2DZLA

Solution structure of the uba domain in human protein fam100b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
GSSGSSGMSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics unknown function
molecule keywords Protein FAM100B
publication title Solution Structure of the UBA domain in Human Protein FAM100B
rcsb
source organism Homo sapiens
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dzlA00
1JR3E 1OTRA 2LTUA 1IXSA 1NV9A 2DAIA 2LVOC 3MMPA 1SG9A 1P3QQ 1YLAA 2WZJA 1HJPA 1VEJA 1ZMWA 2L2DA 1GO5A 2RRUA 1T6OA 2JY6B 2L4FA 2MROB 3E46A 3F92A 2KNZA 3LCUA 3K9OA 2DAKA 1BVSA 3FRIA 2KHHA 1Y8GA 1NV8A 2DAEA 4WP2A 2MGWA 2QNJA 1UFZA 2DKLA 5DFLA 2K0BX 4HEOA 2LBCA 2O25A 2OOBA 1T43A 2LVPC 2MJ5B 1WIVA 3GLGE 2H5XA 1IFYA 1V92A 1ZV1A 4DBGB 2JY7A 1ZMUA 3FRHA 2CP8A 1VQ1A 1OKSA 2JNHA 1VDLA 1QZEA 1XB2B 1HQYE 2DENA 1MN3A 1TR8A 4UN2B 1ZMVA 3T6PA 1VEGA 2G3QA 2L4EA 2R0IA 3E21A 2ZTDA 2DZLA 4GEWA 2KNAA 2EKKA 1G41A 1G3IA 1CUKA 2HAKA 4F2LA 2QSFX 2DAMA 3B89A 2DI0A 3FE3A 3GLIE 2JY8A 1OQYA 1PGYA 1DO0A 1E94E 1WGNA 1OAIA 2DNAA 2OO9A 3LCVB 3H4JA 2DAGA 2JP7A 1XXHE 4F1IA 1F4IA 1VEKA 2JUJA 2HWJA 3IECA 2K9DA 1VG5A 3K9PA 1WGLA 1DV0A 2KNVA 2OOAA 2JY5A 2LVNC 1WR1B 2CWBA 2LVAA 1G4AE 3GLFE 2EKFA 2BWBA 2MR9A 2EJSA 2JZ1A 2BWEA 1Q02A 1WHCA 1EFUB 4G3OA 1AIPC 4Q7JA 4R71A 1WJ7A 2JZ0A 1C7YA 3IHPA 3BBZA 2QHOB 5JI2E 1HT2E 1IM2A 2ZTCA 3GLHE 2B3TA 2LVQD 2DHYA 1TTEA 1R4GA 1DO2A 1HT1E 1KYIA 1A5TA
chains in the Genus database with same CATH superfamily
4IJEA 2WSEF 1OTRA 4JN6A 4MM3B 2F4VM 2DAIA 3WHKA 3GRVA 4RKUF 3MMPA 4BLCA 3L29A 2XFTA 3AV0A 4AI6A 3L27A 4FWGA 1SXJB 3SBJA 1ZMWA 3D8BA 3KVWA 3T1YM 4MGHA 1T6OA 4IBCA 2Y21A 1TDHA 3KS4A 4QNRA 3VKGA 3L28A 3E46A 2C98A 4P16A 1NVMA 4NXNM 2Y0QA 1TGUA 3TWKA 2X49A 2XLJA 1Y8GA 1NV8A 4OU7A 2DAEA 1QUTA 1X37A 2D7HA 1MU5A 4WP2A 4IBIA 4LZJA 2XFSA 5FSWA 1IY2A 2BJWA 2BNKA 2MH8A 4B3RM 4LFAM 3FUVA 1N75A 2QBYA 4YHHM 2I7NA 2P5TA 5EXPA 4HEOA 4YY3M 1J7KA 2LBCA 2XGNA 1DGHA 2F5SA 4JI7M 2DHRA 4DR6M 4XGIA 4KLNA 2J7OA 2UUAM 1AUAA 3PXGA 1G71A 4NC6A 4DUZM 5ITRA 2FH0A 1V92A 3AKZA 4LF7M 3FUWA 4B3SM 4FVMA 2J5YA 1JR3A 2VF8A 1ORYB 1H6UA 5C1BA 1ZMUA 1NY5A 2D7EA 3A42A 3MHVC 3MK6A 4MB7A 4JI3M 4DV0M 3H4MA 4G6ZA 3MJ5A 4L6V6 4NRVA 2ZANA 3J2PB 3SMPA 1TR8A 4G4RA 4UN2B 4LJ7A 2R0IA 1W5SA 4M0DA 4OW0A 2ZTDA 4GC9A 1YE9A 2DZLA 1SXJD 3AOEC 5L8RF 3U5ZB 2EUCA 3K92A 3SARA 1E9RA 2RKOA 3QYEA 3TE6A 3VLFB 4F2LA 3A46A 2DAMA 3FE3A 5EP2A 3T38A 1OQYA 4B7HA 1PGYA 2JXNA 3E9SA 1WGNA 1OAIA 2LH0A 4NL4H 4Y28F 1NNJA 2KDLA 3UJNA 5KPZA 1R7RA 2OO9A 4IBBA 3I4YA 3H4JA 2FE8A 2F5QA 2R45A 4L15A 4X62M 2JP7A 3SHFA 1Z5AA 1XXHE 4F1IA 3U61B 1VEKA 4AG5A 4REZA 3V76A 1QAMA 4W5WA 1VG5A 1K3WA 