2L4EA

Nmr structure of the uba domain of s. cerevisiae dcn1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4eA00
4Q7JA 1WGLA 1SG9A 1EFUB 1DO0A 1UFZA 4R71A 1OTRA 2OO9A 3GLHE 1Q02A 2H5XA 2DAMA 3FRIA 3BBZA 4F1IA 1V92A 2EKKA 1E94E 1OQYA 3K9PA 4GEWA 1VEJA 3LCVB 2DHYA 2JNHA 1G3IA 2BWBA 3K9OA 1KYIA 2MROB 1JR3E 2JY6B 2QSFX 2O25A 2LBCA 2DNAA 2CP8A 2L2DA 2LVAA 1IFYA 2WZJA 2DAGA 1TR8A 2OOAA 2LVNC 2L4EA 2RRUA 1C7YA 2JY5A 1HJPA 3H4JA 1IXSA 2LVOC 2ZTDA 2JP7A 1MN3A 1Y8GA 2MJ5B 1T43A 1HT1E 1ZV1A 2KHHA 3FE3A 4HEOA 3IHPA 1XB2B 1WHCA 3F92A 1WJ7A 1ZMVA 5DFLA 2DKLA 2LTUA 3E46A 1T6OA 2ZTCA 1G41A 2OOBA 2MGWA 1VQ1A 2CWBA 2K9DA 2DZLA 2JY7A 4DBGB 3GLIE 5JI2E 2LVQD 1GO5A 1WR1B 2DAKA 2R0IA 1TTEA 3FRHA 2EJSA 1P3QQ 2JZ0A 2JZ1A 1R4GA 2K0BX 3MMPA 1DO2A 1AIPC 2G3QA 2HWJA 2QNJA 1YLAA 2BWEA 1F4IA 4G3OA 4UN2B 1OAIA 1XXHE 2KNZA 1PGYA 3GLFE 3E21A 3B89A 2HAKA 2L4FA 3GLGE 3IECA 2MR9A 1ZMWA 1WIVA 3T6PA 2LVPC 1HT2E 4WP2A 1HQYE 2B3TA 2KNVA 1A5TA 1QZEA 1ZMUA 1WGNA 1VG5A 2DAEA 1BVSA 1G4AE 1OKSA 2QHOB 2JUJA 2EKFA 2DI0A 1NV8A 1IM2A 1DV0A 2DENA 2DAIA 4F2LA 1VEGA 3LCUA 1VEKA 2KNAA 1NV9A 1CUKA 2JY8A 1VDLA
chains in the Genus database with same CATH superfamily
4GIPA 1PM5A 3DFZA 1UFZA 3UJNA 1OAOC 1PJJA 4BLCA 2UXDM 3C3DA 3SHGB 1Q02A 1GLNA 4L8RC 3ZCBB 5F3WA 3CF6E 1HNWM 2KRUA 3WHLA 1K82A 3L26A 1L2DA 2XEPA 3NBIA 1E94E 3B74A 2VIIA 3Q8GA 3HHYA 3VDPA 4JI5M 1E9SA 5ITXE 1IXRC 1IXZA 1VEJA 5E26A 4XBOA 2R18A 2XSZD 1G3IA 2BWBA 3HZJA 4OU7A 3H4MA 2MROB 2RKOA 1ZQ9A 4FCVA 5C18A 3KVWA 2APLA 1NO1A 4L16A 1R2ZA 3SAUA 2LVAA 3U6EA 4AG5A 4I5SA 4LZZA 3FTDA 5IREB 1TR8A 2OOAA 4QNMA 4AQYM 2C5RA 1XNQM 2RRUA 3R9XB 1NNUC 1E32A 1V33A 1PRBA 3FTFA 4LRSA 5EXSA 2DWMA 4II7A 3L25A 4DR5M 3K92A 2ZTDA 2CE7A 2JP7A 3JAMS 3LQQA 3GQ5A 2CFOA 2R4JA 1NVMA 1QAQA 2YQZA 1OFIA 4DR2M 1SXJD 1Z5BA 2KHHA 4GC9A 3WHKA 2J7NA 5FTMA 3FD9A 3PNYA 4JI8M 1DGHB 3C3EA 2N35A 3DOAA 1XXHB 4AW4A 2M60A 3TE6A 3GPXA 3GPPA 3MK6A 3GLFB 3GPUA 1T6OA 4LGYA 1G41A 4JI4M 4NL4H 1S3SA 3B7ZA 1R2YA 4PDIA 3CGWA 3FUVA 2KRKA 3SAWA 1N32M 3SATA 5JI2E 1L2BA 1GVNA 2J5YA 1WR1B 1GL7A 1N78A 2DAKA 8CATA 1TTEA 3B9PA 2UUBM 3GRYA 3KS8A 2JZ0A 3I04M 2LXEA 4L78A 3EIHA 3KW6A 1R4GA 3SYLA 4NRVA 3HY5A 3C58A 4DUZM 3GLHA 4B7GA 4CJ6A 1DO2A 2LH0A 1YSYA 1YUBA 4JI2M 2Y20A 1PJQA 2QNJA 4LJ8A 1F4IA 4G3OA 2KW0A 2KNZA 4OVZB 3TWLA 1NJGA 4MB7A 4JV5M 2R6FA 4DV6M 4B3SM 2HAKA 2L4FA 2EA0A 1AUAA 3GLGE 3IECA 4AKGA 2F5OA 4D81A 1XC8A 3C9PA 2Z4SA 2MR9A 2W82A 3U6LA 3FUXA 4MGKE 2Z8YM 2CV1A 1PJTA 1QDRA 2L7IA 3ILKA 4REZA 1XNRM 4IBDA 4CISA 2DAEA 1GJSA 4JI1M 4PD2A 2EKFA 1LTMA 2BJVA 4JXJA 3HX3A 5LMUM 3VKHA 2CRUA 1WXQA 1EE8A 2C98A 4IBKA 1DV0A 4NRWA 