1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin-binding protein
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
2LHGA 1GJSA 1GABA 2N35A 1GJTA 2LHCA 2MH8A 2FS1A 2JWSA 2KDLA 2J5YA 1TF0B 1PRBA 2VDBB
chains in the Genus database with same CATH superfamily
1WIVA 1WXQA 2LXEA 3A46A 3KFUG 2CRUA 2XF3A 2QQ8A 1I4WA 4NSOB 1IN6A 4P16A 2BNKA 3K2LA 1ZQ9A 3D8BA 4RF1A 4QNRA 2KDLA 5EXXA 1RU3A 4UN2B 4HEOA 4DR6M 1VEGA 3M7GA 2X4AA 4RF0A 2HKJA 3JR4A 2P5TA 1QANA 4LGMA 5KPRA 2HCBA 4CGYB 3SAWA 3GQ4A 3F92A 4CHTB 2R4JA 2UUBM 4JI1M 4X66M 1HT1E 2JY8A 1OKSA 1VG5A 1ZMWA 2H1RA 3PFIA 3MJ5A 3D8LA 2YQZA 1GO5A 4AI6A 4II7A 2ZANA 1VEJA 1QAQA 5EP4A 3U6MA 1VDDA 2Z4RA 8CATA 2WSEF 3H4JA 3E21A 4FCTA 4I4LA 4L4UA 2XZUA 1DGBA 4IBEA 2LVOC 2F5OA 4AZFA 1NJGA 3NWLA 2JXNA 5JI2E 4JI3M 2KZSA 2ZAOA 2WZJA 2V1UA 4LG2A 1ORYB 4YY3M 3VK8A 1FJGM 3HX3A 2VDBB 2J7NA 1XWIA 2O5RA 1T3TA 2CEAA 1NHWC 2HL7A 2R65A 4L8RC 1V92A 3T1YM 1XMQM 2BJWA 2FFJA 5F3WA 2Z7JA 4BBAA 4DUZM 4DR7M 1E32A 1SXJC 1Z5BA 3KOYE 5IWAM 5ITUA 1XNRM 3C3EA 1FNNA 2R44A 5EP1A 4FCWA 2C5RA 4JI7M 3AJIB 2MROB 3VFDA 3UZUA 3KW6A 2LHCA 4M9XA 4Q7JA 3GLFE 4K0KM 4P17A 5IZ7D 2CUZA 2JZ1A 4OVZB 1A5TA 4S12A 2RRUA 3FTDA 2RKOA 4PT5A 4MH0E 3M0EA 3TE6A 2G3QA 2DAEA 3HHWA 1WGNA 2DZNB 2DWNA 4OVZA 1ZMVA 4KODA 3RGSA 3WHKA 3GRYA 4IBDA 2DXIA 2C9OA 2QENA 2JY6B 4PDIA 1D2NA 1LV7A 2L4EA 2D7HA 3VLFB 3ZCBB 4IJEA 4OX9M 2I7NA 3KSJA 4DV0M 3CF2A 2O01F 3VDUA 1HQYE 2UUAM 4DV6M 5ITTA 2KNVA 3HWSA 1Q02A 1IQPA 1IY0A 1MU5A 1T43A 2QPAA 1ZAEA 2KNZA 1IFYA 2DNAA 2G5GX 3GLGA 4JN6A 2DWZB 2QCUA 1D0LA 4M0DA 4R3DA 4WURA 3LQRA 5ITRA 3GPPA 1VEKA 4DR4M 3KOWE 2CE7A 3J81S 3HKPA 2WSCF 3THGA 4LF8M 1NY6A 2KRKA 1KYIA 1QUSA 4IBJA 3GLGB 2UUCM 4KLNA 1YE9A 4CIZA 3BXWA 2ZAMA 2K6BA 3GLGE 1IN4A 1Q3BA 4QHSA 4CISA 2DI0A 2RGHA 4NRWA 1QAOA 4RNAA 4X65M 3VKGA 3J7AS 2UU9M 4LF9M 5DFLA 1D0KA 5EXPA 1DO0A 3L29A 5BPVA 3AKZA 4L78A 2KA6B 3J80S 4LRSA 1QUTA 4LJ5A 4HLQA 2JY7A 2GQFA 4KO8A 4LZZA 5ITYA 2N35A 4F2LA 4JYAM 1W5SA 4D81A 3NBXX 1IM2A 3KOXE 1G71A 2ERCA 2EO2A 4LF5M 4GITA 3J2PB 3U60A 3BBZA 4GC5A 3FTEA 