1R5LA 1GJTA 2VF7A 4II7A 2JY5A 3L2AA 3U6EA 1WR1B 2K47A 1IBKM 3KOZE 3PNYA 4OVZB 2EKFA 4AG6A 3U6MA 2WSCF 2EJSA 3GRYA 2WSFF 3GLHB 4WURA 2V1UA 1IXSB 3JAMS 4HL4A 2DVWB 2KRUA 5EQTA 1LV7A 4Z8XA 5BPVA 4RNAA 5KQ8A 4DV3M 2DWLA 3FTFA 2XZUA 3IG8A 3KOXE 4CJ6A 1WJ7A 2CUZA 5FTKA 1EE8A 5IWAM 1FNNA 3K2LA 3GLIA 4JV5M 1HR0M 1J09A 5KO3A 2LVQD 3J7AS 3KOWE 1GKIA 1E9SA 1L1TA 3HGIA 1IN8A 3W68A 4AQYM 3U6LA 4KHPM 2E5LM 1RU3A 2OPFA 2LVOC 4AKHA 2LWXA 1QVRA 3J7BA 1VDDA 2UU9M 2LXEA 2WZJA 5FTJA 4JI5M 3SAVA 3SC3A 1Z59A 4B08A 2C5RA 3FUTA 4X66M 4QOSA 3SHGB 3TWLA 2M5ZA 3SATA 1W5TA 4DR5M 3J27B 3LCUA 1G59A 1MJGM 5EXTA 2DAKA 1BVSA 3ZC7B 2KHHA 1EIJA 5KPTA 2C9CA 3CTWB 4CISA 4QNMA 5BR8M 2MGWA 3GLGB 1UFZA 1SXJE 3M0EA 2DKLA 3QAUA 5EP3A 4AW4A 2V6ZM 4HLQA 2NQ8C 5DFLA 4DR1M 3I01M 1XMOM 2F5PA 4JYAM 4PDIA 3JR5A 1NNUC 4LF4M 1N78A 2APLA 3U6QA 4KO8A 3SYLA 4GC5A 3RGPA 4NSRA 1SXJA 4GH9A 2KEBA 4L8RC 2LVPC 3U6CA 4LJ6A 2Q2EB 3QWLA 2H5XA 4GRIA 4M9ZA 3T15A 4CIZA 1ZV1A 1IBMM 2CFOA 4DBGB 1PJTA 3KDSE 5E26A 1K82A 2JY7A 4DV2M 1Q3BA 2VIIA 4L16A 1D0LA 3FTDA 1Z5CA 2R46A 3U6PA 1QZEA 1XNQM 4DR3M 3R9XB 1IY1A 2CE7A 3C3DA 3L25A 2G5GX 2ZBKB 1QZMA 1L2BA 5FTNA 1I4WA 3B74A 3AOGA 3U6DA 1TDZA 2I7PA 2XF3A 1XNRM 3HHXA 4GEWA 2KNAA 4MH0E 3ILKA 2RGOA 1NJGA 1YUBA 2GQFA 3DA1A 1CUKA 1V33A 4BB9A 3LVVA 4IBEA 3TL4X 4IBFA 2JY8A 3FTCA 3FKEA 4I81A 2L7HA 2DNAA 3VKHA 5JI3E 4LF8M 1OFIA 4OX9M 3LCVB 4R7GA 2CV2A 3IG5A 2DAGA 3AL0C 2KA6B 1NHWC 1GABA 2JUJA 2XSZD 1WXQA 3GPPA 3U5ZA 2C9OA 4CGYB 4NSOB 3UGJA 3K9PA 4XK8F 1DV0A 3UK6A 3C58A 4LJAA 2G8LA 3M7GA 4MGIE 3W67A 1ZAEA 5ITTA 4L78A 4X65M 4GKKM 1GL6A 3HU1A 2LVAA 4LF5M 5EJCA 3NBXX 1G4AE 1PJSA 3CF6E 8CATA 1XWIA 2C96A 1OJLA 3KP1E 2MR9A 3WHLA 1PJJA 1DGHB 2FFJA 4S12A 2Z4SA 2BWEA 2UXBM 2L6OA 4B3TM 1WHCA 2HCBA 3SASA 4R71A 2FS1A 1XHBA 2O01F 3LQRA 1QAOA 2VQEM 4AKGA 2Z3XA 4DV7M 3FD9A 3VDPA 1HT2E 2DWMA 3FTEA 3B7QA 4QHSA 4PCZA 3UMMA 3VK8A 2R44A 3GLHE 3HKPA 3HWSA 5IREB 4B7FA 3DFZA 2AHMA 1J5EM 4Z6YA 1DO2A 1E32A 1DGFA 1KFVA 2Z4RA 1XXHA 4DV4M 1PM5A 1N77A 2QENA 3GLHA 5KQDA 2LTUA 4IIWA 1IXSA 1NV9A 4G4QA 4LF6M 1N33M 2L7IA 4LRSA 1SXJC 1P3QQ 1YLAA 1HJPA 3DZDA 1UM8A 4L4UA 5FTMA 2L2DA 2ZM6M 4EIWA 2RRUA 2JY6B 1GO5A 3VDUA 2CEAA 1QANA 1IBLM 3DOAA 4PDGA 2KNZA 2UXCM 3PFIA 5H37D 3K9OA 3W0LB 3SAWA 3FRIA 1OIPA 1ZQ9A 3PNVA 3HHYA 3KSJA 1PJIA 2CHQA 3BOSA 4DUYM 3M6AA 3RGSA 4LGMA 2RGHA 1GVNA 2K0BX 3W0FA 5KPRA 4ZPXA 5FTLA 3J80S 1LTMA 1JR3D 4RF1A 1XMQM 1D0KA 3A98B 3UZUA 1D0MA 3GLGE 4GITA 7CATA 5LMUM 1NO1A 2Y20A 3J81S 4IBGA 4TUWA 3FRHA 1VQ1A 2JNHA 2V1CA 1QQWA 4IBJA 3PVSA 5IZ7D 2N35A 3VFDA 4GHLA 2DENA 4LJ4A 2X8AA 3GLIB 2QZ4A 3HJQA 3LMMA 3SAUA 4LJ5A 2D7GA 2OQ4A 1FJGM 3HZJA 3B7NA 1G41A 2EKKA 1G3IA 3B9PA 