1R4GA

Solution structure of the sendai virus protein x c-subdomain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
b'KPTMHSLRLVIESSPLSRAEKAAYVKSLSKCKTDQEVKAVMELVEEDIESLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase alpha subunit
publication title Structure and dynamics of the nucleocapsid-binding domain of the Sendai virus phosphoprotein in solution
pubmed doi rcsb
source organism Sendai virus (strain harris)
molecule tags Viral protein, transferase
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1r4gA00
2DAMA 2LVOC 2ZTCA 2JP7A 2DENA 1VEKA 2O25A 4G3OA 1E94E 2JY5A 2KNAA 3GLFE 1ZV1A 1G3IA 2H5XA 1P3QQ 1WHCA 4Q7JA 1GO5A 2DZLA 2DKLA 2K0BX 1IFYA 4DBGB 3FRHA 1BVSA 1UFZA 1V92A 2DAEA 2DI0A 3IHPA 1YLAA 3H4JA 2HAKA 2JUJA 2LVNC 5JI2E 2DNAA 2QHOB 2KNZA 2JY7A 3B89A 1DO2A 1WGNA 1EFUB 1PGYA 1TTEA 1ZMVA 1G41A 3GLHE 1ZMUA 1IXSA 2DAIA 1OTRA 2L4FA 1WJ7A 3GLGE 1VQ1A 2DAGA 2JZ1A 3K9PA 1VDLA 3BBZA 1XXHE 1T43A 1A5TA 2B3TA 5DFLA 1MN3A 2CP8A 2HWJA 2OO9A 1SG9A 2MJ5B 2JY8A 1HQYE 2ZTDA 3K9OA 4GEWA 2LTUA 1DO0A 3LCVB 1XB2B 2QNJA 1OAIA 1VG5A 1QZEA 2LBCA 1OKSA 1R4GA 1AIPC 1T6OA 1KYIA 2LVQD 1Q02A 1TR8A 2DAKA 2G3QA 2BWEA 1NV9A 3E21A 4R71A 1HJPA 2RRUA 3GLIE 2R0IA 1IM2A 1CUKA 3LCUA 2JY6B 1OQYA 2MROB 1VEGA 2L4EA 4F1IA 1WR1B 1NV8A 3FE3A 1C7YA 3MMPA 2DHYA 2L2DA 2QSFX 1G4AE 2MGWA 2BWBA 1WIVA 4WP2A 2WZJA 1HT2E 1ZMWA 2OOBA 2EKFA 3T6PA 3F92A 4F2LA 4HEOA 2LVAA 3FRIA 1F4IA 1WGLA 2JNHA 1JR3E 2K9DA 3E46A 1HT1E 2KNVA 2CWBA 1Y8GA 2JZ0A 2EKKA 1DV0A 1VEJA 2MR9A 2LVPC 2KHHA 2EJSA 3IECA 2OOAA 4UN2B
chains in the Genus database with same CATH superfamily
3SFZA 2DAMA 2ZTCA 4L6V6 4D82A 4B3RM 2JP7A 2DENA 4P16A 1MU5A 3U6OA 1I4WA 2JA2A 3D8LA 2L7HA 4L78A 3CTWB 4DV7M 3HWSA 3A45A 5EP4A 2XZUA 1QAQA 1YSYA 5EXXA 3BOSA 3DFZA 3RE8A 1G3IA 3U6PA 3D8BA 3SARA 1IBMM 1IN4A 2J7OA 1NO1A 2DZLA 4LJ8A 3AL0C 1BVSA 2WSCF 4L15A 4DR6M 4EIWA 2DI0A 3GP1A 1NNJA 3SHFA 2Y0QA 4KODA 2X49A 2LHGA 1NSFA 4DV1M 2LVNC 3MJ5A 3QAUA 3U61A 2QBYB 5JI2E 2QENA 4GHAA 2FS1A 4DV5M 3B89A 1OFHA 2MH8A 2NQ8C 2ERCA 1ZMVA 3AOGA 3KDSE 2ZM6M 4LF4M 4I8OA 1IXRC 2ZAMA 2RKOA 5ITQA 2VQEM 2BJWA 3ZC7B 3QYBA 3W0LB 3LVVA 3SMSA 3NBXX 4LJ7A 2DWLA 4OVZA 2DAGA 3FUVA 2LNHC 3LQRA 3M7GA 3CGWA 4M0WA 5JI3E 1OIZA 3LQQA 3BBZA 4QOZC 1LV7A 1HNXM 1T43A 4REZA 3TPZA 2A5YB 2CV1A 3FTFA 4NRWA 3KFUG 5FTJA 3M0EA 1NJGA 4PD2A 2OO9A 4MGHA 2MJ5B 3NBIA 2APLA 4LF6M 2ZTDA 4RF0A 2HL7A 4GEWA 4KT0F 3V76A 4LFAM 3T38A 4JV5M 4FWHA 3UK6A 3ZH9B 1G71A 2QNJA 4R3DA 2X4AA 2DHRA 4X66M 4LF8M 1OKSA 3I04M 4XK8F 2GNOA 1GLNA 5DYIA 4I5SA 1AIPC 3KOXE 1T6OA 4LJAA 2QQ8A 4XBOA 1HNZM 1HNWM 4DR5M 1TR8A 3HJSA 2YNMD 2G3QA 1NHGC 3HU1A 5BPVA 5EXPA 1D0KA 1D2NA 4IBCA 3SMPA 4B3MM 