2DZLA

Solution structure of the uba domain in human protein fam100b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
GSSGSSGMSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FAM100B
publication title Solution Structure of the UBA domain in Human Protein FAM100B
rcsb
source organism Homo sapiens
molecule tags Structural genomics unknown function
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dzlA00
4UN2B 1XB2B 1HT1E 2H5XA 1UFZA 1OQYA 1WIVA 2EJSA 2HAKA 1Y8GA 1YLAA 2LVPC 1AIPC 3H4JA 1R4GA 2JY5A 3GLIE 4F1IA 2K0BX 3E46A 3FE3A 1TR8A 3GLGE 2LVAA 4HEOA 1NV8A 5DFLA 4F2LA 2LBCA 1KYIA 2OOAA 3LCVB 3T6PA 1G4AE 1IXSA 3B89A 2DI0A 3F92A 1OAIA 1WJ7A 1E94E 2L2DA 3BBZA 4R71A 1DO2A 1HT2E 2CWBA 1BVSA 3MMPA 4GEWA 1TTEA 1F4IA 1DO0A 1VEGA 2WZJA 4WP2A 1OTRA 1C7YA 1VEKA 1CUKA 1ZV1A 1NV9A 2JY6B 2DAMA 1WHCA 1IFYA 2DAGA 1G41A 2JP7A 2MR9A 2JY8A 1V92A 1WGLA 2DZLA 2DAKA 2DKLA 1T6OA 2KNZA 1QZEA 1HJPA 1XXHE 1P3QQ 2JY7A 2QNJA 1EFUB 1Q02A 3K9PA 1T43A 1JR3E 3E21A 2LTUA 1VG5A 2KNVA 1GO5A 1G3IA 2DNAA 1VEJA 2LVOC 2LVQD 2CP8A 3GLHE 3IHPA 1VDLA 1WGNA 2KHHA 1VQ1A 2MJ5B 1ZMWA 3IECA 2DENA 3LCUA 2MGWA 1PGYA 3GLFE 1MN3A 1ZMUA 1IM2A 4G3OA 2JUJA 2B3TA 2JZ0A 2QSFX 2ZTDA 2O25A 2L4FA 2KNAA 2QHOB 3FRHA 1HQYE 1SG9A 2JZ1A 2L4EA 5JI2E 2HWJA 2DAEA 2OOBA 2R0IA 1ZMVA 2K9DA 2MROB 2LVNC 3FRIA 2JNHA 2ZTCA 2RRUA 2BWBA 2EKFA 3K9OA 2DAIA 2OO9A 2DHYA 1WR1B 4Q7JA 4DBGB 1OKSA 2EKKA 1A5TA 2G3QA 1DV0A 2BWEA
chains in the Genus database with same CATH superfamily
4DV3M 3Q8XA 1XB2B 4R3DA 4LJ9A 3U5ZB 1V34A 1N32M 2YFQA 4OVZA 1OQYA 1WIVA 2HAKA 3LVWA 1Y8GA 1YLAA 2R65A 3GLIA 2OQ4A 2D7HA 3U6CA 2CV1A 1W5SA 3GLIE 4F1IA 3E46A 4DUZM 1IBMM 3AL0C 5DYIA 2R44A 5EJCA 4HEOA 3HJ8A 5EXSA 3J7BA 1D0MA 1NV8A 4F2LA 5KPTA 5EXPA 4LG2A 1QZMA 1XXHB 4KLNA 5KPRA 4LJ6A 4FWHA 4NRWA 2I7PA 4NC6A 3KSJA 3HU1A 4R71A 4LZJA 2JWSA 2LWXA 4JI6M 2WSEF 3MMPA 3GLHB 4GMQA 4DV4M 1TTEA 4KO8A 2O01F 1SXJB 4LJ8A 5FTJA 2WZJA 2ZM6M 1OTRA 3PNYA 3R9XB 2G8LA 1HNZM 2EO2A 3E4RA 4NL4H 1VEKA 3FTEA 3TPZA 3M6AA 1ZV1A 2DXIA 1IFYA 3KOWE 5JI3E 4MGZE 4IBIA 2BNKA 3T38A 4GHLA 4GC9A 2FFJA 4I4LA 2RKOA 4BLCA 4D81A 4PD2A 2XH9A 2HHHM 2DZLA 2DAKA 3ZC7B 4JXJA 1QVRA 3SMSA 2X49A 3KP0E 5KQDA 3UGJA 2VQFM 5IREB 2L7HA 4FD2A 4GHAA 1NY5A 2JY7A 2X4AA 3CGWA 4NXMM 3A46A 4JYAM 4OU7A 2UU9M 3QWLA 3K92A 4DV6M 4DV1M 4L6V6 2CV0A 4LF7M 2VQEM 1TDHA 3U6EA 2R6FA 1XC8A 2LVOC 4L16A 1IXZA 1VDLA 4AKHA 2V1UA 2KXEA 2C5RA 2EUCA 1VQ1A 2MJ5B 3SHFA 1R7RA 2C96A 2DENA 4KODA 4LCBA 3GLFB 1PGYA 1TDZA 1L1TA 4L8RC 2DZOB 4B7FA 3SARA 4MGHA 2P5TA 2KW0A 3RGPA 2XFSA 2JZ0A 3T1HM 4MM3B 3ZQJA 2QSFX 2QCUA 4XK8F 3FUWA 2L4FA 1Q3CA 3OTOM 4OW0A 5F3WA 3FRHA 3KOXE 1L2BA 2JZ1A 3SBJA 3HKPA 