1HJPA 4GKKM 1HR0M 4GHAA 1S3SA 3C58A 4B7FA 3UK6A 4Z6YA 2OOBA 4REZA 1V34A 4PCZA 2EKFA 1GL6A 3GLHB 1G59A 4MGYE 3R9XB 2OO9A 4AKGA 4R7GA 2LHGA 3I51A 1Q3CA 2BWBA 4FD2A 5FTLA 2AHMA 4I8OA 1JR3A 1PJQA 2APLA 2DHYA 4B3MM 4B3RM 2R4EA 5IT9S 3U5ZB 3FUTA 3DA1A 1OTRA 5DYIA 4D80A 1XC8A 2K47A 2DZOB 4LJAA 3UGJA 1F4IA 1R2YA 2Z4SA 2EKKA 4FWGA 4GC9A 3H4MA 4YHHM 2DKLA 3SMSA 3WHLA 1N36M 4B3SM 4IBIA 4QHTA 2E5LM 4LFCM 1OQYA 4TUWA 2RGOA 2V1CA 2G8LA 2XGNA 3MK6A 4G3OA 3B7QA 1D0MA 3HU3A 2VF8A 1XB2B 1YUBA 4KHPM 3HJSA 3LW5F 3SARA 4MGKE 3B9PA 2Y21A 3TWLA 4M9ZA 1OIPA 5ITQA 4AKHA 1TF0B 1JR3D 1UFZA 4AW4A 3U6DA 1YLAA 4G4QA 1C1KA 2JY5A 3B74A 5EJCA 3LVVA 4G4RA 3KDSE 3U5ZA 1NV9A 1L1TA 2J7OA 3K1JA 4B7GA 4F1IA 1PM5A 3RE8A 3JR5A 5A2QS 1OFHA 2R46A 2XSZA 2ZTDA 5FTNA 5C1BA 2XEPA 4DR1M 1NVMA 2D7EA 2KRUA 2O25A 5ITXA 4AKIA 1HQCA 1Z59A 4L6V6 1IBKM 3DOAA 2K9DA 2JZ0A 2R45A 1QAMA 3SHFA 3L2AA 2CHQA 1NHGC 2JUJA 7CATA 1SXJA 1XMOM 1L1ZA 2JP7A 4AQYM 4B7HA 2F5PA 2KHHA 3PNYA 4PDGA 1GABA 4IBKA 3J27B 3HJQA 4LCBA 2KXEA 5FTMA 2JNHA 3MMPA 3A98B 3KVWA 3FUUA 4MM3B 1R7RA 2ZBKB 3R8FA 2QBYB 5H37D 4NXMM 1TH3A 2JA2A 3B89A 3LMMA 4A3VB 1HNZM 3U6PA 3A45A 1R2ZA 3SBJA 2QHOB 2HAKA 3SATA 3GRVA 5KQDA 2LNHC 1TGUA 2QBYA 1L8QA 4W5WA 4L16A 1MJGM 3GLIA 3IG5A 4RKUF 1NV8A 1V33A 2UXBM 4M0WA 3K9OA 2Q2EB 4QOSA 2CWBA 4DUYM 2L2DA 3L26A 2F5QA 4LFBM 4LJ9A 3UJNA 4I5SA 1N77A 3E46A 4MGZE 3CGWA 1XXHE 4BLCA 4JV5M 1NJFA 1PGYA 3FRHA 3PNVA 1IN5A 5IREB 3GLHA 1KFVA 3HHYA 3GO8A 1YSYA 4LGYA 3T1HM 1IN8A 3TQSA 2DZLA 4IBBA 1JQJC 3VKHA 3I4YA 1LTMA 4NL4H 5E6JA 2UXDM 3C3DA 3SMPA 1Z6TA 2W82A 3IHPA 1XXHA 1C7YA 1W5TA 3U6LA 3KSXA 4FWDA 2BWEA 5FSWA 3GPYA 1Q39A 5L8RF 1QZEA 4B3TM 4NC6A 2LTUA 1HNXM 1IBMM 3EIEA 2VIIA 1E9SA 3GRUA 3SFZA 1WHCA 4GRIA 5EP2A 3PVSA 2ZM6M 4LZJA 1N33M 3L25A 2D7GA 1AUAA 4JI0M 5LMUM 1DV0A 5EXTA 4NXNM 1R6BX 2GNOA 3TWKA 2LVPC 3HU1A 4DV1M 1K3XA 4GIPA 3U60B 2L7IA 4BB9A 4MB7A 2QZ4A 3DFZA 1TTEA 1X37A 2R18A 3AFHA 4AG5A 4IIWA 2L7HA 4Y28F 3SYLA 1DGFA 2LVQD 1OJLA 5KO3A 4X62M 2CV1A 1N34M 1ZV1A 1XXHB 1NY5A 2H5XA 3KS8A 3HU2A 4QNMA 2V6ZM 1GVNA 