1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin-binding protein
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
2FS1A 2MH8A 1TF0B 1GJTA 2LHGA 2LHCA 2N35A 2KDLA 1GABA 2JWSA 1PRBA 2VDBB 2J5YA 1GJSA
chains in the Genus database with same CATH superfamily
1VEKA 1OTRA 5FTNA 3K8ZA 1HNWM 1SXJA 4FWHA 2DWMA 2UUBM 5A2QS 1SXJB 1UFZA 2XFTA 4BLCA 2Y21A 4LFBM 2LWXA 3BXWA 4LG2A 2Y0QA 3I51A 2CHQA 3I4VA 4X64M 4D80A 3SYKA 5C1BA 4JYAM 2QHOB 4XBOA 1J7KA 1VQ1A 1C7YA 2BJWA 3HWSA 2D7EA 3LMMA 2OO9A 2VQEM 1NY6A 4DR5M 2D7HA 2ZANA 4P16A 4DR3M 3C3EA 3KW6A 4IBKA 1PJJA 2VIIA 1ZV1A 1QANA 1V92A 2MROB 4DV2M 4B3SM 1PJIA 1TF0B 4RF1A 2DXIA 2KZSA 4PDGA 3U6MA 4LCBA 1N34M 4A3VB 3A98B 3KOWE 4PD2A 1D2NA 2L7HA 3L26A 4D81A 1D0LA 1RU3A 2JY7A 2QCUA 4FCWA 2CFOA 1XNRM 4L16A 4RF0A 5KPRA 5BR8M 4NC6A 4MH0E 5ITXA 3EIHA 4B7HA 3FUTA 3U61A 3WHLA 3T6PA 3GPPA 4IJFA 3GLGE 5EJCA 1OFIA 4OVZB 3U61B 1GKIA 2NQ8C 5ITQA 1JQJC 5GKNA 3E21A 4QHSA 2KEBA 2H1RA 1AUAA 3HJQA 2HCBA 1J5EM 1K82A 4WW0A 1HNXM 1YUBA 4D82A 1G8PA 3HJSA 3SASA 1IY1A 3E9SA 1IXRC 2DKLA 5FTMA 3K9OA 1LV7A 1Q02A 1TTEA 3VK7A 2R45A 3FUVA 4IBFA 2LHCA 2J7NA 3SFZA 3A46A 3I04M 3U6OA 3VKGA 5EXSA 3KOXE 1D0MA 2K0BX 3KVWA 4LRSA 4IBIA 3SHGB 2VQFM 4II7A 3AOEC 2JWSA 3TWLA 2D7GA 3L27A 4YY3M 2R6FA 3KP1E 3EIEA 1MJGM 1T43A 1KFVA 2GQFA 4JI7M 1IY2A 1YLAA 3KP0E 4FWGA 3VFDA 3U6LA 2UUCM 2VF8A 3DOAA 3GPUA 3W67A 2K6BA 1QAQA 1TH2A 2O25A 2DAIA 2Z4RA 3ZCBB 4PDIA 1Y8GA 5DNYA 4HL4A 1XXHE 4MGYE 1ZAEA 3J7AS 4GITA 5ITTA 4FCTA 4LF6M 2DZNB 3U6EA 4M9ZA 4PCZA 2JY5A 4LF5M 4LFCM 1ZQ9A 5EQTA 2UU9M 3FTFA 4AG5A 2VF7A 1KSFX 4AKGA 3HHWA 3FTCA 4F1IA 3B9PA 4KHPM 4GHAA 3GLIA 3J27B 2RGHA 3FUWA 4ITQA 3T15A 4DV6M 2CEAA 3GLIB 4CHTB 3GPYA 2HHHM 3T1HM 1PRBA 2M5ZA 2CV2A 2LVPC 2C5RA 1HQYE 3L29A 3MJ5A 2KRKA 1GO5A 2BWBA 4LZJA 1J09A 4LGYA 3FTEA 4LRTA 3VDPA 2DWZB 1NVMA 3LCUA 2KA6B 2CRUA 5E6JA 2R4JA 3NBXX 4AKIA 2V1UA 3MK6A 2DAKA 1NV8A 3KS8A 2MGWA 3U6SA 4M9SA 1BVSA 2K9DA 3U6PA 2Y20A 3HY5A 3OTOM 4JI0M 3LCVB 2QNJA 3TQSA 3WHKA 3FRIA 2OQ4A 4MGIE 5LMUM 4OX9M 3GLHE 3MHVC 3H4JA 2LXEA 1K3XA 