2L4EA

Nmr structure of the uba domain of s. cerevisiae dcn1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
b'IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4eA00
3GLIE 2HAKA 4F2LA 1NV8A 3MMPA 1DO0A 2QSFX 2JZ0A 1WR1B 2DAIA 1NV9A 1OQYA 2DENA 1E94E 1G41A 2LVQD 4DBGB 2LVNC 1OKSA 2H5XA 3IHPA 1ZV1A 3E21A 3FRHA 2LVOC 1G4AE 2JNHA 2DKLA 2CWBA 2K0BX 1QZEA 1VEJA 1MN3A 1OAIA 3F92A 2LBCA 1DO2A 2CP8A 1YLAA 1KYIA 2MROB 1HT1E 2QHOB 1P3QQ 2JUJA 2LTUA 2DAEA 3IECA 2JP7A 4F1IA 2KHHA 1V92A 3E46A 3K9OA 3GLFE 1VQ1A 2KNZA 1VDLA 2DAKA 1UFZA 4R71A 2DZLA 1XXHE 1XB2B 1AIPC 2L4EA 3GLGE 2DNAA 3LCVB 2QNJA 1WHCA 2BWBA 2KNVA 1WGNA 3LCUA 1T6OA 2EKFA 2LVAA 4UN2B 1VG5A 1PGYA 1HQYE 2O25A 2ZTDA 1Q02A 2WZJA 2BWEA 1TR8A 1VEKA 1VEGA 2L4FA 1JR3E 2RRUA 2KNAA 2HWJA 2ZTCA 4HEOA 3FRIA 2R0IA 1WIVA 3T6PA 5DFLA 2EKKA 2G3QA 2K9DA 1TTEA 2JY7A 4GEWA 2OO9A 2DAGA 1A5TA 2DHYA 1HJPA 1Y8GA 2LVPC 1ZMVA 2JY8A 4Q7JA 1F4IA 2JY6B 1ZMWA 1IXSA 1ZMUA 4G3OA 2DI0A 3FE3A 2OOBA 3H4JA 3BBZA 3GLHE 2L2DA 2DAMA 2JZ1A 1BVSA 2MJ5B 1WGLA 1SG9A 5JI2E 3B89A 4WP2A 1CUKA 1HT2E 1R4GA 1WJ7A 2OOAA 2MR9A 3K9PA 1IFYA 1C7YA 2MGWA 1T43A 2JY5A 1DV0A 1EFUB 1IM2A 1OTRA 2EJSA 1GO5A 2B3TA 1G3IA
chains in the Genus database with same CATH superfamily
4FVMA 1D2NA 1W5TA 2GNOA 4AW4A 3GQ4A 3TWMA 3C3EA 4L8RC 3SHGB 4LGMA 2JZ0A 1IY0A 1WR1B 2DAIA 3I51A 2F4VM 2D7EA 1Z5BA 4EIWA 2C9OA 2UUAM 2Z7JA 2LVNC 4AKHA 2H5XA 2E5LM 3ILKA 5A2QS 4NSOB 4CJ6A 1NJFA 2N35A 1TH2A 3I4VA 3ZH9B 5FTLA 1Z5AA 4CIZA 1PJJA 4G4OA 5H37D 2K0BX 4X64M 3CGWA 4MGYE 3I01M 4WW0A 1QZEA 3NWLA 3HHWA 3FTCA 4P16A 4DV2M 1DO2A 2ZBKB 3KXEC 1L8QA 3NBIA 1NO1A 1Q39A 5LMNM 4IBBA 3HY5A 3PNYA 4Z6YA 3A98B 2MROB 3SAWA 2DXIA 1HT1E 3B7ZA 2KRKA 3RFWA 2CV1A 3QAUA 2JUJA 2XEPA 3SASA 1GJTA 4BLCA 1MJGM 2LHCA 3B7QA 3T38A 4AI6A 5EXPA 2FOIC 4FCTA 3TWKA 3W67A 4QOZC 4L6V6 1NY6A 3GLFE 2KNZA 3PXGA 3TL4X 5E26A 2R4EA 1GKIA 2KEBA 4DR4M 1K82A 1UFZA 4OU7A 3KW6A 2BNKA 3KOYE 3RE8A 3GLGE 2HL7A 2OPFA 4JYAM 3THGA 2UUBM 4FCWA 2KDLA 3KOZE 2KNVA 1WGNA 3LCUA 3LQQA 3UJNA 4S12A 3GLFB 1HR0M 1WXQA 2K47A 2CHGA 2XSZA 3C58A 2O01F 1IBLM 3GLGB 4LJ6A 2L4FA 2R6FA 3T1HM 2RRUA 1SXJE 1XMOM 5FSWA 4JI0M 2ZTCA 5KQ8A 2XSZD 3FRIA 1QZMA 3C9PA 3AKZA 4LF6M 4B7GA 1NSFA 2Q2EB 4QNMA 1N32M 2R46A 4L4UA 8CATA 4B7HA 2OO9A 4KO8A 4DV1M 4PD2A 3U6MA 1HJPA 2L7IA 3L29A 4OW0A 1IBKM 1F4IA 2J7NA 2JY6B 1ZMWA 4GRIA 1TDHA 3A46A 2J7OA 3HHZA 2XFTA 4CISA 2CRUA 2DI0A 3HU3A 3B74A 3EIHA 2G8LA 1J09A 3GLHE 3HU2A 5EXSA 4GKJM 4IIWA 2DAMA 1MU5A 2JZ1A 4IJEA 1K3WA 1BVSA 3AFHA 1XNQM 1S3SA 2VF8A 3VDUA 1YE9A 2M5ZA 1OIZA 4GC5A 3K8ZA 3J7AS 4TUWA 3KOXE 4WP2A 1R4GA 1SXJC 1WJ7A 3L2AA 5KPZA 1E32A 1HNWM 4KLNA 