3ZH9B 4WW0A 3TWMA 4GKJM 2R62A 4NXMM 3D8LA 1TF0B 3GRRA 2DI0A 2Y0TA 4FW9A 3E4RA 2DZOB 3HY5A 3NWLA 4G4NA 1E94E 1NHGC 4IBKA 5EXSA 2Z8YM 2QCUA 3LW5F 2ZAMA 2LHGA 1DGBA 3AJIB 3U60B 1S3SA 4B3MM 4LFBM 4KT0F 2C99A 2J7NA 1NY6A 2UUBM 5DYGA 3GLFB 4GHAA 1MX0A 2XEPA 4JI0M 3CF2A 4M0WA 1QDRA 3KSXA 3ZQJA 2VQFM 4P17A 3CF0A 2R18A 4LFCM 1IN5A 1R6BX 2LVNC 1TH2A 4AZFA 3GQ3A 2HHHM 2BJVA 3GPUA 5ITXE 2QQ8A 2R4JA 3LVWA 2BWBA 4IBDA 2JZ1A 1Q39A 1XC8A 1Q02A 1Z5BA 1L2CA 4DR7M 4DR2M 2KXEA 4M9SA 3THGA 1IQPA 2CHVA 3C3EA 1C1KA 3Q8XA 5ITXA 4G3OA 5ITUA 1NSFA 1AIPC 5A2QS 3OTOM 3FUUA 4BBAA 3T1HM 1N32M 4LG2A 5EP1A 3I4VA 4A3VB 1C7YA 1YSYA 3BBZA 2QHOB 5JI2E 4MGZE 4LF9M 3HJSA 2VDBB 4I8OA 3FYCA 2ZTCA 1IN7A 5E6JA 2ZAOA 3FUXA 2B3TA 5LMNM 2DHYA 4FWDA 3I04M 5DYIA 1TTEA 1R4GA 2F5OA 3K8ZA 2ERCA 2JWSA 1KYIA 4JI8M 1A5TA 1JR3E 5EXXA 4NOOB 3A45A 3JR4A 3GQ4A 5FLXS 2QBYB 1DGGA 3EIEA 2DZNB 3EIHA 1SG9A 4R3DA 1IXRC 2HL7A 4FCTA 1GLNA 3AFHA 2KZUA 1VEJA 2QP9X 4XBOA 3GQ5A 1JQJC 2L4FA 2MROB 3U6SA 4GMQA 3U61A 2GNOA 2UXDM 3F92A 1QYRA 3KP0E 3GP1A 4FD2A 2KW0A 4LGYA 4DV1M 1N36M 2QNJA 2CV0A 3NBIA 3BXWA 4PD2A 1OIZA 2R65A 4OVZA 2DWNA 1OFHA 4IJFA 3GO8A 3GPXA 1KSFX 3HHZA 1Z6TA 4D82A 2XZFA 2O25A 2YNMD 2YFQA 2OOBA 4FCVA 1IN4A 3R8FA 2JA2A 3HU3A 4M9XA 2FNAA 1PRBA 2UUCM 3HHWA 1T43A 2MJ5B 3KFUG 3KW6A 1WIVA 3SYKA 1IFYA 3TPZA 2H1RA 1IY0A 5GKNA 2F5NA 1HQCA 4JI4M 1G8PA 2LNHC 1GL7A 1D2NA 2CP8A 2XH9A 1OKSA 1VDLA 1HNWM 3KXEC 5ITQA 2M60A 1I94M 1XB2B 3QYBA 1HQYE 4MGKE 4JI6M 5F3WA 1MN3A 2KZSA 5IT9S 3Q8GA 1ZMVA 3T6PA 1VEGA 2G3QA 2L4EA 3E21A 3KS8A 1T3TA 2KRKA 1L2DA 1R2ZA 4K0KM 3TQSA 3ZCBB 2HKJA 3C9PA 4LJ9A 4X64M 2HAKA 2Z7JA 3RFWA 1HNZM 1XXHB 2QSFX 1L1ZA 2CHGA 3B89A 3GLIE 1DO0A 4ANRA 2W82A 3SFZA 3GPYA 2LHCA 4QHTA 3K1JA 4B7GA 4QOZC 2X4AA 3B7ZA 1N34M 3I51A 3CGWA 2EA0A 1NJFA 3SMSA 1F4IA 3GLGA 5C18A 5DNYA 2HWJA 1L8QA 2YQZA 1TH4A 3IECA 2K9DA 4GIPA 2YR0A 4JXJA 1QDTA 4DV5M 1HNXM 4ITQA 3AOEA 1WGLA 2FOIC 2R4EA 4FCWA 4DV6M 2DWZB 2A5YB 2KNVA 2OOAA 4CHTB 4D80A 2XSZA 4I5SA 4D81A 2O5RA 3GRUA 3HJ8A 4RF0A 2L09A 1IN6A 2CWBA 1QAQA 4DR4M 1IXZA 3GLFE 4PT5A 3U60A 3RE8A 3L26A 4LJ8A 4LCBA 1GJSA 2EO2A 4AKIA 4JI2M 3U6OA 4KODA 1K3XA 3FYDA 2CRUA 3KOYE 1EFUB 1PJQA 1R2YA 3GLFA 4NRWA 4LZZA 4LRTA 2QPAA 3VK7A 4FWHA 2JZ0A 3IHPA 5EP4A 1JB0F 2R6FA 1IM2A 3LQQA 3HU2A 1OAOC 1V34A 1QUSA 2K6BA 1TH3A 4LY6A 4JI1M 3HX3A 5ITYA 4G4OA 4MGYE 2DXIA 4I4LA 2CV1A 1HT1E 4Q7JA 1Q3CA
chains in the Genus database with same CATH topology