4G4NA 3IG8A 3GRYA 2DZLA 4G6ZA 4X66M 4DV7M 3VDUA 1N77A 1W5SA 2G3QA 1IN8A 2R65A 2RRUA 3RGSA 1SXJC 1R6BX 3J81S 1TDZA 1VDLA 1NHWC 5EXXA 1FJGM 1G41A 2FFJA 1JR3D 1T6OA 3E46A 1OQYA 2QSFX 3CGWA 2F5QA 1XWIA 2ZBKB 1E32A 4JN6A 4JXJA 2C98A 4OW0A 4QOSA 2V1CA 5FTJA 3V76A 4QNMA 4BBAA 1QUTA 1R7RA 2L6OA 3BBZA 5KQ8A 1TH4A 1ORYB 4L15A 4MM3B 5FTKA 2JY8A 4FD2A 1QDRA 4MGZE 3LW5F 5DFLA 4Q7JA 2M60A 1NSFA 1N32M 4LJ6A 2B3TA 3LVVA 1IY0A 3W0LB 4B7FA 5JI3E 3D8LA 3MMPA 3VKHA 4LJAA 1IBKM 3GLGA 1E9SA 3FYCA 3VLFB 4Y28F 3GLGB 3CTWB 3U6QA 5E26A 3GLFA 1GJTA 3GLFB 2HL7A 4W5WA 3L2AA 4ANRA 3PXGA 1NNJA 3IG5A 2O5RA 3W68A 2QBYA 4NXNM 2F5OA 3AV0A 2QBYB 2LVNC 3R8FA 3KSXA 4R71A 1JR3E 2JNHA 3B7ZA 3U5ZA 2APLA 1KYIA 5EP3A 3BOSA 2XEPA 4IIWA 3U5ZB 2E5LM 1H6UA 4DR2M 2Z4SA 5H37D 4UN2B 4X65M 2C9OA 3HJ8A 4LJ4A 2I7NA 3UJNA 2XLJA 3CF6E 3LQQA 3GPXA 3FTDA 4G4OA 4JI8M 3SAWA 2XH9A 1QZEA 2DENA 2XZFA 2EO2A 1PM5A 2GNOA 4I5SA 4OVZA 7CATA 2P5TA 2VDBB 4CISA 4GKKM 1Z5AA 3HU3A 3HHZA 1IN5A 2CE7A 1XXHA 1E9RA 2LNHC 2R46A 3H4MA 4S12A 3FUUA 8CATA 1XXHB 2Z3XA 3TWMA 1VDDA 1JB0F 3M7GA 1SXJE 1L1ZA 5DYGA 2G5GX 1QAMA 2V6ZM 2KNAA 3RE8A 5IREB 2QQ8A 2YFQA 1IBMM 3GRVA 2JP7A 1NJGA 1Z5BA 1QUSA 2KNZA 2KXEA 2Z8YM 2Z7JA 3SARA 2CV0A 1NO1A 4L4UA 4R3DA 4IBCA 1N33M 1F4IA 1SG9A 1GLNA 2C9CA 1TGUA 2FNAA 1NV9A 2R4EA 4NOOB 4DR1M 2L4EA 4DV1M 4GHLA 2LVQD 4LF8M 2L2DA 4GIPA 3IECA 3SMSA 2QPAA 3GO8A 1OAIA 4DUYM 2BJVA 3GLHA 4JV5M 4IBGA 2DHYA 1VEGA 1DGGA 1QQWA 4FW9A 4KODA 3GLHB 1WHCA 5EP1A 1R2YA 3ZC7B 3HHXA 1GL7A 4Z6YA 3C9PA 3PNYA 3ZH9B 4LGMA 1W5TA 4M0DA 5EP2A 4LF7M 1E94E 5JI2E 1IN4A 1DGBA 3HHYA 2LHGA 3KOZE 4L6V6 4I4LA 5IZ7D 4JI5M 4LJ5A 3I4YA 1DGFA 2DI0A 1WGLA 3KFUG 1NNUC 3QWLA 3LVWA 3T1YM 3GQ5A 5KPTA 4DV5M 2C96A 4HLQA 3FRHA 2QENA 1I94M 1NHGC 5KO3A 5F3WA 4JI3M 1MU5A 4WP2A 4DBGB 2A5YB 1GABA 3Q8XA 4IBJA 4M0WA 4GRIA 2QP9X 4BB9A 4OU7A 1VEJA 1AIPC 2DZOB 4B3TM 1MX0A 4LJ9A 1Z5CA 1DO0A 1I4WA 2CHVA 2LBCA 4QNRA 3NWLA 3AJIB 4GEWA 2KZUA 5FTLA 3DZDA 1WR1B 2EUCA 2EJSA 3NBIA 2J7OA 3L25A 1OKSA 2ERCA 4REZA 3W0FA 3SBJA 2X4AA 4B7GA 3A45A 1JR3A 2WSEF 4B3MM 