1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin-binding protein
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
1GJSA 1TF0B 1PRBA 2LHGA 2VDBB 2JWSA 2KDLA 2N35A 2J5YA 2LHCA 1GJTA 2FS1A 1GABA 2MH8A
chains in the Genus database with same CATH superfamily
1FJGM 2ZAMA 1H6UA 5E6JA 2CUZA 1UM8A 4OVZA 3W67A 3GPUA 2UXCM 2X8AA 5BR8M 2VF7A 1W5SA 1N78A 1E9SA 2J7NA 3GQ4A 2OQ4A 4QOZC 1X37A 1V33A 2D7HA 2R0IA 3M0EA 2R18A 4LF6M 3BOSA 2QENA 3SYKA 2EO2A 3I01M 5ITUA 2Z4SA 1OIZA 5EXSA 4X65M 1IFYA 3HJSA 5ITRA 1VDLA 2C9OA 3V76A 1CUKA 3KXEC 1QANA 1GJSA 1JR3A 5EP2A 1XC8A 3K92A 2JWSA 2D7GA 1GVNA 2FH0A 5IREB 2DHRA 4I4LA 1VEGA 2DVWB 2EKKA 4DUZM 4LJ8A 3SMSA 3HZJA 4R71A 2XEPA 1DGHB 3HJ8A 2JXNA 4IBFA 4D80A 2ZM6M 2DZLA 2ZTDA 4B3MM 3E4RA 2VDBB 4NRWA 3QWLA 3TL4X 3NBIA 2RGHA 4XK8F 2WSFF 3OTOM 4IBKA 5L8RF 1DV0A 1IXZA 5BPVA 4G4NA 1VQ1A 4FW9A 1HT2E 2LTUA 1NO1A 1UFZA 3C3EA 4AG6A 2DAGA 5ITQA 4LFCM 4OX9M 2UXDM 2QBYA 3NWLA 3U5ZA 1Z59A 2CV2A 1IBKM 1NY5A 2EKFA 2G8LA 1QAMA 2K9DA 3IECA 3A98B 4LY6A 5DYIA 3HHYA 5FSWA 4JI2M 2KZSA 2DKLA 3I4YA 3U6MA 4JI7M 2Z8YM 4WURA 2OOAA 4X66M 3SYLA 4IBGA 5A2QS 1N75A 2LVQD 1I4WA 2RKOA 3KP0E 2ERCA 4FWGA 3B89A 4L16A 2L4EA 1ORYB 1WGLA 5ITTA 3B7QA 1MJGM 4REZA 3GLFB 1NJFA 1NY6A 2FFJA 1PJQA 3GLHE 4LJ7A 2N35A 1NSFA 3PNVA 5EXXA 1GABA 2I7NA 4DR4M 1JR3D 4DV4M 1G59A 1XMOM 3PFIA 4IJFA 2YQZA 1PJTA 3R9XB 1T3TA 2VIIA 2KNZA 4JI8M 4B3RM 3L26A 3AOEA 3FD9A 2H5XA 1XMQM 2JP7A 3IG8A 2LHGA 4L4UA 3SAVA 1OQYA 1NHGC 2R6FA 4RF0A 3M6AA 3AV0A 2LVOC 3HKPA 1K3XA 4JI5M 3CTWB 3RGSA 3FTDA 3TWMA 1AUAA 1PM5A 3SAWA 3SASA 1HQYE 1JR3E 2NQ8C 4BB9A 3MJ5A 3SC3A 1N33M 3QYBA 3I04M 1ZQ9A 3BXWA 4OVZB 1BVSA 2VQEM 3GLGB 4IBCA 5FLXS 4YHHM 1HNXM 3LCVB 1NV8A 4G4QA 4GC5A 3CF6E 4IJEA 3VK7A 5C18A 1VEKA 4KLNA 3T1YM 3FE3A 3VK8A 3B9PA 2KNAA 3EIEA 3AOGA 4LCBA 1N32M 3VKHA 4FCVA 2JY5A 1HNWM 4NOOB 5EQTA 2P5TA 3W0LB 1TGUA 1T6OA 2Y0TA 4GKKM 5FTMA 4HEOA 5JI3E 3GQ5A 4B7GA 3LMMA 3EIHA 3FUVA 4S12A 2F4VM 1SG9A 2CWBA 4GEWA 2EA0A 1TDZA 4XGIA 2DZNB 1L1TA 1NNUC 3SAUA 1ZAEA 1D0KA 2BJWA 2WSEF 4EIWA 1Q3CA 4DV1M 