1VDDA 3HWSA 1PJTA 4CGYB 3IG5A 4W5WA 3JAMS 2JY5A 4IBEA 2V1CA 1N77A 1DV0A 4YY3M 3L26A 3SFZA 3HHXA 4MH0E 1GO5A 2B3TA 4QOSA 2J5YA 4MGIE 1GJSA 2ERCA 3W68A 2QP9X 1LV7A 2KXEA 1NV9A 4I81A 3GPUA 1Z5CA 1I94M 1V34A 4JI1M 2R44A 4KODA 3L28A 2KA6B 3FYCA 5ITTA 3I4YA 1ZV1A 3FTEA 2X4AA 3AOEC 4HLQA 1Q3CA 2LVOC 1G4AE 2CWBA 2EUCA 5IREB 3M7GA 4FD2A 2WSFF 2YFQA 1EIJA 3B7NA 1VEJA 2Y20A 3F92A 1G8PA 5EP2A 2KRUA 1TDZA 2CP8A 3U6EA 2R65A 5KQDA 4M0WA 5EJCA 3GO8A 2ZAOA 1DGHB 2DVWB 1NHGC 4RF1A 2OQ4A 3U60B 1N75A 1UM8A 4I8OA 3GQ3A 4LF9M 2QHOB 3K92A 2JWSA 4OVZB 2QBYB 1XNRM 5L8RF 1QUSA 4ITQA 4F1IA 4CHTB 1V92A 3U6OA 3E46A 4JI4M 4MM3B 1EE8A 4GITA 2DZNB 4DUYM 1L2CA 5ITXE 4DR7M 1VQ1A 4AG5A 5FTNA 2DAKA 2DZOB 4FW9A 2DZLA 2L4EA 2Y0QA 3RGPA 1XC8A 3GRYA 3TE6A 3H4MA 3LCVB 4DUZM 3U6SA 2QNJA 4JI8M 1PM5A 4AKGA 1WHCA 2BWBA 2QCUA 5GKNA 4GHLA 1T6OA 3HJ8A 2MH8A 4JI6M 4UN2B 2L6OA 4LGYA 2CHQA 1VG5A 4LRSA 1HQYE 1IY1A 2R45A 3NBXX 3E9SA 3J81S 3HKPA 4NOOB 1JR3E 3J80S 1NNJA 2LHGA 2CV2A 2KNAA 3JR4A 4HEOA 1GLNA 1IXRC 4P17A 3LQRA 2K9DA 3CF6E 1TTEA 1IY2A 3T1YM 1L2DA 2DAGA 2DHRA 3I04M 4QNRA 2FS1A 1QDRA 2HKJA 2LVPC 1HQCA 1NY5A 1Y8GA 2F5OA 4M9ZA 4JV5M 3FTDA 4L78A 4IBFA 3GPPA 3VKGA 3GLFA 4LZZA 3DA1A 2F5SA 2V6ZM 4RKUF 3FUUA 1QAOA 3UGJA 4PDGA 2R4JA 4IBGA 3GLGA 3SMSA 1R2YA 3WHKA 4B3MM 3KS4A 4DR2M 2FH0A 1R6BX 4D82A 2DWMA 5DNYA 4ZPXA 3GP1A 4JXJA 3SARA 1NHWC 1QAMA 4MGKE 1D0KA 2D7HA 4LF8M 5JI2E 2I7NA 3B89A 3V76A 5KPTA 3KS8A 1HT2E 2A5YB 2OOAA 5FTKA 2MR9A 1R7RA 2VDBB 1C7YA 1JB0F 3E4RA 1MX0A 2UXDM 1N36M 4D81A 1V33A 3QYEA 4NRVA 1OTRA 3SAUA 1FJGM 2EJSA 4LY6A 4DR5M 1SXJB 1QDTA 4XK8F 4G4NA 3K2LA 2RGHA 2UUCM 3D8BA 3GLIE 3SAVA 4LFCM 4B7FA 1SXJD 1T3TA 4F2LA 3HGIA 1DO0A 1ZAEA 2QSFX 1N33M 2DENA 4I4LA 1E94E 2KW0A 1G41A 2LVQD 2JA2A 2UU9M 3HHYA 1X37A 3U5ZB 3L25A 3U6CA 4L15A 4GC9A 3HJQA 3DZDA 4D80A 3Q8GA 3PFIA 4PCZA 4NXNM 3FTFA 5EXXA 4GMQA 1RU3A 1N78A 4DV5M 5ITUA 1IXZA 5BPVA 3UK6A 3DOAA 3KFUG 4GH9A 2M60A 3GLHB 1PJQA 3GRRA 3HZJA 1IQPA 2XFSA 1OAIA 3FUWA 1GVNA 2BJVA 4LF5M 4JI2M 2DWZB 2FNAA 4KHPM 3SBJA 1Z6TA 4FWHA 1TH4A 3FUXA 1J5EM 3IG8A 1NJGA 1IN7A 1ORYB 1QAQA 1NNUC 1H6UA 3LVVA 2WSCF 1G59A 4X62M 2F5QA 4WURA 1P3QQ 2H1RA 3W0LB 3ZCBB 4MB7A 1IN5A 2VIIA 5EP3A 2DAEA 3GRVA 2JP7A 3IECA 2DWLA 3A45A 1YUBA 3LW5F 2CUZA 4GIPA 4IBDA 4AZFA 3DFZA 2LWXA 1HNXM 5ITYA 3HJSA 5IZ7D 2P5TA 2Y0TA 4LJ7A 1XXHE 2ZAMA 4QHSA 1DGHA 1IN8A 3AOGA 4LFBM 1PJSA 1IXSB 2D7GA 3U60A 5F3WA 5IT9S 4PT5A 3J2PB 4ANRA 2KZSA 4X66M 2LVAA 5EQTA 3SC3A 5C18A 4NL4H 2XH9A 4LCBA 5KO3A 3U61B 2CV0A 1PGYA 4OVZA 2QBYA 2EO2A 3PVSA 2RGOA 2ZTDA 1XXHB 4II7A 2BWEA 2FE8A 1E9RA 3B9PA 1VEGA 4LJ5A 3UZUA 4DV6M 3CF0A 4QHTA 4IBCA 2XGNA 