1R5LA 2DAIA 4LF6M 4DR1M 3LCUA 4IBIA 4NSOB 5BR8M 3I51A 2K47A 3K2LA 1HQCA 1N33M 3MJ5A 2CHGA 3BXWA 3NWLA 3AL0C 5KPRA 2DVWB 2XSZA 2FE8A 4IJEA 1W5TA 3T1YM 1WGLA 5EXXA 5FTJA 2OPFA 2O01F 2DAMA 5FTNA 4Z6YA 4DR6M 2EUCA 4F1IA 1V92A 4IBGA 4AKIA 1OQYA 4A3VB 4IBEA 4GHAA 1N34M 3K9PA 4LJ7A 4DV4M 3VK7A 1UM8A 2VF8A 4PDGA 1JQJC 1OJLA 4LFAM 4G4QA 2XZUA 3FUTA 4LG2A 2D7GA 1JR3E 2QSFX 3GP1A 1K3WA 3KP1E 2DNAA 1NHWC 2XZFA 3KFUG 1IN4A 5GKNA 2R44A 1QYRA 3LW5F 3IG8A 3AKZA 3KOXE 4LF4M 3GRRA 2CHQA 3NBXX 1QANA 3AJIB 3Q8XA 2L4EA 4HL4A 1C7YA 4LJ4A 4NOOB 2JY5A 1HNXM 3J2PB 5EQTA 1IQPA 1D0LA 1IXSA 4WURA 2QPAA 5C1BA 2JXNA 4QHTA 1Y8GA 4S12A 2BJWA 4AZFA 4I4LA 2DXIA 4JI3M 2OQ4A 4LF5M 2D7HA 2MH8A 4NXNM 1ZV1A 4D80A 3VFDA 3FE3A 2DWZB 1J5EM 4W5WA 4QOZC 2KZSA 3F92A 1G59A 5EP2A 1TH2A 3TWKA 3L28A 3SMSA 3A98B 3QWLA 1IN6A 1IBMM 1IBKM 4KLNA 3V76A 3KSXA 2HCBA 3PNVA 1XWIA 4YY3M 2F5SA 1LV7A 1GO5A 1NJFA 3FRHA 2EJSA 3W0LB 2AHMA 3EIEA 2CV0A 2Y0TA 2Z7JA 4L6V6 3GQ3A 3D8BA 1N75A 2CUZA 4HLQA 4KT0F 3MMPA 2YFQA 3KXEC 1HR0M 1JB0F 5EXTA 2EO2A 2QP9X 4ITQA 4UN2B 5IZ7D 1XXHE 3TPZA 3ZH9B 4FCWA 1H6UA 3GLFE 3E21A 5ITXA 3GO8A 3KP0E 1D2NA 4NXMM 4YHHM 1NNJA 2Y21A 5EJCA 4G4OA 1QAOA 3LVWA 1IN5A 1WIVA 2KA6B 3GRUA 1J09A 4IBFA 3T6PA 3JR4A 1L2CA 3FTEA 3K8ZA 2ZM6M 3I4YA 1QUSA 1QAMA 3GLHB 3R8FA 5L8RF 2B3TA 5DNYA 4IBBA 1K3XA 3T1HM 2R4EA 3UMMA 1QZEA 1G4AE 4DV1M 2LHCA 1TF0B 1IN8A 5EXPA 3DA1A 3W0FA 4DV5M 1Q3CA 1N77A 4CHTB 2KXEA 3HHWA 5IWAM 2DWLA 5ITUA 4GITA 3J27B 2WSEF 4KHPM 4RF0A 1L1ZA 1D0KA 3FYDA 3PVSA 1NV9A 3ZC7B 2QZ4A 4LJ9A 4G4NA 2HHHM 1CUKA 2MGWA 4RKUF 2UU9M 4DBGB 4LF9M 3M6AA 3AOEC 4Q7JA 2C9CA 2QENA 5A2QS 3BOSA 1EFUB 4JI7M 3J7AS 2VQEM 4R71A 1NY5A 4X65M 5FLXS 1KSFX 3CF2A 4IBCA 2H5XA 2Y0QA 2D7EA 3FRIA 2UUAM 1YE9A 4RNAA 4AI6A 4NSRA 3HJSA 5JI3E 4GH9A 3JR5A 3U6MA 4LF7M 4BBAA 3K1JA 2DWNA 1NHGC 3J80S 1QZMA 4LFCM 2DHYA 5ITQA 2M5ZA 1GL6A 4PCZA 4GMQA 3HJ8A 3K9OA 1QUTA 1KYIA 4M0DA 3U61A 2JY6B 3FUUA 2O25A 4RF1A 2LBCA 3VK8A 3U6CA 2CP8A 4X66M 4D82A 2Q2EB 1Z6TA 2WZJA 2DAGA 4MGYE 2L6OA 2ZBKB 5IT9S 4OW0A 3FUWA 4LY6A 3RGSA 5ITYA 2XH9A 3MHVC 2X49A 3PFIA 3UGJA 3GLIB 4LRTA 1HJPA 3HU1A 3GLGA 4K0KM 4FD2A 3RFWA 5H37D 2LVOC 1IY0A 1I4WA 1R7RA 2FNAA 1MN3A 3UK6A 4DUYM 3D8LA 3L2AA 4LJ5A 4JI6M 1E9RA 3UZUA 3QYBA 1HT1E 3SYKA 1PJIA 4B3MM 1SXJE 3OTOM 3GLIA 4HEOA 2F5PA 1D0MA 1Z5AA 3IHPA 4G4RA 4B7FA 4LGMA 5KO3A 2RGHA 1ZMVA 1FJGM 4M9XA 4P16A 2DKLA 3E46A 3KSJA 1XHBA 3U6PA 2R65A 2R45A 4FWHA 1G71A 1IXSB 2VQFM 2WSCF 3RGPA 1VQ1A 3GQ4A 3KOYE 3HU3A 4MGZE 2UXBM 1X37A 4OX9M 2K9DA 1ZAEA 2JY7A 1R6BX 4DV7M 4Z8XA 3A42A 4CGYB 2R0IA 3KDSE 4QOSA 2G5GX 1EIJA 3RE8A 1P3QQ 4FCTA 2XF3A 2JZ1A 2XLJA 2UUCM 3HKPA 