1DO2A 2L09A 2DENA 3L27A 4FD2A 1WR1B 1OAIA 4LZZA 2O01F 3D8BA 3U6PA 3W68A 3AKZA 4AKIA 3GRVA 3U6SA 4MGKE 5IT9S 3WHLA 2XZFA 1N77A 2BWEA 2JZ0A 1PRBA 3SHGB 3GLIA 3FRHA 3QYEA 1OAOC 4NRVA 4KHPM 1GL6A 4ZPXA 3L25A 5ITXA 3SBJA 2GNOA 3RE8A 1MN3A 1VEJA 2KXEA 4P16A 2LXEA 2X4AA 2KEBA 1N36M 3J81S 4L8RC 3TPZA 1J7KA 2BNKA 3ZH9B 3PVSA 5KPRA 3U60A 2E5LM 2KNVA 4GRIA 5KPTA 1EFUB 3HJQA 3U6CA 2LBCA 2BWBA 3FYDA 2JNHA 3LVWA 3KW6A 1TH3A 2JA2A 4DR3M 4BLCA 3I4VA 3J27B 3U6OA 2Y20A 3B7ZA 1WJ7A 1JB0F 3R8FA 4GH9A 1L1ZA 4GHLA 3HHXA 3RGPA 3HY5A 4OU7A 4D81A 1Z5CA 4FCTA 1LV7A 4PDIA 3GLHB 2FE8A 3U6QA 1OJLA 1IN7A 3K2LA 4M0WA 2Z3XA 1K82A 1XXHE 1KFVA 1GLNA 2QHOB 1C7YA 1SXJC 4M9XA 3GPPA 3GLIE 4G3OA 3ILKA 4M0DA 1KSFX 2XFTA 3FKEA 1IBMM 2DAKA 2V1UA 7CATA 1QUTA 4WP2A 5DNYA 3GLIB 3QAUA 2XZUA 4FVMA 1K3WA 5DFLA 2CV0A 3T38A 4B3SM 4I81A 2ZAOA 3GLHA 3HHZA 2G3QA 2L7HA 1D0LA 1XXHB 2DAEA 4JV5M 1IN6A 3KSXA 4LJ5A 1E32A 2J5YA 3UJNA 3AL0C 4AI6A 4CGYB 2GQFA 2L6OA 5KPZA 2MR9A 4LZJA 3GRRA 2BJVA 3HU2A 4NSRA 5FTNA 5FTJA 1IBLM 4IIWA 2JY8A 5FTKA 3B7NA 2XF3A 4L6V6 5F3WA 3KFUG 4LJ6A 1Z5AA 1QYRA 1QZEA 3GLGE 4GKJM 4LJ9A 4MGYE 4MM3B 4NSOB 3FTFA 4CJ6A 2LHCA 1DGHA 2Q2EB 4B7HA 1PJIA 1GO5A 1YUBA 3KP1E 1XNQM 3M7GA 3MHVC 5EXPA 4FWDA 3KOYE 3U6DA 3VFDA 2CHQA 3MMPA 4IBBA 4PD2A 1R5LA 4JXJA 3SHFA 4KO8A 2APLA 3H4MA 2MGWA 1DGGA 3CF0A 3DZDA 3L2AA 4I8OA 5H37D 4GHAA 2DAMA 3E21A 2K47A 5LMUM 3UMMA 2WSCF 1IQPA 2CFOA 1HR0M 4GITA 4FWHA 1T43A 2QBYB 2HL7A 4P17A 1F4IA 4JI6M 1OIPA 2LVAA 4DV2M 1LTMA 2Y0QA 4AKHA 1HNZM 3HHWA 1L8QA 4JI1M 3FYCA 4OW0A 2DAIA 2QSFX 5KQDA 4MH0E 4RKUF 2ZTCA 2JY6B 2CP8A 4II7A 3KOZE 4LJAA 2K6BA 4R3DA 3ZQJA 3KS4A 2XSZA 3K9PA 3DA1A 4F2LA 3K8ZA 3TE6A 4ITQA 2K0BX 4L15A 1ZMVA 4DV3M 5EXTA 2HWJA 4DBGB 4MGHA 3PNYA 1HQCA 2DHYA 5EP3A 2UUCM 3H4JA 4DUYM 3KOWE 3JR4A 4NC6A 1IY0A 3KVWA 3IG5A 4L78A 1Z6TA 1AIPC 2QQ8A 2C96A 2B3TA 1Y8GA 3PXGA 3GO8A 4DV0M 1XNRM 4G4OA 4TUWA 4WW0A 4LJ4A 4HLQA 5ITYA 1DGBA 2ZANA 3UZUA 3TQSA 2OPFA 4IBJA 4KT0F 1R2YA 1WGNA 4QHSA 2XFSA 2JUJA 4UN2B 4ANRA 5IWAM 2DWLA 2Y21A 3HGIA 4K0KM 3U6EA 1J09A 3TWLA 