2DZLA

Solution structure of the uba domain in human protein fam100b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'GSSGSSGMSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FAM100B
publication title Solution Structure of the UBA domain in Human Protein FAM100B
rcsb
source organism Homo sapiens
molecule tags Structural genomics unknown function
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dzlA00
2H5XA 1AIPC 1WIVA 4DBGB 4R71A 2O25A 1DO2A 1Q02A 1G3IA 2DAKA 2DAMA 4F1IA 5JI2E 3T6PA 4UN2B 3GLHE 4F2LA 2LVAA 1BVSA 4HEOA 1VEJA 2JY8A 2OOBA 2EJSA 1ZMVA 2DAIA 1P3QQ 1IM2A 3FRIA 2QSFX 2CP8A 2ZTDA 2MGWA 1KYIA 1XB2B 1IFYA 2HWJA 2JY6B 2ZTCA 1R4GA 2JP7A 1VDLA 3H4JA 1GO5A 2KHHA 1VEKA 1WGLA 1EFUB 2KNZA 2QNJA 1T6OA 3E46A 3F92A 2LVPC 3IHPA 1TR8A 1VG5A 1DV0A 1G41A 1PGYA 1F4IA 2LTUA 1DO0A 2BWEA 1HQYE 3GLGE 2LBCA 1OKSA 1ZV1A 2MR9A 2DAGA 2EKFA 3B89A 2DZLA 3BBZA 3GLFE 1C7YA 1T43A 1V92A 1MN3A 2DI0A 1VQ1A 2CWBA 1NV9A 1QZEA 1WR1B 2B3TA 1TTEA 2BWBA 2OO9A 1SG9A 2DNAA 1ZMWA 3FRHA 3LCUA 1HJPA 4WP2A 1WJ7A 1VEGA 4GEWA 2MJ5B 2L4EA 2EKKA 1A5TA 2K0BX 3LCVB 2G3QA 1CUKA 2MROB 2JZ1A 1G4AE 2K9DA 2JY5A 1Y8GA 2QHOB 1OAIA 1WHCA 2KNVA 2HAKA 1XXHE 2L2DA 2LVOC 2JUJA 3K9PA 4Q7JA 1NV8A 2KNAA 2OOAA 1IXSA 5DFLA 2DKLA 2LVQD 2JY7A 2RRUA 3E21A 1ZMUA 3GLIE 1OQYA 1OTRA 3MMPA 1UFZA 3K9OA 2JNHA 1HT1E 1HT2E 4G3OA 1WGNA 2LVNC 3IECA 2DHYA 3FE3A 1E94E 2JZ0A 2WZJA 2L4FA 2DAEA 2R0IA 2DENA 1JR3E 1YLAA
chains in the Genus database with same CATH superfamily
2QQ8A 4IJEA 1OJLA 1XXHA 3T15A 1D0LA 4G4RA 1WIVA 3JR4A 1W5TA 2C9CA 2GQFA 2LWXA 2LNHC 4LF8M 2C99A 3TWKA 3ZQJA 4DR2M 1N36M 2P5TA 3SYKA 3FUTA 1ZQ9A 1IY2A 2QBYB 4NXNM 4X62M 3KXEC 1NJGA 4NOOB 4PT5A 5A2QS 4LJ6A 4JI5M 1D0MA 3DOAA 3KVWA 2OOBA 4DR4M 5ITYA 1G59A 3MJ5A 4L78A 3FRIA 1OIPA 3M0EA 2DVWB 4II7A 4S12A 3GLFB 2ZTDA 1L8QA 2MGWA 2ZAMA 4LZJA 3VKHA 3R8FA 4B3SM 3B7NA 2ZTCA 3TL4X 2BJWA 5FTJA 4B08A 2JP7A 3FUWA 2R46A 4JI8M 2F5QA 2KNZA 2W82A 5C18A 1MU5A 1T6OA 3GRVA 5E26A 4YY3M 3HHYA 2LVPC 4M9SA 1TR8A 4R7GA 1RU3A 3VDPA 4AKHA 3U61B 3U60A 3GQ3A 4LJ8A 1PGYA 2G5GX 4ZPXA 3KP0E 2EUCA 5DYGA 4JYAM 1DO0A 3LW5F 1HQYE 1SXJD 3K1JA 3KSXA 4LY6A 4M9XA 1YE9A 3GO8A 2YQZA 3LVVA 2QCUA 3ZC7B 4GKJM 3HU2A 5EP2A 1L2BA 1T43A 2X49A 1MN3A 3SAUA 1OFHA 3B7ZA 1HNWM 2CWBA 5ITRA 2NQ8C 3KDSE 1L2DA 1LTMA 3FTDA 3RGPA 3HWSA 4FVMA 3TWLA 1N32M 4GHAA 3B74A 4MGZE 4P16A 4LJ4A 4NSOB 5GKNA 3SHGB 4QHSA 1XXHB 1ZAEA 1XMOM 1HJPA 4XGIA 5JI3E 2XF3A 1LV7A 4MGHA 1PJJA 4B3TM 3QYEA 3CF0A 3PVSA 3Q8GA 1K3XA 3SHFA 2ERCA 3C3DA 2L4EA 5BPVA 3OTOM 3VFDA 4B7GA 2VQFM 4AW4A 4LF6M 1A5TA 4LGYA 2V1CA 2R18A 2XSZD 4LFBM 5EP1A 2MROB 4IJFA 1IBKM 2JZ1A 2CE7A 3K8ZA 4I8OA 3KS4A 4YHHM 2CV2A 