2CEAA 1WIVA 2R0IA 3T6PA 3A42A 1R5LA 4FWDA 4G6ZA 3MHVC 3BXWA 5DFLA 2G3QA 4GEWA 2JY7A 3EIEA 4MGHA 3VKHA 3D8LA 2C99A 4HL4A 4LZJA 4XBOA 3J27B 4IBJA 1ZMVA 2QZ4A 1HNZM 5FTMA 4G3OA 1FNNA 5ITXA 2RKOA 2YR0A 4IBIA 2W82A 4REZA 3HU1A 4G4RA 1QANA 2HCBA 2VQEM 3MK6A 3QWLA 3BBZA 2C9CA 4NSRA 3OTOM 4LFAM 3GQ5A 4L16A 3U6DA 3U6LA 5FTJA 2L2DA 2Z8YM 4KT0F 4LJ8A 4NXMM 2ZM6M 4AQYM 4PDIA 1GL7A 3U6PA 4M9SA 3BOSA 2BJWA 5KPRA 1J7KA 4OX9M 1GL6A 3C3DA 5E6JA 1IFYA 1KSFX 2I7PA 2MGWA 3FUTA 3L27A 1T43A 1IBMM 1JR3A 3AL0C 4M0DA 3Q8XA 3SYLA 3GPXA 3UMMA 1EFUB 1OIPA 1OAOC 3KVWA 4BBAA 4AKIA 3MJ5A 4Z8XA 1DGBA 1G3IA 3CTWB 1JR3D 3HX3A 4IBKA 2HHHM 2HAKA 1TH3A 1NV8A 3MMPA 5EP1A 4R3DA 5C1BA 1OQYA 2KZUA 4LJ9A 5IWAM 4DBGB 3CF2A 4K0KM 1QQWA 2XZUA 4RF0A 2EA0A 3IHPA 1NVMA 3SATA 1PRBA 5ITRA 3E21A 3FRHA 2XLJA 4B3TM 1YSYA 3T15A 4IJFA 2JNHA 4AG6A 2DKLA 4DR6M 3FUVA 3KDSE 4YHHM 2R18A 2C98A 2LH0A 2X8AA 4LJAA 1D0MA 4RNAA 2VQFM 2LXEA 2Z3XA 1MN3A 1IN6A 1SXJA 2LBCA 3FD9A 3U6QA 3GRUA 4DV3M 2YNMD 3ZQJA 4M9XA 2CFOA 1QUTA 3K1JA 4JN6A 4JI3M 3TQSA 1XWIA 1YLAA 4GKKM 3U5ZA 1KYIA 3SMPA 2GQFA 3SHFA 7CATA 3GPYA 3KP0E 2Z4RA 3GLIA 1L1ZA 1JQJC 2LTUA 3FYDA 2XF3A 3W0FA 4NRWA 2CHVA 3TPZA 5FLXS 4DV7M 3GLIB 4DV4M 1IN4A 2FFJA 2R62A 2KHHA 2APLA 1OJLA 2QPAA 2L7HA 2YQZA 3K9OA 4FWGA 3R8FA 3GLHA 3AOEA 4X65M 1DGFA 2Z4SA 1L1TA 4B3SM 1PJIA 2O5RA 3VDPA 1VDLA 2X49A 2F5PA 4R71A 1TGUA 4JI5M 5EP4A 1XB2B 1AIPC 2QENA 2WSEF 1R2ZA 4B3RM 3M0EA 3R9XB 2DNAA 3WHLA 1LTMA 2AHMA 4BB9A 5EXTA 3M6AA 4MGZE 3JR5A 2EKFA 3KSXA 2JXNA 4FCVA 1QYRA 2QQ8A 3PNVA 3AV0A 3VLFB 2O25A 1Q02A 2WZJA 4LF7M 1TR8A 2VF7A 1VEKA 3SYKA 1N34M 3RGSA 1I4WA 4LF4M 2HWJA 1G71A 2DWNA 4GHAA 4DV0M 3LMMA 1XHBA 2EKKA 3KOWE 3VFDA 3J7BA 4LRTA 5DYIA 3VK7A 1A5TA 1D0LA 2C96A 2DHYA 5BR8M 3KSJA 4G4QA 2CE7A 4LJ4A 2JY8A 3QYBA 4Q7JA 2C5RA 3TWLA 1GABA 1IXSA 1OFIA 3LVWA 1ZMUA 2NQ8C 2Y21A 1W5SA 4Y28F 5DYGA 3FE3A 1C1KA 2OOBA 5JI3E 1OFHA 2L09A 2ZANA 2UXBM 3U61A 1QVRA 1E9SA 2F5NA 2XZFA 3H4JA 1XXHA 2UXCM 1Z59A 4XGIA 3FKEA 3KP1E 2V1UA 4B08A 4JI7M 1AUAA 2K6BA 3ZC7B 1ZQ9A 3VK8A 5ITQA 2G5GX 2MJ5B 4R7GA 5LMUM 4LG2A 1WGLA 1KFVA 1SG9A 4A3VB 1CUKA 4DR3M 3AJIB 3K9PA 4NC6A 1L2BA 1DGGA 4DR1M 1Q3BA 1TF0B 1K3XA 1XMQM 1IM2A 4I5SA 2LNHC 1OKSA
chains in the Genus database with same CATH topology