2F4VM 4IJFA 1TDHA 4I81A 4Z8XA 4IBCA 2EUCA 5DYGA 5GKNA 3E9SA 4DBGB 1K3WA 2KNAA 1K82A 1T6OA 4GKJM 1NSFA 4NSRA 1HT2E 2DHRA 3EIHA 2FH0A 1VQ1A 2FS1A 1TH4A 4DV4M 2EJSA 3A42A 3GRRA 1SG9A 3ZH9B 4X64M 4GH9A 2M60A 2L4FA 2I7PA 2A5YB 1R5LA 2BJVA 2DENA 4GMQA 3FTFA 4DV2M 3T38A 2Z3XA 3LCUA 1PJJA 1XNQM 1J7KA 5FLXS 3FKEA 2JWSA 4LJ7A 3HGIA 3SAUA 1GJSA 2HHHM 2XFTA 1E9RA 3GLHE 3I4VA 4FW9A 4DR3M 3K9PA 4LF7M 1Z5AA 2FOIC 2YFQA 3HZJA 4NRVA 4G4NA 1I94M 1BVSA 3T6PA 4PD2A 2XLJA 1NNJA 4XBOA 2DVWB 4JI4M 1IXSA 2NQ8C 2XZFA 4MGHA 2CV0A 3W0LB 2LH0A 1KSFX 3HJ8A 3QWLA 5KQ8A 3GLIE 1TDZA 4ZPXA 5EP3A 1OAIA 1Y8GA 2X49A 4LFAM 1QDTA 1VDLA 1NO1A 1DGHA 3GLIB 1IXSB 2ZTCA 4NOOB 3SHGB 3U6SA 3PXGA 5DNYA 1IY1A 2OPFA 3GPXA 1OIZA 3TL4X 2HWJA 2J5YA 2YR0A 2R0IA 2CV2A 3TWMA 1N78A 3GLFB 1IXZA 1IXRC 1DO2A 1G3IA 1WJ7A 2CHVA 3K92A 3HHXA 2LWXA 4WP2A 4KT0F 4ITQA 1SXJB 2QNJA 3AL0C 2XSZD 2LBCA 3U6CA 3SAVA 3TPZA 1SXJE 2UXCM 3ZQJA 1EFUB 1Z5CA 1UM8A 2KZUA 3M6AA 3QYEA 3QAUA 3IG8A 4OW0A 3VDPA 3L28A 3FUWA 4DR5M 1P3QQ 4FVMA 3GQ5A 3AV0A 3KOZE 4B08A 4JI5M 3SC3A 4XK8F 5KPTA 3IECA 3FYCA 4FWHA 2MGWA 4G4OA 3K8ZA 4MGIE 3UMMA 2MR9A 1PJSA 1GLNA 1TR8A 1GKIA 3CTWB 2QSFX 3QYBA 3NBIA 5FTKA 4ANRA 4G6ZA 4XGIA 2C99A 4FCVA 3U6OA 1L2DA 2C96A 3T15A 3JAMS 3J7BA 2VQFM 2CFOA 3C9PA 3FUXA 2CHGA 2WSFF 1MN3A 3HHZA 2R62A 3AOGA 4R71A 4LF6M 1EIJA 1WR1B 4IBFA 2OQ4A 1ZMUA 1L2BA 4LJ4A 4D82A 5JI3E 2X8AA 2L6OA 3LVWA 1JR3E 1PJIA 4QOZC 4EIWA 2F5NA 1DGGA 1CUKA 3KXEC 1OFIA 3FTCA 1GJTA 3FE3A 1QVRA 2QP9X 3OTOM 4M9SA 3U6QA 3Q8XA 3CF6E 5E26A 3FRIA 1MX0A 4GEWA 3LCVB 4DV7M 3B7ZA 2DAIA 3B7NA 1G4AE 5EXSA 4LF4M 5EQTA 3FUVA 3ZC7B 3U61A 1N75A 1QZMA 2CP8A 2LVAA 5LMNM 2R6FA 2C98A 5ITXE 1GL7A 2LVNC 1E94E 2Y0TA 1N32M 2KW0A 3RFWA 5BR8M 4WW0A 1PRBA 1G41A 3LQQA 1NNUC 3HY5A 3FD9A 1AIPC 1IY2A 3FYDA 2KEBA 3I01M 1TH2A 3ILKA 1QDRA 3CF0A 5FTJA 4LY6A 4OU7A 1QQWA 3SYKA 1L2CA 2XFSA 3AOEC 3KS4A 4DV3M 2VQEM 2MH8A 2Z8YM 2B3TA 2DAGA 1IBLM 1WGLA 1R4GA 4LJ6A 4HL4A 2DWMA 2Y20A 3DZDA 1IN7A 1EE8A 4GHLA 1PJTA 3GQ3A 5C18A 2DAMA 4JXJA 3KP1E 3VK7A 1DGHB 3U61B 2MJ5B 5KPZA 3U6EA 3Q8GA 