1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin-binding protein
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
2N35A 2MH8A 1GJTA 1GJSA 2LHGA 2FS1A 2JWSA 2J5YA 2KDLA 2VDBB 2LHCA 1PRBA 1GABA 1TF0B
chains in the Genus database with same CATH superfamily
3K1JA 3HWSA 2LWXA 5KQ8A 4Z6YA 1GJSA 1XXHB 2CHGA 2D7EA 2VDBB 2R18A 1UFZA 2C5RA 3GPPA 1IBKM 5ITQA 1TDHA 2C9OA 3MJ5A 1IN4A 1P3QQ 3KDSE 4HLQA 4F1IA 3TWLA 3QYEA 5EXXA 8CATA 2UUCM 1SXJA 1WGLA 3A45A 4LFBM 3GLGE 2BJWA 1HNZM 4NRWA 3FUUA 3FRHA 1HT2E 4AZFA 3AOEA 2ZAOA 1QAQA 4OVZB 4FWGA 4I81A 4M0WA 5KPRA 4B3SM 4GHAA 2M5ZA 4BB9A 4FWDA 2RKOA 4QNRA 3LMMA 1Z6TA 4QOSA 1YSYA 1GKIA 3HU2A 1TH2A 1OQYA 4LRSA 5EXPA 4OX9M 1TH4A 4REZA 1NHGC 3J2PB 2H5XA 3AFHA 2BJVA 3UJNA 4X65M 2J5YA 4JI6M 1GLNA 3SAWA 1KYIA 3CF0A 3ZH9B 3VLFB 2DWLA 4LJAA 1HR0M 4XK8F 1OTRA 2UU9M 4JI4M 2L4EA 2HKJA 5EQTA 4LCBA 1K82A 2DAMA 3FTCA 2UUBM 1HT1E 2JUJA 3FUXA 3I51A 2QZ4A 2R62A 4GKKM 4WW0A 4B7FA 3U6PA 4MB7A 4FCWA 3HHYA 2L7IA 2NQ8C 5FSWA 1L8QA 3HU3A 5L8RF 3GLGB 4LF8M 1QANA 3C3DA 3I4VA 2G5GX 3GLHA 3ILKA 3GPYA 2OPFA 2BWBA 3C3EA 1T43A 2R6FA 1V92A 4QNMA 4PDIA 1RU3A 3TQSA 1KFVA 4M9SA 2QHOB 1QUTA 5FTMA 1KSFX 1NO1A 2CP8A 2OO9A 3T6PA 1I4WA 1G8PA 1A5TA 3KSXA 1BVSA 3JR4A 4Y28F 1XXHA 3TWMA 2J7NA 1DGHB 3F92A 3PFIA 3B89A 4IBBA 3GLIB 1NNJA 3FUTA 1Y8GA 1FJGM 2FNAA 2KHHA 3K9OA 2DXIA 2QNJA 4IIWA 5EXTA 1LV7A 1ORYB 2P5TA 1TH3A 1VEGA 1G59A 3GRRA 3AOGA 1N32M 2V6ZM 2KNVA 2ZBKB 3GQ3A 3GQ5A 3ZCBB 1IXRC 1W5SA 2R65A 2LVOC 2KW0A 4CIZA 4B3RM 4NSOB 4OVZA 4LY6A 2R45A 1VDLA 3GLHE 2K6BA 1OAIA 1ZMWA 3KP1E 4Q7JA 3QYBA 5DFLA 4GMQA 3RFWA 1HQCA 4PD2A 5ITYA 1J7KA 2C98A 2JY8A 3L2AA 3SMPA 1AUAA 1X37A 4EIWA 4GKJM 2WZJA 2JA2A 1L2DA 4LF7M 3KXEC 2HCBA 3SAUA 1IY1A 3AKZA 2EKKA 2LHGA 2M60A 1MU5A 1I94M 4DV6M 1K3XA 4M0DA 3R8FA 3E21A 1R2ZA 3W67A 4DR5M 1W5TA 1XXHE 2EO2A 3LCVB 4DUZM 5EJCA 4NXMM 2FH0A 4IBEA 4KODA 3SYLA 3GRUA 4II7A 2R4JA 2YQZA 2ZAMA 4P16A 2JY7A 3U5ZB 3GLGA 3AV0A 2XZUA 1ZMVA 4GEWA 1VEKA 1S3SA 2ERCA 3QAUA 3RGSA 1TTEA 3SAVA 4PT5A 5EP2A 2OOAA 1GABA 4IJFA 3GLHB 3MMPA 