3KSJA 4LFBM 2KA6B 3KOXE 4G6ZA 1QUSA 2KRKA 3Q8GA 4AZFA 2HHHM 1GL7A 2LNHC 4PT5A 4DV7M 2FOIC 3AOEC 1HJPA 1QDTA 3FUXA 2KZUA 4CHTB 4I5SA 2Z7JA 1EE8A 2LWXA 3KDSE 2R4EA 3BBZA 1N34M 1PGYA 1IY2A 1XHBA 1ZMUA 1QVRA 2HKJA 4AW4A 1JQJC 3JR5A 1QAQA 4Z8XA 1SXJE 1Q39A 3B74A 2M5ZA 3HWSA 2FNAA 4MB7A 3LCUA 3D8LA 3LVVA 3FUUA 4AKGA 1IN4A 4LRTA 3NBXX 4GMQA 3W0FA 2R4JA 2WZJA 3GLGA 2LVNC 3U61A 4QNRA 4AQYM 3U5ZB 1SXJA 3L29A 4QNMA 2CV1A 5FTLA 1SXJD 2F5OA 4JI0M 1IN8A 3VDPA 5KO3A 1J5EM 2R65A 4DR7M 4GIPA 1QAOA 2V1CA 1L2CA 5ITXE 1IXRC 2F5PA 4CISA 4FCWA 4R7GA 4IBIA 3HU1A 2R46A 1NVMA 4B7FA 4LGMA 4LF5M 2UUAM 3AJIB 1TR8A 2D7EA 1QDRA 1MX0A 1E9RA 2QPAA 3Q8XA 4JI4M 1IY1A 1V34A 1G41A 4NL4H 3GLFA 2RGOA 1ZV1A 2C5RA 1G4AE 3AFHA 1GKIA 4JYAM 2MH8A 2A5YB 3K1JA 4LFAM 4JN6A 4X62M 1YLAA 2XSZD 4X64M 3GPXA 2KDLA 4KODA 2JZ1A 2C98A 1VG5A 3DFZA 4MGZE 4M9ZA 1YE9A 2EUCA 2YNMD 1OKSA 1WHCA 4LF4M 1DGFA 1OFHA 3FTEA 4AG5A 2QZ4A 4NXNM 1L2BA 3K9OA 4PDGA 2VQFM 2UUBM 4NXMM 4IBEA 5IZ7D 2OO9A 3J7BA 2L2DA 3KS8A 4MGIE 3U61B 2DXIA 4PCZA 1IM2A 3F92A 3FRIA 1XB2B 3J80S 3VDUA 1R7RA 2CHVA 1R6BX 4XBOA 1D2NA 1OTRA 2F5NA 1GJTA 2F5SA 2C99A 1TF0B 2L7IA 2O5RA 3WHKA 1OFIA 2DNAA 2Z4RA 4M9SA 2OOBA 1PJJA 2HAKA 5EP1A 4G4RA 1P3QQ 2DZOB 3DOAA 5EP4A 4A3VB 1NV9A 2J7OA 1QQWA 4DR6M 2KW0A 3T15A 2O25A 2YR0A 2KHHA 2V6ZM 5E26A 2JY7A 2QP9X 2H1RA 2G5GX 2L4FA 1D0MA 4IBDA 1Z5BA 3FUWA 2DI0A 3RFWA 3LQQA 3UK6A 2CRUA 2CE7A 2X49A 2CEAA 3T6PA 4LF8M 1IXSA 1PJSA 1ZMWA 2LH0A 3CF2A 2VF8A 3GP1A 5GKNA 1KYIA 1A5TA 2XGNA 3E46A 1NJGA 2EJSA 4BBAA 2FS1A 1XWIA 4QOSA 2UXBM 1G71A 4B08A 2MJ5B 2LVPC 2UU9M 3GRUA 5DYGA 1R4GA 3A46A 2CHGA 1C1KA 2DWZB 4LGYA 4W5WA 3THGA 2QNJA 4F1IA 1TDHA 3SARA 1S3SA 3SMPA 1DO0A 5KQ8A 4DR5M 1Q3BA 3I51A 5C1BA 4LG2A 2DWMA 1G8PA 3TWKA 3JAMS 2R44A 2YFQA 3C9PA 3U60B 4LRSA 4Z6YA 4D82A 3GPYA 3VLFB 1YSYA 3A45A 3GLFE 1R2ZA 3T1HM 3J2PB 1QZMA 3ZC7B 2XLJA 3VKGA 4DV5M 2C9CA 2XH9A 4Y28F 2ZBKB 1W5TA 3FUTA 2F5QA 4RNAA 1V92A 2M60A 2W82A 8CATA 1TH4A 1HT1E 1MU5A 1NHWC 1WXQA 1VDDA 3ZCBB 3UGJA 1FNNA 1IXSB 1XXHA 4CIZA 4JI3M 4GC9A 4RF1A 2MROB 3HX3A 