1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin-binding protein
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
2JWSA 2J5YA 2N35A 1TF0B 2LHGA 2LHCA 2MH8A 1GJSA 1GABA 2KDLA 1GJTA 2VDBB 1PRBA 2FS1A
chains in the Genus database with same CATH superfamily
1D0MA 4LZJA 3NBIA 1IFYA 2V1UA 2FE8A 5KQDA 1H6UA 3R9XB 1Z5AA 4R7GA 1QANA 3KOWE 1IY0A 2DKLA 2DAEA 4MGHA 5ITUA 3GPXA 3BOSA 5JI3E 2F4VM 4FCWA 3KSJA 5C18A 4I81A 4OVZB 1X37A 2R62A 1BVSA 4HL4A 3T1HM 4K0KM 4LGYA 2UXDM 1HQYE 4GEWA 2WSFF 3HHXA 4LY6A 4IBEA 3GLGA 3U6LA 3U61A 3U60A 1OFIA 2R45A 1GL6A 3UK6A 4LCBA 2Q2EB 3GLFA 1T3TA 5FTNA 5DFLA 4B08A 3GLGE 3MMPA 1HR0M 1QUSA 1GO5A 2DAMA 2R4JA 4NXMM 1OIPA 3VDUA 4AW4A 2WSEF 1TDHA 1IM2A 5EP1A 2KHHA 1QAMA 2HWJA 3SBJA 1R2ZA 5KQ8A 1Z5BA 2UXCM 1KYIA 1Q3CA 3SYLA 3WHKA 1VDLA 1QZMA 3FUTA 1JQJC 4BLCA 1R7RA 2HAKA 2ZANA 5F3WA 2QP9X 2DAIA 3KSXA 3TPZA 2L6OA 2C99A 4JI6M 4FWGA 2YQZA 4B3TM 1WHCA 2D7EA 2E5LM 1Y8GA 2JP7A 4L78A 2RRUA 2Z3XA 1SXJE 2QSFX 2GNOA 2DI0A 2C98A 5EXSA 4OU7A 2VQFM 4DV1M 4D82A 4XBOA 1DGGA 2L7HA 2W82A 3EIEA 4X62M 1IBKM 3K1JA 4CHTB 4BB9A 3QWLA 2H5XA 1KSFX 3TE6A 5DNYA 4PT5A 1DGBA 2APLA 1OFHA 2UUAM 1L2DA 3M0EA 4GMQA 2DNAA 3LQQA 2EKKA 4NRVA 3ZQJA 2R65A 2O5RA 5ITQA 1EFUB 3DA1A 1TH3A 3HU3A 1C1KA 3HHWA 4NXNM 4I4LA 1FJGM 1JB0F 2O25A 2FS1A 4FCTA 2QBYA 4JV5M 4P16A 2R18A 3QYBA 1D2NA 1XWIA 4L4UA 3GLGB 2DVWB 3U60B 3U61B 4CGYB 3JAMS 3W68A 4DV4M 1N75A 4DV5M 3LQRA 4DBGB 1L1ZA 1GABA 2LVOC 2R46A 3C58A 3MJ5A 1NHWC 3GRYA 4LJ8A 2L4FA 1OTRA 2RGOA 3J7BA 1YLAA 1OAOC 2K6BA 3D8LA 2JY5A 3FE3A 1NVMA 4YHHM 3FRIA 3IG8A 3K9OA 2CHVA 3I4VA 4IBIA 1CUKA 4JI1M 5EXXA 2A5YB 4X65M 3VKGA 1NNUC 3U6DA 4DR1M 2RGHA 1ORYB 2XZFA 2QQ8A 3PFIA 2AHMA 4G6ZA 1T43A 3GRRA 3LCUA 4FVMA 4KODA 2CV1A 3FTCA 2F5OA 3E21A 4IBGA 4MGKE 4DR6M 1IN7A 4B7FA 2KW0A 3KXEC 1GVNA 5DYGA 3LW5F 1QYRA 4REZA 1G41A 1GKIA 1QDTA 4Y28F 4I5SA 3W0LB 2KZSA 2ZM6M 2CE7A 3HGIA 3SAVA 3SARA 4GHLA 3HU1A 3K9PA 5LMUM 4LJ7A 2CV0A 4JI3M 4QOZC 1N32M 1XNRM 1MJGM 4GC9A 4IIWA 4RNAA 4M9SA 4F1IA 5ITTA 3GLIB 3U6SA 2MJ5B 2VIIA 3A46A 3GLFE 4DR3M 