1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
molecule tags Immunoglobulin-binding protein
source organism Streptococcus sp. 'group g'
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
1GABA 2N35A 1GJTA 2VDBB 1PRBA 2KDLA 2LHCA 2MH8A 2J5YA 2LHGA 2FS1A 2JWSA 1GJSA 1TF0B
chains in the Genus database with same CATH superfamily
1J09A 2WZJA 2MJ5B 4R7GA 3J27B 1VEKA 5KPTA 5E6JA 5FTLA 3GLIA 3L27A 3GP1A 3E21A 4G4QA 1ORYB 2C5RA 2QBYA 4CISA 4GHAA 4LFCM 3VKGA 1Q3BA 3HKPA 2V6ZM 1IXZA 1DGBA 1NNUC 1OIZA 3KP0E 2R4EA 4PD2A 1ZV1A 2FNAA 1XXHE 3B7NA 4LFBM 4AKIA 3VKHA 3H4MA 1EE8A 4B3MM 4LJ4A 5IT9S 1R2YA 1DGFA 3SARA 2BNKA 4DBGB 1BVSA 2CV0A 2KNVA 1VEJA 4ITQA 1C1KA 1WHCA 3F92A 1GVNA 3LQQA 4DR5M 4DV5M 2MH8A 3BXWA 4K0KM 4HEOA 4LF6M 1IBLM 2R4JA 1LV7A 1XWIA 5FLXS 1K82A 4G3OA 1VDDA 1T3TA 1W5SA 1DGGA 5ITQA 2JWSA 2BWEA 4BBAA 4LF7M 4MH0E 3OTOM 3WHKA 5FTJA 3SMPA 3JAMS 2F5OA 3K9PA 3U6OA 2XZFA 3VFDA 2VF8A 4KT0F 4IBKA 1D0KA 1TDHA 2VDBB 2DAIA 3UJNA 5JI3E 3W68A 2BWBA 3U6SA 1SXJE 2FH0A 2CV1A 1MU5A 2D7GA 1Z59A 1TF0B 2J7NA 2YNMD 1F4IA 2Z7JA 1WXQA 1ZMUA 3KDSE 1A5TA 3IG5A 2CRUA 2DAGA 2QSFX 1XC8A 3U6PA 1IN6A 1GLNA 2K0BX 2KXEA 3TWLA 3SASA 2KNAA 3M6AA 4AKHA 5IZ7D 1EFUB 3FUTA 5ITXA 3HZJA 1QDRA 2ZAOA 4R3DA 1Z5AA 1DO2A 1PJTA 1NHWC 2L09A 3GRYA 4JI3M 3K2LA 3VK8A 3GLGA 4KLNA 3KS8A 3GRVA 1JQJC 3AL0C 2GQFA 1Q3CA 1VG5A 5EJCA 2L7IA 1K3WA 4DV2M 1HNWM 4RKUF 4XBOA 1N78A 4AKGA 4LF4M 3KOZE 4JI2M 3AFHA 4BLCA 3A98B 4GC5A 3AOEC 5JI2E 1JR3D 1E94E 1R6BX 1QAQA 4IBBA 2A5YB 1ZMVA 5EQTA 3RFWA 4JI4M 2CEAA 3I04M 3J7BA 2CV2A 2DKLA 1NNJA 3W67A 4LJ9A 3LW5F 4PDIA 1V33A 4GITA 2JY5A 2JY7A 3GLFE 4FCVA 4DV4M 1D0LA 2D7EA 4M0WA 4GRIA 5EP3A 2Y20A 2I7NA 4CGYB 3AKZA 2O25A 4TUWA 2ZM6M 3KOYE 2XGNA 3L25A 2D7HA 2VIIA 2Z8YM 1XXHB 2DWLA 4LGMA 3U6LA 3K92A 3LVVA 2KZSA 5F3WA 4GMQA 4PT5A 1QAOA 5DFLA 3C58A 1WR1B 1OFHA 2R6FA 1DO0A 2LTUA 1I94M 2UXCM 1VQ1A 3ZCBB 3DOAA 4LRTA 2VF7A 1NJGA 5DYIA 1GKIA 2LVPC 1XMQM 2DWNA 5KPZA 2P5TA 3SATA 4JI7M 5DYGA 1IQPA 2CHVA 1PJJA 4JI5M 4LF9M 2Z4RA 4GKJM 1SG9A 4FCTA 5C1BA 4WW0A 3HJ8A 3PVSA 2E5LM 