1GJTA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin-binding protein
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjtA00
2LHCA 2VDBB 2FS1A 2KDLA 1PRBA 2LHGA 1GJSA 2JWSA 2J5YA 2MH8A 1TF0B 1GJTA 2N35A 1GABA
chains in the Genus database with same CATH superfamily
3GLGB 3LQRA 1W5TA 4IBCA 4PT5A 3KSXA 3GRRA 4LJ5A 2J7OA 1NY6A 2Z8YM 4M9ZA 1J7KA 1S3SA 2R18A 3KOXE 3B7NA 3IG5A 4Z8XA 1QUSA 2R65A 1SXJE 1Z5CA 1Q39A 4MH0E 4YHHM 4PD2A 3PVSA 3GLFA 2HKJA 4AZFA 4LF4M 3L25A 2Y0TA 1QDRA 1EFUB 1YSYA 4FWDA 3SATA 2XZFA 1L8QA 4F1IA 1IN4A 1VEJA 2L6OA 4IBGA 4OVZA 3U6SA 5L8RF 3L2AA 1KFVA 3D8LA 3I51A 2VQFM 5EP3A 2KA6B 1JR3A 2L09A 3GPPA 2CHVA 1WGNA 2KDLA 3BBZA 3FUXA 1DO0A 1OAOC 3B9PA 3ZQJA 1XXHA 5FTLA 2HL7A 3U6LA 4DR4M 2KRKA 2I7NA 3FYDA 1QZMA 2C99A 1IM2A 2HWJA 1XWIA 2LTUA 3B74A 4RNAA 5KO3A 3T15A 3A98B 3AOEC 2V6ZM 1TH2A 1IFYA 2O5RA 3HGIA 1R2YA 4LRTA 2KNVA 3TQSA 1T3TA 4LJ4A 4JYAM 4IBFA 2DZLA 3VK8A 4D80A 3QYBA 1E32A 4JI0M 2YR0A 3M0EA 2O25A 2HHHM 3K8ZA 2K0BX 1SXJD 4DV7M 2QBYA 3LVWA 3FE3A 1Q3BA 4FVMA 2CP8A 3GPXA 1TR8A 4D81A 3Q8GA 4B3SM 3U6DA 3KW6A 1GO5A 2V1CA 4DR5M 4QNMA 4DR6M 4KLNA 2DI0A 1AUAA 2DHRA 1IY0A 5DYIA 3GQ5A 1GKIA 4LFAM 2D7GA 4NL4H 4MM3B 4B7FA 2HCBA 2UXBM 5A2QS 3K9OA 1V34A 4QNRA 3AJIB 3E46A 3SFZA 5JI3E 4X62M 2L7HA 2UUAM 3AKZA 1XNRM 2H5XA 2Y0QA 3VKHA 2VQEM 4JI2M 4RF0A 3PXGA 3J80S 1K3WA 3V76A 2OOAA 4L16A 4AW4A 3SASA 1OFHA 2R0IA 2XSZA 3B89A 3SAVA 2XEPA 3J7BA 3GQ4A 3HU2A 3LW5F 2MR9A 4NXNM 4K0KM 5C1BA 4LJ6A 1OJLA 2VDBB 2L4EA 3GLHE 2DVWB 7CATA 5IT9S 1IBLM 1PGYA 1OFIA 3JR5A 2I7PA 1XC8A 2CFOA 2QZ4A 2CWBA 5EP4A 3RGSA 1J5EM 2RGHA 1DGBA 1DGFA 1LV7A 1P3QQ 1ZQ9A 3FYCA 3W0LB 3GLFB 1YE9A 3C9PA 2EA0A 2UUBM 3M6AA 3HHYA 3HHZA 2ERCA 5ITYA 3A45A 4X65M 1Y8GA 2JP7A 2L7IA 4LCBA 2GNOA 3DFZA 4JI1M 2NQ8C 4LF9M 1DV0A 2ZTCA 3B7ZA 2OPFA 1X37A 3T1HM 5EXPA 4JI3M 4UN2B 5EQTA 5FLXS 2WSEF 2LVAA 4DV5M 3SYKA 3U6PA 2EO2A 1N33M 3UZUA 4DV0M 1Q02A 1WXQA 1XXHB 2DAEA 4NC6A 3KS8A 1TF0B 4JI7M 2JA2A 4L15A 1QAOA 3GRUA 2DWMA 4P17A 1GJSA 3AV0A 1K3XA 2Y20A 2N35A 4M0DA 4LJAA 1NY5A 2K47A 3RGPA 2FH0A 