3CF2A 4DR3M 3CGWA 3L25A 1WIVA 3A98B 2UXCM 4FCVA 1DGBA 1QDTA 4LJ7A 4IBDA 1XWIA 2HHHM 4JI0M 3MK6A 5IREB 4DV0M 1GJTA 2LVNC 1IN8A 2KNZA 4NOOB 2XLJA 2OQ4A 5FTJA 3DOAA 2I7PA 1N34M 4B3MM 2W82A 3IG8A 3NBXX 2Z4SA 3K9PA 3GLIA 2UXBM 4DV7M 2K9DA 3KOXE 2C96A 1WGNA 2XZFA 3L29A 1ZMUA 1VG5A 1PJSA 3BBZA 7CATA 4AQYM 1R7RA 2L2DA 2WSFF 3LW5F 3IECA 1TGUA 3I04M 1HNWM 2XFTA 4S12A 3B74A 2WSCF 4L16A 4B08A 4NXNM 1SXJC 3T1HM 4JXJA 1IN5A 2DENA 1K3WA 2EUCA 5EXSA 1DV0A 1XC8A 4RKUF 4ZPXA 4QHSA 3AOEC 4IBKA 4X62M 2MR9A 3CTWB 2O5RA 1MX0A 2VF7A 3RE8A 4KLNA 1XMOM 5C18A 2A5YB 4TUWA 1YE9A 3VDUA 4KHPM 4AKIA 1IY0A 5KO3A 3FD9A 4BLCA 2EJSA 4JI7M 4MGKE 4JI1M 1OIPA 1PJJA 1Q02A 2KZUA 4GC9A 1XMQM 1V33A 3GLIE 1GVNA 3VK8A 3KS4A 1QYRA 5E26A 3SATA 3U5ZA 2QENA 4JI8M 1V34A 1YUBA 1T3TA 3SHGB 3LQRA 4UN2B 3SBJA 3EIHA 2CV1A 1Z5AA 4PDGA 2Z3XA 4AG6A 2FFJA 3SARA 1N33M 3TPZA 4L8RC 4I5SA 1DO2A 3KP0E 3UK6A 5IWAM 2HWJA 1IQPA 1OFHA 3IHPA 4AG5A 3U6LA 1NVMA 2V1CA 3PXGA 2FS1A 3FYCA 4JI3M 3M6AA 2Y20A 2QP9X 3T38A 2JZ0A 1IN6A 2JNHA 2XGNA 5FTLA 1WXQA 2L6OA 2F5NA 2CWBA 2R0IA 4LFAM 2AHMA 3GQ4A 1HNXM 1OJLA 2DAGA 5BPVA 1VEJA 2KA6B 3FKEA 3ZQJA 4IBFA 4JN6A 1NJGA 4D81A 5LMUM 1C7YA 4MGHA 3HKPA 3U6QA 1XNQM 3B9PA 2JWSA 1D0KA 2FOIC 2BNKA 1Q3CA 5JI3E 3KFUG 4JYAM 5ITXA 4XGIA 3U6CA 1IFYA 5ITUA 2APLA 1MJGM 3V76A 1PJIA 2RGOA 1WJ7A 1NY6A 2F5QA 1N78A 4L78A 4GH9A 4FD2A 1E9RA 3BXWA 3E9SA 1C1KA 1CUKA 2LVPC 2LXEA 3LVWA 3H4JA 3WHKA 3L28A 5A2QS 4JV5M 1OAOC 1Z5BA 4L4UA 2DWZB 1IBMM 3DA1A 1Z5CA 1PM5A 1L2BA 4HEOA 3SASA 5FTNA 2J7OA 4I8OA 1Z59A 4LZZA 4DR6M 3U6MA 3HJQA 1MN3A 5E6JA 3TE6A 3PNYA 1IY2A 2VQFM 1OFIA 3J80S 2R44A 2HL7A 1QZEA 4FW9A 3HHWA 4KO8A 2C9CA 3LCUA 2CV2A 4MH0E 4LJ4A 4OW0A 4GRIA 1VDDA 1ZQ9A 2LBCA 3GRYA 3W0LB 4X64M 4K0KM 4D82A 3U61B 1TR8A 5EP3A 2F5PA 4DUYM 2LH0A 2O25A 4IBJA 3GLFB 3K8ZA 1PRBA 3IG5A 4LGMA 2Z7JA 2R4EA 2UXDM 1FNNA 2KRUA 3FYDA 3KW6A 3L27A 2CV0A 1L2CA 5ITXE 1GO5A 3HGIA 4R7GA 2H1RA 2LHCA 3GPXA 4A3VB 2L7HA 2Y0TA 2DZNB 2XH9A 4BBAA 3KSJA 4JI5M 3U6OA 1L1ZA 2VIIA 3DZDA 2WSEF 4GITA 2Y21A 2GNOA 2DAEA 1D0LA 1ZV1A 2JXNA 