2O01F 3JAMS 3TE6A 1GJSA 2KRUA 4AG6A 1XMOM 2YNMD 1OIPA 4CJ6A 4XGIA 3SC3A 1EIJA 1HNZM 1EFUB 2ZAMA 5EXPA 2UUAM 2WSCF 1Q39A 1ZMWA 2HKJA 1XNQM 1WGNA 1DO2A 2LVOC 3LQRA 3RFWA 1G71A 3E4RA 4GMQA 2FOIC 4NRWA 2RKOA 3B7NA 3PNVA 4GC5A 4DV4M 2MH8A 3FE3A 3J2PB 2EA0A 4DR7M 3KXEC 4HEOA 2F5PA 1YE9A 3AL0C 1GL6A 2DWLA 4EIWA 1SXJD 2MJ5B 4Z8XA 4JI4M 4F2LA 2UXCM 5KQDA 4RKUF 4AZFA 3U6CA 2JZ1A 3B89A 3J80S 3GP1A 3VK8A 1OAOC 1Z59A 1P3QQ 4PT5A 4QHTA 3JR4A 3SAUA 1R2ZA 2I7PA 4QOZC 3AFHA 3K1JA 4LFAM 1IM2A 2XF3A 2XGNA 1V34A 2DNAA 2JXNA 3F92A 5ITRA 3JR5A 2XFSA 5BPVA 3K2LA 5C18A 2L7IA 1TH3A 2RGOA 4LY6A 2BNKA 2MR9A 4LZZA 1T3TA 3R9XB 3ZQJA 2DAMA 4GH9A 4DV0M 2JA2A 1ZMVA 3UK6A 5IT9S 1Q3BA 2R62A 4NL4H 2CP8A 3PVSA 1ZMUA 3L28A 2YR0A 2F5SA 5LMNM 1IXSA 1HT1E 4G4RA 1IXSB 3M6AA 3THGA 2G8LA 3U6DA 1EE8A 1OIZA 1TR8A 4IBEA 2OPFA 2XZUA 1Z6TA 1QAOA 4LF4M 2CV1A 4L78A 3AOGA 1CUKA 1NJFA 1FNNA 4P17A 2X49A 4KT0F 2EKFA 5L8RF 1G59A 1PJTA 4X62M 3M0EA 1K3WA 4L8RC 5EP4A 1IN7A 3SATA 1NY5A 3GRRA 2W82A 4IBDA 3KDSE 2XSZD 4GC9A 1OFHA 3HU1A 2JZ0A 4XK8F 3T38A 5FLXS 2XSZA 2CWBA 3RGPA 1XC8A 1TDHA 5ITYA 4AW4A 2WSFF 3GLFE 5FSWA 4FWDA 3C58A 4DV3M 3B7QA 2J5YA 1DGHA 3UGJA 4G4QA 4AQYM 1DGHB 2R18A 1C1KA 2R44A 4JI1M 4LF9M 4AKHA 1S3SA 5KPZA 1LTMA 1IN6A 2CHGA 4GKJM 2ZM6M 4NSOB 4G3OA 1WIVA 4DR4M 1PJQA 3K9PA 1HR0M 3KOYE 3KSJA 3FYDA 3UZUA 4M9XA 1XB2B 1OJLA 1N75A 4CGYB 2LTUA 2JUJA 1G4AE 3QAUA 4CIZA 1HT2E 1IFYA 3HKPA 1IQPA 3HGIA 2KDLA 4KLNA 4NSRA 1XMQM 1L8QA 2WZJA 3DA1A 4LJ8A 3GQ3A 3DFZA 1XHBA 1N78A 3D8BA 1MN3A 5ITXE 3CF2A 3TPZA 5IWAM 4TUWA 2JY6B 2KHHA 2ZTCA 3AOEA 2CUZA 3A42A 4I81A 4LJ7A 4MB7A 4R7GA 3TL4X 4B3RM 2UXBM 2L09A 4B08A 2ZTDA 1WJ7A 2Q2EB 2OOBA 4ZPXA 2L4FA 2FE8A 2C99A 3UMMA 2N35A 4NRVA 5ITUA 1QYRA 2K47A 3ILKA 2F5NA 3AKZA 1GVNA 4I8OA 5EXTA 4IBBA 2DVWB 4NXMM 1PJSA 1R5LA 2EKKA 3QYEA 1PGYA 2DWNA 4K0KM 5DYIA 2DHRA 1QVRA 3QYBA 1IXZA 3U60A 4DR6M 1QZMA 3U60B 2R0IA 1IBLM 1HJPA 3K92A 2OOAA 1L2CA 1VG5A 3HU2A 4FVMA 3CF0A 1D0KA 2LH0A 3FD9A 3I01M 1A5TA 3HX3A 3C3DA 4IJEA 3FKEA 2F4VM 2H5XA 3Q8GA 4FCVA 3SHFA 4MGHA 1L2DA 1QDTA 