2L4EA

Nmr structure of the uba domain of s. cerevisiae dcn1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4eA00
2EJSA 1WHCA 2DAKA 1VEKA 1QZEA 1OQYA 2L4FA 2QSFX 2HWJA 1AIPC 5DFLA 1F4IA 2MJ5B 2RRUA 1DO2A 1OKSA 1KYIA 1R4GA 2R0IA 4UN2B 1IM2A 1DV0A 2JY7A 2DAEA 5JI2E 1PGYA 2B3TA 2JY5A 3FRHA 1HJPA 1NV8A 2CWBA 2K9DA 1V92A 1TR8A 2L2DA 1E94E 4G3OA 4F2LA 2DAGA 2EKFA 1IXSA 3GLFE 1Q02A 1T43A 2EKKA 2CP8A 1OAIA 2DENA 3FRIA 2MR9A 1BVSA 2DAMA 3K9OA 2LVQD 3H4JA 1WIVA 1C7YA 1WGLA 1NV9A 2LTUA 1YLAA 4WP2A 2ZTDA 1IFYA 3F92A 2MGWA 2MROB 2DHYA 2BWEA 2JY8A 1GO5A 2LVOC 2JUJA 1HT2E 1ZV1A 4R71A 2DAIA 1TTEA 1G3IA 1JR3E 2JP7A 2DZLA 2O25A 3B89A 3FE3A 3MMPA 2LVNC 1XXHE 2QHOB 1ZMWA 2JNHA 1MN3A 1WGNA 1VG5A 3IHPA 2DNAA 1EFUB 2LBCA 4HEOA 1ZMUA 3LCVB 3IECA 1VDLA 2DKLA 1A5TA 2DI0A 4Q7JA 4F1IA 2LVPC 1G4AE 4DBGB 1G41A 1VQ1A 1T6OA 1DO0A 1VEJA 2WZJA 1XB2B 4GEWA 2G3QA 1P3QQ 2KNAA 2OOAA 2L4EA 2KHHA 1CUKA 2ZTCA 3E21A 3GLIE 1WJ7A 3E46A 2QNJA 3BBZA 2JY6B 2K0BX 3GLHE 2OOBA 1UFZA 1ZMVA 2H5XA 2JZ0A 1VEGA 3LCUA 1SG9A 1WR1B 2KNZA 2OO9A 3T6PA 1Y8GA 2BWBA 1HQYE 1HT1E 2HAKA 2LVAA 3K9PA 1OTRA 2JZ1A 2KNVA 3GLGE
chains in the Genus database with same CATH superfamily
3WHLA 1FJGM 2HKJA 1TH4A 3GQ4A 1D2NA 1Z5BA 1WHCA 3TQSA 2DAKA 1C1KA 4LFAM 2XEPA 3W0FA 2V1UA 2L4FA 1XXHA 2QQ8A 1AIPC 4G6ZA 1HQCA 3B74A 2Z4SA 1E9RA 2MJ5B 3HWSA 2FFJA 4DV2M 1ORYB 4B3RM 5A2QS 3FD9A 1IXSB 1KYIA 4I5SA 2DWLA 4Z8XA 3AL0C 3QYBA 5EP4A 4DR5M 2B3TA 3J7BA 1HJPA 4M0DA 3CF2A 3A46A 1ZAEA 2L7IA 4JI5M 1N78A 4GHLA 2I7NA 3K2LA 3FUUA 4G3OA 1J7KA 4Z6YA 1IN6A 2EKFA 1Q02A 1T43A 3DZDA 2XSZD 3SFZA 3GLIA 3AFHA 2L09A 4FCTA 2DENA 4FWDA 5EP1A 4X62M 4L8RC 5BR8M 3T15A 1AUAA 4DR3M 4FVMA 2LVQD 1QAQA 3B7QA 4GH9A 4I4LA 1DGGA 3H4JA 1LTMA 4L4UA 1WIVA 2K6BA 1SXJA 1D0LA 2ZAOA 2UXDM 3AJIB 2LTUA 3KVWA 2P5TA 2J7NA 2O5RA 1UM8A 4W5WA 1IQPA 3L29A 3TL4X 1XC8A 2O01F 2XH9A 3HJQA 5EJCA 2MROB 3HY5A 3HKPA 3J2PB 3SC3A 3GPYA 3M7GA 3VFDA 3ZCBB 1L2DA 1J09A 4FWHA 4I81A 1IN4A 5ITTA 3QAUA 3DFZA 1ZV1A 2K47A 1IBKM 2CV0A 1TF0B 5ITUA 1XMQM 2FOIC 3FYDA 2F5QA 3T38A 2O25A 3V76A 3MMPA 3IG8A 4XBOA 4LF7M 4GKJM 1TH2A 1WGNA 3GRRA 1NY6A 3JR5A 4DV1M 3FUTA 1QUSA 2BJVA 3KOXE 3L26A 2R6FA 4JI2M 3QWLA 2XZFA 2X49A 1ZMUA 3IECA 1K82A 4LCBA 2KRUA 2CFOA 2DI0A 1EE8A 3J27B 5FTJA 2F5SA 2XGNA 4PT5A 1NHGC 3FKEA 3KSJA 1VEJA 1H6UA 4NOOB 4B08A 4RF1A 5FLXS 1HNWM 4LJ6A 4QOSA 4HL4A 2VF8A 1MJGM 1TH3A 4JI8M 2C99A 2QCUA 4DV3M 2KHHA 3U6MA 1CUKA 4LRTA 3E21A 4I8OA 3U5ZA 4MGYE 1JR3D 4OVZB 3HHZA 4AKGA 4YY3M 5FSWA 2VIIA 1IN8A 2M60A 3LVWA 3W0LB 5LMNM 2H5XA 3JR4A 3HX3A 1SG9A 1Q39A 1XXHB 2KNZA 3C9PA 4LGMA 1K3XA 1Z59A 5IWAM 2JZ1A 1NNJA 1L2BA 2VDBB 