3E4RA 2Y0QA 3W0FA 1J09A 2F5SA 4JI6M 1XHBA 4JI2M 3I04M 2XH9A 4DR2M 2DAKA 3W68A 1JB0F 1J5EM 2DWLA 3V76A 3BOSA 3GLFA 2FE8A 3MHVC 3SASA 4AG6A 3GP1A 2FNAA 2C9CA 2VF7A 3W67A 3GPUA 1QYRA 4IBGA 3RGPA 2M5ZA 1SXJD 4LRTA 4CJ6A 4L15A 3AOEA 2EA0A 1HNWM 2YNMD 4JI8M 2K0BX 3KP0E 2OOAA 4DV5M 4LJ8A 1G8PA 1H6UA 2L09A 1OAOC 3L27A
chains in the Genus database with same CATH topology
2LHGA 1GJSA 1GABA 2N35A 1GJTA 2LHCA 2MH8A 2FS1A 2JWSA 2KDLA 2J5YA 1TF0B 1PRBA 2VDBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHG A;  1GJS A;  1GAB A;  2N35 A;  1GJT A;  2LHC A;  2MH8 A;  2FS1 A;  2JWS A;  2KDL A;  2J5Y A;  1TF0 B;  1PRB A;  2VDB B; 
#chains in the Genus database with same CATH topology
 1WIV A;  1WXQ A;  2LXE A;  3A46 A;  3KFU G;  2CRU A;  2XF3 A;  2QQ8 A;  1I4W A;  4NSO B;  1IN6 A;  4P16 A;  2BNK A;  3K2L A;  1ZQ9 A;  3D8B A;  4RF1 A;  4QNR A;  2KDL A;  5EXX A;  1RU3 A;  4UN2 B;  4HEO A;  4DR6 M;  1VEG A;  3M7G A;  2X4A A;  4RF0 A;  2HKJ A;  3JR4 A;  2P5T A;  1QAN A;  4LGM A;  5KPR A;  2HCB A;  4CGY B;  3SAW A;  3GQ4 A;  3F92 A;  4CHT B;  2R4J A;  2UUB M;  4JI1 M;  4X66 M;  1HT1 E;  2JY8 A;  1OKS A;  1VG5 A;  1ZMW A;  2H1R A;  3PFI A;  3MJ5 A;  3D8L A;  2YQZ A;  1GO5 A;  4AI6 A;  4II7 A;  2ZAN A;  1VEJ A;  1QAQ A;  5EP4 A;  3U6M A;  1VDD A;  2Z4R A;  8CAT A;  2WSE F;  3H4J A;  3E21 A;  4FCT A;  4I4L A;  4L4U A;  2XZU A;  1DGB A;  4IBE A;  2LVO C;  2F5O A;  4AZF A;  1NJG A;  3NWL A;  2JXN A;  5JI2 E;  4JI3 M;  2KZS A;  2ZAO A;  2WZJ A;  2V1U A;  4LG2 A;  1ORY B;  4YY3 M;  3VK8 A;  1FJG M;  3HX3 A;  2VDB B;  2J7N A;  1XWI A;  2O5R A;  1T3T A;  2CEA A;  1NHW C;  2HL7 A;  2R65 A;  4L8R C;  1V92 A;  3T1Y M;  1XMQ M;  2BJW A;  2FFJ A;  5F3W A;  2Z7J A;  4BBA A;  4DUZ M;  4DR7 M;  1E32 A;  1SXJ C;  1Z5B A;  3KOY E;  5IWA M;  5ITU A;  1XNR M;  3C3E A;  1FNN A;  2R44 A;  5EP1 A;  4FCW A;  2C5R A;  4JI7 M;  3AJI B;  2MRO B;  3VFD A;  3UZU A;  3KW6 A;  2LHC A;  4M9X A;  4Q7J A;  3GLF E;  4K0K M;  4P17 A;  5IZ7 D;  2CUZ A;  2JZ1 A;  4OVZ B;  1A5T A;  4S12 A;  