4KODA 1ORYB 4EIWA 3U6SA 5DYIA 2QBYB 2VDBB 4AKHA 3CTWB 2K0BX 3SARA 4B3RM 1NSFA 1TDHA 4R3DA 2HL7A 2ZANA 2DHRA 2G3QA 2HWJA 3TL4X 4B7HA 1YLAA 2BWEA 3QAUA 1PGYA 4MM3B 1TGUA 1Z59A 3B89A 2QBYA 4GHLA 4L4UA 2KDLA 3AFHA 3U5ZA 4B3TM 3E9SA 2P5TA 4QNRA 5FSWA 3AV0A 1ZMWA 3W68A 1JR3A 4FVMA 4IIWA 1HT2E 3AOGA 4X64M 3A46A 3SAVA 4WP2A 1HQYE 4ZPXA 1IN7A 2R46A 4GC5A 5FTLA 3A45A 1WGNA 1V34A 4MGHA 1BVSA 1OKSA 2QHOB 3AOEA 2JUJA 2FOIC 5LMNM 1MU5A 2NQ8C 2DI0A 1W5SA 5E6JA 4DR4M 1OIPA 1Q39A 2FS1A 2QQ8A 3FTCA 3T38A 1XMQM 3J81S 2JWSA 2YNMD 3VDUA 3DZDA 2KNAA 3L27A 3W67A 2X8AA 4B08A 1FNNA 4NC6A 1XMOM 1Q3BA 2KNVA 1VDLA 4IBJA 4JN6A 4GKJM 4LJ6A 1N36M 3KOZE 3TWMA 1SG9A 2VF7A 2YR0A 1DO0A 3QYEA 1OTRA 2OO9A 3GLHE 4MGIE 2I7NA 3BBZA 1GKIA 1HNZM 1J7KA 2A5YB 2EKKA 2J7OA 3B7QA 3THGA 3HHZA 4TUWA 1SXJC 4DV3M 2X4AA 3SMPA 2Z4RA 4GEWA 1I94M 3LCVB 1OFHA 3U6OA 2JNHA 3ZQJA 3CF0A 1G8PA 4QHSA 1TDZA 1JR3D 5EP4A 2F5QA 4M9ZA 5KPZA 3I4VA 2L2DA 4DR7M 4XGIA 1GABA 1IFYA 3U6QA 1DGHA 3L29A 2CHVA 1XXHA 2CEAA 4LF8M 2LVNC 3FYCA 1RU3A 3GLFA 1MX0A 4CIZA 3GPYA 1NY6A 4Y28F 2L09A 3H4JA 2H1RA 3SC3A 3LVVA 2KZUA 2WSFF 2MJ5B 1T43A 2XGNA 3U61B 5KPTA 3SBJA 5FTKA 4I8OA 4DR3M 2FFJA 5DYGA 3FKEA 1GJTA 2L7HA 4JI0M 4M9SA 2F5NA 1XB2B 1WHCA 4IJFA 4L15A 1WJ7A 1MJGM 2Z3XA 1OIZA 3VLFB 5DFLA 2E5LM 1DGFA 2RGOA 2LTUA 3GRVA 7CATA 5ITRA 3HHXA 3T15A 2ZTCA 4ANRA 3I01M 2OOBA 4M0WA 3LQRA 3GLGB 4LCBA 3M0EA 2O5RA 1Z5CA 2CWBA 4OVZA 2BNKA 4X62M 2DZLA 5KQ8A 3GLIE 3HGIA 1KFVA 2LVQD 2V1CA 3SASA 1IBLM 4KO8A 2C96A 2HKJA 4FW9A 2XFTA 4BB9A 2V1UA 1QDTA 3HWSA 1PJSA 4PT5A 2DZOB 2GQFA 2ZAOA 2R62A 1DGBA 3U6DA 4DV0M 3LMMA 2LNHC 4GKKM 3VKGA 1AIPC 1OAIA 1T3TA 2QCUA 2CV2A 2C9OA 2KEBA 3HJQA 4R7GA 1L1TA 3SFZA 4JYAM 4I81A 1IY1A 5EP1A 5KQDA 3SHFA 2V6ZM 3U60B 4LFBM 3B7NA 4AG6A 4WW0A 5ITTA 2LVPC 4MH0E 2LHGA 4FWDA 3KS4A 3J7BA 4P17A 2GNOA 2I7PA 2XFSA 2ZAMA 3U60A 2UXCM 1A5TA 4G6ZA 1TH4A 1ZMUA 2JA2A 1QVRA 1VG5A 1SXJB 3TQSA 2FH0A 4FWGA 4LZJA 4LJAA 5EP3A 3PXGA 3E4RA 4DV2M 3U5ZB 3KOWE 2C99A 2ERCA 1NV8A 1IY2A 1L8QA 1IM2A 2DENA 4F2LA 1VEGA 2G8LA 3IG5A 1SXJA 4GRIA 2F4VM 2K6BA 1TH3A 1VEKA 2LWXA 2DZNB 3HU2A 4XK8F 3M7GA 1QQWA 1VDDA 1C1KA 1DGGA 2JY8A 5BPVA
chains in the Genus database with same CATH topology
4Q7JA 1WGLA 1SG9A 1EFUB 1DO0A 1UFZA 4R71A 1OTRA 2OO9A 3GLHE 1Q02A 2H5XA 2DAMA 3FRIA 3BBZA 4F1IA 1V92A 2EKKA 1E94E 1OQYA 3K9PA 4GEWA 1VEJA 3LCVB 2DHYA 2JNHA 1G3IA 2BWBA 3K9OA 1KYIA 2MROB 1JR3E 2JY6B 2QSFX 2O25A 2LBCA 2DNAA 2CP8A 2L2DA 2LVAA 1IFYA 2WZJA 2DAGA 1TR8A 2OOAA 2LVNC 2L4EA 2RRUA 1C7YA 2JY5A 1HJPA 3H4JA 1IXSA 2LVOC 2ZTDA 2JP7A 1MN3A 1Y8GA 2MJ5B 1T43A 1HT1E 1ZV1A 2KHHA 3FE3A 4HEOA 3IHPA 1XB2B 