1R4GA

Solution structure of the sendai virus protein x c-subdomain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
KPTMHSLRLVIESSPLSRAEKAAYVKSLSKCKTDQEVKAVMELVEEDIESLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase alpha subunit
publication title Structure and dynamics of the nucleocapsid-binding domain of the Sendai virus phosphoprotein in solution
pubmed doi rcsb
source organism Sendai virus (strain harris)
molecule tags Viral protein, transferase
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1r4gA00
3F92A 1XXHE 3GLHE 2CP8A 2WZJA 2MJ5B 2LVOC 4GEWA 1A5TA 5DFLA 5JI2E 2KNAA 2OOBA 1WGLA 1DV0A 1HJPA 3B89A 1T43A 1T6OA 1ZMUA 2K9DA 1OAIA 1HQYE 2LBCA 3FE3A 1OKSA 2L4FA 1XB2B 3FRIA 2G3QA 2CWBA 1WGNA 1C7YA 1R4GA 1OQYA 3LCUA 1TTEA 3IECA 1GO5A 2JY6B 2LVAA 1BVSA 1Y8GA 1WHCA 2DENA 3FRHA 1IM2A 2H5XA 1OTRA 1F4IA 3GLGE 1UFZA 3K9OA 1WR1B 2KHHA 2KNZA 4HEOA 2RRUA 2JP7A 4DBGB 1IXSA 1VQ1A 1KYIA 2DKLA 2LVPC 1MN3A 1HT1E 2L4EA 1G4AE 1JR3E 3MMPA 1Q02A 1TR8A 2QSFX 4G3OA 4F1IA 3E46A 2DAMA 1WIVA 3H4JA 2DAEA 3LCVB 1WJ7A 1YLAA 2EKFA 2QHOB 1NV9A 3GLIE 2DAGA 2JNHA 2JZ0A 2MR9A 3IHPA 2O25A 1G3IA 1HT2E 2HWJA 1DO2A 2QNJA 1G41A 4Q7JA 2R0IA 2K0BX 2DAIA 4F2LA 2BWEA 1AIPC 2JZ1A 4R71A 1E94E 1NV8A 1SG9A 2JUJA 2ZTDA 3BBZA 1V92A 2DNAA 1VG5A 2MROB 1PGYA 1ZMWA 2LVQD 2LTUA 1IFYA 1ZMVA 2B3TA 3GLFE 4WP2A 2EKKA 2DAKA 2OO9A 3T6PA 1CUKA 2EJSA 2HAKA 1P3QQ 2OOAA 3E21A 1VDLA 2LVNC 2L2DA 3K9PA 1VEGA 1ZV1A 2ZTCA 2JY5A 1VEKA 2KNVA 1DO0A 1VEJA 2DI0A 2DHYA 1EFUB 2BWBA 2JY8A 1QZEA 2MGWA 4UN2B 2DZLA 2JY7A
chains in the Genus database with same CATH superfamily
1N75A 1XXHE 2KA6B 5EP1A 2VQFM 1GL6A 4GEWA 4OVZA 1OFHA 1I94M 3GLHA 2KNAA 5JI2E 2OOBA 3B89A 4GKJM 4DV1M 1T43A 1IXRC 1N33M 4JXJA 2Z4RA 4LJ8A 1YE9A 3A45A 4II7A 5FTMA 2K9DA 4I81A 5L8RF 4LFCM 1EIJA 2R18A 5ITQA 3VDPA 3FE3A 3HHYA 3HX3A 1XWIA 3GQ5A 2OPFA 1E9SA 2Q2EB 1C7YA 1R4GA 3VK8A 3LCUA 1IBMM 3IECA 2C98A 2ZAOA 5ITTA 1PJIA 3CF2A 3HY5A 4L4UA 4G6ZA 2LXEA 4BLCA 2JWSA 2KZSA 1WHCA 5EQTA 2DENA 2W82A 2X8AA 1OTRA 3KOYE 2XF3A 2KDLA 5H37D 1IXZA 5F3WA 2CHGA 4S12A 1NY5A 4L6V6 1YSYA 3SAUA 4MH0E 3GLGA 4GIPA 1UM8A 2ZANA 1TDZA 4HEOA 4LJ7A 2R46A 3T38A 4DUZM 3MK6A 3HU2A 3I51A 3SARA 1HT1E 1GLNA 1Q3CA 3EIEA 2L6OA 4CISA 3KSJA 2F5QA 1Z5BA 4IBGA 3DA1A 2QZ4A 4LY6A 5KQ8A 3E9SA 1TR8A 4LGYA 2JA2A 2DHRA 4G3OA 3U5ZA 1XMQM 1H6UA 4F1IA 4DV4M 2QBYB 3SMSA 4D82A 1PM5A 5KPTA 3KOXE 5EP2A 2DVWB 2FNAA 2CV1A 4GHLA 1L2BA 2EKFA 2F5OA 3UK6A 1V33A 3K1JA 3B9PA 2JNHA 3U61B 3SHGB 2APLA 5C18A 3K92A 1D0LA 3A42A 4LF6M 2QPAA 1NJGA 3K8ZA 1SXJE 2I7PA 2K0BX 2DAIA 5EP4A 2VF7A 3KOWE 1D2NA 2BWEA 2L7HA 4RKUF 3SFZA 4IBJA 4JYAM 1IBLM 1E32A 1R6BX 3SYKA 1T3TA 1DGHB 1KSFX 