3Q8GA 2Z4RA 1XNRM 5EXXA 2KNVA 3KOZE 5EQTA 3GLGE 3U60B 3HU3A 2EJSA 2C96A 4DR4M 3GP1A 1N36M 5KPTA 1VEKA 2KRKA 2H1RA 3CTWB 1OQYA 2E5LM 3SASA 4GIPA 5KQ8A 1PJTA 5KPZA 2YFQA 2FH0A 1DO2A 1NNUC 2CUZA 2XFTA 1GL7A 4G4NA 1OKSA 4NXNM 1R4GA 4NXMM 2DXIA 4CGYB 1IM2A 3AOGA 3B9PA 3K8ZA 4DR7M 1DV0A 3GLIB 2Z8YM 3IG5A 5JI2E 4CHTB 3U6OA 4LF8M 1NV8A 4GITA 1QQWA 2K9DA 1V92A 3AOEA 1W5SA 4IIWA 4JI3M 2APLA 2L2DA 3Q8XA 4GRIA 1Q3BA 5ITXE 1SXJB 3GLFE 4RNAA 1OAOC 3LVVA 4L6V6 1DGFA 4LJ7A 4AG6A 1QAMA 4IBJA 1NY5A 1IY1A 1YE9A 2MR9A 1QYRA 3NWLA 4M0WA 4MGKE 4WW0A 2ZM6M 4JI4M 1GLNA 4B3MM 3GRUA 2V1CA 3SHFA 2LH0A 1NO1A 1GJTA 4IBCA 4DR6M 1C7YA 1KSFX 3HHXA 1NV9A 3BOSA 1YLAA 1NJFA 3HJ8A 2XF3A 4L16A 2R45A 5EXTA 2CHGA 3LW5F 3GLGA 2Y20A 1TDZA 2V6ZM 2UXBM 2BWEA 3SAWA 1SXJC 5ITQA 1GO5A 3D8BA 2ZANA 4JI7M 2F4VM 2DVWB 1HT2E 2VF7A 1L1ZA 2DAIA 2CHQA 2L7HA 3FTFA 3FTDA 3KDSE 3PNYA 1IN7A 2DZLA 3JAMS 4GC9A 4S12A 4DUZM 3B89A 3J80S 4EIWA 1ZMWA 5EP2A 1IXZA 1V33A 1MN3A 4ZPXA 1D0KA 4IBIA 3GLHA 1HNZM 3IHPA 3TWLA 5DNYA 2DNAA 1DGHA 1K3WA 4CISA 2Q2EB 4HEOA 3KS8A 1E9SA 4AG5A 1TDHA 2J7OA 1QANA 1QUTA 4M9XA 1HR0M 5FTKA 1VDLA 4BLCA 2DKLA 2FNAA 1A5TA 5ITXA 3GLFA 4DV0M 3E9SA 4AQYM 1G4AE 4DBGB 2WZJA 1DO0A 3I04M 4NL4H 1XB2B 2G3QA 3TPZA 5LMUM 4KLNA 4RF0A 2Y21A 1R5LA 3KP0E 4LJ5A 1R6BX 2RGHA 3LQQA 2CEAA 2L4EA 4KODA 2R4JA 5E26A 1N77A 2DWMA 1E32A 4ITQA 3E46A 3ZC7B 5DYGA 2R4EA 2DZNB 4DV5M 1GVNA 1IY2A 2XZUA 4MH0E 1N75A 3R8FA 1L1TA 3H4MA 2RKOA 5F3WA 3J81S 2OOBA 1N34M 1IBMM 3SATA 3KXEC 2J5YA 3SBJA 2G5GX 1WR1B 2KZUA 3PFIA 2CV1A 2KDLA 4RKUF 4AKHA 2LVAA 3K9PA 2GQFA 4GMQA 5H37D 3U6PA 1OIZA 3QYEA 2R44A 3VLFB 3DA1A 2ZBKB 3U61A 1TGUA 4MGIE 3VDUA 4II7A 3HU2A 4Y28F 3AV0A 1QZEA 2A5YB 2I7PA 2LXEA 2HWJA 3MJ5A 4P16A 1F4IA 4PDIA 3EIEA 4X64M 3M6AA 5E6JA 1I94M 4R7GA 1GL6A 1Q3CA 4CIZA 1LV7A 2D7GA 2R0IA 3W68A 5KQDA 2JWSA 1IXRC 2XLJA 2OQ4A 2JY7A 2QPAA 3PVSA 1OFIA 2JY5A 3MHVC 3FRHA 4B7GA 3RFWA 3J7AS 4KHPM 3HZJA 3I4VA 3I51A 4LFBM 1TR8A 1SXJD 1Z5AA 4D80A 8CATA 3SYLA 1E94E 3KSXA 1ZQ9A 3U6SA 3HJSA 2WSFF 4JI1M 2EKKA 1R2YA 4DR1M 3MK6A 2CRUA 2G8LA 2C5RA 3AOEC 1OAIA 4JN6A 1N33M 1D0MA 4M9ZA 2YR0A 4XK8F 1BVSA 4JI6M 3GLGB 1W5TA 2BNKA 5FTNA 4PDGA 4PCZA 4LY6A 2GNOA 4LFCM 1FNNA 2KW0A 3SMSA 4IBBA 4NSRA 4A3VB 2VQEM 2OPFA 2HL7A 4FCWA 2QZ4A 3CGWA 3HU1A 2N35A 2RGOA 2ZTDA 3NBXX 3ZH9B 5ITRA 1NVMA 1IFYA 2QENA 2MGWA 5L8RF 1QZMA 2XSZA 3A42A 3VDPA 1NSFA 4DUYM 3UMMA 2QBYA 2JY8A 4IBEA 3D8LA 4QHSA 2LVOC 4XGIA 3GLHB 1R7RA 4R71A 3L28A 1DGHB 3E4RA 3FYCA 3GRYA 3LQRA 1G3IA 3C3DA 4JXJA 4M9SA 3SMPA 4DV4M 1JR3E 3B7ZA 2LNHC 3I4YA 3K92A 3GLFB 3U6EA 3FE3A 2EO2A 2LVNC 4IBFA 1J5EM 4L15A 2C9CA 2YQZA 2KZSA 4KO8A 4REZA 