1WHCA 3F92A 1WJ7A 1ZMVA 5DFLA 2DKLA 2LTUA 3E46A 1T6OA 2ZTCA 1G41A 2OOBA 2MGWA 1VQ1A 2CWBA 2K9DA 2DZLA 2JY7A 4DBGB 3GLIE 5JI2E 2LVQD 1GO5A 1WR1B 2DAKA 2R0IA 1TTEA 3FRHA 2EJSA 1P3QQ 2JZ0A 2JZ1A 1R4GA 2K0BX 3MMPA 1DO2A 1AIPC 2G3QA 2HWJA 2QNJA 1YLAA 2BWEA 1F4IA 4G3OA 4UN2B 1OAIA 1XXHE 2KNZA 1PGYA 3GLFE 3E21A 3B89A 2HAKA 2L4FA 3GLGE 3IECA 2MR9A 1ZMWA 1WIVA 3T6PA 2LVPC 1HT2E 4WP2A 1HQYE 2B3TA 2KNVA 1A5TA 1QZEA 1ZMUA 1WGNA 1VG5A 2DAEA 1BVSA 1G4AE 1OKSA 2QHOB 2JUJA 2EKFA 2DI0A 1NV8A 1IM2A 1DV0A 2DENA 2DAIA 4F2LA 1VEGA 3LCUA 1VEKA 2KNAA 1NV9A 1CUKA 2JY8A 1VDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q7J A;  1WGL A;  1SG9 A;  1EFU B;  1DO0 A;  1UFZ A;  4R71 A;  1OTR A;  2OO9 A;  3GLH E;  1Q02 A;  2H5X A;  2DAM A;  3FRI A;  3BBZ A;  4F1I A;  1V92 A;  2EKK A;  1E94 E;  1OQY A;  3K9P A;  4GEW A;  1VEJ A;  3LCV B;  2DHY A;  2JNH A;  1G3I A;  2BWB A;  3K9O A;  1KYI A;  2MRO B;  1JR3 E;  2JY6 B;  2QSF X;  2O25 A;  2LBC A;  2DNA A;  2CP8 A;  2L2D A;  2LVA A;  1IFY A;  2WZJ A;  2DAG A;  1TR8 A;  2OOA A;  2LVN C;  2L4E A;  2RRU A;  1C7Y A;  2JY5 A;  1HJP A;  3H4J A;  1IXS A;  2LVO C;  2ZTD A;  2JP7 A;  1MN3 A;  1Y8G A;  2MJ5 B;  1T43 A;  1HT1 E;  1ZV1 A;  2KHH A;  3FE3 A;  4HEO A;  3IHP A;  1XB2 B;  1WHC A;  3F92 A;  1WJ7 A;  1ZMV A;  5DFL A;  2DKL A;  2LTU A;  3E46 A;  1T6O A;  2ZTC A;  1G41 A;  2OOB A;  2MGW A;  1VQ1 A;  2CWB A;  2K9D A;  2DZL A;  2JY7 A;  4DBG B;  3GLI E;  5JI2 E;  2LVQ D;  1GO5 A;  1WR1 B;  2DAK A;  2R0I A;  1TTE A;  3FRH A;  2EJS A;  1P3Q Q;  2JZ0 A;  2JZ1 A;  1R4G A;  2K0B X;  3MMP A;  1DO2 A;  1AIP C;  2G3Q A;  2HWJ A;  2QNJ A;  1YLA A;  2BWE A;  1F4I A;  4G3O A;  4UN2 B;  1OAI A;  1XXH E;  2KNZ A;  1PGY A;  3GLF E;  3E21 A;  3B89 A;  2HAK A;  2L4F A;  3GLG E;  3IEC A;  2MR9 A;  1ZMW A;  1WIV A;  3T6P A;  2LVP C;  1HT2 E;  4WP2 A;  1HQY E;  2B3T A;  2KNV A;  1A5T A;  1QZE A;  1ZMU A;  1WGN A;  1VG5 A;  2DAE A;  1BVS A;  1G4A E;  1OKS A;  2QHO B;  2JUJ A;  2EKF A;  2DI0 A;  1NV8 A;  1IM2 A;  1DV0 A;  2DEN A;  2DAI A;  4F2L A;  1VEG A;  3LCU A;  1VEK A;  2KNA A;  1NV9 A;  1CUK A;  2JY8 A;  1VDL A; 
#chains in the Genus database with same CATH topology
 4GIP A;  1PM5 A;  3DFZ A;  1UFZ A;  3UJN A;  1OAO C;  1PJJ A;  4BLC A;  2UXD M;  3C3D A;  3SHG B;  1Q02 A;  1GLN A;  4L8R C;  3ZCB B;  5F3W A;  3CF6 E;  1HNW M;  2KRU A;  3WHL A;  1K82 A;  3L26 A;  1L2D A;  2XEP A;  3NBI A;  1E94 E;  3B74 A;  2VII A;  3Q8G A;  3HHY A;  3VDP A;  4JI5 M;  1E9S A;  5ITX E;  1IXR C;  1IXZ A;  1VEJ A;  5E26 A;  4XBO A;  2R18 A;  2XSZ D;  1G3I A;  2BWB A;  3HZJ A;  4OU7 A;  3H4M A;  