2C9OA 5FTNA 3TE6A 4R7GA 3BBZA 3FUWA 3GPXA 4CIZA 5FTLA 1PGYA 4PT5A 2KXEA 2LVQD 1HQCA 1IFYA 3HGIA 1L1TA 3THGA 4NXNM 4G4NA 2LWXA 4WP2A 4DR7M 2ZAMA 1IQPA 3UZUA 3I4VA 3AOGA 3M7GA 3T6PA 5ITRA 2DXIA 2KW0A 2RGOA 3HU1A 1P3QQ 4BB9A 3FUTA 4R3DA 5IT9S 4X66M 2D7HA 3E21A 2LVNC 4FCTA 3K9PA 1GABA 2ZTCA 3AJIB 1TH4A 3HHXA 4GC9A 2BNKA 2CE7A 2KNVA 1DO0A 2NQ8C 2Y0TA 4LJ6A 4LFAM 4I4LA 2QBYA 4JI3M 1DGBA 1EFUB 2BWBA 2MGWA 3FTDA 4UN2B 3GPPA 2E5LM 4G4QA 2DZLA 3U6OA 2RGHA 2CP8A 2WZJA 2MJ5B 4GRIA 5DYIA 4M9SA 2GNOA 2Z7JA 3LW5F 3U61A 4FWDA 4JI4M 4LF7M 4GKKM 3SHFA 4EIWA 8CATA 1WGLA 2G8LA 1HJPA 3KW6A 3J81S 4DV3M 3U6PA 4JI1M 3SBJA 1MU5A 2OQ4A 1T6OA 3GO8A 1OAOC 3SAVA 2VF8A 3CF6E 1OAIA 1HQYE 4LRSA 1OKSA 3LQRA 1HNZM 3L29A 3FRIA 3L27A 2G3QA 1G8PA 5FTKA 1WGNA 1DGHA 2CHVA 4KO8A 1GVNA 3U6EA 3W0LB 1TTEA 4IBKA 1SXJB 3ZH9B 3T1HM 3H4MA 2HL7A 4Z6YA 3NBXX 1XHBA 3K2LA 3C58A 4B3SM 1QZMA 3CGWA 3Q8GA 2R65A 2HCBA 3M6AA 3SASA 3A46A 2M60A 1QUSA 1F4IA 2XFTA 1NY6A 2QENA 3I01M 2XEPA 1NVMA 2O5RA 3C3EA 2HKJA 4NSRA 1Q39A 2CV2A 1JR3D 2KHHA 4DR1M 2JP7A 4DBGB 4PDIA 2XFSA 2DZOB 4JI2M 3HHWA 1VQ1A 2G5GX 2DKLA 2BJVA 4P17A 4PD2A 3AFHA 2XGNA 1MN3A 2Z3XA 2C9CA 3NWLA 1L1ZA 1FNNA 2VDBB 3AOEA 1IY2A 2KEBA 1IN8A 1PJQA 3JR5A 5GKNA 3E4RA 2XH9A 2Z8YM 2N35A 4NXMM 3E46A 4M9XA 2R4EA 4LF5M 4LJ4A 1V34A 3LCVB 1W5SA 1Z59A 4B7GA 3UJNA 3R9XB 4X64M 4KHPM 3B7QA 1N34M 1NV9A 3GPUA 4QNRA 4PCZA 2R62A 2MR9A 3GQ3A 1K82A 4DV7M 4P16A 1RU3A 1J7KA 2QCUA 2C96A 3QWLA 2ZBKB 1G3IA 1X37A 1HT2E 4LGMA 3U6SA 4GMQA 3BOSA 1OIPA 4YY3M 2QNJA 1G41A 4F2LA 2R0IA 4Z8XA 4CJ6A 1QANA 1NHWC 4GH9A 5FSWA 4B3RM 4M9ZA 4NRVA 4R71A 1SXJA 1E94E 4MGHA 3HU3A 3PXGA 2JUJA 5EXTA 2F5SA 2DWMA 3CF0A 5BR8M 1PJJA 4LF4M 1VG5A 2RKOA 1QQWA 1WXQA 4LJAA 4AG6A 1ZMVA 4M0DA 3LQQA 1GJTA 4LF9M 3GPYA 4LF8M 2OO9A 5EJCA 1N78A 5KO3A 1TH3A 2J7NA 2L09A 2EO2A 1JB0F 3A98B 2EJSA 4RF0A 2YNMD 4MB7A 3GP1A 4LG2A 2KZUA 2OOAA 3R8FA 3QYEA 2O01F 3EIHA 4XK8F 3PNYA 5BPVA 4IBBA 1IXSB 3C3DA 4B7FA 4AKHA 1N77A 1NJFA 4IIWA 4WW0A 1OFIA 2JY5A 3QAUA 4GC5A 3FYCA 4DV2M 2M5ZA 2F5PA 5A2QS 4QOZC 5EXSA 3KFUG 4NL4H 4QHSA 5KQDA 4G4OA 3FUVA 4FW9A 2JY7A 3GRUA 3FKEA 4CHTB 1IBKM 3KVWA 2LVOC 3LVVA 2XLJA 1IY1A 1A5TA 3TWLA 5DFLA 5KPZA 1NSFA 3IG5A 1QVRA 1K3XA 4DV0M 2WSFF 1Z5CA 3KS4A 1GKIA 4LFBM 3SC3A 2A5YB 1ZMUA 1FJGM 2LBCA 4IJFA 5KPRA 2L4FA 1XB2B 3W67A 3W68A 3DFZA 1D0MA 3U60B 4DV6M 2CWBA 2X4AA 3L25A 2EUCA 1IN4A 1MX0A 4AKGA 1OQYA 3I4YA 1QDTA 2R45A 4GITA 1N32M 1XMOM 4M0WA 4FWGA 4X62M 1L8QA 2JY6B 2LVAA 1BVSA 4AKIA 3FD9A 3L2AA 3RGSA 3TPZA 4B3TM 4MGIE 4L8RC 2H5XA 1DGGA 1SXJD 4KODA 2LNHC 4MGZE 1UFZA 2CFOA 3HJ8A 3ZCBB 4GHAA 1WR1B 4LZZA 5DNYA 4RF1A 4JN6A 3WHLA 4ITQA 7CATA 3KXEC 2KNZA 2LHCA 2RRUA 3U6CA 3Q8XA 2F4VM 