1R4GA

Solution structure of the sendai virus protein x c-subdomain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
KPTMHSLRLVIESSPLSRAEKAAYVKSLSKCKTDQEVKAVMELVEEDIESLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, transferase
molecule keywords RNA polymerase alpha subunit
publication title Structure and dynamics of the nucleocapsid-binding domain of the Sendai virus phosphoprotein in solution
pubmed doi rcsb
source organism Sendai virus (strain harris)
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1r4gA00
2B3TA 2JNHA 2R0IA 2H5XA 2DAEA 3FRIA 1AIPC 3E21A 2K9DA 1CUKA 2MR9A 1EFUB 1TR8A 1VDLA 2DENA 3IECA 1VEKA 2EKFA 3FRHA 3GLFE 2ZTDA 2WZJA 2DZLA 1OQYA 1IFYA 1OAIA 1OKSA 2KNAA 2LVNC 2JZ1A 4GEWA 1G3IA 1ZMVA 3GLGE 2DAMA 2DI0A 2KNVA 2G3QA 1PGYA 1TTEA 1WGNA 3LCVB 4R71A 1KYIA 1QZEA 2HWJA 2JY8A 2K0BX 2MJ5B 2QNJA 2DAGA 3GLIE 1HJPA 1Q02A 3F92A 3K9PA 1NV9A 3H4JA 1HT2E 4HEOA 1Y8GA 2MGWA 4G3OA 1GO5A 2OO9A 3K9OA 2L2DA 1NV8A 1E94E 3BBZA 1G41A 4F1IA 2DAKA 3IHPA 4WP2A 2QSFX 4F2LA 2LVAA 2JY6B 2O25A 1A5TA 2CWBA 1YLAA 2HAKA 2RRUA 4Q7JA 5DFLA 1HT1E 1IXSA 2BWBA 2ZTCA 2LVQD 1T6OA 1WGLA 2DHYA 3E46A 2LVOC 1HQYE 2KNZA 2JY5A 1WJ7A 2LTUA 1DO0A 3T6PA 1SG9A 1XXHE 1JR3E 1VQ1A 3LCUA 1VEJA 2L4FA 1DO2A 1ZMWA 1C7YA 1WIVA 2DAIA 3MMPA 1DV0A 1ZMUA 2JZ0A 2OOAA 2MROB 2EKKA 4UN2B 1IM2A 4DBGB 1T43A 1ZV1A 2CP8A 2LBCA 1VEGA 2KHHA 2DKLA 2L4EA 1P3QQ 1VG5A 1WHCA 2DNAA 1WR1B 3GLHE 1BVSA 2OOBA 5JI2E 1XB2B 2LVPC 2EJSA 1MN3A 1G4AE 1F4IA 1OTRA 1V92A 2JUJA 1UFZA 2JY7A 2BWEA 3B89A 3FE3A 1R4GA 2QHOB 2JP7A
chains in the Genus database with same CATH superfamily
2GQFA 3LVWA 2HKJA 4LRTA 4LZZA 4Z6YA 3SAVA 2RKOA 4JI4M 2XGNA 3AKZA 4NL4H 2J7OA 4LJ5A 4I8OA 3BOSA 1NSFA 2DAEA 4CHTB 3FRIA 4FCVA 4FVMA 4QNRA 3SATA 4M9ZA 4LF7M 1RU3A 2K9DA 1VDLA 3J81S 1VEKA 4AG5A 2E5LM 2R18A 3HJSA 4PDGA 1IFYA 3ILKA 3GLGB 4KODA 4W5WA 4R7GA 1SXJA 1OFHA 1HNXM 4LF5M 4IJFA 3I51A 3RFWA 1W5TA 1Q3BA 1WGNA 4RNAA 5EXPA 4D81A 4XK8F 1QDTA 1J09A 3E9SA 2OQ4A 1KFVA 3GLIB 5EP4A 2K47A 2MJ5B 2QNJA 3FUVA 3FTEA 4LG2A 2KRKA 1DGGA 4IBCA 1HT2E 3HHYA 1UM8A 2QENA 2UU9M 1Y8GA 4MGZE 3FYCA 2KXEA 4FCWA 1NNUC 4WURA 4LJ9A 1NV8A 3SARA 1TH4A 4L15A 4MM3B 4IJEA 3KXEC 3T1YM 3KDSE 2XZUA 3KVWA 3A42A 2VQFM 2DAKA 4F2LA 3GLHA 3GQ5A 1X37A 2D7GA 4B08A 3T38A 2DWNA 3J7AS 1ORYB 3VDPA 2XLJA 4DV0M 4IBJA 2C9CA 1YLAA 4MGKE 1YE9A 3FD9A 3JAMS 4GKKM 2HAKA 4Q7JA 1FNNA 1TH3A 1IXSA 1IY0A 1R2YA 4JV5M 1NJGA 2BJWA 4OVZA 4EIWA 1D0KA 2DHYA 1C1KA 3U6EA 4DV7M 3B7NA 3SBJA 3SAWA 3VKGA 1QUTA 3TQSA 5IWAM 1K82A 4PD2A 2WSCF 1PJIA 2D7EA 2JY5A 2DXIA 4CJ6A 1HQCA 3R9XB 3NWLA 4AQYM 3W67A 1IN5A 1N75A 4X66M 4I5SA 1NHWC 4QHTA 4JI1M 5DYIA 3C3EA 2CV0A 1G71A 1XXHE 3D8LA 