4NC6A 5IREB 4AI6A 2R46A 4NRWA 3CF6E 1T3TA 5IZ7D 1EFUB 2C9OA 4MGHA 4LF5M 4JYAM 2KA6B 1SXJE 2DZOB 2FE8A 4K0KM 5IT9S 4FW9A 4LJ9A 4LJAA 5FTMA 2L6OA 4Q7JA 2LVPC 3HHYA 3KP1E 5EXPA 1PJQA 1T6OA 1VQ1A 2AHMA 1I4WA 2Z7JA 3GRVA 3KOWE 4IJFA 1PJIA 4PD2A 1OIPA 3SYKA 2HCBA 2VQFM 2W82A 2OOAA 3OTOM 2F5OA 4B7FA 5KPRA 3GQ5A 3VK7A 3L27A 2UUBM 4NSOB 4X66M 2M5ZA 4HLQA 1G59A 3SAUA 2NQ8C 3A45A 4QNMA 5C1BA 1GJSA 1OJLA 4LF9M 4LF4M 2JY6B 2KEBA 3U61B 3U60A 3HHWA 4TUWA 3C58A 2K0BX 1EIJA 4B3SM 3LCUA 4LRSA 5C18A 4D81A 2ERCA 3T1HM 3NBIA 2F5PA 1Y8GA 3VK8A 3KFUG 1L8QA 2HAKA 3DOAA 3U5ZB 4MM3B 5EP3A 2YNMD 5KO3A 2QP9X 3A98B 3U6LA 3M0EA 1Z5CA 1DGBA 3K1JA 1JR3A 4P17A 3PXGA 3WHKA 4CJ6A 1XMOM 1PM5A 2DWNA 1YSYA 2QSFX 4IBGA 3FUXA 4IBDA 4KT0F 5DFLA 2Z3XA 3VKHA 4B3TM 4FWGA 3U6QA 4AW4A 3TWMA 2RRUA 1PRBA 4UN2B 1NHWC 1GKIA 2FS1A 4AKIA 1XWIA 2DAEA 4MB7A 4L78A 5DYIA 1PGYA 4AZFA 5GKNA 2JXNA 4G4RA 2DWZB 2CHVA 2CWBA 4G4OA 3RGPA 3AKZA 4GHAA 3UZUA 2D7HA 2X4AA 1R2ZA 4F2LA 2DAGA 1QAOA 3L25A 1IXSA 3FUWA 3GPXA 2ZAMA 4IBKA 4JI0M 2CP8A 3FTCA 1QVRA 3LMMA 2EUCA 3FRIA 4DV7M 5BPVA 3R9XB 2QBYB 3W67A 2DAMA 4X65M 1V34A 3K9OA 4DV6M 2MH8A 1QDRA 3TWKA 1N32M 1WGLA 2DHRA 1IY0A 3FUVA 1RU3A 4WP2A 3SAVA 4B7HA 3L2AA 3F92A 1KFVA 3THGA 2DHYA 3FTEA 2UXCM 3I01M 2R18A 3B7NA 2Y0QA 3ILKA 2HHHM 2LHGA 2JUJA 3C3EA 3KOYE 4R3DA 3SARA 1TTEA 3HGIA 3UGJA 4DR2M 1JQJC 2JP7A 4QNRA 1L2CA 3EIHA 4WURA 5ITYA 4IJEA 2WSCF 7CATA 3UJNA 1IBLM 1QDTA 2JA2A 1XXHE 2LHCA 2QHOB 1G8PA 1PJJA 4LF6M 2JNHA 1VG5A 4BB9A 1WXQA 2LBCA 2X8AA 4OU7A 4ANRA 2UUCM 1G71A 4FD2A 2CE7A 2D7EA 3CF0A 3LCVB 3ZQJA 1XHBA 3KW6A 3PNVA 4OW0A 2WSEF 5EXSA 1PJSA 4F1IA 2UU9M 2BJWA 4MGZE 2KXEA 3GO8A 2F5NA 1G41A 3U6CA 4NRVA 4QOZC 1S3SA 4GEWA 1IN5A 4YHHM 1P3QQ 2KNAA 1YUBA 2UUAM 1HNXM 3T1YM 4FCVA 1VDDA 2Y0TA 3RGSA 2EA0A 1XNQM 2ZTCA 1NJGA 3GLIE 2C98A 2CV2A 1WJ7A 4D82A 3GPUA 3GQ3A 1JB0F 4GC5A 3TE6A 2QNJA 2R65A 3BBZA 5JI3E 4LZZA 3U6DA 4LZJA 1MU5A 2R62A 1GABA 4LJ4A 4LGYA 1X37A 3GLHE 1UFZA 1ZMVA 2JZ0A 3GPPA 1VEGA 4QHTA 4G4QA 3VKGA 4LJ8A 3KS4A 4BBAA 4OX9M 1MX0A 2OO9A 3T6PA 2XFSA 2BWBA 1HQYE 1HT1E 2LWXA 3UK6A 5FTLA 4JV5M 1OTRA 4LG2A 4OVZA 1Z6TA 3SHGB 4GKKM 3RE8A 1OFHA 3BXWA
chains in the Genus database with same CATH topology
2EJSA 1WHCA 2DAKA 1VEKA 1QZEA 1OQYA 2L4FA 2QSFX 2HWJA 1AIPC 5DFLA 1F4IA 2MJ5B 2RRUA 1DO2A 1OKSA 1KYIA 1R4GA 2R0IA 4UN2B 1IM2A 1DV0A 2JY7A 2DAEA 5JI2E 1PGYA 2B3TA 2JY5A 3FRHA 1HJPA 1NV8A 2CWBA 2K9DA 1V92A 1TR8A 2L2DA 1E94E 4G3OA 4F2LA 2DAGA 2EKFA 1IXSA 3GLFE 1Q02A 1T43A 2EKKA 2CP8A 1OAIA 2DENA 3FRIA 2MR9A 1BVSA 2DAMA 3K9OA 2LVQD 3H4JA 1WIVA 1C7YA 1WGLA 1NV9A 2LTUA 1YLAA 4WP2A 2ZTDA 1IFYA 3F92A 2MGWA 