4I81A 1JQJC 4IBFA 3AOGA 2H1RA 3W0LB 1LTMA 3J80S 2OOBA 3B7QA 3PVSA 4AG5A 3B7ZA 3U6QA 4EIWA 4AKGA 2HCBA 4B3TM 3VFDA 5EXTA 2FS1A 4QNMA 2E5LM 2YR0A 2K9DA 4YHHM 2Z8YM 4B3RM 2QZ4A 2FNAA 2JNHA 3LMMA 1L8QA 2RRUA 4HLQA 1HNXM 1IBLM 1QDTA 3VKGA 2QBYB 3L26A 4X65M 1AUAA 3FKEA 3K8ZA 4LFCM 1E9RA 4OX9M 5ITXA 4ITQA 1K3WA 2XSZA 2DHRA 4DV0M 2EKKA 2G3QA 1LV7A 1IN8A 4UN2B 5LMUM 5ITXE 4DV5M 2XZFA 1YUBA 3CF0A 3NWLA 2WSCF 1GJTA 4LJ5A 4G4OA 1N78A 4FWDA 4R7GA 3QAUA 1PRBA 4MB7A 2H5XA 4Y28F 2D7GA 1QYRA 4LRTA 1DGFA 1MX0A 2R62A 4M0DA 3E9SA 5KO3A 1FNNA 3WHKA 3GPXA 3WHLA 3HX3A 1C1KA 2LHGA 2LVPC 1R4GA 3VK8A 5L8RF 4G4NA 2I7NA 1PJTA 2J5YA 3HJSA 4QNRA 3ZCBB 3W0FA 2DWMA 1XHBA 4JN6A 2LVAA 3B9PA 3T15A 8CATA 4QOZC 2ZAMA 2FH0A 3GQ4A 5H37D 2LBCA 5EQTA 2VDBB 2VF8A 5FTNA 4AG6A 3TWKA 1N36M 4GKJM 1IXSA 3F92A 1QDRA 5GKNA 1WJ7A 3R8FA 2VIIA 3BBZA 3L27A 4MGKE 1OAOC 2YNMD 1NHWC 1TGUA 4G4RA 1DGHA 4B08A 3CTWB 4IBCA 1XNQM 1J5EM 1SXJE 4JI0M 5ITUA 2UXDM 3C3DA 2L7IA 4MGIE 4X64M 3CF6E 3GRUA 4G6ZA 3SC3A 5KQ8A 3HGIA 3U6SA 3A45A 4GRIA 4M0WA 3SAVA 4XGIA 1QUSA 5A2QS 2JY8A 3FUXA 3W67A 3U61B 1GL7A 3SYLA 2KRKA 3K1JA 1H6UA 1PJQA 2DKLA 4W5WA 1K3XA 3LVVA 1QZEA 3VDUA 1XNRM 3HY5A 1P3QQ 4AZFA 2QNJA 2ZANA 3K9PA 3U6MA 1XMQM 3Q8GA 3SHGB 2L6OA 2C9OA 2CHQA 2XSZD 1OFIA 1OIPA 2LVQD 3JAMS 3EIEA 3NBIA 4GITA 4IBEA 2KHHA 1YE9A 3GLFA 3JR5A 1I4WA 2K6BA 1ZMWA 3IECA 1FJGM 3M7GA 1L1ZA 3GLFE 2Y0TA 5FSWA 1MN3A 3U60B 4B3MM 3LW5F 3VLFB 4X62M 2KA6B 3DOAA 3SYKA 1N77A 3RGSA 2B3TA 4CGYB 1E9SA 1DGGA 1EIJA 3I04M 4LJAA 2JXNA 1PJJA 3LQQA 5EP4A 1N33M 2QHOB 1SG9A 1X37A 3HJQA 3KW6A 3AV0A 3DZDA 1GJSA 2L4EA 1XWIA 3GO8A 1NNUC 2KDLA 4RF0A 4LF4M 3UJNA 1IN7A 3RFWA 5DNYA 4IBKA 2GNOA 1IN6A 2DAEA 1WXQA 3HHZA 1E32A 2CHGA 3KDSE 2R0IA 4GC5A 4M9SA 4PDGA 1JR3D 3GLIB 3CF2A 4DV2M 1ZMVA 3V76A 4LGYA 3K2LA 2QPAA 2BWBA 3I01M 3PXGA 3GPYA 2NQ8C 1SXJD 3L29A 4B3SM 3K9OA 2C9CA 3FUUA 4P17A 2DHYA 2XZUA 3ILKA 1L2DA 2X8AA 4LZZA 4XBOA 3U6PA 2FOIC 1G8PA 2BWEA 3J81S 1QQWA 1OFHA 2XFTA 3SATA 1ORYB 5DYGA 3EIHA 5LMNM 3DFZA 1HT1E 4IJEA 1KFVA 2V6ZM 1OJLA 5ITRA 2EJSA 1NO1A 2QENA 2HKJA 2CEAA 1R6BX 3A42A 3FTCA 1G59A 1QAMA 2XEPA 1AIPC 4FCTA 4QHSA 1IY1A 2JY5A 3GLGA 2JA2A 4Z8XA 2K0BX 3KOZE 3GPPA 3FE3A 3KP1E 5BPVA 1TR8A 4M9XA 1TH3A 3GLGE 1MU5A 2DVWB 1QUTA 5C1BA 3FTDA 3SMPA 4BB9A 1Z5AA 1KYIA 3LCVB 2GQFA 3UMMA 2J7NA 1RU3A 3GPUA 2L2DA 3SAWA 3U5ZA 1R2ZA 4GH9A 3BOSA 1NY6A 3AKZA 3B74A 4JI4M 3C9PA 3SAUA 3KFUG 3BXWA 4CISA 4IBBA 3I4YA 3GQ3A 4K0KM 4GEWA 3PFIA 1QAOA 2HL7A 2QP9X 1DO0A 1G71A 4LFAM 5ITTA 2W82A 3L25A 5BR8M 4L4UA 3NBXX 4WURA 4NSRA 3AFHA 4LRSA 3GP1A 1T3TA 4JI8M 2JY6B 1NV9A 2DAMA 1WHCA 5IT9S 1G41A 3J27B 3MHVC 1Q39A 1WGLA 2DWNA 1J09A 3A98B 2F5NA 1R2YA 