MHV C;  3FTD A;  1T3T A;  2OOB A;  4DUY M;  2JUJ A;  2UU9 M;  4DV3 M;  3L2A A;  4LZZ A;  3BOS A;  4B3S M;  2UUA M;  4LF5 M;  2KRU A;  2C98 A;  2ZTD A;  3QYB A;  4PCZ A;  3U61 B;  5FTN A;  1IN7 A;  1GKI A;  1NJF A;  2CFO A;  3V76 A;  3UGJ A;  3SHG B;  2NQ8 C;  3GLG B;  2R46 A;  4D80 A;  1HNZ M;  1V92 A;  3K9P A;  1VQ1 A;  4RF1 A;  2D7G A;  3WHK A;  3B89 A;  3RE8 A;  2UXD M;  2LHG A;  5ITY A;  4MGZ E;  3D8B A;  3T38 A;  1N34 M;  1QZE A;  4AKI A;  4LF8 M;  1SXJ C;  3UK6 A;  1R7R A;  3GLH E;  3GLF A;  2QNJ A;  4DR6 M;  3J2P B;  1NY5 A;  1E9S A;  3NBI A;  4Y28 F;  5IWA M;  4LY6 A;  3IHP A;  3SC3 A;  3GPP A;  1RU3 A;  2VF8 A;  2HWJ A;  3DOA A;  2CHG A;  4LF7 M;  2HL7 A;  2XF3 A;  2ERC A;  4TUW A;  2JZ1 A;  3GLG E;  1Y8G A;  2JY5 A;  5FSW A;  2ZTC A;  2QQ8 A;  1QVR A;  1DO2 A;  2C9C A;  2RKO A;  3FYC A;  3LQR A;  1IXS A;  2DHY A;  5ITT A;  2EA0 A;  1NNJ A;  1UFZ A;  3U6C A;  2D7E A;  4DR5 M;  4LJ7 A;  5KPZ A;  1QUT A;  3AJI B;  2F5N A;  2DWN A;  2F5O A;  3AV0 A;  1N36 M;  2BWE A;  3KOX E;  4GEW A;  3FTE A;  2L7I A;  2KZS A;  1HT2 E;  4HEO A;  2DHR A;  1PJQ A;  3KXE C;  3HHX A;  4X62 M;  2OPF A;  4R71 A;  5KQD A;  1VEK A;  1S3S A;  1D0M A;  2Z8Y M;  2Y0Q A;  3GRY A;  2VQF M;  3SBJ A;  4LJ4 A;  2VDB B;  4OW0 A;  1FNN A;  3GQ4 A;  2ZAN A;  2LNH C;  2BJV A;  4BB9 A;  1C1K A;  1QDR A;  2R4J A;  1XNR M;  1PGY A;  3KS4 A;  3ZC7 B;  4DR3 M;  1QQW A;  4MM3 B;  1BVS A;  2Z4S A;  3L25 A;  4G4Q A;  2R45 A;  2X8A A;  2O25 A;  3L28 A;  2Y0T A;  4LF6 M;  1XNQ M;  4OVZ A;  1DGF A;  5EP3 A;  2XLJ A;  1G4A E;  1DO0 A;  5BR8 M;  1Z5C A;  2F4V M;  3IG8 A;  3W0L B;  5KQ8 A;  2FNA A;  1EE8 A;  1G59 A;  4DR4 M;  3GLF B;  4FD2 A;  4KT0 F;  1R6B X;  4FVM A;  3FTF A;  2D7H A;  2X49 A;  4LJ6 A;  3TQS A;  1KSF X;  3J7B A;  2K0B X;  3E21 A;  1TH4 A;  3TE6 A;  1XMO M;  4Q7J A;  3EIE A;  2C5R A;  3GRV A;  2K9D A;  3LCU A;  3VLF B;  5LMU M;  4GC5 A;  3GLH A;  2L4F A;  3HHZ A;  2KA6 B;  3A45 A;  1ZQ9 A;  3U6Q A;  4LZJ A;  4OU7 A;  2Q2E B;  1IXS B;  1T43 A;  4NL4 H;  4GIT A;  2ZAM A;  2DNA A;  2DKL A;  3LQQ A;  3A46 A;  3M6A A;  2Z4R A;  4I5S A;  3KW6 A;  3FRH A;  3GPY A;  3IG5 A;  1Z6T A;  1HQY E;  3D8L A;  2HHH M;  4DV5 M;  1G3I A;  2FS1 