4M9SA 3WHKA 4IBFA 2KA6B 5ITXE 1DV0A 4IBGA 4NXMM 4JI0M 4IIWA 4CISA 2JZ0A 1DGFA 2KRUA 2P5TA 2EKKA 3GLGA 2VF7A 3KOYE 4JI8M 2RGOA 1NO1A 2X4AA 1GJSA 2KHHA 3FTFA 1P3QQ 3PNVA 5JI3E 2ZANA 1QAQA 5LMUM 2OOBA 4NSOB 1GABA 4LJ6A 4OU7A 4DV2M 1MN3A 5KQ8A 3FTCA 1V92A 4Y28F 5FTJA 2V6ZM 3WHLA 2JY7A 2DWLA 1GVNA 2BWEA 2R6FA 3HKPA 1QZMA 1E32A 5DYGA 5C18A 1NVMA 2QHOB 2KW0A 3GRYA 2G8LA 3EIEA 4QNMA 1L1TA 2B3TA 3QYEA 3UMMA 3L29A 3SC3A 4YY3M 2L7HA 3LQRA 2W82A 2C9OA 4DUZM 4GH9A 4DR3M 2H5XA 3W68A 2CHVA 2Q2EB 1AIPC 3CGWA 3RE8A 5GKNA 1CUKA 4DR7M 2MR9A 3GLFB 5IT9S 3ZH9B 1MJGM 2DENA 3EIHA 2M60A 2KDLA 2YFQA 2EKFA 4PDIA 2ZTDA 1S3SA 3HJQA 3J2PB 4AZFA 3AOGA 1PJSA 3GPUA 5FTLA 4I81A 3K92A 2Z7JA 5IREB 2UXCM 1G3IA 4NXNM 4B7FA 2DAMA 4DV6M 4OVZB 1PGYA 1TTEA 1YSYA 2Z8YM 1J7KA 4L16A 3GRRA 3L26A 1YUBA 1R5LA 2JY8A 3LVVA 5FLXS 1IN7A 4IBIA 4R3DA 3F92A 4GRIA 3L25A 5FTMA 3HHXA 4HEOA 2N35A 2UXBM 4G3OA 3ZCBB 1TF0B 1V34A 1N77A 2DWZB 1J5EM 4IBDA 3K9OA 1JQJC 3K2LA 5BPVA 1JB0F 2ZBKB 4NRWA 4DV3M 1D0LA 4NRVA 3GPPA 4KT0F 3BBZA 4JYAM 1G41A 3HZJA 2LWXA 3IHPA 4QHSA 1I4WA 2QSFX 8CATA 3KS8A 2UXDM 3I01M 2DHRA 3SHGB 2JY6B 3J7BA 1GL6A 1KSFX 2XSZD 2F4VM 4DR6M 2XEPA 5BR8M 3UGJA 2VF8A 3U6OA 2CWBA 2R44A 2WSEF 3SHFA 4M0WA 1W5SA 3C3DA 3NBXX 4LFAM 3U6DA 1T6OA 1WGLA 3W0LB 1QDRA 4L6V6 3L28A 3V76A 1SXJE 1TH2A 5A2QS 3AV0A 2LHCA 3SASA 2ZAMA 2CEAA 3Q8XA 3FUWA 3QWLA 1WJ7A 1NJFA 2LTUA 1FJGM 4NSRA 2L09A 4MGIE 2VDBB 1SG9A 2C99A 2M5ZA 3VDUA 3GLFA 1JR3E 5EXSA 1ZMWA 1WIVA 2HHHM 4GKJM 1IN4A 4JI5M 2MROB 2DZOB 2F5NA 4FWGA 2FH0A 2L7IA 1IM2A 4FCTA 1XNRM 4DBGB 3SMPA 3VKHA 4LFCM 4LRSA 2DKLA 5ITUA 2L4EA 2MH8A 4B7GA 1WHCA 4LJ7A 4G4OA 4XBOA 2R45A 1WR1B 3U5ZB 3FKEA 1BVSA 3GLHE 1QVRA 3UJNA 3U60A 1XB2B 2CV2A 1Q39A 1G4AE 4PT5A 1HR0M 4LF9M 2FFJA 1OTRA 1PM5A 4FWDA 1XMQM 2QBYB 5FSWA 1IBMM 1UFZA 3KP0E 3FE3A 3KOXE 1R4GA 5IZ7D 4JI6M 5E26A 2JP7A 1IXZA 3DOAA 4DV5M 4QOSA 3IG5A 1JR3D 2QZ4A 4NOOB 1NY6A 1G59A 2CRUA 1Z6TA 3A98B 1Z59A 1DGBA 4BB9A 1ZQ9A 3J27B 3GPYA 2FE8A 4DR5M 3ZQJA 3K1JA 5L8RF 1N78A 1TR8A 3IECA 4RKUF 2CFOA 1N34M 3CF0A 3FRHA 2WZJA 1QYRA 3TE6A 5EJCA 3GP1A 1MU5A 4CIZA 1OAIA 3KSJA 2KNAA 3GRVA 4IBBA 4HL4A 4Z8XA 1V33A 2C98A 4A3VB 1N33M 1ZMVA 3GLGE 3U6LA 2DI0A 5FTNA 2QP9X 2KZUA 3KOZE 3PFIA 2OPFA 2G3QA 1XC8A 4RF1A 1ZAEA 3LCVB 3TL4X 2F5SA 2Y0QA 2QQ8A 5EXXA 4NC6A 3TWKA 1E9RA 2EA0A 1QANA 1Z5CA 5FTKA 2K0BX 3R8FA 2R4JA 2NQ8C 1GKIA 2EUCA 2CE7A 4S12A 4GC5A 1Q02A 2Y21A 3LW5F 3UK6A 3GLIE 1NV9A 2BNKA 4K0KM 3KSXA 3SYLA 3U6CA 2LNHC 4LF6M 4BLCA 2CHQA 7CATA 4G4RA 3VK7A 1HNWM 1GO5A 3M6AA 2OO9A 2ERCA 4ZPXA 3OTOM 2J7NA 4AKHA 4HLQA 3GO8A 2Z3XA 3FUXA 2L2DA 3KS4A 4FW9A 4MGHA 3HU1A 3NBIA 1GL7A 2R4EA 4L8RC 3I4VA 4X65M 3JR4A 4FD2A 1E94E 4D80A 1I94M 