2RRU A;  3FTD A;  2RKO A;  4PT5 A;  4MH0 E;  3M0E A;  3TE6 A;  2G3Q A;  2DAE A;  3HHW A;  1WGN A;  2DZN B;  2DWN A;  4OVZ A;  1ZMV A;  4KOD A;  3RGS A;  3WHK A;  3GRY A;  4IBD A;  2DXI A;  2C9O A;  2QEN A;  2JY6 B;  4PDI A;  1D2N A;  1LV7 A;  2L4E A;  2D7H A;  3VLF B;  3ZCB B;  4IJE A;  4OX9 M;  2I7N A;  3KSJ A;  4DV0 M;  3CF2 A;  2O01 F;  3VDU A;  1HQY E;  2UUA M;  4DV6 M;  5ITT A;  2KNV A;  3HWS A;  1Q02 A;  1IQP A;  1IY0 A;  1MU5 A;  1T43 A;  2QPA A;  1ZAE A;  2KNZ A;  1IFY A;  2DNA A;  2G5G X;  3GLG A;  4JN6 A;  2DWZ B;  2QCU A;  1D0L A;  4M0D A;  4R3D A;  4WUR A;  3LQR A;  5ITR A;  3GPP A;  1VEK A;  4DR4 M;  3KOW E;  2CE7 A;  3J81 S;  3HKP A;  2WSC F;  3THG A;  4LF8 M;  1NY6 A;  2KRK A;  1KYI A;  1QUS A;  4IBJ A;  3GLG B;  2UUC M;  4KLN A;  1YE9 A;  4CIZ A;  3BXW A;  2ZAM A;  2K6B A;  3GLG E;  1IN4 A;  1Q3B A;  4QHS A;  4CIS A;  2DI0 A;  2RGH A;  4NRW A;  1QAO A;  4RNA A;  4X65 M;  3VKG A;  3J7A S;  2UU9 M;  4LF9 M;  5DFL A;  1D0K A;  5EXP A;  1DO0 A;  3L29 A;  5BPV A;  3AKZ A;  4L78 A;  2KA6 B;  3J80 S;  4LRS A;  1QUT A;  4LJ5 A;  4HLQ A;  2JY7 A;  2GQF A;  4KO8 A;  4LZZ A;  5ITY A;  2N35 A;  4F2L A;  4JYA M;  1W5S A;  4D81 A;  3NBX X;  1IM2 A;  3KOX E;  1G71 A;  2ERC A;  2EO2 A;  4LF5 M;  4GIT A;  3J2P B;  3U60 A;  3BBZ A;  4GC5 A;  3FTE A;  1HJP A;  4GKK M;  1HR0 M;  4GHA A;  1S3S A;  3C58 A;  4B7F A;  3UK6 A;  4Z6Y A;  2OOB A;  4REZ A;  1V34 A;  4PCZ A;  2EKF A;  1GL6 A;  3GLH B;  1G59 A;  4MGY E;  3R9X B;  2OO9 A;  4AKG A;  4R7G A;  2LHG A;  3I51 A;  1Q3C A;  2BWB A;  4FD2 A;  5FTL A;  2AHM A;  4I8O A;  1JR3 A;  1PJQ A;  2APL A;  2DHY A;  4B3M M;  4B3R M;  2R4E A;  5IT9 S;  3U5Z B;  3FUT A;  3DA1 A;  1OTR A;  5DYI A;  4D80 A;  1XC8 A;  2K47 A;  2DZO B;  4LJA A;  3UGJ A;  1F4I A;  1R2Y A;  2Z4S A;  2EKK A;  4FWG A;  4GC9 A;  3H4M A;  4YHH M;  2DKL A;  3SMS A;  3WHL A;  1N36 M;  4B3S M;  4IBI A;  4QHT A;  2E5L M;  4LFC M;  1OQY A;  4TUW A;  2RGO A;  2V1C A;  2G8L A;  2XGN A;  3MK6 A;  4G3O A;  3B7Q A;  1D0M A;  3HU3 A;  2VF8 A;  