1V33A 3GQ4A 3PFIA 2FS1A 2KNVA 3HZJA 4JI6M 1UM8A 3KS4A 2HWJA 3J7BA 1G3IA 4YHHM 1HQCA 3GRUA 4DUZM 2X8AA 4AI6A 3TWKA 2LVAA 2HAKA 2FH0A 2AHMA 3SAVA 2Y0TA 3FUXA 1YSYA 1L1TA 3GLIE 1DV0A 2DAEA 1L2BA 1X37A 3SYLA 1WXQA 4MGKE 4RNAA 4KO8A 2UXDM 2YQZA 1N36M 1Q3CA 3SMPA 2QZ4A 2BWEA 2ZAOA 2KW0A 1R4GA 3IHPA 3B74A 2DAGA 4WURA 4JI2M
chains in the Genus database with same CATH topology
2FS1A 2MH8A 1TF0B 1GJTA 2LHGA 2LHCA 2N35A 2KDLA 1GABA 2JWSA 1PRBA 2VDBB 2J5YA 1GJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS1 A;  2MH8 A;  1TF0 B;  1GJT A;  2LHG A;  2LHC A;  2N35 A;  2KDL A;  1GAB A;  2JWS A;  1PRB A;  2VDB B;  2J5Y A;  1GJS A; 
#chains in the Genus database with same CATH topology
 1VEK A;  1OTR A;  5FTN A;  3K8Z A;  1HNW M;  1SXJ A;  4FWH A;  2DWM A;  2UUB M;  5A2Q S;  1SXJ B;  1UFZ A;  2XFT A;  4BLC A;  2Y21 A;  4LFB M;  2LWX A;  3BXW A;  4LG2 A;  2Y0Q A;  3I51 A;  2CHQ A;  3I4V A;  4X64 M;  4D80 A;  3SYK A;  5C1B A;  4JYA M;  2QHO B;  4XBO A;  1J7K A;  1VQ1 A;  1C7Y A;  2BJW A;  3HWS A;  2D7E A;  3LMM A;  2OO9 A;  2VQE M;  1NY6 A;  4DR5 M;  2D7H A;  2ZAN A;  4P16 A;  4DR3 M;  3C3E A;  3KW6 A;  4IBK A;  1PJJ A;  2VII A;  1ZV1 A;  1QAN A;  1V92 A;  2MRO B;  4DV2 M;  4B3S M;  1PJI A;  1TF0 B;  4RF1 A;  2DXI A;  2KZS A;  4PDG A;  3U6M A;  4LCB A;  1N34 M;  4A3V B;  3A98 B;  3KOW E;  4PD2 A;  1D2N A;  2L7H A;  3L26 A;  4D81 A;  1D0L A;  1RU3 A;  2JY7 A;  2QCU A;  4FCW A;  2CFO A;  1XNR M;  4L16 A;  4RF0 A;  5KPR A;  5BR8 M;  4NC6 A;  4MH0 E;  5ITX A;  3EIH A;  4B7H A;  3FUT A;  3U61 A;  3WHL A;  3T6P A;  3GPP A;  4IJF A;  3GLG E;  5EJC A;  1OFI A;  4OVZ B;  3U61 B;  1GKI A;  2NQ8 C;  5ITQ A;  1JQJ C;  5GKN A;  3E21 A;  4QHS A;  2KEB A;  2H1R A;  1AUA A;  3HJQ A;  2HCB A;  1J5E M;  1K82 A;  4WW0 A;  1HNX M;  1YUB A;  4D82 A;  1G8P A;  3HJS A;  3SAS A;  1IY1 A;  3E9S A;  1IXR C;  2DKL A;  5FTM A;  3K9O A;  1LV7 A;  1Q02 A;  1TTE A;  3VK7 A;  2R45 A;  3FUV A;  4IBF A;  2LHC A;  2J7N A;  3SFZ A;  3A46 A;  3I04 M;  3U6O A;  3VKG A;  5EXS A;  3KOX E;  