2K9DA 2JY5A 2XFSA 5KQ8A 1DGFA 2I7PA 2QHOB 4KODA 2CRUA 4FCVA 2M5ZA 1OAIA 3SC3A 3PFIA 3KFUG 1WHCA 1G71A 2D7HA 2CFOA 5EP4A 3K9PA 4Q7JA 5EXTA 4D80A 7CATA 5ITTA 2OOAA 1IXSA 4CJ6A 4QNRA 2Y20A 4NL4H 3RGSA 2F5PA 2DWLA 4JI4M 2HCBA 3GLFA 3RE8A 2KZSA 3U60B 2FNAA 2JNHA 4G3OA 4AG5A 1PRBA 2LVNC 4PCZA 2YFQA 3A98B 3FE3A 4PD2A 5FTLA 1GABA 4L16A 3J81S 5DYIA 2XFTA 2FH0A 4X66M 1PJTA 3A45A 3SAVA 4IBFA 2C9OA 1IY0A 2Y21A 5LMNM 2L7IA 4XBOA 2C5RA 3KSJA 2E5LM 3HZJA 5ITXA 2DXIA 2R45A 3AKZA 3GLIA 2BJVA 1R2ZA 2G8LA 5E6JA 4NRWA 1NHGC 3J80S 2DHRA 3HU1A 3GQ4A 3NBXX 4F2LA 2VIIA 1BVSA 3T1HM 4JI1M 1IN4A 1TGUA 1V33A 1ZMVA 3SMSA 1P3QQ 3KOXE 3I01M 4LFCM 4GC5A 2V1UA 3SASA 2LHCA 4DR7M 4I81A 1W5SA 2QENA 2HL7A 4GH9A 2Z8YM 1N78A 4L8RC 4L4UA 3VKGA 1VDLA 1H6UA 4RF1A 1GO5A 2KHHA 4W5WA 2Z7JA 3HHXA 4FW9A 3LQRA 5ITUA 4FWGA 4LFAM 3GLHA 3CF2A 4FWHA 2J7NA 4DV0M 3GPXA 1G41A 1IQPA 2KDLA 3PNVA 3J7AS 1L1ZA 1IN7A 2KW0A 1QANA 2BWEA 4I4LA 3B9PA 5KO3A 4NRVA 2VQEM 3FTCA 1IXSB 1QAMA 4LF5M 1ZV1A 1R7RA 2DWZB 2WSFF 4LGMA 2UU9M 3SARA 2EKFA 4DR6M 3B89A 3BBZA 3H4MA 4IBKA 3GQ5A 3GLFE 3MHVC 3VK7A 4BLCA 4IBIA 2L6OA 3E9SA 2DI0A 1TH4A 3FUXA 4G4OA 4LF4M 1G8PA 1TTEA 4MGKE 4JI6M 1DGHA 3UK6A 2XLJA 2CV0A 1Z59A 2DNAA 5FSWA 2D7EA 2ZM6M 1FNNA 1Z6TA 1SXJA 2CHQA 4KO8A 4QNMA 3GLGA 3FYCA 1V34A 3K2LA 4WP2A 5FTMA 4A3VB 2OQ4A 4CISA 4GEWA 1YUBA 1WXQA 2R4JA 2RKOA 3R9XB 1QVRA 3GLIB 1XMQM 2JWSA 3HX3A 4FWDA 3HY5A 1L2CA 4LJ9A 4Z6YA 4M0WA 2K0BX 4IBGA 4QOSA 4PDGA 3AOGA 2G3QA 3PNYA 4MM3B 3HJ8A 3IG5A 2JA2A 1SXJC 3HJSA 1GLNA 1Q3CA 1UM8A 1QQWA 1QUSA 5F3WA 5EXSA 1KSFX 2EO2A 3L27A 2R44A 4QHTA 3QAUA 4NSRA 2KNVA 2HAKA 5ITQA 1IBLM 3W68A 1XXHE 1HNXM 4AKIA 1N33M 5FTKA 4MGYE 1NV8A 2L09A 3VK8A 5DFLA 5IWAM 5IT9S 2JY7A 4JI7M 3GLHB 3DZDA 4AG6A 2MH8A 3GRYA 3L26A 1D2NA 1XNQM 3L25A 1WGNA 2C98A 3SYLA 1MJGM 3SFZA 1E94E 1OFIA 1TH3A 4GC9A 3SAWA 2DAEA 1D0KA 2R0IA 2DENA 1IN5A 4LJ7A 4CGYB 1Q3BA 2VF7A 1AIPC 4IBDA 4DBGB 2UUAM 4ITQA 1I4WA 5DNYA 1DO2A 1Q02A 4LRTA 1G3IA 2DAMA 1GJTA 4JXJA 4F1IA 4L6V6 4NC6A 2X8AA 4DR5M 1DGHB 4M9ZA 2Z4SA 1I94M 1SXJE 4LCBA 5KPZA 3T6PA 4FD2A 1SXJB 3WHKA 3W0LB 3GPPA 3U6QA 4QOZC 2LVAA 3GLGB 4HL4A 3QWLA 1VDDA 2JY8A 3AOEA 4WURA 3GRUA 4TUWA 4LZZA 1IM2A 3TWMA 3U6PA 1GVNA 2CP8A 1N34M 3NWLA 3UGJA 5EJCA 2HWJA 1IBMM 3FUVA 4G6ZA 2JY6B 1HR0M 1IXRC 4AI6A 4DV7M 4LRSA 1PM5A 3BOSA 4OW0A 3AV0A 2BNKA 2R6FA 1JR3D 2YNMD 3U6LA 4BB9A 4KHPM 2HKJA 1WGLA 1EFUB 3A42A 5EP3A 3CTWB 2Z3XA 3E46A 1QYRA 3KOYE 2LH0A 3IHPA 1VG5A 3E4RA 3MK6A 1DV0A 4L15A 3JAMS 4LF9M 1F4IA 4B3MM 3CGWA 1NHWC 2H1RA 2R65A 3I51A 1IXZA 1L1TA 3FD9A 1OKSA 1NNUC 1EE8A 3DA1A 3DFZA 3AL0C 3U6SA 3Q8XA 4P17A 1FJGM 4AQYM 5BR8M 3U6DA 5H37D 1NY6A 1NJFA 1YSYA 1QDTA 2DZOB 