3GLIE 2HAKA 4F2LA 1NV8A 3MMPA 1DO0A 2QSFX 2JZ0A 1WR1B 2DAIA 1NV9A 1OQYA 2DENA 1E94E 1G41A 2LVQD 4DBGB 2LVNC 1OKSA 2H5XA 3IHPA 1ZV1A 3E21A 3FRHA 2LVOC 1G4AE 2JNHA 2DKLA 2CWBA 2K0BX 1QZEA 1VEJA 1MN3A 1OAIA 3F92A 2LBCA 1DO2A 2CP8A 1YLAA 1KYIA 2MROB 1HT1E 2QHOB 1P3QQ 2JUJA 2LTUA 2DAEA 3IECA 2JP7A 4F1IA 2KHHA 1V92A 3E46A 3K9OA 3GLFE 1VQ1A 2KNZA 1VDLA 2DAKA 1UFZA 4R71A 2DZLA 1XXHE 1XB2B 1AIPC 2L4EA 3GLGE 2DNAA 3LCVB 2QNJA 1WHCA 2BWBA 2KNVA 1WGNA 3LCUA 1T6OA 2EKFA 2LVAA 4UN2B 1VG5A 1PGYA 1HQYE 2O25A 2ZTDA 1Q02A 2WZJA 2BWEA 1TR8A 1VEKA 1VEGA 2L4FA 1JR3E 2RRUA 2KNAA 2HWJA 2ZTCA 4HEOA 3FRIA 2R0IA 1WIVA 3T6PA 5DFLA 2EKKA 2G3QA 2K9DA 1TTEA 2JY7A 4GEWA 2OO9A 2DAGA 1A5TA 2DHYA 1HJPA 1Y8GA 2LVPC 1ZMVA 2JY8A 4Q7JA 1F4IA 2JY6B 1ZMWA 1IXSA 1ZMUA 4G3OA 2DI0A 3FE3A 2OOBA 3H4JA 3BBZA 3GLHE 2L2DA 2DAMA 2JZ1A 1BVSA 2MJ5B 1WGLA 1SG9A 5JI2E 3B89A 4WP2A 1CUKA 1HT2E 1R4GA 1WJ7A 2OOAA 2MR9A 3K9PA 1IFYA 1C7YA 2MGWA 1T43A 2JY5A 1DV0A 1EFUB 1IM2A 1OTRA 2EJSA 1GO5A 2B3TA 1G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLI E;  2HAK A;  4F2L A;  1NV8 A;  3MMP A;  1DO0 A;  2QSF X;  2JZ0 A;  1WR1 B;  2DAI A;  1NV9 A;  1OQY A;  2DEN A;  1E94 E;  1G41 A;  2LVQ D;  4DBG B;  2LVN C;  1OKS A;  2H5X A;  3IHP A;  1ZV1 A;  3E21 A;  3FRH A;  2LVO C;  1G4A E;  2JNH A;  2DKL A;  2CWB A;  2K0B X;  1QZE A;  1VEJ A;  1MN3 A;  1OAI A;  3F92 A;  2LBC A;  1DO2 A;  2CP8 A;  1YLA A;  1KYI A;  2MRO B;  1HT1 E;  2QHO B;  1P3Q Q;  2JUJ A;  2LTU A;  2DAE A;  3IEC A;  2JP7 A;  4F1I A;  2KHH A;  1V92 A;  3E46 A;  3K9O A;  3GLF E;  1VQ1 A;  2KNZ A;  1VDL A;  2DAK A;  1UFZ A;  4R71 A;  2DZL A;  1XXH E;  1XB2 B;  1AIP C;  2L4E A;  3GLG E;  2DNA A;  3LCV B;  2QNJ A;  1WHC A;  2BWB A;  2KNV A;  1WGN A;  3LCU A;  1T6O A;  2EKF A;  2LVA A;  4UN2 B;  1VG5 A;  1PGY A;  1HQY E;  2O25 A;  2ZTD A;  1Q02 A;  2WZJ A;  2BWE A;  1TR8 A;  1VEK A;  1VEG A;  2L4F A;  1JR3 E;  2RRU A;  2KNA A;  2HWJ A;  2ZTC A;  4HEO A;  3FRI A;  2R0I A;  1WIV A;  3T6P A;  5DFL A;  2EKK A;  2G3Q A;  2K9D A;  1TTE A;  2JY7 A;  4GEW A;  2OO9 A;  2DAG A;  1A5T A;  2DHY A;  1HJP A;  1Y8G A;  2LVP C;  1ZMV A;  2JY8 A;  4Q7J A;  1F4I A;  2JY6 B;  1ZMW A;  1IXS A;  1ZMU A;  4G3O A;  2DI0 A;  3FE3 A;  2OOB A;  3H4J A;  3BBZ A;  3GLH E;  2L2D A;  2DAM A;  2JZ1 A;  1BVS A;  2MJ5 B;  1WGL A;  1SG9 A;  5JI2 E;  3B89 A;  4WP2 A;  1CUK A;  1HT2 E;  1R4G A;  1WJ7 A;  2OOA A;  2MR9 A;  3K9P A;  1IFY A;  1C7Y A;  2MGW A;  1T43 A;  2JY5 A;  1DV0 A;  1EFU B;  1IM2 A;  1OTR A;  2EJS A;  1GO5 A;  2B3T A;  1G3I A; 
#chains in the Genus database with same CATH topology
 4FVM A;  1D2N A;  1W5T A;  2GNO A;  4AW4 A;  3GQ4 A;  3TWM A;  3C3E A;  4L8R C;  3SHG B;  4LGM A;  2JZ0 A;  1IY0 A;  1WR1 B;  2DAI A;  3I51 A;  2F4V M;  2D7E A;  1Z5B A;  4EIW A;  2C9O A;  2UUA M;  2Z7J A;  2LVN C;  4AKH A;  2H5X A;  2E5L M;  3ILK A;  5A2Q S;  4NSO B;  4CJ6 A;  1NJF A;  2N35 A;  1TH2 A;  3I4V A;  3ZH9 B;  5FTL A;  1Z5A A;  4CIZ A;  1PJJ A;  4G4O A;  5H37 D;  2K0B X;  