1D0M A;  2K0B X;  3KVW A;  4LRS A;  4IBI A;  3SHG B;  2VQF M;  4II7 A;  3AOE C;  2JWS A;  3TWL A;  2D7G A;  3L27 A;  4YY3 M;  2R6F A;  3KP1 E;  3EIE A;  1MJG M;  1T43 A;  1KFV A;  2GQF A;  4JI7 M;  1IY2 A;  1YLA A;  3KP0 E;  4FWG A;  3VFD A;  3U6L A;  2UUC M;  2VF8 A;  3DOA A;  3GPU A;  3W67 A;  2K6B A;  1QAQ A;  1TH2 A;  2O25 A;  2DAI A;  2Z4R A;  3ZCB B;  4PDI A;  1Y8G A;  5DNY A;  4HL4 A;  1XXH E;  4MGY E;  1ZAE A;  3J7A S;  4GIT A;  5ITT A;  4FCT A;  4LF6 M;  2DZN B;  3U6E A;  4M9Z A;  4PCZ A;  2JY5 A;  4LF5 M;  4LFC M;  1ZQ9 A;  5EQT A;  2UU9 M;  3FTF A;  4AG5 A;  2VF7 A;  1KSF X;  4AKG A;  3HHW A;  3FTC A;  4F1I A;  3B9P A;  4KHP M;  4GHA A;  3GLI A;  3J27 B;  2RGH A;  3FUW A;  4ITQ A;  3T15 A;  4DV6 M;  2CEA A;  3GLI B;  4CHT B;  3GPY A;  2HHH M;  3T1H M;  1PRB A;  2M5Z A;  2CV2 A;  2LVP C;  2C5R A;  1HQY E;  3L29 A;  3MJ5 A;  2KRK A;  1GO5 A;  2BWB A;  4LZJ A;  1J09 A;  4LGY A;  3FTE A;  4LRT A;  3VDP A;  2DWZ B;  1NVM A;  3LCU A;  2KA6 B;  2CRU A;  5E6J A;  2R4J A;  3NBX X;  4AKI A;  2V1U A;  3MK6 A;  2DAK A;  1NV8 A;  3KS8 A;  2MGW A;  3U6S A;  4M9S A;  1BVS A;  2K9D A;  3U6P A;  2Y20 A;  3HY5 A;  3OTO M;  4JI0 M;  3LCV B;  2QNJ A;  3TQS A;  3WHK A;  3FRI A;  2OQ4 A;  4MGI E;  5LMU M;  4OX9 M;  3GLH E;  3MHV C;  3H4J A;  2LXE A;  1K3X A;  4G4N A;  3IG8 A;  3GRY A;  2DZL A;  4G6Z A;  4X66 M;  4DV7 M;  3VDU A;  1N77 A;  1W5S A;  2G3Q A;  1IN8 A;  2R65 A;  2RRU A;  3RGS A;  1SXJ C;  1R6B X;  3J81 S;  1TDZ A;  1VDL A;  1NHW C;  5EXX A;  1FJG M;  1G41 A;  2FFJ A;  1JR3 D;  1T6O A;  3E46 A;  1OQY A;  2QSF X;  3CGW A;  2F5Q A;  1XWI A;  2ZBK B;  1E32 A;  4JN6 A;  4JXJ A;  2C98 A;  4OW0 A;  4QOS A;  2V1C A;  5FTJ A;  3V76 A;  4QNM A;  4BBA A;  1QUT A;  1R7R A;  2L6O A;  3BBZ A;  5KQ8 A;  1TH4 A;  1ORY B;  4L15 A;  4MM3 B;  5FTK A;  2JY8 A;  4FD2 A;  1QDR A;  4MGZ E;  3LW5 F;  5DFL A;  4Q7J A;  2M60 A;  1NSF A;  1N32 M;  4LJ6 A;  2B3T A;  3LVV A;  1IY0 A;  3W0L B;  4B7F A;  5JI3 E;  3D8L A;  3MMP A;  3VKH A;  4LJA A;  1IBK M;  3GLG A;  