1N77A 1NJFA 1NY5A 1XMOM 2X4AA 5IWAM 4G4NA 4P17A 3MHVC 3B7NA 3J27B 1Q39A 3L2AA 1E94E 3F92A 1HQCA 1VDDA 3SAWA 3TQSA 2R44A 1NO1A 1VEJA 3I04M 4YY3M 1ZMUA 2CFOA 4LGMA 1N34M 2M5ZA 2YR0A 4HEOA 3GPPA 2C9CA 2R4EA 5ITXA 3HJSA 2DHYA 3DOAA 1PGYA 4JI2M 1VEKA 4LRTA 2JY6B 4X64M 2DZOB 2L4EA 2I7PA 2ZTDA 3GQ3A 1K82A 4B3MM 3W0FA 4II7A 4QHTA 4LJ9A 5E26A 4R71A 2LH0A 4RF0A 1SXJB 4NSOB 1YE9A 4PDIA 5JI2E 2XH9A 4L16A 2DWNA 1SG9A 1OIZA 1IBMM 3J2PB 3MK6A 4IBDA 3UZUA 3SASA 2JZ1A 5ITYA 3GRVA 2JZ0A 1PJSA 2CUZA 3VK8A 3BBZA 3RGSA 1DGFA 1V34A 2KNZA 1WIVA 2B3TA 4LJ4A 3KOXE 4QOSA 1XNQM 2MGWA 4DV3M 1OJLA 1QUTA 1G59A 2YFQA 1TF0B 4GIPA 4LJ5A 5DYIA 2FNAA 2FOIC 2OOBA 3PVSA 1XXHE 2XF3A 2XGNA 4B7HA 4ZPXA 2XSZA 2ZAMA 1C7YA 3FRHA 4LF9M 3QAUA 2CHQA 4AZFA 2HKJA 3ZH9B 1JR3A 5EP4A 3LVVA 1JR3D 2KRKA 3AOGA 4PD2A 2R6FA 2ZBKB 3L27A 3ZC7B 2L09A 1DV0A 2JWSA 1QAOA 3L26A 2Y21A 3C9PA 3KP1E 1OQYA 1VQ1A 4B3SM 3FTEA 5KPRA 2Y20A 2JY7A 3KOZE 4LZZA 1YUBA 4GRIA 4DV2M 1HNWM 4KHPM 3R8FA 3C3EA 4UN2B 7CATA 3GQ4A 1NHGC 2P5TA 1JR3E 2CRUA 1QAQA 1D0LA 4F2LA 1I94M 1PRBA 2CWBA 3U6OA 4L8RC 4FW9A 2HCBA 2DAGA 3VLFB 2G5GX 1IY1A 2Z8YM 3GLHB 3VK7A 3FYDA 3AKZA 4KT0F 3UMMA 3B7ZA 2DWLA 4NC6A 4LF8M 4PDGA 3KP0E 3CF2A 1GLNA 1A5TA 1P3QQ 2QPAA 2XFSA 3HU2A 2BJWA 3B9PA 4DV0M 1HT1E 3KVWA 4CIZA 2F5NA 1DGHA 4DUZM 3L29A 4X66M 4OVZA 1GL7A 2LVNC 1XHBA 1WGLA 2QHOB 4MGIE 4DR5M 4CISA 3T1YM 2FH0A 2JUJA 3SMPA 3HX3A 1OKSA 2L2DA 2MH8A 2KXEA 2OOAA 3FUUA 1XC8A 1DGHB 2NQ8C 2DZLA 4A3VB 1XMQM 4Z8XA 1J5EM 4LG2A 1MX0A 3VFDA 3FYCA 3HHZA 2Z7JA 2K0BX 1EE8A 3DFZA 3UGJA 2QZ4A 4DUYM 1KFVA 4JN6A 5FLXS 4LF4M 3SHGB 1GJSA 3KDSE 1ZAEA 4L15A 1R2YA 4AG5A 1SXJC 4G4OA 2WZJA 4MGZE 3J81S 2BNKA 2OO9A 1IXRC 4IBBA 1XXHB 2LXEA 2JXNA 3AOEC 3THGA 3J80S 3SC3A 4LFAM 2ZTCA 4OX9M 4Z6YA 3GLFB 4DR7M 1N78A 2KEBA 4DV7M 3RE8A 3SMSA 5KPTA 5EP2A 2LVAA 2CEAA 3L25A 1MU5A 2Z4SA 3J7AS 3FUXA 2L7IA 1S3SA 4R3DA 1N36M 2CHGA 2EO2A 2OPFA 3NWLA 1TH2A 3CTWB 3ZCBB 3C3DA 1PJJA 4NOOB 2C5RA 3HWSA 4IBFA 3AOEA 2DENA 2EJSA 2UU9M 1DO2A 1QDRA 5E6JA 1R4GA 3FTFA 3HZJA 3H4MA 4L6V6 2HL7A 3T38A 4IBJA 