2KZSA 3MHVC 3WHLA 2DZLA 3W68A 3C9PA 4X66M 4YHHM 4G4OA 1UM8A 2UUAM 4DR7M 3HHXA 1PGYA 1IM2A 3J81S 4IBCA 3ZC7B 5F3WA 3JAMS 1WR1B 2ZTDA 1ZAEA 3EIEA 3KOWE 4DV2M 4LF4M 4DR4M 1J09A 3UMMA 1SG9A 4WP2A 1GL6A 1R5LA 4D80A 4I4LA 1QUSA 1EFUB 2DNAA 1NJFA 2LVQD 4M9XA 4NRVA 3SC3A 3JR5A 3VK7A 3AL0C 1DGFA 1F4IA 4WURA 3C58A 1HQYE 1E94E 1QZMA 3VDPA 2G8LA 2MH8A 3B7NA 3SHFA 3Q8XA 2B3TA 3PVSA 1OKSA 3J7BA 3LVVA 2CHVA 4R71A 1WHCA 4DBGB 3GRVA 5C1BA 5DYGA 2KEBA 3FTFA 1PJTA 4RNAA 2KRKA 5ITRA 3THGA 2Q2EB 5FLXS 3HJ8A 3VFDA 3HX3A 4R3DA 4G4RA 1QVRA 3HJSA 5EP1A 4B7GA 3OTOM 1LTMA 2HAKA 1G41A 5IZ7D 2DWNA 2Z4RA 2R46A 4IBGA 2I7NA 4MGZE 2C99A 2CRUA 2XSZA 1N75A 3AJIB 1PJQA 3U61A 5IT9S 3VKHA 4ITQA 2Y0QA 2O01F 3GLFA 1G3IA 3HY5A 4QHTA 2JY6B 2ZTCA 3QWLA 4FWHA 3E46A 1J5EM 1IBLM 3UZUA 1Q3BA 2MROB 2RGHA 2EA0A 1OIZA 2LTUA 4DV1M 1AIPC 3KOZE 4LJ9A 2QPAA 4CJ6A 4GC5A 3SYKA 3M7GA 2LNHC 4P17A 5KPTA 2DAKA 3UGJA 3L26A 1JR3A 3J7AS 4MM3B 5LMNM 4JI2M 1R6BX 4G4QA 4LGYA 2DI0A 2X49A 1T6OA 1D2NA 2XSZD 3U6SA 2DHYA 2CFOA 2DHRA 4GIPA 4G4NA 3H4MA 3GO8A 3U60A 5JI2E 4RF0A 1IXSA 1SXJD 2JY5A 2BWEA 2CE7A 3KS8A 2CUZA 2QBYA 1QAMA 2EKFA 3NBIA 2DKLA 2OOBA 4LRTA 4PCZA 1XNRM 3VKGA 2DVWB 4KT0F 4XBOA 4AKGA 3GLFE 3FUVA 1SXJE 2DAIA 3KVWA 4LG2A 3NWLA 1G4AE 4LJ5A 2F4VM 2F5SA 2X8AA 4FVMA 4L6V6 4MGYE 4DV5M 1IN7A 2KDLA 4F2LA 1D0MA 4LJ8A 3TWKA 2XF3A 4NL4H 4ANRA 1E32A 2K47A 4AKHA 1JR3D 2YFQA 1NY5A 3M0EA 4Z8XA 2RRUA 3K2LA 5DNYA 3LQQA 3GPUA 4LF9M 4DR2M 3B7QA 1E9SA 3HU1A 2KNAA 1JR3E 1N36M 2YR0A 4IJEA 2VQEM 3T1YM 3CF6E 1NV8A 1NNUC 5BR8M 1VQ1A 4G6ZA 4NC6A 4LF5M 1NV9A 1N77A 4DV4M 4LZJA 1R2YA 5ITTA 2QSFX 5H37D 2YNMD 2N35A 2F5OA 3DFZA 4CGYB 1NSFA 2Z8YM 1G71A 1XHBA 4IBIA 4LJ6A 4OU7A 2L09A 3U6DA 4LF6M 2JZ1A 2E5LM 4FCTA 4L15A 1SXJB 4M9ZA 3K92A 3GP1A 3B7ZA 3HZJA 3FRIA 1R4GA 2D7HA 2K0BX 2QCUA 3FTEA 4DR1M 2JP7A 1QQWA 1Q39A 1XB2B 2ZM6M 3TL4X 4MGIE 4CISA 1EIJA 3I01M 2GQFA 3W0FA 2DWMA 4RF1A 1DGGA 5DYIA 2CHQA 3I4YA 1HJPA 4B7HA 3SFZA 2DZOB 3E4RA 1EE8A 2X4AA 2L4FA 3R9XB 3A46A 2VF8A 2ZANA 3D8BA 4AI6A 3HHZA 4QOZC 3U60B 3SMSA 1IXSB 3FTDA 3J27B 