1IXSA 2CRUA 2J5YA 3CTWB 3KOZE 1IY0A 3FUXA 3RGPA 2Y21A 3ZQJA 2F5NA 4A3VB 3T15A 4B7HA 4FCVA 2L4EA 5LMUM 1PJSA 1JR3E 2XSZA 4IBEA 2UXDM 2UUBM 1Q02A 2QSFX 1DGFA 4LJ5A 4QNMA 5DYGA 4OU7A 1Q3BA 4IBFA 2DAEA 2R6FA 3BXWA 3HZJA 3QYBA 2UUCM 1YLAA 2QQ8A 2Y0QA 3RFWA 5ITYA 4D80A 3TWMA 5ITXE 3FTCA 4XGIA 3GLIE 2DWLA 2DAGA 2JZ0A 3MHVC 1ZQ9A 4JI0M 3T1YM 4XBOA 2O25A 1R7RA 1XC8A 4REZA 3JR4A 4MGKE 2HWJA 1DO2A 2C5RA 5FLXS 3SATA 4Q7JA 3U60A 2HHHM 2EA0A 3KS8A 4OW0A 2XZUA 3JAMS 3GQ4A 1AIPC 4Y28F 4AG5A 1LV7A 4FWHA 1G71A 3B74A 2UXCM 3B7NA 4OX9M 3VKHA 3SYLA 1GJSA 2ERCA 2CEAA 3NBIA 2D7GA 4HL4A 1NO1A 2CV0A 1JQJC 2LTUA 2YR0A 2VQEM 5LMNM 4DUYM 3GLFE 1K3WA 3GRRA 4ANRA 3TWKA 3PNVA 1CUKA 3U6DA 3L28A 5JI3E 2HAKA 1KFVA 1XNRM 3LMMA 3ZC7B 3HHZA 4K0KM 3UGJA 2WSCF 3GRVA 5IZ7D 2L2DA 2L7IA 2KRKA 2D7EA 4AI6A 1ZV1A 2V1UA 1IN7A 3FUUA 4NRWA 1VEKA 4DR6M 3M0EA 1I4WA 3TQSA 4LRTA 1PJTA 3VKGA 1VEJA 4W5WA 1YUBA 2DI0A 2YQZA 2JY8A 1TF0B 4NC6A 4L16A 3F92A 3GLHE 4BBAA 1L2DA 4IBIA 2XSZD 1J09A 3VDUA 2UU9M 3FTFA 3AKZA 1GL7A 4LJ9A 4DR2M 1VDDA 1W5TA 2JXNA 2ZM6M 2K6BA 2DWNA 4L15A 1QYRA 1TH2A 4WURA 1DV0A 4CGYB 5C1BA 1R2ZA 2CUZA 2Y20A 4FCWA 1OJLA 3AV0A 4YHHM 1EE8A 3GLIB 3OTOM 4IJEA 4LZJA 1N36M 4JI6M 3FTEA 3WHKA 2FOIC 4D81A 1QDRA 4DR3M 1IN5A 3AL0C 4KLNA 2YFQA 5IREB 3J7AS 4QOSA 1GO5A 3AOEC 2AHMA 2H1RA 1Y8GA 4PDGA 4RNAA 3W0FA 3LVWA 2K47A 3KSXA 3FRHA 1IM2A 3J2PB 4L78A 2R4JA 2FFJA 3GLGE 1E9RA 1G59A 2MH8A 3K9OA 3PVSA 3RE8A 1XXHB 3DOAA 4AW4A 1HNWM 1NHGC 2LHGA 2X49A 3J27B 2UUAM 2V6ZM 3ILKA 2UXBM 4IBDA 2J7OA 3GLFB 1L2CA 2R44A 5E26A 3MJ5A 4ZPXA 3FYDA 1KYIA 1QAQA 2BJWA 2VIIA 2LVPC 4KT0F 4DR5M 3GRYA 2GQFA 2P5TA 2LH0A 4IBCA 4NSOB 4FD2A 1G4AE 1SXJC 1ORYB 3MMPA 5EP3A 1Z5AA 2FS1A 3HWSA 4AZFA 1PRBA 5IWAM 2C99A 3IG8A 3U6LA 1ZAEA 1JR3A 3D8LA 2DAMA 1WIVA 3B7ZA 3H4JA 1WJ7A 4MGYE 1NNUC 3HKPA 2QHOB 3TL4X 2I7NA 3IHPA 1XNQM 1TDHA 4OVZB 5EXPA 3GLHB 5E6JA 5ITXA 1D0KA 3L26A 3SAWA 4B08A 3GLIA 4TUWA 4I5SA 1R2YA 4I8OA 5FTJA 4QHTA 2CHQA 4G4RA 1HR0M 3KP0E 1TGUA 2JZ1A 2XZFA 1NV8A 2WSEF 3HJQA 4DV5M 1Z6TA 1SG9A 2ZTDA 3KDSE 1V92A 1NNJA 4MM3B 1HNXM 1MJGM 2DNAA 4FVMA 2MROB 4JI5M 3U6QA 4B3MM 3SMPA 1ZMWA 3DZDA 4NOOB 1LTMA 1XXHA 2B3TA 3D8BA 3U6MA 3KP1E 3J80S 3HJSA 1OIZA 3J7BA 2EKKA 2DAKA 5EXXA 4X65M 5ITUA 2DWZB 1J5EM 3GLFA 2V1CA 3GLGB 1C1KA 2KRUA 1QAOA 3I04M 1VDLA 3C9PA 2FE8A 2Z4SA 3VFDA 4DR4M 1VEGA 2FH0A 1IN6A 2QP9X 3UMMA 1R5LA 3VLFB 3V76A 1QUTA 4AQYM 3VK7A 3PFIA 1QAMA 1AUAA 2DZNB 4LCBA 4JV5M 1S3SA 2DHYA 4JI7M 3U5ZB 1QZEA 4JI8M 4HLQA
chains in the Genus database with same CATH topology