5LMNM 4DR1M 2KRUA 5EJCA 2I7PA 3SFZA 3C3DA 3IHPA 3A42A 4DV6M 1TH2A 4LF9M 2R62A 4LF7M 1NNJA 3FTCA 4YY3M 3LW5F 4Q7JA 2DWNA 1L2DA 4B3TM 3J7AS 3U6LA 3GRYA 2R45A 1RU3A 1EIJA 5JI2E 3E9SA 3MK6A 2AHMA 1I94M 3C58A 1Q02A 3GQ3A 3SATA 4QHTA 2RRUA 2QCUA 4DR2M 1IN5A 1TTEA 1WIVA 1E94E 2HCBA 3HU3A 3LQRA 3L28A 3CGWA 4HL4A 1G3IA 1SXJB
chains in the Genus database with same CATH topology
1GJSA 1TF0B 1PRBA 2LHGA 2VDBB 2JWSA 2KDLA 2N35A 2J5YA 2LHCA 1GJTA 2FS1A 1GABA 2MH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJS A;  1TF0 B;  1PRB A;  2LHG A;  2VDB B;  2JWS A;  2KDL A;  2N35 A;  2J5Y A;  2LHC A;  1GJT A;  2FS1 A;  1GAB A;  2MH8 A; 
#chains in the Genus database with same CATH topology
 1FJG M;  2ZAM A;  1H6U A;  5E6J A;  2CUZ A;  1UM8 A;  4OVZ A;  3W67 A;  3GPU A;  2UXC M;  2X8A A;  5BR8 M;  2VF7 A;  1W5S A;  1N78 A;  1E9S A;  2J7N A;  3GQ4 A;  2OQ4 A;  4QOZ C;  1X37 A;  1V33 A;  2D7H A;  2R0I A;  3M0E A;  2R18 A;  4LF6 M;  3BOS A;  2QEN A;  3SYK A;  2EO2 A;  3I01 M;  5ITU A;  2Z4S A;  1OIZ A;  5EXS A;  4X65 M;  1IFY A;  3HJS A;  5ITR A;  1VDL A;  2C9O A;  3V76 A;  1CUK A;  3KXE C;  1QAN A;  1GJS A;  1JR3 A;  5EP2 A;  1XC8 A;  3K92 A;  2JWS A;  2D7G A;  1GVN A;  2FH0 A;  5IRE B;  2DHR A;  4I4L A;  1VEG A;  2DVW B;  2EKK A;  4DUZ M;  4LJ8 A;  3SMS A;  3HZJ A;  4R71 A;  2XEP A;  1DGH B;  3HJ8 A;  2JXN A;  4IBF A;  4D80 A;  2ZM6 M;  2DZL A;  2ZTD A;  4B3M M;  3E4R A;  2VDB B;  4NRW A;  3QWL A;  3TL4 X;  3NBI A;  2RGH A;  4XK8 F;  2WSF F;  3OTO M;  4IBK A;  5L8R F;  1DV0 A;  1IXZ A;  5BPV A;  4G4N A;  1VQ1 A;  4FW9 A;  1HT2 E;  2LTU A;  1NO1 A;  1UFZ A;  3C3E A;  4AG6 A;  2DAG A;  5ITQ A;  4LFC M;  4OX9 M;  2UXD M;  2QBY A;  3NWL A;  3U5Z A;  1Z59 A;  2CV2 A;  1IBK M;  1NY5 A;  2EKF A;  2G8L A;  1QAM A;  2K9D A;  3IEC A;  3A98 B;  4LY6 A;  5DYI A;  3HHY A;  5FSW A;  4JI2 M;  2KZS A;  2DKL A;  3I4Y A;  3U6M A;  4JI7 M;  2Z8Y M;  4WUR A;  2OOA A;  4X66 M;  3SYL A;  4IBG A;  5A2Q S;  1N75 A;  2LVQ D;  1I4W A;  2RKO A;  3KP0 E;  2ERC A;  4FWG A;  3B89 A;  