3RGPA 3SYKA 1K3WA 4JI7M 3B7QA 2MROB 3GPUA 3E46A 1W5SA 5ITRA 1UFZA 2K47A 2RKOA 3IG5A 4NSRA 3TWMA 1IN4A 2V6ZM 1L2BA 1NJGA 2DHRA 2XLJA 3JR4A 4WURA 4IBKA 3E4RA 3DZDA 3CF6E 3SHFA 1NY6A 4M0WA 1OAIA 5L8RF 3SAUA 4ITQA 2J7NA 2XFTA 2XZUA 5A2QS 1VG5A 3KFUG 2LHCA 3KS8A 4KLNA 2DWZB 1GJTA 3HKPA 3GO8A 4B3RM 2JY8A 3LMMA 4AI6A 4LF7M 1DO0A 3GLIA 4CJ6A 3Q8XA 3LCVB 4JI5M 4IJFA 1AIPC 1QQWA 3VKHA 4QHSA 4I8OA 1IN8A 2UUCM 2KNVA 1Z5CA 2QBYB 1IXZA 4M9ZA 1NV8A 2ZAOA 5EXTA 1N33M 5EQTA 4EIWA 4D81A 1I4WA 2MR9A 4LF5M 4JI8M 4GHAA 1V92A 4DR2M 1ZMVA 5H37D 3HJQA 2YNMD 4QNMA 5IZ7D 2V1CA 4LF6M 4JI0M 1E9RA 2VDBB 5IREB 5ITXE 1UM8A 1V33A 3FD9A 2DWMA 4MH0E 3FUWA 4S12A 1WGNA 2X49A 4GC5A 2CV2A 2OQ4A 2Y0TA 4GKKM 3V76A 2QNJA 2FFJA 1IN6A 5FTJA 1T6OA 1G4AE 1Q3BA 1QVRA 3U6QA 2R0IA 3VDPA 1L1TA 2M60A 1NNJA 2H1RA 2KRUA 2LVPC 1PJQA 4AKGA 5EXPA 1EIJA 3AFHA 3FTDA 4BBAA 1XXHA 2Z4RA 3HY5A 3U5ZA 1AUAA 1ZQ9A 1Z6TA 2C96A 2LBCA 3A45A 2EA0A 1NSFA 2J5YA 2DZNB 3H4JA 2D7HA 3I01M 2F5SA 2K9DA 4M0DA 3GLIE 5KO3A 3GQ5A 3AV0A 1LTMA 5BR8M 2DXIA 2XSZD 4DR4M 3HHYA 3FUVA 1TR8A 3OTOM 1YSYA 1TTEA 2DAKA 2ERCA 3UJNA 4LFCM 3E9SA 1G8PA 4G3OA 2Y0QA 3AJIB 4G4QA 4GITA 1HNZM 3U6PA 1WXQA 4TUWA 3QYEA 4IBCA 2KDLA 1QZEA 2WSCF 4LJ6A 3HJ8A 1HJPA 2VF8A 1Q02A 3U6CA 1FNNA 3AL0C 5EP3A 1NV9A 1PM5A 1IQPA 1IXSB 2J7OA 3PNYA 4LRSA 8CATA 3U6EA 2LWXA 3IHPA 4FWHA 4AG6A 5BPVA 4JYAM 3PXGA 5EJCA 1HNXM 3I51A 5IT9S 4XK8F 4MGYE 1TGUA 4JXJA 3TWLA 2LVQD 4RKUF 4JI4M 3SFZA 1F4IA 4AKIA 2KA6B 4WW0A 3SATA 1XB2B 3GRUA 4M9XA 1IBLM 2F5PA 2HHHM 1G3IA 3K92A 5FSWA 2UXBM 1J7KA 2EUCA 2LHGA 3I4YA 2O01F 3KS4A 4GH9A 2JA2A 4W5WA 2EKFA 1SXJA 3EIHA 1L2CA 2D7GA 1SXJD 4QNRA 5FTLA 3IECA 2LNHC 1ZV1A 1R6BX 3U5ZB 1R5LA 1L8QA 3KW6A 4FD2A 3T15A 2BWEA 3A42A 1RU3A 3T6PA 3WHLA 1HT2E 4MM3B 3B74A 3FKEA 4AQYM 1TDZA 2G8LA 3K8ZA 3PNVA 5GKNA 2CP8A 2GQFA 4XGIA 2UUBM 3K2LA 4FCVA 4NRWA 1PJTA 2KZUA 4IJEA 2BJVA 4FWDA 3L28A 3M6AA 4D80A 3U6MA 3KOYE 1IY2A 4G4RA 1PJIA 2VF7A 3CF0A 5C1BA 3JR5A 2QCUA 4HLQA 3LVWA 3CGWA 3W67A 4LJAA 3A98B 5LMNM 1TH4A 2KNAA 4WP2A 5FTKA 4GKJM 4ANRA 2F5QA 4PCZA 