3F92A 1XXHE 3GLHE 2CP8A 2WZJA 2MJ5B 2LVOC 4GEWA 1A5TA 5DFLA 5JI2E 2KNAA 2OOBA 1WGLA 1DV0A 1HJPA 3B89A 1T43A 1T6OA 1ZMUA 2K9DA 1OAIA 1HQYE 2LBCA 3FE3A 1OKSA 2L4FA 1XB2B 3FRIA 2G3QA 2CWBA 1WGNA 1C7YA 1R4GA 1OQYA 3LCUA 1TTEA 3IECA 1GO5A 2JY6B 2LVAA 1BVSA 1Y8GA 1WHCA 2DENA 3FRHA 1IM2A 2H5XA 1OTRA 1F4IA 3GLGE 1UFZA 3K9OA 1WR1B 2KHHA 2KNZA 4HEOA 2RRUA 2JP7A 4DBGB 1IXSA 1VQ1A 1KYIA 2DKLA 2LVPC 1MN3A 1HT1E 2L4EA 1G4AE 1JR3E 3MMPA 1Q02A 1TR8A 2QSFX 4G3OA 4F1IA 3E46A 2DAMA 1WIVA 3H4JA 2DAEA 3LCVB 1WJ7A 1YLAA 2EKFA 2QHOB 1NV9A 3GLIE 2DAGA 2JNHA 2JZ0A 2MR9A 3IHPA 2O25A 1G3IA 1HT2E 2HWJA 1DO2A 2QNJA 1G41A 4Q7JA 2R0IA 2K0BX 2DAIA 4F2LA 2BWEA 1AIPC 2JZ1A 4R71A 1E94E 1NV8A 1SG9A 2JUJA 2ZTDA 3BBZA 1V92A 2DNAA 1VG5A 2MROB 1PGYA 1ZMWA 2LVQD 2LTUA 1IFYA 1ZMVA 2B3TA 3GLFE 4WP2A 2EKKA 2DAKA 2OO9A 3T6PA 1CUKA 2EJSA 2HAKA 1P3QQ 2OOAA 3E21A 1VDLA 2LVNC 2L2DA 3K9PA 1VEGA 1ZV1A 2ZTCA 2JY5A 1VEKA 2KNVA 1DO0A 1VEJA 2DI0A 2DHYA 1EFUB 2BWBA 2JY8A 1QZEA 2MGWA 4UN2B 2DZLA 2JY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F92 A;  1XXH E;  3GLH E;  2CP8 A;  2WZJ A;  2MJ5 B;  2LVO C;  4GEW A;  1A5T A;  5DFL A;  5JI2 E;  2KNA A;  2OOB A;  1WGL A;  1DV0 A;  1HJP A;  3B89 A;  1T43 A;  1T6O A;  1ZMU A;  2K9D A;  1OAI A;  1HQY E;  2LBC A;  3FE3 A;  1OKS A;  2L4F A;  1XB2 B;  3FRI A;  2G3Q A;  2CWB A;  1WGN A;  1C7Y A;  1R4G A;  1OQY A;  3LCU A;  1TTE A;  3IEC A;  1GO5 A;  2JY6 B;  2LVA A;  1BVS A;  1Y8G A;  1WHC A;  2DEN A;  3FRH A;  1IM2 A;  2H5X A;  1OTR A;  1F4I A;  3GLG E;  1UFZ A;  3K9O A;  1WR1 B;  2KHH A;  2KNZ A;  4HEO A;  2RRU A;  2JP7 A;  4DBG B;  1IXS A;  1VQ1 A;  1KYI A;  2DKL A;  2LVP C;  1MN3 A;  1HT1 E;  2L4E A;  1G4A E;  1JR3 E;  3MMP A;  1Q02 A;  1TR8 A;  2QSF X;  4G3O A;  4F1I A;  3E46 A;  2DAM A;  1WIV A;  3H4J A;  2DAE A;  3LCV B;  1WJ7 A;  1YLA A;  2EKF A;  2QHO B;  1NV9 A;  3GLI E;  2DAG A;  2JNH A;  2JZ0 A;  2MR9 A;  3IHP A;  2O25 A;  1G3I A;  1HT2 E;  2HWJ A;  1DO2 A;  2QNJ A;  1G41 A;  4Q7J A;  2R0I A;  2K0B X;  2DAI A;  4F2L A;  2BWE A;  1AIP C;  2JZ1 A;  4R71 A;  1E94 E;  1NV8 A;  1SG9 A;  2JUJ A;  2ZTD A;  3BBZ A;  1V92 A;  2DNA A;  1VG5 A;  2MRO B;  1PGY A;  1ZMW A;  2LVQ D;  2LTU A;  1IFY A;  1ZMV A;  2B3T A;  3GLF E;  4WP2 A;  2EKK A;  2DAK A;  2OO9 A;  3T6P A;  1CUK A;  2EJS A;  2HAK A;  1P3Q Q;  2OOA A;  3E21 A;  1VDL A;  2LVN C;  2L2D A;  3K9P A;  1VEG A;  1ZV1 A;  2ZTC A;  2JY5 A;  1VEK A;  2KNV A;  1DO0 A;  1VEJ A;  2DI0 A;  2DHY A;  1EFU B;  2BWB A;  2JY8 A;  1QZE A;  2MGW A;  4UN2 B;  2DZL A;  2JY7 A; 
#chains in the Genus database with same CATH topology