2QQ8A 3T15A 1TDZA 3FUWA 4W5WA 1L1TA 4NSRA 3D8LA 2QBYB 2MJ5B 1JB0F 4DV3M 1YLAA 3BOSA 2MGWA 4AW4A 1QAOA 2KXEA 2CEAA 1IXZA 5EP4A 4YY3M 2XFSA 1JQJC 5FTKA 1TF0B 5GKNA 1QDRA 2LVAA 4G3OA 2D7GA 5KQDA 5KPZA 3Q8GA 4CHTB 1H6UA 3U6EA 4B3TM 1GL7A 3KOYE 4GHLA 3FE3A 3RGPA 3A42A 4HL4A 4LFCM 3PNVA 2XEPA 2G3QA 1NHWC 1DO0A 2FE8A 2V1UA 1DGHA
chains in the Genus database with same CATH topology
2N35A 2MH8A 1GJTA 1GJSA 2LHGA 2FS1A 2JWSA 2J5YA 2KDLA 2VDBB 2LHCA 1PRBA 1GABA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N35 A;  2MH8 A;  1GJT A;  1GJS A;  2LHG A;  2FS1 A;  2JWS A;  2J5Y A;  2KDL A;  2VDB B;  2LHC A;  1PRB A;  1GAB A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 3K1J A;  3HWS A;  2LWX A;  5KQ8 A;  4Z6Y A;  1GJS A;  1XXH B;  2CHG A;  2D7E A;  2VDB B;  2R18 A;  1UFZ A;  2C5R A;  3GPP A;  1IBK M;  5ITQ A;  1TDH A;  2C9O A;  3MJ5 A;  1IN4 A;  1P3Q Q;  3KDS E;  4HLQ A;  4F1I A;  3TWL A;  3QYE A;  5EXX A;  8CAT A;  2UUC M;  1SXJ A;  1WGL A;  3A45 A;  4LFB M;  3GLG E;  2BJW A;  1HNZ M;  4NRW A;  3FUU A;  3FRH A;  1HT2 E;  4AZF A;  3AOE A;  2ZAO A;  1QAQ A;  4OVZ B;  4FWG A;  4I81 A;  4M0W A;  5KPR A;  4B3S M;  4GHA A;  2M5Z A;  4BB9 A;  4FWD A;  2RKO A;  4QNR A;  3LMM A;  1Z6T A;  4QOS A;  1YSY A;  1GKI A;  3HU2 A;  1TH2 A;  1OQY A;  4LRS A;  5EXP A;  4OX9 M;  1TH4 A;  4REZ A;  1NHG C;  3J2P B;  2H5X A;  3AFH A;  2BJV A;  3UJN A;  4X65 M;  2J5Y A;  4JI6 M;  1GLN A;  3SAW A;  1KYI A;  3CF0 A;  3ZH9 B;  3VLF B;  2DWL A;  4LJA A;  1HR0 M;  4XK8 F;  1OTR A;  2UU9 M;  4JI4 M;  2L4E A;  2HKJ A;  5EQT A;  4LCB A;  1K82 A;  2DAM A;  3FTC A;  2UUB M;  1HT1 E;  2JUJ A;  3FUX A;  3I51 A;  2QZ4 A;  2R62 A;  4GKK M;  4WW0 A;  4B7F A;  3U6P A;  4MB7 A;  4FCW A;  3HHY A;  2L7I A;  2NQ8 C;  5FSW A;  1L8Q A;  3HU3 A;  5L8R F;  3GLG B;  4LF8 M;  1QAN A;  3C3D A;  3I4V A;  2G5G X;  3GLH A;  3ILK A;  3GPY A;  2OPF A;  2BWB A;  3C3E A;  1T43 A;  2R6F A;  1V92 A;  4QNM A;  4PDI A;  1RU3 A;  3TQS A;  1KFV A;  4M9S A;  2QHO B;  1QUT A;  5FTM A;  1KSF X;  1NO1 