1XB2 B;  1YUB A;  4KHP M;  3HJS A;  3LW5 F;  3SAR A;  4MGK E;  3B9P A;  2Y21 A;  3TWL A;  4M9Z A;  1OIP A;  5ITQ A;  4AKH A;  1TF0 B;  1JR3 D;  1UFZ A;  4AW4 A;  3U6D A;  1YLA A;  4G4Q A;  1C1K A;  2JY5 A;  3B74 A;  5EJC A;  3LVV A;  4G4R A;  3KDS E;  3U5Z A;  1NV9 A;  1L1T A;  2J7O A;  3K1J A;  4B7G A;  4F1I A;  1PM5 A;  3RE8 A;  3JR5 A;  5A2Q S;  1OFH A;  2R46 A;  2XSZ A;  2ZTD A;  5FTN A;  5C1B A;  2XEP A;  4DR1 M;  1NVM A;  2D7E A;  2KRU A;  2O25 A;  5ITX A;  4AKI A;  1HQC A;  1Z59 A;  4L6V 6;  1IBK M;  3DOA A;  2K9D A;  2JZ0 A;  2R45 A;  1QAM A;  3SHF A;  3L2A A;  2CHQ A;  1NHG C;  2JUJ A;  7CAT A;  1SXJ A;  1XMO M;  1L1Z A;  2JP7 A;  4AQY M;  4B7H A;  2F5P A;  2KHH A;  3PNY A;  4PDG A;  1GAB A;  4IBK A;  3J27 B;  3HJQ A;  4LCB A;  2KXE A;  5FTM A;  2JNH A;  3MMP A;  3A98 B;  3KVW A;  3FUU A;  4MM3 B;  1R7R A;  2ZBK B;  3R8F A;  2QBY B;  5H37 D;  4NXM M;  1TH3 A;  2JA2 A;  3B89 A;  3LMM A;  4A3V B;  1HNZ M;  3U6P A;  3A45 A;  1R2Z A;  3SBJ A;  2QHO B;  2HAK A;  3SAT A;  3GRV A;  5KQD A;  2LNH C;  1TGU A;  2QBY A;  1L8Q A;  4W5W A;  4L16 A;  1MJG M;  3GLI A;  3IG5 A;  4RKU F;  1NV8 A;  1V33 A;  2UXB M;  4M0W A;  3K9O A;  2Q2E B;  4QOS A;  2CWB A;  4DUY M;  2L2D A;  3L26 A;  2F5Q A;  4LFB M;  4LJ9 A;  3UJN A;  4I5S A;  1N77 A;  3E46 A;  4MGZ E;  3CGW A;  1XXH E;  4BLC A;  4JV5 M;  1NJF A;  1PGY A;  3FRH A;  3PNV A;  1IN5 A;  5IRE B;  3GLH A;  1KFV A;  3HHY A;  3GO8 A;  1YSY A;  4LGY A;  3T1H M;  1IN8 A;  3TQS A;  2DZL A;  4IBB A;  1JQJ C;  3VKH A;  3I4Y A;  1LTM A;  4NL4 H;  5E6J A;  2UXD M;  3C3D A;  3SMP A;  1Z6T A;  2W82 A;  3IHP A;  1XXH A;  1C7Y A;  1W5T A;  3U6L A;  3KSX A;  4FWD A;  2BWE A;  5FSW A;  3GPY A;  1Q39 A;  5L8R F;  1QZE A;  4B3T M;  4NC6 A;  2LTU A;  1HNX M;  1IBM M;  3EIE A;  2VII A;  1E9S A;  3GRU A;  3SFZ A;  1WHC A;  4GRI A;  5EP2 A;  3PVS A;  2ZM6 M;  4LZJ A;  1N33 M;  3L25 A;  2D7G A;  1AUA A;  4JI0 M;  5LMU M;  1DV0 A;  5EXT A;  4NXN M;  1R6B X;  2GNO A;  3TWK A;  2LVP C;  3HU1 A;  4DV1 M;  1K3X A;  4GIP A;  