4Y28F 5L8RF 2LH0A 2VQFM 4P17A 4NOOB 3BBZA 3I4VA 1IXSB 2RRUA 3FUXA 4DR1M 1QYRA 4KODA 4AW4A 4LJ8A 1QANA 3GRUA 3KP1E 3HU2A 3B7QA 3UK6A 1XNQM 1SXJB 3M7GA 3C3DA 2LXEA 3THGA 4HLQA 4I8OA 3C3EA 3L26A 2XZUA 2QQ8A 3B74A 1MN3A 1W5TA 1IN8A 2B3TA 4DV0M 1VEGA 2OPFA 3RGPA 1Z6TA 2JZ0A 1J7KA 3E9SA 3Q8XA 5BPVA 1NV9A 4B3SM 1KYIA 3IECA 1IY0A 5H37D 3RE8A 3GPPA 4YY3M 3SC3A 3R9XB 4L16A 2ZTDA 2K47A 2EA0A 3SMSA 2QPAA 4B7GA 2L4FA 2WSFF 1XMOM 5DNYA 1OAIA 1HNXM 3K8ZA 3J2PB 1N34M 4NXNM 2VQEM 1TTEA 1V92A 2AHMA 2JY6B 4LZZA 1DGHB 3KW6A 1GL6A 4AG5A 5BR8M 3SAUA 1PJQA 4DUZM 2MR9A 3HU1A 2Z4SA 1XXHA 4MM3B 3VDUA 3QWLA 5KQDA 2DXIA 1HT1E 3FUUA 3U61B 3CGWA 3QYEA 2EJSA 2QZ4A 2DVWB 2EUCA 3QYBA 2XEPA 4YHHM 2K6BA 1AUAA 3VLFB 4FWHA 2F5PA 3PFIA 4KO8A 3T38A 1R4GA 3GLFB 4JI0M 1CUKA 2W82A 3C9PA 3KOWE 4LRSA 4B7FA 3KSJA 5EXTA 4NXMM 3MK6A 4REZA 4X64M 1HJPA 4WP2A 3GO8A 1OQYA 3TE6A 4FD2A 3J81S 4QOSA 3B7ZA 3GPXA 4P16A 3L29A 4II7A 2ZAMA 3A46A 1OIPA 4RF1A 4IIWA 1PJIA 2J7OA 3AV0A 2V1CA 1G41A 1IXSA 3JR5A 3W0FA 4CJ6A 1KSFX 1TH3A 3GPYA 3FUVA 5FTMA 2LNHC 3KSXA 1TR8A 2UXDM 3FTCA 2FS1A 2XFTA 3HHYA 2L2DA 1QQWA 3FTEA 1N77A 1L2CA 2YQZA 4IJFA 2ZBKB 1N36M 3M0EA 1K3XA 4DR6M 2DNAA 4M9XA 1TH2A 2R45A 3I01M 3FRHA 4X66M 3V76A 1QAMA 3E46A 4F2LA 3GLGE 1JR3E 2DAMA 3GQ3A 3HJQA 4M0DA 1L2BA 5LMUM 2JNHA 4I81A 4OVZB 4LGYA 3KS4A 3L2AA 1D0MA 2Z3XA 4JYAM 1PGYA 3J80S 4B08A 2K9DA 4MGHA 1H6UA 1GJTA 1P3QQ 2RKOA 3KXEC 4L4UA 1Q02A 3CF6E 3FTFA 2BJWA 4JI1M 2LHGA 3B9PA 1DGHA 4JI6M 4X65M 4CIZA 1E9SA 3B89A 4L6V6 3DZDA 1IN4A 3LVWA 1L2DA 2UUCM 2X49A 1Y8GA 4Z8XA 5KPRA 2DI0A 1RU3A 3U61A 4GH9A 3CTWB 3ZH9B 4ANRA 4MGIE 1G71A 3U6EA 3HY5A 2O01F 2L6OA 3R8FA 1G3IA 1XHBA 3IG8A 3VK7A 4CHTB 5FTNA 2XLJA 2XSZA 2OOAA 4S12A 3QAUA 5ITRA 3GLFA 4MB7A 1UFZA 1MX0A 2QP9X 3SHFA 4IBCA 3U6QA 3CF2A 5FSWA 3SBJA 3MJ5A 2DZNB 2F5SA 4M9ZA 4G6ZA 1IBMM 2WSEF 3HJSA 3TWMA 2J5YA 4I4LA 1QUSA 3TPZA 2X4AA 3U6MA 3TL4X 3A45A 2F5NA 1I4WA 2HWJA 3GLHE 4W5WA 4B3TM 1FJGM 3W0LB 3KVWA 2M5ZA 1NJFA 1YLAA 4L78A 2UU9M 1C7YA 2DWMA 1HQCA 1LTMA 4FWGA 2KRUA 2R65A 3SYLA 2CE7A 2C9CA 2BJVA 3FE3A 