A;  2QHO B;  3CGW A;  4IBD A;  1IBK M;  3PVS A;  3E46 A;  1WXQ A;  3PNY A;  2R4E A;  3VK7 A;  3ZQJ A;  3AFH A;  4JYA M;  4QHS A;  4AI6 A;  3I51 A;  1IXR C;  4QNR A;  3GLI E;  2B3T A;  3A42 A;  2GQF A;  2LVA A;  2R0I A;  4B7H A;  2JP7 A;  4G4R A;  3TWM A;  3UJN A;  4LF4 M;  1QUS A;  4D81 A;  5E26 A;  3HU2 A;  2XFT A;  3SMP A;  2JA2 A;  4RNA A;  2LTU A;  4JXJ A;  1Z5A A;  2R6F A;  1PJT A;  2MJ5 B;  4GKK M;  2CHQ A;  4FWH A;  1N75 A;  5FTK A;  2KDL A;  4OVZ B;  3RGP A;  3GPU A;  1HNX M;  3RGS A;  4NOO B;  1NHW C;  2G8L A;  1NV8 A;  3FE3 A;  1TF0 B;  2EKK A;  2LVQ D;  3ZH9 B;  4DV1 M;  3SAR A;  1IQP A;  1ZMV A;  2J5Y A;  4ANR A;  2CUZ A;  4A3V B;  2BWB A;  4MGY E;  3T1H M;  4IBC A;  2R44 A;  4GHA A;  3C9P A;  3KSJ A;  3JR5 A;  4DV2 M;  2DWZ B;  2MR9 A;  2X4A A;  3AOE C;  4JI0 M;  3GLH B;  4G4N A;  4G6Z A;  3BXW A;  4PD2 A;  2ZAO A;  5DNY A;  2CV0 A;  4QHT A;  4EIW A;  4JI7 M;  2KW0 A;  1IXZ A;  3PNV A;  4MGI E;  3HU3 A;  2V1U A;  1HJP A;  3DFZ A;  2OOA A;  2V6Z M;  2WZJ A;  3J27 B;  3SAW A;  2G5G X;  4XK8 F;  4IIW A;  3FD9 A;  1PJS A;  1WHC A;  3GQ3 A;  5ITQ A;  2FE8 A;  1DV0 A;  2K6B A;  1NY6 A;  1MX0 A;  3QWL A;  4FWG A;  2HKJ A;  1OIZ A;  2M5Z A;  1IN8 A;  4G4O A;  2DWM A;  3FTC A;  4ITQ A;  4D82 A;  5EP1 A;  2CP8 A;  2JZ0 A;  2R18 A;  3M0E A;  1PJJ A;  4R3D A;  1Q02 A;  2R62 A;  1IN6 A;  1IBL M;  4GKJ M;  2LHC A;  2RRU A;  2FH0 A;  2KZU A;  2XFS A;  3LMM A;  4B3R M;  5H37 D;  4G3O A;  2ZM6 M;  2LXE A;  5DFL A;  3LVW A;  1G8P A;  3JAM S;  3OTO M;  3EIH A;  3J7A S;  2H1R A;  5EP2 A;  2C9O A;  3B9P A;  2YNM D;  3GLI A;  2EJS A;  3DZD A;  3GO8 A;  2DEN A;  2LWX A;  4NRV A;  4GIP A;  1IN5 A;  4WW0 A;  4F1I A;  3J80 S;  1G41 A;  2HCB A;  1IY2 A;  2R65 A;  5JI2 E;  3U5Z A;  5EXP A;  1V33 A;  2QBY A;  1GLN A;  1ZV1 A;  4IBG A;  4DBG B;  2J7N A;  1L2D A;  3BBZ A;  1IN4 A;  4LJ8 A;  2VII A;  1Z59 A;  3GQ5 A;  1VEJ A;  3L26 A;  3IEC A;  4CIS A;  1NHG C;  4QOZ C;  2VQE M;  1K3X A;  4LCB A;  2DZO B;  2QCU A;  3GRR A;  4MH0 E;  8CAT A;  4DV6 M;  1NO1 A;  3QAU A;  1GL7 A;  2M60 A;  1YSY A;  3F92 A;  2XEP A;  4P17 A;  1EFU B;  1CUK A;  2G3Q A;  3E9S A;  1L1T A;  1UM8 A;  1C7Y A;  2YFQ A;  2JXN A;  1QAM A;  2P5T