1J5EM 2UXCM 1VQ1A 4DR3M 1NV9A 1QZEA 2QPAA 2DWMA 2V6ZM 2UUBM 1PJSA 2B3TA 4DR1M 2OO9A 3GRRA 3VLFB 3T1YM 2UXDM 2WSCF 2RGHA 4B7HA 1QAQA 3GP1A 2I7NA 1Z5CA 1ZMWA 1NO1A 1AUAA 2QZ4A 3FRHA 2FS1A 3ILKA 3LCUA 2D7GA 3M6AA 3K92A 3C9PA 4Z8XA 4B3RM 2KA6B 3UJNA 4GKKM 2UUCM 2APLA 2XH9A 2MJ5B 3AJIB 4OVZA 4REZA 1QUTA 1R6BX 1S3SA 1Z5BA 3KP1E 2XEPA 2L7HA 3I4YA 1T3TA 2EKKA 2O01F 1C1KA 2QP9X 3BXWA 2KRUA 3LCVB 2N35A 4JI2M 5EQTA 3GPUA 3L2AA 5KPRA 1N75A 1HQCA 2YR0A 1NY5A 1JB0F 3I4VA 1EIJA 3U5ZA 4JN6A 2M60A 2ZBKB 2XZUA 4GRIA 4RF0A 1TF0B 4FCWA 5FLXS 2DZNB 4I5SA 5EXPA 1MX0A 3LVWA 2L2DA 2LVOC 4G4QA 1PJQA 2JUJA 4FCTA 1NVMA 2KNAA 2CV1A 3TE6A 2DKLA 2XZFA 2FOIC 4JI3M 5ITXE 1ZMUA 3GLIE 3SATA 3LQQA 1OQYA 1OTRA 3MMPA 1UFZA 3K9OA 1GL6A 3FKEA 1HT1E 1HT2E 2UXBM 4IIWA 2K47A 4LJAA 1NSFA 3IECA 2DHYA 3U6OA 1J09A 2WZJA 4IBEA 4Y28F 3U6CA 4M0DA 1DGBA 2Z4RA 2Q2EB 2XGNA 3U6EA 4NXMM 1E9RA 5KPTA 4HLQA 2H5XA 5IZ7D 1R2YA 4LF7M 4OX9M 4CIZA 3B7QA 4GIPA 3HGIA 4R71A 3ZH9B 2O25A 2J5YA 2Y0QA 1IY1A 3W67A 2DAKA 2O5RA 3UZUA 1HNZM 5JI2E 4DV1M 5L8RF 4GHLA 1X37A 3C3EA 4UN2B 4G4NA 3GLHE 1OIZA 4K0KM 4CHTB 2XSZA 4HEOA 1IN6A 1VEJA 2CHVA 2EJSA 2DAIA 1PJIA 2ZANA 4OVZB 3SMPA 2F5NA 2KRKA 2QSFX 4GMQA 4JI0M 1E32A 1KYIA 1XB2B 3IG8A 1IFYA 2WSEF 3TQSA 1XNRM 4X64M 4EIWA 3GPYA 3THGA 1R4GA 3U6MA 2RGOA 5C1BA 3H4JA 2FE8A 2VDBB 1VEKA 2DWNA 1TH2A 2QNJA 3F92A 3KS8A 3U5ZB 4AKGA 3L29A 4MH0E 3ZCBB 1TDHA 1K82A 1QZMA 3HKPA 3D8BA 2JXNA 2ZAOA 2KEBA 1DGGA 2LTUA 1XWIA 4MGIE 2CEAA 1ORYB 3GLGE 1XC8A 4IBJA 2LBCA 2MR9A 4DV6M 2DAGA 3UMMA 3CF6E 2KZUA 3FUUA 1JR3A 2DZLA 1C7YA 3VDUA 8CATA 1GKIA 2OPFA 1V92A 4BBAA 2EA0A 5LMUM 3D8LA 5KQDA 3RFWA 1QAOA 4OU7A 4KT0F 3PXGA 1WR1B 3I04M 4DV2M 2BWBA 2F5SA 3J27B 4X65M 1SG9A 3HHWA 1OAOC 2QBYA 2J7OA 3J7BA 2K6BA 3HJQA 3HU3A 4D81A 1GL7A 4RKUF 4IBCA 3TPZA 2F4VM 1KFVA 1WJ7A 3AOEC 1VEGA 3EIEA 3FYDA 3L28A 5EXXA 5IREB 4DUZM 3SBJA 2LHGA 4B7FA 4DV3M 1NNJA 3AFHA 3T38A 4XK8F 1N77A 2A5YB 2AHMA 2LXEA 2C96A 3WHLA 2R62A 1CUKA 2GNOA 3A46A 3KOWE 1XHBA 3KW6A 4ANRA 1G4AE 1GJSA 1Y8GA 3U61A 2HHHM 2F5OA 4LJ5A 4RNAA 3FTEA 1Q39A 1IN8A 1JQJC 2VF8A 2KXEA 3M7GA 1K3WA 4IBBA 2CHGA 1QDRA 4D82A 4GITA 4AZFA 2LVQD 3LMMA 2RRUA 3E21A 3JR5A 3V76A 2X4AA 4DUYM 4DV5M 1J7KA 1E9SA 3QYBA 2Y0TA 3J2PB 4DV4M 1TDZA 3FTFA 3HHZA 2FFJA 3EIHA 4PDIA 2CUZA 4LG2A 4WW0A 3C58A 4KLNA 2JZ0A 3W0FA 4R3DA 3NBIA 2L4FA 2R4EA 1R5LA 1JR3E 3KOZE 1Z5AA 5FTNA 4MB7A 1YLAA 4JV5M
chains in the Genus database with same CATH topology
