2DZLA

Solution structure of the uba domain in human protein fam100b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
GSSGSSGMSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the UBA domain in Human Protein FAM100B
rcsb
source organism Homo sapiens
molecule tags Structural genomics unknown function
molecule keywords Protein FAM100B
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dzlA00
2JY5A 2G3QA 1WGLA 2DZLA 1VDLA 1R4GA 1VEGA 1HJPA 2ZTDA 5DFLA 2JY6B 2DAMA 2LVPC 2MGWA 2OOBA 1BVSA 2K9DA 2KNVA 1VG5A 1ZMWA 1ZMVA 1Q02A 4F2LA 3GLIE 1OQYA 2JY8A 1DO2A 1E94E 1T43A 2LVNC 2DNAA 1T6OA 1P3QQ 1Y8GA 2LVAA 3FRIA 1V92A 1PGYA 3FE3A 2BWBA 4G3OA 1GO5A 1QZEA 2LTUA 2LVOC 1HQYE 4F1IA 4WP2A 1XXHE 2DKLA 1DO0A 2DAGA 2HAKA 2H5XA 1JR3E 2KNAA 1AIPC 1ZMUA 2L2DA 2MROB 2RRUA 4UN2B 1IFYA 2DENA 1F4IA 1TR8A 2OO9A 2JUJA 3GLFE 1OKSA 1DV0A 3LCVB 1CUKA 2L4EA 1WR1B 1VQ1A 4Q7JA 1G3IA 3F92A 2CP8A 1C7YA 2DI0A 2HWJA 1ZV1A 3T6PA 2CWBA 1WGNA 2KHHA 1A5TA 1HT2E 1MN3A 1UFZA 1WIVA 1SG9A 3MMPA 1IM2A 1TTEA 2O25A 1G4AE 2JNHA 2K0BX 3IHPA 1NV8A 2DAKA 1YLAA 1EFUB 2JY7A 1KYIA 1OAIA 2JZ1A 2QNJA 3GLGE 2QHOB 2EKKA 4HEOA 2L4FA 1XB2B 2DAEA 3LCUA 2R0IA 2JZ0A 1NV9A 2LBCA 3E21A 3H4JA 4DBGB 2ZTCA 5JI2E 2MJ5B 2DHYA 2LVQD 3GLHE 1WHCA 3BBZA 3IECA 2KNZA 1VEKA 3K9PA 2QSFX 1IXSA 2EKFA 2EJSA 1WJ7A 4R71A 2WZJA 2JP7A 1OTRA 2OOAA 1G41A 1VEJA 1HT1E 3E46A 3FRHA 4GEWA 3K9OA 2DAIA 2MR9A 2B3TA 3B89A 2BWEA
chains in the Genus database with same CATH superfamily
2O01F 4IBGA 4REZA 2LWXA 1VDLA 5KPRA 1R4GA 4GHAA 2JWSA 1V33A 3L28A 1HJPA 3KXEC 5EXPA 3HGIA 1TH4A 2LVPC 3GLHB 2OOBA 3W68A 4AG6A 4AZFA 1IXSB 2Y20A 2ZM6M 1EE8A 4P17A 3TE6A 3CF2A 2JY8A 2Y21A 1E94E 2F5PA 1RU3A 4M9XA 1T43A 4QNMA 2LVNC 4DV3M 2DNAA 3KOZE 3FTFA 2LVAA 2M60A 3QAUA 3UZUA 3PXGA 1IN5A 2OPFA 4IBEA 3FUUA 3CF0A 