A;  4CGY B;  1Q3B A;  4HL4 A;  4K0K M;  3LVV A;  3RFW A;  2CE7 A;  1N78 A;  1GO5 A;  1T6O A;  1A5T A;  4X66 M;  3R9X B;  3E4R A;  3TWL A;  4X64 M;  3SYK A;  2Z3X A;  4JI2 M;  4GC9 A;  1I4W A;  3B7Z A;  3K9O A;  1AIP C;  3FRI A;  4DR2 M;  1J09 A;  3K2L A;  2EUC A;  4JI8 M;  7CAT A;  3FUX A;  1TDH A;  4NXM M;  1TTE A;  3K8Z A;  4F2L A;  2KRK A;  2JNH A;  1ZAE A;  1OKS A;  3TPZ A;  4REZ A;  2YR0 A;  2CHV A;  3C3D A;  1SXJ E;  1OJL A;  4S12 A;  2XGN A;  4JI3 M;  1E9R A;  4AW4 A;  2VF7 A;  2HAK A;  3SAU A;  4AQY M;  3GLI B;  4AKG A;  4X65 M;  2DWL A;  4RF0 A;  1MU5 A;  1HR0 M;  1EIJ A;  3MK6 A;  1KYI A;  1LV7 A;  2YQZ A;  5ITU A;  1NNU C;  2QZ4 A;  4DR1 M;  2Y21 A;  1VEG A;  1R5L A;  4WUR A;  5BPV A;  2RGO A;  4LFB M;  2JY7 A;  5C1B A;  1XWI A;  2CV2 A;  1L1Z A;  3U5Z B;  5EXT A;  5EJC A;  3FYD A;  3A98 B;  5EXX A;  1QAN A;  2QBY B;  1WGN A;  1N33 M;  3U60 A;  4LJA A;  2QP9 X;  4LJ5 A;  5JI3 E;  3FUU A;  4FWD A;  3M7G A;  1YE9 A;  3J81 S;  5IT9 S;  4M9X A;  3C58 A;  2AHM A;  2N35 A;  3HHW A;  4OX9 M;  2DZL A;  3I01 M;  3KFU G;  4B3M M;  2KXE A;  2OQ4 A;  4W5W A;  2LBC A;  2LVN C;  3K1J A;  1WR1 B;  3HJ8 A;  3U6P A;  1OAI A;  1GJT A;  3ILK A;  3FUV A;  1IM2 A;  3W68 A;  1SXJ D;  5F3W A;  4L78 A;  2WSF F;  3L27 A;  4IBK A;  1KFV A;  2DAI A;  1GAB A;  2XZF A;  3W67 A;  1XB2 B;  2MGW A;  3B74 A;  4JI4 M;  2I7P A;  1QZM A;  2H5X A;  3AOE A;  5L8R F;  1XMQ M;  4PDI A;  1L2C A;  4FCT A;  2XZU A;  3SAS A;  1QAQ A;  4FCW A;  4IBB A;  5A2Q S;  3JR4 A;  1W5T A;  3GRU A;  4M0W A;  4XBO A;  3GP1 A;  1DGG A;  4P16 A;  4GRI A;  3HZJ A;  3KOW E;  4NC6 A;  2DXI A;  4IBF A;  5E6J A;  3KSX A;  4CIZ A;  4I8O A;  1VG5 A;  2DVW B;  1OIP A;  4IJE A;  2O01 F;  4NSO B;  3T1Y M;  1SXJ A;  2XH9 A;  2APL A;  1MJG M;  1OFI A;  3HJS A;  3SFZ A;  1GJS A;  2UUB M;  4L8R C;  3U6M A;  4JV5 M;  3L29 A;  1Q3C A;  2OO9 A;  3VKG A;  5FTL A;  2F5S A;  3U60 B;  2UXC M;  2JWS A;  5ITR A;  2WSE F;  5LMN M;  2MH8 A;  3HU1 A;  3I04 M;  4IBJ A;  1NVM A;  3HKP A;  3I4Y A;  4KOD A;  2KNZ A;  3KOY E;  4B08 A;  3T6P A;  4CHT B;  1IY0 A;  1DGH A;  1GVN A;  3SYL A;  3VDP A;  1XXH E;  1IY1 A;  3B7Q A;  3SHF A;  4NXN M;  1K82 A;  1P3Q Q;  1TH2 A;  2O5R A;  