1E9S A;  3FYC A;  3VLF B;  4Y28 F;  3GLG B;  3CTW B;  3U6Q A;  5E26 A;  3GLF A;  1GJT A;  3GLF B;  2HL7 A;  4W5W A;  3L2A A;  4ANR A;  3PXG A;  1NNJ A;  3IG5 A;  2O5R A;  3W68 A;  2QBY A;  4NXN M;  2F5O A;  3AV0 A;  2QBY B;  2LVN C;  3R8F A;  3KSX A;  4R71 A;  1JR3 E;  2JNH A;  3B7Z A;  3U5Z A;  2APL A;  1KYI A;  5EP3 A;  3BOS A;  2XEP A;  4IIW A;  3U5Z B;  2E5L M;  1H6U A;  4DR2 M;  2Z4S A;  5H37 D;  4UN2 B;  4X65 M;  2C9O A;  3HJ8 A;  4LJ4 A;  2I7N A;  3UJN A;  2XLJ A;  3CF6 E;  3LQQ A;  3GPX A;  3FTD A;  4G4O A;  4JI8 M;  3SAW A;  2XH9 A;  1QZE A;  2DEN A;  2XZF A;  2EO2 A;  1PM5 A;  2GNO A;  4I5S A;  4OVZ A;  7CAT A;  2P5T A;  2VDB B;  4CIS A;  4GKK M;  1Z5A A;  3HU3 A;  3HHZ A;  1IN5 A;  2CE7 A;  1XXH A;  1E9R A;  2LNH C;  2R46 A;  3H4M A;  4S12 A;  3FUU A;  8CAT A;  1XXH B;  2Z3X A;  3TWM A;  1VDD A;  1JB0 F;  3M7G A;  1SXJ E;  1L1Z A;  5DYG A;  2G5G X;  1QAM A;  2V6Z M;  2KNA A;  3RE8 A;  5IRE B;  2QQ8 A;  2YFQ A;  1IBM M;  3GRV A;  2JP7 A;  1NJG A;  1Z5B A;  1QUS A;  2KNZ A;  2KXE A;  2Z8Y M;  2Z7J A;  3SAR A;  2CV0 A;  1NO1 A;  4L4U A;  4R3D A;  4IBC A;  1N33 M;  1F4I A;  1SG9 A;  1GLN A;  2C9C A;  1TGU A;  2FNA A;  1NV9 A;  2R4E A;  4NOO B;  4DR1 M;  2L4E A;  4DV1 M;  4GHL A;  2LVQ D;  4LF8 M;  2L2D A;  4GIP A;  3IEC A;  3SMS A;  2QPA A;  3GO8 A;  1OAI A;  4DUY M;  2BJV A;  3GLH A;  4JV5 M;  4IBG A;  2DHY A;  1VEG A;  1DGG A;  1QQW A;  4FW9 A;  4KOD A;  3GLH B;  1WHC A;  5EP1 A;  1R2Y A;  3ZC7 B;  3HHX A;  1GL7 A;  4Z6Y A;  3C9P A;  3PNY A;  3ZH9 B;  4LGM A;  1W5T A;  4M0D A;  5EP2 A;  4LF7 M;  1E94 E;  5JI2 E;  1IN4 A;  1DGB A;  3HHY A;  2LHG A;  3KOZ E;  4L6V 6;  4I4L A;  5IZ7 D;  4JI5 M;  4LJ5 A;  3I4Y A;  1DGF A;  2DI0 A;  1WGL A;  3KFU G;  1NNU C;  3QWL A;  3LVW A;  3T1Y M;  3GQ5 A;  5KPT A;  4DV5 M;  2C96 A;  4HLQ A;  3FRH A;  2QEN A;  1I94 M;  1NHG C;  5KO3 A;  5F3W A;  4JI3 M;  1MU5 A;  4WP2 A;  4DBG B;  2A5Y B;  1GAB A;  3Q8X A;  4IBJ A;  4M0W A;  4GRI A;  2QP9 X;  4BB9 A;  4OU7 A;  1VEJ A;  1AIP C;  2DZO B;  4B3T M;  