4G3OA 3KSJA 1TH3A 2CRUA 1NVMA 1PJQA 2LTUA 2LVOC 3LW5F 4F1IA 1QANA 4CISA 4JV5M 2F5NA 4WP2A 4BBAA 2GNOA 4GHLA 2I7NA 3VKGA 2HAKA 3T38A 1PJSA 1Q39A 3HJSA 2KA6B 3NBIA 5FLXS 2VQEM 3EIHA 1IN4A 3HU1A 4IBCA 4JN6A 4DV5M 1NNJA 1L2BA 3SMSA 1DGGA 2KRKA 2KW0A 4NL4H 4UN2B 2DENA 3HU3A 3I01M 2QPAA 3AJIB 1QAOA 3IG8A 3FTCA 4GITA 1ZAEA 2OO9A 1NNUC 4FD2A 2WSEF 4M0DA 3U61A 3FD9A 4NXNM 3THGA 1XC8A 1R2ZA 3LCVB 5IZ7D 3A98B 1WR1B 3K2LA 3HJQA 4LJ5A 4FCVA 5EXTA 2ZBKB 1C7YA 3R8FA 3BOSA 4NXMM 2KHHA 2Y0TA 2YNMD 3KOXE 3HHXA 1D0KA 2LH0A 3J2PB 2JNHA 2X4AA 5ITTA 1K82A 2UUCM 3GLGA 2VF7A 1Z5BA 5JI3E 3KP0E 3I51A 4MM3B 2JA2A 4DV0M 1XXHB 2RGHA 3TWKA 4MGHA 4DUYM 4LRTA 5ITRA 1KYIA 2X8AA 2C5RA 1NSFA 2GQFA 5IT9S 1NO1A 1AUAA 1QUSA 1E32A 1R7RA 1JR3A 2QP9X 4HEOA 3AKZA 4LF4M 1R2YA 2C98A 5IREB 3SC3A 1PJJA 1HNWM 5GKNA 2K6BA 2I7PA 2XFSA 4MGZE 5DYIA 2KZSA 3HWSA 4DR5M 1XMOM 1IXRC 5KO3A 3HU2A 3A46A 4LGYA 1MX0A 2R4EA 2KDLA 3V76A 4X66M 4X62M 5EP1A 3ZC7B 2KNZA 3FKEA 4LF7M 2CV0A 3KSXA 3QWLA 5ITQA 2ZANA 4AKIA 1YSYA 3AOEA 4FWHA 4P16A 3D8LA 1TH2A 1Z5CA 3RGPA 2EJSA 2KXEA 4I8OA 4AW4A 3UGJA 3RGSA 1IBKM 3HHYA 1XHBA 4R71A 3GPUA 2Z3XA 4DV7M 4JI7M 4M0WA 1OTRA 4NC6A 1VEJA 1HT1E 2YR0A 4X65M 4B3MM 5FTLA 3CF6E 2N35A 4D80A 2O5RA 2MH8A 1GVNA 2CHVA 1IQPA 2FS1A 3K9OA 5EP4A 3TWLA 4DV6M 4LJ6A 3R9XB 3MJ5A 3B89A 3GLIA 3GPPA 2RKOA 5EXSA 1NY6A 3L29A 3U6QA 2W82A 1QAQA 3L26A 4DV2M 1Z5AA 5FTJA 3HHZA 2VF8A 2LHGA 5DFLA 5F3WA 3WHKA 1BVSA 2DWLA 4B7HA 4NRWA 1IN8A 1VG5A 1ZQ9A 1W5TA 4OX9M 1NY5A 2CEAA 5ITXA 3KVWA 3SYLA 3IG5A 4Z8XA 1DO2A 3T1YM 1L1ZA 1KSFX 2DXIA 1T6OA 3EIEA 3AOGA 4GRIA 1Y8GA 2QCUA 2K47A 1V92A 2VDBB 5KPZA 4NOOB 3QYBA 2WSFF 4NSOB 4D81A 1IY2A 2KRUA 1GJSA 1QUTA 3AOEC 1HNXM 4EIWA 3ZCBB 4KO8A 3M7GA 3SAWA 1XNQM 2BJVA 2LHCA 3GRYA 2G8LA 4IJFA 1EIJA 4DR4M 3KFUG 2D7HA 2HL7A 2DAGA 3SHGB 