1R4GA

Solution structure of the sendai virus protein x c-subdomain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
KPTMHSLRLVIESSPLSRAEKAAYVKSLSKCKTDQEVKAVMELVEEDIESLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase alpha subunit
publication title Structure and dynamics of the nucleocapsid-binding domain of the Sendai virus phosphoprotein in solution
pubmed doi rcsb
source organism Sendai virus (strain harris)
molecule tags Viral protein, transferase
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1r4gA00
2EJSA 1XB2B 2DNAA 2LVPC 1A5TA 2HAKA 2LVAA 1KYIA 1PGYA 2ZTCA 2QHOB 1Q02A 1IXSA 2DAMA 1G3IA 2HWJA 4R71A 2L4EA 2CWBA 2DAEA 2LVQD 1HT1E 1AIPC 3IHPA 2DAGA 2OOBA 2KHHA 1R4GA 2K9DA 1NV9A 1T43A 2JZ0A 3IECA 1P3QQ 2H5XA 1VDLA 1GO5A 2BWBA 3K9OA 3F92A 2KNVA 2MR9A 2LVNC 2JUJA 2JY6B 1OKSA 3T6PA 2QSFX 2DAKA 1XXHE 1OAIA 1VEGA 1WJ7A 1HT2E 3GLFE 3BBZA 2JP7A 1ZV1A 2ZTDA 2DHYA 3H4JA 1MN3A 1WGLA 4F1IA 4F2LA 4Q7JA 1C7YA 2LBCA 2CP8A 4GEWA 1EFUB 2O25A 1G4AE 1E94E 1ZMVA 3LCVB 3GLHE 1BVSA 2DAIA 2DI0A 2DENA 2KNAA 2JY7A 1UFZA 1HQYE 1TTEA 3E21A 3GLGE 3E46A 4UN2B 1WIVA 1QZEA 5JI2E 1HJPA 3GLIE 1VQ1A 1VEJA 1F4IA 2WZJA 3FRIA 2QNJA 2JY5A 1WR1B 2DZLA 1WGNA 2K0BX 1VG5A 3FRHA 4HEOA 1ZMWA 1DO0A 1TR8A 1IFYA 1T6OA 2KNZA 2MROB 1CUKA 1G41A 2R0IA 2L2DA 2MJ5B 3B89A 1SG9A 4WP2A 1DV0A 2BWEA 2MGWA 2LTUA 2EKFA 1VEKA 1WHCA 2JY8A 2L4FA 1YLAA 2JZ1A 2RRUA 1ZMUA 3LCUA 1NV8A 2G3QA 5DFLA 2B3TA 2OOAA 2OO9A 1JR3E 1OTRA 2DKLA 2JNHA 3MMPA 1Y8GA 4DBGB 4G3OA 3FE3A 3K9PA 2LVOC 1DO2A 1V92A 1OQYA 1IM2A 2EKKA
chains in the Genus database with same CATH superfamily
4IBCA 3U61A 1V33A 1IY2A 1T3TA 2LHGA 1XB2B 2DNAA 2LVPC 3ZH9B 3JR4A 4DR3M 4G4QA 3U5ZA 1KYIA 2X49A 1I4WA 1NHGC 1Q39A 1N75A 4IBGA 1LV7A 2V1CA 4P17A 3KXEC 2J5YA 4EIWA 2LVQD 5EXXA 4M0WA 2WSEF 3CGWA 3LQRA 3PNYA 1Z5BA 2XFTA 3THGA 3QAUA 1OIZA 1K3WA 1G59A 1MJGM 4L16A 2KEBA 4L4UA 3AKZA 3GPXA 2L6OA 1NV9A 1VDDA 2XEPA 4L15A 3Q8GA 3B7ZA 3VDUA 2EA0A 1XMQM 4GHAA 3NWLA 2RKOA 3W68A 3UK6A 1QAMA 1NHWC 2LVNC 2JUJA 2JY6B 1OKSA 1K82A 2RGOA 1XXHE 3B9PA 5DYGA 4D82A 3PVSA 1WJ7A 1I94M 3U6EA 3WHLA 4DV7M 2QZ4A 2JP7A 3I4YA 1ZV1A 3M0EA 4HLQA 2DHYA 4R7GA 1GJSA 5L8RF 3HHYA 4NC6A 4F1IA 4F2LA 3U6SA 3HJSA 3KS4A 2LBCA 2CP8A 4XGIA 4X66M 4LG2A 2KZUA 2XZUA 4CJ6A 1E94E 1QDRA 3U6LA 1XWIA 5EXTA 2LNHC 2YNMD 3HHXA 4JN6A 3HU1A 5DNYA 1UFZA 3E21A 4P16A 2D7GA 3GLHB 1HNZM 3E46A 2HKJA 3A98B 5JI2E 5LMNM 3CTWB 3SARA 4XK8F 4LZJA 4DR1M 1IXRC 1HJPA 5DYIA 3GLIE 2JWSA 4JI2M 1VQ1A 1IXZA 1NJGA 3CF2A 1VEJA 1F4IA 1D0KA 3FRIA 2QNJA 4X65M 2D7HA 2JY5A 1UM8A 4I4LA 3B74A 3U6QA 4AKHA 4LF7M 3W0FA 1WGNA 2H1RA 1IN6A 4REZA 4DV1M 1EE8A 4GRIA 1HQCA 1TH2A 4FWHA 2CV0A 2XSZA 1IXSB 