1JR3E 1OTRA 2LTUA 1IXSA 1NV9A 2DAIA 2LVOC 3MMPA 1SG9A 1P3QQ 1YLAA 2WZJA 1HJPA 1VEJA 1ZMWA 2L2DA 1GO5A 2RRUA 1T6OA 2JY6B 2L4FA 2MROB 3E46A 3F92A 2KNZA 3LCUA 3K9OA 2DAKA 1BVSA 3FRIA 2KHHA 1Y8GA 1NV8A 2DAEA 4WP2A 2MGWA 2QNJA 1UFZA 2DKLA 5DFLA 2K0BX 4HEOA 2LBCA 2O25A 2OOBA 1T43A 2LVPC 2MJ5B 1WIVA 3GLGE 2H5XA 1IFYA 1V92A 1ZV1A 4DBGB 2JY7A 1ZMUA 3FRHA 2CP8A 1VQ1A 1OKSA 2JNHA 1VDLA 1QZEA 1XB2B 1HQYE 2DENA 1MN3A 1TR8A 4UN2B 1ZMVA 3T6PA 1VEGA 2G3QA 2L4EA 2R0IA 3E21A 2ZTDA 2DZLA 4GEWA 2KNAA 2EKKA 1G41A 1G3IA 1CUKA 2HAKA 4F2LA 2QSFX 2DAMA 3B89A 2DI0A 3FE3A 3GLIE 2JY8A 1OQYA 1PGYA 1DO0A 1E94E 1WGNA 1OAIA 2DNAA 2OO9A 3LCVB 3H4JA 2DAGA 2JP7A 1XXHE 4F1IA 1F4IA 1VEKA 2JUJA 2HWJA 3IECA 2K9DA 1VG5A 3K9PA 1WGLA 1DV0A 2KNVA 2OOAA 2JY5A 2LVNC 1WR1B 2CWBA 2LVAA 1G4AE 3GLFE 2EKFA 2BWBA 2MR9A 2EJSA 2JZ1A 2BWEA 1Q02A 1WHCA 1EFUB 4G3OA 1AIPC 4Q7JA 4R71A 1WJ7A 2JZ0A 1C7YA 3IHPA 3BBZA 2QHOB 5JI2E 1HT2E 1IM2A 2ZTCA 3GLHE 2B3TA 2LVQD 2DHYA 1TTEA 1R4GA 1DO2A 1HT1E 1KYIA 1A5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR3 E;  1OTR A;  2LTU A;  1IXS A;  1NV9 A;  2DAI A;  2LVO C;  3MMP A;  1SG9 A;  1P3Q Q;  1YLA A;  2WZJ A;  1HJP A;  1VEJ A;  1ZMW A;  2L2D A;  1GO5 A;  2RRU A;  1T6O A;  2JY6 B;  2L4F A;  2MRO B;  3E46 A;  3F92 A;  2KNZ A;  3LCU A;  3K9O A;  2DAK A;  1BVS A;  3FRI A;  2KHH A;  1Y8G A;  1NV8 A;  2DAE A;  4WP2 A;  2MGW A;  2QNJ A;  1UFZ A;  2DKL A;  5DFL A;  2K0B X;  4HEO A;  2LBC A;  2O25 A;  2OOB A;  1T43 A;  2LVP C;  2MJ5 B;  1WIV A;  3GLG E;  2H5X A;  1IFY A;  1V92 A;  1ZV1 A;  4DBG B;  2JY7 A;  1ZMU A;  3FRH A;  2CP8 A;  1VQ1 A;  1OKS A;  2JNH A;  1VDL A;  1QZE A;  1XB2 B;  1HQY E;  2DEN A;  1MN3 A;  1TR8 A;  4UN2 B;  1ZMV A;  3T6P A;  1VEG A;  2G3Q A;  2L4E A;  2R0I A;  3E21 A;  2ZTD A;  2DZL A;  4GEW A;  2KNA A;  2EKK A;  1G41 A;  1G3I A;  1CUK A;  2HAK A;  4F2L A;  2QSF X;  2DAM A;  3B89 A;  2DI0 A;  3FE3 A;  3GLI E;  2JY8 A;  1OQY A;  1PGY A;  1DO0 A;  1E94 E;  1WGN A;  1OAI A;  2DNA A;  2OO9 A;  3LCV B;  3H4J A;  2DAG A;  2JP7 A;  1XXH E;  4F1I A;  1F4I A;  1VEK A;  2JUJ A;  2HWJ A;  3IEC A;  2K9D A;  1VG5 A;  3K9P A;  1WGL A;  1DV0 A;  2KNV A;  2OOA A;  2JY5 A;  2LVN C;  1WR1 B;  2CWB A;  2LVA A;  1G4A E;  3GLF E;  2EKF A;  2BWB A;  2MR9 A;  2EJS A;  2JZ1 A;  2BWE A;  1Q02 A;  1WHC A;  1EFU B;  4G3O A;  1AIP C;  4Q7J A;  4R71 A;  1WJ7 A;  2JZ0 A;  1C7Y A;  3IHP A;  3BBZ A;  2QHO B;  5JI2 E;  1HT2 E;  1IM2 A;  2ZTC A;  3GLH E;  2B3T A;  2LVQ D;  2DHY A;  1TTE A;  1R4G A;  1DO2 A;  1HT1 E;  1KYI A;  1A5T A; 
#chains in the Genus database with same CATH topology