5IRE B;  1TR8 A;  3W0F A;  1V34 A;  2DAE A;  2UUC M;  2XSZ D;  3UZU A;  1R2Z A;  3H4M A;  4AG5 A;  4DR7 M;  4L4U A;  2DAM A;  4PT5 A;  4CJ6 A;  4LFA M;  4LG2 A;  1AUA A;  2FOI C;  1N32 M;  1JB0 F;  3VK8 A;  2E5L M;  2DAG A;  2KNV A;  4KLN A;  1YUB A;  5GKN A;  3QYE A;  2L4E A;  4Z6Y A;  4KHP M;  1DGB A;  1ORY B;  3LW5 F;  4ZPX A;  2ZBK B;  2MRO B;  2Z7J A;  4R7G A;  4M9Z A;  1FJG M;  2F5Q A;  3KP0 E;  2LVO C;  2FFJ A;  5IZ7 D;  4MB7 A;  2BJW A;  1WIV A;  5C18 A;  4GMQ A;  4BBA A;  2J7O A;  3U6O A;  1K3W A;  3KVW A;  2EO2 A;  3PFI A;  1J7K A;  1SG9 A;  5FLX S;  3LCV B;  2XSZ A;  3K92 A;  3NWL A;  4B3T M;  1PM5 A;  4AKH A;  4DV4 M;  3PXG A;  2L6O A;  3AKZ A;  1D2N A;  1NJG A;  1IFY A;  4LFC M;  4II7 A;  3CF0 A;  1D0K A;  3HGI A;  1GL6 A;  2L2D A;  2Y20 A;  2KNA A;  4Z8X A;  3T15 A;  1OAO C;  3R8F A;  3U6L A;  3HY5 A;  1F4I A;  1HNW M;  4IBI A;  4M0D A;  5DYI A;  1XHB A;  5ITX A;  1VDD A;  3TL4 X;  4DV7 M;  1SXJ B;  3DA1 A;  2RGH A;  4JN6 A;  3Q8G A;  3AOG A;  3CF2 A;  5KPT A;  3KS8 A;  1QAO A;  4KO8 A;  1OQY A;  2DI0 A;  1L8Q A;  1NV9 A;  5KO3 A;  4JI6 M;  4AZF A;  4B7F A;  3VDU A;  2KEB A;  4FCV A;  1N77 A;  4HLQ A;  4LJ9 A;  2CV1 A;  3HHY A;  3THG A;  3HX3 A;  3B7N A;  4FW9 A;  4LRT A;  3SAV A;  2QEN A;  1TGU A;  1R2Y A;  3FUT A;  2DAK A;  3CTW B;  1PJI A;  4I4L A;  1DGH B;  1W5S A;  2WSC F;  1JR3 E;  1X37 A;  3KDS E;  4AG6 A;  1E32 A;  3UMM A;  3CF6 E;  3SAT A;  1J5E M;  4NRW A;  3FUW A;  4JI1 M;  2W82 A;  3SMS A;  4JI5 M;  4PDG A;  2DZN B;  1XXH A;  1I94 M;  3NBX X;  4M9S A;  2KHH A;  4L16 A;  1E94 E;  4YY3 M;  3MMP A;  4DUZ M;  2UXB M;  4WP2 A;  2JY8 A;  4IJF A;  4RKU F;  3MJ5 A;  4DV0 M;  3ZCB B; 
#chains in the Genus database with same CATH homology
 3AL0 C;  3FKE A;  3U61 A;  4GHL A;  3HJQ A;  1HT1 E;  4YHH M;  3U6S A;  3HWS A;  3TWK A;  1IBM M;  2F5P A;  1L2B A;  4L15 A;  1Z5B A;  5FTM A;  4QNM A;  3GLG A;  4IBE A;  2K47 A;  2L09 A;  5DYG A;  1QYR A;  5KPR A;  3I4V A;  5EQT A;  1JR3 D;  2QPA A;  1JQJ C;  1Q39 A;  4LF9 M;  1H6U A;  3U6E A;  2CEA A;  4MGK E;  5EXS A;  3VFD A;  2I7N A;  2C96 A;  1TH3 A;  1NSF A;  3KP1 E;  4LGM A;  3Q8X A;  4MGH A;  5ITX E;  5EP4 A;  3KOZ E;  4BLC A;  4I81 A;  