1Z59A 1XXHA 2KEBA 1MJGM 3L2AA 3C58A 5ITYA 1GABA 1JR3A 4REZA 1SXJC 4DR6M 1N75A 4MGYE 1HJPA 1XXHE 1Z5CA 1TH2A 1J7KA 4B7GA 4Z6YA 5FTLA 3HHWA 2M5ZA 3L28A 3GLHA 1JR3E 2KRUA 4JI1M 1SXJA 3E21A 4FWGA 4G4QA 1PM5A 4LY6A 2CRUA 3B7NA 1VG5A 2KNVA 3TE6A 3T1YM 4II7A 3LQRA 1G3IA 2DNAA 1VEJA 3GLHE 1R5LA 2MH8A 3MJ5A 3UZUA 1QANA 3RE8A 4B7HA 3LCUA 4HL4A 2R18A 3I4VA 2MGWA 4D82A 4IBGA 1IM2A 1IN4A 2LNHC 3VKHA 4KHPM 1NSFA 1DGBA 2ZTDA 4IBDA 2EA0A 2KZSA 2G5GX 2BJWA 2R4JA 1NVMA 4FCVA 3UK6A 4LFBM 7CATA 2KNAA 4D80A 5C18A 2R45A 4IJFA 3VDPA 3KSXA 2R46A 4IIWA 5EP3A 3KS8A 5EP2A 5JI2E 2N35A 2HWJA 2Y21A 3GQ5A 2FE8A 1IY0A 3QYEA 4PDIA 3VK7A 3GRYA 3GRVA 4LF6M 4CIZA 2R4EA 4JI2M 1Z6TA 2UXBM 2KZUA 4RF1A 4I8OA 1NHGC 4LF5M 2LVNC 2ZTCA 3GRRA 5IZ7D 5EP1A 2M60A 5KPZA 3HU2A 2D7EA 2DZNB 1D2NA 2DAIA 1GL6A 4Q7JA 3FYCA 4MH0E 2F5QA 2RGHA 4FCWA 1TF0B 3C3EA 1DV0A 2YQZA 3AOEC 4M9ZA 4PT5A 1IXSB 3SASA 2CUZA 3FUVA 1NNJA 1HQCA 2Y20A 2DWLA 3U6LA 2Q2EB 4IBJA 1L2CA 3AOEA 3TWMA 2Z4RA 4NOOB 1UFZA 4A3VB 2F4VM 1NJGA 1DGHB 3D8LA 4QOSA 4DR2M 1Q3BA 3FD9A 4OVZB 3TQSA 3H4JA 4AQYM 2L09A 5FLXS 2CV2A 3SFZA 4CJ6A 3HZJA 2QBYA 4P16A 1D0KA 1IN5A 1GVNA 4TUWA 2APLA 4ANRA 4GIPA 4JI3M 3KS4A 1YSYA 4X66M 5DFLA 2OOAA 1PJSA 3PNVA 4QHTA 3T6PA 1G4AE 3B89A 4DR3M 2DI0A 1OAIA 1S3SA 2Y0QA 1GKIA 1E94E 2XGNA 3D8BA 1EE8A 1KSFX 4LJ4A 4CHTB 4DR4M 1DO2A 5EXXA 2F5OA 1HT2E 4DR5M 2CWBA 1TH4A 1PJIA 1BVSA 3TL4X 3HWSA 1HNWM 1F4IA 2LHCA 1IY2A 2J7OA 1VEGA 4WP2A 1C7YA 3M0EA 3ZH9B 4DV7M 2VF7A 2O5RA 2CHVA 2ERCA 1OIZA 3I51A 3W68A 1CUKA 2LH0A 1ZAEA 2DAGA 4LJ7A 4WW0A 5E26A 2JP7A 2MR9A 1W5TA 4NRVA 1V92A 4JI7M 3HU3A 1T6OA 2BJVA 2A5YB 1IQPA 2KNZA 4AW4A 3J7AS 4L78A 2UUBM 1EFUB 1Q02A 4RKUF 5IWAM 1T43A 4LF8M 1N34M 4NSOB 1UM8A 3IG5A 2DWZB 2LTUA 2LXEA 3KXEC 4S12A 1GO5A 3IHPA 2CP8A 4KT0F 1WGNA 2AHMA 3QYBA 4I5SA 1GLNA 3JR4A 2V1CA 2UUAM 2UUCM 4DR7M 1ZMUA 3IG8A 2CE7A 2QQ8A 3U61A 4G3OA 2C98A 2JUJA 1JB0F 4DR1M 2RGOA 5FTKA 2OPFA 2ZAOA 2O25A 1QAQA 2WSFF 1Z5BA 4PCZA 3J2PB 2K47A 3H4MA 2F5SA 3FTFA 1HQYE 1NJFA 4ZPXA 4DUYM 4NXNM 3FYDA 3MK6A 4GKKM 1XMOM 3AJIB 1ZQ9A 4FW9A 5FTMA 3U6DA 2CFOA 1K82A 2ZBKB 3KOYE 4YY3M 2Z7JA 2Z3XA 4BBAA 4FVMA 1I94M 4RNAA 1IBKM 3DA1A 3FUTA 3KVWA 2MROB 1V33A 3FRIA 3HHXA 4LGMA 3U60A 2F5PA 2Z4SA 3GLGB 3THGA 5ITQA 1IXRC 2EKFA 1VDDA 2XLJA 4AKIA 3HHYA 3TWLA 4JV5M 2C99A 2OO9A 4L15A 5E6JA 2XF3A 1D0LA 1WR1B 4DBGB 3U6OA 1HR0M 4JI5M 2UXCM 1OKSA 4AI6A 1A5TA 4LF9M
chains in the Genus database with same CATH topology