2C9CA 4FWDA 3VFDA 2DWNA 4RF1A 1IN7A 3W0FA 4DR2M 7CATA 1AIPC 1ZMUA 4JI1M 2VQFM 1J5EM 5E26A 2RRUA 1IFYA 1TDHA 1OFHA 1F4IA 3J80S 5KPTA 3DOAA 2DZOB 2Y0QA 2Z7JA 1L1TA 5FTMA 4PDIA 2JUJA 4IBKA 2XSZD 2XZUA 4LJ4A 4B3TM 1OKSA 2APLA 1TDZA 1CUKA 3L2AA 4NSRA 4OW0A 2FNAA 3GLIB 5KQDA 4DR7M 3VKHA 1DGBA 2UU9M 3PVSA 4R7GA 4CIZA 3UMMA 2Z4SA 3T6PA 1WXQA 4FCWA 2CWBA 3U5ZB 2ZAOA 1N34M 3C3EA 2J7OA 3U6PA 2F5OA 4K0KM 1WIVA 2R62A 3HHWA 4FW9A 1TTEA 2L09A 3RFWA 4HL4A 2R6FA 4JI2M 2FE8A 4LG2A 4B3RM 2UXCM 3NWLA 1HNZM 3FYDA 1L8QA 2L7IA 1EFUB 4G4RA 4XGIA 2NQ8C 1R6BX 2QQ8A 2J5YA 4OU7A 3GPXA 1TF0B 2JXNA 2JZ1A 2BNKA 2QHOB 1YE9A 2EA0A 3ZQJA 2UUAM 2DVWB 2F4VM 4JYAM 4AKHA 3B7QA 1J09A 1XB2B 4FCTA 4JI0M 3LCUA 5ITYA 3W0LB 3JR5A 3U5ZA 4B08A 3E21A 4GH9A 1QDRA 3T1HM 4LCBA 4DR1M 2MJ5B 2DHYA 3GLHE 3U6LA 3BBZA 1VDDA 3LVVA 4HLQA 2R65A 3C3DA 4IJEA 5ITUA 4QHTA 4BLCA 1V34A 3K8ZA 1VEKA 5BR8M 2HCBA 3J81S 3ZH9B 3TPZA 2F5QA 2CHQA 5A2QS 3KOWE 4I81A 2CE7A 1N78A 2QZ4A 1SXJA 3ILKA 5FTNA 4QOZC 4D82A 1G8PA 4ITQA 4JI8M 3J27B 2V1UA 3LVWA 4XK8F 5KQ8A 3E4RA 4I4LA 1JQJC 3VK7A 1I94M 2B3TA 1J7KA 4PT5A 2BWEA 4CHTB 2G3QA 2DZLA 1N36M 3HX3A 1L2DA 1QVRA 1IXZA 2DAMA 2MGWA 4FVMA 4B3SM 4AKGA 2KNVA 4IIWA 1PM5A 1LTMA 1ZMVA 2EUCA 5C18A 4F2LA 4PD2A 5E6JA 3TWMA 3HZJA 1YUBA 4L78A 3UJNA 2KEBA 1OFIA 3KS4A 3SAVA 4MGYE 3HKPA 3SHFA 2XGNA 3FTDA 5EJCA 3FRIA 5LMNM 4LZJA 1PGYA 1QQWA 2CHGA 3FE3A 1QDTA 2BWBA 4FWGA 1MU5A 3W67A 1D0LA 1QZEA 4KODA 1N32M 4B7FA 2AHMA 3GQ3A 1C1KA 3BXWA 4MGIE 3J7AS 4LFAM 2WSCF 2D7GA 1D0MA 1XXHE 2ERCA 1DO0A 5C1BA 2XZFA 3QYEA 2H5XA 1JR3E 4W5WA 2KNAA 4YHHM 2FFJA 3KS8A 3GLFA 1DGFA 5FSWA 2XSZA 1HQCA 2HHHM 2J7NA 1JB0F 3Q8GA 3MK6A 2KZUA 4IBFA 3GLFE 3GP1A 3FUTA 1DV0A 3DA1A 3E9SA 4RKUF 3NBXX 1K3XA 3SASA 4LF5M 1IN6A 5DNYA 3FTEA 2XLJA 1G3IA 4GKKM 3FYCA 2DWZB 3KW6A 4DR3M 1QZMA 