3J81S 1J7KA 2R62A 1IBLM 3C3DA 4PT5A 2R0IA 2C98A 3U6DA 1T3TA 2JY6B 2R44A 2I7NA 3KOZE 5EP1A 1N32M 4JI2M 4NL4H 1IN6A 2W82A 4IBEA 1VEGA 2KXEA 2F5SA 2D7EA 4DUZM 4AKHA 3C58A 1TF0B 2L4EA 2X8AA 3FE3A 3IG5A 3HJQA 4CHTB 2L2DA 4RNAA 4DV6M 2MGWA 1R7RA 1XMOM 2KW0A 3GLIB 3SAWA 4KHPM 4MGYE 4S12A 4LZZA 3VKGA 5ITXE 2Z3XA 3Q8XA 2OOBA 5H37D 1L2DA 2EKFA 3T6PA 4MB7A 3F92A 3KOYE 4JXJA 5L8RF 4DV2M 4B7GA 4HEOA 1SXJC 1R5LA 1WGLA 3K1JA 2JNHA 4Y28F 2K9DA 4IBIA 4LJ9A 4QNMA 2OQ4A 1HT1E 3JR4A 3CF2A 4GIPA 4X62M 3LW5F 2C9CA 3U60B 1OAOC 3ILKA 2EKKA 5C18A 2EA0A 3KW6A 1UM8A 1IXSB 5KQDA 3L26A 1PRBA 3RGPA 2QPAA 4TUWA 3HX3A 3UJNA 3K2LA 4W5WA 3K8ZA 4G4OA 2LHCA 4FWDA 1L2CA 5ITXA 2FH0A 2CHGA 2O25A 3B9PA 2CEAA 1QAOA 4HLQA 4MM3B 4ZPXA 3SBJA 4ANRA 3H4MA 2JY5A 2KNAA 4GITA 4FCVA 3FUXA 1ZV1A 4DV3M 2H5XA 4Q7JA 1IY1A 1GO5A 1GJSA 2V1CA 3GPYA 3SATA 2V6ZM 4JI6M 1IFYA 3AJIB 2EUCA 2XSZA 4MH0E 4MGKE 3FUUA 1UFZA 4FD2A 1V92A 2DAEA 1EIJA 1KSFX 1YLAA 5EQTA 1L2BA 4I4LA 3W0FA 1L8QA 2HAKA 1TDHA 1WXQA 3GLFB 2DNAA 2KNZA 4LCBA 1DO2A 2Y21A 3VDUA 1XNQM 1WGNA 4AG5A 1EFUB 1AUAA 1PGYA 5C1BA 2GQFA 1TTEA 1NY6A 1LTMA 1N33M 3VDPA 1G41A 3SYKA 2DAIA 2L09A 1OTRA 4QHSA 4GC5A 2UUCM 4LJ4A 3GLGE 1S3SA 4M9SA 5ITYA 1J09A 2YFQA 2XEPA 2XZFA 4MGZE 4IBKA 1L1TA 5KPRA 1XXHE 4II7A 1ZAEA 4DV4M 3GLHB 2HCBA 4CIZA 1N34M 2CP8A 2HWJA 4R7GA 4G4NA 2QCUA 4NC6A 4G6ZA 1HQYE 3B7NA 4IIWA 4BLCA 1R2YA 4GRIA 3EIHA 1XB2B 1W5TA 3PVSA 3DOAA 2DWNA 1SXJD 1QZEA 1DGBA 4NXNM 3GLGA 1X37A 2DWZB 2DZNB 1H6UA 2FFJA 3L27A 4LRTA 3A46A 4GKJM 2UXBM 4LFCM 4YY3M 2I7PA 2M60A 4DR2M 3LMMA 4Z8XA 1Q3BA 3UMMA 3GQ4A 4ITQA 1XXHA 4OW0A 4G4QA 3MK6A 2DVWB 4G4RA 3EIEA 2BWEA 3WHLA 1G8PA 2WSEF 4R71A 5ITRA 2G8LA 4PDGA 1DGHA 3GLIE 1IM2A 2K6BA 1OFIA 1OQYA 3JAMS 3GPPA 2KZUA 3AV0A 5FTLA 1JQJC 3T1HM 4WURA 1WR1B 3MHVC 5GKNA 1N78A 2UXDM 1Z5AA 1YUBA 4IBFA 3PNVA 1HR0M 1Q39A 1R6BX 2DZOB 4JI7M 3FUTA 1Z6TA 2ZAOA 1WIVA 1XWIA 3AOEC 3FTCA 2C5RA 2OPFA 2BNKA 2J5YA 1MJGM 4JN6A 2CFOA 4P17A 3E4RA 3JR5A 3L2AA 1IN7A 2XF3A 2CUZA 3TWLA 2KEBA 2Q2EB 3U61B 4RF1A 2LVAA 4M9ZA 3FD9A 5A2QS 4PDIA 1Q3CA 3FYCA 2XFTA 3HZJA 2R4EA 1Y8GA 1XC8A 4NSOB 2KRKA 2DXIA 1SXJE 1R2ZA 1QQWA 1VEJA 2MR9A 4FCWA 3HU3A 4FCTA 1FJGM 1QUTA 2F5PA 4JI1M 2CV0A 3GQ5A 4DR1M 2P5TA 4FVMA 4RKUF 5IWAM 3U5ZA 3U6EA 1IN5A 4OVZB 1GL6A 3A42A 1D0LA 4G3OA 1J5EM 5FTNA 3B74A 3GLFE 3GPUA 1IBKM 1P3QQ 2KRUA 3GRUA 4B7FA 4B3TM 1QUSA 2DKLA 2K0BX 2JXNA 4K0KM 5EXTA 3FRHA 4LF7M 1SXJA 2L7IA 3HJ8A 1NY5A 4WW0A 4X65M 1N77A 3H4JA 2JUJA 1TH2A 3QWLA 3VKHA 3HHYA 4BB9A 1GL7A 2F5NA 2QHOB 1QVRA 2JY7A 3FKEA 3FYDA 5E26A 3HGIA 2CV2A 4GKKM 3HKPA 1QANA 1PJSA 3GLFA 4FW9A 2LXEA 3GLHE 1ZMUA 3FUWA 4OX9M 3Q8GA 2FNAA 3VK8A 1YE9A 3TWMA 3PFIA 8CATA 4IBDA 1VQ1A 1E9RA 