4L16 A;  2L4E A;  1ORY B;  1WGL A;  5ITT A;  3B7Q A;  1MJG M;  4REZ A;  3GLF B;  1NJF A;  1NY6 A;  2FFJ A;  1PJQ A;  3GLH E;  4LJ7 A;  2N35 A;  1NSF A;  3PNV A;  5EXX A;  1GAB A;  2I7N A;  4DR4 M;  1JR3 D;  4DV4 M;  1G59 A;  1XMO M;  3PFI A;  4IJF A;  2YQZ A;  1PJT A;  3R9X B;  1T3T A;  2VII A;  2KNZ A;  4JI8 M;  4B3R M;  3L26 A;  3AOE A;  3FD9 A;  2H5X A;  1XMQ M;  2JP7 A;  3IG8 A;  2LHG A;  4L4U A;  3SAV A;  1OQY A;  1NHG C;  2R6F A;  4RF0 A;  3M6A A;  3AV0 A;  2LVO C;  3HKP A;  1K3X A;  4JI5 M;  3CTW B;  3RGS A;  3FTD A;  3TWM A;  1AUA A;  1PM5 A;  3SAW A;  3SAS A;  1HQY E;  1JR3 E;  2NQ8 C;  4BB9 A;  3MJ5 A;  3SC3 A;  1N33 M;  3QYB A;  3I04 M;  1ZQ9 A;  3BXW A;  4OVZ B;  1BVS A;  2VQE M;  3GLG B;  4IBC A;  5FLX S;  4YHH M;  1HNX M;  3LCV B;  1NV8 A;  4G4Q A;  4GC5 A;  3CF6 E;  4IJE A;  3VK7 A;  5C18 A;  1VEK A;  4KLN A;  3T1Y M;  3FE3 A;  3VK8 A;  3B9P A;  2KNA A;  3EIE A;  3AOG A;  4LCB A;  1N32 M;  3VKH A;  4FCV A;  2JY5 A;  1HNW M;  4NOO B;  5EQT A;  2P5T A;  3W0L B;  1TGU A;  1T6O A;  2Y0T A;  4GKK M;  5FTM A;  4HEO A;  5JI3 E;  3GQ5 A;  4B7G A;  3LMM A;  3EIH A;  3FUV A;  4S12 A;  2F4V M;  1SG9 A;  2CWB A;  4GEW A;  2EA0 A;  1TDZ A;  4XGI A;  2DZN B;  1L1T A;  1NNU C;  3SAU A;  1ZAE A;  1D0K A;  2BJW A;  2WSE F;  4EIW A;  1Q3C A;  4DV1 M;  1DO2 A;  2L09 A;  2DEN A;  3L27 A;  4FD2 A;  1WR1 B;  1OAI A;  4LZZ A;  2O01 F;  3D8B A;  3U6P A;  3W68 A;  3AKZ A;  4AKI A;  3GRV A;  3U6S A;  4MGK E;  5IT9 S;  3WHL A;  2XZF A;  1N77 A;  2BWE A;  2JZ0 A;  1PRB A;  3SHG B;  3GLI A;  3FRH A;  3QYE A;  1OAO C;  4NRV A;  4KHP M;  1GL6 A;  4ZPX A;  3L25 A;  5ITX A;  3SBJ A;  2GNO A;  3RE8 A;  1MN3 A;  1VEJ A;  2KXE A;  4P16 A;  2LXE A;  2X4A A;  2KEB A;  1N36 M;  3J81 S;  4L8R C;  3TPZ A;  1J7K A;  2BNK A;  3ZH9 B;  3PVS A;  5KPR A;  3U60 A;  2E5L M;  2KNV A;  4GRI A;  5KPT A;  1EFU B;  3HJQ A;  3U6C A;  2LBC A;  2BWB A;  3FYD A;  2JNH A;  3LVW A;  3KW6 A;  1TH3 A;  2JA2 A;  4DR3 M;  4BLC A;  3I4V A;  3J27 B;  3U6O A;  2Y20 A;  3B7Z A;  1WJ7 A;  