3U6D A;  5FTJ A;  1HQC A;  4LRS A;  3GPX A;  2BNK A;  4LGY A;  1OFH A;  2V1C A;  2L7H A;  3WHL A;  4B7G A;  4GH9 A;  4NSR A;  2A5Y B;  4XGI A;  1JR3 A;  1TDZ A;  1XXH B;  1XC8 A;  4QOS A;  2C99 A;  2LH0 A;  3MHV C;  3FTD A;  1T3T A;  4DUY M;  2UU9 M;  3L2A A;  4LZZ A;  3BOS A;  4B3S M;  2UUA M;  4LF5 M;  2KRU A;  2C98 A;  4PCZ A;  3U61 B;  5FTN A;  1IN7 A;  1GKI A;  1NJF A;  2CFO A;  3UGJ A;  3SHG B;  2NQ8 C;  3GLG B;  2R46 A;  4D80 A;  1HNZ M;  4RF1 A;  3WHK A;  2D7G A;  3RE8 A;  2UXD M;  5ITY A;  4MGZ E;  3D8B A;  3T38 A;  1N34 M;  4AKI A;  4LF8 M;  1SXJ C;  3UK6 A;  1R7R A;  3GLF A;  4DR6 M;  3J2P B;  1NY5 A;  1E9S A;  3NBI A;  5IWA M;  4LY6 A;  3SC3 A;  3GPP A;  3DOA A;  2CHG A;  4LF7 M;  2HL7 A;  2XF3 A;  2ERC A;  4TUW A;  5FSW A;  1QVR A;  1DO2 A;  2C9C A;  2RKO A;  3FYC A;  3LQR A;  5ITT A;  2EA0 A;  1NNJ A;  3U6C A;  2D7E A;  4DR5 M;  4LJ7 A;  5KPZ A;  3AJI B;  2F5N A;  2DWN A;  2F5O A;  3AV0 A;  1N36 M;  3KOX E;  3FTE A;  2L7I A;  2KZS A;  1HT2 E;  2DHR A;  3KXE C;  3HHX A;  4X62 M;  2OPF A;  5KQD A;  1S3S A;  3GRY A;  2Y0Q A;  2VQF M;  3SBJ A;  4LJ4 A;  4OW0 A;  1FNN A;  3GQ4 A;  2ZAN A;  2LNH C;  2BJV A;  1C1K A;  2R4J A;  1XNR M;  3KS4 A;  3ZC7 B;  4DR3 M;  1QQW A;  4MM3 B;  2Z4S A;  3L25 A;  4G4Q A;  2R45 A;  2X8A A;  3L28 A;  2Y0T A;  4LF6 M;  1XNQ M;  4OVZ A;  1DGF A;  5EP3 A;  2XLJ A;  1G4A E;  1DO0 A;  5BR8 M;  1Z5C A;  2F4V M;  3IG8 A;  3W0L B;  5KQ8 A;  2FNA A;  1EE8 A;  1G59 A;  4DR4 M;  3GLF B;  4FD2 A;  1R6B X;  4FVM A;  3FTF A;  2D7H A;  2X49 A;  4LJ6 A;  3TQS A;  1KSF X;  3J7B A;  1TH4 A;  3TE6 A;  1XMO M;  3EIE A;  2C5R A;  3GRV A;  3VLF B;  5LMU M;  4GC5 A;  3GLH A;  3HHZ A;  2KA6 B;  3A45 A;  1ZQ9 A;  3U6Q A;  4LZJ A;  4OU7 A;  2Q2E B;  1IXS B;  4NL4 H;  4GIT A;  2ZAM A;  3LQQ A;  3A46 A;  3M6A A;  2Z4R A;  4I5S A;  3KW6 A;  3GPY A;  3IG5 A;  1Z6T A;  1HQY E;  3D8L A;  2HHH M;  4DV5 M;  1G3I A;  4IBD A;  1IBK M;  3PVS A;  3PNY A;  1WXQ A;  3VK7 A;  2R4E A;  3AFH A;  4JYA M;  4QHS A;  4AI6 A;  3I51 A;  1IXR C;  4QNR A;  3A42 A;  4B7H A;  3TWM A;  4G4R A;  3UJN A;  4LF4 M;  4D81 A;  5E26 A;  3HU2 A;  2XFT A;  3SMP A;  2JA2 A;  4RNA A;  4JXJ A;  1Z5A A;  4GKK M;  2CHQ A;  