1L8QA 2Y0TA 3J7AS 1JR3A 2CUZA 1DO0A 2DZNB 2QPAA 4LRSA 3SHFA 4D80A 4DV2M 2V1UA 4JI8M 4QNMA 4W5WA 3CF6E 4NXNM 2L2DA 2CHQA 2MJ5B 2Z7JA 2CHGA 2R18A 1SG9A 3CF0A 3LMMA 4M9XA 2LTUA 3PXGA 4I8OA 1QAOA 1J09A 4LF4M 3L2AA 2XGNA 2J7OA 4MGHA 1NSFA 1C1KA 1D0LA 3HKPA 3VKGA 3U6CA 3C3EA 3PNVA 4DV4M 4DR7M 4GH9A 4DR4M 3B7NA 5FSWA 2M60A 3BXWA 3KVWA 3LVWA 3HJ8A 3LVVA 5KQDA 1KSFX 4RKUF 4AZFA 4ITQA 2BJWA 2OOAA 1FJGM 1OTRA 2G8LA 4IBKA 5FTLA 4IJEA 4LF8M 3TWMA 4GC5A 2J7NA 3GLHA 3MMPA 4JXJA 4LJAA 4RF0A 4A3VB 4DBGB 3SMPA 3IG8A 1PRBA 3FE3A 1LTMA 2YR0A 3KOWE 2DWNA 2KA6B 3W67A 1GJTA 4LGYA 3I4VA 1L2DA 1IN5A 4IBBA 4JI0M 1RU3A 2EJSA 4KHPM 2O5RA 3B7QA 1A5TA 3HU3A 5GKNA 2Y0QA 4G6ZA 4G4OA 2C9CA 5ITYA 3TL4X 3L27A 4LF6M 2ZTCA 3GQ5A 2DWMA 2QHOB 3NBIA 2C9OA 1IXSA 3FYCA 1SXJC 3QYEA 1PM5A 4MB7A 1KFVA 1G3IA 4DV0M 2KRKA 2A5YB 4DR2M 2E5LM 3HZJA 3RE8A 4MM3B 1L2CA 3DOAA 4GIPA 4MGZE 2AHMA 2DAGA 4OVZA 4FCTA 3FTFA 2C99A 1JB0F 4QOSA 2KHHA 2VQFM 3FTCA 1TH4A 2XZFA 1ZAEA 3IECA 3SHGB 4NXMM 2CEAA 4JI3M 5EP4A 1XNQM 2BWBA 3ZCBB 2I7PA 5ITUA 1QQWA 2DWZB 1GLNA 4MGYE 5EQTA 3UMMA 1NNJA 1XC8A 1TDHA 4PD2A 3GQ4A 1QAQA 2ZAOA 2QSFX 3U6OA 1X37A 4B3TM 1GABA 1R7RA 2DAKA 1Z5AA 1J5EM 1OIPA 3SMSA 4KT0F 4QNRA 1XXHB 3J80S 2ZTDA 4ANRA 1MN3A 1WGLA 3SAUA 2GQFA 2CE7A 1EFUB 1V34A 5FTKA 4M0DA 4BBAA 3DFZA 3GPPA 3AOEA 3HY5A 4PCZA 1ZMVA 2P5TA 3HX3A 2KZSA 2KNAA 5FTJA 1OJLA 1IY1A 4LGMA 3J7BA 1QZEA 4AG6A 2QBYB 2YFQA 4B7HA 1JQJC 3HU2A 3KSXA 3K1JA 5F3WA 2F5PA 1H6UA 2QENA 3E9SA 3A42A 4IBDA 1YSYA 3E4RA 4B3RM 2GNOA 2WZJA 4AKIA 2UXCM 4AG5A 2KXEA 2DZLA 4QHSA 3V76A 2ZM6M 1IBKM 1TH3A 5C1BA 4IBFA 5ITRA 1E32A 1ZMWA 1TR8A 5FTMA 3QWLA 4I81A 4R3DA 1T6OA 4Z6YA 1SXJE 2ZANA 4B7FA 3U6PA 3VK8A 1TDZA 1QANA 3SAVA 3D8BA 4NSRA 2NQ8C 4WP2A 2BWEA 2MGWA 2KW0A 3JR5A 2HHHM 1G8PA 4LJ4A 2EKFA 3KSJA 3TPZA 3T1YM 4LJ9A 4LRTA 1XXHA 2C5RA 2DZOB 1EIJA 1L2BA 5ITXE 1YUBA 2JZ1A 3R9XB 3PFIA 3UJNA 3FUVA 2F5QA 3OTOM 3HJQA 2OPFA 1WXQA 1ZQ9A 1L1ZA 4LFAM 7CATA 3FUTA 2I7NA 2LH0A 5DFLA 4RF1A 3K2LA 1JR3E 1IN8A 1R6BX 1Z5CA 2EO2A 4B08A 2CV1A 2VIIA 3MJ5A 4G3OA 2VF8A 3K9PA 1IBMM 2DWLA 2QBYA 4GHLA 1DO2A 1V92A 3KP1E 4OVZB 4B7GA 1IM2A 2EKKA 3D8LA 3AFHA 3W0LB 2XLJA 2HAKA 3C58A 2LVAA 3M6AA 1PGYA 3HWSA 5IT9S 5EP1A 1NNUC 1FNNA 2HWJA 2LHCA 2Q2EB 3DA1A 4JI4M 2L4EA 2CWBA 3SAWA 1N77A 1HT1E 1AIPC 1PJTA 4BB9A 3UZUA 4X62M 4GKKM 4K0KM 2UUCM 5FTNA 2ZBKB 5LMUM 4IJFA 2F4VM 2Z4RA 2JZ0A 3MK6A 1IBLM 1P3QQ 2H5XA 4WURA 2FFJA 3L26A 3HHZA 4LJ6A 2UXDM 1NVMA 2WSCF 3VK7A 2R44A 3F92A 4DV5M 2KNVA 2QP9X 4YHHM 2VDBB 3T6PA 1TF0B 1PJQA 1OAIA 4AQYM 4KODA 5FLXS 4CGYB 1E9SA 1HT2E 3GLFE 4DUZM 1YE9A 3BBZA 4S12A 3KS8A 2M5ZA 2V6ZM 4CHTB 3H4JA 1PJJA 4FCWA 4GITA 4Q7JA 2R4JA 5IZ7D 1C7YA 4XBOA 3GRRA 4GEWA 