1E9SA 2YQZA 4R71A 3U6MA 3R9XB 3SAWA 3K92A 3MHVC 4DBGB 2MROB 2G8LA 3LCUA 4G6ZA 3NBXX 4W5WA 3VK7A 3D8BA 2OOBA 4X66M 2MGWA 1IXZA 4DUZM 1NNJA 2QBYB 3L27A 3QAUA 1GABA 2BNKA 3NBIA 4CISA 4FCVA 2G5GX 4LF6M 4LG2A 3TWMA 3SYLA 4F2LA 1FJGM 1A5TA 5ITXE 3GLIB 1NV8A 5KQDA 1NVMA 2EJSA 3KXEC 3THGA 4GKJM 2DWZB 4DV2M 3WHKA 4PDIA 5F3WA 3CF2A 2R45A 3U61A 1ZAEA 2LVPC 4MGKE 4IJFA 2XGNA 1VQ1A 1HNXM 1PJSA 1WHCA 4D82A 3FTCA 1TGUA 3IHPA 4IJEA 2LVNC 4DR2M 1H6UA 4LY6A 4AG5A 1DGHB 2KRUA 1EIJA 2DAKA 4LJ7A 3UJNA 2X8AA 1WR1B 4REZA 3W0FA 1JQJC 4NSOB 1ZMUA 3T6PA 4LFBM 4I81A 2CE7A 4DV4M 4IBIA 5FTMA 4LJ8A 4NSRA 1OIZA 3MMPA 2G3QA 5KPZA 3KVWA 4GEWA 2XFTA 4XGIA 1TTEA 3JAMS 1IN8A 2XH9A 5IWAM 3HHWA 4LGMA 2VIIA 4JXJA 2CHGA 4AKHA 3PNVA 5ITQA 1HQCA 1ZV1A 5EXXA 3WHLA 1QYRA 2CV0A 2JY5A 1KSFX 2P5TA 3FTDA 3HU1A 2LHCA 1MU5A 4B3TM 4LF5M 3EIHA 5FTNA 3VDPA 3GLGE 1L1TA 1Z5BA 2DXIA 2BWEA 2X4AA 3QWLA 4ZPXA 2WSFF 4BB9A 1DGGA 1Z5AA 5C18A 2DZOB 3HKPA 4GRIA 2ZM6M 1XB2B 4DR1M 4PCZA 3ZC7B 3GLIA 1OQYA 4GKKM 4CGYB 4B3RM 2OO9A 2KEBA 1OTRA 1WIVA 1TDZA 2F5SA 1NHWC 1NO1A 1QAQA 1BVSA 4TUWA 2QHOB 1C7YA 3U60A 2QQ8A 3DA1A 4ITQA 1DGHA 1JR3D 1N75A 2DNAA 2FFJA 1G4AE 2Z4SA 2QCUA 2JWSA 2Z7JA 3CGWA 3LMMA 2XZUA 2CV2A 3PFIA 4AG6A 5H37D 2R46A 1OKSA 3FRIA 3W68A 2MJ5B 1UFZA 3GPUA 8CATA 4DV1M 5FTJA 3ILKA 3F92A 5KPTA 2CV1A 3FUWA 4CJ6A 1Q3CA 2R4EA 1TH4A 5FTKA 2QPAA 3Q8XA 1HR0M 4DR3M 4RKUF 3TPZA 3HJQA 2H1RA 2BWBA 3VLFB 2FNAA 2DWLA 1XHBA 2JZ0A 3JR4A 2LHGA 1PJTA 2FOIC 3A42A 1IBMM 2YNMD 2V1UA 2JY7A 3CF0A 2DHYA 2LXEA 3T38A 4RF1A 4LF8M 3KP0E 1V33A 3U61B 4NXMM 2F5NA 3ZH9B 1L2CA 1OIPA 1GJTA 3ZCBB 4LFCM 1VEKA 4P16A 4XK8F 1EE8A 2FS1A 2KHHA 2WSCF 2KXEA 4FWGA 3E4RA 2AHMA 2M60A 3I4VA 3L29A 3HWSA 2HAKA 3HU3A 2WZJA 3L28A 2VF8A 3IG8A 3GLHA 4LZZA 4M9SA 2EUCA 1D0LA 4IBDA 4B7HA 1HQYE 3OTOM 3GQ3A 2KZSA 1N77A 1LTMA 1VEGA 4CHTB 3AL0C 1SXJB 2XF3A 1MX0A 1MJGM 1JB0F 1PJQA 3KDSE 2KNZA 1G8PA 3E21A 2J7NA 2JNHA 2CEAA 4FCWA 3VKGA 2XSZD 2UXCM 1R5LA 1NJGA 4PDGA 4JI5M 1HNWM 1CUKA 4KHPM 1HT2E 1QQWA 2XFSA 3FUTA 1D0MA 3I01M 3BOSA 4KODA 3VDUA 1PJIA 4JI8M 