4UN2B 1XB2B 1HT1E 2H5XA 1UFZA 1OQYA 1WIVA 2EJSA 2HAKA 1Y8GA 1YLAA 2LVPC 1AIPC 3H4JA 1R4GA 2JY5A 3GLIE 4F1IA 2K0BX 3E46A 3FE3A 1TR8A 3GLGE 2LVAA 4HEOA 1NV8A 5DFLA 4F2LA 2LBCA 1KYIA 2OOAA 3LCVB 3T6PA 1G4AE 1IXSA 3B89A 2DI0A 3F92A 1OAIA 1WJ7A 1E94E 2L2DA 3BBZA 4R71A 1DO2A 1HT2E 2CWBA 1BVSA 3MMPA 4GEWA 1TTEA 1F4IA 1DO0A 1VEGA 2WZJA 4WP2A 1OTRA 1C7YA 1VEKA 1CUKA 1ZV1A 1NV9A 2JY6B 2DAMA 1WHCA 1IFYA 2DAGA 1G41A 2JP7A 2MR9A 2JY8A 1V92A 1WGLA 2DZLA 2DAKA 2DKLA 1T6OA 2KNZA 1QZEA 1HJPA 1XXHE 1P3QQ 2JY7A 2QNJA 1EFUB 1Q02A 3K9PA 1T43A 1JR3E 3E21A 2LTUA 1VG5A 2KNVA 1GO5A 1G3IA 2DNAA 1VEJA 2LVOC 2LVQD 2CP8A 3GLHE 3IHPA 1VDLA 1WGNA 2KHHA 1VQ1A 2MJ5B 1ZMWA 3IECA 2DENA 3LCUA 2MGWA 1PGYA 3GLFE 1MN3A 1ZMUA 1IM2A 4G3OA 2JUJA 2B3TA 2JZ0A 2QSFX 2ZTDA 2O25A 2L4FA 2KNAA 2QHOB 3FRHA 1HQYE 1SG9A 2JZ1A 2L4EA 5JI2E 2HWJA 2DAEA 2OOBA 2R0IA 1ZMVA 2K9DA 2MROB 2LVNC 3FRIA 2JNHA 2ZTCA 2RRUA 2BWBA 2EKFA 3K9OA 2DAIA 2OO9A 2DHYA 1WR1B 4Q7JA 4DBGB 1OKSA 2EKKA 1A5TA 2G3QA 1DV0A 2BWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UN2 B;  1XB2 B;  1HT1 E;  2H5X A;  1UFZ A;  1OQY A;  1WIV A;  2EJS A;  2HAK A;  1Y8G A;  1YLA A;  2LVP C;  1AIP C;  3H4J A;  1R4G A;  2JY5 A;  3GLI E;  4F1I A;  2K0B X;  3E46 A;  3FE3 A;  1TR8 A;  3GLG E;  2LVA A;  4HEO A;  1NV8 A;  5DFL A;  4F2L A;  2LBC A;  1KYI A;  2OOA A;  3LCV B;  3T6P A;  1G4A E;  1IXS A;  3B89 A;  2DI0 A;  3F92 A;  1OAI A;  1WJ7 A;  1E94 E;  2L2D A;  3BBZ A;  4R71 A;  1DO2 A;  1HT2 E;  2CWB A;  1BVS A;  3MMP A;  4GEW A;  1TTE A;  1F4I A;  1DO0 A;  1VEG A;  2WZJ A;  4WP2 A;  1OTR A;  1C7Y A;  1VEK A;  1CUK A;  1ZV1 A;  1NV9 A;  2JY6 B;  2DAM A;  1WHC A;  1IFY A;  2DAG A;  1G41 A;  2JP7 A;  2MR9 A;  2JY8 A;  1V92 A;  1WGL A;  2DZL A;  2DAK A;  2DKL A;  1T6O A;  2KNZ A;  1QZE A;  1HJP A;  1XXH E;  1P3Q Q;  2JY7 A;  2QNJ A;  1EFU B;  1Q02 A;  3K9P A;  1T43 A;  1JR3 E;  3E21 A;  2LTU A;  1VG5 A;  2KNV A;  1GO5 A;  1G3I A;  2DNA A;  1VEJ A;  2LVO C;  2LVQ D;  2CP8 A;  3GLH E;  3IHP A;  1VDL A;  1WGN A;  2KHH A;  1VQ1 A;  2MJ5 B;  1ZMW A;  3IEC A;  2DEN A;  3LCU A;  2MGW A;  1PGY A;  3GLF E;  1MN3 A;  1ZMU A;  1IM2 A;  4G3O A;  2JUJ A;  2B3T A;  2JZ0 A;  2QSF X;  2ZTD A;  2O25 A;  2L4F A;  2KNA A;  2QHO B;  3FRH A;  1HQY E;  1SG9 A;  2JZ1 A;  2L4E A;  5JI2 E;  2HWJ A;  2DAE A;  2OOB A;  2R0I A;  1ZMV A;  2K9D A;  2MRO B;  2LVN C;  3FRI A;  2JNH A;  2ZTC A;  2RRU A;  2BWB A;  2EKF A;  3K9O A;  2DAI A;  2OO9 A;  2DHY A;  1WR1 B;  4Q7J A;  4DBG B;  1OKS A;  2EKK A;  1A5T A;  2G3Q A;  1DV0 A;  2BWE A; 
#chains in the Genus database with same CATH topology