1QZMA 2O25A 5EXSA 4BLCA 3KW6A 5JI3E 1SXJD 3U60B 3KFUG 4B3SM 3WHKA 1NO1A 2VF7A 1DGHB 3LCVB 2QCUA 1IY0A 4GKJM 3RGSA 2UU9M 3L29A 4LJ7A 2DI0A 2DENA 3VLFB 2JY7A 4LFCM 2KRUA 3MHVC 2CHVA 2XFSA 3GLGE 1D0MA 3NBXX 4G4NA 1MU5A 5BPVA 2FE8A 1GVNA 3AJIB 3J2PB 1DGGA 2RGHA 2XF3A 4FD2A 1N78A 2Z8YM 1QUTA 3T15A 5KO3A 3L28A 4DV6M 1MX0A 1QDTA 4PDGA 1WR1B 2BJVA 3M7GA 3TE6A 3ZC7B 2K0BX 3FTEA 4HL4A 3AL0C 1DGFA 4HEOA 4M9SA 3K8ZA 3SBJA 3KP0E 3GRYA 5IREB 4FCVA 5KPTA 2LXEA 3GPUA 1IN7A 2FS1A 1CUKA 2MROB 3FKEA 2FH0A 3KOYE 3KOZE 2X4AA 3RFWA 2DVWB 4LJ5A 2DHRA 4JYAM 3VKHA 1SXJB 3A46A 3B89A 4PT5A 4DV3M 5EJCA 1DV0A 2OQ4A 1G71A 1VEKA 1PJIA 3IG5A 2JY8A 4LY6A 3HGIA 5ITQA 5EP3A 2L4FA 2VQEM 2EUCA 2R4EA 2Z3XA 3KDSE 1GL7A 1R5LA 1YLAA 4GMQA 2RRUA 2R65A 2BNKA 1ZMUA 2Y20A 3U60A 3LQQA 1N33M 3GLIB 2APLA 5KQ8A 2Y21A 2F5NA 4PDIA 1PJSA 5EXPA 4Z8XA 1GKIA 1IN4A 1DGHA 3QYBA 3J27B 2OO9A 2QQ8A 1Z6TA 4AKGA 2YQZA 3SYLA 3SATA 2G5GX 5A2QS 1E9RA 2UUAM 1IQPA 3GRVA 4NOOB 3I01M 1QYRA 2LVOC 2N35A 2C96A 1K3XA 3HHWA 1OQYA 1OAOC 2KDLA 3GPYA 1IFYA 2FNAA 4WW0A 3TQSA 5E6JA 4JI6M 3DZDA 2K6BA 1N36M 2L7HA 3FD9A 1TGUA 3FUUA 4KLNA 3T38A 3C3DA 5H37D 3VDPA 1Q02A 2C98A 3RGPA 2CV2A 5BR8M 2DAMA 1NY5A 4R71A 2R46A 2DAEA 4FVMA 4M9ZA 3VFDA 4RNAA 2W82A 3IHPA 1SXJA 3AV0A 2DXIA 2OOBA 2ZAMA 5IWAM 1XHBA 1HNXM 2XH9A 2Z4SA 3C9PA 4L8RC 1R4GA 2HCBA 2K9DA 1N34M 2MH8A 1XMOM 4JI5M 1T43A 2CRUA 1VDLA 2K47A 4LJ8A 1GO5A 4OU7A 4AW4A 2WSFF 3K9OA 3T1HM 4LFBM 4QOZC 4NRWA 1S3SA 2R45A 3GO8A 3SASA 1J7KA 1Z59A 3AOGA 4NRVA 3SYKA 4X64M 3FYDA 2MR9A 3H4MA 3K92A 5ITXA 3TWLA 1QUSA 3GLIA 2L09A 4L78A 3GRUA 4DR6M 4MGIE 1VEGA 1N32M 4LZZA 1D2NA 2ERCA 4QHTA 4G4RA 4IBJA 3FUXA 3TWKA 2R6FA 3AOEC 3GLFB 4TUWA 4JI1M 1G4AE 1ORYB 5KPZA 3JAMS 3LW5F 4I5SA 4MGKE 1HNWM 4ZPXA 1NY6A 5KPRA 3EIHA 1L1TA 4FWGA 1OFIA 3I51A 4KO8A 4DUYM 2JA2A 4D81A 3GLHE 1BVSA 2DAIA 2LWXA 5C18A 1HQYE 1TTEA 3BOSA 4YY3M 4UN2B 3EIEA 2HL7A 1WIVA 2FOIC 4LCBA 2X8AA 3GLGB 4DR5M 4LF5M 2JXNA 3FTDA 1DGBA 4II7A 3U61B 4OW0A 2UXBM 1NJFA 1HR0M 4OX9M 3GP1A 3U6DA 3U5ZB 1VG5A 3J81S 3FRHA 3U6MA 4CIZA 4L6V6 4NSOB 3SFZA 3Q8XA 4JV5M 2KNZA 4NL4H 4FW9A 1G41A 3KOXE 2R0IA 4AI6A 3A45A 3UGJA 4IIWA 1R2YA 4GC9A 2F5SA 8CATA 1WHCA 4LF9M 1XNRM 1Q3BA 1AUAA 2CFOA 5EP2A 1Q3CA 3GLFA 4FWDA 2UUBM 5E26A 2R62A 3L25A 3R8FA 4B3MM 3LCUA 1NV8A 5ITTA 3GQ3A 1QVRA 1OFHA 3ZQJA 4CISA 2G3QA 3I04M 4Y28F 2B3TA 2XSZD 3SC3A 1JR3D 3ILKA 4IBIA 2DKLA 1W5TA 2JNHA 1Y8GA 2D7EA 4JI7M 4IBEA 1W5SA 1GL6A 3FUWA 2O01F 2L7IA 3GLGA 4MH0E 2F5OA 1R2ZA
chains in the Genus database with same CATH topology