1MX0 A;  4LJ9 A;  1Z5C A;  1DO0 A;  1I4W A;  2CHV A;  2LBC A;  4QNR A;  3NWL A;  3AJI B;  4GEW A;  2KZU A;  5FTL A;  3DZD A;  1WR1 B;  2EUC A;  2EJS A;  3NBI A;  2J7O A;  3L25 A;  1OKS A;  2ERC A;  4REZ A;  3W0F A;  3SBJ A;  2X4A A;  4B7G A;  3A45 A;  1JR3 A;  2WSE F;  4B3M M;  2O01 F;  3JAM S;  3TE6 A;  1GJS A;  2KRU A;  4AG6 A;  1XMO M;  2YNM D;  1OIP A;  4CJ6 A;  4XGI A;  3SC3 A;  1EIJ A;  1HNZ M;  1EFU B;  2ZAM A;  5EXP A;  2UUA M;  2WSC F;  1Q39 A;  1ZMW A;  2HKJ A;  1XNQ M;  1WGN A;  1DO2 A;  2LVO C;  3LQR A;  3RFW A;  1G71 A;  3E4R A;  4GMQ A;  2FOI C;  4NRW A;  2RKO A;  3B7N A;  3PNV A;  4GC5 A;  4DV4 M;  2MH8 A;  3FE3 A;  3J2P B;  2EA0 A;  4DR7 M;  3KXE C;  4HEO A;  2F5P A;  1YE9 A;  3AL0 C;  1GL6 A;  2DWL A;  4EIW A;  1SXJ D;  2MJ5 B;  4Z8X A;  4JI4 M;  4F2L A;  2UXC M;  5KQD A;  4RKU F;  4AZF A;  3U6C A;  2JZ1 A;  3B89 A;  3J80 S;  3GP1 A;  3VK8 A;  1OAO C;  1Z59 A;  1P3Q Q;  4PT5 A;  4QHT A;  3JR4 A;  3SAU A;  1R2Z A;  2I7P A;  4QOZ C;  3AFH A;  3K1J A;  4LFA M;  1IM2 A;  2XF3 A;  2XGN A;  1V34 A;  2DNA A;  2JXN A;  3F92 A;  5ITR A;  3JR5 A;  2XFS A;  5BPV A;  3K2L A;  5C18 A;  2L7I A;  1TH3 A;  2RGO A;  4LY6 A;  2BNK A;  2MR9 A;  4LZZ A;  1T3T A;  3R9X B;  3ZQJ A;  2DAM A;  4GH9 A;  4DV0 M;  2JA2 A;  1ZMV A;  3UK6 A;  5IT9 S;  1Q3B A;  2R62 A;  4NL4 H;  2CP8 A;  3PVS A;  1ZMU A;  3L28 A;  2YR0 A;  2F5S A;  5LMN M;  1IXS A;  1HT1 E;  4G4R A;  1IXS B;  3M6A A;  3THG A;  2G8L A;  3U6D A;  1EE8 A;  1OIZ A;  1TR8 A;  4IBE A;  2OPF A;  2XZU A;  1Z6T A;  1QAO A;  4LF4 M;  2CV1 A;  4L78 A;  3AOG A;  1CUK A;  1NJF A;  1FNN A;  4P17 A;  2X49 A;  4KT0 F;  2EKF A;  5L8R F;  1G59 A;  1PJT A;  4X62 M;  3M0E A;  1K3W A;  4L8R C;  5EP4 A;  1IN7 A;  3SAT A;  1NY5 A;  3GRR A;  2W82 A;  4IBD A;  3KDS E;  2XSZ D;  4GC9 A;  1OFH A;  3HU1 A;  2JZ0 A;  4XK8 F;  3T38 A;  5FLX S;  2XSZ A;  2CWB A;  3RGP A;  1XC8 A;  1TDH A;  5ITY A;  4AW4 A;  2WSF F;  3GLF E;  5FSW A;  4FWD A;  3C58 A;  4DV3 M;  3B7Q A;  2J5Y A;  1DGH A;  3UGJ A;  4G4Q A;  4AQY M;  