2MRO B;  2RKO A;  1ZQ9 A;  4FCV A;  5C18 A;  3KVW A;  2APL A;  1NO1 A;  4L16 A;  1R2Z A;  3SAU A;  2LVA A;  3U6E A;  4AG5 A;  4I5S A;  4LZZ A;  3FTD A;  5IRE B;  1TR8 A;  2OOA A;  4QNM A;  4AQY M;  2C5R A;  1XNQ M;  2RRU A;  3R9X B;  1NNU C;  1E32 A;  1V33 A;  1PRB A;  3FTF A;  4LRS A;  5EXS A;  2DWM A;  4II7 A;  3L25 A;  4DR5 M;  3K92 A;  2ZTD A;  2CE7 A;  2JP7 A;  3JAM S;  3LQQ A;  3GQ5 A;  2CFO A;  2R4J A;  1NVM A;  1QAQ A;  2YQZ A;  1OFI A;  4DR2 M;  1SXJ D;  1Z5B A;  2KHH A;  4GC9 A;  3WHK A;  2J7N A;  5FTM A;  3FD9 A;  3PNY A;  4JI8 M;  1DGH B;  3C3E A;  2N35 A;  3DOA A;  1XXH B;  4AW4 A;  2M60 A;  3TE6 A;  3GPX A;  3GPP A;  3MK6 A;  3GLF B;  3GPU A;  1T6O A;  4LGY A;  1G41 A;  4JI4 M;  4NL4 H;  1S3S A;  3B7Z A;  1R2Y A;  4PDI A;  3CGW A;  3FUV A;  2KRK A;  3SAW A;  1N32 M;  3SAT A;  5JI2 E;  1L2B A;  1GVN A;  2J5Y A;  1WR1 B;  1GL7 A;  1N78 A;  2DAK A;  8CAT A;  1TTE A;  3B9P A;  2UUB M;  3GRY A;  3KS8 A;  2JZ0 A;  3I04 M;  2LXE A;  4L78 A;  3EIH A;  3KW6 A;  1R4G A;  3SYL A;  4NRV A;  3HY5 A;  3C58 A;  4DUZ M;  3GLH A;  4B7G A;  4CJ6 A;  1DO2 A;  2LH0 A;  1YSY A;  1YUB A;  4JI2 M;  2Y20 A;  1PJQ A;  2QNJ A;  4LJ8 A;  1F4I A;  4G3O A;  2KW0 A;  2KNZ A;  4OVZ B;  3TWL A;  1NJG A;  4MB7 A;  4JV5 M;  2R6F A;  4DV6 M;  4B3S M;  2HAK A;  2L4F A;  2EA0 A;  1AUA A;  3GLG E;  3IEC A;  4AKG A;  2F5O A;  4D81 A;  1XC8 A;  3C9P A;  2Z4S A;  2MR9 A;  2W82 A;  3U6L A;  3FUX A;  4MGK E;  2Z8Y M;  2CV1 A;  1PJT A;  1QDR A;  2L7I A;  3ILK A;  4REZ A;  1XNR M;  4IBD A;  4CIS A;  2DAE A;  1GJS A;  4JI1 M;  4PD2 A;  2EKF A;  1LTM A;  2BJV A;  4JXJ A;  3HX3 A;  5LMU M;  3VKH A;  2CRU A;  1WXQ A;  1EE8 A;  2C98 A;  4IBK A;  1DV0 A;  4NRW A;  1R5L A;  2DAI A;  4LF6 M;  4DR1 M;  3LCU A;  4IBI A;  4NSO B;  5BR8 M;  3I51 A;  2K47 A;  3K2L A;  1HQC A;  1N33 M;  3MJ5 A;  2CHG A;  3BXW A;  3NWL A;  3AL0 C;  5KPR A;  2DVW B;  2XSZ A;  2FE8 A;  4IJE A;  1W5T A;  3T1Y M;  1WGL A;  5EXX A;  5FTJ A;  2OPF A;  2O01 F;  2DAM A;  5FTN A;  4Z6Y A;  4DR6 M;  2EUC A;  4F1I A;  1V92 A;  4IBG A;  4AKI A;  1OQY A;  4A3V B;  4IBE A;  4GHA A;  1N34 M;  3K9P A;  4LJ7 A;  4DV4 M;  3VK7 A;  1UM8 A;  2VF8 A;  4PDG A;  1JQJ C;  1OJL A;  4LFA M;  4G4Q A;  2XZU A;  3FUT A;  4LG2 A;  2D7G A;  1JR3 E;  2QSF X;  3GP1 A;  1K3W A;  3KP1 E;  2DNA A;  1NHW C;  2XZF A;  3KFU G;  1IN4 A;  5GKN A;  2R44 A;  1QYR A;  3LW5 F;  3IG8 A;  3AKZ A;  3KOX E;  4LF4 M;  3GRR A;  2CHQ A;  3NBX X;  1QAN A;  3AJI B;  3Q8X A;  2L4E A;  4HL4 A;  1C7Y A;  4LJ4 A;  4NOO B;  2JY5 A;  1HNX M;  3J2P B;  5EQT A;  1IQP A;  1D0L A;  1IXS A;  4WUR A;  