A;  2CP8 A;  2OO9 A;  3T6P A;  1I4W A;  1G8P A;  1A5T A;  3KSX A;  1BVS A;  3JR4 A;  4Y28 F;  1XXH A;  3TWM A;  2J7N A;  1DGH B;  3F92 A;  3PFI A;  3B89 A;  4IBB A;  3GLI B;  1NNJ A;  3FUT A;  1Y8G A;  1FJG M;  2FNA A;  2KHH A;  3K9O A;  2DXI A;  2QNJ A;  4IIW A;  5EXT A;  1LV7 A;  1ORY B;  2P5T A;  1TH3 A;  1VEG A;  1G59 A;  3GRR A;  3AOG A;  1N32 M;  2V6Z M;  2KNV A;  2ZBK B;  3GQ3 A;  3GQ5 A;  3ZCB B;  1IXR C;  1W5S A;  2R65 A;  2LVO C;  2KW0 A;  4CIZ A;  4B3R M;  4NSO B;  4OVZ A;  4LY6 A;  2R45 A;  1VDL A;  3GLH E;  2K6B A;  1OAI A;  1ZMW A;  3KP1 E;  4Q7J A;  3QYB A;  5DFL A;  4GMQ A;  3RFW A;  1HQC A;  4PD2 A;  5ITY A;  1J7K A;  2C98 A;  2JY8 A;  3L2A A;  3SMP A;  1AUA A;  1X37 A;  4EIW A;  4GKJ M;  2WZJ A;  2JA2 A;  1L2D A;  4LF7 M;  3KXE C;  2HCB A;  3SAU A;  1IY1 A;  3AKZ A;  2EKK A;  2LHG A;  2M60 A;  1MU5 A;  1I94 M;  4DV6 M;  1K3X A;  4M0D A;  3R8F A;  3E21 A;  1R2Z A;  3W67 A;  4DR5 M;  1W5T A;  1XXH E;  2EO2 A;  3LCV B;  4DUZ M;  5EJC A;  4NXM M;  2FH0 A;  4IBE A;  4KOD A;  3SYL A;  3GRU A;  4II7 A;  2R4J A;  2YQZ A;  2ZAM A;  4P16 A;  2JY7 A;  3U5Z B;  3GLG A;  3AV0 A;  2XZU A;  1ZMV A;  4GEW A;  1VEK A;  1S3S A;  2ERC A;  3QAU A;  3RGS A;  1TTE A;  3SAV A;  4PT5 A;  5EP2 A;  2OOA A;  1GAB A;  4IJF A;  3GLH B;  3MMP A;  3CF2 A;  4DR3 M;  3CGW A;  3L25 A;  1WIV A;  3A98 B;  2UXC M;  4FCV A;  1DGB A;  1QDT A;  4LJ7 A;  4IBD A;  1XWI A;  2HHH M;  4JI0 M;  3MK6 A;  5IRE B;  4DV0 M;  1GJT A;  2LVN C;  1IN8 A;  2KNZ A;  4NOO B;  2XLJ A;  2OQ4 A;  5FTJ A;  3DOA A;  2I7P A;  1N34 M;  4B3M M;  2W82 A;  3IG8 A;  3NBX X;  2Z4S A;  3K9P A;  3GLI A;  2UXB M;  4DV7 M;  2K9D A;  3KOX E;  2C96 A;  1WGN A;  2XZF A;  3L29 A;  1ZMU A;  1VG5 A;  1PJS A;  3BBZ A;  7CAT A;  4AQY M;  1R7R A;  2L2D A;  2WSF F;  3LW5 F;  3IEC A;  1TGU A;  3I04 M;  1HNW M;  2XFT A;  4S12 A;  3B74 A;  2WSC F;  4L16 A;  4B08 A;  4NXN M;  1SXJ C;  3T1H M;  4JXJ A;  1IN5 A;  2DEN A;  1K3W A;  2EUC A;  5EXS A;  1DV0 A;  1XC8 A;  4RKU F;  4ZPX A;  4QHS A;  3AOE C;  4IBK