2C96A 1GL7A 2Z8YM 1FNNA 2C99A 1IM2A 4MGKE 3A45A 3T15A 2O25A 3GQ5A 3C58A 3KDSE 1SXJB 1HR0M 2K0BX 3H4MA 2EO2A 1NV8A 1PJTA 2DAKA 3FUXA 2V6ZM 4Z6YA 2JY7A 2XH9A 1E9SA 3I04M 3J7BA 3GPYA 1N77A 5LMUM 3DZDA 4M9ZA 4G4OA 2Q2EB 1OAIA 2QNJA 2LXEA 2CV1A 1FJGM 4QHSA 5ITXE 2HKJA 2EKKA 4IBJA 2RGOA 2UXBM 2L4FA 3GLHA 3SYKA 4GIPA 3SMPA 4GC9A 2DAEA 4L8RC 2R0IA 3A42A 2LBCA 4M9SA 3WHLA 1JR3D 3SATA 3H4JA 3LMMA 4DBGB 2ZTCA 3SARA 1T3TA 3U6EA 1WHCA 2H1RA 2R46A 4L15A 3IECA 3HY5A 3PNVA 4PCZA 3HJ8A 1SXJE 3RE8A 3K9PA 2QBYA 2CUZA 1SXJD 2QSFX 1IXSA 4LJ7A 4YY3M 2EKFA 1WJ7A 1QAMA 1DGHB 2DWMA 1KFVA 2OOAA 4QNRA 1OIZA 3LQRA 4WW0A 3GRVA 4OVZA 3SAUA 3FRHA 4MH0E 1IY0A 4GEWA 4PDGA 4JI5M 1N75A 4B7GA 3B7NA 1D2NA 1XWIA 2P5TA 3FUWA 3UK6A 3I4VA 2DAIA 8CATA 2MR9A 3B7ZA 3B9PA 3U6DA 2JY5A 5H37D 4DUZM 1WGLA 3K92A 4BB9A 4LF9M 3OTOM 4GMQA 5L8RF 1VEGA 1IBLM 1H6UA 2ZTDA 2JY6B 4JXJA 5EP3A 1Z6TA 4LFCM 1E9RA 2K9DA 3M0EA 1ZMWA 1XNRM 1Q02A 4TUWA 3SBJA 3GLIE 3AFHA 4I5SA 1OQYA 3K1JA 4II7A 1QYRA 5DYGA 4G4QA 1W5SA 1L2CA 3TQSA 5BPVA 3KP1E 3I4YA 2YFQA 1P3QQ 3GRRA 3CTWB 1Q3BA 2QBYB 2DHRA 4DR6M 3U60A 5IWAM 1GO5A 4S12A 2DZNB 2R44A 2D7EA 4JI6M 4LJ8A 3PNYA 1GL6A 1HQYE 1GABA 2E5LM 4KLNA 1GJTA 1Z59A 4GKJM 2DKLA 1NHWC 3D8BA 2Z4RA 2UXDM 4X64M 2L2DA 4LRSA 3L25A 2MROB 1OIPA 4JI3M 3PFIA 4LF8M 5FTKA 1PJIA 3KOYE 1TR8A 4L6V6 1N33M 4LGMA 4LFBM 3VDPA 4L4UA 2L4EA 1OJLA 2A5YB 4CJ6A 1VQ1A 4Q7JA 3TL4X 3U6CA 3VK8A 2F5SA 4LZZA 1NJFA 2FH0A 3F92A 2CP8A 4A3VB 1Q3CA 2DI0A 2L7HA 1ZV1A 2HWJA 2FOIC 5EQTA 1WGNA 2M5ZA 1A5TA 1HT2E 1MN3A 1GKIA 1UFZA 3DFZA 1SG9A 3MMPA 3Q8XA 1LV7A 3LQQA 2R45A 1SXJC 4RF0A 3JR4A 2OQ4A 1DGHA 1G4AE 3GLGB 1G71A 1NJGA 1GLNA 3AV0A 4IBIA 4LJ9A 3IHPA 2VIIA 1YLAA 4ZPXA 3GRUA 4LY6A 2ZAMA 2C9OA 2V1CA 1NHGC 1TGUA 3C9PA 4KHPM 2XFTA 4NRVA 4OVZB 3GLGE 2XF3A 4AG5A 3GLFB 3JAMS 4GC5A 