2EJSA 1XB2B 2DNAA 2LVPC 1A5TA 2HAKA 2LVAA 1KYIA 1PGYA 2ZTCA 2QHOB 1Q02A 1IXSA 2DAMA 1G3IA 2HWJA 4R71A 2L4EA 2CWBA 2DAEA 2LVQD 1HT1E 1AIPC 3IHPA 2DAGA 2OOBA 2KHHA 1R4GA 2K9DA 1NV9A 1T43A 2JZ0A 3IECA 1P3QQ 2H5XA 1VDLA 1GO5A 2BWBA 3K9OA 3F92A 2KNVA 2MR9A 2LVNC 2JUJA 2JY6B 1OKSA 3T6PA 2QSFX 2DAKA 1XXHE 1OAIA 1VEGA 1WJ7A 1HT2E 3GLFE 3BBZA 2JP7A 1ZV1A 2ZTDA 2DHYA 3H4JA 1MN3A 1WGLA 4F1IA 4F2LA 4Q7JA 1C7YA 2LBCA 2CP8A 4GEWA 1EFUB 2O25A 1G4AE 1E94E 1ZMVA 3LCVB 3GLHE 1BVSA 2DAIA 2DI0A 2DENA 2KNAA 2JY7A 1UFZA 1HQYE 1TTEA 3E21A 3GLGE 3E46A 4UN2B 1WIVA 1QZEA 5JI2E 1HJPA 3GLIE 1VQ1A 1VEJA 1F4IA 2WZJA 3FRIA 2QNJA 2JY5A 1WR1B 2DZLA 1WGNA 2K0BX 1VG5A 3FRHA 4HEOA 1ZMWA 1DO0A 1TR8A 1IFYA 1T6OA 2KNZA 2MROB 1CUKA 1G41A 2R0IA 2L2DA 2MJ5B 3B89A 1SG9A 4WP2A 1DV0A 2BWEA 2MGWA 2LTUA 2EKFA 1VEKA 1WHCA 2JY8A 2L4FA 1YLAA 2JZ1A 2RRUA 1ZMUA 3LCUA 1NV8A 2G3QA 5DFLA 2B3TA 2OOAA 2OO9A 1JR3E 1OTRA 2DKLA 2JNHA 3MMPA 1Y8GA 4DBGB 4G3OA 3FE3A 3K9PA 2LVOC 1DO2A 1V92A 1OQYA 1IM2A 2EKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJS A;  1XB2 B;  2DNA A;  2LVP C;  1A5T A;  2HAK A;  2LVA A;  1KYI A;  1PGY A;  2ZTC A;  2QHO B;  1Q02 A;  1IXS A;  2DAM A;  1G3I A;  2HWJ A;  4R71 A;  2L4E A;  2CWB A;  2DAE A;  2LVQ D;  1HT1 E;  1AIP C;  3IHP A;  2DAG A;  2OOB A;  2KHH A;  1R4G A;  2K9D A;  1NV9 A;  1T43 A;  2JZ0 A;  3IEC A;  1P3Q Q;  2H5X A;  1VDL A;  1GO5 A;  2BWB A;  3K9O A;  3F92 A;  2KNV A;  2MR9 A;  2LVN C;  2JUJ A;  2JY6 B;  1OKS A;  3T6P A;  2QSF X;  2DAK A;  1XXH E;  1OAI A;  1VEG A;  1WJ7 A;  1HT2 E;  3GLF E;  3BBZ A;  2JP7 A;  1ZV1 A;  2ZTD A;  2DHY A;  3H4J A;  1MN3 A;  1WGL A;  4F1I A;  4F2L A;  4Q7J A;  1C7Y A;  2LBC A;  2CP8 A;  4GEW A;  1EFU B;  2O25 A;  1G4A E;  1E94 E;  1ZMV A;  3LCV B;  3GLH E;  1BVS A;  2DAI A;  2DI0 A;  2DEN A;  2KNA A;  2JY7 A;  1UFZ A;  1HQY E;  1TTE A;  3E21 A;  3GLG E;  3E46 A;  4UN2 B;  1WIV A;  1QZE A;  5JI2 E;  1HJP A;  3GLI E;  1VQ1 A;  1VEJ A;  1F4I A;  2WZJ A;  3FRI A;  2QNJ A;  2JY5 A;  1WR1 B;  2DZL A;  1WGN A;  2K0B X;  1VG5 A;  3FRH A;  4HEO A;  1ZMW A;  1DO0 A;  1TR8 A;  1IFY A;  1T6O A;  2KNZ A;  2MRO B;  1CUK A;  1G41 A;  2R0I A;  2L2D A;  2MJ5 B;  3B89 A;  1SG9 A;  4WP2 A;  1DV0 A;  2BWE A;  2MGW A;  2LTU A;  2EKF A;  1VEK A;  1WHC A;  2JY8 A;  2L4F A;  1YLA A;  2JZ1 A;  2RRU A;  1ZMU A;  3LCU A;  1NV8 A;  2G3Q A;  5DFL A;  2B3T A;  2OOA A;  2OO9 A;  1JR3 E;  1OTR A;  2DKL A;  2JNH A;  3MMP A;  1Y8G A;  4DBG B;  4G3O A;  3FE3 A;  3K9P A;  2LVO C;  1DO2 A;  1V92 A;  1OQY A;  1IM2 A;  2EKK A; 
#chains in the Genus database with same CATH topology
 4IBC A;  3U61 A;  1V33 A;  1IY2 A;  1T3T A;  2LHG A;  1XB2 B;  2DNA A;  2LVP C;  3ZH9 B;  3JR4 A;  4DR3 M;  4G4Q A;  3U5Z A;  1KYI A;  2X49 A;  1I4W A;  1NHG C;  1Q39 A;  1N75 A;  4IBG A;  1LV7 A;  2V1C A;  4P17 A;  3KXE C;  2J5Y A;  4EIW A;  2LVQ D;  5EXX A;  4M0W A;  2WSE F;  3CGW A;  3LQR A;  3PNY A;  1Z5B A;  2XFT A;  3THG A;  3QAU A;  1OIZ A;  1K3W A;  1G59 A;  1MJG M;  4L16 A;  2KEB A;  4L4U A;  3AKZ A;  3GPX A;  2L6O A;  1NV9 A;  1VDD A;  2XEP A;  4L15 A;  3Q8G A;  3B7Z A;  3VDU A;  2EA0 A;  1XMQ M;  4GHA A;  3NWL A;  2RKO A;  3W68 A;  3UK6 A;  1QAM A;  1NHW C;  2LVN C;  2JUJ A;  2JY6 B;  1OKS A;  1K82 A;  2RGO A;  1XXH E;  3B9P A;  5DYG A;  4D82 A;  3PVS A;  1WJ7 A;  1I94 M;  3U6E A;  3WHL A;  4DV7 M;  2QZ4 A;  2JP7 A;  3I4Y A;  1ZV1 A;  3M0E A;  4HLQ A;  2DHY A;  4R7G A;  1GJS A;  5L8R F;  3HHY A;  4NC6 A;  4F1I A;  4F2L A;  3U6S A;  3HJS A;  3KS4 A;  2LBC A;  2CP8 A;  4XGI A;  4X66 M;  4LG2 A;  2KZU A;  2XZU A;  4CJ6 A;  1E94 E;  1QDR A;  3U6L A;  1XWI A;  5EXT A;  2LNH C;  2YNM D;  3HHX A;  4JN6 A;  3HU1 A;  5DNY A;  1UFZ A;  3E21 A;  4P16 A;  2D7G A;  3GLH B;  1HNZ M;  3E46 A;  2HKJ A;  3A98 B;  5JI2 E;  5LMN M;  3CTW B;  3SAR A;  4XK8 F;  4LZJ A;  4DR1 M;  1IXR C;  1HJP A;  5DYI A;  3GLI E;  2JWS A;  4JI2 M;  1VQ1 A;  1IXZ A;  1NJG A;  3CF2 A;  1VEJ A;  1F4I A;  1D0K A;  3FRI A;  2QNJ A;  4X65 M;  2D7H A;  2JY5 A;  1UM8 A;  4I4L A;  3B74 A;  3U6Q A;  4AKH A;  4LF7 M;  3W0F A;  1WGN A;  2H1R A;  1IN6 A;  4REZ A;  4DV1 M;  1EE8 A;  4GRI A;  1HQC A;  1TH2 A;  4FWH A;  2CV0 A;  2XSZ A;  1IXS B;  1L8Q A;  2Y0T A;  3J7A S;  1JR3 A;  2CUZ A;  1DO0 A;  2DZN B;  2QPA A;  4LRS A;  3SHF A;  4D80 A;  4DV2 M;  2V1U A;  4JI8 M;  4QNM A;  4W5W A;  3CF6 E;  4NXN M;  2L2D A;  2CHQ A;  2MJ5 B;  2Z7J A;  2CHG A;  2R18 A;  1SG9 A;  3CF0 A;  3LMM A;  4M9X A;  2LTU A;  3PXG A;  4I8O A;  1QAO A;  1J09 A;  4LF4 M;  3L2A A;  2XGN A;  2J7O A;  4MGH A;  1NSF A;  1C1K A;  1D0L A;  3HKP A;  3VKG A;  3U6C A;  3C3E A;  3PNV A;  4DV4 M;  4DR7 M;  4GH9 A;  4DR4 M;  3B7N A;  5FSW A;  2M60 A;  3BXW A;  3KVW A;  3LVW A;  3HJ8 A;  3LVV A;  5KQD A;  1KSF X;  4RKU F;  4AZF A;  4ITQ A;  2BJW A;  2OOA A;  1FJG M;  1OTR A;  2G8L A;  4IBK A;  5FTL A;  4IJE A;  4LF8 M;  3TWM A;  4GC5 A;  2J7N A;  3GLH A;  3MMP A;  4JXJ A;  4LJA A;  4RF0 A;  4A3V B;  4DBG B;  3SMP A;  3IG8 A;  1PRB A;  3FE3 A;  1LTM A;  2YR0 A;  3KOW E;  2DWN A;  2KA6 B;  3W67 A;  1GJT A;  4LGY A;  3I4V A;  1L2D A;  1IN5 A;  4IBB A;  4JI0 M;  1RU3 A;  2EJS A;  4KHP M;  2O5R A;  3B7Q A;  1A5T A;  3HU3 A;  5GKN A;  2Y0Q A;  4G6Z A;  4G4O A;  2C9C A;  5ITY A;  3TL4 X;  3L27 A;  4LF6 M;  2ZTC A;  3GQ5 A;  2DWM A;  2QHO B;  3NBI A;  2C9O A;  1IXS A;  3FYC A;  1SXJ C;  3QYE A;  1PM5 A;  4MB7 A;  1KFV A;  1G3I A;  4DV0 M;  2KRK A;  2A5Y B;  4DR2 M;  2E5L M;  3HZJ A;  3RE8 A;  4MM3 B;  1L2C A;  3DOA A;  