4MGIE 1L1ZA 4GHLA 3L28A 2JZ1A 4DV0M 2YQZA 1OJLA 2F5QA 3RGSA 3KXEC 4KLNA 1A5TA 5EJCA 3HU2A 4AZFA 3L25A 4LJ6A 3GRVA 3AKZA 1SG9A 2JY8A 2N35A 3GQ3A 5DNYA 4JI4M 2VDBB 3I4YA 2FOIC 1JR3D 1TDZA 1DO0A 4GMQA 2QBYA 3I01M 1OAIA 3U6CA 2LBCA 3SAVA 2Z7JA 4AG6A 1R4GA 4BBAA 2F4VM 2WSFF 1XHBA 1IQPA 1KFVA 2UUBM 1N36M 1KYIA 2LVQD 3VFDA 4JYAM 3J80S 5IREB 4IBGA 4LZJA 3OTOM 2DAKA 2D7GA 1TGUA 3W67A 4I81A 5FTMA 2D7HA 5KQ8A 3E21A 1HJPA 2RRUA 4OU7A 2RGOA 3TWKA 3LCUA 3U6QA 3KP0E 3HHWA 1E32A 4KO8A 3KP1E 7CATA 1GKIA 4QHTA 4JI3M 4F1IA 3UZUA 4CGYB 2E5LM 3BXWA 3ZQJA 1QYRA 2Y0TA 1XMQM 2CRUA 2VQFM 3HHXA 1D0MA 4AKGA 2BWBA 3KSXA 1HT2E 4LF5M 1QDTA 3ZCBB 1HQCA 1ZMWA 3K92A 2Y20A 4YHHM 4IJEA 2FE8A 1NNUC 3FTEA 1GABA 1QAMA 3FRIA 1F4IA 4L4UA 4M0DA 4L16A 1JR3E 3E46A 2CWBA 4AKIA 3SASA 1DV0A 2LVPC 4IBBA 5FTKA 4QOSA 5KO3A 4AW4A 1PJJA 4UN2B 1MX0A 3SYLA 3C3EA 2LVOC 4NXMM 2HKJA 3NWLA 1VEKA 5FSWA 3T15A 5DYGA 2R4JA 1E94E 3PXGA 3AOEA 4JI8M 3J7BA 3I51A 1WHCA 1Z59A 3CF6E 2AHMA 3KOWE 5E6JA 3GRRA 1JR3A 3GLIA 2C96A 2C9OA 4QNRA 3WHKA 3J2PB 4DBGB 1NVMA 2ZANA 3J27B 3C9PA 2CHQA 1C1KA 1GJTA 2QP9X 4B7HA 1V34A 3IHPA 1TH3A 3E9SA 3GRYA 1K82A 4LF9M 4L8RC 1FNNA 3AFHA 3GLGB 2LH0A 3VK7A 4XGIA 2RGHA 2XSZD 4CJ6A 1RU3A 1I94M 3U60A 2KA6B 3DA1A 1XXHB 1DGGA 2JWSA 1IXSA 3VLFB 1NJFA 3RFWA 2R46A 5EXSA 2V1UA 1PJQA 2L4FA 2UU9M 2YR0A 1WJ7A 3TL4X 3J7AS 2BJVA 3B7QA 1PM5A 4D81A 1DGHB 4DUYM 1K3XA 2CHVA 4B3SM 3B7ZA 1W5SA 3K9PA 2XH9A 1VDLA 4JI0M 1IN8A 4AQYM 4AI6A 4B08A 1ORYB 2B3TA 2KZSA 3M6AA 4LRSA 1MN3A 5DFLA 3QYEA 5ITTA 3SHGB 1OIPA 2KDLA 2UXCM 1ZQ9A 4IJFA 1N75A 2H1RA 1EE8A 3KS8A 3U6MA 3DZDA 3K9OA 1K3WA 2Z4RA 2LTUA 2K47A 2G5GX 2Z8YM 4GH9A 3W68A 2F5OA 3LCVB 2HHHM 1VG5A 1IY2A 3R9XB 1DGFA 5EP3A 5LMNM 4JI5M 2Z4SA 1QDRA 4HL4A 5KPTA 2R65A 3KVWA 3TQSA 4A3VB 1Z5BA 3LVWA 1Q02A 3GO8A 3R8FA 5F3WA 2XFSA 4M9XA 4NOOB 1IXZA 5IT9S 3U6SA 1XNRM 1NV9A 5EP2A 4NSRA 3UGJA 2R6FA 4IBJA 4X64M 5IZ7D 2QZ4A 1PJTA 1CUKA 1V33A 2M5ZA 2O01F 3IG8A 4CISA 3U5ZB 2MROB 4LGMA 2VF8A 2EO2A 4DR7M 3GLHA 3I4VA 2ZBKB 1NV8A 3THGA 1C7YA 2R18A 2VF7A 2J7NA 4PCZA 3MMPA 1IY0A 2DHYA 4LGYA 2R45A 1E9SA 1QZMA 3GPXA 2QSFX 3T1YM 4LG2A 1G4AE 2LWXA 4FWGA 3SAUA 1G59A 4WP2A 2WZJA 2CE7A 3PNYA 1VDDA 4LFBM 1SXJB 2DWMA 2C99A 2XGNA 3HY5A 5BR8M 3L29A 2UUAM 2L6OA 4F2LA 3HHZA 4D80A 2VIIA 4GC9A 4LY6A 4NRVA 3CF0A 1PJIA 4DR3M 5ITUA 5LMUM 5KPZA 2KNVA 1TH4A 3A98B 3FTDA 4DR4M 2O5RA 1NHWC 5FLXS 2JZ0A 3KS4A 3TE6A 3U6LA 1JB0F 2KHHA 2EJSA 2XLJA 1Z5CA 3IECA 3KSJA 4LJ5A 2OOAA 3SC3A 1GVNA 4Z6YA
chains in the Genus database with same CATH topology