 4DV3 M;  3Q8X A;  1XB2 B;  4R3D A;  4LJ9 A;  3U5Z B;  1V34 A;  1N32 M;  2YFQ A;  4OVZ A;  1OQY A;  1WIV A;  2HAK A;  3LVW A;  1Y8G A;  1YLA A;  2R65 A;  3GLI A;  2OQ4 A;  2D7H A;  3U6C A;  2CV1 A;  1W5S A;  3GLI E;  4F1I A;  3E46 A;  4DUZ M;  1IBM M;  3AL0 C;  5DYI A;  2R44 A;  5EJC A;  4HEO A;  3HJ8 A;  5EXS A;  3J7B A;  1D0M A;  1NV8 A;  4F2L A;  5KPT A;  5EXP A;  4LG2 A;  1QZM A;  1XXH B;  4KLN A;  5KPR A;  4LJ6 A;  4FWH A;  4NRW A;  2I7P A;  4NC6 A;  3KSJ A;  3HU1 A;  4R71 A;  4LZJ A;  2JWS A;  2LWX A;  4JI6 M;  2WSE F;  3MMP A;  3GLH B;  4GMQ A;  4DV4 M;  1TTE A;  4KO8 A;  2O01 F;  1SXJ B;  4LJ8 A;  5FTJ A;  2WZJ A;  2ZM6 M;  1OTR A;  3PNY A;  3R9X B;  2G8L A;  1HNZ M;  2EO2 A;  3E4R A;  4NL4 H;  1VEK A;  3FTE A;  3TPZ A;  3M6A A;  1ZV1 A;  2DXI A;  1IFY A;  3KOW E;  5JI3 E;  4MGZ E;  4IBI A;  2BNK A;  3T38 A;  4GHL A;  4GC9 A;  2FFJ A;  4I4L A;  2RKO A;  4BLC A;  4D81 A;  4PD2 A;  2XH9 A;  2HHH M;  2DZL A;  2DAK A;  3ZC7 B;  4JXJ A;  1QVR A;  3SMS A;  2X49 A;  3KP0 E;  5KQD A;  3UGJ A;  2VQF M;  5IRE B;  2L7H A;  4FD2 A;  4GHA A;  1NY5 A;  2JY7 A;  2X4A A;  3CGW A;  4NXM M;  3A46 A;  4JYA M;  4OU7 A;  2UU9 M;  3QWL A;  3K92 A;  4DV6 M;  4DV1 M;  4L6V 6;  2CV0 A;  4LF7 M;  2VQE M;  1TDH A;  3U6E A;  2R6F A;  1XC8 A;  2LVO C;  4L16 A;  1IXZ A;  1VDL A;  4AKH A;  2V1U A;  2KXE A;  2C5R A;  2EUC A;  1VQ1 A;  2MJ5 B;  3SHF A;  1R7R A;  2C96 A;  2DEN A;  4KOD A;  4LCB A;  3GLF B;  1PGY A;  1TDZ A;  1L1T A;  4L8R C;  2DZO B;  4B7F A;  3SAR A;  4MGH A;  2P5T A;  2KW0 A;  3RGP A;  2XFS A;  2JZ0 A;  3T1H M;  4MM3 B;  3ZQJ A;  2QSF X;  2QCU A;  4XK8 F;  3FUW A;  2L4F A;  1Q3C A;  3OTO M;  4OW0 A;  5F3W A;  3FRH A;  3KOX E;  1L2B A;  2JZ1 A;  3SBJ A;  3HKP A;  4I81 A;  1JQJ C;  4IBF A;  3AOG A;  2H1R A;  3W0L B;  1LTM A;  3J80 S;  2OOB A;  3B7Q A;  3PVS A;  4AG5 A;  3B7Z A;  3U6Q A;  4EIW A;  4AKG A;  2HCB A;  4B3T M;  3VFD A;  5EXT A;  2FS1 A;  4QNM A;  2E5L M;  2YR0 A;  2K9D A;  4YHH M;  2Z8Y M;  4B3R M;  2QZ4 A;  2FNA A;  2JNH A;  3LMM A;  1L8Q A;  2RRU A;  4HLQ A;  1HNX M;  1IBL M;  1QDT A;  3VKG A;  2QBY B;  3L26 A;  4X65 M;  1AUA A;  3FKE A;  3K8Z A;  4LFC M;  1E9R A;  4OX9 M;  5ITX A;  4ITQ A;  1K3W A;  2XSZ A;  2DHR A;  4DV0 M;  2EKK A;  2G3Q A;  1LV7 A;  1IN8 A;  4UN2 B;  5LMU M;  5ITX E;  4DV5 M;  2XZF A;  1YUB A;  3CF0 A;  3NWL A;  2WSC F;  1GJT A;  4LJ5 A;  4G4O A;  1N78 A;  4FWD A;  4R7G A;  3QAU A;  1PRB A;  4MB7 A;  2H5X A;  4Y28 F;  2D7G A;  1QYR A;  4LRT A;  1DGF A;  1MX0 A;  2R62 A;  4M0D A;  3E9S A;  5KO3 A;  1FNN A;  3WHK A;  3GPX A;  3WHL A;  3HX3 A;  1C1K A;  2LHG A;  2LVP C;  1R4G A;  3VK8 A;  5L8R F;  4G4N A;  2I7N A;  1PJT A;  2J5Y A;  3HJS A;  4QNR A;  3ZCB B;  3W0F A;  2DWM A;  1XHB A;  4JN6 A;  2LVA A;  3B9P A;  3T15 A;  8CAT A;  4QOZ C;  2ZAM A;  2FH0 A;  3GQ4 A;  5H37 D;  2LBC A;  5EQT A;  2VDB B;  2VF8 A;  5FTN A;  4AG6 A;  3TWK A;  1N36 M;  4GKJ M;  1IXS A;  3F92 A;  1QDR A;  5GKN A;  1WJ7 A;  3R8F A;  2VII A;  3BBZ A;  3L27 A;  4MGK E;  1OAO C;  2YNM D;  1NHW C;  1TGU A;  4G4R A;  1DGH A;  4B08 A;  3CTW B;  4IBC A;  1XNQ M;  1J5E M;  1SXJ E;  4JI0 M;  5ITU A;  2UXD M;  3C3D A;  2L7I A;  4MGI E;  4X64 M;  3CF6 E;  3GRU A;  4G6Z A;  3SC3 A;  5KQ8 A;  3HGI A;  3U6S A;  3A45 A;  4GRI A;  4M0W A;  3SAV A;  4XGI A;  1QUS A;  5A2Q S;  2JY8 A;  3FUX A;  3W67 A;  3U61 B;  1GL7 A;  3SYL A;  2KRK A;  3K1J A;  1H6U A;  1PJQ A;  2DKL A;  4W5W A;  1K3X A;  3LVV A;  1QZE A;  3VDU A;  1XNR M;  3HY5 A;  1P3Q Q;  4AZF A;  2QNJ A;  2ZAN A;  3K9P A;  3U6M A;  1XMQ M;  3Q8G A;  3SHG B;  2L6O A;  2C9O A;  2CHQ A;  2XSZ D;  1OFI A;  1OIP A;  2LVQ D;  3JAM S;  3EIE A;  3NBI A;  4GIT A;  4IBE A;  2KHH A;  1YE9 A;  3GLF A;  3JR5 A;  1I4W A;  2K6B A;  1ZMW A;  3IEC A;  1FJG M;  3M7G A;  1L1Z A;  3GLF E;  2Y0T A;  5FSW A;  1MN3 A;  3U60 B;  4B3M M;  3LW5 F;  3VLF B;  4X62 M;  2KA6 B;  3DOA A;  3SYK A;  1N77 A;  3RGS A;  2B3T A;  4CGY B;  1E9S A;  1DGG A;  1EIJ A;  3I04 M;  4LJA A;  2JXN A;  1PJJ A;  3LQQ A;  5EP4 A;  1N33 M;  2QHO B;  1SG9 A;  1X37 A;  3HJQ A;  3KW6 A;  3AV0 A;  3DZD A;  1GJS A;  2L4E A;  1XWI A;  3GO8 A;  1NNU C;  2KDL A;  4RF0 A;  4LF4 M;  3UJN A;  1IN7 A;  3RFW A;  5DNY A;  4IBK A;  2GNO A;  1IN6 A;  2DAE A;  1WXQ A;  3HHZ A;  1E32 A;  2CHG A;  3KDS E;  2R0I A;  4GC5 A;  4M9S A;  4PDG A;  1JR3 D;  3GLI B;  3CF2 A;  4DV2 M;  1ZMV A;  3V76 A;  4LGY A;  3K2L A;  2QPA A;  2BWB A;  3I01 M;  3PXG A;  3GPY A;  2NQ8 C;  1SXJ D;  3L29 A;  4B3S M;  3K9O A;  2C9C A;  3FUU A;  4P17 A;  2DHY A;  2XZU A;  3ILK A;  1L2D A;  2X8A A;  4LZZ A;  4XBO A;  3U6P A;  2FOI C;  1G8P A;  2BWE A;  3J81 S;  1QQW A;  1OFH A;  2XFT A;  3SAT A;  1ORY B;  5DYG A;  3EIH A;  5LMN M;  3DFZ A;  1HT1 E;  4IJE A;  1KFV A;  2V6Z M;  1OJL A;  5ITR A;  2EJS A;  1NO1 A;  2QEN A;  2HKJ A;  2CEA A;  1R6B X;  3A42 A;  3FTC A;  1G59 A;  1QAM A;  2XEP A;  1AIP C;  4FCT A;  4QHS A;  1IY1 A;  2JY5 A;  3GLG A;  2JA2 A;  4Z8X A;  2K0B X;  3KOZ E;  3GPP A;  3FE3 A;  3KP1 E;  5BPV A;  1TR8 A;  4M9X A;  1TH3 A;  3GLG E;  1MU5 A;  2DVW B;  1QUT A;  5C1B A;  3FTD A;  3SMP A;  4BB9 A;  1Z5A A;  1KYI A;  3LCV B;  2GQF A;  3UMM A;  2J7N A;  1RU3 A;  3GPU A;  2L2D A;  3SAW A;  3U5Z A;  1R2Z A;  4GH9 A;  3BOS A;  1NY6 A;  3AKZ A;  3B74 A;  4JI4 M;  3C9P A;  3SAU A;  3KFU G;  3BXW A;  4CIS A;  4IBB A;  3I4Y A;  3GQ3 A;  4K0K M;  4GEW A;  3PFI A;  1QAO A;  2HL7 A;  2QP9 X;  1DO0 A;  1G71 A;  4LFA M;  5ITT A;  2W82 A;  3L25 A;  5BR8 M;  4L4U A;  3NBX X;  4WUR A;  4NSR A;  3AFH A;  4LRS A;  3GP1 A;  1T3T A;  4JI8 M;  