 1N75 A;  1XXH E;  2KA6 B;  5EP1 A;  2VQF M;  1GL6 A;  4GEW A;  4OVZ A;  1OFH A;  1I94 M;  3GLH A;  2KNA A;  5JI2 E;  2OOB A;  3B89 A;  4GKJ M;  4DV1 M;  1T43 A;  1IXR C;  1N33 M;  4JXJ A;  2Z4R A;  4LJ8 A;  1YE9 A;  3A45 A;  4II7 A;  5FTM A;  2K9D A;  4I81 A;  5L8R F;  4LFC M;  1EIJ A;  2R18 A;  5ITQ A;  3VDP A;  3FE3 A;  3HHY A;  3HX3 A;  1XWI A;  3GQ5 A;  2OPF A;  1E9S A;  2Q2E B;  1C7Y A;  1R4G A;  3VK8 A;  3LCU A;  1IBM M;  3IEC A;  2C98 A;  2ZAO A;  5ITT A;  1PJI A;  3CF2 A;  3HY5 A;  4L4U A;  4G6Z A;  2LXE A;  4BLC A;  2JWS A;  2KZS A;  1WHC A;  5EQT A;  2DEN A;  2W82 A;  2X8A A;  1OTR A;  3KOY E;  2XF3 A;  2KDL A;  5H37 D;  1IXZ A;  5F3W A;  2CHG A;  4S12 A;  1NY5 A;  4L6V 6;  1YSY A;  3SAU A;  4MH0 E;  3GLG A;  4GIP A;  1UM8 A;  2ZAN A;  1TDZ A;  4HEO A;  4LJ7 A;  2R46 A;  3T38 A;  4DUZ M;  3MK6 A;  3HU2 A;  3I51 A;  3SAR A;  1HT1 E;  1GLN A;  1Q3C A;  3EIE A;  2L6O A;  4CIS A;  3KSJ A;  2F5Q A;  1Z5B A;  4IBG A;  3DA1 A;  2QZ4 A;  4LY6 A;  5KQ8 A;  3E9S A;  1TR8 A;  4LGY A;  2JA2 A;  2DHR A;  4G3O A;  3U5Z A;  1XMQ M;  1H6U A;  4F1I A;  4DV4 M;  2QBY B;  3SMS A;  4D82 A;  1PM5 A;  5KPT A;  3KOX E;  5EP2 A;  2DVW B;  2FNA A;  2CV1 A;  4GHL A;  1L2B A;  2EKF A;  2F5O A;  3UK6 A;  1V33 A;  3K1J A;  3B9P A;  2JNH A;  3U61 B;  3SHG B;  2APL A;  5C18 A;  3K92 A;  1D0L A;  3A42 A;  4LF6 M;  2QPA A;  1NJG A;  3K8Z A;  1SXJ E;  2I7P A;  2K0B X;  2DAI A;  5EP4 A;  2VF7 A;  3KOW E;  1D2N A;  2BWE A;  2L7H A;  4RKU F;  3SFZ A;  4IBJ A;  4JYA M;  1IBL M;  1E32 A;  1R6B X;  3SYK A;  1T3T A;  1DGH B;  1KSF X;  2C9O A;  5FTN A;  3TE6 A;  4R7G A;  3BBZ A;  3FUW A;  3GPX A;  4CIZ A;  5FTL A;  1PGY A;  4PT5 A;  2KXE A;  2LVQ D;  1HQC A;  1IFY A;  3HGI A;  1L1T A;  3THG A;  4NXN M;  4G4N A;  2LWX A;  4WP2 A;  4DR7 M;  2ZAM A;  1IQP A;  3UZU A;  3I4V A;  3AOG A;  3M7G A;  3T6P A;  5ITR A;  2DXI A;  2KW0 A;  2RGO A;  3HU1 A;  1P3Q Q;  4BB9 A;  3FUT A;  4R3D A;  5IT9 S;  4X66 M;  2D7H A;  3E21 A;  2LVN C;  4FCT A;  3K9P A;  1GAB A;  2ZTC A;  3AJI B;  1TH4 A;  3HHX A;  4GC9 A;  2BNK A;  2CE7 A;  2KNV A;  1DO0 A;  2NQ8 C;  2Y0T A;  4LJ6 A;  4LFA M;  4I4L A;  2QBY A;  4JI3 M;  1DGB A;  1EFU B;  2BWB A;  2MGW A;  3FTD A;  4UN2 B;  3GPP A;  2E5L M;  4G4Q A;  2DZL A;  3U6O A;  2RGH A;  2CP8 A;  2WZJ A;  2MJ5 B;  4GRI A;  5DYI A;  4M9S A;  2GNO A;  2Z7J A;  3LW5 F;  3U61 A;  4FWD A;  4JI4 M;  4LF7 M;  4GKK M;  3SHF A;  4EIW A;  8CAT A;  1WGL A;  2G8L A;  1HJP A;  3KW6 A;  3J81 S;  4DV3 M;  3U6P A;  4JI1 M;  3SBJ A;  1MU5 A;  2OQ4 A;  1T6O A;  3GO8 A;  1OAO C;  3SAV A;  2VF8 A;  3CF6 E;  1OAI A;  1HQY E;  4LRS A;  1OKS A;  3LQR A;  1HNZ M;  3L29 A;  3FRI A;  3L27 A;  2G3Q A;  1G8P A;  5FTK A;  1WGN A;  1DGH A;  2CHV A;  4KO8 A;  1GVN A;  3U6E A;  3W0L B;  1TTE A;  4IBK A;  1SXJ B;  3ZH9 B;  3T1H M;  3H4M A;  2HL7 A;  4Z6Y A;  3NBX X;  1XHB A;  3K2L