1PM5A 2MGWA 3HGIA 5ITYA 2FFJA 4JV5M 3MHVC 3HHZA 1T43A 2KNZA 2ERCA 3HU3A 1YSYA 2Y21A 3NBXX 2L7HA 3HWSA 3U5ZB 3PNYA 4PCZA 2G8LA 1SXJC 4FW9A 4IBFA 4JXJA 5ITTA 2LVAA 2C9OA 4OVZA 3LCVB 1IN5A 5LMNM 1XB2B 2YFQA 4B3RM 3SAWA 1OKSA 4QHTA 5EP4A 3GLIE 3DFZA 4G4RA 1N75A 3FYDA 3T1HM 1IY2A 2HL7A 4IBGA 4FVMA 3DA1A 2L4EA 4KHPM 2C98A 2RGHA 3T15A 5IWAM 4A3VB 7CATA 4QOZC 1QZMA 4QNMA 1ZMWA 3HHWA 2MROB 2KA6B 1KFVA 1NY5A 2DAEA 4AQYM 4DV1M 4LF5M 2KHHA 2CHQA 2DZOB 3PNVA 2FE8A 1PJSA 1T6OA 4B7HA 1L1ZA 4NRVA 2DWZB 4IBJA 2LVQD 4F1IA 4LCBA 1VDLA 1IY1A 1GJSA 5GKNA 2QNJA 4DR3M 4LG2A 1YUBA 3GQ4A 1AIPC 4MGKE 1WGNA 1L8QA 1OTRA 3SAVA 2QENA 1QVRA 4IBEA 2ZTCA 3VDPA 4DV7M 1R2ZA 1NO1A 3LMMA 2XF3A 2KEBA 4FWDA 1WGLA 4QNRA 2DAKA 3T1YM 3T6PA 1EIJA 3TWKA 4UN2B 3EIEA 4LJ7A 4EIWA 1V34A 3PXGA 5C18A 3NBIA 4GIPA 1WJ7A 3SYKA 1GO5A 2OQ4A 1YE9A 3D8LA 4OX9M 2JY8A 5A2QS 1NV8A 1NY6A 1HT2E 1OJLA 2QHOB 3U60B 4NRWA 4GC9A 2I7PA 2UUAM 2OOBA 4I5SA 4FCWA 2HHHM 4AZFA 1SXJA 4OW0A 4Z6YA 3U5ZA 1E32A 3HX3A 5ITXE 3GLHB 3ILKA 2H5XA 2XFSA 2Y0TA 2DZLA 2C99A 2N35A 3H4JA 4GEWA 2HKJA 1IBKM 2C96A 4BB9A 4G4NA 2R46A 4AG6A 1GL7A 5EXXA 3RGSA 3FYCA 5KO3A 1SXJD 4NC6A 4NSRA 2DENA 4G4OA 2APLA 3BOSA 4IJEA 2JUJA 2LVOC 1HNZM 4LJ5A 3E4RA 1IXRC 1OFIA 1WIVA 2HAKA 4GKKM 5FTKA 3KOXE 2JP7A 2JXNA 4AI6A 4LJAA 3CF0A 4DV3M 3GPUA 3FD9A 4QHSA 2X8AA 4XK8F 2R18A 1TH4A 5EXPA 1JR3A 3SHGB 3JR4A 8CATA 4LY6A 2Y0QA 5IREB 3SFZA 3ZQJA 4D81A 4DUYM 2O5RA 4DR7M 4GHLA 1OAOC 1IM2A 1D2NA 4M9SA 1DV0A 3I51A 4NL4H 1R7RA 2OO9A 4MGYE 2H1RA 4LZJA 1UM8A 2CFOA 2DHRA 1N33M 3GLIB 1QUTA 2M60A 2G5GX 2JA2A 3GQ5A 3U6DA 2QBYB 1R5LA 1NHGC 4WURA 1TGUA 1E9RA 2NQ8C 2CHGA 4IBDA 3J7AS 1HR0M 2CP8A 5ITUA 2KZUA 2LVNC 3A42A 3HHXA 4JN6A 2R44A 3IHPA 4DR4M 3LCUA 1X37A 4MGZE 2EO2A 1XNRM 3Q8GA 3D8BA 2HCBA 2CWBA 5KQ8A 1N32M 4ZPXA 2LHCA 1S3SA 4X62M 1QZEA 2XSZD 3UGJA 3UMMA 4IBIA 3L28A 2CUZA 3NWLA 2F5QA 1NSFA 1Q39A 1FNNA 2Q2EB 2EKKA 5EP2A 3GRRA 3U6CA 2QCUA 4JI8M 3U60A 2ZANA 2F4VM 4RF0A 4XGIA 1IFYA 3LQRA 2G3QA 2UUBM 2XH9A 4RNAA 1GABA 4R71A 2JZ1A 1IN7A 2FOIC 2WSCF 3GLHA 5EXSA 1ZAEA 3AJIB 4D82A 