1PJJA 2V1UA 5KQDA 3DZDA 4WP2A 2FNAA 2QCUA 2EO2A 4B3RM 4L78A 2LVAA 2V1CA 4G4QA 1D2NA 3B9PA 2APLA 1Z5AA 3JR5A 3U5ZA 2ZM6M 3DFZA 2O25A 3LMMA 5E6JA 4DR1M 4KLNA 1Q3CA 2XSZA 2D7HA 3AOEC 3U60B 1K3WA 1OJLA 2QBYA 2RRUA 5DFLA 2BWBA 3PNYA 2G5GX 4AW4A 1GLNA 1PJTA 2R65A 4CGYB 2LVQD 3TPZA 3D8BA 1XMOM 3I4YA 3SFZA 3A46A 3CTWB 3TWMA 4AG6A 2LVOC 2KNZA 3THGA 2C5RA 1Z5BA 5H37D 4LCBA 4DUYM 1OFIA 1TDHA 1XXHB 4REZA 1DO0A 1OIZA 3T6PA 4AI6A 3FYDA 1IBLM 2ZAOA 2Z4RA 2O01F 4PCZA 1VQ1A 1R6BX 1VEJA 2HCBA 1DO2A 1GJTA 4P17A 2DAIA 3MMPA 1C7YA 1ZMUA 1L2DA 3A45A 2KEBA 2X8AA 1T3TA 2OOAA 4MB7A 4B3SM 3U6QA 3SYKA 3SMSA 2YR0A 3AOEA 4UN2B 4YHHM 5ITTA 2YNMD 3T1HM 3B7ZA 1T43A 1ZV1A 2CP8A 2FS1A 2LHGA 2K6BA 2I7NA 1OAOC 3U61B 3TWLA 1D0MA 1G8PA 2Y0TA 2DVWB 2XF3A 3U6PA 1QUSA 4QOZC 2LH0A 4LJ8A 3KP1E 3MHVC 3VFDA 1WXQA 2LVPC 2EJSA 3B7QA 3KW6A 2A5YB 3GPXA 4DV1M 4GITA 1XHBA 3SAUA 1LV7A 1QAOA 2F5OA 3AL0C 1PRBA 4GC9A 1QQWA 1E9SA 4KHPM 2WSFF 1NY5A 2AHMA 2VIIA 4WW0A 2DWMA 1DGHB 4B3MM 2DZNB 2I7PA 2FOIC 1JR3A 3DA1A 2R0IA 3BXWA 4MH0E 3AFHA 1R7RA 3E21A 5F3WA 1LTMA 1VDDA 3KOWE 2J5YA 1EFUB 5LMNM 3HU3A 3GLFE 4OX9M 4XGIA 2DZLA 2XFSA 3VK8A 3FTDA 1IY1A 1OQYA 1SXJD 2Z4SA 1L1ZA 1OKSA 2X49A 2LVNC 3U6MA 2JZ1A 4GIPA 4GEWA 3QAUA 4L4UA 3CF6E 2UUBM 1IN6A 3U6SA 1NNJA 2KNVA 2UUCM 2Y20A 3T15A 3H4MA 4R71A 4JXJA 4X64M 4IBEA 3L2AA 4P16A 1KYIA 4DR4M 3UZUA 1QZEA 2CUZA 2HWJA 2XH9A 2BJVA 4FWHA 4OW0A 1TDZA 1PJQA 1XXHA 2DAGA 3MK6A 3CF2A 1HJPA 3PVSA 3K8ZA 3K9PA 4LY6A 5EP2A 5ITXA 1K3XA 4II7A 1N32M 3W0FA 3C9PA 3H4JA 4JI2M 3B74A 2LXEA 2YQZA 4DV4M 4GHLA 2MGWA 2R62A 3MJ5A 1NHGC 3L27A 3HWSA 1IY2A 4LFBM 2KZSA 4GMQA 4JI7M 1EIJA 4X62M 5EQTA 1XNQM 5ITQA 4DR2M 3U61A 4F1IA 1L8QA 3HHZA 4AKIA 4GHAA 3AJIB 3HGIA 4MGYE 4LF4M 4M0DA 4LGMA 2XZFA 2O5RA 1R2ZA 2VQEM 1A5TA 5KPTA 4B3TM 3E4RA 2C96A 4IBKA 1HT1E 2ZTCA 2L6OA 1SXJB 4LZJA 1H6UA 1IBKM 1OIPA 3E46A 3M7GA 3Q8GA 2H1RA 4LJAA 3ZC7B 1HQYE 5ITYA 3GLIA 1EE8A 4BBAA 3I04M 1DGHA 2QPAA 3HHWA 3LQQA 2RGHA 3RGSA 3HY5A 3GQ3A 2JWSA 1N36M 3VLFB 4G4NA 4RF0A 2CV1A 3HX3A 4ITQA 3QYBA 3IG8A 3RGPA 5DNYA 1MX0A 1IQPA 2CHGA 1IN8A 3LCUA 2L4FA 5EP1A 2F5QA 3HU2A 5C1BA 2JXNA 2F5PA 1HNZM 3PXGA 1IXRC 1TGUA 4JN6A 4D82A 2UUAM 5KPRA 2JA2A 1AUAA 4M9XA 4TUWA 2LBCA 1VEGA 1XWIA 4LJ4A 4LGYA 1L2CA 3KFUG 3FUUA 3GLHB 1VG5A 4KO8A 3C58A 5EXTA 1L2BA 2HL7A 4ANRA 3HJ8A 2DNAA 2R46A 3M0EA 5EP3A 3GQ4A 3J80S 3FUTA 4AKGA 4G6ZA 5JI2E 4JI3M 1QAMA 4LF8M 1F4IA 4I4LA 2JUJA 2GNOA 1SXJC 5KO3A 1IXSB 5KPZA 3B89A 4B7HA 3GRUA 2JNHA 2XFTA 5ITRA
chains in the Genus database with same CATH topology