4X64 M;  3CGW A;  4MGY E;  3I01 M;  4WW0 A;  1QZE A;  3NWL A;  3HHW A;  3FTC A;  4P16 A;  4DV2 M;  1DO2 A;  2ZBK B;  3KXE C;  1L8Q A;  3NBI A;  1NO1 A;  1Q39 A;  5LMN M;  4IBB A;  3HY5 A;  3PNY A;  4Z6Y A;  3A98 B;  2MRO B;  3SAW A;  2DXI A;  1HT1 E;  3B7Z A;  2KRK A;  3RFW A;  2CV1 A;  3QAU A;  2JUJ A;  2XEP A;  3SAS A;  1GJT A;  4BLC A;  1MJG M;  2LHC A;  3B7Q A;  3T38 A;  4AI6 A;  5EXP A;  2FOI C;  4FCT A;  3TWK A;  3W67 A;  4QOZ C;  4L6V 6;  1NY6 A;  3GLF E;  2KNZ A;  3PXG A;  3TL4 X;  5E26 A;  2R4E A;  1GKI A;  2KEB A;  4DR4 M;  1K82 A;  1UFZ A;  4OU7 A;  3KW6 A;  2BNK A;  3KOY E;  3RE8 A;  3GLG E;  2HL7 A;  2OPF A;  4JYA M;  3THG A;  2UUB M;  4FCW A;  2KDL A;  3KOZ E;  2KNV A;  1WGN A;  3LCU A;  3LQQ A;  3UJN A;  4S12 A;  3GLF B;  1HR0 M;  1WXQ A;  2K47 A;  2CHG A;  2XSZ A;  3C58 A;  2O01 F;  1IBL M;  3GLG B;  4LJ6 A;  2L4F A;  2R6F A;  3T1H M;  2RRU A;  1SXJ E;  1XMO M;  5FSW A;  4JI0 M;  2ZTC A;  5KQ8 A;  2XSZ D;  3FRI A;  1QZM A;  3C9P A;  3AKZ A;  4LF6 M;  4B7G A;  1NSF A;  2Q2E B;  4QNM A;  1N32 M;  2R46 A;  4L4U A;  8CAT A;  4B7H A;  2OO9 A;  4KO8 A;  4DV1 M;  4PD2 A;  3U6M A;  1HJP A;  2L7I A;  3L29 A;  4OW0 A;  1IBK M;  1F4I A;  2J7N A;  2JY6 B;  1ZMW A;  4GRI A;  1TDH A;  3A46 A;  2J7O A;  3HHZ A;  2XFT A;  4CIS A;  2CRU A;  2DI0 A;  3HU3 A;  3B74 A;  3EIH A;  2G8L A;  1J09 A;  3GLH E;  3HU2 A;  5EXS A;  4GKJ M;  4IIW A;  2DAM A;  1MU5 A;  2JZ1 A;  4IJE A;  1K3W A;  1BVS A;  3AFH A;  1XNQ M;  1S3S A;  2VF8 A;  3VDU A;  1YE9 A;  2M5Z A;  1OIZ A;  4GC5 A;  3K8Z A;  3J7A S;  4TUW A;  3KOX E;  4WP2 A;  1R4G A;  1SXJ C;  1WJ7 A;  3L2A A;  5KPZ A;  1E32 A;  1HNW M;  4KLN A;  1VDD A;  3HWS A;  1PJT A;  4CGY B;  3IG5 A;  4W5W A;  3JAM S;  2JY5 A;  4IBE A;  2V1C A;  1N77 A;  1DV0 A;  4YY3 M;  3L26 A;  3SFZ A;  3HHX A;  4MH0 E;  1GO5 A;  2B3T A;  4QOS A;  2J5Y A;  4MGI E;  1GJS A;  2ERC A;  3W68 A;  2QP9 X;  1LV7 A;  2KXE A;  1NV9 A;  4I81 A;  3GPU A;  1Z5C A;  1I94 M;  1V34 A;  4JI1 M;  2R44 A;  4KOD A;  3L28 A;  2KA6 B;  3FYC A;  5ITT A;  3I4Y A;  1ZV1 A;  3FTE A;  2X4A A;  3AOE C;  4HLQ A;  1Q3C A;  2LVO C;  1G4A E;  2CWB A;  2EUC A;  5IRE B;  3M7G A;  4FD2 A;  2WSF F;  2YFQ A;  1EIJ A;  3B7N A;  1VEJ A;  2Y20 A;  3F92 A;  1G8P A;  5EP2 A;  2KRU A;  1TDZ A;  2CP8 A;  3U6E A;  2R65 A;  5KQD A;  4M0W A;  5EJC A;  3GO8 A;  2ZAO A;  1DGH B;  2DVW B;  1NHG C;  4RF1 A;  2OQ4 A;  3U60 B;  1N75 A;  1UM8 A;  4I8O A;  3GQ3 A;  4LF9 M;  2QHO B;  3K92 A;  2JWS A;  4OVZ B;  2QBY B;  1XNR M;  5L8R F;  1QUS A;  4ITQ A;  4F1I A;  4CHT B;  1V92 A;  3U6O A;  3E46 A;  4JI4 M;  4MM3 B;  1EE8 