3FUWA 2LBCA 4NSOB 2RGOA 2KRKA 3FRIA 4L15A 4Q7JA 1TDZA 4LF8M 4OU7A 1HQYE 3UZUA 1MJGM 2GNOA 2R0IA 4LJ6A 3KFUG 1G4AE 1QDTA 2KW0A 2YR0A 4PDGA 2EKFA 2R62A 4DR2M 1L1TA 1G59A 1Z5BA 5EP1A 1NVMA 1JB0F 4D80A 1PRBA 2KDLA 1J5EM 1ZQ9A 3ZC7B 1G8PA 5E26A 3TQSA 2LWXA 3EIHA 3WHLA 4DV6M 1Z5CA 4HL4A 3AOEA 3FTDA 3MMPA 4LFAM 3GLGB 3K1JA 3FKEA 2UXBM 3K9OA 4L8RC 3AOGA 2V1UA 2DHYA 3I4YA
chains in the Genus database with same CATH topology
1GABA 2N35A 1GJTA 2VDBB 1PRBA 2KDLA 2LHCA 2MH8A 2J5YA 2LHGA 2FS1A 2JWSA 1GJSA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAB A;  2N35 A;  1GJT A;  2VDB B;  1PRB A;  2KDL A;  2LHC A;  2MH8 A;  2J5Y A;  2LHG A;  2FS1 A;  2JWS A;  1GJS A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 1J09 A;  2WZJ A;  2MJ5 B;  4R7G A;  3J27 B;  1VEK A;  5KPT A;  5E6J A;  5FTL A;  3GLI A;  3L27 A;  3GP1 A;  3E21 A;  4G4Q A;  1ORY B;  2C5R A;  2QBY A;  4CIS A;  4GHA A;  4LFC M;  3VKG A;  1Q3B A;  3HKP A;  2V6Z M;  1IXZ A;  1DGB A;  1NNU C;  1OIZ A;  3KP0 E;  2R4E A;  4PD2 A;  1ZV1 A;  2FNA A;  1XXH E;  3B7N A;  4LFB M;  4AKI A;  3VKH A;  3H4M A;  1EE8 A;  4B3M M;  4LJ4 A;  5IT9 S;  1R2Y A;  1DGF A;  3SAR A;  2BNK A;  4DBG B;  1BVS A;  2CV0 A;  2KNV A;  1VEJ A;  4ITQ A;  1C1K A;  1WHC A;  3F92 A;  1GVN A;  3LQQ A;  4DR5 M;  4DV5 M;  2MH8 A;  3BXW A;  4K0K M;  4HEO A;  4LF6 M;  1IBL M;  2R4J A;  1LV7 A;  1XWI A;  5FLX S;  1K82 A;  4G3O A;  1VDD A;  1T3T A;  1W5S A;  1DGG A;  5ITQ A;  2JWS A;  2BWE A;  4BBA A;  4LF7 M;  4MH0 E;  3OTO M;  3WHK A;  5FTJ A;  3SMP A;  3JAM S;  2F5O A;  3K9P A;  3U6O A;  2XZF A;  3VFD A;  2VF8 A;  4KT0 F;  4IBK A;  1D0K A;  1TDH A;  2VDB B;  2DAI A;  3UJN A;  5JI3 E;  3W68 A;  2BWB A;  3U6S A;  1SXJ E;  2FH0 A;  2CV1 A;  1MU5 A;  2D7G A;  1Z59 A;  1TF0 B;  2J7N A;  2YNM D;  1F4I A;  2Z7J A;  1WXQ A;  1ZMU A;  3KDS E;  1A5T A;  3IG5 A;  2CRU A;  2DAG A;  2QSF X;  1XC8 A;  3U6P A;  1IN6 A;  1GLN A;  2K0B X;  2KXE A;  3TWL A;  3SAS A;  2KNA A;  3M6A A;  4AKH A;  5IZ7 D;  1EFU B;  3FUT A;  5ITX A;  3HZJ A;  1QDR A;  