1E9SA 4KO8A 3Q8GA 4B7GA 2VQEM 1E32A 2G3QA 2I7NA 2XEPA 4NL4H 3TL4X 1K3XA 3D8BA 4OW0A 3TWKA 3GP1A 1IXSA 4Q7JA 2QENA 4MB7A 1LV7A 1IN5A 3B89A 1G71A 2LTUA 2BWBA 1WJ7A 2JNHA 1VEGA 2C9OA 3NBXX 4AKHA 3M7GA 1J09A 2X8AA 4DV6M 1Z59A 2N35A 3ILKA 3RFWA 3GPYA 1D0KA 5KPZA 1WR1B 4LFBM 3BXWA 4RF1A 3GLHE 5FTMA 1MN3A 1ZMWA 3GLHA 1W5TA
chains in the Genus database with same CATH topology
2JWSA 2J5YA 2N35A 1TF0B 2LHGA 2LHCA 2MH8A 1GJSA 1GABA 2KDLA 1GJTA 2VDBB 1PRBA 2FS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  2J5Y A;  2N35 A;  1TF0 B;  2LHG A;  2LHC A;  2MH8 A;  1GJS A;  1GAB A;  2KDL A;  1GJT A;  2VDB B;  1PRB A;  2FS1 A; 
#chains in the Genus database with same CATH topology
 1D0M A;  4LZJ A;  3NBI A;  1IFY A;  2V1U A;  2FE8 A;  5KQD A;  1H6U A;  3R9X B;  1Z5A A;  4R7G A;  1QAN A;  3KOW E;  1IY0 A;  2DKL A;  2DAE A;  4MGH A;  5ITU A;  3GPX A;  3BOS A;  5JI3 E;  2F4V M;  4FCW A;  3KSJ A;  5C18 A;  4I81 A;  4OVZ B;  1X37 A;  2R62 A;  1BVS A;  4HL4 A;  3T1H M;  4K0K M;  4LGY A;  2UXD M;  1HQY E;  4GEW A;  2WSF F;  3HHX A;  4LY6 A;  4IBE A;  3GLG A;  3U6L A;  3U61 A;  3U60 A;  1OFI A;  2R45 A;  1GL6 A;  3UK6 A;  4LCB A;  2Q2E B;  3GLF A;  1T3T A;  5FTN A;  5DFL A;  4B08 A;  3GLG E;  3MMP A;  1HR0 M;  1QUS A;  1GO5 A;  2DAM A;  2R4J A;  4NXM M;  1OIP A;  3VDU A;  4AW4 A;  2WSE F;  1TDH A;  1IM2 A;  5EP1 A;  2KHH A;  1QAM A;  2HWJ A;  3SBJ A;  1R2Z A;  5KQ8 A;  1Z5B A;  2UXC M;  1KYI A;  1Q3C A;  3SYL A;  3WHK A;  1VDL A;  1QZM A;  3FUT A;  1JQJ C;  4BLC A;  1R7R A;  2HAK A;  2ZAN A;  5F3W A;  2QP9 X;  2DAI A;  3KSX A;  3TPZ A;  2L6O A;  2C99 A;  4JI6 M;  4FWG A;  2YQZ A;  4B3T M;  1WHC A;  2D7E A;  2E5L M;  1Y8G A;  2JP7 A;  4L78 A;  2RRU A;  2Z3X A;  1SXJ E;  2QSF X;  2GNO A;  2DI0 A;  2C98 A;  5EXS A;  4OU7 A;  2VQF M;  4DV1 M;  4D82 A;  4XBO A;  1DGG A;  2L7H A;  2W82 A;  3EIE A;  4X62 M;  1IBK M;  3K1J A;  4CHT B;  4BB9 A;  3QWL A;  2H5X A;  1KSF X;  3TE6 A;  5DNY A;  4PT5 A;  1DGB A;  2APL A;  1OFH A;  2UUA M;  1L2D A;  3M0E A;  4GMQ A;  2DNA