2DAMA 2LVOC 2ZTCA 2JP7A 2DENA 1VEKA 2O25A 4G3OA 1E94E 2JY5A 2KNAA 3GLFE 1ZV1A 1G3IA 2H5XA 1P3QQ 1WHCA 4Q7JA 1GO5A 2DZLA 2DKLA 2K0BX 1IFYA 4DBGB 3FRHA 1BVSA 1UFZA 1V92A 2DAEA 2DI0A 3IHPA 1YLAA 3H4JA 2HAKA 2JUJA 2LVNC 5JI2E 2DNAA 2QHOB 2KNZA 2JY7A 3B89A 1DO2A 1WGNA 1EFUB 1PGYA 1TTEA 1ZMVA 1G41A 3GLHE 1ZMUA 1IXSA 2DAIA 1OTRA 2L4FA 1WJ7A 3GLGE 1VQ1A 2DAGA 2JZ1A 3K9PA 1VDLA 3BBZA 1XXHE 1T43A 1A5TA 2B3TA 5DFLA 1MN3A 2CP8A 2HWJA 2OO9A 1SG9A 2MJ5B 2JY8A 1HQYE 2ZTDA 3K9OA 4GEWA 2LTUA 1DO0A 3LCVB 1XB2B 2QNJA 1OAIA 1VG5A 1QZEA 2LBCA 1OKSA 1R4GA 1AIPC 1T6OA 1KYIA 2LVQD 1Q02A 1TR8A 2DAKA 2G3QA 2BWEA 1NV9A 3E21A 4R71A 1HJPA 2RRUA 3GLIE 2R0IA 1IM2A 1CUKA 3LCUA 2JY6B 1OQYA 2MROB 1VEGA 2L4EA 4F1IA 1WR1B 1NV8A 3FE3A 1C7YA 3MMPA 2DHYA 2L2DA 2QSFX 1G4AE 2MGWA 2BWBA 1WIVA 4WP2A 2WZJA 1HT2E 1ZMWA 2OOBA 2EKFA 3T6PA 3F92A 4F2LA 4HEOA 2LVAA 3FRIA 1F4IA 1WGLA 2JNHA 1JR3E 2K9DA 3E46A 1HT1E 2KNVA 2CWBA 1Y8GA 2JZ0A 2EKKA 1DV0A 1VEJA 2MR9A 2LVPC 2KHHA 2EJSA 3IECA 2OOAA 4UN2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAM A;  2LVO C;  2ZTC A;  2JP7 A;  2DEN A;  1VEK A;  2O25 A;  4G3O A;  1E94 E;  2JY5 A;  2KNA A;  3GLF E;  1ZV1 A;  1G3I A;  2H5X A;  1P3Q Q;  1WHC A;  4Q7J A;  1GO5 A;  2DZL A;  2DKL A;  2K0B X;  1IFY A;  4DBG B;  3FRH A;  1BVS A;  1UFZ A;  1V92 A;  2DAE A;  2DI0 A;  3IHP A;  1YLA A;  3H4J A;  2HAK A;  2JUJ A;  2LVN C;  5JI2 E;  2DNA A;  2QHO B;  2KNZ A;  2JY7 A;  3B89 A;  1DO2 A;  1WGN A;  1EFU B;  1PGY A;  1TTE A;  1ZMV A;  1G41 A;  3GLH E;  1ZMU A;  1IXS A;  2DAI A;  1OTR A;  2L4F A;  1WJ7 A;  3GLG E;  1VQ1 A;  2DAG A;  2JZ1 A;  3K9P A;  1VDL A;  3BBZ A;  1XXH E;  1T43 A;  1A5T A;  2B3T A;  5DFL A;  1MN3 A;  2CP8 A;  2HWJ A;  2OO9 A;  1SG9 A;  2MJ5 B;  2JY8 A;  1HQY E;  2ZTD A;  3K9O A;  4GEW A;  2LTU A;  1DO0 A;  3LCV B;  1XB2 B;  2QNJ A;  1OAI A;  1VG5 A;  1QZE A;  2LBC A;  1OKS A;  1R4G A;  1AIP C;  1T6O A;  1KYI A;  2LVQ D;  1Q02 A;  1TR8 A;  2DAK A;  2G3Q A;  2BWE A;  1NV9 A;  3E21 A;  4R71 A;  1HJP A;  2RRU A;  3GLI E;  2R0I A;  1IM2 A;  1CUK A;  3LCU A;  2JY6 B;  1OQY A;  2MRO B;  1VEG A;  2L4E A;  4F1I A;  1WR1 B;  1NV8 A;  3FE3 A;  1C7Y A;  3MMP A;  2DHY A;  2L2D A;  2QSF X;  1G4A E;  2MGW A;  2BWB A;  1WIV A;  4WP2 A;  2WZJ A;  1HT2 E;  1ZMW A;  2OOB A;  2EKF A;  3T6P A;  3F92 A;  4F2L A;  4HEO A;  2LVA A;  3FRI A;  1F4I A;  1WGL A;  2JNH A;  1JR3 E;  2K9D A;  3E46 A;  1HT1 E;  2KNV A;  2CWB A;  1Y8G A;  2JZ0 A;  2EKK A;  1DV0 A;  1VEJ A;  2MR9 A;  2LVP C;  2KHH A;  2EJS A;  3IEC A;  2OOA A;  4UN2 B; 
#chains in the Genus database with same CATH topology