2ZAO A;  4R3D A;  1Z5A A;  1DO2 A;  1PJT A;  1NHW C;  2L09 A;  3GRY A;  4JI3 M;  3K2L A;  3VK8 A;  3GLG A;  4KLN A;  3KS8 A;  3GRV A;  1JQJ C;  3AL0 C;  2GQF A;  1Q3C A;  1VG5 A;  5EJC A;  2L7I A;  1K3W A;  4DV2 M;  1HNW M;  4RKU F;  4XBO A;  1N78 A;  4AKG A;  4LF4 M;  3KOZ E;  4JI2 M;  3AFH A;  4BLC A;  3A98 B;  4GC5 A;  3AOE C;  5JI2 E;  1JR3 D;  1E94 E;  1R6B X;  1QAQ A;  4IBB A;  2A5Y B;  1ZMV A;  5EQT A;  3RFW A;  4JI4 M;  2CEA A;  3I04 M;  3J7B A;  2CV2 A;  2DKL A;  1NNJ A;  3W67 A;  4LJ9 A;  3LW5 F;  4PDI A;  1V33 A;  4GIT A;  2JY5 A;  2JY7 A;  3GLF E;  4FCV A;  4DV4 M;  1D0L A;  2D7E A;  4M0W A;  4GRI A;  5EP3 A;  2Y20 A;  2I7N A;  4CGY B;  3AKZ A;  2O25 A;  4TUW A;  2ZM6 M;  3KOY E;  2XGN A;  3L25 A;  2D7H A;  2VII A;  2Z8Y M;  1XXH B;  2DWL A;  4LGM A;  3U6L A;  3K92 A;  3LVV A;  2KZS A;  5F3W A;  4GMQ A;  4PT5 A;  1QAO A;  5DFL A;  3C58 A;  1WR1 B;  1OFH A;  2R6F A;  1DO0 A;  2LTU A;  1I94 M;  2UXC M;  1VQ1 A;  3ZCB B;  3DOA A;  4LRT A;  2VF7 A;  1NJG A;  5DYI A;  1GKI A;  2LVP C;  1XMQ M;  2DWN A;  5KPZ A;  2P5T A;  3SAT A;  4JI7 M;  5DYG A;  1IQP A;  2CHV A;  1PJJ A;  4JI5 M;  4LF9 M;  2Z4R A;  4GKJ M;  1SG9 A;  4FCT A;  5C1B A;  4WW0 A;  3HJ8 A;  3PVS A;  2E5L M;  4Y28 F;  5L8R F;  2LH0 A;  2VQF M;  4P17 A;  4NOO B;  3BBZ A;  3I4V A;  1IXS B;  2RRU A;  3FUX A;  4DR1 M;  1QYR A;  4KOD A;  4AW4 A;  4LJ8 A;  1QAN A;  3GRU A;  3KP1 E;  3HU2 A;  3B7Q A;  3UK6 A;  1XNQ M;  1SXJ B;  3M7G A;  3C3D A;  2LXE A;  3THG A;  4HLQ A;  4I8O A;  3C3E A;  3L26 A;  2XZU A;  2QQ8 A;  3B74 A;  1MN3 A;  1W5T A;  1IN8 A;  2B3T A;  4DV0 M;  1VEG A;  2OPF A;  3RGP A;  1Z6T A;  2JZ0 A;  1J7K A;  3E9S A;  3Q8X A;  5BPV A;  1NV9 A;  4B3S M;  1KYI A;  3IEC A;  1IY0 A;  5H37 D;  3RE8 A;  3GPP A;  4YY3 M;  3SC3 A;  3R9X B;  4L16 A;  2ZTD A;  2K47 A;  2EA0 A;  3SMS A;  2QPA A;  4B7G A;  2L4F A;  2WSF F;  1XMO M;  5DNY A;  1OAI A;  1HNX M;  3K8Z A;  3J2P B;  1N34 M;  4NXN M;  2VQE M;  1TTE A;  1V92 A;  2AHM A;  2JY6 B;  4LZZ A;  1DGH B;  3KW6 A;  1GL6 A;  4AG5 