A;  3LQQ A;  2EKK A;  4NRV A;  3ZQJ A;  2R65 A;  2O5R A;  5ITQ A;  1EFU B;  3DA1 A;  1TH3 A;  3HU3 A;  1C1K A;  3HHW A;  4NXN M;  4I4L A;  1FJG M;  1JB0 F;  2O25 A;  2FS1 A;  4FCT A;  2QBY A;  4JV5 M;  4P16 A;  2R18 A;  3QYB A;  1D2N A;  1XWI A;  4L4U A;  3GLG B;  2DVW B;  3U60 B;  3U61 B;  4CGY B;  3JAM S;  3W68 A;  4DV4 M;  1N75 A;  4DV5 M;  3LQR A;  4DBG B;  1L1Z A;  1GAB A;  2LVO C;  2R46 A;  3C58 A;  3MJ5 A;  1NHW C;  3GRY A;  4LJ8 A;  2L4F A;  1OTR A;  2RGO A;  3J7B A;  1YLA A;  1OAO C;  2K6B A;  3D8L A;  2JY5 A;  3FE3 A;  1NVM A;  4YHH M;  3FRI A;  3IG8 A;  3K9O A;  2CHV A;  3I4V A;  4IBI A;  1CUK A;  4JI1 M;  5EXX A;  2A5Y B;  4X65 M;  3VKG A;  1NNU C;  3U6D A;  4DR1 M;  2RGH A;  1ORY B;  2XZF A;  2QQ8 A;  3PFI A;  2AHM A;  4G6Z A;  1T43 A;  3GRR A;  3LCU A;  4FVM A;  4KOD A;  2CV1 A;  3FTC A;  2F5O A;  3E21 A;  4IBG A;  4MGK E;  4DR6 M;  1IN7 A;  4B7F A;  2KW0 A;  3KXE C;  1GVN A;  5DYG A;  3LW5 F;  1QYR A;  4REZ A;  1G41 A;  1GKI A;  1QDT A;  4Y28 F;  4I5S A;  3W0L B;  2KZS A;  2ZM6 M;  2CE7 A;  3HGI A;  3SAV A;  3SAR A;  4GHL A;  3HU1 A;  3K9P A;  5LMU M;  4LJ7 A;  2CV0 A;  4JI3 M;  4QOZ C;  1N32 M;  1XNR M;  1MJG M;  4GC9 A;  4IIW A;  4RNA A;  4M9S A;  4F1I A;  5ITT A;  3GLI B;  3U6S A;  2MJ5 B;  2VII A;  3A46 A;  3GLF E;  4DR3 M;  1N77 A;  1NJF A;  1NY5 A;  1XMO M;  2X4A A;  5IWA M;  4G4N A;  4P17 A;  3MHV C;  3B7N A;  3J27 B;  1Q39 A;  3L2A A;  1E94 E;  3F92 A;  1HQC A;  1VDD A;  3SAW A;  3TQS A;  2R44 A;  1NO1 A;  1VEJ A;  3I04 M;  4YY3 M;  1ZMU A;  2CFO A;  4LGM A;  1N34 M;  2M5Z A;  2YR0 A;  4HEO A;  3GPP A;  2C9C A;  2R4E A;  5ITX A;  3HJS A;  2DHY A;  3DOA A;  1PGY A;  4JI2 M;  1VEK A;  4LRT A;  2JY6 B;  4X64 M;  2DZO B;  2L4E A;  2I7P A;  2ZTD A;  3GQ3 A;  1K82 A;  4B3M M;  3W0F A;  4II7 A;  4QHT A;  4LJ9 A;  5E26 A;  4R71 A;  2LH0 A;  4RF0 A;  1SXJ B;  4NSO B;  1YE9 A;  4PDI A;  5JI2 E;  2XH9 A;  4L16 A;  2DWN A;  1SG9 A;  1OIZ A;  1IBM M;  3J2P B;  3MK6 A;  4IBD A;  3UZU A;  3SAS A;  2JZ1 A;  5ITY A;  3GRV A;  