1JB0 F;  3R8F A;  4GH9 A;  1L1Z A;  4GHL A;  3HHX A;  3RGP A;  3HY5 A;  4OU7 A;  4D81 A;  1Z5C A;  4FCT A;  1LV7 A;  4PDI A;  3GLH B;  2FE8 A;  3U6Q A;  1OJL A;  1IN7 A;  3K2L A;  4M0W A;  2Z3X A;  1K82 A;  1XXH E;  1KFV A;  1GLN A;  2QHO B;  1C7Y A;  1SXJ C;  4M9X A;  3GPP A;  3GLI E;  4G3O A;  3ILK A;  4M0D A;  1KSF X;  2XFT A;  3FKE A;  1IBM M;  2DAK A;  2V1U A;  7CAT A;  1QUT A;  4WP2 A;  5DNY A;  3GLI B;  3QAU A;  2XZU A;  4FVM A;  1K3W A;  5DFL A;  2CV0 A;  3T38 A;  4B3S M;  4I81 A;  2ZAO A;  3GLH A;  3HHZ A;  2G3Q A;  2L7H A;  1D0L A;  1XXH B;  2DAE A;  4JV5 M;  1IN6 A;  3KSX A;  4LJ5 A;  1E32 A;  2J5Y A;  3UJN A;  3AL0 C;  4AI6 A;  4CGY B;  2GQF A;  2L6O A;  5KPZ A;  2MR9 A;  4LZJ A;  3GRR A;  2BJV A;  3HU2 A;  4NSR A;  5FTN A;  5FTJ A;  1IBL M;  4IIW A;  2JY8 A;  5FTK A;  3B7N A;  2XF3 A;  4L6V 6;  5F3W A;  3KFU G;  4LJ6 A;  1Z5A A;  1QYR A;  1QZE A;  3GLG E;  4GKJ M;  4LJ9 A;  4MGY E;  4MM3 B;  4NSO B;  3FTF A;  4CJ6 A;  2LHC A;  1DGH A;  2Q2E B;  4B7H A;  1PJI A;  1GO5 A;  1YUB A;  3KP1 E;  1XNQ M;  3M7G A;  3MHV C;  5EXP A;  4FWD A;  3KOY E;  3U6D A;  3VFD A;  2CHQ A;  3MMP A;  4IBB A;  4PD2 A;  1R5L A;  4JXJ A;  3SHF A;  4KO8 A;  2APL A;  3H4M A;  2MGW A;  1DGG A;  3CF0 A;  3DZD A;  3L2A A;  4I8O A;  5H37 D;  4GHA A;  2DAM A;  3E21 A;  2K47 A;  5LMU M;  3UMM A;  2WSC F;  1IQP A;  2CFO A;  1HR0 M;  4GIT A;  4FWH A;  1T43 A;  2QBY B;  2HL7 A;  4P17 A;  1F4I A;  4JI6 M;  1OIP A;  2LVA A;  4DV2 M;  1LTM A;  2Y0Q A;  4AKH A;  1HNZ M;  3HHW A;  1L8Q A;  4JI1 M;  3FYC A;  4OW0 A;  2DAI A;  2QSF X;  5KQD A;  4MH0 E;  4RKU F;  2ZTC A;  2JY6 B;  2CP8 A;  4II7 A;  3KOZ E;  4LJA A;  2K6B A;  4R3D A;  3ZQJ A;  3KS4 A;  2XSZ A;  3K9P A;  3DA1 A;  4F2L A;  3K8Z A;  3TE6 A;  4ITQ A;  2K0B X;  4L15 A;  1ZMV A;  4DV3 M;  5EXT A;  2HWJ A;  4DBG B;  4MGH A;  3PNY A;  1HQC A;  2DHY A;  5EP3 A;  2UUC M;  3H4J A;  4DUY M;  3KOW E;  3JR4 A;  4NC6 A;  1IY0 A;  3KVW A;  3IG5 A;  4L78 A;  1Z6T A;  1AIP C;  2QQ8 A;  2C96 A;  2B3T A;  1Y8G A;  3PXG A;  