4L8RC 2R62A 3FRHA 4IBEA 2ZAMA 1D0KA 1QUTA 3KOWE 4HEOA 4M0WA 4Z6YA 1IXRC 3IECA 4LRSA 3J27B 3K1JA 2QP9X 3PNYA 1SG9A 3GRVA 1IN6A 2Y21A 3C58A 1T43A 5DFLA 1G59A 2F5PA 4GHAA 2JXNA 1YLAA 5EXSA 2JY8A 3HZJA 4KO8A 1E94E 2B3TA 1I94M 4L6V6 1QAMA 3M7GA 2ZBKB 4MB7A 4G3OA 4NRVA 2RKOA 3HX3A 3K2LA 3GLFE 4JI6M 3CTWB 3R8FA 3KOZE 3GRYA 4DUYM 4I5SA 4DV3M 1VDLA 1J09A 2UUCM 1GVNA 5E26A 4IBBA 3U60B 2OQ4A 2MH8A 2YFQA 4G4RA 1Z6TA 4QOZC 4AKGA 4KT0F 4GHLA 3K9PA 1G3IA 3T1YM 1NV9A 1N78A 1F4IA 2DWNA 1JR3E 1IN5A 1TH3A 4FWHA 5IREB 2R4JA 5ITXA 1XXHE 1SXJA 2O01F 2C9CA 5LMUM 3AFHA 1K82A 3AOEA 5BPVA 4Y28F 4B3MM 3MJ5A 3LCVB 1D2NA 3QYEA 1XMOM 3LQQA 2W82A 1ZMVA 2D7EA 4DR7M 3RE8A 1G71A 1MN3A 1WGLA 2CRUA 4IBJA 2DAIA 3E9SA 1L2DA 5KPRA 1G41A 1N34M 1IQPA 4MGZE 3SARA 3KFUG 2X49A 3FKEA 3NWLA 3CF6E 4QHTA 2DAGA 2C98A 2DKLA 4LF7M 4GIPA 2F4VM 3HJ8A 2UU9M 3UGJA 4OW0A 1R7RA 4LGYA 3FTEA 1HT1E 5ITUA 2XLJA 1L2BA 4FD2A 3FUVA 1V92A 3GLIE 5JI2E 3H4JA 2UXDM 1SXJC 2R44A 4MGIE 3UK6A 1QDTA 5KQ8A 3GLHB 1HJPA 2L4FA 3A46A 2LVQD 5EXTA 1PJJA 2A5YB 4L78A 1PRBA 4LZJA 4X64M 1C1KA 5EP1A 5ITRA 3I4YA 3TWKA 5E6JA 4FCTA 3GLGA 4NRWA 1QZEA 2GQFA 2JZ1A 1NNUC 1RU3A 3HHXA 3H4MA 3VFDA 4WURA 3J81S 2C9OA 2LH0A 3SBJA 2K6BA 3SC3A 4CIZA 2BJVA 1Z59A 4JV5M 4AKIA 4OX9M 1IBKM 2KW0A 3KS4A 1GL7A 1ORYB 1YUBA 3FD9A 4I4LA 4HL4A 4M9XA 1R4GA 3EIEA 4NOOB 3U6QA 3U5ZB 1N36M 4WW0A 2VF7A 3AOGA 2JY6B 4L4UA 4II7A 4S12A 2CHQA 3KOYE 4WP2A 2R6FA 4MGYE 4LJ9A 3SHFA 3HY5A 2CUZA 3GP1A 4R7GA 3J2PB 2LWXA 2E5LM 3HJSA 2ZANA 1QANA 2RGOA 4ANRA 2C5RA 1IXSB 4IIWA 1XNQM 4B7GA 1AIPC 3DOAA 4A3VB 2D7HA 2BJWA 4FW9A 1OAIA 5EJCA 5ITTA 1R2ZA 5GKNA 3C3DA 1IY2A 1GL6A 3C3EA 3MK6A 4BLCA 2RRUA 2DAMA 3J7AS 1TDHA 2LNHC 2C96A 3TWLA 1NJFA 2KZUA 4XBOA 4EIWA 1R6BX 3GO8A 4GC5A 4MGHA 2Z3XA 5LMNM 1QVRA 5DYGA 3U6OA 1NSFA 3U6CA 2M5ZA 1E9RA 1T6OA 1WJ7A 2KNAA 4BBAA 3SAUA 2FE8A 2ZAOA 3SMPA 1DO2A 2DZNB 4QHSA 4DV6M 1PM5A 2Q2EB 2QSFX 2K9DA 2LBCA 4R3DA 4I8OA 2J5YA 1IY1A 3KSJA 2F5QA 2EKFA 3L26A 4OVZB 4G4OA 1ZMWA 3SMSA 3B7QA 3RFWA 3I04M 5EP2A 3SHGB 2L2DA 3FUUA 3KP1E 2LVOC 4GITA 4OU7A 4Q7JA 