4R3DA 2QENA 3U6SA 2YQZA 2CV2A 3B74A 1K3WA 3U60B 3L27A 2JZ0A 1NV9A 5EXXA 3U61B 4IBDA 2LNHC 3M6AA 2CFOA 1PRBA 5JI2E 2LVQD 4WURA 4DV4M 1MJGM 4ANRA 2L6OA 1XMQM 4IBBA 4KT0F 2BJWA 4XBOA 1IY1A 4G6ZA 4AQYM 3MHVC 1XXHA 2R18A 4LJAA 3VLFB 1UM8A 3U6OA 4LF6M 1ORYB 2G5GX 4CGYB 2WZJA 1OAOC 1S3SA 2JP7A 4L16A 4RNAA 1G41A 4QOSA 3SFZA 2R4JA 3GO8A 3CGWA 4Y28F 5EP2A 2UUBM 3E46A 4G4NA 3U6MA 4AI6A 4MB7A 3VDUA 1G59A 2X49A 1X37A 1I4WA 3FUVA 3GQ4A 4DV1M 3AL0C 1R5LA 1IBMM 4JI4M 2XEPA
chains in the Genus database with same CATH topology
2JY5A 2G3QA 1WGLA 2DZLA 1VDLA 1R4GA 1VEGA 1HJPA 2ZTDA 5DFLA 2JY6B 2DAMA 2LVPC 2MGWA 2OOBA 1BVSA 2K9DA 2KNVA 1VG5A 1ZMWA 1ZMVA 1Q02A 4F2LA 3GLIE 1OQYA 2JY8A 1DO2A 1E94E 1T43A 2LVNC 2DNAA 1T6OA 1P3QQ 1Y8GA 2LVAA 3FRIA 1V92A 1PGYA 3FE3A 2BWBA 4G3OA 1GO5A 1QZEA 2LTUA 2LVOC 1HQYE 4F1IA 4WP2A 1XXHE 2DKLA 1DO0A 2DAGA 2HAKA 2H5XA 1JR3E 2KNAA 1AIPC 1ZMUA 2L2DA 2MROB 2RRUA 4UN2B 1IFYA 2DENA 1F4IA 1TR8A 2OO9A 2JUJA 3GLFE 1OKSA 1DV0A 3LCVB 1CUKA 2L4EA 1WR1B 1VQ1A 4Q7JA 1G3IA 3F92A 2CP8A 1C7YA 2DI0A 2HWJA 1ZV1A 3T6PA 2CWBA 1WGNA 2KHHA 1A5TA 1HT2E 1MN3A 1UFZA 1WIVA 1SG9A 3MMPA 1IM2A 1TTEA 2O25A 1G4AE 2JNHA 2K0BX 3IHPA 1NV8A 2DAKA 1YLAA 1EFUB 2JY7A 1KYIA 1OAIA 2JZ1A 2QNJA 3GLGE 2QHOB 2EKKA 4HEOA 2L4FA 1XB2B 2DAEA 3LCUA 2R0IA 2JZ0A 1NV9A 2LBCA 3E21A 3H4JA 4DBGB 2ZTCA 5JI2E 2MJ5B 2DHYA 2LVQD 3GLHE 1WHCA 3BBZA 3IECA 2KNZA 1VEKA 3K9PA 2QSFX 1IXSA 2EKFA 2EJSA 1WJ7A 4R71A 2WZJA 2JP7A 1OTRA 2OOAA 1G41A 1VEJA 1HT1E 3E46A 3FRHA 4GEWA 3K9OA 2DAIA 2MR9A 2B3TA 3B89A 2BWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY5 A;  2G3Q A;  1WGL A;  2DZL A;  1VDL A;  1R4G A;  1VEG A;  1HJP A;  2ZTD A;  5DFL A;  2JY6 B;  2DAM A;  2LVP C;  2MGW A;  2OOB A;  1BVS A;  2K9D A;  2KNV A;  1VG5 A;  1ZMW A;  1ZMV A;  1Q02 A;  4F2L A;  