2MROB 2DHYA 2BWEA 2JY8A 1GO5A 2LVOC 2JUJA 1HT2E 1ZV1A 4R71A 2DAIA 1TTEA 1G3IA 1JR3E 2JP7A 2DZLA 2O25A 3B89A 3FE3A 3MMPA 2LVNC 1XXHE 2QHOB 1ZMWA 2JNHA 1MN3A 1WGNA 1VG5A 3IHPA 2DNAA 1EFUB 2LBCA 4HEOA 1ZMUA 3LCVB 3IECA 1VDLA 2DKLA 1A5TA 2DI0A 4Q7JA 4F1IA 2LVPC 1G4AE 4DBGB 1G41A 1VQ1A 1T6OA 1DO0A 1VEJA 2WZJA 1XB2B 4GEWA 2G3QA 1P3QQ 2KNAA 2OOAA 2L4EA 2KHHA 1CUKA 2ZTCA 3E21A 3GLIE 1WJ7A 3E46A 2QNJA 3BBZA 2JY6B 2K0BX 3GLHE 2OOBA 1UFZA 1ZMVA 2H5XA 2JZ0A 1VEGA 3LCUA 1SG9A 1WR1B 2KNZA 2OO9A 3T6PA 1Y8GA 2BWBA 1HQYE 1HT1E 2HAKA 2LVAA 3K9PA 1OTRA 2JZ1A 2KNVA 3GLGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJS A;  1WHC A;  2DAK A;  1VEK A;  1QZE A;  1OQY A;  2L4F A;  2QSF X;  2HWJ A;  1AIP C;  5DFL A;  1F4I A;  2MJ5 B;  2RRU A;  1DO2 A;  1OKS A;  1KYI A;  1R4G A;  2R0I A;  4UN2 B;  1IM2 A;  1DV0 A;  2JY7 A;  2DAE A;  5JI2 E;  1PGY A;  2B3T A;  2JY5 A;  3FRH A;  1HJP A;  1NV8 A;  2CWB A;  2K9D A;  1V92 A;  1TR8 A;  2L2D A;  1E94 E;  4G3O A;  4F2L A;  2DAG A;  2EKF A;  1IXS A;  3GLF E;  1Q02 A;  1T43 A;  2EKK A;  2CP8 A;  1OAI A;  2DEN A;  3FRI A;  2MR9 A;  1BVS A;  2DAM A;  3K9O A;  2LVQ D;  3H4J A;  1WIV A;  1C7Y A;  1WGL A;  1NV9 A;  2LTU A;  1YLA A;  4WP2 A;  2ZTD A;  1IFY A;  3F92 A;  2MGW A;  2MRO B;  2DHY A;  2BWE A;  2JY8 A;  1GO5 A;  2LVO C;  2JUJ A;  1HT2 E;  1ZV1 A;  4R71 A;  2DAI A;  1TTE A;  1G3I A;  1JR3 E;  2JP7 A;  2DZL A;  2O25 A;  3B89 A;  3FE3 A;  3MMP A;  2LVN C;  1XXH E;  2QHO B;  1ZMW A;  2JNH A;  1MN3 A;  1WGN A;  1VG5 A;  3IHP A;  2DNA A;  1EFU B;  2LBC A;  4HEO A;  1ZMU A;  3LCV B;  3IEC A;  1VDL A;  2DKL A;  1A5T A;  2DI0 A;  4Q7J A;  4F1I A;  2LVP C;  1G4A E;  4DBG B;  1G41 A;  1VQ1 A;  1T6O A;  1DO0 A;  1VEJ A;  2WZJ A;  1XB2 B;  4GEW A;  2G3Q A;  1P3Q Q;  2KNA A;  2OOA A;  2L4E A;  2KHH A;  1CUK A;  2ZTC A;  3E21 A;  3GLI E;  1WJ7 A;  3E46 A;  2QNJ A;  3BBZ A;  2JY6 B;  2K0B X;  3GLH E;  2OOB A;  1UFZ A;  1ZMV A;  2H5X A;  2JZ0 A;  1VEG A;  3LCU A;  1SG9 A;  1WR1 B;  2KNZ A;  2OO9 A;  3T6P A;  1Y8G A;  2BWB A;  1HQY E;  1HT1 E;  2HAK A;  2LVA A;  3K9P A;  1OTR A;  2JZ1 A;  2KNV A;  3GLG E; 
#chains in the Genus database with same CATH topology
 3WHL A;  1FJG M;  2HKJ A;  1TH4 A;  3GQ4 A;  1D2N A;  1Z5B A;  1WHC A;  3TQS A;  2DAK A;  1C1K A;  4LFA M;  2XEP A;  3W0F A;  2V1U A;  2L4F A;  1XXH A;  2QQ8 A;  1AIP C;  4G6Z A;  1HQC A;  3B74 A;  2Z4S A;  1E9R A;  2MJ5 B;  3HWS A;  2FFJ A;  4DV2 M;  1ORY B;  4B3R M;  5A2Q S;  3FD9 A;  1IXS B;  1KYI A;  4I5S A;  2DWL A;  4Z8X A;  3AL0 C;  3QYB A;  5EP4 A;  4DR5 M;  2B3T A;  3J7B A;  1HJP A;  4M0D A;  3CF2 A;  