1DGH B;  2R18 A;  1C1K A;  2R44 A;  4JI1 M;  4LF9 M;  4AKH A;  1S3S A;  5KPZ A;  1LTM A;  1IN6 A;  2CHG A;  4GKJ M;  2ZM6 M;  4NSO B;  4G3O A;  1WIV A;  4DR4 M;  1PJQ A;  3K9P A;  1HR0 M;  3KOY E;  3KSJ A;  3FYD A;  3UZU A;  4M9X A;  1XB2 B;  1OJL A;  1N75 A;  4CGY B;  2LTU A;  2JUJ A;  1G4A E;  3QAU A;  4CIZ A;  1HT2 E;  1IFY A;  3HKP A;  1IQP A;  3HGI A;  2KDL A;  4KLN A;  4NSR A;  1XMQ M;  1L8Q A;  2WZJ A;  3DA1 A;  4LJ8 A;  3GQ3 A;  3DFZ A;  1XHB A;  1N78 A;  3D8B A;  1MN3 A;  5ITX E;  3CF2 A;  3TPZ A;  5IWA M;  4TUW A;  2JY6 B;  2KHH A;  2ZTC A;  3AOE A;  2CUZ A;  3A42 A;  4I81 A;  4LJ7 A;  4MB7 A;  4R7G A;  3TL4 X;  4B3R M;  2UXB M;  2L09 A;  4B08 A;  2ZTD A;  1WJ7 A;  2Q2E B;  2OOB A;  4ZPX A;  2L4F A;  2FE8 A;  2C99 A;  3UMM A;  2N35 A;  4NRV A;  5ITU A;  1QYR A;  2K47 A;  3ILK A;  2F5N A;  3AKZ A;  1GVN A;  4I8O A;  5EXT A;  4IBB A;  2DVW B;  4NXM M;  1PJS A;  1R5L A;  2EKK A;  3QYE A;  1PGY A;  2DWN A;  4K0K M;  5DYI A;  2DHR A;  1QVR A;  3QYB A;  1IXZ A;  3U60 A;  4DR6 M;  1QZM A;  3U60 B;  2R0I A;  1IBL M;  1HJP A;  3K92 A;  2OOA A;  1L2C A;  1VG5 A;  3HU2 A;  4FVM A;  3CF0 A;  1D0K A;  2LH0 A;  3FD9 A;  3I01 M;  1A5T A;  3HX3 A;  3C3D A;  4IJE A;  3FKE A;  2F4V M;  2H5X A;  3Q8G A;  4FCV A;  3SHF A;  4MGH A;  1L2D A;  1QDT A;  1V33 A;  3GQ4 A;  3PFI A;  2FS1 A;  2KNV A;  3HZJ A;  4JI6 M;  1UM8 A;  3KS4 A;  2HWJ A;  3J7B A;  1G3I A;  4YHH M;  1HQC A;  3GRU A;  4DUZ M;  2X8A A;  4AI6 A;  3TWK A;  2LVA A;  2HAK A;  2FH0 A;  2AHM A;  3SAV A;  2Y0T A;  3FUX A;  1YSY A;  1L1T A;  3GLI E;  1DV0 A;  2DAE A;  1L2B A;  1X37 A;  3SYL A;  1WXQ A;  4MGK E;  4RNA A;  4KO8 A;  2UXD M;  2YQZ A;  1N36 M;  1Q3C A;  3SMP A;  2QZ4 A;  2BWE A;  2ZAO A;  2KW0 A;  1R4G A;  3IHP A;  3B74 A;  2DAG A;  4WUR A;  4JI2 M; 
#chains in the Genus database with same CATH homology
 2FS1 A;  2MH8 A;  1TF0 B;  1GJT A;  2LHG A;  2LHC A;  2N35 A;  2KDL A;  1GAB A;  2JWS A;  1PRB A;  2VDB B;  2J5Y A;  1GJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...