2H5XA 1AIPC 1WIVA 4DBGB 4R71A 2O25A 1DO2A 1Q02A 1G3IA 2DAKA 2DAMA 4F1IA 5JI2E 3T6PA 4UN2B 3GLHE 4F2LA 2LVAA 1BVSA 4HEOA 1VEJA 2JY8A 2OOBA 2EJSA 1ZMVA 2DAIA 1P3QQ 1IM2A 3FRIA 2QSFX 2CP8A 2ZTDA 2MGWA 1KYIA 1XB2B 1IFYA 2HWJA 2JY6B 2ZTCA 1R4GA 2JP7A 1VDLA 3H4JA 1GO5A 2KHHA 1VEKA 1WGLA 1EFUB 2KNZA 2QNJA 1T6OA 3E46A 3F92A 2LVPC 3IHPA 1TR8A 1VG5A 1DV0A 1G41A 1PGYA 1F4IA 2LTUA 1DO0A 2BWEA 1HQYE 3GLGE 2LBCA 1OKSA 1ZV1A 2MR9A 2DAGA 2EKFA 3B89A 2DZLA 3BBZA 3GLFE 1C7YA 1T43A 1V92A 1MN3A 2DI0A 1VQ1A 2CWBA 1NV9A 1QZEA 1WR1B 2B3TA 1TTEA 2BWBA 2OO9A 1SG9A 2DNAA 1ZMWA 3FRHA 3LCUA 1HJPA 4WP2A 1WJ7A 1VEGA 4GEWA 2MJ5B 2L4EA 2EKKA 1A5TA 2K0BX 3LCVB 2G3QA 1CUKA 2MROB 2JZ1A 1G4AE 2K9DA 2JY5A 1Y8GA 2QHOB 1OAIA 1WHCA 2KNVA 2HAKA 1XXHE 2L2DA 2LVOC 2JUJA 3K9PA 4Q7JA 1NV8A 2KNAA 2OOAA 1IXSA 5DFLA 2DKLA 2LVQD 2JY7A 2RRUA 3E21A 1ZMUA 3GLIE 1OQYA 1OTRA 3MMPA 1UFZA 3K9OA 2JNHA 1HT1E 1HT2E 4G3OA 1WGNA 2LVNC 3IECA 2DHYA 3FE3A 1E94E 2JZ0A 2WZJA 2L4FA 2DAEA 2R0IA 2DENA 1JR3E 1YLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5X A;  1AIP C;  1WIV A;  4DBG B;  4R71 A;  2O25 A;  1DO2 A;  1Q02 A;  1G3I A;  2DAK A;  2DAM A;  4F1I A;  5JI2 E;  3T6P A;  4UN2 B;  3GLH E;  4F2L A;  2LVA A;  1BVS A;  4HEO A;  1VEJ A;  2JY8 A;  2OOB A;  2EJS A;  1ZMV A;  2DAI A;  1P3Q Q;  1IM2 A;  3FRI A;  2QSF X;  2CP8 A;  2ZTD A;  2MGW A;  1KYI A;  1XB2 B;  1IFY A;  2HWJ A;  2JY6 B;  2ZTC A;  1R4G A;  2JP7 A;  1VDL A;  3H4J A;  1GO5 A;  2KHH A;  1VEK A;  1WGL A;  1EFU B;  2KNZ A;  2QNJ A;  1T6O A;  3E46 A;  3F92 A;  2LVP C;  3IHP A;  1TR8 A;  1VG5 A;  1DV0 A;  1G41 A;  1PGY A;  1F4I A;  2LTU A;  1DO0 A;  2BWE A;  1HQY E;  3GLG E;  2LBC A;  1OKS A;  1ZV1 A;  2MR9 A;  2DAG A;  2EKF A;  3B89 A;  2DZL A;  3BBZ A;  3GLF E;  1C7Y A;  1T43 A;  1V92 A;  1MN3 A;  2DI0 A;  1VQ1 A;  2CWB A;  1NV9 A;  1QZE A;  1WR1 B;  2B3T A;  1TTE A;  2BWB A;  2OO9 A;  1SG9 A;  2DNA A;  1ZMW A;  3FRH A;  3LCU A;  1HJP A;  4WP2 A;  1WJ7 A;  1VEG A;  4GEW A;  2MJ5 B;  2L4E A;  2EKK A;  1A5T A;  2K0B X;  3LCV B;  2G3Q A;  1CUK A;  2MRO B;  2JZ1 A;  1G4A E;  2K9D A;  2JY5 A;  1Y8G A;  2QHO B;  1OAI A;  1WHC A;  2KNV A;  2HAK A;  1XXH E;  2L2D A;  2LVO C;  2JUJ A;  3K9P A;  4Q7J A;  1NV8 A;  2KNA A;  2OOA A;  1IXS A;  5DFL A;  2DKL A;  2LVQ D;  2JY7 A;  2RRU A;  3E21 A;  1ZMU A;  3GLI E;  1OQY A;  1OTR A;  3MMP A;  1UFZ A;  3K9O A;  2JNH A;  1HT1 E;  1HT2 E;  4G3O A;  1WGN A;  2LVN C;  3IEC A;  2DHY A;  3FE3 A;  1E94 E;  2JZ0 A;  2WZJ A;  2L4F A;  2DAE A;  2R0I A;  2DEN A;  1JR3 E;  1YLA A; 
#chains in the Genus database with same CATH topology