 3SFZ A;  2DAM A;  2ZTC A;  4L6V 6;  4D82 A;  4B3R M;  2JP7 A;  2DEN A;  4P16 A;  1MU5 A;  3U6O A;  1I4W A;  2JA2 A;  3D8L A;  2L7H A;  4L78 A;  3CTW B;  4DV7 M;  3HWS A;  3A45 A;  5EP4 A;  2XZU A;  1QAQ A;  1YSY A;  5EXX A;  3BOS A;  3DFZ A;  3RE8 A;  1G3I A;  3U6P A;  3D8B A;  3SAR A;  1IBM M;  1IN4 A;  2J7O A;  1NO1 A;  2DZL A;  4LJ8 A;  3AL0 C;  1BVS A;  2WSC F;  4L15 A;  4DR6 M;  4EIW A;  2DI0 A;  3GP1 A;  1NNJ A;  3SHF A;  2Y0Q A;  4KOD A;  2X49 A;  2LHG A;  1NSF A;  4DV1 M;  2LVN C;  3MJ5 A;  3QAU A;  3U61 A;  2QBY B;  5JI2 E;  2QEN A;  4GHA A;  2FS1 A;  4DV5 M;  3B89 A;  1OFH A;  2MH8 A;  2NQ8 C;  2ERC A;  1ZMV A;  3AOG A;  3KDS E;  2ZM6 M;  4LF4 M;  4I8O A;  1IXR C;  2ZAM A;  2RKO A;  5ITQ A;  2VQE M;  2BJW A;  3ZC7 B;  3QYB A;  3W0L B;  3LVV A;  3SMS A;  3NBX X;  4LJ7 A;  2DWL A;  4OVZ A;  2DAG A;  3FUV A;  2LNH C;  3LQR A;  3M7G A;  3CGW A;  4M0W A;  5JI3 E;  1OIZ A;  3LQQ A;  3BBZ A;  4QOZ C;  1LV7 A;  1HNX M;  1T43 A;  4REZ A;  3TPZ A;  2A5Y B;  2CV1 A;  3FTF A;  4NRW A;  3KFU G;  5FTJ A;  3M0E A;  1NJG A;  4PD2 A;  2OO9 A;  4MGH A;  2MJ5 B;  3NBI A;  2APL A;  4LF6 M;  2ZTD A;  4RF0 A;  2HL7 A;  4GEW A;  4KT0 F;  3V76 A;  4LFA M;  3T38 A;  4JV5 M;  4FWH A;  3UK6 A;  3ZH9 B;  1G71 A;  2QNJ A;  4R3D A;  2X4A A;  2DHR A;  4X66 M;  4LF8 M;  1OKS A;  3I04 M;  4XK8 F;  2GNO A;  1GLN A;  5DYI A;  4I5S A;  1AIP C;  3KOX E;  1T6O A;  4LJA A;  2QQ8 A;  4XBO A;  1HNZ M;  1HNW M;  4DR5 M;  1TR8 A;  3HJS A;  2YNM D;  2G3Q A;  1NHG C;  3HU1 A;  5BPV A;  5EXP A;  1D0K A;  1D2N A;  4IBC A;  3SMP A;  4B3M M;  3J81 S;  1J7K A;  2R62 A;  1IBL M;  3C3D A;  4PT5 A;  2R0I A;  2C98 A;  3U6D A;  1T3T A;  2JY6 B;  2R44 A;  2I7N A;  3KOZ E;  5EP1 A;  1N32 M;  4JI2 M;  4NL4 H;  1IN6 A;  2W82 A;  4IBE A;  1VEG A;  2KXE A;  2F5S A;  2D7E A;  4DUZ M;  4AKH A;  3C58 A;  1TF0 B;  2L4E A;  2X8A A;  3FE3 A;  3IG5 A;  3HJQ A;  4CHT B;  2L2D A;  4RNA A;  4DV6 M;  2MGW A;  1R7R A;  1XMO M;  2KW0 A;  3GLI B;  3SAW A;  4KHP M;  4MGY E;  4S12 A;  4LZZ A;  3VKG A;  5ITX E;  2Z3X A;  3Q8X A;  2OOB A;  5H37 D;  1L2D A;  2EKF A;  3T6P A;  4MB7 A;  3F92 A;  3KOY E;  4JXJ A;  5L8R F;  4DV2 M;  4B7G A;  4HEO A;  1SXJ C;  1R5L A;  1WGL A;  3K1J A;  2JNH A;  4Y28 F;  2K9D A;  4IBI A;  4LJ9 A;  4QNM A;  2OQ4 A;  1HT1 E;  3JR4 A;  3CF2 A;  4GIP A;  4X62 M;  3LW5 F;  2C9C A;  3U60 B;  1OAO C;  3ILK A;  2EKK A;  5C18 A;  2EA0 A;  3KW6 A;  1UM8 A;  1IXS B;  5KQD A;  3L26 A;  1PRB A;  3RGP A;  2QPA A;  4TUW A;  3HX3 A;  3UJN A;  3K2L A;  4W5W A;  3K8Z A;  4G4O A;  2LHC A;  4FWD A;  1L2C A;  5ITX A;  2FH0 A;  2CHG A;  2O25 A;  3B9P A;  2CEA A;  1QAO A;  4HLQ A;  4MM3 B;  4ZPX A;  3SBJ A;  4ANR A;  3H4M A;  2JY5 A;  2KNA A;  4GIT A;  4FCV A;  3FUX A;  1ZV1 A;  4DV3 M;  2H5X A;  4Q7J A;  1IY1 A;  1GO5 A;  1GJS A;  2V1C A;  3GPY A;  3SAT A;  2V6Z M;  4JI6 M;  1IFY A;  3AJI