2B3TA 2JNHA 2R0IA 2H5XA 2DAEA 3FRIA 1AIPC 3E21A 2K9DA 1CUKA 2MR9A 1EFUB 1TR8A 1VDLA 2DENA 3IECA 1VEKA 2EKFA 3FRHA 3GLFE 2ZTDA 2WZJA 2DZLA 1OQYA 1IFYA 1OAIA 1OKSA 2KNAA 2LVNC 2JZ1A 4GEWA 1G3IA 1ZMVA 3GLGE 2DAMA 2DI0A 2KNVA 2G3QA 1PGYA 1TTEA 1WGNA 3LCVB 4R71A 1KYIA 1QZEA 2HWJA 2JY8A 2K0BX 2MJ5B 2QNJA 2DAGA 3GLIE 1HJPA 1Q02A 3F92A 3K9PA 1NV9A 3H4JA 1HT2E 4HEOA 1Y8GA 2MGWA 4G3OA 1GO5A 2OO9A 3K9OA 2L2DA 1NV8A 1E94E 3BBZA 1G41A 4F1IA 2DAKA 3IHPA 4WP2A 2QSFX 4F2LA 2LVAA 2JY6B 2O25A 1A5TA 2CWBA 1YLAA 2HAKA 2RRUA 4Q7JA 5DFLA 1HT1E 1IXSA 2BWBA 2ZTCA 2LVQD 1T6OA 1WGLA 2DHYA 3E46A 2LVOC 1HQYE 2KNZA 2JY5A 1WJ7A 2LTUA 1DO0A 3T6PA 1SG9A 1XXHE 1JR3E 1VQ1A 3LCUA 1VEJA 2L4FA 1DO2A 1ZMWA 1C7YA 1WIVA 2DAIA 3MMPA 1DV0A 1ZMUA 2JZ0A 2OOAA 2MROB 2EKKA 4UN2B 1IM2A 4DBGB 1T43A 1ZV1A 2CP8A 2LBCA 1VEGA 2KHHA 2DKLA 2L4EA 1P3QQ 1VG5A 1WHCA 2DNAA 1WR1B 3GLHE 1BVSA 2OOBA 5JI2E 1XB2B 2LVPC 2EJSA 1MN3A 1G4AE 1F4IA 1OTRA 1V92A 2JUJA 1UFZA 2JY7A 2BWEA 3B89A 3FE3A 1R4GA 2QHOB 2JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3T A;  2JNH A;  2R0I A;  2H5X A;  2DAE A;  3FRI A;  1AIP C;  3E21 A;  2K9D A;  1CUK A;  2MR9 A;  1EFU B;  1TR8 A;  1VDL A;  2DEN A;  3IEC A;  1VEK A;  2EKF A;  3FRH A;  3GLF E;  2ZTD A;  2WZJ A;  2DZL A;  1OQY A;  1IFY A;  1OAI A;  1OKS A;  2KNA A;  2LVN C;  2JZ1 A;  4GEW A;  1G3I A;  1ZMV A;  3GLG E;  2DAM A;  2DI0 A;  2KNV A;  2G3Q A;  1PGY A;  1TTE A;  1WGN A;  3LCV B;  4R71 A;  1KYI A;  1QZE A;  2HWJ A;  2JY8 A;  2K0B X;  2MJ5 B;  2QNJ A;  2DAG A;  3GLI E;  1HJP A;  1Q02 A;  3F92 A;  3K9P A;  1NV9 A;  3H4J A;  1HT2 E;  4HEO A;  1Y8G A;  2MGW A;  4G3O A;  1GO5 A;  2OO9 A;  3K9O A;  2L2D A;  1NV8 A;  1E94 E;  3BBZ A;  1G41 A;  4F1I A;  2DAK A;  3IHP A;  4WP2 A;  2QSF X;  4F2L A;  2LVA A;  2JY6 B;  2O25 A;  1A5T A;  2CWB A;  1YLA A;  2HAK A;  2RRU A;  4Q7J A;  5DFL A;  1HT1 E;  1IXS A;  2BWB A;  2ZTC A;  2LVQ D;  1T6O A;  1WGL A;  2DHY A;  3E46 A;  2LVO C;  1HQY E;  2KNZ A;  2JY5 A;  1WJ7 A;  2LTU A;  1DO0 A;  3T6P A;  1SG9 A;  1XXH E;  1JR3 E;  1VQ1 A;  3LCU A;  1VEJ A;  2L4F A;  1DO2 A;  1ZMW A;  1C7Y A;  1WIV A;  2DAI A;  3MMP A;  1DV0 A;  1ZMU A;  2JZ0 A;  2OOA A;  2MRO B;  2EKK A;  4UN2 B;  1IM2 A;  4DBG B;  1T43 A;  1ZV1 A;  2CP8 A;  2LBC A;  1VEG A;  2KHH A;  2DKL A;  2L4E A;  1P3Q Q;  1VG5 A;  1WHC A;  2DNA A;  1WR1 B;  3GLH E;  1BVS A;  2OOB A;  5JI2 E;  1XB2 B;  2LVP C;  2EJS A;  1MN3 A;  1G4A E;  1F4I A;  1OTR A;  1V92 A;  2JUJ A;  1UFZ A;  2JY7 A;  2BWE A;  3B89 A;  3FE3 A;  1R4G A;  2QHO B;  2JP7 A; 
#chains in the Genus database with same CATH topology