3U60 B;  2L7I A;  4BB9 A;  4MB7 A;  2QZ4 A;  3DFZ A;  1TTE A;  1X37 A;  2R18 A;  3AFH A;  4AG5 A;  4IIW A;  2L7H A;  4Y28 F;  3SYL A;  1DGF A;  2LVQ D;  1OJL A;  5KO3 A;  4X62 M;  2CV1 A;  1N34 M;  1ZV1 A;  1XXH B;  1NY5 A;  2H5X A;  3KS8 A;  3HU2 A;  4QNM A;  2V6Z M;  1GVN A;  2F4V M;  4IJF A;  1TDH A;  4I81 A;  4Z8X A;  4IBC A;  2EUC A;  5DYG A;  5GKN A;  3E9S A;  4DBG B;  1K3W A;  2KNA A;  1K82 A;  1T6O A;  4GKJ M;  1NSF A;  4NSR A;  1HT2 E;  2DHR A;  3EIH A;  2FH0 A;  1VQ1 A;  2FS1 A;  1TH4 A;  4DV4 M;  2EJS A;  3A42 A;  3GRR A;  1SG9 A;  3ZH9 B;  4X64 M;  4GH9 A;  2M60 A;  2L4F A;  2I7P A;  2A5Y B;  1R5L A;  2BJV A;  2DEN A;  4GMQ A;  3FTF A;  4DV2 M;  3T38 A;  2Z3X A;  3LCU A;  1PJJ A;  1XNQ M;  1J7K A;  5FLX S;  3FKE A;  2JWS A;  4LJ7 A;  3HGI A;  3SAU A;  1GJS A;  2HHH M;  2XFT A;  1E9R A;  3GLH E;  3I4V A;  4FW9 A;  4DR3 M;  3K9P A;  4LF7 M;  1Z5A A;  2FOI C;  2YFQ A;  3HZJ A;  4NRV A;  4G4N A;  1I94 M;  1BVS A;  3T6P A;  4PD2 A;  2XLJ A;  1NNJ A;  4XBO A;  2DVW B;  4JI4 M;  1IXS A;  2NQ8 C;  2XZF A;  4MGH A;  2CV0 A;  3W0L B;  2LH0 A;  1KSF X;  3HJ8 A;  3QWL A;  5KQ8 A;  3GLI E;  1TDZ A;  4ZPX A;  5EP3 A;  1OAI A;  1Y8G A;  2X49 A;  4LFA M;  1QDT A;  1VDL A;  1NO1 A;  1DGH A;  3GLI B;  1IXS B;  2ZTC A;  4NOO B;  3SHG B;  3U6S A;  3PXG A;  5DNY A;  1IY1 A;  2OPF A;  3GPX A;  1OIZ A;  3TL4 X;  2HWJ A;  2J5Y A;  2YR0 A;  2R0I A;  2CV2 A;  3TWM A;  1N78 A;  3GLF B;  1IXZ A;  1IXR C;  1DO2 A;  1G3I A;  1WJ7 A;  2CHV A;  3K92 A;  3HHX A;  2LWX A;  4WP2 A;  4KT0 F;  4ITQ A;  1SXJ B;  2QNJ A;  3AL0 C;  2XSZ D;  2LBC A;  3U6C A;  3SAV A;  3TPZ A;  1SXJ E;  2UXC M;  3ZQJ A;  1EFU B;  1Z5C A;  1UM8 A;  2KZU A;  3M6A A;  3QYE A;  3QAU A;  3IG8 A;  4OW0 A;  3VDP A;  3L28 A;  3FUW A;  4DR5 M;  1P3Q Q;  4FVM A;  3GQ5 A;  3AV0 A;  3KOZ E;  4B08 A;  4JI5 M;  3SC3 A;  4XK8 F;  5KPT A;  3IEC A;  3FYC A;  4FWH A;  2MGW A;  4G4O A;  3K8Z A;  4MGI E;  3UMM A;  2MR9 A;  1PJS A;  1GLN A;  1TR8 A;  1GKI A;  3CTW B;  2QSF X;  3QYB A;  3NBI A;  5FTK A;  