A;  4GIT A;  2DZN B;  4DUY M;  1L2C A;  5ITX E;  4DR7 M;  1VQ1 A;  4AG5 A;  5FTN A;  2DAK A;  2DZO B;  4FW9 A;  2DZL A;  2L4E A;  2Y0Q A;  3RGP A;  1XC8 A;  3GRY A;  3TE6 A;  3H4M A;  3LCV B;  4DUZ M;  3U6S A;  2QNJ A;  4JI8 M;  1PM5 A;  4AKG A;  1WHC A;  2BWB A;  2QCU A;  5GKN A;  4GHL A;  1T6O A;  3HJ8 A;  2MH8 A;  4JI6 M;  4UN2 B;  2L6O A;  4LGY A;  2CHQ A;  1VG5 A;  4LRS A;  1HQY E;  1IY1 A;  2R45 A;  3NBX X;  3E9S A;  3J81 S;  3HKP A;  4NOO B;  1JR3 E;  3J80 S;  1NNJ A;  2LHG A;  2CV2 A;  2KNA A;  3JR4 A;  4HEO A;  1GLN A;  1IXR C;  4P17 A;  3LQR A;  2K9D A;  3CF6 E;  1TTE A;  1IY2 A;  3T1Y M;  1L2D A;  2DAG A;  2DHR A;  3I04 M;  4QNR A;  2FS1 A;  1QDR A;  2HKJ A;  2LVP C;  1HQC A;  1NY5 A;  1Y8G A;  2F5O A;  4M9Z A;  4JV5 M;  3FTD A;  4L78 A;  4IBF A;  3GPP A;  3VKG A;  3GLF A;  4LZZ A;  3DA1 A;  2F5S A;  2V6Z M;  4RKU F;  3FUU A;  1QAO A;  3UGJ A;  4PDG A;  2R4J A;  4IBG A;  3GLG A;  3SMS A;  1R2Y A;  3WHK A;  4B3M M;  3KS4 A;  4DR2 M;  2FH0 A;  1R6B X;  4D82 A;  2DWM A;  5DNY A;  4ZPX A;  3GP1 A;  4JXJ A;  3SAR A;  1NHW C;  1QAM A;  4MGK E;  1D0K A;  2D7H A;  4LF8 M;  5JI2 E;  2I7N A;  3B89 A;  3V76 A;  5KPT A;  3KS8 A;  1HT2 E;  2A5Y B;  2OOA A;  5FTK A;  2MR9 A;  1R7R A;  2VDB B;  1C7Y A;  1JB0 F;  3E4R A;  1MX0 A;  2UXD M;  1N36 M;  4D81 A;  1V33 A;  3QYE A;  4NRV A;  1OTR A;  3SAU A;  1FJG M;  2EJS A;  4LY6 A;  4DR5 M;  1SXJ B;  1QDT A;  4XK8 F;  4G4N A;  3K2L A;  2RGH A;  2UUC M;  3D8B A;  3GLI E;  3SAV A;  4LFC M;  4B7F A;  1SXJ D;  1T3T A;  4F2L A;  3HGI A;  1DO0 A;  1ZAE A;  2QSF X;  1N33 M;  2DEN A;  4I4L A;  1E94 E;  2KW0 A;  1G41 A;  2LVQ D;  2JA2 A;  2UU9 M;  3HHY A;  1X37 A;  3U5Z B;  3L25 A;  3U6C A;  4L15 A;  4GC9 A;  3HJQ A;  3DZD A;  4D80 A;  3Q8G A;  3PFI A;  4PCZ A;  4NXN M;  3FTF A;  5EXX A;  4GMQ A;  1RU3 A;  1N78 A;  4DV5 M;  5ITU A;  1IXZ A;  5BPV A;  3UK6 A;  3DOA A;  3KFU G;  4GH9 A;  2M60 A;  3GLH B;  1PJQ A;  3GRR A;  3HZJ A;  1IQP A;  2XFS A;  1OAI A;  3FUW A;  1GVN A;  2BJV A;  4LF5 M;  4JI2 M;  2DWZ B;  2FNA A;  4KHP M;  3SBJ A;  1Z6T A;  4FWH A;  1TH4 A;  3FUX A;  1J5E M;  3IG8 A;  1NJG A;  1IN7 A;  1ORY B;  1QAQ A;  1NNU C;  1H6U A;  3LVV A;  2WSC F;  1G59 A;  4X62 M;  2F5Q A;  4WUR A;  1P3Q Q;  2H1R A;  3W0L B;  3ZCB B;  4MB7 A;  1IN5 A;  2VII A;  5EP3 A;  2DAE A;  3GRV A;  2JP7 A;  3IEC A;  2DWL A;  3A45 A;  1YUB A;  3LW5 F;  2CUZ A;  4GIP A;  4IBD A;  4AZF A;  3DFZ A;  2LWX A;  1HNX M;  5ITY A;  3HJS A;  5IZ7 D;  2P5T A;  2Y0T A;  4LJ7 A;  1XXH E;  2ZAM A;  4QHS A;  1DGH A;  1IN8 A;  3AOG A;  4LFB M;  1PJS A;  1IXS B;  2D7G A;  3U60 A;  