3A46 A;  1ZAE A;  2L7I A;  4JI5 M;  1N78 A;  4GHL A;  2I7N A;  3K2L A;  3FUU A;  4G3O A;  1J7K A;  4Z6Y A;  1IN6 A;  2EKF A;  1Q02 A;  1T43 A;  3DZD A;  2XSZ D;  3SFZ A;  3GLI A;  3AFH A;  2L09 A;  4FCT A;  2DEN A;  4FWD A;  5EP1 A;  4X62 M;  4L8R C;  5BR8 M;  3T15 A;  1AUA A;  4DR3 M;  4FVM A;  2LVQ D;  1QAQ A;  3B7Q A;  4GH9 A;  4I4L A;  1DGG A;  3H4J A;  1LTM A;  4L4U A;  1WIV A;  2K6B A;  1SXJ A;  1D0L A;  2ZAO A;  2UXD M;  3AJI B;  2LTU A;  3KVW A;  2P5T A;  2J7N A;  2O5R A;  1UM8 A;  4W5W A;  1IQP A;  3L29 A;  3TL4 X;  1XC8 A;  2O01 F;  2XH9 A;  3HJQ A;  5EJC A;  2MRO B;  3HY5 A;  3HKP A;  3J2P B;  3SC3 A;  3GPY A;  3M7G A;  3VFD A;  3ZCB B;  1L2D A;  1J09 A;  4FWH A;  4I81 A;  1IN4 A;  5ITT A;  3QAU A;  3DFZ A;  1ZV1 A;  2K47 A;  1IBK M;  2CV0 A;  1TF0 B;  5ITU A;  1XMQ M;  2FOI C;  3FYD A;  2F5Q A;  3T38 A;  2O25 A;  3V76 A;  3MMP A;  3IG8 A;  4XBO A;  4LF7 M;  4GKJ M;  1TH2 A;  1WGN A;  3GRR A;  1NY6 A;  3JR5 A;  4DV1 M;  3FUT A;  1QUS A;  2BJV A;  3KOX E;  3L26 A;  2R6F A;  4JI2 M;  3QWL A;  2XZF A;  2X49 A;  1ZMU A;  3IEC A;  1K82 A;  4LCB A;  2KRU A;  2CFO A;  2DI0 A;  1EE8 A;  3J27 B;  5FTJ A;  2F5S A;  2XGN A;  4PT5 A;  1NHG C;  3FKE A;  3KSJ A;  1VEJ A;  1H6U A;  4NOO B;  4B08 A;  4RF1 A;  5FLX S;  1HNW M;  4LJ6 A;  4QOS A;  4HL4 A;  2VF8 A;  1MJG M;  1TH3 A;  4JI8 M;  2C99 A;  2QCU A;  4DV3 M;  2KHH A;  3U6M A;  1CUK A;  4LRT A;  3E21 A;  4I8O A;  3U5Z A;  4MGY E;  1JR3 D;  4OVZ B;  3HHZ A;  4AKG A;  4YY3 M;  5FSW A;  2VII A;  1IN8 A;  2M60 A;  3LVW A;  3W0L B;  5LMN M;  2H5X A;  3JR4 A;  3HX3 A;  1SG9 A;  1Q39 A;  1XXH B;  2KNZ A;  3C9P A;  4LGM A;  1K3X A;  1Z59 A;  5IWA M;  2JZ1 A;  1NNJ A;  1L2B A;  2VDB B;  3Q8G A;  2Z4R A;  1XNR M;  5EXX A;  2KNV A;  3KOZ E;  5EQT A;  3GLG E;  3U60 B;  3HU3 A;  2EJS A;  2C96 A;  4DR4 M;  3GP1 A;  1N36 M;  5KPT A;  1VEK A;  2KRK A;  2H1R A;  3CTW B;  1OQY A;  2E5L M;  3SAS A;  4GIP A;  5KQ8 A;  1PJT A;  5KPZ A;  2YFQ A;  2FH0 A;  1DO2 A;  1NNU C;  2CUZ A;  2XFT A;  1GL7 A;  4G4N A;  1OKS A;  4NXN M;  1R4G A;  4NXM M;  2DXI A;  4CGY B;  1IM2 A;  3AOG A;  3B9P A;  3K8Z A;  4DR7 M;  1DV0 A;  3GLI B;  2Z8Y M;  3IG5 A;  5JI2 E;  4CHT B;  3U6O A;  4LF8 M;  1NV8 A;  4GIT A;  1QQW A;  2K9D A;  1V92 A;  3AOE A;  1W5S A;  4IIW A;  4JI3 M;  2APL A;  2L2D A;  3Q8X A;  4GRI A;  1Q3B A;  5ITX E;  1SXJ B;  3GLF E;  4RNA A;  1OAO C;  3LVV A;  4L6V 6;  1DGF A;  4LJ7 A;  4AG6 A;  1QAM A;  4IBJ A;  1NY5 A;  1IY1 A;  1YE9 A;  2MR9 A;  1QYR A;  3NWL A;  4M0W A;  4MGK E;  4WW0 A;  2ZM6 M;  4JI4 M;  1GLN A;  4B3M M;  3GRU A;  2V1C A;  3SHF A;  