B;  2EUC A;  2XSZ A;  4MH0 E;  4MGK E;  3FUU A;  1UFZ A;  4FD2 A;  1V92 A;  2DAE A;  1EIJ A;  1KSF X;  1YLA A;  5EQT A;  1L2B A;  4I4L A;  3W0F A;  1L8Q A;  2HAK A;  1TDH A;  1WXQ A;  3GLF B;  2DNA A;  2KNZ A;  4LCB A;  1DO2 A;  2Y21 A;  3VDU A;  1XNQ M;  1WGN A;  4AG5 A;  1EFU B;  1AUA A;  1PGY A;  5C1B A;  2GQF A;  1TTE A;  1NY6 A;  1LTM A;  1N33 M;  3VDP A;  1G41 A;  3SYK A;  2DAI A;  2L09 A;  1OTR A;  4QHS A;  4GC5 A;  2UUC M;  4LJ4 A;  3GLG E;  1S3S A;  4M9S A;  5ITY A;  1J09 A;  2YFQ A;  2XEP A;  2XZF A;  4MGZ E;  4IBK A;  1L1T A;  5KPR A;  1XXH E;  4II7 A;  1ZAE A;  4DV4 M;  3GLH B;  2HCB A;  4CIZ A;  1N34 M;  2CP8 A;  2HWJ A;  4R7G A;  4G4N A;  2QCU A;  4NC6 A;  4G6Z A;  1HQY E;  3B7N A;  4IIW A;  4BLC A;  1R2Y A;  4GRI A;  3EIH A;  1XB2 B;  1W5T A;  3PVS A;  3DOA A;  2DWN A;  1SXJ D;  1QZE A;  1DGB A;  4NXN M;  3GLG A;  1X37 A;  2DWZ B;  2DZN B;  1H6U A;  2FFJ A;  3L27 A;  4LRT A;  3A46 A;  4GKJ M;  2UXB M;  4LFC M;  4YY3 M;  2I7P A;  2M60 A;  4DR2 M;  3LMM A;  4Z8X A;  1Q3B A;  3UMM A;  3GQ4 A;  4ITQ A;  1XXH A;  4OW0 A;  4G4Q A;  3MK6 A;  2DVW B;  4G4R A;  3EIE A;  2BWE A;  3WHL A;  1G8P A;  2WSE F;  4R71 A;  5ITR A;  2G8L A;  4PDG A;  1DGH A;  3GLI E;  1IM2 A;  2K6B A;  1OFI A;  1OQY A;  3JAM S;  3GPP A;  2KZU A;  3AV0 A;  5FTL A;  1JQJ C;  3T1H M;  4WUR A;  1WR1 B;  3MHV C;  5GKN A;  1N78 A;  2UXD M;  1Z5A A;  1YUB A;  4IBF A;  3PNV A;  1HR0 M;  1Q39 A;  1R6B X;  2DZO B;  4JI7 M;  3FUT A;  1Z6T A;  2ZAO A;  1WIV A;  1XWI A;  3AOE C;  3FTC A;  2C5R A;  2OPF A;  2BNK A;  2J5Y A;  1MJG M;  4JN6 A;  2CFO A;  4P17 A;  3E4R A;  3JR5 A;  3L2A A;  1IN7 A;  2XF3 A;  2CUZ A;  3TWL A;  2KEB A;  2Q2E B;  3U61 B;  4RF1 A;  2LVA A;  4M9Z A;  3FD9 A;  5A2Q S;  4PDI A;  1Q3C A;  3FYC A;  2XFT A;  3HZJ A;  2R4E A;  1Y8G A;  1XC8 A;  4NSO B;  2KRK A;  2DXI A;  1SXJ E;  1R2Z A;  1QQW A;  1VEJ A;  2MR9 A;  4FCW A;  3HU3 A;  4FCT A;  1FJG M;  1QUT A;  2F5P A;  4JI1 M;  2CV0 A;  3GQ5 A;  4DR1 M;  2P5T A;  4FVM A;  4RKU F;  5IWA M;  3U5Z A;  3U6E A;  1IN5 A;  4OVZ B;  1GL6 A;  3A42 A;  1D0L A;  4G3O A;  1J5E M;  5FTN A;  3B74 A;  3GLF E;  3GPU A;  1IBK M;  1P3Q Q;  2KRU A;  3GRU A;  4B7F A;  4B3T M;  1QUS A;  2DKL A;  2K0B X;  2JXN A;  4K0K M;  5EXT A;  3FRH A;  4LF7 M;  1SXJ A;  2L7I A;  3HJ8 A;  1NY5 A;  4WW0 A;  4X65 M;  1N77 A;  3H4J A;  2JUJ A;  1TH2 A;  3QWL A;  3VKH A;  3HHY A;  4BB9 A;  1GL7 A;  2F5N A;  2QHO B;  1QVR A;  2JY7 A;  3FKE A;  3FYD A;  5E26 A;  3HGI A;  2CV2 A;  4GKK M;  3HKP A;  1QAN A;  1PJS A;  3GLF A;  4FW9 A;  2LXE A;  3GLH E;  1ZMU A;  3FUW A;  4OX9 M;  3Q8G A;  2FNA A;  3VK8 A;  1YE9 A;  3TWM A;  3PFI A;  