 2QQ8 A;  4IJE A;  1OJL A;  1XXH A;  3T15 A;  1D0L A;  4G4R A;  1WIV A;  3JR4 A;  1W5T A;  2C9C A;  2GQF A;  2LWX A;  2LNH C;  4LF8 M;  2C99 A;  3TWK A;  3ZQJ A;  4DR2 M;  1N36 M;  2P5T A;  3SYK A;  3FUT A;  1ZQ9 A;  1IY2 A;  2QBY B;  4NXN M;  4X62 M;  3KXE C;  1NJG A;  4NOO B;  4PT5 A;  5A2Q S;  4LJ6 A;  4JI5 M;  1D0M A;  3DOA A;  3KVW A;  2OOB A;  4DR4 M;  5ITY A;  1G59 A;  3MJ5 A;  4L78 A;  3FRI A;  1OIP A;  3M0E A;  2DVW B;  4II7 A;  4S12 A;  3GLF B;  2ZTD A;  1L8Q A;  2MGW A;  2ZAM A;  4LZJ A;  3VKH A;  3R8F A;  4B3S M;  3B7N A;  2ZTC A;  3TL4 X;  2BJW A;  5FTJ A;  4B08 A;  2JP7 A;  3FUW A;  2R46 A;  4JI8 M;  2F5Q A;  2KNZ A;  2W82 A;  5C18 A;  1MU5 A;  1T6O A;  3GRV A;  5E26 A;  4YY3 M;  3HHY A;  2LVP C;  4M9S A;  1TR8 A;  4R7G A;  1RU3 A;  3VDP A;  4AKH A;  3U61 B;  3U60 A;  3GQ3 A;  4LJ8 A;  1PGY A;  2G5G X;  4ZPX A;  3KP0 E;  2EUC A;  5DYG A;  4JYA M;  1DO0 A;  3LW5 F;  1HQY E;  1SXJ D;  3K1J A;  3KSX A;  4LY6 A;  4M9X A;  1YE9 A;  3GO8 A;  2YQZ A;  3LVV A;  2QCU A;  3ZC7 B;  4GKJ M;  3HU2 A;  5EP2 A;  1L2B A;  1T43 A;  2X49 A;  1MN3 A;  3SAU A;  1OFH A;  3B7Z A;  1HNW M;  2CWB A;  5ITR A;  2NQ8 C;  3KDS E;  1L2D A;  1LTM A;  3FTD A;  3RGP A;  3HWS A;  4FVM A;  3TWL A;  1N32 M;  4GHA A;  3B74 A;  4MGZ E;  4P16 A;  4LJ4 A;  4NSO B;  5GKN A;  3SHG B;  4QHS A;  1XXH B;  1ZAE A;  1XMO M;  1HJP A;  4XGI A;  5JI3 E;  2XF3 A;  1LV7 A;  4MGH A;  1PJJ A;  4B3T M;  3QYE A;  3CF0 A;  3PVS A;  3Q8G A;  1K3X A;  3SHF A;  2ERC A;  3C3D A;  2L4E A;  5BPV A;  3OTO M;  3VFD A;  4B7G A;  2VQF M;  4AW4 A;  4LF6 M;  1A5T A;  4LGY A;  2V1C A;  2R18 A;  2XSZ D;  4LFB M;  5EP1 A;  2MRO B;  4IJF A;  1IBK M;  2JZ1 A;  2CE7 A;  3K8Z A;  4I8O A;  3KS4 A;  4YHH M;  2CV2 A;  2K9D A;  2JY5 A;  2XFS A;  5KQ8 A;  1DGF A;  2I7P A;  2QHO B;  4KOD A;  2CRU A;  4FCV A;  2M5Z A;  1OAI A;  3SC3 A;  3PFI A;  3KFU G;  1WHC A;  1G71 A;  2D7H A;  2CFO A;  5EP4 A;  3K9P A;  4Q7J A;  5EXT A;  4D80 A;  7CAT A;  5ITT A;  2OOA A;  1IXS A;  4CJ6 A;  4QNR A;  2Y20 A;  4NL4 H;  3RGS A;  2F5P A;  2DWL A;  4JI4 M;  2HCB A;  3GLF A;  3RE8 A;  2KZS A;  3U60 B;  2FNA A;  2JNH A;  4G3O A;  4AG5 A;  1PRB A;  2LVN C;  4PCZ A;  2YFQ A;  3A98 B;  3FE3 A;  4PD2 A;  5FTL A;  1GAB A;  4L16 A;  3J81 S;  5DYI A;  2XFT A;  2FH0 A;  4X66 M;  1PJT A;  3A45 A;  3SAV A;  4IBF A;  2C9O A;  1IY0 A;  2Y21 A;  5LMN M;  2L7I A;  4XBO A;  2C5R A;  3KSJ A;  2E5L M;  3HZJ A;  5ITX A;  2DXI A;  2R45 A;  3AKZ A;  3GLI A;  2BJV A;  1R2Z A;  2G8L A;  5E6J A;  4NRW A;  1NHG C;  3J80 S;  2DHR A;  3HU1 A;  3GQ4 A;  3NBX X;  4F2L A;  2VII A;  1BVS A;  3T1H M;  4JI1 M;  1IN4 A;  1TGU A;  1V33 A;  1ZMV A;  3SMS A;  1P3Q Q;  3KOX E;  3I01 M;  4LFC M;  4GC5 A;  2V1U A;  3SAS A;  2LHC A;  4DR7 M;  4I81 A;  1W5S A;  2QEN A;  2HL7 A;  4GH9 A;  2Z8Y M;  1N78 A;  4L8R C;  4L4U A;  3VKG A;  1VDL A;  1H6U A;  4RF1 A;  1GO5 A;  2KHH A;  4W5W A;  2Z7J A;  3HHX