 4IJE A;  2WSE F;  1OTR A;  4JN6 A;  4MM3 B;  2F4V M;  2DAI A;  3WHK A;  3GRV A;  4RKU F;  3MMP A;  4BLC A;  3L29 A;  2XFT A;  3AV0 A;  4AI6 A;  3L27 A;  4FWG A;  1SXJ B;  3SBJ A;  1ZMW A;  3D8B A;  3KVW A;  3T1Y M;  4MGH A;  1T6O A;  4IBC A;  2Y21 A;  1TDH A;  3KS4 A;  4QNR A;  3VKG A;  3L28 A;  3E46 A;  2C98 A;  4P16 A;  1NVM A;  4NXN M;  2Y0Q A;  1TGU A;  3TWK A;  2X49 A;  2XLJ A;  1Y8G A;  1NV8 A;  4OU7 A;  2DAE A;  1QUT A;  1X37 A;  2D7H A;  1MU5 A;  4WP2 A;  4IBI A;  4LZJ A;  2XFS A;  5FSW A;  1IY2 A;  2BJW A;  2BNK A;  2MH8 A;  4B3R M;  4LFA M;  3FUV A;  1N75 A;  2QBY A;  4YHH M;  2I7N A;  2P5T A;  5EXP A;  4HEO A;  4YY3 M;  1J7K A;  2LBC A;  2XGN A;  1DGH A;  2F5S A;  4JI7 M;  2DHR A;  4DR6 M;  4XGI A;  4KLN A;  2J7O A;  2UUA M;  1AUA A;  3PXG A;  1G71 A;  4NC6 A;  4DUZ M;  5ITR A;  2FH0 A;  1V92 A;  3AKZ A;  4LF7 M;  3FUW A;  4B3S M;  4FVM A;  2J5Y A;  1JR3 A;  2VF8 A;  1ORY B;  1H6U A;  5C1B A;  1ZMU A;  1NY5 A;  2D7E A;  3A42 A;  3MHV C;  3MK6 A;  4MB7 A;  4JI3 M;  4DV0 M;  3H4M A;  4G6Z A;  3MJ5 A;  4L6V 6;  4NRV A;  2ZAN A;  3J2P B;  3SMP A;  1TR8 A;  4G4R A;  4UN2 B;  4LJ7 A;  2R0I A;  1W5S A;  4M0D A;  4OW0 A;  2ZTD A;  4GC9 A;  1YE9 A;  2DZL A;  1SXJ D;  3AOE C;  5L8R F;  3U5Z B;  2EUC A;  3K92 A;  3SAR A;  1E9R A;  2RKO A;  3QYE A;  3TE6 A;  3VLF B;  4F2L A;  3A46 A;  2DAM A;  3FE3 A;  5EP2 A;  3T38 A;  1OQY A;  4B7H A;  1PGY A;  2JXN A;  3E9S A;  1WGN A;  1OAI A;  2LH0 A;  4NL4 H;  4Y28 F;  1NNJ A;  2KDL A;  3UJN A;  5KPZ A;  1R7R A;  2OO9 A;  4IBB A;  3I4Y A;  3H4J A;  2FE8 A;  2F5Q A;  2R45 A;  4L15 A;  4X62 M;  2JP7 A;  3SHF A;  1Z5A A;  1XXH E;  4F1I A;  3U61 B;  1VEK A;  4AG5 A;  4REZ A;  3V76 A;  1QAM A;  4W5W A;  1VG5 A;  1K3W A;  1R5L A;  1GJT A;  2VF7 A;  4II7 A;  2JY5 A;  3L2A A;  3U6E A;  1WR1 B;  2K47 A;  1IBK M;  3KOZ E;  3PNY A;  4OVZ B;  2EKF A;  4AG6 A;  3U6M A;  2WSC F;  2EJS A;  3GRY A;  2WSF F;  3GLH B;  4WUR A;  2V1U A;  1IXS B;  3JAM S;  4HL4 A;  2DVW B;  2KRU A;  5EQT A;  1LV7 A;  4Z8X A;  5BPV A;  4RNA A;  5KQ8 A;  4DV3 M;  2DWL A;  3FTF A;  2XZU A;  3IG8 A;  3KOX E;  4CJ6 A;  1WJ7 A;  2CUZ A;  5FTK A;  1EE8 A;  5IWA M;  1FNN A;  3K2L A;  3GLI A;  4JV5 M;  1HR0 M;  1J09 A;  5KO3 A;  2LVQ D;  3J7A S;  3KOW E;  1GKI A;  1E9S A;  1L1T A;  3HGI A;  1IN8 A;  3W68 A;  4AQY M;  3U6L A;  4KHP M;  2E5L M;  1RU3 A;  2OPF A;  2LVO C;  4AKH A;  2LWX A;  1QVR A;  3J7B A;  1VDD A;  2UU9 M;  2LXE A;  2WZJ A;  5FTJ A;  4JI5 M;  3SAV A;  3SC3 A;  1Z59 A;  4B08 A;  2C5R A;  3FUT A;  4X66 M;  4QOS A;  3SHG B;  3TWL A;  2M5Z A;  3SAT A;  1W5T A;  4DR5 M;  3J27 B;  3LCU A;  1G59 A;  1MJG M;  5EXT A;  2DAK A;  1BVS A;  3ZC7 B;  2KHH A;  1EIJ A;  5KPT A;  2C9C A;  3CTW B;  4CIS A;  4QNM A;  5BR8 M;  2MGW A;  3GLG B;  1UFZ A;  1SXJ E;  3M0E A;  2DKL A;  3QAU A;  5EP3 A;  4AW4 A;  2V6Z M;  4HLQ A;  2NQ8 C;  5DFL A;  4DR1 M;  3I01 M;  1XMO M;  2F5P A;  4JYA