4GIP A;  4MGZ E;  2AHM A;  2DAG A;  4OVZ A;  4FCT A;  3FTF A;  2C99 A;  1JB0 F;  4QOS A;  2KHH A;  2VQF M;  3FTC A;  1TH4 A;  2XZF A;  1ZAE A;  3IEC A;  3SHG B;  4NXM M;  2CEA A;  4JI3 M;  5EP4 A;  1XNQ M;  2BWB A;  3ZCB B;  2I7P A;  5ITU A;  1QQW A;  2DWZ B;  1GLN A;  4MGY E;  5EQT A;  3UMM A;  1NNJ A;  1XC8 A;  1TDH A;  4PD2 A;  3GQ4 A;  1QAQ A;  2ZAO A;  2QSF X;  3U6O A;  1X37 A;  4B3T M;  1GAB A;  1R7R A;  2DAK A;  1Z5A A;  1J5E M;  1OIP A;  3SMS A;  4KT0 F;  4QNR A;  1XXH B;  3J80 S;  2ZTD A;  4ANR A;  1MN3 A;  1WGL A;  3SAU A;  2GQF A;  2CE7 A;  1EFU B;  1V34 A;  5FTK A;  4M0D A;  4BBA A;  3DFZ A;  3GPP A;  3AOE A;  3HY5 A;  4PCZ A;  1ZMV A;  2P5T A;  3HX3 A;  2KZS A;  2KNA A;  5FTJ A;  1OJL A;  1IY1 A;  4LGM A;  3J7B A;  1QZE A;  4AG6 A;  2QBY B;  2YFQ A;  4B7H A;  1JQJ C;  3HU2 A;  3KSX A;  3K1J A;  5F3W A;  2F5P A;  1H6U A;  2QEN A;  3E9S A;  3A42 A;  4IBD A;  1YSY A;  3E4R A;  4B3R M;  2GNO A;  2WZJ A;  4AKI A;  2UXC M;  4AG5 A;  2KXE A;  2DZL A;  4QHS A;  3V76 A;  2ZM6 M;  1IBK M;  1TH3 A;  5C1B A;  4IBF A;  5ITR A;  1E32 A;  1ZMW A;  1TR8 A;  5FTM A;  3QWL A;  4I81 A;  4R3D A;  1T6O A;  4Z6Y A;  1SXJ E;  2ZAN A;  4B7F A;  3U6P A;  3VK8 A;  1TDZ A;  1QAN A;  3SAV A;  3D8B A;  4NSR A;  2NQ8 C;  4WP2 A;  2BWE A;  2MGW A;  2KW0 A;  3JR5 A;  2HHH M;  1G8P A;  4LJ4 A;  2EKF A;  3KSJ A;  3TPZ A;  3T1Y M;  4LJ9 A;  4LRT A;  1XXH A;  2C5R A;  2DZO B;  1EIJ A;  1L2B A;  5ITX E;  1YUB A;  2JZ1 A;  3R9X B;  3PFI A;  3UJN A;  3FUV A;  2F5Q A;  3OTO M;  3HJQ A;  2OPF A;  1WXQ A;  1ZQ9 A;  1L1Z A;  4LFA M;  7CAT A;  3FUT A;  2I7N A;  2LH0 A;  5DFL A;  4RF1 A;  3K2L A;  1JR3 E;  1IN8 A;  1R6B X;  1Z5C A;  2EO2 A;  4B08 A;  2CV1 A;  2VII A;  3MJ5 A;  4G3O A;  2VF8 A;  3K9P A;  1IBM M;  2DWL A;  2QBY A;  4GHL A;  1DO2 A;  1V92 A;  3KP1 E;  4OVZ B;  4B7G A;  1IM2 A;  2EKK A;  3D8L A;  3AFH A;  3W0L B;  2XLJ A;  2HAK A;  3C58 A;  2LVA A;  3M6A A;  1PGY A;  3HWS A;  5IT9 S;  5EP1 A;  1NNU C;  1FNN A;  2HWJ A;  2LHC A;  2Q2E B;  3DA1 A;  4JI4 M;  2L4E A;  2CWB A;  3SAW A;  1N77 A;  1HT1 E;  1AIP C;  1PJT A;  4BB9 A;  3UZU A;  4X62 M;  4GKK M;  4K0K M;  2UUC M;  5FTN A;  2ZBK B;  5LMU M;  4IJF A;  2F4V M;  2Z4R A;  2JZ0 A;  3MK6 A;  1IBL M;  1P3Q Q;  2H5X A;  4WUR A;  2FFJ A;  3L26 A;  3HHZ A;  4LJ6 A;  2UXD M;  1NVM A;  2WSC F;  3VK7 A;  2R44 A;  3F92 A;  4DV5 M;  2KNV A;  2QP9 X;  4YHH M;  2VDB B;  3T6P A;  1TF0 B;  1PJQ A;  1OAI A;  4AQY M;  4KOD A;  5FLX S;  4CGY B;  1E9S A;  1HT2 E;  3GLF E;  4DUZ M;  1YE9 A;  3BBZ A;  4S12 A;  3KS8 A;  2M5Z A;  2V6Z M;  4CHT B;  3H4J A;  1PJJ A;  4FCW A;  4GIT A;  4Q7J A;  2R4J A;  5IZ7 D;  