2JY6 B;  1NV9 A;  2DAM A;  1WHC A;  5IT9 S;  1G41 A;  3J27 B;  3MHV C;  1Q39 A;  1WGL A;  2DWN A;  1J09 A;  3A98 B;  2F5N A;  1R2Y A;  1Z59 A;  1XXH A;  2KEB A;  1MJG M;  3L2A A;  3C58 A;  5ITY A;  1GAB A;  1JR3 A;  4REZ A;  1SXJ C;  4DR6 M;  1N75 A;  4MGY E;  1HJP A;  1XXH E;  1Z5C A;  1TH2 A;  1J7K A;  4B7G A;  4Z6Y A;  5FTL A;  3HHW A;  2M5Z A;  3L28 A;  3GLH A;  1JR3 E;  2KRU A;  4JI1 M;  1SXJ A;  3E21 A;  4FWG A;  4G4Q A;  1PM5 A;  4LY6 A;  2CRU A;  3B7N A;  1VG5 A;  2KNV A;  3TE6 A;  3T1Y M;  4II7 A;  3LQR A;  1G3I A;  2DNA A;  1VEJ A;  3GLH E;  1R5L A;  2MH8 A;  3MJ5 A;  3UZU A;  1QAN A;  3RE8 A;  4B7H A;  3LCU A;  4HL4 A;  2R18 A;  3I4V A;  2MGW A;  4D82 A;  4IBG A;  1IM2 A;  1IN4 A;  2LNH C;  3VKH A;  4KHP M;  1NSF A;  1DGB A;  2ZTD A;  4IBD A;  2EA0 A;  2KZS A;  2G5G X;  2BJW A;  2R4J A;  1NVM A;  4FCV A;  3UK6 A;  4LFB M;  7CAT A;  2KNA A;  4D80 A;  5C18 A;  2R45 A;  4IJF A;  3VDP A;  3KSX A;  2R46 A;  4IIW A;  5EP3 A;  3KS8 A;  5EP2 A;  5JI2 E;  2N35 A;  2HWJ A;  2Y21 A;  3GQ5 A;  2FE8 A;  1IY0 A;  3QYE A;  4PDI A;  3VK7 A;  3GRY A;  3GRV A;  4LF6 M;  4CIZ A;  2R4E A;  4JI2 M;  1Z6T A;  2UXB M;  2KZU A;  4RF1 A;  4I8O A;  1NHG C;  4LF5 M;  2LVN C;  2ZTC A;  3GRR A;  5IZ7 D;  5EP1 A;  2M60 A;  5KPZ A;  3HU2 A;  2D7E A;  2DZN B;  1D2N A;  2DAI A;  1GL6 A;  4Q7J A;  3FYC A;  4MH0 E;  2F5Q A;  2RGH A;  4FCW A;  1TF0 B;  3C3E A;  1DV0 A;  2YQZ A;  3AOE C;  4M9Z A;  4PT5 A;  1IXS B;  3SAS A;  2CUZ A;  3FUV A;  1NNJ A;  1HQC A;  2Y20 A;  2DWL A;  3U6L A;  2Q2E B;  4IBJ A;  1L2C A;  3AOE A;  3TWM A;  2Z4R A;  4NOO B;  1UFZ A;  4A3V B;  2F4V M;  1NJG A;  1DGH B;  3D8L A;  4QOS A;  4DR2 M;  1Q3B A;  3FD9 A;  4OVZ B;  3TQS A;  3H4J A;  4AQY M;  2L09 A;  5FLX S;  2CV2 A;  3SFZ A;  4CJ6 A;  3HZJ A;  2QBY A;  4P16 A;  1D0K A;  1IN5 A;  1GVN A;  4TUW A;  2APL A;  4ANR A;  4GIP A;  4JI3 M;  3KS4 A;  1YSY A;  4X66 M;  5DFL A;  2OOA A;  1PJS A;  3PNV A;  4QHT A;  3T6P A;  1G4A E;  3B89 A;  4DR3 M;  2DI0 A;  1OAI A;  1S3S A;  2Y0Q A;  1GKI A;  1E94 E;  2XGN A;  3D8B A;  1EE8 A;  1KSF X;  4LJ4 A;  4CHT B;  4DR4 M;  1DO2 A;  5EXX A;  2F5O A;  1HT2 E;  4DR5 M;  2CWB A;  1TH4 A;  1PJI A;  1BVS A;  3TL4 X;  3HWS A;  1HNW M;  1F4I A;  2LHC A;  1IY2 A;  2J7O A;  1VEG A;  4WP2 A;  1C7Y A;  3M0E A;  3ZH9 B;  4DV7 M;  2VF7 A;  2O5R A;  2CHV A;  2ERC A;  1OIZ A;  3I51 A;  3W68 A;  1CUK A;  2LH0 A;  1ZAE A;  2DAG A;  4LJ7 A;  4WW0 A;  5E26 A;  2JP7 A;  2MR9 A;  1W5T A;  4NRV A;  1V92 A;  4JI7 M;  3HU3 A;  1T6O A;  2BJV A;  2A5Y B;  1IQP A;  2KNZ A;  4AW4 A;  3J7A S;  4L78 A;  2UUB M;  1EFU B;  1Q02 A;  4RKU F;  5IWA M;  1T43 A;  