A;  5BR8 M;  3SAU A;  1PJQ A;  4DUZ M;  2MR9 A;  3HU1 A;  2Z4S A;  1XXH A;  4MM3 B;  3VDU A;  3QWL A;  5KQD A;  2DXI A;  1HT1 E;  3FUU A;  3U61 B;  3CGW A;  3QYE A;  2EJS A;  2QZ4 A;  2DVW B;  2EUC A;  3QYB A;  2XEP A;  4YHH M;  2K6B A;  1AUA A;  3VLF B;  4FWH A;  2F5P A;  3PFI A;  4KO8 A;  3T38 A;  1R4G A;  3GLF B;  4JI0 M;  1CUK A;  2W82 A;  3C9P A;  3KOW E;  4LRS A;  4B7F A;  3KSJ A;  5EXT A;  4NXM M;  3MK6 A;  4REZ A;  4X64 M;  1HJP A;  4WP2 A;  3GO8 A;  1OQY A;  3TE6 A;  4FD2 A;  3J81 S;  4QOS A;  3B7Z A;  3GPX A;  4P16 A;  3L29 A;  4II7 A;  2ZAM A;  3A46 A;  1OIP A;  4RF1 A;  4IIW A;  1PJI A;  2J7O A;  3AV0 A;  2V1C A;  1G41 A;  1IXS A;  3JR5 A;  3W0F A;  4CJ6 A;  1KSF X;  1TH3 A;  3GPY A;  3FUV A;  5FTM A;  2LNH C;  3KSX A;  1TR8 A;  2UXD M;  3FTC A;  2FS1 A;  2XFT A;  3HHY A;  2L2D A;  1QQW A;  3FTE A;  1N77 A;  1L2C A;  2YQZ A;  4IJF A;  2ZBK B;  1N36 M;  3M0E A;  1K3X A;  4DR6 M;  2DNA A;  4M9X A;  1TH2 A;  2R45 A;  3I01 M;  3FRH A;  4X66 M;  3V76 A;  1QAM A;  3E46 A;  4F2L A;  3GLG E;  1JR3 E;  2DAM A;  3GQ3 A;  3HJQ A;  4M0D A;  1L2B A;  5LMU M;  2JNH A;  4I81 A;  4OVZ B;  4LGY A;  3KS4 A;  3L2A A;  1D0M A;  2Z3X A;  4JYA M;  1PGY A;  3J80 S;  4B08 A;  2K9D A;  4MGH A;  1H6U A;  1GJT A;  1P3Q Q;  2RKO A;  3KXE C;  4L4U A;  1Q02 A;  3CF6 E;  3FTF A;  2BJW A;  4JI1 M;  2LHG A;  3B9P A;  1DGH A;  4JI6 M;  4X65 M;  4CIZ A;  1E9S A;  3B89 A;  4L6V 6;  3DZD A;  1IN4 A;  3LVW A;  1L2D A;  2UUC M;  2X49 A;  1Y8G A;  4Z8X A;  5KPR A;  2DI0 A;  1RU3 A;  3U61 A;  4GH9 A;  3CTW B;  3ZH9 B;  4ANR A;  4MGI E;  1G71 A;  3U6E A;  3HY5 A;  2O01 F;  2L6O A;  3R8F A;  1G3I A;  1XHB A;  3IG8 A;  3VK7 A;  4CHT B;  5FTN A;  2XLJ A;  2XSZ A;  2OOA A;  4S12 A;  3QAU A;  5ITR A;  3GLF A;  4MB7 A;  1UFZ A;  1MX0 A;  2QP9 X;  3SHF A;  4IBC A;  3U6Q A;  3CF2 A;  5FSW A;  3SBJ A;  3MJ5 A;  2DZN B;  2F5S A;  4M9Z A;  4G6Z A;  1IBM M;  2WSE F;  3HJS A;  3TWM A;  2J5Y A;  4I4L A;  1QUS A;  3TPZ A;  2X4A A;  3U6M A;  3TL4 X;  3A45 A;  2F5N A;  1I4W A;  2HWJ A;  