M;  4PDI A;  3JR5 A;  1NNU C;  4LF4 M;  1N78 A;  2APL A;  3U6Q A;  4KO8 A;  3SYL A;  4GC5 A;  3RGP A;  4NSR A;  1SXJ A;  4GH9 A;  2KEB A;  4L8R C;  2LVP C;  3U6C A;  4LJ6 A;  2Q2E B;  3QWL A;  2H5X A;  4GRI A;  4M9Z A;  3T15 A;  4CIZ A;  1ZV1 A;  1IBM M;  2CFO A;  4DBG B;  1PJT A;  3KDS E;  5E26 A;  1K82 A;  2JY7 A;  4DV2 M;  1Q3B A;  2VII A;  4L16 A;  1D0L A;  3FTD A;  1Z5C A;  2R46 A;  3U6P A;  1QZE A;  1XNQ M;  4DR3 M;  3R9X B;  1IY1 A;  2CE7 A;  3C3D A;  3L25 A;  2G5G X;  2ZBK B;  1QZM A;  1L2B A;  5FTN A;  1I4W A;  3B74 A;  3AOG A;  3U6D A;  1TDZ A;  2I7P A;  2XF3 A;  1XNR M;  3HHX A;  4GEW A;  2KNA A;  4MH0 E;  3ILK A;  2RGO A;  1NJG A;  1YUB A;  2GQF A;  3DA1 A;  1CUK A;  1V33 A;  4BB9 A;  3LVV A;  4IBE A;  3TL4 X;  4IBF A;  2JY8 A;  3FTC A;  3FKE A;  4I81 A;  2L7H A;  2DNA A;  3VKH A;  5JI3 E;  4LF8 M;  1OFI A;  4OX9 M;  3LCV B;  4R7G A;  2CV2 A;  3IG5 A;  2DAG A;  3AL0 C;  2KA6 B;  1NHW C;  1GAB A;  2JUJ A;  2XSZ D;  1WXQ A;  3GPP A;  3U5Z A;  2C9O A;  4CGY B;  4NSO B;  3UGJ A;  3K9P A;  4XK8 F;  1DV0 A;  3UK6 A;  3C58 A;  4LJA A;  2G8L A;  3M7G A;  4MGI E;  3W67 A;  1ZAE A;  5ITT A;  4L78 A;  4X65 M;  4GKK M;  1GL6 A;  3HU1 A;  2LVA A;  4LF5 M;  5EJC A;  3NBX X;  1G4A E;  1PJS A;  3CF6 E;  8CAT A;  1XWI A;  2C96 A;  1OJL A;  3KP1 E;  2MR9 A;  3WHL A;  1PJJ A;  1DGH B;  2FFJ A;  4S12 A;  2Z4S A;  2BWE A;  2UXB M;  2L6O A;  4B3T M;  1WHC A;  2HCB A;  3SAS A;  4R71 A;  2FS1 A;  1XHB A;  2O01 F;  3LQR A;  1QAO A;  2VQE M;  4AKG A;  2Z3X A;  4DV7 M;  3FD9 A;  3VDP A;  1HT2 E;  2DWM A;  3FTE A;  3B7Q A;  4QHS A;  4PCZ A;  3UMM A;  3VK8 A;  2R44 A;  3GLH E;  3HKP A;  3HWS A;  5IRE B;  4B7F A;  3DFZ A;  2AHM A;  1J5E M;  4Z6Y A;  1DO2 A;  1E32 A;  1DGF A;  1KFV A;  2Z4R A;  1XXH A;  4DV4 M;  1PM5 A;  1N77 A;  2QEN A;  3GLH A;  5KQD A;  2LTU A;  4IIW A;  1IXS A;  1NV9 A;  4G4Q A;  4LF6 M;  1N33 M;  2L7I A;  4LRS A;  1SXJ C;  1P3Q Q;  1YLA A;  1HJP A;  3DZD A;  1UM8 A;  4L4U A;  5FTM A;  2L2D A;  2ZM6 M;  4EIW A;  2RRU A;  2JY6 B;  1GO5 A;  3VDU A;  2CEA A;  1QAN A;  1IBL M;  3DOA A;  4PDG A;  2KNZ A;  2UXC M;  3PFI A;  5H37 D;  3K9O A;  3W0L B;  3SAW A;  3FRI A;  1OIP A;  1ZQ9 A;  3PNV A;  3HHY A;  3KSJ A;  1PJI A;  2CHQ A;  3BOS A;  4DUY M;  3M6A A;  3RGS A;  4LGM A;  2RGH A;  1GVN A;  2K0B X;  3W0F A;  5KPR A;  4ZPX A;  5FTL A;  3J80 S;  1LTM A;  1JR3 D;  4RF1 A;  1XMQ M;  1D0K A;  3A98 B;  3UZU A;  1D0M A;  3GLG E;  4GIT A;  7CAT A;  5LMU M;  1NO1 A;  2Y20 A;  3J81 S;  4IBG A;  4TUW A;  3FRH A;  1VQ1 A;  2JNH A;  2V1C A;  1QQW A;  4IBJ A;  3PVS A;  5IZ7 D;  2N35 A;  3VFD A;  4GHL A;  2DEN A;  4LJ4 A;  2X8A