4ANR A;  4G6Z A;  4XGI A;  2C99 A;  4FCV A;  3U6O A;  1L2D A;  2C96 A;  3T15 A;  3JAM S;  3J7B A;  2VQF M;  2CFO A;  3C9P A;  3FUX A;  2CHG A;  2WSF F;  1MN3 A;  3HHZ A;  2R62 A;  3AOG A;  4R71 A;  4LF6 M;  1EIJ A;  1WR1 B;  4IBF A;  2OQ4 A;  1ZMU A;  1L2B A;  4LJ4 A;  4D82 A;  5JI3 E;  2X8A A;  2L6O A;  3LVW A;  1JR3 E;  1PJI A;  4QOZ C;  4EIW A;  2F5N A;  1DGG A;  1CUK A;  3KXE C;  1OFI A;  3FTC A;  1GJT A;  3FE3 A;  1QVR A;  2QP9 X;  3OTO M;  4M9S A;  3U6Q A;  3Q8X A;  3CF6 E;  5E26 A;  3FRI A;  1MX0 A;  4GEW A;  3LCV B;  4DV7 M;  3B7Z A;  2DAI A;  3B7N A;  1G4A E;  5EXS A;  4LF4 M;  5EQT A;  3FUV A;  3ZC7 B;  3U61 A;  1N75 A;  1QZM A;  2CP8 A;  2LVA A;  5LMN M;  2R6F A;  2C98 A;  5ITX E;  1GL7 A;  2LVN C;  1E94 E;  2Y0T A;  1N32 M;  2KW0 A;  3RFW A;  5BR8 M;  4WW0 A;  1PRB A;  1G41 A;  3LQQ A;  1NNU C;  3HY5 A;  3FD9 A;  1AIP C;  1IY2 A;  3FYD A;  2KEB A;  3I01 M;  1TH2 A;  3ILK A;  1QDR A;  3CF0 A;  5FTJ A;  4LY6 A;  4OU7 A;  1QQW A;  3SYK A;  1L2C A;  2XFS A;  3AOE C;  3KS4 A;  4DV3 M;  2VQE M;  2MH8 A;  2Z8Y M;  2B3T A;  2DAG A;  1IBL M;  1WGL A;  1R4G A;  4LJ6 A;  4HL4 A;  2DWM A;  2Y20 A;  3DZD A;  1IN7 A;  1EE8 A;  4GHL A;  1PJT A;  3GQ3 A;  5C18 A;  2DAM A;  4JXJ A;  3KP1 E;  3VK7 A;  1DGH B;  3U61 B;  2MJ5 B;  5KPZ A;  3U6E A;  3Q8G A;  3E4R A;  2Y0Q A;  3W0F A;  1J09 A;  2F5S A;  4JI6 M;  1XHB A;  4JI2 M;  3I04 M;  2XH9 A;  4DR2 M;  2DAK A;  3W68 A;  1JB0 F;  1J5E M;  2DWL A;  3V76 A;  3BOS A;  3GLF A;  2FE8 A;  3MHV C;  3SAS A;  4AG6 A;  3GP1 A;  2FNA A;  2C9C A;  2VF7 A;  3W67 A;  3GPU A;  1QYR A;  4IBG A;  3RGP A;  2M5Z A;  1SXJ D;  4LRT A;  4CJ6 A;  4L15 A;  3AOE A;  2EA0 A;  1HNW M;  2YNM D;  4JI8 M;  2K0B X;  3KP0 E;  2OOA A;  4DV5 M;  4LJ8 A;  1G8P A;  1H6U A;  2L09 A;  1OAO C;  3L27 A; 
#chains in the Genus database with same CATH homology
 2LHG A;  1GJS A;  1GAB A;  2N35 A;  1GJT A;  2LHC A;  2MH8 A;  2FS1 A;  2JWS A;  2KDL A;  2J5Y A;  1TF0 B;  1PRB A;  2VDB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...