A;  4X62 M;  2MR9 A;  3CTW B;  2O5R A;  1MX0 A;  2VF7 A;  3RE8 A;  4KLN A;  1XMO M;  5C18 A;  2A5Y B;  4TUW A;  1YE9 A;  3VDU A;  4KHP M;  4AKI A;  1IY0 A;  5KO3 A;  3FD9 A;  4BLC A;  2EJS A;  4JI7 M;  4MGK E;  4JI1 M;  1OIP A;  1PJJ A;  1Q02 A;  2KZU A;  4GC9 A;  1XMQ M;  1V33 A;  3GLI E;  1GVN A;  3VK8 A;  3KS4 A;  1QYR A;  5E26 A;  3SAT A;  3U5Z A;  2QEN A;  4JI8 M;  1V34 A;  1YUB A;  1T3T A;  3SHG B;  3LQR A;  4UN2 B;  3SBJ A;  3EIH A;  2CV1 A;  1Z5A A;  4PDG A;  2Z3X A;  4AG6 A;  2FFJ A;  3SAR A;  1N33 M;  3TPZ A;  4L8R C;  4I5S A;  1DO2 A;  3KP0 E;  3UK6 A;  5IWA M;  2HWJ A;  1IQP A;  1OFH A;  3IHP A;  4AG5 A;  3U6L A;  1NVM A;  2V1C A;  3PXG A;  2FS1 A;  3FYC A;  4JI3 M;  3M6A A;  2Y20 A;  2QP9 X;  3T38 A;  2JZ0 A;  1IN6 A;  2JNH A;  2XGN A;  5FTL A;  1WXQ A;  2L6O A;  2F5N A;  2CWB A;  2R0I A;  4LFA M;  2AHM A;  3GQ4 A;  1HNX M;  1OJL A;  2DAG A;  5BPV A;  1VEJ A;  2KA6 B;  3FKE A;  3ZQJ A;  4IBF A;  4JN6 A;  1NJG A;  4D81 A;  5LMU M;  1C7Y A;  4MGH A;  3HKP A;  3U6Q A;  1XNQ M;  3B9P A;  2JWS A;  1D0K A;  2FOI C;  2BNK A;  1Q3C A;  5JI3 E;  3KFU G;  4JYA M;  5ITX A;  4XGI A;  3U6C A;  1IFY A;  5ITU A;  2APL A;  1MJG M;  3V76 A;  1PJI A;  2RGO A;  1WJ7 A;  1NY6 A;  2F5Q A;  1N78 A;  4L78 A;  4GH9 A;  4FD2 A;  1E9R A;  3BXW A;  3E9S A;  1C1K A;  1CUK A;  2LVP C;  2LXE A;  3LVW A;  3H4J A;  3WHK A;  3L28 A;  5A2Q S;  4JV5 M;  1OAO C;  1Z5B A;  4L4U A;  2DWZ B;  1IBM M;  3DA1 A;  1Z5C A;  1PM5 A;  1L2B A;  4HEO A;  3SAS A;  5FTN A;  2J7O A;  4I8O A;  1Z59 A;  4LZZ A;  4DR6 M;  3U6M A;  3HJQ A;  1MN3 A;  5E6J A;  3TE6 A;  3PNY A;  1IY2 A;  2VQF M;  1OFI A;  3J80 S;  2R44 A;  2HL7 A;  1QZE A;  4FW9 A;  3HHW A;  4KO8 A;  2C9C A;  3LCU A;  2CV2 A;  4MH0 E;  4LJ4 A;  4OW0 A;  4GRI A;  1VDD A;  1ZQ9 A;  2LBC A;  3GRY A;  3W0L B;  4X64 M;  4K0K M;  4D82 A;  3U61 B;  1TR8 A;  5EP3 A;  2F5P A;  4DUY M;  2LH0 A;  2O25 A;  4IBJ A;  3GLF B;  3K8Z A;  1PRB A;  3IG5 A;  4LGM A;  2Z7J A;  2R4E A;  2UXD M;  1FNN A;  2KRU A;  3FYD A;  3KW6 A;  