4FWH A;  1N75 A;  5FTK A;  4OVZ B;  3RGP A;  3GPU A;  1HNX M;  3RGS A;  4NOO B;  1NHW C;  2G8L A;  3ZH9 B;  4DV1 M;  3SAR A;  1IQP A;  2CUZ A;  4A3V B;  4MGY E;  3T1H M;  4IBC A;  4GHA A;  3KSJ A;  3JR5 A;  4DV2 M;  2DWZ B;  2X4A A;  3AOE C;  4G4N A;  4JI0 M;  3GLH B;  4G6Z A;  4PD2 A;  5DNY A;  2ZAO A;  2CV0 A;  4JI7 M;  4QHT A;  4EIW A;  2KW0 A;  1IXZ A;  3PNV A;  4MGI E;  3HU3 A;  2V1U A;  3DFZ A;  2V6Z M;  3J27 B;  3SAW A;  2G5G X;  4IIW A;  3FD9 A;  3GQ3 A;  5ITQ A;  2FE8 A;  1NY6 A;  1MX0 A;  3QWL A;  4FWG A;  2HKJ A;  2M5Z A;  4G4O A;  1IN8 A;  2DWM A;  4ITQ A;  3FTC A;  4D82 A;  5EP1 A;  2R18 A;  3M0E A;  1PJJ A;  4R3D A;  2R62 A;  1IN6 A;  1IBL M;  4GKJ M;  2KZU A;  2XFS A;  3LMM A;  4B3R M;  5H37 D;  2ZM6 M;  2LXE A;  3LVW A;  1G8P A;  3JAM S;  3OTO M;  3EIH A;  3J7A S;  2H1R A;  5EP2 A;  2C9O A;  3B9P A;  2YNM D;  3GLI A;  3DZD A;  3GO8 A;  2LWX A;  4NRV A;  4GIP A;  1IN5 A;  4WW0 A;  3J80 S;  1G41 A;  2HCB A;  1IY2 A;  2R65 A;  5JI2 E;  3U5Z A;  5EXP A;  2QBY A;  1GLN A;  4IBG A;  2J7N A;  1L2D A;  4LJ8 A;  1IN4 A;  2VII A;  1Z59 A;  3GQ5 A;  3L26 A;  4CIS A;  4QOZ C;  1NHG C;  2VQE M;  1K3X A;  4LCB A;  2DZO B;  2QCU A;  3GRR A;  4MH0 E;  8CAT A;  4DV6 M;  3QAU A;  1GL7 A;  2M60 A;  1YSY A;  2XEP A;  3E9S A;  1L1T A;  1UM8 A;  2YFQ A;  1QAM A;  2P5T A;  4CGY B;  1Q3B A;  4HL4 A;  4K0K M;  3LVV A;  3RFW A;  2CE7 A;  1N78 A;  4X66 M;  3R9X B;  3E4R A;  3TWL A;  4X64 M;  3SYK A;  2Z3X A;  4JI2 M;  4GC9 A;  1I4W A;  4DR2 M;  1J09 A;  3K2L A;  2EUC A;  4JI8 M;  7CAT A;  3FUX A;  1TDH A;  4NXM M;  3K8Z A;  2KRK A;  3TPZ A;  1ZAE A;  4REZ A;  2YR0 A;  2CHV A;  1SXJ E;  1OJL A;  4S12 A;  2XGN A;  4JI3 M;  1E9R A;  4AW4 A;  3SAU A;  4AKG A;  4AQY M;  3GLI B;  4X65 M;  2DWL A;  4RF0 A;  1MU5 A;  1HR0 M;  3MK6 A;  1KYI A;  1LV7 A;  2YQZ A;  5ITU A;  1NNU C;  2QZ4 A;  4DR1 M;  2Y21 A;  4WUR A;  5BPV A;  2RGO A;  4LFB M;  5C1B A;  1XWI A;  2CV2 A;  1L1Z A;  3U5Z B;  5EXT A;  5EJC A;  3FYD A;  3A98 B;  5EXX A;  1QAN A;  2QBY B;  1N33 M;  3U60 A;  4LJA A;  2QP9 X;  4LJ5 A;  5JI3 E;  3FUU A;  4FWD A;  3M7G A;  1YE9 A;  3J81 S;  5IT9 S;  4M9X A;  3C58 A;  2AHM A;  4OX9 M;  3HHW A;  3KFU G;  4B3M M;  2KXE