 2GQF A;  3LVW A;  2HKJ A;  4LRT A;  4LZZ A;  4Z6Y A;  3SAV A;  2RKO A;  4JI4 M;  2XGN A;  3AKZ A;  4NL4 H;  2J7O A;  4LJ5 A;  4I8O A;  3BOS A;  1NSF A;  2DAE A;  4CHT B;  3FRI A;  4FCV A;  4FVM A;  4QNR A;  3SAT A;  4M9Z A;  4LF7 M;  1RU3 A;  2K9D A;  1VDL A;  3J81 S;  1VEK A;  4AG5 A;  2E5L M;  2R18 A;  3HJS A;  4PDG A;  1IFY A;  3ILK A;  3GLG B;  4KOD A;  4W5W A;  4R7G A;  1SXJ A;  1OFH A;  1HNX M;  4LF5 M;  4IJF A;  3I51 A;  3RFW A;  1W5T A;  1Q3B A;  1WGN A;  4RNA A;  5EXP A;  4D81 A;  4XK8 F;  1QDT A;  1J09 A;  3E9S A;  2OQ4 A;  1KFV A;  3GLI B;  5EP4 A;  2K47 A;  2MJ5 B;  2QNJ A;  3FUV A;  3FTE A;  4LG2 A;  2KRK A;  1DGG A;  4IBC A;  1HT2 E;  3HHY A;  1UM8 A;  2QEN A;  2UU9 M;  1Y8G A;  4MGZ E;  3FYC A;  2KXE A;  4FCW A;  1NNU C;  4WUR A;  4LJ9 A;  1NV8 A;  3SAR A;  1TH4 A;  4L15 A;  4MM3 B;  4IJE A;  3KXE C;  3T1Y M;  3KDS E;  2XZU A;  3KVW A;  3A42 A;  2VQF M;  2DAK A;  4F2L A;  3GLH A;  3GQ5 A;  1X37 A;  2D7G A;  4B08 A;  3T38 A;  2DWN A;  3J7A S;  1ORY B;  3VDP A;  2XLJ A;  4DV0 M;  4IBJ A;  2C9C A;  1YLA A;  4MGK E;  1YE9 A;  3FD9 A;  3JAM S;  4GKK M;  2HAK A;  4Q7J A;  1FNN A;  1TH3 A;  1IXS A;  1IY0 A;  1R2Y A;  4JV5 M;  1NJG A;  2BJW A;  4OVZ A;  4EIW A;  1D0K A;  2DHY A;  1C1K A;  3U6E A;  4DV7 M;  3B7N A;  3SBJ A;  3SAW A;  3VKG A;  1QUT A;  3TQS A;  5IWA M;  1K82 A;  4PD2 A;  2WSC F;  1PJI A;  2D7E A;  2JY5 A;  2DXI A;  4CJ6 A;  1HQC A;  3R9X B;  3NWL A;  4AQY M;  3W67 A;  1IN5 A;  1N75 A;  4X66 M;  4I5S A;  1NHW C;  4QHT A;  4JI1 M;  5DYI A;  3C3E A;  2CV0 A;  1G71 A;  1XXH E;  3D8L A;  4M9S A;  3WHK A;  4IBF A;  2KA6 B;  5ITX E;  1DV0 A;  4IBG A;  4NXM M;  4JI0 M;  4IIW A;  4CIS A;  2JZ0 A;  1DGF A;  2KRU A;  2P5T A;  2EKK A;  3GLG A;  2VF7 A;  3KOY E;  4JI8 M;  2RGO A;  1NO1 A;  2X4A A;  1GJS A;  2KHH A;  3FTF A;  1P3Q Q;  3PNV A;  5JI3 E;  2ZAN A;  1QAQ A;  5LMU M;  2OOB A;  4NSO B;  1GAB A;  4LJ6 A;  4OU7 A;  4DV2 M;  1MN3 A;  5KQ8 A;  3FTC A;  1V92 A;  4Y28 F;  5FTJ A;  2V6Z M;  3WHL A;  2JY7 A;  2DWL A;  1GVN A;  2BWE A;  2R6F A;  3HKP A;  1QZM A;  1E32 A;  5DYG A;  5C18 A;  1NVM A;  2QHO B;  2KW0 A;  3GRY A;  2G8L A;  3EIE A;  4QNM A;  1L1T A;  2B3T A;  3QYE A;  3UMM A;  3L29 A;  3SC3 A;  4YY3 M;  2L7H A;  3LQR A;  2W82 A;  2C9O A;  4DUZ M;  4GH9 A;  4DR3 M;  2H5X A;  3W68 A;  2CHV A;  2Q2E B;  1AIP C;  3CGW A;  3RE8 A;  5GKN A;  1CUK A;  4DR7 M;  2MR9 A;  3GLF B;  5IT9 S;  3ZH9 B;  1MJG M;  2DEN A;  3EIH A;  2M60 A;  2KDL A;  2YFQ A;  2EKF A;  4PDI A;  2ZTD A;  1S3S A;  3HJQ A;  3J2P B;  4AZF A;  3AOG A;  1PJS A;  3GPU A;  5FTL A;  4I81 A;  3K92 A;  2Z7J A;  5IRE B;  2UXC M;  1G3I A;  4NXN M;  4B7F A;  2DAM A;  4DV6 M;  4OVZ B;  1PGY A;  1TTE A;  1YSY A;  2Z8Y M;  1J7K A;  4L16 A;  3GRR A;  3L26 A;  1YUB A;  1R5L A;  2JY8 A;  3LVV A;  5FLX S;  1IN7 A;  4IBI A;  4R3D A;  3F92 A;  4GRI A;  3L25 A;  5FTM