2LH0 A;  1NO1 A;  1GJT A;  4IBC A;  4DR6 M;  1C7Y A;  1KSF X;  3HHX A;  1NV9 A;  3BOS A;  1YLA A;  1NJF A;  3HJ8 A;  2XF3 A;  4L16 A;  2R45 A;  5EXT A;  2CHG A;  3LW5 F;  3GLG A;  2Y20 A;  1TDZ A;  2V6Z M;  2UXB M;  2BWE A;  3SAW A;  1SXJ C;  5ITQ A;  1GO5 A;  3D8B A;  2ZAN A;  4JI7 M;  2F4V M;  2DVW B;  1HT2 E;  2VF7 A;  1L1Z A;  2DAI A;  2CHQ A;  2L7H A;  3FTF A;  3FTD A;  3KDS E;  3PNY A;  1IN7 A;  2DZL A;  3JAM S;  4GC9 A;  4S12 A;  4DUZ M;  3B89 A;  3J80 S;  4EIW A;  1ZMW A;  5EP2 A;  1IXZ A;  1V33 A;  1MN3 A;  4ZPX A;  1D0K A;  4IBI A;  3GLH A;  1HNZ M;  3IHP A;  3TWL A;  5DNY A;  2DNA A;  1DGH A;  1K3W A;  4CIS A;  2Q2E B;  4HEO A;  3KS8 A;  1E9S A;  4AG5 A;  1TDH A;  2J7O A;  1QAN A;  1QUT A;  4M9X A;  1HR0 M;  5FTK A;  1VDL A;  4BLC A;  2DKL A;  2FNA A;  1A5T A;  5ITX A;  3GLF A;  4DV0 M;  3E9S A;  4AQY M;  1G4A E;  4DBG B;  2WZJ A;  1DO0 A;  3I04 M;  4NL4 H;  1XB2 B;  2G3Q A;  3TPZ A;  5LMU M;  4KLN A;  4RF0 A;  2Y21 A;  1R5L A;  3KP0 E;  4LJ5 A;  1R6B X;  2RGH A;  3LQQ A;  2CEA A;  2L4E A;  4KOD A;  2R4J A;  5E26 A;  1N77 A;  2DWM A;  1E32 A;  4ITQ A;  3E46 A;  3ZC7 B;  5DYG A;  2R4E A;  2DZN B;  4DV5 M;  1GVN A;  1IY2 A;  2XZU A;  4MH0 E;  1N75 A;  3R8F A;  1L1T A;  3H4M A;  2RKO A;  5F3W A;  3J81 S;  2OOB A;  1N34 M;  1IBM M;  3SAT A;  3KXE C;  2J5Y A;  3SBJ A;  2G5G X;  1WR1 B;  2KZU A;  3PFI A;  2CV1 A;  2KDL A;  4RKU F;  4AKH A;  2LVA A;  3K9P A;  2GQF A;  4GMQ A;  5H37 D;  3U6P A;  1OIZ A;  3QYE A;  2R44 A;  3VLF B;  3DA1 A;  2ZBK B;  3U61 A;  1TGU A;  4MGI E;  3VDU A;  4II7 A;  3HU2 A;  4Y28 F;  3AV0 A;  1QZE A;  2A5Y B;  2I7P A;  2LXE A;  2HWJ A;  3MJ5 A;  4P16 A;  1F4I A;  4PDI A;  3EIE A;  4X64 M;  3M6A A;  5E6J A;  1I94 M;  4R7G A;  1GL6 A;  1Q3C A;  4CIZ A;  1LV7 A;  2D7G A;  2R0I A;  3W68 A;  5KQD A;  2JWS A;  1IXR C;  2XLJ A;  2OQ4 A;  2JY7 A;  2QPA A;  3PVS A;  1OFI A;  2JY5 A;  3MHV C;  3FRH A;  4B7G A;  3RFW A;  3J7A S;  4KHP M;  3HZJ A;  3I4V A;  3I51 A;  4LFB M;  1TR8 A;  1SXJ D;  1Z5A A;  4D80 A;  8CAT A;  3SYL A;  1E94 E;  3KSX A;  1ZQ9 A;  3U6S A;  3HJS A;  2WSF F;  4JI1 M;  2EKK A;  1R2Y A;  4DR1 M;  3MK6 A;  2CRU A;  2G8L A;  2C5R A;  3AOE C;  1OAI A;  4JN6 A;  1N33 M;  1D0M A;  4M9Z A;  2YR0 A;  4XK8 F;  1BVS A;  4JI6 M;  3GLG B;  1W5T A;  2BNK A;  5FTN A;  4PDG A;  4PCZ A;  4LY6 A;  2GNO A;  4LFC M;  1FNN A;  2KW0 A;  3SMS A;  4IBB A;  4NSR A;  4A3V B;  2VQE M;  2OPF A;  2HL7 A;  4FCW A;  2QZ4 A;  3CGW A;  3HU1 A;  2N35 A;  2RGO A;  2ZTD A;  3NBX X;  3ZH9 B;  5ITR A;  1NVM A;  1IFY A;  2QEN A;  2MGW A;  5L8R F;  1QZM A;  2XSZ A;  3A42 