3U5ZA 3U6EA 2DENA 3TL4X 2ZTDA 4GH9A 3UMMA 1I4WA 2EKKA 4B08A 4G4NA 4JN6A 3DZDA 3W67A 4HLQA 4QOSA 5IZ7D 2APLA 1N32M 1XMQM 1NHGC 4AI6A 1IN7A 3LVVA 4IBKA 4G4QA 4JI4M 4YY3M 2Z4RA 3TE6A 2JUJA 1L1ZA 1HNZM 3FTFA 5FSWA 3BXWA 1W5SA 1VDDA 1IXSA 2QENA 1KYIA 1GLNA 1FNNA 4GC9A 4GMQA 3GPYA 2F5OA 5DNYA 5BR8M 1UM8A 1VG5A 2QNJA 4AQYM
chains in the Genus database with same CATH topology
2LHCA 2VDBB 2FS1A 2KDLA 1PRBA 2LHGA 1GJSA 2JWSA 2J5YA 2MH8A 1TF0B 1GJTA 2N35A 1GABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHC A;  2VDB B;  2FS1 A;  2KDL A;  1PRB A;  2LHG A;  1GJS A;  2JWS A;  2J5Y A;  2MH8 A;  1TF0 B;  1GJT A;  2N35 A;  1GAB A; 
#chains in the Genus database with same CATH topology
 3GLG B;  3LQR A;  1W5T A;  4IBC A;  4PT5 A;  3KSX A;  3GRR A;  4LJ5 A;  2J7O A;  1NY6 A;  2Z8Y M;  4M9Z A;  1J7K A;  1S3S A;  2R18 A;  3KOX E;  3B7N A;  3IG5 A;  4Z8X A;  1QUS A;  2R65 A;  1SXJ E;  1Z5C A;  1Q39 A;  4MH0 E;  4YHH M;  4PD2 A;  3PVS A;  3GLF A;  2HKJ A;  4AZF A;  4LF4 M;  3L25 A;  2Y0T A;  1QDR A;  1EFU B;  1YSY A;  4FWD A;  3SAT A;  2XZF A;  1L8Q A;  4F1I A;  1IN4 A;  1VEJ A;  2L6O A;  4IBG A;  4OVZ A;  3U6S A;  5L8R F;  3L2A A;  1KFV A;  3D8L A;  3I51 A;  2VQF M;  5EP3 A;  2KA6 B;  1JR3 A;  2L09 A;  3GPP A;  2CHV A;  1WGN A;  2KDL A;  3BBZ A;  3FUX A;  1DO0 A;  1OAO C;  3B9P A;  3ZQJ A;  1XXH A;  5FTL A;  2HL7 A;  3U6L A;  4DR4 M;  2KRK A;  2I7N A;  3FYD A;  1QZM A;  2C99 A;  1IM2 A;  2HWJ A;  1XWI A;  2LTU A;  3B74 A;  4RNA A;  5KO3 A;  3T15 A;  3A98 B;  3AOE C;  2V6Z M;  1TH2 A;  1IFY A;  2O5R A;  3HGI A;  1R2Y A;  4LRT A;  2KNV A;  3TQS A;  1T3T A;  4LJ4 A;  4JYA M;  4IBF A;  2DZL A;  3VK8 A;  4D80 A;  3QYB A;  1E32 A;  4JI0 M;  2YR0 A;  3M0E A;  2O25 A;  2HHH M;  3K8Z A;  2K0B X;  1SXJ D;  4DV7 M;  2QBY A;  3LVW A;  3FE3 A;  1Q3B A;  4FVM A;  2CP8 A;  3GPX A;  1TR8 A;  4D81 A;  3Q8G A;  4B3S M;  3U6D A;  3KW6 A;  1GO5 A;  2V1C A;  4DR5 M;  4QNM A;  4DR6 M;  4KLN A;  2DI0 A;  1AUA A;  2DHR A;  1IY0 A;  5DYI A;  3GQ5 A;  1GKI A;  4LFA M;  2D7G