3L27 A;  2CV0 A;  1L2C A;  5ITX E;  1GO5 A;  3HGI A;  4R7G A;  2H1R A;  2LHC A;  3GPX A;  4A3V B;  2L7H A;  2Y0T A;  2DZN B;  2XH9 A;  4BBA A;  3KSJ A;  4JI5 M;  3U6O A;  1L1Z A;  2VII A;  3DZD A;  2WSE F;  4GIT A;  2Y21 A;  2GNO A;  2DAE A;  1D0L A;  1ZV1 A;  2JXN A;  2KZS A;  3MHV C;  3WHL A;  2DZL A;  3W68 A;  3C9P A;  4X66 M;  4YHH M;  4G4O A;  1UM8 A;  2UUA M;  4DR7 M;  3HHX A;  1PGY A;  1IM2 A;  3J81 S;  4IBC A;  3ZC7 B;  5F3W A;  3JAM S;  1WR1 B;  2ZTD A;  1ZAE A;  3EIE A;  3KOW E;  4DV2 M;  4LF4 M;  4DR4 M;  1J09 A;  3UMM A;  1SG9 A;  4WP2 A;  1GL6 A;  1R5L A;  4D80 A;  4I4L A;  1QUS A;  1EFU B;  2DNA A;  1NJF A;  2LVQ D;  4M9X A;  4NRV A;  3SC3 A;  3JR5 A;  3VK7 A;  3AL0 C;  1DGF A;  1F4I A;  4WUR A;  3C58 A;  1HQY E;  1E94 E;  1QZM A;  3VDP A;  2G8L A;  2MH8 A;  3B7N A;  3SHF A;  3Q8X A;  2B3T A;  3PVS A;  1OKS A;  3J7B A;  3LVV A;  2CHV A;  4R71 A;  1WHC A;  4DBG B;  3GRV A;  5C1B A;  5DYG A;  2KEB A;  3FTF A;  1PJT A;  4RNA A;  2KRK A;  5ITR A;  3THG A;  2Q2E B;  5FLX S;  3HJ8 A;  3VFD A;  3HX3 A;  4R3D A;  4G4R A;  1QVR A;  3HJS A;  5EP1 A;  4B7G A;  3OTO M;  1LTM A;  2HAK A;  1G41 A;  5IZ7 D;  2DWN A;  2Z4R A;  2R46 A;  4IBG A;  2I7N A;  4MGZ E;  2C99 A;  2CRU A;  2XSZ A;  1N75 A;  3AJI B;  1PJQ A;  3U61 A;  5IT9 S;  3VKH A;  4ITQ A;  2Y0Q A;  2O01 F;  3GLF A;  1G3I A;  3HY5 A;  4QHT A;  2JY6 B;  2ZTC A;  3QWL A;  4FWH A;  3E46 A;  1J5E M;  1IBL M;  3UZU A;  1Q3B A;  2MRO B;  2RGH A;  2EA0 A;  1OIZ A;  2LTU A;  4DV1 M;  1AIP C;  3KOZ E;  4LJ9 A;  2QPA A;  4CJ6 A;  4GC5 A;  3SYK A;  3M7G A;  2LNH C;  4P17 A;  5KPT A;  2DAK A;  3UGJ A;  3L26 A;  1JR3 A;  3J7A S;  4MM3 B;  5LMN M;  4JI2 M;  1R6B X;  4G4Q A;  4LGY A;  2DI0 A;  2X49 A;  1T6O A;  1D2N A;  2XSZ D;  3U6S A;  2DHY A;  2CFO A;  2DHR A;  4GIP A;  4G4N A;  3H4M A;  3GO8 A;  3U60 A;  5JI2 E;  4RF0 A;  1IXS A;  1SXJ D;  2JY5 A;  2BWE A;  2CE7 A;  3KS8 A;  2CUZ A;  2QBY A;  1QAM A;  2EKF A;  3NBI A;  2DKL A;  2OOB A;  4LRT A;  4PCZ A;  1XNR M;  3VKG A;  2DVW B;  4KT0 