3GLH E;  4W5W A;  4B3T M;  1FJG M;  3W0L B;  3KVW A;  2M5Z A;  1NJF A;  1YLA A;  4L78 A;  2UU9 M;  1C7Y A;  2DWM A;  1HQC A;  1LTM A;  4FWG A;  2KRU A;  2R65 A;  3SYL A;  2CE7 A;  2C9C A;  2BJV A;  3FE3 A;  1PM5 A;  2MGW A;  3HGI A;  5ITY A;  2FFJ A;  4JV5 M;  3MHV C;  3HHZ A;  1T43 A;  2KNZ A;  2ERC A;  3HU3 A;  1YSY A;  2Y21 A;  3NBX X;  2L7H A;  3HWS A;  3U5Z B;  3PNY A;  4PCZ A;  2G8L A;  1SXJ C;  4FW9 A;  4IBF A;  4JXJ A;  5ITT A;  2LVA A;  2C9O A;  4OVZ A;  3LCV B;  1IN5 A;  5LMN M;  1XB2 B;  2YFQ A;  4B3R M;  3SAW A;  1OKS A;  4QHT A;  5EP4 A;  3GLI E;  3DFZ A;  4G4R A;  1N75 A;  3FYD A;  3T1H M;  1IY2 A;  2HL7 A;  4IBG A;  4FVM A;  3DA1 A;  2L4E A;  4KHP M;  2C98 A;  2RGH A;  3T15 A;  5IWA M;  4A3V B;  7CAT A;  4QOZ C;  1QZM A;  4QNM A;  1ZMW A;  3HHW A;  2MRO B;  2KA6 B;  1KFV A;  1NY5 A;  2DAE A;  4AQY M;  4DV1 M;  4LF5 M;  2KHH A;  2CHQ A;  2DZO B;  3PNV A;  2FE8 A;  1PJS A;  1T6O A;  4B7H A;  1L1Z A;  4NRV A;  2DWZ B;  4IBJ A;  2LVQ D;  4F1I A;  4LCB A;  1VDL A;  1IY1 A;  1GJS A;  5GKN A;  2QNJ A;  4DR3 M;  4LG2 A;  1YUB A;  3GQ4 A;  1AIP C;  4MGK E;  1WGN A;  1L8Q A;  1OTR A;  3SAV A;  2QEN A;  1QVR A;  4IBE A;  2ZTC A;  3VDP A;  4DV7 M;  1R2Z A;  1NO1 A;  3LMM A;  2XF3 A;  2KEB A;  4FWD A;  1WGL A;  4QNR A;  2DAK A;  3T1Y M;  3T6P A;  1EIJ A;  3TWK A;  4UN2 B;  3EIE A;  4LJ7 A;  4EIW A;  1V34 A;  3PXG A;  5C18 A;  3NBI A;  4GIP A;  1WJ7 A;  3SYK A;  1GO5 A;  2OQ4 A;  1YE9 A;  3D8L A;  4OX9 M;  2JY8 A;  5A2Q S;  1NV8 A;  1NY6 A;  1HT2 E;  1OJL A;  2QHO B;  3U60 B;  4NRW A;  4GC9 A;  2I7P A;  2UUA M;  2OOB A;  4I5S A;  4FCW A;  2HHH M;  4AZF A;  1SXJ A;  4OW0 A;  4Z6Y A;  3U5Z A;  1E32 A;  3HX3 A;  5ITX E;  3GLH B;  3ILK A;  2H5X A;  2XFS A;  2Y0T A;  2DZL A;  2C99 A;  2N35 A;  3H4J A;  4GEW A;  2HKJ A;  1IBK M;  2C96 A;  4BB9 A;  4G4N A;  2R46 A;  4AG6 A;  1GL7 A;  5EXX A;  3RGS A;  3FYC A;  5KO3 A;  1SXJ D;  4NC6 A;  4NSR A;  2DEN A;  4G4O A;  2APL A;  3BOS A;  4IJE A;  2JUJ A;  2LVO C;  1HNZ M;  4LJ5 A;  3E4R A;  1IXR C;  1OFI