A;  4NL4 H;  4MM3 B;  4B7F A;  2HCB A;  2UXB M;  5A2Q S;  3K9O A;  1V34 A;  4QNR A;  3AJI B;  3E46 A;  3SFZ A;  5JI3 E;  4X62 M;  2L7H A;  2UUA M;  3AKZ A;  1XNR M;  2H5X A;  2Y0Q A;  3VKH A;  2VQE M;  4JI2 M;  4RF0 A;  3PXG A;  3J80 S;  1K3W A;  3V76 A;  2OOA A;  4L16 A;  4AW4 A;  3SAS A;  1OFH A;  2R0I A;  2XSZ A;  3B89 A;  3SAV A;  2XEP A;  3J7B A;  3GQ4 A;  3HU2 A;  3LW5 F;  2MR9 A;  4NXN M;  4K0K M;  5C1B A;  4LJ6 A;  1OJL A;  2VDB B;  2L4E A;  3GLH E;  2DVW B;  7CAT A;  5IT9 S;  1IBL M;  1PGY A;  1OFI A;  3JR5 A;  2I7P A;  1XC8 A;  2CFO A;  2QZ4 A;  2CWB A;  5EP4 A;  3RGS A;  1J5E M;  2RGH A;  1DGB A;  1DGF A;  1LV7 A;  1P3Q Q;  1ZQ9 A;  3FYC A;  3W0L B;  3GLF B;  1YE9 A;  3C9P A;  2EA0 A;  2UUB M;  3M6A A;  3HHY A;  3HHZ A;  2ERC A;  5ITY A;  3A45 A;  4X65 M;  1Y8G A;  2JP7 A;  2L7I A;  4LCB A;  2GNO A;  3DFZ A;  4JI1 M;  2NQ8 C;  4LF9 M;  1DV0 A;  2ZTC A;  3B7Z A;  2OPF A;  1X37 A;  3T1H M;  5EXP A;  4JI3 M;  4UN2 B;  5EQT A;  5FLX S;  2WSE F;  2LVA A;  4DV5 M;  3SYK A;  3U6P A;  2EO2 A;  1N33 M;  3UZU A;  4DV0 M;  1Q02 A;  1WXQ A;  1XXH B;  2DAE A;  4NC6 A;  3KS8 A;  1TF0 B;  4JI7 M;  2JA2 A;  4L15 A;  1QAO A;  3GRU A;  2DWM A;  4P17 A;  1GJS A;  3AV0 A;  1K3X A;  2Y20 A;  2N35 A;  4M0D A;  4LJA A;  1NY5 A;  2K47 A;  3RGP A;  2FH0 A;  1E9S A;  2YQZ A;  4R71 A;  3U6M A;  3R9X B;  3SAW A;  3K92 A;  3MHV C;  4DBG B;  2MRO B;  2G8L A;  3LCU A;  4G6Z A;  3NBX X;  4W5W A;  3VK7 A;  3D8B A;  2OOB A;  4X66 M;  2MGW A;  1IXZ A;  4DUZ M;  1NNJ A;  2QBY B;  3L27 A;  3QAU A;  1GAB A;  2BNK A;  3NBI A;  4CIS A;  4FCV A;  2G5G X;  4LF6 M;  4LG2 A;  3TWM A;  3SYL A;  4F2L A;  1FJG M;  1A5T A;  5ITX E;  3GLI B;  1NV8 A;  5KQD A;  1NVM A;  2EJS A;  3KXE C;  3THG A;  4GKJ M;  2DWZ B;  4DV2 M;  3WHK A;  4PDI A;  5F3W A;  3CF2 A;  2R45 A;  3U61 A;  1ZAE A;  2LVP C;  4MGK E;  4IJF A;  2XGN A;  1VQ1 A;  1HNX M;  1PJS A;  1WHC A;  4D82 A;  3FTC A;  1TGU A;  3IHP A;  4IJE A;  2LVN C;  4DR2 M;  1H6U A;  4LY6 A;  4AG5 A;  1DGH B;  2KRU A;  1EIJ A;  2DAK