F;  4XBO A;  4AKG A;  3GLF E;  3FUV A;  1SXJ E;  2DAI A;  3KVW A;  4LG2 A;  3NWL A;  1G4A E;  4LJ5 A;  2F4V M;  2F5S A;  2X8A A;  4FVM A;  4L6V 6;  4MGY E;  4DV5 M;  1IN7 A;  2KDL A;  4F2L A;  1D0M A;  4LJ8 A;  3TWK A;  2XF3 A;  4NL4 H;  4ANR A;  1E32 A;  2K47 A;  4AKH A;  1JR3 D;  2YFQ A;  1NY5 A;  3M0E A;  4Z8X A;  2RRU A;  3K2L A;  5DNY A;  3LQQ A;  3GPU A;  4LF9 M;  4DR2 M;  3B7Q A;  1E9S A;  3HU1 A;  2KNA A;  1JR3 E;  1N36 M;  2YR0 A;  4IJE A;  2VQE M;  3T1Y M;  3CF6 E;  1NV8 A;  1NNU C;  5BR8 M;  1VQ1 A;  4G6Z A;  4NC6 A;  4LF5 M;  1NV9 A;  1N77 A;  4DV4 M;  4LZJ A;  1R2Y A;  5ITT A;  2QSF X;  5H37 D;  2YNM D;  2N35 A;  2F5O A;  3DFZ A;  4CGY B;  1NSF A;  2Z8Y M;  1G71 A;  1XHB A;  4IBI A;  4LJ6 A;  4OU7 A;  2L09 A;  3U6D A;  4LF6 M;  2JZ1 A;  2E5L M;  4FCT A;  4L15 A;  1SXJ B;  4M9Z A;  3K92 A;  3GP1 A;  3B7Z A;  3HZJ A;  3FRI A;  1R4G A;  2D7H A;  2K0B X;  2QCU A;  3FTE A;  4DR1 M;  2JP7 A;  1QQW A;  1Q39 A;  1XB2 B;  2ZM6 M;  3TL4 X;  4MGI E;  4CIS A;  1EIJ A;  3I01 M;  2GQF A;  3W0F A;  2DWM A;  4RF1 A;  1DGG A;  5DYI A;  2CHQ A;  3I4Y A;  1HJP A;  4B7H A;  3SFZ A;  2DZO B;  3E4R A;  1EE8 A;  2X4A A;  2L4F A;  3R9X B;  3A46 A;  2VF8 A;  2ZAN A;  3D8B A;  4AI6 A;  3HHZ A;  4QOZ C;  3U60 B;  3SMS A;  1IXS B;  3FTD A;  3J27 B;  2QQ8 A;  3T15 A;  1TDZ A;  3FUW A;  4W5W A;  1L1T A;  4NSR A;  3D8L A;  2QBY B;  2MJ5 B;  1JB0 F;  4DV3 M;  1YLA A;  3BOS A;  2MGW A;  4AW4 A;  1QAO A;  2KXE A;  2CEA A;  1IXZ A;  5EP4 A;  4YY3 M;  2XFS A;  1JQJ C;  5FTK A;  1TF0 B;  5GKN A;  1QDR A;  2LVA A;  4G3O A;  2D7G A;  5KQD A;  5KPZ A;  3Q8G A;  4CHT B;  1H6U A;  3U6E A;  4B3T M;  1GL7 A;  3KOY E;  4GHL A;  3FE3 A;  3RGP A;  3A42 A;  4HL4 A;  4LFC M;  3PNV A;  2XEP A;  2G3Q A;  1NHW C;  1DO0 A;  2FE8 A;  2V1U A;  1DGH A; 
#chains in the Genus database with same CATH homology
 2N35 A;  2MH8 A;  1GJT A;  1GJS A;  2LHG A;  2FS1 A;  2JWS A;  2J5Y A;  2KDL A;  2VDB B;  2LHC A;  1PRB A;  1GAB A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...