A;  4FW9 A;  3LQR A;  5ITU A;  4FWG A;  4LFA M;  3GLH A;  3CF2 A;  4FWH A;  2J7N A;  4DV0 M;  3GPX A;  1G41 A;  1IQP A;  2KDL A;  3PNV A;  3J7A S;  1L1Z A;  1IN7 A;  2KW0 A;  1QAN A;  2BWE A;  4I4L A;  3B9P A;  5KO3 A;  4NRV A;  2VQE M;  3FTC A;  1IXS B;  1QAM A;  4LF5 M;  1ZV1 A;  1R7R A;  2DWZ B;  2WSF F;  4LGM A;  2UU9 M;  3SAR A;  2EKF A;  4DR6 M;  3B89 A;  3BBZ A;  3H4M A;  4IBK A;  3GQ5 A;  3GLF E;  3MHV C;  3VK7 A;  4BLC A;  4IBI A;  2L6O A;  3E9S A;  2DI0 A;  1TH4 A;  3FUX A;  4G4O A;  4LF4 M;  1G8P A;  1TTE A;  4MGK E;  4JI6 M;  1DGH A;  3UK6 A;  2XLJ A;  2CV0 A;  1Z59 A;  2DNA A;  5FSW A;  2D7E A;  2ZM6 M;  1FNN A;  1Z6T A;  1SXJ A;  2CHQ A;  4KO8 A;  4QNM A;  3GLG A;  3FYC A;  1V34 A;  3K2L A;  4WP2 A;  5FTM A;  4A3V B;  2OQ4 A;  4CIS A;  4GEW A;  1YUB A;  1WXQ A;  2R4J A;  2RKO A;  3R9X B;  1QVR A;  3GLI B;  1XMQ M;  2JWS A;  3HX3 A;  4FWD A;  3HY5 A;  1L2C A;  4LJ9 A;  4Z6Y A;  4M0W A;  2K0B X;  4IBG A;  4QOS A;  4PDG A;  3AOG A;  2G3Q A;  3PNY A;  4MM3 B;  3HJ8 A;  3IG5 A;  2JA2 A;  1SXJ C;  3HJS A;  1GLN A;  1Q3C A;  1UM8 A;  1QQW A;  1QUS A;  5F3W A;  5EXS A;  1KSF X;  2EO2 A;  3L27 A;  2R44 A;  4QHT A;  3QAU A;  4NSR A;  2KNV A;  2HAK A;  5ITQ A;  1IBL M;  3W68 A;  1XXH E;  1HNX M;  4AKI A;  1N33 M;  5FTK A;  4MGY E;  1NV8 A;  2L09 A;  3VK8 A;  5DFL A;  5IWA M;  5IT9 S;  2JY7 A;  4JI7 M;  3GLH B;  3DZD A;  4AG6 A;  2MH8 A;  3GRY A;  3L26 A;  1D2N A;  1XNQ M;  3L25 A;  1WGN A;  2C98 A;  3SYL A;  1MJG M;  3SFZ A;  1E94 E;  1OFI A;  1TH3 A;  4GC9 A;  3SAW A;  2DAE A;  1D0K A;  2R0I A;  2DEN A;  1IN5 A;  4LJ7 A;  4CGY B;  1Q3B A;  2VF7 A;  1AIP C;  4IBD A;  4DBG B;  2UUA M;  4ITQ A;  1I4W A;  5DNY A;  1DO2 A;  1Q02 A;  4LRT A;  1G3I A;  2DAM A;  1GJT A;  4JXJ A;  4F1I A;  4L6V 6;  4NC6 A;  2X8A A;  4DR5 M;  1DGH B;  4M9Z A;  2Z4S A;  1I94 M;  1SXJ E;  4LCB A;  5KPZ A;  3T6P A;  4FD2 A;  1SXJ B;  3WHK A;  3W0L B;  3GPP A;  3U6Q A;  4QOZ C;  2LVA A;  3GLG B;  4HL4 A;  3QWL A;  1VDD A;  2JY8 A;  3AOE A;  4WUR A;  3GRU A;  4TUW A;  4LZZ A;  1IM2 A;  3TWM A;  3U6P A;  1GVN A;  2CP8 A;  1N34 M;  3NWL A;  3UGJ A;  5EJC A;  2HWJ A;  1IBM M;  3FUV A;  4G6Z A;  2JY6 B;  1HR0 M;  1IXR C;  4AI6 A;  4DV7 M;  4LRS A;  1PM5 A;  3BOS A;  4OW0 A;  3AV0 A;  2BNK A;  2R6F A;  1JR3 D;  2YNM D;  3U6L A;  4BB9 A;  4KHP M;  2HKJ A;  1WGL A;  1EFU B;  3A42 A;  5EP3 A;  3CTW B;  2Z3X A;  3E46 A;  1QYR A;  3KOY E;  2LH0 A;  3IHP A;  1VG5 A;  3E4R A;  3MK6 A;  1DV0 A;  4L15 A;  3JAM S;  4LF9 M;  1F4I A;  4B3M M;  3CGW A;  1NHW C;  2H1R A;  2R65 A;  3I51 A;  1IXZ A;  1L1T A;  3FD9 A;  1OKS A;  1NNU C;  1EE8 A;  3DA1 A;  