A;  4LJ7 A;  3UJN A;  2X8A A;  1WR1 B;  4REZ A;  3W0F A;  1JQJ C;  4NSO B;  1ZMU A;  3T6P A;  4LFB M;  4I81 A;  2CE7 A;  4DV4 M;  4IBI A;  5FTM A;  4LJ8 A;  4NSR A;  1OIZ A;  3MMP A;  2G3Q A;  5KPZ A;  3KVW A;  4GEW A;  2XFT A;  4XGI A;  1TTE A;  3JAM S;  1IN8 A;  2XH9 A;  5IWA M;  3HHW A;  4LGM A;  2VII A;  4JXJ A;  2CHG A;  4AKH A;  3PNV A;  5ITQ A;  1HQC A;  1ZV1 A;  5EXX A;  3WHL A;  1QYR A;  2CV0 A;  2JY5 A;  1KSF X;  2P5T A;  3FTD A;  3HU1 A;  2LHC A;  1MU5 A;  4B3T M;  4LF5 M;  3EIH A;  5FTN A;  3VDP A;  3GLG E;  1L1T A;  1Z5B A;  2DXI A;  2BWE A;  2X4A A;  3QWL A;  4ZPX A;  2WSF F;  4BB9 A;  1DGG A;  1Z5A A;  5C18 A;  2DZO B;  3HKP A;  4GRI A;  2ZM6 M;  1XB2 B;  4DR1 M;  4PCZ A;  3ZC7 B;  3GLI A;  1OQY A;  4GKK M;  4CGY B;  4B3R M;  2OO9 A;  2KEB A;  1OTR A;  1WIV A;  1TDZ A;  2F5S A;  1NHW C;  1NO1 A;  1QAQ A;  1BVS A;  4TUW A;  2QHO B;  1C7Y A;  3U60 A;  2QQ8 A;  3DA1 A;  4ITQ A;  1DGH A;  1JR3 D;  1N75 A;  2DNA A;  2FFJ A;  1G4A E;  2Z4S A;  2QCU A;  2JWS A;  2Z7J A;  3CGW A;  3LMM A;  2XZU A;  2CV2 A;  3PFI A;  4AG6 A;  5H37 D;  2R46 A;  1OKS A;  3FRI A;  3W68 A;  2MJ5 B;  1UFZ A;  3GPU A;  8CAT A;  4DV1 M;  5FTJ A;  3ILK A;  3F92 A;  5KPT A;  2CV1 A;  3FUW A;  4CJ6 A;  1Q3C A;  2R4E A;  1TH4 A;  5FTK A;  2QPA A;  3Q8X A;  1HR0 M;  4DR3 M;  4RKU F;  3TPZ A;  3HJQ A;  2H1R A;  2BWB A;  3VLF B;  2FNA A;  2DWL A;  1XHB A;  2JZ0 A;  3JR4 A;  2LHG A;  1PJT A;  2FOI C;  3A42 A;  1IBM M;  2YNM D;  2V1U A;  2JY7 A;  3CF0 A;  2DHY A;  2LXE A;  3T38 A;  4RF1 A;  4LF8 M;  3KP0 E;  1V33 A;  3U61 B;  4NXM M;  2F5N A;  3ZH9 B;  1L2C A;  1OIP A;  1GJT A;  3ZCB B;  4LFC M;  1VEK A;  4P16 A;  4XK8 F;  1EE8 A;  2FS1 A;  2KHH A;  2WSC F;  2KXE A;  4FWG A;  3E4R A;  2AHM A;  2M60 A;  3I4V A;  3L29 A;  3HWS A;  2HAK A;  3HU3 A;  2WZJ A;  3L28 A;  2VF8 A;  3IG8 A;  3GLH A;  4LZZ A;  4M9S A;  2EUC A;  1D0L A;  4IBD A;  4B7H A;  1HQY E;  3OTO M;  3GQ3 A;  2KZS A;  1N77 A;  1LTM A;  1VEG A;  4CHT B;  3AL0 C;  1SXJ B;  2XF3 A;  1MX0 A;  1MJG M;  1JB0 