5F3W A;  5IT9 S;  4PT5 A;  3J2P B;  4ANR A;  2KZS A;  4X66 M;  2LVA A;  5EQT A;  3SC3 A;  5C18 A;  4NL4 H;  2XH9 A;  4LCB A;  5KO3 A;  3U61 B;  2CV0 A;  1PGY A;  4OVZ A;  2QBY A;  2EO2 A;  3PVS A;  2RGO A;  2ZTD A;  1XXH B;  4II7 A;  2BWE A;  2FE8 A;  1E9R A;  3B9P A;  1VEG A;  4LJ5 A;  3UZU A;  4DV6 M;  3CF0 A;  4QHT A;  4IBC A;  2XGN A;  2CEA A;  1WIV A;  2R0I A;  3T6P A;  3A42 A;  1R5L A;  4FWD A;  4G6Z A;  3MHV C;  3BXW A;  5DFL A;  2G3Q A;  4GEW A;  2JY7 A;  3EIE A;  4MGH A;  3VKH A;  3D8L A;  2C99 A;  4HL4 A;  4LZJ A;  4XBO A;  3J27 B;  4IBJ A;  1ZMV A;  2QZ4 A;  1HNZ M;  5FTM A;  4G3O A;  1FNN A;  5ITX A;  2RKO A;  2YR0 A;  4IBI A;  2W82 A;  4REZ A;  3HU1 A;  4G4R A;  1QAN A;  2HCB A;  2VQE M;  3MK6 A;  3QWL A;  3BBZ A;  2C9C A;  4NSR A;  3OTO M;  4LFA M;  3GQ5 A;  4L16 A;  3U6D A;  3U6L A;  5FTJ A;  2L2D A;  2Z8Y M;  4KT0 F;  4LJ8 A;  4NXM M;  2ZM6 M;  4AQY M;  4PDI A;  1GL7 A;  3U6P A;  4M9S A;  3BOS A;  2BJW A;  5KPR A;  1J7K A;  4OX9 M;  1GL6 A;  3C3D A;  5E6J A;  1IFY A;  1KSF X;  2I7P A;  2MGW A;  3FUT A;  3L27 A;  1T43 A;  1IBM M;  1JR3 A;  3AL0 C;  4M0D A;  3Q8X A;  3SYL A;  3GPX A;  3UMM A;  1EFU B;  1OIP A;  1OAO C;  3KVW A;  4BBA A;  4AKI A;  3MJ5 A;  4Z8X A;  1DGB A;  1G3I A;  3CTW B;  1JR3 D;  3HX3 A;  4IBK A;  2HHH M;  2HAK A;  1TH3 A;  1NV8 A;  3MMP A;  5EP1 A;  4R3D A;  5C1B A;  1OQY A;  2KZU A;  4LJ9 A;  5IWA M;  4DBG B;  3CF2 A;  4K0K M;  1QQW A;  2XZU A;  4RF0 A;  2EA0 A;  3IHP A;  1NVM A;  3SAT A;  1PRB A;  5ITR A;  3E21 A;  3FRH A;  2XLJ A;  4B3T M;  1YSY A;  3T15 A;  4IJF A;  2JNH A;  4AG6 A;  2DKL A;  4DR6 M;  3FUV A;  3KDS E;  4YHH M;  2R18 A;  2C98 A;  2LH0 A;  2X8A A;  4LJA A;  1D0M A;  4RNA A;  2VQF M;  2LXE A;  2Z3X A;  1MN3 A;  1IN6 A;  1SXJ A;  2LBC A;  3FD9 A;  3U6Q A;  3GRU A;  4DV3 M;  2YNM D;  3ZQJ A;  4M9X A;  2CFO A;  1QUT A;  3K1J A;  4JN6 A;  4JI3 M;  3TQS A;  1XWI A;  1YLA A;  4GKK M;  3U5Z A;  1KYI A;  3SMP A;  2GQF A;  3SHF A;  7CAT A;  3GPY A;  3KP0 E;  2Z4R A;  3GLI A;  1L1Z A;  1JQJ C;  2LTU A;  3FYD A;  2XF3 A;  3W0F A;  4NRW A;  2CHV A;  3TPZ A;  5FLX S;  4DV7 M;  3GLI B;  4DV4 M;  1IN4 A;  2FFJ A;  2R62 A;  2KHH A;  2APL A;  1OJL A;  2QPA A;  2L7H A;  2YQZ A;  3K9O A;  4FWG A;  3R8F A;  3GLH A;  3AOE A;  4X65 M;  1DGF A;  2Z4S A;  1L1T A;  4B3S M;  1PJI A;  2O5R A;  3VDP A;  1VDL A;  2X49 A;  2F5P A;  4R71 A;  1TGU A;  4JI5 M;  5EP4 A;  1XB2 B;  1AIP C;  2QEN A;  2WSE F;  1R2Z A;  4B3R M;  3M0E A;  3R9X B;  2DNA A;  3WHL A;  1LTM A;  2AHM A;  4BB9 A;  5EXT A;  3M6A A;  4MGZ E;  3JR5 A;  2EKF A;  3KSX A;  2JXN A;  4FCV A;  