2QPA A;  5C1B A;  2JXN A;  4QHT A;  1Y8G A;  4S12 A;  2BJW A;  4AZF A;  4I4L A;  2DXI A;  4JI3 M;  2OQ4 A;  4LF5 M;  2D7H A;  2MH8 A;  4NXN M;  1ZV1 A;  4D80 A;  3VFD A;  3FE3 A;  2DWZ B;  1J5E M;  4W5W A;  4QOZ C;  2KZS A;  3F92 A;  1G59 A;  5EP2 A;  1TH2 A;  3TWK A;  3L28 A;  3SMS A;  3A98 B;  3QWL A;  1IN6 A;  1IBM M;  1IBK M;  4KLN A;  3V76 A;  3KSX A;  2HCB A;  3PNV A;  1XWI A;  4YY3 M;  2F5S A;  1LV7 A;  1GO5 A;  1NJF A;  3FRH A;  2EJS A;  3W0L B;  2AHM A;  3EIE A;  2CV0 A;  2Y0T A;  2Z7J A;  4L6V 6;  3GQ3 A;  3D8B A;  1N75 A;  2CUZ A;  4HLQ A;  4KT0 F;  3MMP A;  2YFQ A;  3KXE C;  1HR0 M;  1JB0 F;  5EXT A;  2EO2 A;  2QP9 X;  4ITQ A;  4UN2 B;  5IZ7 D;  1XXH E;  3TPZ A;  3ZH9 B;  4FCW A;  1H6U A;  3GLF E;  3E21 A;  5ITX A;  3GO8 A;  3KP0 E;  1D2N A;  4NXM M;  4YHH M;  1NNJ A;  2Y21 A;  5EJC A;  4G4O A;  1QAO A;  3LVW A;  1IN5 A;  1WIV A;  2KA6 B;  3GRU A;  1J09 A;  4IBF A;  3T6P A;  3JR4 A;  1L2C A;  3FTE A;  3K8Z A;  2ZM6 M;  3I4Y A;  1QUS A;  1QAM A;  3GLH B;  3R8F A;  5L8R F;  2B3T A;  5DNY A;  4IBB A;  1K3X A;  3T1H M;  2R4E A;  3UMM A;  1QZE A;  1G4A E;  4DV1 M;  2LHC A;  1TF0 B;  1IN8 A;  5EXP A;  3DA1 A;  3W0F A;  4DV5 M;  1Q3C A;  1N77 A;  4CHT B;  2KXE A;  3HHW A;  5IWA M;  2DWL A;  5ITU A;  4GIT A;  3J27 B;  2WSE F;  4KHP M;  4RF0 A;  1L1Z A;  1D0K A;  3FYD A;  3PVS A;  1NV9 A;  3ZC7 B;  2QZ4 A;  4LJ9 A;  4G4N A;  2HHH M;  1CUK A;  2MGW A;  4RKU F;  2UU9 M;  4DBG B;  4LF9 M;  3M6A A;  3AOE C;  4Q7J A;  2C9C A;  2QEN A;  5A2Q S;  3BOS A;  1EFU B;  4JI7 M;  3J7A S;  2VQE M;  4R71 A;  1NY5 A;  4X65 M;  5FLX S;  1KSF X;  3CF2 A;  4IBC A;  2H5X A;  2Y0Q A;  2D7E A;  3FRI A;  2UUA M;  1YE9 A;  4RNA A;  4AI6 A;  4NSR A;  3HJS A;  5JI3 E;  4GH9 A;  3JR5 A;  3U6M A;  4LF7 M;  4BBA A;  3K1J A;  2DWN A;  1NHG C;  3J80 S;  1QZM A;  4LFC M;  2DHY A;  5ITQ A;  2M5Z A;  1GL6 A;  4PCZ A;  4GMQ A;  3HJ8 A;  3K9O A;  1QUT A;  1KYI A;  4M0D A;  3U61 A;  2JY6 B;  3FUU A;  2O25 A;  4RF1 A;  2LBC A;  3VK8 A;  3U6C A;  2CP8 A;  4X66 M;  4D82 A;  2Q2E B;  1Z6T A;  2WZJ A;  2DAG A;  4MGY E;  2L6O A;  2ZBK B;  5IT9 S;  4OW0 A;  3FUW A;  4LY6 A;  3RGS A;  5ITY A;  2XH9 A;  3MHV C;  2X49 A;  3PFI A;  3UGJ A;  3GLI B;  4LRT A;  1HJP A;  3HU1 A;  3GLG A;  4K0K M;  4FD2 A;  3RFW A;  5H37 D;  2LVO C;  1IY0 A;  1I4W A;  1R7R A;  2FNA A;  1MN3 A;  3UK6 A;  4DUY M;  3D8L A;  3L2A A;  4LJ5 A;  4JI6 M;  1E9R A;  3UZU A;  3QYB A;  1HT1 E;  3SYK A;  1PJI A;  4B3M M;  1SXJ E;  3OTO M;  3GLI A;  4HEO A;  2F5P A;  1D0M A;  1Z5A A;  3IHP A;  4G4R A;  4B7F A;  4LGM A;  5KO3 A;  2RGH A;  1ZMV A;  1FJG