A;  3C58 A;  4B3S M;  1QZM A;  3CGW A;  3Q8G A;  2R65 A;  2HCB A;  3M6A A;  3SAS A;  3A46 A;  2M60 A;  1QUS A;  1F4I A;  2XFT A;  1NY6 A;  2QEN A;  3I01 M;  2XEP A;  1NVM A;  2O5R A;  3C3E A;  2HKJ A;  4NSR A;  1Q39 A;  2CV2 A;  1JR3 D;  2KHH A;  4DR1 M;  2JP7 A;  4DBG B;  4PDI A;  2XFS A;  2DZO B;  4JI2 M;  3HHW A;  1VQ1 A;  2G5G X;  2DKL A;  2BJV A;  4P17 A;  4PD2 A;  3AFH A;  2XGN A;  1MN3 A;  2Z3X A;  2C9C A;  3NWL A;  1L1Z A;  1FNN A;  2VDB B;  3AOE A;  1IY2 A;  2KEB A;  1IN8 A;  1PJQ A;  3JR5 A;  5GKN A;  3E4R A;  2XH9 A;  2Z8Y M;  2N35 A;  4NXM M;  3E46 A;  4M9X A;  2R4E A;  4LF5 M;  4LJ4 A;  1V34 A;  3LCV B;  1W5S A;  1Z59 A;  4B7G A;  3UJN A;  3R9X B;  4X64 M;  4KHP M;  3B7Q A;  1N34 M;  1NV9 A;  3GPU A;  4QNR A;  4PCZ A;  2R62 A;  2MR9 A;  3GQ3 A;  1K82 A;  4DV7 M;  4P16 A;  1RU3 A;  1J7K A;  2QCU A;  2C96 A;  3QWL A;  2ZBK B;  1G3I A;  1X37 A;  1HT2 E;  4LGM A;  3U6S A;  4GMQ A;  3BOS A;  1OIP A;  4YY3 M;  2QNJ A;  1G41 A;  4F2L A;  2R0I A;  4Z8X A;  4CJ6 A;  1QAN A;  1NHW C;  4GH9 A;  5FSW A;  4B3R M;  4M9Z A;  4NRV A;  4R71 A;  1SXJ A;  1E94 E;  4MGH A;  3HU3 A;  3PXG A;  2JUJ A;  5EXT A;  2F5S A;  2DWM A;  3CF0 A;  5BR8 M;  1PJJ A;  4LF4 M;  1VG5 A;  2RKO A;  1QQW A;  1WXQ A;  4LJA A;  4AG6 A;  1ZMV A;  4M0D A;  3LQQ A;  1GJT A;  4LF9 M;  3GPY A;  4LF8 M;  2OO9 A;  5EJC A;  1N78 A;  5KO3 A;  1TH3 A;  2J7N A;  2L09 A;  2EO2 A;  1JB0 F;  3A98 B;  2EJS A;  4RF0 A;  2YNM D;  4MB7 A;  3GP1 A;  4LG2 A;  2KZU A;  2OOA A;  3R8F A;  3QYE A;  2O01 F;  3EIH A;  4XK8 F;  3PNY A;  5BPV A;  4IBB A;  1IXS B;  3C3D A;  4B7F A;  4AKH A;  1N77 A;  1NJF A;  4IIW A;  4WW0 A;  1OFI A;  2JY5 A;  3QAU A;  4GC5 A;  3FYC A;  4DV2 M;  2M5Z A;  2F5P A;  5A2Q S;  4QOZ C;  5EXS A;  3KFU G;  4NL4 H;  4QHS A;  5KQD A;  4G4O A;  3FUV A;  4FW9 A;  2JY7 A;  3GRU A;  3FKE A;  4CHT B;  1IBK M;  3KVW A;  2LVO C;  3LVV A;  2XLJ A;  1IY1 A;  1A5T A;  3TWL A;  5DFL A;  5KPZ A;  1NSF A;  3IG5 A;  1QVR A;  1K3X A;  4DV0 M;  2WSF F;  1Z5C A;  3KS4 A;  1GKI A;  4LFB M;  3SC3 A;  2A5Y B;  1ZMU A;  1FJG M;  2LBC A;  4IJF A;  5KPR A;  2L4F A;  1XB2 B;  3W67 A;  3W68 A;  3DFZ A;  1D0M A;  3U60 B;  4DV6 M;  2CWB A;  2X4A A;  3L25 A;  2EUC A;  1IN4 A;  1MX0 A;  4AKG A;  1OQY A;  3I4Y A;  1QDT A;  2R45 A;  4GIT A;  1N32 M;  1XMO M;  4M0W A;  4FWG A;  4X62 M;  1L8Q A;  2JY6 B;  2LVA A;  1BVS A;  4AKI A;  3FD9 A;  3L2A A;  3RGS A;  3TPZ A;  4B3T M;  4MGI E;  4L8R C;  2H5X A;  1DGG A;  1SXJ D;  4KOD A;  2LNH C;  4MGZ E;  1UFZ A;  2CFO A;  3HJ8 A;  3ZCB B;  4GHA A;  1WR1 B;  4LZZ A;  5DNY A;  4RF1 A;  4JN6 A;  3WHL A;  4ITQ A;  7CAT A;  3KXE C;  2KNZ A;  2LHC A;  