4LF8 M;  1N34 M;  4NSO B;  1UM8 A;  3IG5 A;  2DWZ B;  2LTU A;  2LXE A;  3KXE C;  4S12 A;  1GO5 A;  3IHP A;  2CP8 A;  4KT0 F;  1WGN A;  2AHM A;  3QYB A;  4I5S A;  1GLN A;  3JR4 A;  2V1C A;  2UUA M;  2UUC M;  4DR7 M;  1ZMU A;  3IG8 A;  2CE7 A;  2QQ8 A;  3U61 A;  4G3O A;  2C98 A;  2JUJ A;  1JB0 F;  4DR1 M;  2RGO A;  5FTK A;  2OPF A;  2ZAO A;  2O25 A;  1QAQ A;  2WSF F;  1Z5B A;  4PCZ A;  3J2P B;  2K47 A;  3H4M A;  2F5S A;  3FTF A;  1HQY E;  1NJF A;  4ZPX A;  4DUY M;  4NXN M;  3FYD A;  3MK6 A;  4GKK M;  1XMO M;  3AJI B;  1ZQ9 A;  4FW9 A;  5FTM A;  3U6D A;  2CFO A;  1K82 A;  2ZBK B;  3KOY E;  4YY3 M;  2Z7J A;  2Z3X A;  4BBA A;  4FVM A;  1I94 M;  4RNA A;  1IBK M;  3DA1 A;  3FUT A;  3KVW A;  2MRO B;  1V33 A;  3FRI A;  3HHX A;  4LGM A;  3U60 A;  2F5P A;  2Z4S A;  3GLG B;  3THG A;  5ITQ A;  1IXR C;  2EKF A;  1VDD A;  2XLJ A;  4AKI A;  3HHY A;  3TWL A;  4JV5 M;  2C99 A;  2OO9 A;  4L15 A;  5E6J A;  2XF3 A;  1D0L A;  1WR1 B;  4DBG B;  3U6O A;  1HR0 M;  4JI5 M;  2UXC M;  1OKS A;  4AI6 A;  1A5T A;  4LF9 M; 
#chains in the Genus database with same CATH homology
 4UN2 B;  1XB2 B;  1HT1 E;  2H5X A;  1UFZ A;  1OQY A;  1WIV A;  2EJS A;  2HAK A;  1Y8G A;  1YLA A;  2LVP C;  1AIP C;  3H4J A;  1R4G A;  2JY5 A;  3GLI E;  4F1I A;  2K0B X;  3E46 A;  3FE3 A;  1TR8 A;  3GLG E;  2LVA A;  4HEO A;  1NV8 A;  5DFL A;  4F2L A;  2LBC A;  1KYI A;  2OOA A;  3LCV B;  3T6P A;  1G4A E;  1IXS A;  3B89 A;  2DI0 A;  3F92 A;  1OAI A;  1WJ7 A;  1E94 E;  2L2D A;  3BBZ A;  4R71 A;  1DO2 A;  1HT2 E;  2CWB A;  1BVS A;  3MMP A;  4GEW A;  1TTE A;  1F4I A;  1DO0 A;  1VEG A;  2WZJ A;  4WP2 A;  1OTR A;  1C7Y A;  1VEK A;  1CUK A;  1ZV1 A;  1NV9 A;  2JY6 B;  2DAM A;  1WHC A;  1IFY A;  2DAG A;  1G41 A;  2JP7 A;  2MR9 A;  2JY8 A;  1V92 A;  1WGL A;  2DZL A;  2DAK A;  2DKL A;  1T6O A;  2KNZ A;  1QZE A;  1HJP A;  1XXH E;  1P3Q Q;  2JY7 A;  2QNJ A;  1EFU B;  1Q02 A;  3K9P A;  1T43 A;  1JR3 E;  3E21 A;  2LTU A;  1VG5 A;  2KNV A;  1GO5 A;  1G3I A;  2DNA A;  1VEJ A;  2LVO C;  2LVQ D;  2CP8 A;  3GLH E;  3IHP A;  1VDL A;  1WGN A;  2KHH A;  1VQ1 A;  2MJ5 B;  1ZMW A;  3IEC A;  2DEN A;  3LCU A;  2MGW A;  1PGY A;  3GLF E;  1MN3 A;  1ZMU A;  1IM2 A;  4G3O A;  2JUJ A;  2B3T A;  2JZ0 A;  2QSF X;  2ZTD A;  2O25 A;  2L4F A;  2KNA A;  2QHO B;  3FRH A;  1HQY E;  1SG9 A;  2JZ1 A;  2L4E A;  5JI2 E;  2HWJ A;  2DAE A;  2OOB A;  2R0I A;  1ZMV A;  2K9D A;  2MRO B;  2LVN C;  3FRI A;  2JNH A;  2ZTC A;  2RRU A;  2BWB A;  2EKF A;  3K9O A;  2DAI A;  2OO9 A;  2DHY A;  1WR1 B;  4Q7J A;  4DBG B;  1OKS A;  2EKK A;  1A5T A;  2G3Q A;  1DV0 A;  2BWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...