M;  4M9X A;  4P16 A;  2DKL A;  3E46 A;  3KSJ A;  1XHB A;  3U6P A;  2R65 A;  2R45 A;  4FWH A;  1G71 A;  1IXS B;  2VQF M;  2WSC F;  3RGP A;  1VQ1 A;  3GQ4 A;  3KOY E;  3HU3 A;  4MGZ E;  2UXB M;  1X37 A;  4OX9 M;  2K9D A;  1ZAE A;  2JY7 A;  1R6B X;  4DV7 M;  4Z8X A;  3A42 A;  4CGY B;  2R0I A;  3KDS E;  4QOS A;  2G5G X;  1EIJ A;  3RE8 A;  1P3Q Q;  4FCT A;  2XF3 A;  2JZ1 A;  2XLJ A;  2UUC M;  3HKP A;  4KOD A;  1ORY B;  4EIW A;  3U6S A;  5DYI A;  2QBY B;  2VDB B;  4AKH A;  3CTW B;  2K0B X;  3SAR A;  4B3R M;  1NSF A;  1TDH A;  4R3D A;  2HL7 A;  2ZAN A;  2DHR A;  2G3Q A;  2HWJ A;  3TL4 X;  4B7H A;  1YLA A;  2BWE A;  3QAU A;  1PGY A;  4MM3 B;  1TGU A;  1Z59 A;  3B89 A;  2QBY A;  4GHL A;  4L4U A;  2KDL A;  3AFH A;  3U5Z A;  4B3T M;  3E9S A;  2P5T A;  4QNR A;  5FSW A;  3AV0 A;  1ZMW A;  3W68 A;  1JR3 A;  4FVM A;  4IIW A;  1HT2 E;  3AOG A;  4X64 M;  3A46 A;  3SAV A;  4WP2 A;  1HQY E;  4ZPX A;  1IN7 A;  2R46 A;  4GC5 A;  5FTL A;  3A45 A;  1WGN A;  1V34 A;  4MGH A;  1BVS A;  1OKS A;  2QHO B;  3AOE A;  2JUJ A;  2FOI C;  5LMN M;  1MU5 A;  2NQ8 C;  2DI0 A;  1W5S A;  5E6J A;  4DR4 M;  1OIP A;  1Q39 A;  2FS1 A;  2QQ8 A;  3FTC A;  3T38 A;  1XMQ M;  3J81 S;  2JWS A;  2YNM D;  3VDU A;  3DZD A;  2KNA A;  3L27 A;  3W67 A;  2X8A A;  4B08 A;  1FNN A;  4NC6 A;  1XMO M;  1Q3B A;  2KNV A;  1VDL A;  4IBJ A;  4JN6 A;  4GKJ M;  4LJ6 A;  1N36 M;  3KOZ E;  3TWM A;  1SG9 A;  2VF7 A;  2YR0 A;  1DO0 A;  3QYE A;  1OTR A;  2OO9 A;  3GLH E;  4MGI E;  2I7N A;  3BBZ A;  1GKI A;  1HNZ M;  1J7K A;  2A5Y B;  2EKK A;  2J7O A;  3B7Q A;  3THG A;  3HHZ A;  4TUW A;  1SXJ C;  4DV3 M;  2X4A A;  3SMP A;  2Z4R A;  4GEW A;  1I94 M;  3LCV B;  1OFH A;  3U6O A;  2JNH A;  3ZQJ A;  3CF0 A;  1G8P A;  4QHS A;  1TDZ A;  1JR3 D;  5EP4 A;  2F5Q A;  4M9Z A;  5KPZ A;  3I4V A;  2L2D A;  4DR7 M;  4XGI A;  1GAB A;  1IFY A;  3U6Q A;  1DGH A;  3L29 A;  2CHV A;  1XXH A;  2CEA A;  4LF8 M;  2LVN C;  3FYC A;  1RU3 A;  3GLF A;  1MX0 A;  4CIZ A;  3GPY A;  1NY6 A;  4Y28 F;  2L09 A;  3H4J A;  2H1R A;  3SC3 A;  3LVV A;  2KZU A;  2WSF F;  2MJ5 B;  1T43 A;  2XGN A;  3U61 B;  5KPT A;  3SBJ A;  5FTK A;  4I8O A;  4DR3 M;  2FFJ A;  5DYG A;  3FKE A;  1GJT A;  2L7H A;  4JI0 M;  4M9S A;  2F5N A;  1XB2 B;  1WHC A;  4IJF A;  4L15 A;  1WJ7 A;  1MJG M;  2Z3X A;  1OIZ A;  3VLF B;  5DFL A;  2E5L M;  1DGF A;  2RGO A;  2LTU A;  3GRV A;  7CAT A;  5ITR A;  3HHX A;  3T15 A;  2ZTC A;  4ANR A;  3I01 M;  2OOB A;  4M0W A;  3LQR A;  3GLG B;  4LCB A;  3M0E A;  2O5R A;  1Z5C A;  2CWB A;  4OVZ A;  2BNK A;  4X62 M;  2DZL A;  5KQ8 A;  3GLI E;  3HGI A;  1KFV A;  2LVQ D;  2V1C A;  