A;  3VDP A;  1NSF A;  4DUY M;  3UMM A;  2QBY A;  2JY8 A;  4IBE A;  3D8L A;  4QHS A;  2LVO C;  4XGI A;  3GLH B;  1R7R A;  4R71 A;  3L28 A;  1DGH B;  3E4R A;  3FYC A;  3GRY A;  3LQR A;  1G3I A;  3C3D A;  4JXJ A;  4M9S A;  3SMP A;  4DV4 M;  1JR3 E;  3B7Z A;  2LNH C;  3I4Y A;  3K92 A;  3GLF B;  3U6E A;  3FE3 A;  2EO2 A;  2LVN C;  4IBF A;  1J5E M;  4L15 A;  2C9C A;  2YQZ A;  2KZS A;  4KO8 A;  4REZ A;  4NC6 A;  5IRE B;  4AI6 A;  2R46 A;  4NRW A;  3CF6 E;  1T3T A;  5IZ7 D;  1EFU B;  2C9O A;  4MGH A;  4LF5 M;  4JYA M;  2KA6 B;  1SXJ E;  2DZO B;  2FE8 A;  4K0K M;  5IT9 S;  4FW9 A;  4LJ9 A;  4LJA A;  5FTM A;  2L6O A;  4Q7J A;  2LVP C;  3HHY A;  3KP1 E;  5EXP A;  1PJQ A;  1T6O A;  1VQ1 A;  2AHM A;  1I4W A;  2Z7J A;  3GRV A;  3KOW E;  4IJF A;  1PJI A;  4PD2 A;  1OIP A;  3SYK A;  2HCB A;  2VQF M;  2W82 A;  2OOA A;  3OTO M;  2F5O A;  4B7F A;  5KPR A;  3GQ5 A;  3VK7 A;  3L27 A;  2UUB M;  4NSO B;  4X66 M;  2M5Z A;  4HLQ A;  1G59 A;  3SAU A;  2NQ8 C;  3A45 A;  4QNM A;  5C1B A;  1GJS A;  1OJL A;  4LF9 M;  4LF4 M;  2JY6 B;  2KEB A;  3U61 B;  3U60 A;  3HHW A;  4TUW A;  3C58 A;  2K0B X;  1EIJ A;  4B3S M;  3LCU A;  4LRS A;  5C18 A;  4D81 A;  2ERC A;  3T1H M;  3NBI A;  2F5P A;  1Y8G A;  3VK8 A;  3KFU G;  1L8Q A;  2HAK A;  3DOA A;  3U5Z B;  4MM3 B;  5EP3 A;  2YNM D;  5KO3 A;  2QP9 X;  3A98 B;  3U6L A;  3M0E A;  1Z5C A;  1DGB A;  3K1J A;  1JR3 A;  4P17 A;  3PXG A;  3WHK A;  4CJ6 A;  1XMO M;  1PM5 A;  2DWN A;  1YSY A;  2QSF X;  4IBG A;  3FUX A;  4IBD A;  4KT0 F;  5DFL A;  2Z3X A;  3VKH A;  4B3T M;  4FWG A;  3U6Q A;  4AW4 A;  3TWM A;  2RRU A;  1PRB A;  4UN2 B;  1NHW C;  1GKI A;  2FS1 A;  4AKI A;  1XWI A;  2DAE A;  4MB7 A;  4L78 A;  5DYI A;  1PGY A;  4AZF A;  5GKN A;  2JXN A;  4G4R A;  2DWZ B;  2CHV A;  2CWB A;  4G4O A;  3RGP A;  3AKZ A;  4GHA A;  3UZU A;  2D7H A;  2X4A A;  1R2Z A;  4F2L A;  2DAG A;  1QAO A;  3L25 A;  1IXS A;  3FUW A;  3GPX A;  2ZAM A;  4IBK A;  4JI0 M;  2CP8 A;  3FTC A;  1QVR A;  3LMM A;  2EUC A;  3FRI A;  4DV7 M;  5BPV A;  3R9X B;  2QBY B;  3W67 A;  2DAM A;  4X65 M;  1V34 A;  3K9O A;  4DV6 M;  2MH8 A;  1QDR A;  3TWK A;  1N32 M;  1WGL A;  2DHR A;  1IY0 A;  3FUV A;  1RU3 A;  4WP2 A;  3SAV A;  4B7H A;  3L2A A;  3F92 A;  1KFV A;  3THG A;  2DHY A;  3FTE A;  2UXC M;  3I01 M;  2R18 A;  3B7N A;  2Y0Q A;  3ILK A;  2HHH M;  2LHG A;  2JUJ A;  3C3E A;  3KOY E;  4R3D A;  3SAR A;  1TTE A;  3HGI A;  3UGJ A;  4DR2 M;  1JQJ C;  2JP7 A;  4QNR A;  1L2C A;  3EIH A;  4WUR A;  5ITY A;  4IJE A;  2WSC F;  7CAT A;  3UJN A;  1IBL M;  1QDT A;  2JA2 A;  1XXH E;  2LHC A;  2QHO B;  1G8P A;  1PJJ A;  4LF6 M;  