A;  3HHX A;  4HEO A;  2N35 A;  2UXB M;  4G3O A;  3ZCB B;  1TF0 B;  1V34 A;  1N77 A;  2DWZ B;  1J5E M;  4IBD A;  3K9O A;  1JQJ C;  3K2L A;  5BPV A;  1JB0 F;  2ZBK B;  4NRW A;  4DV3 M;  1D0L A;  4NRV A;  3GPP A;  4KT0 F;  3BBZ A;  4JYA M;  1G41 A;  3HZJ A;  2LWX A;  3IHP A;  4QHS A;  1I4W A;  2QSF X;  8CAT A;  3KS8 A;  2UXD M;  3I01 M;  2DHR A;  3SHG B;  2JY6 B;  3J7B A;  1GL6 A;  1KSF X;  2XSZ D;  2F4V M;  4DR6 M;  2XEP A;  5BR8 M;  3UGJ A;  2VF8 A;  3U6O A;  2CWB A;  2R44 A;  2WSE F;  3SHF A;  4M0W A;  1W5S A;  3C3D A;  3NBX X;  4LFA M;  3U6D A;  1T6O A;  1WGL A;  3W0L B;  1QDR A;  4L6V 6;  3L28 A;  3V76 A;  1SXJ E;  1TH2 A;  5A2Q S;  3AV0 A;  2LHC A;  3SAS A;  2ZAM A;  2CEA A;  3Q8X A;  3FUW A;  3QWL A;  1WJ7 A;  1NJF A;  2LTU A;  1FJG M;  4NSR A;  2L09 A;  4MGI E;  2VDB B;  1SG9 A;  2C99 A;  2M5Z A;  3VDU A;  3GLF A;  1JR3 E;  5EXS A;  1ZMW A;  1WIV A;  2HHH M;  4GKJ M;  1IN4 A;  4JI5 M;  2MRO B;  2DZO B;  2F5N A;  4FWG A;  2FH0 A;  2L7I A;  1IM2 A;  4FCT A;  1XNR M;  4DBG B;  3SMP A;  3VKH A;  4LFC M;  4LRS A;  2DKL A;  5ITU A;  2L4E A;  2MH8 A;  4B7G A;  1WHC A;  4LJ7 A;  4G4O A;  4XBO A;  2R45 A;  1WR1 B;  3U5Z B;  3FKE A;  1BVS A;  3GLH E;  1QVR A;  3UJN A;  3U60 A;  1XB2 B;  2CV2 A;  1Q39 A;  1G4A E;  4PT5 A;  1HR0 M;  4LF9 M;  2FFJ A;  1OTR A;  1PM5 A;  4FWD A;  1XMQ M;  2QBY B;  5FSW A;  1IBM M;  1UFZ A;  3KP0 E;  3FE3 A;  3KOX E;  1R4G A;  5IZ7 D;  4JI6 M;  5E26 A;  2JP7 A;  1IXZ A;  3DOA A;  4DV5 M;  4QOS A;  3IG5 A;  1JR3 D;  2QZ4 A;  4NOO B;  1NY6 A;  1G59 A;  2CRU A;  1Z6T A;  3A98 B;  1Z59 A;  1DGB A;  4BB9 A;  1ZQ9 A;  3J27 B;  3GPY A;  2FE8 A;  4DR5 M;  3ZQJ A;  3K1J A;  5L8R F;  1N78 A;  1TR8 A;  3IEC A;  4RKU F;  2CFO A;  1N34 M;  3CF0 A;  3FRH A;  2WZJ A;  1QYR A;  3TE6 A;  5EJC A;  3GP1 A;  1MU5 A;  4CIZ A;  1OAI A;  3KSJ A;  2KNA A;  3GRV A;  4IBB A;  4HL4 A;  4Z8X A;  1V33 A;  2C98 A;  4A3V B;  1N33 M;  1ZMV A;  3GLG E;  3U6L A;  2DI0 A;  5FTN A;  2QP9 X;  2KZU A;  3KOZ E;  3PFI A;  2OPF A;  2G3Q A;  1XC8 A;  4RF1 A;  1ZAE A;  3LCV B;  3TL4 X;  2F5S A;  2Y0Q A;  2QQ8 A;  5EXX A;  4NC6 A;  3TWK A;  1E9R A;  2EA0 A;  1QAN A;  1Z5C A;  5FTK A;  2K0B X;  3R8F A;  2R4J A;  2NQ8 C;  1GKI A;  2EUC A;  2CE7 A;  4S12 A;  4GC5 A;  1Q02 A;  2Y21 A;  3LW5 F;  3UK6 A;  3GLI E;  1NV9 A;  2BNK A;  4K0K M;  3KSX A;  3SYL A;  3U6C A;  2LNH C;  4LF6 M;  4BLC A;  2CHQ A;  7CAT A;  4G4R A;  3VK7 A;  1HNW M;  1GO5 A;  3M6A A;  2OO9 A;  2ERC A;  4ZPX A;  3OTO M;  2J7N A;  4AKH A;  4HLQ A;  3GO8 A;  2Z3X A;  3FUX A;  2L2D A;  3KS4 A;  4FW9 A;  4MGH A;  3HU1 A;  3NBI A;  1GL7 A;  2R4E A;  4L8R C;  3I4V A;  4X65 M;  3JR4 A;  