1QYR A;  2QQ8 A;  3PNV A;  3AV0 A;  3VLF B;  2O25 A;  1Q02 A;  2WZJ A;  4LF7 M;  1TR8 A;  2VF7 A;  1VEK A;  3SYK A;  1N34 M;  3RGS A;  1I4W A;  4LF4 M;  2HWJ A;  1G71 A;  2DWN A;  4GHA A;  4DV0 M;  3LMM A;  1XHB A;  2EKK A;  3KOW E;  3VFD A;  3J7B A;  4LRT A;  5DYI A;  3VK7 A;  1A5T A;  1D0L A;  2C96 A;  2DHY A;  5BR8 M;  3KSJ A;  4G4Q A;  2CE7 A;  4LJ4 A;  2JY8 A;  3QYB A;  4Q7J A;  2C5R A;  3TWL A;  1GAB A;  1IXS A;  1OFI A;  3LVW A;  1ZMU A;  2NQ8 C;  2Y21 A;  1W5S A;  4Y28 F;  5DYG A;  3FE3 A;  1C1K A;  2OOB A;  5JI3 E;  1OFH A;  2L09 A;  2ZAN A;  2UXB M;  3U61 A;  1QVR A;  1E9S A;  2F5N A;  2XZF A;  3H4J A;  1XXH A;  2UXC M;  1Z59 A;  4XGI A;  3FKE A;  3KP1 E;  2V1U A;  4B08 A;  4JI7 M;  1AUA A;  2K6B A;  3ZC7 B;  1ZQ9 A;  3VK8 A;  5ITQ A;  2G5G X;  2MJ5 B;  4R7G A;  5LMU M;  4LG2 A;  1WGL A;  1KFV A;  1SG9 A;  4A3V B;  1CUK A;  4DR3 M;  3AJI B;  3K9P A;  4NC6 A;  1L2B A;  1DGG A;  4DR1 M;  1Q3B A;  1TF0 B;  1K3X A;  1XMQ M;  1IM2 A;  4I5S A;  2LNH C;  1OKS A; 
#chains in the Genus database with same CATH homology
 3GLI E;  2HAK A;  4F2L A;  1NV8 A;  3MMP A;  1DO0 A;  2QSF X;  2JZ0 A;  1WR1 B;  2DAI A;  1NV9 A;  1OQY A;  2DEN A;  1E94 E;  1G41 A;  2LVQ D;  4DBG B;  2LVN C;  1OKS A;  2H5X A;  3IHP A;  1ZV1 A;  3E21 A;  3FRH A;  2LVO C;  1G4A E;  2JNH A;  2DKL A;  2CWB A;  2K0B X;  1QZE A;  1VEJ A;  1MN3 A;  1OAI A;  3F92 A;  2LBC A;  1DO2 A;  2CP8 A;  1YLA A;  1KYI A;  2MRO B;  1HT1 E;  2QHO B;  1P3Q Q;  2JUJ A;  2LTU A;  2DAE A;  3IEC A;  2JP7 A;  4F1I A;  2KHH A;  1V92 A;  3E46 A;  3K9O A;  3GLF E;  1VQ1 A;  2KNZ A;  1VDL A;  2DAK A;  1UFZ A;  4R71 A;  2DZL A;  1XXH E;  1XB2 B;  1AIP C;  2L4E A;  3GLG E;  2DNA A;  3LCV B;  2QNJ A;  1WHC A;  2BWB A;  2KNV A;  1WGN A;  3LCU A;  1T6O A;  2EKF A;  2LVA A;  4UN2 B;  1VG5 A;  1PGY A;  1HQY E;  2O25 A;  2ZTD A;  1Q02 A;  2WZJ A;  2BWE A;  1TR8 A;  1VEK A;  1VEG A;  2L4F A;  1JR3 E;  2RRU A;  2KNA A;  2HWJ A;  2ZTC A;  4HEO A;  3FRI A;  2R0I A;  1WIV A;  3T6P A;  5DFL A;  2EKK A;  2G3Q A;  2K9D A;  1TTE A;  2JY7 A;  4GEW A;  2OO9 A;  2DAG A;  1A5T A;  2DHY A;  1HJP A;  1Y8G A;  2LVP C;  1ZMV A;  2JY8 A;  4Q7J A;  1F4I A;  2JY6 B;  1ZMW A;  1IXS A;  1ZMU A;  4G3O A;  2DI0 A;  3FE3 A;  2OOB A;  3H4J A;  3BBZ A;  3GLH E;  2L2D A;  2DAM A;  2JZ1 A;  1BVS A;  2MJ5 B;  1WGL A;  1SG9 A;  5JI2 E;  3B89 A;  4WP2 A;  1CUK A;  1HT2 E;  1R4G A;  1WJ7 A;  2OOA A;  2MR9 A;  3K9P A;  1IFY A;  1C7Y A;  2MGW A;  1T43 A;  2JY5 A;  1DV0 A;  1EFU B;  1IM2 A;  1OTR A;  2EJS A;  1GO5 A;  2B3T A;  1G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...