A;  2OQ4 A;  4W5W A;  3K1J A;  3HJ8 A;  3U6P A;  3ILK A;  3FUV A;  1IM2 A;  1SXJ D;  5F3W A;  4L78 A;  3L27 A;  4IBK A;  1KFV A;  2XZF A;  4JI4 M;  2I7P A;  1QZM A;  3AOE A;  1XMQ M;  4PDI A;  1L2C A;  4FCT A;  2XZU A;  3SAS A;  1QAQ A;  4FCW A;  4IBB A;  5A2Q S;  3JR4 A;  1W5T A;  3GRU A;  4M0W A;  4XBO A;  3GP1 A;  1DGG A;  4P16 A;  4GRI A;  3KOW E;  2DXI A;  4IBF A;  5E6J A;  3KSX A;  4I8O A;  2DVW B;  4IJE A;  3T1Y M;  4NSO B;  1SXJ A;  2XH9 A;  1OFI A;  3HJS A;  3SFZ A;  2UUB M;  4L8R C;  3U6M A;  4JV5 M;  3L29 A;  1Q3C A;  3VKG A;  5FTL A;  2F5S A;  3U60 B;  2UXC M;  5ITR A;  3HU1 A;  4BB9 A;  4IBJ A;  4KOD A;  1NVM A;  3HKP A;  3I4Y A;  4B08 A;  3KOY E;  4DV3 M;  4CHT B;  1IY0 A;  1DGH A;  1GVN A;  3SYL A;  3VDP A;  1IY1 A;  3SHF A;  4NXN M;  1K82 A;  1TH2 A;  5IRE B;  2O5R A;  3W0F A;  2UUC M;  2XSZ D;  3UZU A;  1R2Z A;  3H4M A;  4AG5 A;  4DR7 M;  4L4U A;  4PT5 A;  4LFA M;  4LG2 A;  2FOI C;  1N32 M;  3VK8 A;  2E5L M;  4KLN A;  1YUB A;  5GKN A;  4Z6Y A;  4KHP M;  1DGB A;  1ORY B;  4ZPX A;  2ZBK B;  2Z7J A;  4R7G A;  4M9Z A;  1FJG M;  2F5Q A;  3KP0 E;  2FFJ A;  5IZ7 D;  4MB7 A;  2BJW A;  5C18 A;  4GMQ A;  4BBA A;  2J7O A;  3U6O A;  1K3W A;  3KVW A;  2EO2 A;  3PFI A;  1J7K A;  5FLX S;  2XSZ A;  3K92 A;  3NWL A;  4B3T M;  1PM5 A;  4AKH A;  4DV4 M;  3PXG A;  2L6O A;  3AKZ A;  1D2N A;  1NJG A;  4LFC M;  4II7 A;  3CF0 A;  3HGI A;  3T15 A;  1GL6 A;  2Y20 A;  4Z8X A;  3R8F A;  3VKH A;  3U6L A;  1HNW M;  4IBI A;  4M0D A;  5DYI A;  1XHB A;  5ITX A;  1VDD A;  3TL4 X;  4DV7 M;  1SXJ B;  3DA1 A;  2RGH A;  4JN6 A;  3AOG A;  3CF2 A;  5KPT A;  3KS8 A;  1QAO A;  4KO8 A;  1L8Q A;  5KO3 A;  4JI6 M;  4AZF A;  4B7F A;  3VDU A;  2KEB A;  4FCV A;  1N77 A;  4HLQ A;  4LJ9 A;  2CV1 A;  3HHY A;  3THG A;  4FW9 A;  4LRT A;  3SAV A;  2QEN A;  1TGU A;  1R2Y A;  3FUT A;  3CTW B;  1PJI A;  4I4L A;  1DGH B;  1W5S A;  1X37 A;  3KDS E;  4AG6 A;  1E32 A;  3UMM A;  3CF6 E;  3SAT A;  1J5E M;  4NRW A;  3FUW A;  4JI1 M;  2W82 A;  3SMS A;  4JI5 M;  4PDG A;  2DZN B;  1XXH A;  1I94 M;  4M9S A;  4L16 A;  1E94 E;  4YY3 M;  4DUZ M;  2UXB M;  4IJF A;  5LMN M;  3MJ5 A;  4DV0 M;  3ZCB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...