2RRU A;  3U6C A;  3Q8X A;  2F4V M;  1IXS A;  2CRU A;  2J5Y A;  3CTW B;  3KOZ E;  1IY0 A;  3FUX A;  3RGP A;  2Y21 A;  3ZQJ A;  2F5N A;  4A3V B;  3T15 A;  4B7H A;  4FCV A;  2L4E A;  5LMU M;  1PJS A;  1JR3 E;  2XSZ A;  4IBE A;  2UXD M;  2UUB M;  1Q02 A;  2QSF X;  1DGF A;  4LJ5 A;  4QNM A;  5DYG A;  4OU7 A;  1Q3B A;  4IBF A;  2DAE A;  2R6F A;  3BXW A;  3HZJ A;  3QYB A;  2UUC M;  1YLA A;  2QQ8 A;  2Y0Q A;  3RFW A;  5ITY A;  4D80 A;  3TWM A;  5ITX E;  3FTC A;  4XGI A;  3GLI E;  2DWL A;  2DAG A;  2JZ0 A;  3MHV C;  1ZQ9 A;  4JI0 M;  3T1Y M;  4XBO A;  2O25 A;  1R7R A;  1XC8 A;  4REZ A;  3JR4 A;  4MGK E;  2HWJ A;  1DO2 A;  2C5R A;  5FLX S;  3SAT A;  4Q7J A;  3U60 A;  2HHH M;  2EA0 A;  3KS8 A;  4OW0 A;  2XZU A;  3JAM S;  3GQ4 A;  1AIP C;  4Y28 F;  4AG5 A;  1LV7 A;  4FWH A;  1G71 A;  3B74 A;  2UXC M;  3B7N A;  4OX9 M;  3VKH A;  3SYL A;  1GJS A;  2ERC A;  2CEA A;  3NBI A;  2D7G A;  4HL4 A;  1NO1 A;  2CV0 A;  1JQJ C;  2LTU A;  2YR0 A;  2VQE M;  5LMN M;  4DUY M;  3GLF E;  1K3W A;  3GRR A;  4ANR A;  3TWK A;  3PNV A;  1CUK A;  3U6D A;  3L28 A;  5JI3 E;  2HAK A;  1KFV A;  1XNR M;  3LMM A;  3ZC7 B;  3HHZ A;  4K0K M;  3UGJ A;  2WSC F;  3GRV A;  5IZ7 D;  2L2D A;  2L7I A;  2KRK A;  2D7E A;  4AI6 A;  1ZV1 A;  2V1U A;  1IN7 A;  3FUU A;  4NRW A;  1VEK A;  4DR6 M;  3M0E A;  1I4W A;  3TQS A;  4LRT A;  1PJT A;  3VKG A;  1VEJ A;  4W5W A;  1YUB A;  2DI0 A;  2YQZ A;  2JY8 A;  1TF0 B;  4NC6 A;  4L16 A;  3F92 A;  3GLH E;  4BBA A;  1L2D A;  4IBI A;  2XSZ D;  1J09 A;  3VDU A;  2UU9 M;  3FTF A;  3AKZ A;  1GL7 A;  4LJ9 A;  4DR2 M;  1VDD A;  1W5T A;  2JXN A;  2ZM6 M;  2K6B A;  2DWN A;  4L15 A;  1QYR A;  1TH2 A;  4WUR A;  1DV0 A;  4CGY B;  5C1B A;  1R2Z A;  2CUZ A;  2Y20 A;  4FCW A;  1OJL A;  3AV0 A;  4YHH M;  1EE8 A;  3GLI B;  3OTO M;  4IJE A;  4LZJ A;  1N36 M;  4JI6 M;  3FTE A;  3WHK A;  2FOI C;  4D81 A;  1QDR A;  4DR3 M;  1IN5 A;  3AL0 C;  4KLN A;  2YFQ A;  5IRE B;  3J7A S;  4QOS A;  1GO5 A;  3AOE C;  2AHM A;  2H1R A;  1Y8G A;  4PDG A;  4RNA A;  3W0F A;  3LVW A;  2K47 A;  3KSX A;  3FRH A;  1IM2 A;  3J2P B;  4L78 A;  2R4J A;  2FFJ A;  3GLG E;  1E9R A;  1G59 A;  2MH8 A;  3K9O A;  3PVS A;  3RE8 A;  1XXH B;  3DOA A;  4AW4 A;  1HNW M;  1NHG C;  2LHG A;  2X49 A;  3J27 B;  2UUA M;  2V6Z M;  3ILK A;  2UXB M;  4IBD A;  2J7O A;  3GLF B;  1L2C A;  2R44 A;  5E26 A;  3MJ5 A;  4ZPX A;  3FYD A;  1KYI A;  1QAQ A;  2BJW A;  2VII A;  2LVP C;  4KT0 F;  4DR5 M;  3GRY A;  2GQF A;  2P5T A;  2LH0 A;  4IBC A;  4NSO B;  4FD2 A;  1G4A E;  1SXJ C;  1ORY B;  3MMP A;  5EP3 A;  1Z5A A;  2FS1 A;  3HWS A;  4AZF A;  1PRB A;  5IWA M;  2C99 A;  3IG8 A;  3U6L A;  1ZAE A;  1JR3 A;  3D8L A;  2DAM