F;  1PJQ A;  3KDS E;  2KNZ A;  1G8P A;  3E21 A;  2J7N A;  2JNH A;  2CEA A;  4FCW A;  3VKG A;  2XSZ D;  2UXC M;  1R5L A;  1NJG A;  4PDG A;  4JI5 M;  1HNW M;  1CUK A;  4KHP M;  1HT2 E;  1QQW A;  2XFS A;  3FUT A;  1D0M A;  3I01 M;  3BOS A;  4KOD A;  3VDU A;  1PJI A;  4JI8 M;  4L8R C;  2R62 A;  3FRH A;  4IBE A;  2ZAM A;  1D0K A;  1QUT A;  3KOW E;  4HEO A;  4M0W A;  4Z6Y A;  1IXR C;  3IEC A;  4LRS A;  3J27 B;  3K1J A;  2QP9 X;  3PNY A;  1SG9 A;  3GRV A;  1IN6 A;  2Y21 A;  3C58 A;  1T43 A;  5DFL A;  1G59 A;  2F5P A;  4GHA A;  2JXN A;  1YLA A;  5EXS A;  2JY8 A;  3HZJ A;  4KO8 A;  1E94 E;  2B3T A;  1I94 M;  4L6V 6;  1QAM A;  3M7G A;  2ZBK B;  4MB7 A;  4G3O A;  4NRV A;  2RKO A;  3HX3 A;  3K2L A;  3GLF E;  4JI6 M;  3CTW B;  3R8F A;  3KOZ E;  3GRY A;  4DUY M;  4I5S A;  4DV3 M;  1VDL A;  1J09 A;  2UUC M;  1GVN A;  5E26 A;  4IBB A;  3U60 B;  2OQ4 A;  2MH8 A;  2YFQ A;  4G4R A;  1Z6T A;  4QOZ C;  4AKG A;  4KT0 F;  4GHL A;  3K9P A;  1G3I A;  3T1Y M;  1NV9 A;  1N78 A;  1F4I A;  2DWN A;  1JR3 E;  1IN5 A;  1TH3 A;  4FWH A;  5IRE B;  2R4J A;  5ITX A;  1XXH E;  1SXJ A;  2O01 F;  2C9C A;  5LMU M;  3AFH A;  1K82 A;  3AOE A;  5BPV A;  4Y28 F;  4B3M M;  3MJ5 A;  3LCV B;  1D2N A;  3QYE A;  1XMO M;  3LQQ A;  2W82 A;  1ZMV A;  2D7E A;  4DR7 M;  3RE8 A;  1G71 A;  1MN3 A;  1WGL A;  2CRU A;  4IBJ A;  2DAI A;  3E9S A;  1L2D A;  5KPR A;  1G41 A;  1N34 M;  1IQP A;  4MGZ E;  3SAR A;  3KFU G;  2X49 A;  3FKE A;  3NWL A;  3CF6 E;  4QHT A;  2DAG A;  2C98 A;  2DKL A;  4LF7 M;  4GIP A;  2F4V M;  3HJ8 A;  2UU9 M;  3UGJ A;  4OW0 A;  1R7R A;  4LGY A;  3FTE A;  1HT1 E;  5ITU A;  2XLJ A;  1L2B A;  4FD2 A;  3FUV A;  1V92 A;  3GLI E;  5JI2 E;  3H4J A;  2UXD M;  1SXJ C;  2R44 A;  4MGI E;  3UK6 A;  1QDT A;  5KQ8 A;  3GLH B;  1HJP A;  2L4F A;  3A46 A;  2LVQ D;  5EXT A;  1PJJ A;  2A5Y B;  4L78 A;  1PRB A;  4LZJ A;  4X64 M;  1C1K A;  5EP1 A;  5ITR A;  3I4Y A;  3TWK A;  5E6J A;  4FCT A;  3GLG A;  4NRW A;  1QZE A;  2GQF A;  2JZ1 A;  1NNU C;  1RU3 A;  3HHX A;  3H4M A;  3VFD A;  4WUR A;  3J81 