2JZ0 A;  1PJS A;  2CUZ A;  3VK8 A;  3BBZ A;  3RGS A;  1DGF A;  1V34 A;  2KNZ A;  1WIV A;  2B3T A;  4LJ4 A;  3KOX E;  4QOS A;  1XNQ M;  2MGW A;  4DV3 M;  1OJL A;  1QUT A;  1G59 A;  2YFQ A;  1TF0 B;  4GIP A;  4LJ5 A;  5DYI A;  2FNA A;  2FOI C;  2OOB A;  3PVS A;  1XXH E;  2XF3 A;  2XGN A;  4B7H A;  4ZPX A;  2XSZ A;  2ZAM A;  1C7Y A;  3FRH A;  4LF9 M;  3QAU A;  2CHQ A;  4AZF A;  2HKJ A;  3ZH9 B;  1JR3 A;  5EP4 A;  3LVV A;  1JR3 D;  2KRK A;  3AOG A;  4PD2 A;  2R6F A;  2ZBK B;  3L27 A;  3ZC7 B;  2L09 A;  1DV0 A;  2JWS A;  1QAO A;  3L26 A;  2Y21 A;  3C9P A;  3KP1 E;  1OQY A;  1VQ1 A;  4B3S M;  3FTE A;  5KPR A;  2Y20 A;  2JY7 A;  3KOZ E;  4LZZ A;  1YUB A;  4GRI A;  4DV2 M;  1HNW M;  4KHP M;  3R8F A;  3C3E A;  4UN2 B;  7CAT A;  3GQ4 A;  1NHG C;  2P5T A;  1JR3 E;  2CRU A;  1QAQ A;  1D0L A;  4F2L A;  1I94 M;  1PRB A;  2CWB A;  3U6O A;  4L8R C;  4FW9 A;  2HCB A;  2DAG A;  3VLF B;  2G5G X;  1IY1 A;  2Z8Y M;  3GLH B;  3VK7 A;  3FYD A;  3AKZ A;  4KT0 F;  3UMM A;  3B7Z A;  2DWL A;  4NC6 A;  4LF8 M;  4PDG A;  3KP0 E;  3CF2 A;  1GLN A;  1A5T A;  1P3Q Q;  2QPA A;  2XFS A;  3HU2 A;  2BJW A;  3B9P A;  4DV0 M;  1HT1 E;  3KVW A;  4CIZ A;  2F5N A;  1DGH A;  4DUZ M;  3L29 A;  4X66 M;  4OVZ A;  1GL7 A;  2LVN C;  1XHB A;  1WGL A;  2QHO B;  4MGI E;  4DR5 M;  4CIS A;  3T1Y M;  2FH0 A;  2JUJ A;  3SMP A;  3HX3 A;  1OKS A;  2L2D A;  2MH8 A;  2KXE A;  2OOA A;  3FUU A;  1XC8 A;  1DGH B;  2NQ8 C;  2DZL A;  4A3V B;  1XMQ M;  4Z8X A;  1J5E M;  4LG2 A;  1MX0 A;  3VFD A;  3FYC A;  3HHZ A;  2Z7J A;  2K0B X;  1EE8 A;  3DFZ A;  3UGJ A;  2QZ4 A;  4DUY M;  1KFV A;  4JN6 A;  5FLX S;  4LF4 M;  3SHG B;  1GJS A;  3KDS E;  1ZAE A;  4L15 A;  1R2Y A;  4AG5 A;  1SXJ C;  4G4O A;  2WZJ A;  4MGZ E;  3J81 S;  2BNK A;  2OO9 A;  1IXR C;  4IBB A;  1XXH B;  2LXE A;  2JXN A;  3AOE C;  3THG A;  3J80 S;  3SC3 A;  4LFA M;  2ZTC A;  4OX9 M;  4Z6Y A;  3GLF B;  4DR7 M;  1N78 A;  2KEB A;  4DV7 M;  3RE8 A;  3SMS A;  5KPT A;  5EP2 A;  2LVA A;  2CEA A;  3L25 A;  1MU5 A;  2Z4S A;  3J7A S;  3FUX A;  2L7I A;  