3SAS A;  1IBL M;  4KO8 A;  2C96 A;  2HKJ A;  4FW9 A;  2XFT A;  4BB9 A;  2V1U A;  1QDT A;  3HWS A;  1PJS A;  4PT5 A;  2DZO B;  2GQF A;  2ZAO A;  2R62 A;  1DGB A;  3U6D A;  4DV0 M;  3LMM A;  2LNH C;  4GKK M;  3VKG A;  1AIP C;  1OAI A;  1T3T A;  2QCU A;  2CV2 A;  2C9O A;  2KEB A;  3HJQ A;  4R7G A;  1L1T A;  3SFZ A;  4JYA M;  4I81 A;  1IY1 A;  5EP1 A;  5KQD A;  3SHF A;  2V6Z M;  3U60 B;  4LFB M;  3B7N A;  4AG6 A;  4WW0 A;  5ITT A;  2LVP C;  4MH0 E;  2LHG A;  4FWD A;  3KS4 A;  3J7B A;  4P17 A;  2GNO A;  2I7P A;  2XFS A;  2ZAM A;  3U60 A;  2UXC M;  1A5T A;  4G6Z A;  1TH4 A;  1ZMU A;  2JA2 A;  1QVR A;  1VG5 A;  1SXJ B;  3TQS A;  2FH0 A;  4FWG A;  4LZJ A;  4LJA A;  5EP3 A;  3PXG A;  3E4R A;  4DV2 M;  3U5Z B;  3KOW E;  2C99 A;  2ERC A;  1NV8 A;  1IY2 A;  1L8Q A;  1IM2 A;  2DEN A;  4F2L A;  1VEG A;  2G8L A;  3IG5 A;  1SXJ A;  4GRI A;  2F4V M;  2K6B A;  1TH3 A;  1VEK A;  2LWX A;  2DZN B;  3HU2 A;  4XK8 F;  3M7G A;  1QQW A;  1VDD A;  1C1K A;  1DGG A;  2JY8 A;  5BPV A; 
#chains in the Genus database with same CATH homology
 4Q7J A;  1WGL A;  1SG9 A;  1EFU B;  1DO0 A;  1UFZ A;  4R71 A;  1OTR A;  2OO9 A;  3GLH E;  1Q02 A;  2H5X A;  2DAM A;  3FRI A;  3BBZ A;  4F1I A;  1V92 A;  2EKK A;  1E94 E;  1OQY A;  3K9P A;  4GEW A;  1VEJ A;  3LCV B;  2DHY A;  2JNH A;  1G3I A;  2BWB A;  3K9O A;  1KYI A;  2MRO B;  1JR3 E;  2JY6 B;  2QSF X;  2O25 A;  2LBC A;  2DNA A;  2CP8 A;  2L2D A;  2LVA A;  1IFY A;  2WZJ A;  2DAG A;  1TR8 A;  2OOA A;  2LVN C;  2L4E A;  2RRU A;  1C7Y A;  2JY5 A;  1HJP A;  3H4J A;  1IXS A;  2LVO C;  2ZTD A;  2JP7 A;  1MN3 A;  1Y8G A;  2MJ5 B;  1T43 A;  1HT1 E;  1ZV1 A;  2KHH A;  3FE3 A;  4HEO A;  3IHP A;  1XB2 B;  1WHC A;  3F92 A;  1WJ7 A;  1ZMV A;  5DFL A;  2DKL A;  2LTU A;  3E46 A;  1T6O A;  2ZTC A;  1G41 A;  2OOB A;  2MGW A;  1VQ1 A;  2CWB A;  2K9D A;  2DZL A;  2JY7 A;  4DBG B;  3GLI E;  5JI2 E;  2LVQ D;  1GO5 A;  1WR1 B;  2DAK A;  2R0I A;  1TTE A;  3FRH A;  2EJS A;  1P3Q Q;  2JZ0 A;  2JZ1 A;  1R4G A;  2K0B X;  3MMP A;  1DO2 A;  1AIP C;  2G3Q A;  2HWJ A;  2QNJ A;  1YLA A;  2BWE A;  1F4I A;  4G3O A;  4UN2 B;  1OAI A;  1XXH E;  2KNZ A;  1PGY A;  3GLF E;  3E21 A;  3B89 A;  2HAK A;  2L4F A;  3GLG E;  3IEC A;  2MR9 A;  1ZMW A;  1WIV A;  3T6P A;  2LVP C;  1HT2 E;  4WP2 A;  1HQY E;  2B3T A;  2KNV A;  1A5T A;  1QZE A;  1ZMU A;  1WGN A;  1VG5 A;  2DAE A;  1BVS A;  1G4A E;  1OKS A;  2QHO B;  2JUJ A;  2EKF A;  2DI0 A;  1NV8 A;  1IM2 A;  1DV0 A;  2DEN A;  2DAI A;  4F2L A;  1VEG A;  3LCU A;  1VEK A;  2KNA A;  1NV9 A;  1CUK A;  2JY8 A;  1VDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...