4FD2 A;  1E94 E;  4D80 A;  1I94 M;  1PJJ A;  2V1U A;  5KQD A;  3DZD A;  4WP2 A;  2FNA A;  2QCU A;  2EO2 A;  4B3R M;  4L78 A;  2LVA A;  2V1C A;  4G4Q A;  1D2N A;  3B9P A;  2APL A;  1Z5A A;  3JR5 A;  3U5Z A;  2ZM6 M;  3DFZ A;  2O25 A;  3LMM A;  5E6J A;  4DR1 M;  4KLN A;  1Q3C A;  2XSZ A;  2D7H A;  3AOE C;  3U60 B;  1K3W A;  1OJL A;  2QBY A;  2RRU A;  5DFL A;  2BWB A;  3PNY A;  2G5G X;  4AW4 A;  1GLN A;  1PJT A;  2R65 A;  4CGY B;  2LVQ D;  3TPZ A;  3D8B A;  1XMO M;  3I4Y A;  3SFZ A;  3A46 A;  3CTW B;  3TWM A;  4AG6 A;  2LVO C;  2KNZ A;  3THG A;  2C5R A;  1Z5B A;  5H37 D;  4LCB A;  4DUY M;  1OFI A;  1TDH A;  1XXH B;  4REZ A;  1DO0 A;  1OIZ A;  3T6P A;  4AI6 A;  3FYD A;  1IBL M;  2ZAO A;  2Z4R A;  2O01 F;  4PCZ A;  1VQ1 A;  1R6B X;  1VEJ A;  2HCB A;  1DO2 A;  1GJT A;  4P17 A;  2DAI A;  3MMP A;  1C7Y A;  1ZMU A;  1L2D A;  3A45 A;  2KEB A;  2X8A A;  1T3T A;  2OOA A;  4MB7 A;  4B3S M;  3U6Q A;  3SYK A;  3SMS A;  2YR0 A;  3AOE A;  4UN2 B;  4YHH M;  5ITT A;  2YNM D;  3T1H M;  3B7Z A;  1T43 A;  1ZV1 A;  2CP8 A;  2FS1 A;  2LHG A;  2K6B A;  2I7N A;  1OAO C;  3U61 B;  3TWL A;  1D0M A;  1G8P A;  2Y0T A;  2DVW B;  2XF3 A;  3U6P A;  1QUS A;  4QOZ C;  2LH0 A;  4LJ8 A;  3KP1 E;  3MHV C;  3VFD A;  1WXQ A;  2LVP C;  2EJS A;  3B7Q A;  3KW6 A;  2A5Y B;  3GPX A;  4DV1 M;  4GIT A;  1XHB A;  3SAU A;  1LV7 A;  1QAO A;  2F5O A;  3AL0 C;  1PRB A;  4GC9 A;  1QQW A;  1E9S A;  4KHP M;  2WSF F;  1NY5 A;  2AHM A;  2VII A;  4WW0 A;  2DWM A;  1DGH B;  4B3M M;  2DZN B;  2I7P A;  2FOI C;  1JR3 A;  3DA1 A;  2R0I A;  3BXW A;  4MH0 E;  3AFH A;  1R7R A;  3E21 A;  5F3W A;  1LTM A;  1VDD A;  3KOW E;  2J5Y A;  1EFU B;  5LMN M;  3HU3 A;  3GLF E;  4OX9 M;  4XGI A;  2DZL A;  2XFS A;  3VK8 A;  3FTD A;  1IY1 A;  1OQY A;  1SXJ D;  2Z4S A;  1L1Z A;  1OKS A;  2X49 A;  2LVN C;  3U6M A;  2JZ1 A;  4GIP A;  4GEW A;  3QAU A;  4L4U A;  3CF6 E;  2UUB M;  1IN6 A;  3U6S A;  1NNJ A;  2KNV A;  2UUC M;  2Y20 A;  3T15 A;  3H4M A;  4R71 A;  4JXJ A;  4X64 M;  4IBE A;  3L2A A;  4P16 A;  1KYI A;  4DR4 M;  3UZU A;  1QZE A;  2CUZ A;  2HWJ A;  2XH9 A;  2BJV A;  4FWH A;  4OW0 A;  1TDZ A;  1PJQ A;  1XXH A;  2DAG A;  3MK6 A;  3CF2 A;  1HJP A;  3PVS A;  3K8Z A;  3K9P A;  4LY6 A;  5EP2 A;  5ITX A;  1K3X A;  4II7 A;  1N32 M;  3W0F A;  3C9P A;  3H4J A;  4JI2 M;  3B74 A;  2LXE A;  2YQZ A;  4DV4 M;  4GHL A;  2MGW A;  2R62 A;  3MJ5 A;  1NHG C;  3L27 A;  3HWS A;  1IY2 A;  4LFB M;  2KZS A;  4GMQ A;  4JI7 M;  1EIJ A;  4X62 M;  5EQT A;  1XNQ M;  5ITQ A;  4DR2 M;  3U61 A;  4F1I A;  1L8Q A;  3HHZ A;  4AKI A;  4GHA A;  3AJI B;  3HGI A;  4MGY E;  4LF4 M;  4M0D A;  4LGM A;  2XZF A;  2O5R A;  1R2Z A;  2VQE M;  