3GO8 A;  4DV0 M;  1XNR M;  4G4O A;  4TUW A;  4WW0 A;  4LJ4 A;  4HLQ A;  5ITY A;  1DGB A;  2ZAN A;  3UZU A;  3TQS A;  2OPF A;  4IBJ A;  4KT0 F;  1R2Y A;  1WGN A;  4QHS A;  2XFS A;  2JUJ A;  4UN2 B;  4ANR A;  5IWA M;  2DWL A;  2Y21 A;  3HGI A;  4K0K M;  3U6E A;  1J09 A;  3TWL A;  3KSJ A;  4LFB M;  2KA6 B;  3KOX E;  4G6Z A;  1QUS A;  2KRK A;  3Q8G A;  4AZF A;  2HHH M;  1GL7 A;  2LNH C;  4PT5 A;  4DV7 M;  2FOI C;  3AOE C;  1HJP A;  1QDT A;  3FUX A;  2KZU A;  4CHT B;  4I5S A;  2Z7J A;  1EE8 A;  2LWX A;  3KDS E;  2R4E A;  3BBZ A;  1N34 M;  1PGY A;  1IY2 A;  1XHB A;  1ZMU A;  1QVR A;  2HKJ A;  4AW4 A;  1JQJ C;  3JR5 A;  1QAQ A;  4Z8X A;  1SXJ E;  1Q39 A;  3B74 A;  2M5Z A;  3HWS A;  2FNA A;  4MB7 A;  3LCU A;  3D8L A;  3LVV A;  3FUU A;  4AKG A;  1IN4 A;  4LRT A;  3NBX X;  4GMQ A;  3W0F A;  2R4J A;  2WZJ A;  3GLG A;  2LVN C;  3U61 A;  4QNR A;  4AQY M;  3U5Z B;  1SXJ A;  3L29 A;  4QNM A;  2CV1 A;  5FTL A;  1SXJ D;  2F5O A;  4JI0 M;  1IN8 A;  3VDP A;  5KO3 A;  1J5E M;  2R65 A;  4DR7 M;  4GIP A;  1QAO A;  2V1C A;  1L2C A;  5ITX E;  1IXR C;  2F5P A;  4CIS A;  4FCW A;  4R7G A;  4IBI A;  3HU1 A;  2R46 A;  1NVM A;  4B7F A;  4LGM A;  4LF5 M;  2UUA M;  3AJI B;  1TR8 A;  2D7E A;  1QDR A;  1MX0 A;  1E9R A;  2QPA A;  3Q8X A;  4JI4 M;  1IY1 A;  1V34 A;  1G41 A;  4NL4 H;  3GLF A;  2RGO A;  1ZV1 A;  2C5R A;  1G4A E;  3AFH A;  1GKI A;  4JYA M;  2MH8 A;  2A5Y B;  3K1J A;  4LFA M;  4JN6 A;  4X62 M;  1YLA A;  2XSZ D;  4X64 M;  3GPX A;  2KDL A;  4KOD A;  2JZ1 A;  2C98 A;  1VG5 A;  3DFZ A;  4MGZ E;  4M9Z A;  1YE9 A;  2EUC A;  2YNM D;  1OKS A;  1WHC A;  4LF4 M;  1DGF A;  1OFH A;  3FTE A;  4AG5 A;  2QZ4 A;  4NXN M;  1L2B A;  3K9O A;  4PDG A;  2VQF M;  2UUB M;  4NXM M;  4IBE A;  5IZ7 D;  2OO9 A;  3J7B A;  2L2D A;  3KS8 A;  4MGI E;  3U61 B;  2DXI A;  4PCZ A;  1IM2 A;  3F92 A;  3FRI A;  1XB2 B;  3J80 S;  3VDU A;  1R7R A;  2CHV A;  1R6B X;  4XBO A;  1D2N A;  1OTR A;  2F5N A;  1GJT A;  2F5S A;  2C99 A;  1TF0 B;  2L7I A;  2O5R A;  3WHK A;  1OFI A;  2DNA A;  2Z4R A;  4M9S A;  