A;  1WIV A;  2HAK A;  4GKK M;  5FTK A;  3KOX E;  2JP7 A;  2JXN A;  4AI6 A;  4LJA A;  3CF0 A;  4DV3 M;  3GPU A;  3FD9 A;  4QHS A;  2X8A A;  4XK8 F;  2R18 A;  1TH4 A;  5EXP A;  1JR3 A;  3SHG B;  3JR4 A;  8CAT A;  4LY6 A;  2Y0Q A;  5IRE B;  3SFZ A;  3ZQJ A;  4D81 A;  4DUY M;  2O5R A;  4DR7 M;  4GHL A;  1OAO C;  1IM2 A;  1D2N A;  4M9S A;  1DV0 A;  3I51 A;  4NL4 H;  1R7R A;  2OO9 A;  4MGY E;  2H1R A;  4LZJ A;  1UM8 A;  2CFO A;  2DHR A;  1N33 M;  3GLI B;  1QUT A;  2M60 A;  2G5G X;  2JA2 A;  3GQ5 A;  3U6D A;  2QBY B;  1R5L A;  1NHG C;  4WUR A;  1TGU A;  1E9R A;  2NQ8 C;  2CHG A;  4IBD A;  3J7A S;  1HR0 M;  2CP8 A;  5ITU A;  2KZU A;  2LVN C;  3A42 A;  3HHX A;  4JN6 A;  2R44 A;  3IHP A;  4DR4 M;  3LCU A;  1X37 A;  4MGZ E;  2EO2 A;  1XNR M;  3Q8G A;  3D8B A;  2HCB A;  2CWB A;  5KQ8 A;  1N32 M;  4ZPX A;  2LHC A;  1S3S A;  4X62 M;  1QZE A;  2XSZ D;  3UGJ A;  3UMM A;  4IBI A;  3L28 A;  2CUZ A;  3NWL A;  2F5Q A;  1NSF A;  1Q39 A;  1FNN A;  2Q2E B;  2EKK A;  5EP2 A;  3GRR A;  3U6C A;  2QCU A;  4JI8 M;  3U60 A;  2ZAN A;  2F4V M;  4RF0 A;  4XGI A;  1IFY A;  3LQR A;  2G3Q A;  2UUB M;  2XH9 A;  4RNA A;  1GAB A;  4R71 A;  2JZ1 A;  1IN7 A;  2FOI C;  2WSC F;  3GLH A;  5EXS A;  1ZAE A;  3AJI B;  4D82 A;  3FUW A;  2LBC A;  4NSO B;  2RGO A;  2KRK A;  3FRI A;  4L15 A;  4Q7J A;  1TDZ A;  4LF8 M;  4OU7 A;  1HQY E;  3UZU A;  1MJG M;  2GNO A;  2R0I A;  4LJ6 A;  3KFU G;  1G4A E;  1QDT A;  2KW0 A;  2YR0 A;  4PDG A;  2EKF A;  2R62 A;  4DR2 M;  1L1T A;  1G59 A;  1Z5B A;  5EP1 A;  1NVM A;  1JB0 F;  4D80 A;  1PRB A;  2KDL A;  1J5E M;  1ZQ9 A;  3ZC7 B;  1G8P A;  5E26 A;  3TQS A;  2LWX A;  3EIH A;  3WHL A;  4DV6 M;  1Z5C A;  4HL4 A;  3AOE A;  3FTD A;  3MMP A;  4LFA M;  3GLG B;  3K1J A;  3FKE A;  2UXB M;  3K9O A;  4L8R C;  3AOG A;  2V1U A;  2DHY A;  3I4Y A; 
#chains in the Genus database with same CATH homology
 1GAB A;  2N35 A;  1GJT A;  2VDB B;  1PRB A;  2KDL A;  2LHC A;  2MH8 A;  2J5Y A;  2LHG A;  2FS1 A;  2JWS A;  1GJS A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...