S;  2C9O A;  2LH0 A;  3SBJ A;  2K6B A;  3SC3 A;  4CIZ A;  2BJV A;  1Z59 A;  4JV5 M;  4AKI A;  4OX9 M;  1IBK M;  2KW0 A;  3KS4 A;  1GL7 A;  1ORY B;  1YUB A;  3FD9 A;  4I4L A;  4HL4 A;  4M9X A;  1R4G A;  3EIE A;  4NOO B;  3U6Q A;  3U5Z B;  1N36 M;  4WW0 A;  2VF7 A;  3AOG A;  2JY6 B;  4L4U A;  4II7 A;  4S12 A;  2CHQ A;  3KOY E;  4WP2 A;  2R6F A;  4MGY E;  4LJ9 A;  3SHF A;  3HY5 A;  2CUZ A;  3GP1 A;  4R7G A;  3J2P B;  2LWX A;  2E5L M;  3HJS A;  2ZAN A;  1QAN A;  2RGO A;  4ANR A;  2C5R A;  1IXS B;  4IIW A;  1XNQ M;  4B7G A;  1AIP C;  3DOA A;  4A3V B;  2D7H A;  2BJW A;  4FW9 A;  1OAI A;  5EJC A;  5ITT A;  1R2Z A;  5GKN A;  3C3D A;  1IY2 A;  1GL6 A;  3C3E A;  3MK6 A;  4BLC A;  2RRU A;  2DAM A;  3J7A S;  1TDH A;  2LNH C;  2C96 A;  3TWL A;  1NJF A;  2KZU A;  4XBO A;  4EIW A;  1R6B X;  3GO8 A;  4GC5 A;  4MGH A;  2Z3X A;  5LMN M;  1QVR A;  5DYG A;  3U6O A;  1NSF A;  3U6C A;  2M5Z A;  1E9R A;  1T6O A;  1WJ7 A;  2KNA A;  4BBA A;  3SAU A;  2FE8 A;  2ZAO A;  3SMP A;  1DO2 A;  2DZN B;  4QHS A;  4DV6 M;  1PM5 A;  2Q2E B;  2QSF X;  2K9D A;  2LBC A;  4R3D A;  4I8O A;  2J5Y A;  1IY1 A;  3KSJ A;  2F5Q A;  2EKF A;  3L26 A;  4OVZ B;  4G4O A;  1ZMW A;  3SMS A;  3B7Q A;  3RFW A;  3I04 M;  5EP2 A;  3SHG B;  2L2D A;  3FUU A;  3KP1 E;  2LVO C;  4GIT A;  4OU7 A;  4Q7J A;  3U5Z A;  3U6E A;  2DEN A;  3TL4 X;  2ZTD A;  4GH9 A;  3UMM A;  1I4W A;  2EKK A;  4B08 A;  4G4N A;  4JN6 A;  3DZD A;  3W67 A;  4HLQ A;  4QOS A;  5IZ7 D;  2APL A;  1N32 M;  1XMQ M;  1NHG C;  4AI6 A;  1IN7 A;  3LVV A;  4IBK A;  4G4Q A;  4JI4 M;  4YY3 M;  2Z4R A;  3TE6 A;  2JUJ A;  1L1Z A;  1HNZ M;  3FTF A;  5FSW A;  3BXW A;  1W5S A;  1VDD A;  1IXS A;  2QEN A;  1KYI A;  1GLN A;  1FNN A;  4GC9 A;  4GMQ A;  3GPY A;  2F5O A;  5DNY A;  5BR8 M;  1UM8 A;  1VG5 A;  2QNJ A;  4AQY M; 
#chains in the Genus database with same CATH homology
 2LHC A;  2VDB B;  2FS1 A;  2KDL A;  1PRB A;  2LHG A;  1GJS A;  2JWS A;  2J5Y A;  2MH8 A;  1TF0 B;  1GJT A;  2N35 A;  1GAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...