3DFZ A;  3AL0 C;  3U6S A;  3Q8X A;  4P17 A;  1FJG M;  4AQY M;  5BR8 M;  3U6D A;  5H37 D;  1NY6 A;  1NJF A;  1YSY A;  1QDT A;  2DZO B;  1J5E M;  2UXC M;  1VQ1 A;  4DR3 M;  1NV9 A;  1QZE A;  2QPA A;  2DWM A;  2V6Z M;  2UUB M;  1PJS A;  2B3T A;  4DR1 M;  2OO9 A;  3GRR A;  3VLF B;  3T1Y M;  2UXD M;  2WSC F;  2RGH A;  4B7H A;  1QAQ A;  3GP1 A;  2I7N A;  1Z5C A;  1ZMW A;  1NO1 A;  1AUA A;  2QZ4 A;  3FRH A;  2FS1 A;  3ILK A;  3LCU A;  2D7G A;  3M6A A;  3K92 A;  3C9P A;  4Z8X A;  4B3R M;  2KA6 B;  3UJN A;  4GKK M;  2UUC M;  2APL A;  2XH9 A;  2MJ5 B;  3AJI B;  4OVZ A;  4REZ A;  1QUT A;  1R6B X;  1S3S A;  1Z5B A;  3KP1 E;  2XEP A;  2L7H A;  3I4Y A;  1T3T A;  2EKK A;  2O01 F;  1C1K A;  2QP9 X;  3BXW A;  2KRU A;  3LCV B;  2N35 A;  4JI2 M;  5EQT A;  3GPU A;  3L2A A;  5KPR A;  1N75 A;  1HQC A;  2YR0 A;  1NY5 A;  1JB0 F;  3I4V A;  1EIJ A;  3U5Z A;  4JN6 A;  2M60 A;  2ZBK B;  2XZU A;  4GRI A;  4RF0 A;  1TF0 B;  4FCW A;  5FLX S;  2DZN B;  4I5S A;  5EXP A;  1MX0 A;  3LVW A;  2L2D A;  2LVO C;  4G4Q A;  1PJQ A;  2JUJ A;  4FCT A;  1NVM A;  2KNA A;  2CV1 A;  3TE6 A;  2DKL A;  2XZF A;  2FOI C;  4JI3 M;  5ITX E;  1ZMU A;  3GLI E;  3SAT A;  3LQQ A;  1OQY A;  1OTR A;  3MMP A;  1UFZ A;  3K9O A;  1GL6 A;  3FKE A;  1HT1 E;  1HT2 E;  2UXB M;  4IIW A;  2K47 A;  4LJA A;  1NSF A;  3IEC A;  2DHY A;  3U6O A;  1J09 A;  2WZJ A;  4IBE A;  4Y28 F;  3U6C A;  4M0D A;  1DGB A;  2Z4R A;  2Q2E B;  2XGN A;  3U6E A;  4NXM M;  1E9R A;  5KPT A;  4HLQ A;  2H5X A;  5IZ7 D;  1R2Y A;  4LF7 M;  4OX9 M;  4CIZ A;  3B7Q A;  4GIP A;  3HGI A;  4R71 A;  3ZH9 B;  2O25 A;  2J5Y A;  2Y0Q A;  1IY1 A;  3W67 A;  2DAK A;  2O5R A;  3UZU A;  1HNZ M;  5JI2 E;  4DV1 M;  5L8R F;  4GHL A;  1X37 A;  3C3E A;  4UN2 B;  4G4N A;  3GLH E;  1OIZ A;  4K0K M;  4CHT B;  2XSZ A;  4HEO A;  1IN6 A;  1VEJ A;  2CHV A;  2EJS A;  2DAI A;  1PJI A;  2ZAN A;  4OVZ B;  3SMP A;  2F5N A;  2KRK A;  2QSF X;  4GMQ A;  4JI0 M;  1E32 A;  1KYI A;  1XB2 B;  3IG8 A;  1IFY A;  2WSE F;  3TQS A;  1XNR M;  4X64 M;  4EIW A;  3GPY A;  3THG A;  1R4G A;  3U6M A;  2RGO A;  5C1B A;  3H4J A;  2FE8 A;  2VDB B;  1VEK A;  2DWN A;  1TH2 A;  2QNJ A;  3F92 A;  3KS8 A;  3U5Z B;  4AKG A;  3L29 A;  4MH0 E;  3ZCB B;  1TDH A;  1K82 A;  1QZM A;  3HKP A;  3D8B A;  2JXN A;  2ZAO A;  2KEB A;  1DGG A;  2LTU A;  1XWI A;  4MGI E;  2CEA A;  1ORY B;  3GLG E;  1XC8 A;  4IBJ A;  2LBC A;  2MR9 A;  4DV6 M;  2DAG A;  3UMM A;  3CF6 E;  2KZU A;  3FUU A;  1JR3 A;  2DZL A;  1C7Y A;  3VDU A;  8CAT A;  1GKI A;  2OPF A;  1V92 A;  4BBA A;  2EA0 A;  5LMU M;  3D8L A;  5KQD A;  3RFW A;  1QAO A;  4OU7 A;  4KT0 F;  3PXG A;  1WR1 B;  3I04 M;  4DV2 M;  2BWB A;  