1C7Y A;  4XBO A;  3GRR A;  4GEW A;  1QZM A;  2O25 A;  5EXS A;  4BLC A;  3KW6 A;  5JI3 E;  1SXJ D;  3U60 B;  3KFU G;  4B3S M;  3WHK A;  1NO1 A;  2VF7 A;  1DGH B;  3LCV B;  2QCU A;  1IY0 A;  4GKJ M;  3RGS A;  2UU9 M;  3L29 A;  4LJ7 A;  2DI0 A;  2DEN A;  3VLF B;  2JY7 A;  4LFC M;  2KRU A;  3MHV C;  2CHV A;  2XFS A;  3GLG E;  1D0M A;  3NBX X;  4G4N A;  1MU5 A;  5BPV A;  2FE8 A;  1GVN A;  3AJI B;  3J2P B;  1DGG A;  2RGH A;  2XF3 A;  4FD2 A;  1N78 A;  2Z8Y M;  1QUT A;  3T15 A;  5KO3 A;  3L28 A;  4DV6 M;  1MX0 A;  1QDT A;  4PDG A;  1WR1 B;  2BJV A;  3M7G A;  3TE6 A;  3ZC7 B;  2K0B X;  3FTE A;  4HL4 A;  3AL0 C;  1DGF A;  4HEO A;  4M9S A;  3K8Z A;  3SBJ A;  3KP0 E;  3GRY A;  5IRE B;  4FCV A;  5KPT A;  2LXE A;  3GPU A;  1IN7 A;  2FS1 A;  1CUK A;  2MRO B;  3FKE A;  2FH0 A;  3KOY E;  3KOZ E;  2X4A A;  3RFW A;  2DVW B;  4LJ5 A;  2DHR A;  4JYA M;  3VKH A;  1SXJ B;  3A46 A;  3B89 A;  4PT5 A;  4DV3 M;  5EJC A;  1DV0 A;  2OQ4 A;  1G71 A;  1VEK A;  1PJI A;  3IG5 A;  2JY8 A;  4LY6 A;  3HGI A;  5ITQ A;  5EP3 A;  2L4F A;  2VQE M;  2EUC A;  2R4E A;  2Z3X A;  3KDS E;  1GL7 A;  1R5L A;  1YLA A;  4GMQ A;  2RRU A;  2R65 A;  2BNK A;  1ZMU A;  2Y20 A;  3U60 A;  3LQQ A;  1N33 M;  3GLI B;  2APL A;  5KQ8 A;  2Y21 A;  2F5N A;  4PDI A;  1PJS A;  5EXP A;  4Z8X A;  1GKI A;  1IN4 A;  1DGH A;  3QYB A;  3J27 B;  2OO9 A;  2QQ8 A;  1Z6T A;  4AKG A;  2YQZ A;  3SYL A;  3SAT A;  2G5G X;  5A2Q S;  1E9R A;  2UUA M;  1IQP A;  3GRV A;  4NOO B;  3I01 M;  1QYR A;  2LVO C;  2N35 A;  2C96 A;  1K3X A;  3HHW A;  1OQY A;  1OAO C;  2KDL A;  3GPY A;  1IFY A;  2FNA A;  4WW0 A;  3TQS A;  5E6J A;  4JI6 M;  3DZD A;  2K6B A;  1N36 M;  2L7H A;  3FD9 A;  1TGU A;  3FUU A;  4KLN A;  3T38 A;  3C3D A;  5H37 D;  3VDP A;  1Q02 A;  2C98 A;  3RGP A;  2CV2 A;  5BR8 M;  2DAM A;  1NY5 A;  4R71 A;  2R46 A;  2DAE A;  4FVM A;  4M9Z A;  3VFD A;  4RNA A;  2W82 A;  3IHP A;  1SXJ A;  3AV0 A;  2DXI A;  2OOB A;  2ZAM A;  5IWA M;  1XHB A;  1HNX M;  2XH9 A;  2Z4S A;  3C9P A;  4L8R C;  1R4G A;  2HCB A;  2K9D A;  1N34 M;  2MH8 A;  1XMO M;  4JI5 M;  1T43 A;  2CRU A;  1VDL A;  2K47 A;  4LJ8 A;  1GO5 A;  4OU7 A;  4AW4 A;  2WSF F;  3K9O A;  3T1H M;  4LFB M;  4QOZ C;  4NRW A;  1S3S A;  2R45 A;  3GO8 A;  3SAS A;  1J7K A;  1Z59 A;  3AOG A;  4NRV A;  3SYK A;  4X64 M;  3FYD A;  2MR9 A;  3H4M A;  3K92 A;  5ITX A;  3TWL A;  1QUS A;  3GLI A;  2L09 A;  4L78 A;  3GRU A;  4DR6 M;  4MGI E;  1VEG A;  1N32 M;  4LZZ A;  1D2N A;  2ERC A;  4QHT A;  4G4R A;  4IBJ A;  3FUX A;  3TWK A;  2R6F A;  3AOE C;  3GLF B;  4TUW A;  4JI1 M;  1G4A E;  1ORY B;  5KPZ A;  3JAM S;  3LW5 F;  4I5S A;  4MGK E;  1HNW M;  4ZPX A;  1NY6 A;  5KPR A;  3EIH