1S3S A;  4R3D A;  1N36 M;  2CHG A;  2EO2 A;  2OPF A;  3NWL A;  1TH2 A;  3CTW B;  3ZCB B;  3C3D A;  1PJJ A;  4NOO B;  2C5R A;  3HWS A;  4IBF A;  3AOE A;  2DEN A;  2EJS A;  2UU9 M;  1DO2 A;  1QDR A;  5E6J A;  1R4G A;  3FTF A;  3HZJ A;  3H4M A;  4L6V 6;  2HL7 A;  3T38 A;  4IBJ A;  3RGP A;  3SYK A;  1K3W A;  4JI7 M;  3B7Q A;  2MRO B;  3GPU A;  3E46 A;  1W5S A;  5ITR A;  1UFZ A;  2K47 A;  2RKO A;  3IG5 A;  4NSR A;  3TWM A;  1IN4 A;  2V6Z M;  1L2B A;  1NJG A;  2DHR A;  2XLJ A;  3JR4 A;  4WUR A;  4IBK A;  3E4R A;  3DZD A;  3CF6 E;  3SHF A;  1NY6 A;  4M0W A;  1OAI A;  5L8R F;  3SAU A;  4ITQ A;  2J7N A;  2XFT A;  2XZU A;  5A2Q S;  1VG5 A;  3KFU G;  2LHC A;  3KS8 A;  4KLN A;  2DWZ B;  1GJT A;  3HKP A;  3GO8 A;  4B3R M;  2JY8 A;  3LMM A;  4AI6 A;  4LF7 M;  1DO0 A;  3GLI A;  4CJ6 A;  3Q8X A;  3LCV B;  4JI5 M;  4IJF A;  1AIP C;  1QQW A;  3VKH A;  4QHS A;  4I8O A;  1IN8 A;  2UUC M;  2KNV A;  1Z5C A;  2QBY B;  1IXZ A;  4M9Z A;  1NV8 A;  2ZAO A;  5EXT A;  1N33 M;  5EQT A;  4EIW A;  4D81 A;  1I4W A;  2MR9 A;  4LF5 M;  4JI8 M;  4GHA A;  1V92 A;  4DR2 M;  1ZMV A;  5H37 D;  3HJQ A;  2YNM D;  4QNM A;  5IZ7 D;  2V1C A;  4LF6 M;  4JI0 M;  1E9R A;  2VDB B;  5IRE B;  5ITX E;  1UM8 A;  1V33 A;  3FD9 A;  2DWM A;  4MH0 E;  3FUW A;  4S12 A;  1WGN A;  2X49 A;  4GC5 A;  2CV2 A;  2OQ4 A;  2Y0T A;  4GKK M;  3V76 A;  2QNJ A;  2FFJ A;  1IN6 A;  5FTJ A;  1T6O A;  1G4A E;  1Q3B A;  1QVR A;  3U6Q A;  2R0I A;  3VDP A;  1L1T A;  2M60 A;  1NNJ A;  2H1R A;  2KRU A;  2LVP C;  1PJQ A;  4AKG A;  5EXP A;  1EIJ A;  3AFH A;  3FTD A;  4BBA A;  1XXH A;  2Z4R A;  3HY5 A;  3U5Z A;  1AUA A;  1ZQ9 A;  1Z6T A;  2C96 A;  2LBC A;  3A45 A;  2EA0 A;  1NSF A;  2J5Y A;  2DZN B;  3H4J A;  2D7H A;  3I01 M;  2F5S A;  2K9D A;  4M0D A;  3GLI E;  5KO3 A;  3GQ5 A;  3AV0 A;  1LTM A;  5BR8 M;  2DXI A;  2XSZ D;  4DR4 M;  3HHY A;  3FUV A;  1TR8 A;  3OTO M;  1YSY A;  1TTE A;  2DAK A;  2ERC A;  3UJN A;  4LFC M;  3E9S A;  1G8P A;  4G3O A;  2Y0Q A;  3AJI B;  4G4Q A;  4GIT A;  1HNZ M;  3U6P A;  1WXQ A;  4TUW A;  