A;  3GLI B;  2QZ4 A;  3HJQ A;  3LMM A;  3SAU A;  4LJ5 A;  2D7G A;  2OQ4 A;  1FJG M;  3HZJ A;  3B7N A;  1G41 A;  2EKK A;  1G3I A;  3B9P A;  3ZH9 B;  4WW0 A;  3TWM A;  4GKJ M;  2R62 A;  4NXM M;  3D8L A;  1TF0 B;  3GRR A;  2DI0 A;  2Y0T A;  4FW9 A;  3E4R A;  2DZO B;  3HY5 A;  3NWL A;  4G4N A;  1E94 E;  1NHG C;  4IBK A;  5EXS A;  2Z8Y M;  2QCU A;  3LW5 F;  2ZAM A;  2LHG A;  1DGB A;  3AJI B;  3U60 B;  1S3S A;  4B3M M;  4LFB M;  4KT0 F;  2C99 A;  2J7N A;  1NY6 A;  2UUB M;  5DYG A;  3GLF B;  4GHA A;  1MX0 A;  2XEP A;  4JI0 M;  3CF2 A;  4M0W A;  1QDR A;  3KSX A;  3ZQJ A;  2VQF M;  4P17 A;  3CF0 A;  2R18 A;  4LFC M;  1IN5 A;  1R6B X;  2LVN C;  1TH2 A;  4AZF A;  3GQ3 A;  2HHH M;  2BJV A;  3GPU A;  5ITX E;  2QQ8 A;  2R4J A;  3LVW A;  2BWB A;  4IBD A;  2JZ1 A;  1Q39 A;  1XC8 A;  1Q02 A;  1Z5B A;  1L2C A;  4DR7 M;  4DR2 M;  2KXE A;  4M9S A;  3THG A;  1IQP A;  2CHV A;  3C3E A;  1C1K A;  3Q8X A;  5ITX A;  4G3O A;  5ITU A;  1NSF A;  1AIP C;  5A2Q S;  3OTO M;  3FUU A;  4BBA A;  3T1H M;  1N32 M;  4LG2 A;  5EP1 A;  3I4V A;  4A3V B;  1C7Y A;  1YSY A;  3BBZ A;  2QHO B;  5JI2 E;  4MGZ E;  4LF9 M;  3HJS A;  2VDB B;  4I8O A;  3FYC A;  2ZTC A;  1IN7 A;  5E6J A;  2ZAO A;  3FUX A;  2B3T A;  5LMN M;  2DHY A;  4FWD A;  3I04 M;  5DYI A;  1TTE A;  1R4G A;  2F5O A;  3K8Z A;  2ERC A;  2JWS A;  1KYI A;  4JI8 M;  1A5T A;  1JR3 E;  5EXX A;  4NOO B;  3A45 A;  3JR4 A;  3GQ4 A;  5FLX S;  2QBY B;  1DGG A;  3EIE A;  2DZN B;  3EIH A;  1SG9 A;  4R3D A;  1IXR C;  2HL7 A;  4FCT A;  1GLN A;  3AFH A;  2KZU A;  1VEJ A;  2QP9 X;  4XBO A;  3GQ5 A;  1JQJ C;  2L4F A;  2MRO B;  3U6S A;  4GMQ A;  3U61 A;  2GNO A;  2UXD M;  3F92 A;  1QYR A;  3KP0 E;  3GP1 A;  4FD2 A;  2KW0 A;  4LGY A;  4DV1 M;  1N36 M;  2QNJ A;  2CV0 A;  3NBI A;  3BXW A;  4PD2 A;  1OIZ A;  2R65 A;  4OVZ A;  2DWN A;  1OFH A;  4IJF A;  3GO8 A;  3GPX A;  1KSF X;  3HHZ A;  1Z6T A;  4D82 A;  2XZF A;  2O25 A;  2YNM D;  2YFQ A;  2OOB A;  4FCV A;  1IN4 A;  3R8F A;  2JA2 A;  3HU3 A;  4M9X A;  2FNA A;  1PRB A;  2UUC M;  3HHW A;  1T43 A;  2MJ5 B;  3KFU G;  3KW6 A;  1WIV A;  3SYK A;  1IFY A;  3TPZ A;  2H1R A;  1IY0 A;  5GKN A;  2F5N A;  1HQC A;  4JI4 M;  1G8P A;  2LNH C;  1GL7 A;  1D2N A;  2CP8 A;  2XH9 A;  1OKS A;  1VDL A;  1HNW M;  3KXE C;  5ITQ A;  2M60 A;  1I94 M;  1XB2 B;  3QYB A;  1HQY E;  4MGK E;  4JI6 M;  5F3W A;  1MN3 A;  2KZS A;  5IT9 S;  3Q8G A;  1ZMV A;  3T6P A;  1VEG A;  2G3Q A;  2L4E A;  3E21 A;  3KS8 A;  1T3T A;  2KRK A;  1L2D A;  1R2Z A;  4K0K M;  3TQS A;  3ZCB B;  2HKJ A;  3C9P A;  4LJ9 A;  4X64 M;  2HAK A;  2Z7J A;  3RFW A;  1HNZ M;  1XXH B;  2QSF X;  1L1Z A;  2CHG A;  3B89 A;  3GLI E;  