2F5S A;  3J27 B;  4X65 M;  1SG9 A;  3HHW A;  1OAO C;  2QBY A;  2J7O A;  3J7B A;  2K6B A;  3HJQ A;  3HU3 A;  4D81 A;  1GL7 A;  4RKU F;  4IBC A;  3TPZ A;  2F4V M;  1KFV A;  1WJ7 A;  3AOE C;  1VEG A;  3EIE A;  3FYD A;  3L28 A;  5EXX A;  5IRE B;  4DUZ M;  3SBJ A;  2LHG A;  4B7F A;  4DV3 M;  1NNJ A;  3AFH A;  3T38 A;  4XK8 F;  1N77 A;  2A5Y B;  2AHM A;  2LXE A;  2C96 A;  3WHL A;  2R62 A;  1CUK A;  2GNO A;  3A46 A;  3KOW E;  1XHB A;  3KW6 A;  4ANR A;  1G4A E;  1GJS A;  1Y8G A;  3U61 A;  2HHH M;  2F5O A;  4LJ5 A;  4RNA A;  3FTE A;  1Q39 A;  1IN8 A;  1JQJ C;  2VF8 A;  2KXE A;  3M7G A;  1K3W A;  4IBB A;  2CHG A;  1QDR A;  4D82 A;  4GIT A;  4AZF A;  2LVQ D;  3LMM A;  2RRU A;  3E21 A;  3JR5 A;  3V76 A;  2X4A A;  4DUY M;  4DV5 M;  1J7K A;  1E9S A;  3QYB A;  2Y0T A;  3J2P B;  4DV4 M;  1TDZ A;  3FTF A;  3HHZ A;  2FFJ A;  3EIH A;  4PDI A;  2CUZ A;  4LG2 A;  4WW0 A;  3C58 A;  4KLN A;  2JZ0 A;  3W0F A;  4R3D A;  3NBI A;  2L4F A;  2R4E A;  1R5L A;  1JR3 E;  3KOZ E;  1Z5A A;  5FTN A;  4MB7 A;  1YLA A;  4JV5 M; 
#chains in the Genus database with same CATH homology
 2H5X A;  1AIP C;  1WIV A;  4DBG B;  4R71 A;  2O25 A;  1DO2 A;  1Q02 A;  1G3I A;  2DAK A;  2DAM A;  4F1I A;  5JI2 E;  3T6P A;  4UN2 B;  3GLH E;  4F2L A;  2LVA A;  1BVS A;  4HEO A;  1VEJ A;  2JY8 A;  2OOB A;  2EJS A;  1ZMV A;  2DAI A;  1P3Q Q;  1IM2 A;  3FRI A;  2QSF X;  2CP8 A;  2ZTD A;  2MGW A;  1KYI A;  1XB2 B;  1IFY A;  2HWJ A;  2JY6 B;  2ZTC A;  1R4G A;  2JP7 A;  1VDL A;  3H4J A;  1GO5 A;  2KHH A;  1VEK A;  1WGL A;  1EFU B;  2KNZ A;  2QNJ A;  1T6O A;  3E46 A;  3F92 A;  2LVP C;  3IHP A;  1TR8 A;  1VG5 A;  1DV0 A;  1G41 A;  1PGY A;  1F4I A;  2LTU A;  1DO0 A;  2BWE A;  1HQY E;  3GLG E;  2LBC A;  1OKS A;  1ZV1 A;  2MR9 A;  2DAG A;  2EKF A;  3B89 A;  2DZL A;  3BBZ A;  3GLF E;  1C7Y A;  1T43 A;  1V92 A;  1MN3 A;  2DI0 A;  1VQ1 A;  2CWB A;  1NV9 A;  1QZE A;  1WR1 B;  2B3T A;  1TTE A;  2BWB A;  2OO9 A;  1SG9 A;  2DNA A;  1ZMW A;  3FRH A;  3LCU A;  1HJP A;  4WP2 A;  1WJ7 A;  1VEG A;  4GEW A;  2MJ5 B;  2L4E A;  2EKK A;  1A5T A;  2K0B X;  3LCV B;  2G3Q A;  1CUK A;  2MRO B;  2JZ1 A;  1G4A E;  2K9D A;  2JY5 A;  1Y8G A;  2QHO B;  1OAI A;  1WHC A;  2KNV A;  2HAK A;  1XXH E;  2L2D A;  2LVO C;  2JUJ A;  3K9P A;  4Q7J A;  1NV8 A;  2KNA A;  2OOA A;  1IXS A;  5DFL A;  2DKL A;  2LVQ D;  2JY7 A;  2RRU A;  3E21 A;  1ZMU A;  3GLI E;  1OQY A;  1OTR A;  3MMP A;  1UFZ A;  3K9O A;  2JNH A;  1HT1 E;  1HT2 E;  4G3O A;  1WGN A;  2LVN C;  3IEC A;  2DHY A;  3FE3 A;  1E94 E;  2JZ0 A;  2WZJ A;  2L4F A;  2DAE A;  2R0I A;  2DEN A;  1JR3 E;  1YLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...