8CAT A;  4IBD A;  1VQ1 A;  1E9R A;  4MGI E;  1L1Z A;  4GHL A;  3L28 A;  2JZ1 A;  4DV0 M;  2YQZ A;  1OJL A;  2F5Q A;  3RGS A;  3KXE C;  4KLN A;  1A5T A;  5EJC A;  3HU2 A;  4AZF A;  3L25 A;  4LJ6 A;  3GRV A;  3AKZ A;  1SG9 A;  2JY8 A;  2N35 A;  3GQ3 A;  5DNY A;  4JI4 M;  2VDB B;  3I4Y A;  2FOI C;  1JR3 D;  1TDZ A;  1DO0 A;  4GMQ A;  2QBY A;  3I01 M;  1OAI A;  3U6C A;  2LBC A;  3SAV A;  2Z7J A;  4AG6 A;  1R4G A;  4BBA A;  2F4V M;  2WSF F;  1XHB A;  1IQP A;  1KFV A;  2UUB M;  1N36 M;  1KYI A;  2LVQ D;  3VFD A;  4JYA M;  3J80 S;  5IRE B;  4IBG A;  4LZJ A;  3OTO M;  2DAK A;  2D7G A;  1TGU A;  3W67 A;  4I81 A;  5FTM A;  2D7H A;  5KQ8 A;  3E21 A;  1HJP A;  2RRU A;  4OU7 A;  2RGO A;  3TWK A;  3LCU A;  3U6Q A;  3KP0 E;  3HHW A;  1E32 A;  4KO8 A;  3KP1 E;  7CAT A;  1GKI A;  4QHT A;  4JI3 M;  4F1I A;  3UZU A;  4CGY B;  2E5L M;  3BXW A;  3ZQJ A;  1QYR A;  2Y0T A;  1XMQ M;  2CRU A;  2VQF M;  3HHX A;  1D0M A;  4AKG A;  2BWB A;  3KSX A;  1HT2 E;  4LF5 M;  1QDT A;  3ZCB B;  1HQC A;  1ZMW A;  3K92 A;  2Y20 A;  4YHH M;  4IJE A;  2FE8 A;  1NNU C;  3FTE A;  1GAB A;  1QAM A;  3FRI A;  1F4I A;  4L4U A;  4M0D A;  4L16 A;  1JR3 E;  3E46 A;  2CWB A;  4AKI A;  3SAS A;  1DV0 A;  2LVP C;  4IBB A;  5FTK A;  4QOS A;  5KO3 A;  4AW4 A;  1PJJ A;  4UN2 B;  1MX0 A;  3SYL A;  3C3E A;  2LVO C;  4NXM M;  2HKJ A;  3NWL A;  1VEK A;  5FSW A;  3T15 A;  5DYG A;  2R4J A;  1E94 E;  3PXG A;  3AOE A;  4JI8 M;  3J7B A;  3I51 A;  1WHC A;  1Z59 A;  3CF6 E;  2AHM A;  3KOW E;  5E6J A;  3GRR A;  1JR3 A;  3GLI A;  2C96 A;  2C9O A;  4QNR A;  3WHK A;  3J2P B;  4DBG B;  1NVM A;  2ZAN A;  3J27 B;  3C9P A;  2CHQ A;  1C1K A;  1GJT A;  2QP9 X;  4B7H A;  1V34 A;  3IHP A;  1TH3 A;  3E9S A;  3GRY A;  1K82 A;  4LF9 M;  4L8R C;  1FNN A;  3AFH A;  3GLG B;  2LH0 A;  3VK7 A;  4XGI A;  2RGH A;  2XSZ D;  4CJ6 A;  1RU3 A;  1I94 M;  3U60 A;  2KA6 B;  3DA1 A;  1XXH B;  1DGG A;  2JWS A;  1IXS A;  3VLF B;  1NJF A;  3RFW A;  2R46 A;  5EXS A;  2V1U A;  1PJQ A;  2L4F A;  2UU9 M;  2YR0 A;  1WJ7 A;  3TL4 X;  3J7A S;  2BJV A;  3B7Q A;  1PM5 A;  4D81 A;  1DGH B;  4DUY M;  1K3X A;  2CHV A;  4B3S M;  3B7Z A;  1W5S A;  3K9P A;  2XH9 A;  1VDL A;  4JI0 M;  1IN8 A;  4AQY M;  4AI6 A;  4B08 A;  1ORY B;  2B3T A;  2KZS A;  3M6A A;  4LRS A;  1MN3 A;  5DFL A;  3QYE A;  5ITT A;  3SHG B;  1OIP A;  2KDL A;  2UXC M;  1ZQ9 A;  4IJF A;  1N75 A;  2H1R A;  1EE8 A;  3KS8 A;  3U6M A;  3DZD A;  3K9O A;  1K3W A;  2Z4R A;  2LTU A;  2K47 A;  2G5G X;  2Z8Y M;  4GH9 A;  3W68 A;  2F5O A;  3LCV B;  2HHH M;  1VG5 A;  1IY2 A;  3R9X B;  1DGF A;  5EP3 A;  5LMN M;  4JI5 M;  2Z4S A;  1QDR A;  4HL4 A;  5KPT A;  2R65 A;  3KVW A;  3TQS A;  4A3V