1A5T A;  5KPT A;  4B3T M;  3E4R A;  2C96 A;  4IBK A;  1HT1 E;  2ZTC A;  2L6O A;  1SXJ B;  4LZJ A;  1H6U A;  1IBK M;  1OIP A;  3E46 A;  3M7G A;  3Q8G A;  2H1R A;  4LJA A;  3ZC7 B;  1HQY E;  5ITY A;  3GLI A;  1EE8 A;  4BBA A;  3I04 M;  1DGH A;  2QPA A;  3HHW A;  3LQQ A;  2RGH A;  3RGS A;  3HY5 A;  3GQ3 A;  2JWS A;  1N36 M;  3VLF B;  4G4N A;  4RF0 A;  2CV1 A;  3HX3 A;  4ITQ A;  3QYB A;  3IG8 A;  3RGP A;  5DNY A;  1MX0 A;  1IQP A;  2CHG A;  1IN8 A;  3LCU A;  2L4F A;  5EP1 A;  2F5Q A;  3HU2 A;  5C1B A;  2JXN A;  2F5P A;  1HNZ M;  3PXG A;  1IXR C;  1TGU A;  4JN6 A;  4D82 A;  2UUA M;  5KPR A;  2JA2 A;  1AUA A;  4M9X A;  4TUW A;  2LBC A;  1VEG A;  1XWI A;  4LJ4 A;  4LGY A;  1L2C A;  3KFU G;  3FUU A;  3GLH B;  1VG5 A;  4KO8 A;  3C58 A;  5EXT A;  1L2B A;  2HL7 A;  4ANR A;  3HJ8 A;  2DNA A;  2R46 A;  3M0E A;  5EP3 A;  3GQ4 A;  3J80 S;  3FUT A;  4AKG A;  4G6Z A;  5JI2 E;  4JI3 M;  1QAM A;  4LF8 M;  1F4I A;  4I4L A;  2JUJ A;  2GNO A;  1SXJ C;  5KO3 A;  1IXS B;  5KPZ A;  3B89 A;  4B7H A;  3GRU A;  2JNH A;  2XFT A;  5ITR A; 
#chains in the Genus database with same CATH homology
 2B3T A;  2JNH A;  2R0I A;  2H5X A;  2DAE A;  3FRI A;  1AIP C;  3E21 A;  2K9D A;  1CUK A;  2MR9 A;  1EFU B;  1TR8 A;  1VDL A;  2DEN A;  3IEC A;  1VEK A;  2EKF A;  3FRH A;  3GLF E;  2ZTD A;  2WZJ A;  2DZL A;  1OQY A;  1IFY A;  1OAI A;  1OKS A;  2KNA A;  2LVN C;  2JZ1 A;  4GEW A;  1G3I A;  1ZMV A;  3GLG E;  2DAM A;  2DI0 A;  2KNV A;  2G3Q A;  1PGY A;  1TTE A;  1WGN A;  3LCV B;  4R71 A;  1KYI A;  1QZE A;  2HWJ A;  2JY8 A;  2K0B X;  2MJ5 B;  2QNJ A;  2DAG A;  3GLI E;  1HJP A;  1Q02 A;  3F92 A;  3K9P A;  1NV9 A;  3H4J A;  1HT2 E;  4HEO A;  1Y8G A;  2MGW A;  4G3O A;  1GO5 A;  2OO9 A;  3K9O A;  2L2D A;  1NV8 A;  1E94 E;  3BBZ A;  1G41 A;  4F1I A;  2DAK A;  3IHP A;  4WP2 A;  2QSF X;  4F2L A;  2LVA A;  2JY6 B;  2O25 A;  1A5T A;  2CWB A;  1YLA A;  2HAK A;  2RRU A;  4Q7J A;  5DFL A;  1HT1 E;  1IXS A;  2BWB A;  2ZTC A;  2LVQ D;  1T6O A;  1WGL A;  2DHY A;  3E46 A;  2LVO C;  1HQY E;  2KNZ A;  2JY5 A;  1WJ7 A;  2LTU A;  1DO0 A;  3T6P A;  1SG9 A;  1XXH E;  1JR3 E;  1VQ1 A;  3LCU A;  1VEJ A;  2L4F A;  1DO2 A;  1ZMW A;  1C7Y A;  1WIV A;  2DAI A;  3MMP A;  1DV0 A;  1ZMU A;  2JZ0 A;  2OOA A;  2MRO B;  2EKK A;  4UN2 B;  1IM2 A;  4DBG B;  1T43 A;  1ZV1 A;  2CP8 A;  2LBC A;  1VEG A;  2KHH A;  2DKL A;  2L4E A;  1P3Q Q;  1VG5 A;  1WHC A;  2DNA A;  1WR1 B;  3GLH E;  1BVS A;  2OOB A;  5JI2 E;  1XB2 B;  2LVP C;  2EJS A;  1MN3 A;  1G4A E;  1F4I A;  1OTR A;  1V92 A;  2JUJ A;  1UFZ A;  2JY7 A;  2BWE A;  3B89 A;  3FE3 A;  1R4G A;  2QHO B;  2JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...