2JNH A;  1VG5 A;  4BB9 A;  1WXQ A;  2LBC A;  2X8A A;  4OU7 A;  4ANR A;  2UUC M;  1G71 A;  4FD2 A;  2CE7 A;  2D7E A;  3CF0 A;  3LCV B;  3ZQJ A;  1XHB A;  3KW6 A;  3PNV A;  4OW0 A;  2WSE F;  5EXS A;  1PJS A;  4F1I A;  2UU9 M;  2BJW A;  4MGZ E;  2KXE A;  3GO8 A;  2F5N A;  1G41 A;  3U6C A;  4NRV A;  4QOZ C;  1S3S A;  4GEW A;  1IN5 A;  4YHH M;  1P3Q Q;  2KNA A;  1YUB A;  2UUA M;  1HNX M;  3T1Y M;  4FCV A;  1VDD A;  2Y0T A;  3RGS A;  2EA0 A;  1XNQ M;  2ZTC A;  1NJG A;  3GLI E;  2C98 A;  2CV2 A;  1WJ7 A;  4D82 A;  3GPU A;  3GQ3 A;  1JB0 F;  4GC5 A;  3TE6 A;  2QNJ A;  2R65 A;  3BBZ A;  5JI3 E;  4LZZ A;  3U6D A;  4LZJ A;  1MU5 A;  2R62 A;  1GAB A;  4LJ4 A;  4LGY A;  1X37 A;  3GLH E;  1UFZ A;  1ZMV A;  2JZ0 A;  3GPP A;  1VEG A;  4QHT A;  4G4Q A;  3VKG A;  4LJ8 A;  3KS4 A;  4BBA A;  4OX9 M;  1MX0 A;  2OO9 A;  3T6P A;  2XFS A;  2BWB A;  1HQY E;  1HT1 E;  2LWX A;  3UK6 A;  5FTL A;  4JV5 M;  1OTR A;  4LG2 A;  4OVZ A;  1Z6T A;  3SHG B;  4GKK M;  3RE8 A;  1OFH A;  3BXW A; 
#chains in the Genus database with same CATH homology
 2EJS A;  1WHC A;  2DAK A;  1VEK A;  1QZE A;  1OQY A;  2L4F A;  2QSF X;  2HWJ A;  1AIP C;  5DFL A;  1F4I A;  2MJ5 B;  2RRU A;  1DO2 A;  1OKS A;  1KYI A;  1R4G A;  2R0I A;  4UN2 B;  1IM2 A;  1DV0 A;  2JY7 A;  2DAE A;  5JI2 E;  1PGY A;  2B3T A;  2JY5 A;  3FRH A;  1HJP A;  1NV8 A;  2CWB A;  2K9D A;  1V92 A;  1TR8 A;  2L2D A;  1E94 E;  4G3O A;  4F2L A;  2DAG A;  2EKF A;  1IXS A;  3GLF E;  1Q02 A;  1T43 A;  2EKK A;  2CP8 A;  1OAI A;  2DEN A;  3FRI A;  2MR9 A;  1BVS A;  2DAM A;  3K9O A;  2LVQ D;  3H4J A;  1WIV A;  1C7Y A;  1WGL A;  1NV9 A;  2LTU A;  1YLA A;  4WP2 A;  2ZTD A;  1IFY A;  3F92 A;  2MGW A;  2MRO B;  2DHY A;  2BWE A;  2JY8 A;  1GO5 A;  2LVO C;  2JUJ A;  1HT2 E;  1ZV1 A;  4R71 A;  2DAI A;  1TTE A;  1G3I A;  1JR3 E;  2JP7 A;  2DZL A;  2O25 A;  3B89 A;  3FE3 A;  3MMP A;  2LVN C;  1XXH E;  2QHO B;  1ZMW A;  2JNH A;  1MN3 A;  1WGN A;  1VG5 A;  3IHP A;  2DNA A;  1EFU B;  2LBC A;  4HEO A;  1ZMU A;  3LCV B;  3IEC A;  1VDL A;  2DKL A;  1A5T A;  2DI0 A;  4Q7J A;  4F1I A;  2LVP C;  1G4A E;  4DBG B;  1G41 A;  1VQ1 A;  1T6O A;  1DO0 A;  1VEJ A;  2WZJ A;  1XB2 B;  4GEW A;  2G3Q A;  1P3Q Q;  2KNA A;  2OOA A;  2L4E A;  2KHH A;  1CUK A;  2ZTC A;  3E21 A;  3GLI E;  1WJ7 A;  3E46 A;  2QNJ A;  3BBZ A;  2JY6 B;  2K0B X;  3GLH E;  2OOB A;  1UFZ A;  1ZMV A;  2H5X A;  2JZ0 A;  1VEG A;  3LCU A;  1SG9 A;  1WR1 B;  2KNZ A;  2OO9 A;  3T6P A;  1Y8G A;  2BWB A;  1HQY E;  1HT1 E;  2HAK A;  2LVA A;  3K9P A;  1OTR A;  2JZ1 A;  2KNV A;  3GLG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...