3QYE A;  4IBC A;  2KDL A;  1QZE A;  2WSC F;  4LJ6 A;  3HJ8 A;  1HJP A;  2VF8 A;  1Q02 A;  3U6C A;  1FNN A;  3AL0 C;  5EP3 A;  1NV9 A;  1PM5 A;  1IQP A;  1IXS B;  2J7O A;  3PNY A;  4LRS A;  8CAT A;  3U6E A;  2LWX A;  3IHP A;  4FWH A;  4AG6 A;  5BPV A;  4JYA M;  3PXG A;  5EJC A;  1HNX M;  3I51 A;  5IT9 S;  4XK8 F;  4MGY E;  1TGU A;  4JXJ A;  3TWL A;  2LVQ D;  4RKU F;  4JI4 M;  3SFZ A;  1F4I A;  4AKI A;  2KA6 B;  4WW0 A;  3SAT A;  1XB2 B;  3GRU A;  4M9X A;  1IBL M;  2F5P A;  2HHH M;  1G3I A;  3K92 A;  5FSW A;  2UXB M;  1J7K A;  2EUC A;  2LHG A;  3I4Y A;  2O01 F;  3KS4 A;  4GH9 A;  2JA2 A;  4W5W A;  2EKF A;  1SXJ A;  3EIH A;  1L2C A;  2D7G A;  1SXJ D;  4QNR A;  5FTL A;  3IEC A;  2LNH C;  1ZV1 A;  1R6B X;  3U5Z B;  1R5L A;  1L8Q A;  3KW6 A;  4FD2 A;  3T15 A;  2BWE A;  3A42 A;  1RU3 A;  3T6P A;  3WHL A;  1HT2 E;  4MM3 B;  3B74 A;  3FKE A;  4AQY M;  1TDZ A;  2G8L A;  3K8Z A;  3PNV A;  5GKN A;  2CP8 A;  2GQF A;  4XGI A;  2UUB M;  3K2L A;  4FCV A;  4NRW A;  1PJT A;  2KZU A;  4IJE A;  2BJV A;  4FWD A;  3L28 A;  3M6A A;  4D80 A;  3U6M A;  3KOY E;  1IY2 A;  4G4R A;  1PJI A;  2VF7 A;  3CF0 A;  5C1B A;  3JR5 A;  2QCU A;  4HLQ A;  3LVW A;  3CGW A;  3W67 A;  4LJA A;  3A98 B;  5LMN M;  1TH4 A;  2KNA A;  4WP2 A;  5FTK A;  4GKJ M;  4ANR A;  2F5Q A;  4PCZ A;  1E9S A;  4KO8 A;  3Q8G A;  4B7G A;  2VQE M;  1E32 A;  2G3Q A;  2I7N A;  2XEP A;  4NL4 H;  3TL4 X;  1K3X A;  3D8B A;  4OW0 A;  3TWK A;  3GP1 A;  1IXS A;  4Q7J A;  2QEN A;  4MB7 A;  1LV7 A;  1IN5 A;  3B89 A;  1G71 A;  2LTU A;  2BWB A;  1WJ7 A;  2JNH A;  1VEG A;  2C9O A;  3NBX X;  4AKH A;  3M7G A;  1J09 A;  2X8A A;  4DV6 M;  1Z59 A;  2N35 A;  3ILK A;  3RFW A;  3GPY A;  1D0K A;  5KPZ A;  1WR1 B;  4LFB M;  3BXW A;  4RF1 A;  3GLH E;  5FTM A;  1MN3 A;  1ZMW A;  3GLH A;  1W5T A; 
#chains in the Genus database with same CATH homology
 2JWS A;  2J5Y A;  2N35 A;  1TF0 B;  2LHG A;  2LHC A;  2MH8 A;  1GJS A;  1GAB A;  2KDL A;  1GJT A;  2VDB B;  1PRB A;  2FS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...