1DO0 A;  4ANR A;  2W82 A;  3SFZ A;  3GPY A;  2LHC A;  4QHT A;  3K1J A;  4B7G A;  4QOZ C;  2X4A A;  3B7Z A;  1N34 M;  3I51 A;  3CGW A;  2EA0 A;  1NJF A;  3SMS A;  1F4I A;  3GLG A;  5C18 A;  5DNY A;  2HWJ A;  1L8Q A;  2YQZ A;  1TH4 A;  3IEC A;  2K9D A;  4GIP A;  2YR0 A;  4JXJ A;  1QDT A;  4DV5 M;  1HNX M;  4ITQ A;  3AOE A;  1WGL A;  2FOI C;  2R4E A;  4FCW A;  4DV6 M;  2DWZ B;  2A5Y B;  2KNV A;  2OOA A;  4CHT B;  4D80 A;  2XSZ A;  4I5S A;  4D81 A;  2O5R A;  3GRU A;  3HJ8 A;  4RF0 A;  2L09 A;  1IN6 A;  2CWB A;  1QAQ A;  4DR4 M;  1IXZ A;  3GLF E;  4PT5 A;  3U60 A;  3RE8 A;  3L26 A;  4LJ8 A;  4LCB A;  1GJS A;  2EO2 A;  4AKI A;  4JI2 M;  3U6O A;  4KOD A;  1K3X A;  3FYD A;  2CRU A;  3KOY E;  1EFU B;  1PJQ A;  1R2Y A;  3GLF A;  4NRW A;  4LZZ A;  4LRT A;  2QPA A;  3VK7 A;  4FWH A;  2JZ0 A;  3IHP A;  5EP4 A;  1JB0 F;  2R6F A;  1IM2 A;  3LQQ A;  3HU2 A;  1OAO C;  1V34 A;  1QUS A;  2K6B A;  1TH3 A;  4LY6 A;  4JI1 M;  3HX3 A;  5ITY A;  4G4O A;  4MGY E;  2DXI A;  4I4L A;  2CV1 A;  1HT1 E;  4Q7J A;  1Q3C A; 
#chains in the Genus database with same CATH homology
 1JR3 E;  1OTR A;  2LTU A;  1IXS A;  1NV9 A;  2DAI A;  2LVO C;  3MMP A;  1SG9 A;  1P3Q Q;  1YLA A;  2WZJ A;  1HJP A;  1VEJ A;  1ZMW A;  2L2D A;  1GO5 A;  2RRU A;  1T6O A;  2JY6 B;  2L4F A;  2MRO B;  3E46 A;  3F92 A;  2KNZ A;  3LCU A;  3K9O A;  2DAK A;  1BVS A;  3FRI A;  2KHH A;  1Y8G A;  1NV8 A;  2DAE A;  4WP2 A;  2MGW A;  2QNJ A;  1UFZ A;  2DKL A;  5DFL A;  2K0B X;  4HEO A;  2LBC A;  2O25 A;  2OOB A;  1T43 A;  2LVP C;  2MJ5 B;  1WIV A;  3GLG E;  2H5X A;  1IFY A;  1V92 A;  1ZV1 A;  4DBG B;  2JY7 A;  1ZMU A;  3FRH A;  2CP8 A;  1VQ1 A;  1OKS A;  2JNH A;  1VDL A;  1QZE A;  1XB2 B;  1HQY E;  2DEN A;  1MN3 A;  1TR8 A;  4UN2 B;  1ZMV A;  3T6P A;  1VEG A;  2G3Q A;  2L4E A;  2R0I A;  3E21 A;  2ZTD A;  2DZL A;  4GEW A;  2KNA A;  2EKK A;  1G41 A;  1G3I A;  1CUK A;  2HAK A;  4F2L A;  2QSF X;  2DAM A;  3B89 A;  2DI0 A;  3FE3 A;  3GLI E;  2JY8 A;  1OQY A;  1PGY A;  1DO0 A;  1E94 E;  1WGN A;  1OAI A;  2DNA A;  2OO9 A;  3LCV B;  3H4J A;  2DAG A;  2JP7 A;  1XXH E;  4F1I A;  1F4I A;  1VEK A;  2JUJ A;  2HWJ A;  3IEC A;  2K9D A;  1VG5 A;  3K9P A;  1WGL A;  1DV0 A;  2KNV A;  2OOA A;  2JY5 A;  2LVN C;  1WR1 B;  2CWB A;  2LVA A;  1G4A E;  3GLF E;  2EKF A;  2BWB A;  2MR9 A;  2EJS A;  2JZ1 A;  2BWE A;  1Q02 A;  1WHC A;  1EFU B;  4G3O A;  1AIP C;  4Q7J A;  4R71 A;  1WJ7 A;  2JZ0 A;  1C7Y A;  3IHP A;  3BBZ A;  2QHO B;  5JI2 E;  1HT2 E;  1IM2 A;  2ZTC A;  3GLH E;  2B3T A;  2LVQ D;  2DHY A;  1TTE A;  1R4G A;  1DO2 A;  1HT1 E;  1KYI A;  1A5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...