2OOB A;  1PJJ A;  2HAK A;  5EP1 A;  4G4R A;  1P3Q Q;  2DZO B;  3DOA A;  5EP4 A;  4A3V B;  1NV9 A;  2J7O A;  1QQW A;  4DR6 M;  2KW0 A;  3T15 A;  2O25 A;  2YR0 A;  2KHH A;  2V6Z M;  5E26 A;  2JY7 A;  2QP9 X;  2H1R A;  2G5G X;  2L4F A;  1D0M A;  4IBD A;  1Z5B A;  3FUW A;  2DI0 A;  3RFW A;  3LQQ A;  3UK6 A;  2CRU A;  2CE7 A;  2X49 A;  2CEA A;  3T6P A;  4LF8 M;  1IXS A;  1PJS A;  1ZMW A;  2LH0 A;  3CF2 A;  2VF8 A;  3GP1 A;  5GKN A;  1KYI A;  1A5T A;  2XGN A;  3E46 A;  1NJG A;  2EJS A;  4BBA A;  2FS1 A;  1XWI A;  4QOS A;  2UXB M;  1G71 A;  4B08 A;  2MJ5 B;  2LVP C;  2UU9 M;  3GRU A;  5DYG A;  1R4G A;  3A46 A;  2CHG A;  1C1K A;  2DWZ B;  4LGY A;  4W5W A;  3THG A;  2QNJ A;  4F1I A;  1TDH A;  3SAR A;  1S3S A;  3SMP A;  1DO0 A;  5KQ8 A;  4DR5 M;  1Q3B A;  3I51 A;  5C1B A;  4LG2 A;  2DWM A;  1G8P A;  3TWK A;  3JAM S;  2R44 A;  2YFQ A;  3C9P A;  3U60 B;  4LRS A;  4Z6Y A;  4D82 A;  3GPY A;  3VLF B;  1YSY A;  3A45 A;  3GLF E;  1R2Z A;  3T1H M;  3J2P B;  1QZM A;  3ZC7 B;  2XLJ A;  3VKG A;  4DV5 M;  2C9C A;  2XH9 A;  4Y28 F;  2ZBK B;  1W5T A;  3FUT A;  2F5Q A;  4RNA A;  1V92 A;  2M60 A;  2W82 A;  8CAT A;  1TH4 A;  1HT1 E;  1MU5 A;  1NHW C;  1WXQ A;  1VDD A;  3ZCB B;  3UGJ A;  1FNN A;  1IXS B;  1XXH A;  4CIZ A;  4JI3 M;  4GC9 A;  4RF1 A;  2MRO B;  3HX3 A;  5LMN M;  4DR1 M;  2KRU A;  5EJC A;  2I7P A;  3SFZ A;  3C3D A;  3IHP A;  3A42 A;  4DV6 M;  1TH2 A;  4LF9 M;  2R62 A;  4LF7 M;  1NNJ A;  3FTC A;  4YY3 M;  3LW5 F;  4Q7J A;  2DWN A;  1L2D A;  4B3T M;  3J7A S;  3U6L A;  3GRY A;  2R45 A;  1RU3 A;  1EIJ A;  5JI2 E;  3E9S A;  3MK6 A;  2AHM A;  1I94 M;  3C58 A;  1Q02 A;  3GQ3 A;  3SAT A;  4QHT A;  2RRU A;  2QCU A;  4DR2 M;  1IN5 A;  1TTE A;  1WIV A;  1E94 E;  2HCB A;  3HU3 A;  3LQR A;  3L28 A;  3CGW A;  4HL4 A;  1G3I A;  1SXJ B; 
#chains in the Genus database with same CATH homology
 1GJS A;  1TF0 B;  1PRB A;  2LHG A;  2VDB B;  2JWS A;  2KDL A;  2N35 A;  2J5Y A;  2LHC A;  1GJT A;  2FS1 A;  1GAB A;  2MH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...