B;  1Z5B A;  3LVW A;  1Q02 A;  3GO8 A;  3R8F A;  5F3W A;  2XFS A;  4M9X A;  4NOO B;  1IXZ A;  5IT9 S;  3U6S A;  1XNR M;  1NV9 A;  5EP2 A;  4NSR A;  3UGJ A;  2R6F A;  4IBJ A;  4X64 M;  5IZ7 D;  2QZ4 A;  1PJT A;  1CUK A;  1V33 A;  2M5Z A;  2O01 F;  3IG8 A;  4CIS A;  3U5Z B;  2MRO B;  4LGM A;  2VF8 A;  2EO2 A;  4DR7 M;  3GLH A;  3I4V A;  2ZBK B;  1NV8 A;  3THG A;  1C7Y A;  2R18 A;  2VF7 A;  2J7N A;  4PCZ A;  3MMP A;  1IY0 A;  2DHY A;  4LGY A;  2R45 A;  1E9S A;  1QZM A;  3GPX A;  2QSF X;  3T1Y M;  4LG2 A;  1G4A E;  2LWX A;  4FWG A;  3SAU A;  1G59 A;  4WP2 A;  2WZJ A;  2CE7 A;  3PNY A;  1VDD A;  4LFB M;  1SXJ B;  2DWM A;  2C99 A;  2XGN A;  3HY5 A;  5BR8 M;  3L29 A;  2UUA M;  2L6O A;  4F2L A;  3HHZ A;  4D80 A;  2VII A;  4GC9 A;  4LY6 A;  4NRV A;  3CF0 A;  1PJI A;  4DR3 M;  5ITU A;  5LMU M;  5KPZ A;  2KNV A;  1TH4 A;  3A98 B;  3FTD A;  4DR4 M;  2O5R A;  1NHW C;  5FLX S;  2JZ0 A;  3KS4 A;  3TE6 A;  3U6L A;  1JB0 F;  2KHH A;  2EJS A;  2XLJ A;  1Z5C A;  3IEC A;  3KSJ A;  4LJ5 A;  2OOA A;  3SC3 A;  1GVN A;  4Z6Y A; 
#chains in the Genus database with same CATH homology
 2DAM A;  2LVO C;  2ZTC A;  2JP7 A;  2DEN A;  1VEK A;  2O25 A;  4G3O A;  1E94 E;  2JY5 A;  2KNA A;  3GLF E;  1ZV1 A;  1G3I A;  2H5X A;  1P3Q Q;  1WHC A;  4Q7J A;  1GO5 A;  2DZL A;  2DKL A;  2K0B X;  1IFY A;  4DBG B;  3FRH A;  1BVS A;  1UFZ A;  1V92 A;  2DAE A;  2DI0 A;  3IHP A;  1YLA A;  3H4J A;  2HAK A;  2JUJ A;  2LVN C;  5JI2 E;  2DNA A;  2QHO B;  2KNZ A;  2JY7 A;  3B89 A;  1DO2 A;  1WGN A;  1EFU B;  1PGY A;  1TTE A;  1ZMV A;  1G41 A;  3GLH E;  1ZMU A;  1IXS A;  2DAI A;  1OTR A;  2L4F A;  1WJ7 A;  3GLG E;  1VQ1 A;  2DAG A;  2JZ1 A;  3K9P A;  1VDL A;  3BBZ A;  1XXH E;  1T43 A;  1A5T A;  2B3T A;  5DFL A;  1MN3 A;  2CP8 A;  2HWJ A;  2OO9 A;  1SG9 A;  2MJ5 B;  2JY8 A;  1HQY E;  2ZTD A;  3K9O A;  4GEW A;  2LTU A;  1DO0 A;  3LCV B;  1XB2 B;  2QNJ A;  1OAI A;  1VG5 A;  1QZE A;  2LBC A;  1OKS A;  1R4G A;  1AIP C;  1T6O A;  1KYI A;  2LVQ D;  1Q02 A;  1TR8 A;  2DAK A;  2G3Q A;  2BWE A;  1NV9 A;  3E21 A;  4R71 A;  1HJP A;  2RRU A;  3GLI E;  2R0I A;  1IM2 A;  1CUK A;  3LCU A;  2JY6 B;  1OQY A;  2MRO B;  1VEG A;  2L4E A;  4F1I A;  1WR1 B;  1NV8 A;  3FE3 A;  1C7Y A;  3MMP A;  2DHY A;  2L2D A;  2QSF X;  1G4A E;  2MGW A;  2BWB A;  1WIV A;  4WP2 A;  2WZJ A;  1HT2 E;  1ZMW A;  2OOB A;  2EKF A;  3T6P A;  3F92 A;  4F2L A;  4HEO A;  2LVA A;  3FRI A;  1F4I A;  1WGL A;  2JNH A;  1JR3 E;  2K9D A;  3E46 A;  1HT1 E;  2KNV A;  2CWB A;  1Y8G A;  2JZ0 A;  2EKK A;  1DV0 A;  1VEJ A;  2MR9 A;  2LVP C;  2KHH A;  2EJS A;  3IEC A;  2OOA A;  4UN2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...