A;  1WIV A;  3B7Z A;  3H4J A;  1WJ7 A;  4MGY E;  1NNU C;  3HKP A;  2QHO B;  3TL4 X;  2I7N A;  3IHP A;  1XNQ M;  1TDH A;  4OVZ B;  5EXP A;  3GLH B;  5E6J A;  5ITX A;  1D0K A;  3L26 A;  3SAW A;  4B08 A;  3GLI A;  4TUW A;  4I5S A;  1R2Y A;  4I8O A;  5FTJ A;  4QHT A;  2CHQ A;  4G4R A;  1HR0 M;  3KP0 E;  1TGU A;  2JZ1 A;  2XZF A;  1NV8 A;  2WSE F;  3HJQ A;  4DV5 M;  1Z6T A;  1SG9 A;  2ZTD A;  3KDS E;  1V92 A;  1NNJ A;  4MM3 B;  1HNX M;  1MJG M;  2DNA A;  4FVM A;  2MRO B;  4JI5 M;  3U6Q A;  4B3M M;  3SMP A;  1ZMW A;  3DZD A;  4NOO B;  1LTM A;  1XXH A;  2B3T A;  3D8B A;  3U6M A;  3KP1 E;  3J80 S;  3HJS A;  1OIZ A;  3J7B A;  2EKK A;  2DAK A;  5EXX A;  4X65 M;  5ITU A;  2DWZ B;  1J5E M;  3GLF A;  2V1C A;  3GLG B;  1C1K A;  2KRU A;  1QAO A;  3I04 M;  1VDL A;  3C9P A;  2FE8 A;  2Z4S A;  3VFD A;  4DR4 M;  1VEG A;  2FH0 A;  1IN6 A;  2QP9 X;  3UMM A;  1R5L A;  3VLF B;  3V76 A;  1QUT A;  4AQY M;  3VK7 A;  3PFI A;  1QAM A;  1AUA A;  2DZN B;  4LCB A;  4JV5 M;  1S3S A;  2DHY A;  4JI7 M;  3U5Z B;  1QZE A;  4JI8 M;  4HLQ A; 
#chains in the Genus database with same CATH homology
 3F92 A;  1XXH E;  3GLH E;  2CP8 A;  2WZJ A;  2MJ5 B;  2LVO C;  4GEW A;  1A5T A;  5DFL A;  5JI2 E;  2KNA A;  2OOB A;  1WGL A;  1DV0 A;  1HJP A;  3B89 A;  1T43 A;  1T6O A;  1ZMU A;  2K9D A;  1OAI A;  1HQY E;  2LBC A;  3FE3 A;  1OKS A;  2L4F A;  1XB2 B;  3FRI A;  2G3Q A;  2CWB A;  1WGN A;  1C7Y A;  1R4G A;  1OQY A;  3LCU A;  1TTE A;  3IEC A;  1GO5 A;  2JY6 B;  2LVA A;  1BVS A;  1Y8G A;  1WHC A;  2DEN A;  3FRH A;  1IM2 A;  2H5X A;  1OTR A;  1F4I A;  3GLG E;  1UFZ A;  3K9O A;  1WR1 B;  2KHH A;  2KNZ A;  4HEO A;  2RRU A;  2JP7 A;  4DBG B;  1IXS A;  1VQ1 A;  1KYI A;  2DKL A;  2LVP C;  1MN3 A;  1HT1 E;  2L4E A;  1G4A E;  1JR3 E;  3MMP A;  1Q02 A;  1TR8 A;  2QSF X;  4G3O A;  4F1I A;  3E46 A;  2DAM A;  1WIV A;  3H4J A;  2DAE A;  3LCV B;  1WJ7 A;  1YLA A;  2EKF A;  2QHO B;  1NV9 A;  3GLI E;  2DAG A;  2JNH A;  2JZ0 A;  2MR9 A;  3IHP A;  2O25 A;  1G3I A;  1HT2 E;  2HWJ A;  1DO2 A;  2QNJ A;  1G41 A;  4Q7J A;  2R0I A;  2K0B X;  2DAI A;  4F2L A;  2BWE A;  1AIP C;  2JZ1 A;  4R71 A;  1E94 E;  1NV8 A;  1SG9 A;  2JUJ A;  2ZTD A;  3BBZ A;  1V92 A;  2DNA A;  1VG5 A;  2MRO B;  1PGY A;  1ZMW A;  2LVQ D;  2LTU A;  1IFY A;  1ZMV A;  2B3T A;  3GLF E;  4WP2 A;  2EKK A;  2DAK A;  2OO9 A;  3T6P A;  1CUK A;  2EJS A;  2HAK A;  1P3Q Q;  2OOA A;  3E21 A;  1VDL A;  2LVN C;  2L2D A;  3K9P A;  1VEG A;  1ZV1 A;  2ZTC A;  2JY5 A;  1VEK A;  2KNV A;  1DO0 A;  1VEJ A;  2DI0 A;  2DHY A;  1EFU B;  2BWB A;  2JY8 A;  1QZE A;  2MGW A;  4UN2 B;  2DZL A;  2JY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...