A;  1L1T A;  4FWG A;  1OFI A;  3I51 A;  4KO8 A;  4DUY M;  2JA2 A;  4D81 A;  3GLH E;  1BVS A;  2DAI A;  2LWX A;  5C18 A;  1HQY E;  1TTE A;  3BOS A;  4YY3 M;  4UN2 B;  3EIE A;  2HL7 A;  1WIV A;  2FOI C;  4LCB A;  2X8A A;  3GLG B;  4DR5 M;  4LF5 M;  2JXN A;  3FTD A;  1DGB A;  4II7 A;  3U61 B;  4OW0 A;  2UXB M;  1NJF A;  1HR0 M;  4OX9 M;  3GP1 A;  3U6D A;  3U5Z B;  1VG5 A;  3J81 S;  3FRH A;  3U6M A;  4CIZ A;  4L6V 6;  4NSO B;  3SFZ A;  3Q8X A;  4JV5 M;  2KNZ A;  4NL4 H;  4FW9 A;  1G41 A;  3KOX E;  2R0I A;  4AI6 A;  3A45 A;  3UGJ A;  4IIW A;  1R2Y A;  4GC9 A;  2F5S A;  8CAT A;  1WHC A;  4LF9 M;  1XNR M;  1Q3B A;  1AUA A;  2CFO A;  5EP2 A;  1Q3C A;  3GLF A;  4FWD A;  2UUB M;  5E26 A;  2R62 A;  3L25 A;  3R8F A;  4B3M M;  3LCU A;  1NV8 A;  5ITT A;  3GQ3 A;  1QVR A;  1OFH A;  3ZQJ A;  4CIS A;  2G3Q A;  3I04 M;  4Y28 F;  2B3T A;  2XSZ D;  3SC3 A;  1JR3 D;  3ILK A;  4IBI A;  2DKL A;  1W5T A;  2JNH A;  1Y8G A;  2D7E A;  4JI7 M;  4IBE A;  1W5S A;  1GL6 A;  3FUW A;  2O01 F;  2L7I A;  3GLG A;  4MH0 E;  2F5O A;  1R2Z A; 
#chains in the Genus database with same CATH homology
 2EJS A;  1XB2 B;  2DNA A;  2LVP C;  1A5T A;  2HAK A;  2LVA A;  1KYI A;  1PGY A;  2ZTC A;  2QHO B;  1Q02 A;  1IXS A;  2DAM A;  1G3I A;  2HWJ A;  4R71 A;  2L4E A;  2CWB A;  2DAE A;  2LVQ D;  1HT1 E;  1AIP C;  3IHP A;  2DAG A;  2OOB A;  2KHH A;  1R4G A;  2K9D A;  1NV9 A;  1T43 A;  2JZ0 A;  3IEC A;  1P3Q Q;  2H5X A;  1VDL A;  1GO5 A;  2BWB A;  3K9O A;  3F92 A;  2KNV A;  2MR9 A;  2LVN C;  2JUJ A;  2JY6 B;  1OKS A;  3T6P A;  2QSF X;  2DAK A;  1XXH E;  1OAI A;  1VEG A;  1WJ7 A;  1HT2 E;  3GLF E;  3BBZ A;  2JP7 A;  1ZV1 A;  2ZTD A;  2DHY A;  3H4J A;  1MN3 A;  1WGL A;  4F1I A;  4F2L A;  4Q7J A;  1C7Y A;  2LBC A;  2CP8 A;  4GEW A;  1EFU B;  2O25 A;  1G4A E;  1E94 E;  1ZMV A;  3LCV B;  3GLH E;  1BVS A;  2DAI A;  2DI0 A;  2DEN A;  2KNA A;  2JY7 A;  1UFZ A;  1HQY E;  1TTE A;  3E21 A;  3GLG E;  3E46 A;  4UN2 B;  1WIV A;  1QZE A;  5JI2 E;  1HJP A;  3GLI E;  1VQ1 A;  1VEJ A;  1F4I A;  2WZJ A;  3FRI A;  2QNJ A;  2JY5 A;  1WR1 B;  2DZL A;  1WGN A;  2K0B X;  1VG5 A;  3FRH A;  4HEO A;  1ZMW A;  1DO0 A;  1TR8 A;  1IFY A;  1T6O A;  2KNZ A;  2MRO B;  1CUK A;  1G41 A;  2R0I A;  2L2D A;  2MJ5 B;  3B89 A;  1SG9 A;  4WP2 A;  1DV0 A;  2BWE A;  2MGW A;  2LTU A;  2EKF A;  1VEK A;  1WHC A;  2JY8 A;  2L4F A;  1YLA A;  2JZ1 A;  2RRU A;  1ZMU A;  3LCU A;  1NV8 A;  2G3Q A;  5DFL A;  2B3T A;  2OOA A;  2OO9 A;  1JR3 E;  1OTR A;  2DKL A;  2JNH A;  3MMP A;  1Y8G A;  4DBG B;  4G3O A;  3FE3 A;  3K9P A;  2LVO C;  1DO2 A;  1V92 A;  1OQY A;  1IM2 A;  2EKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...