3GLI E;  1OQY A;  2JY8 A;  1DO2 A;  1E94 E;  1T43 A;  2LVN C;  2DNA A;  1T6O A;  1P3Q Q;  1Y8G A;  2LVA A;  3FRI A;  1V92 A;  1PGY A;  3FE3 A;  2BWB A;  4G3O A;  1GO5 A;  1QZE A;  2LTU A;  2LVO C;  1HQY E;  4F1I A;  4WP2 A;  1XXH E;  2DKL A;  1DO0 A;  2DAG A;  2HAK A;  2H5X A;  1JR3 E;  2KNA A;  1AIP C;  1ZMU A;  2L2D A;  2MRO B;  2RRU A;  4UN2 B;  1IFY A;  2DEN A;  1F4I A;  1TR8 A;  2OO9 A;  2JUJ A;  3GLF E;  1OKS A;  1DV0 A;  3LCV B;  1CUK A;  2L4E A;  1WR1 B;  1VQ1 A;  4Q7J A;  1G3I A;  3F92 A;  2CP8 A;  1C7Y A;  2DI0 A;  2HWJ A;  1ZV1 A;  3T6P A;  2CWB A;  1WGN A;  2KHH A;  1A5T A;  1HT2 E;  1MN3 A;  1UFZ A;  1WIV A;  1SG9 A;  3MMP A;  1IM2 A;  1TTE A;  2O25 A;  1G4A E;  2JNH A;  2K0B X;  3IHP A;  1NV8 A;  2DAK A;  1YLA A;  1EFU B;  2JY7 A;  1KYI A;  1OAI A;  2JZ1 A;  2QNJ A;  3GLG E;  2QHO B;  2EKK A;  4HEO A;  2L4F A;  1XB2 B;  2DAE A;  3LCU A;  2R0I A;  2JZ0 A;  1NV9 A;  2LBC A;  3E21 A;  3H4J A;  4DBG B;  2ZTC A;  5JI2 E;  2MJ5 B;  2DHY A;  2LVQ D;  3GLH E;  1WHC A;  3BBZ A;  3IEC A;  2KNZ A;  1VEK A;  3K9P A;  2QSF X;  1IXS A;  2EKF A;  2EJS A;  1WJ7 A;  4R71 A;  2WZJ A;  2JP7 A;  1OTR A;  2OOA A;  1G41 A;  1VEJ A;  1HT1 E;  3E46 A;  3FRH A;  4GEW A;  3K9O A;  2DAI A;  2MR9 A;  2B3T A;  3B89 A;  2BWE A; 
#chains in the Genus database with same CATH topology
 2O01 F;  4IBG A;  4REZ A;  2LWX A;  1VDL A;  5KPR A;  1R4G A;  4GHA A;  2JWS A;  1V33 A;  3L28 A;  1HJP A;  3KXE C;  5EXP A;  3HGI A;  1TH4 A;  2LVP C;  3GLH B;  2OOB A;  3W68 A;  4AG6 A;  4AZF A;  1IXS B;  2Y20 A;  2ZM6 M;  1EE8 A;  4P17 A;  3TE6 A;  3CF2 A;  2JY8 A;  2Y21 A;  1E94 E;  2F5P A;  1RU3 A;  4M9X A;  1T43 A;  4QNM A;  2LVN C;  4DV3 M;  2DNA A;  3KOZ E;  3FTF A;  2LVA A;  2M60 A;  3QAU A;  3UZU A;  3PXG A;  1IN5 A;  2OPF A;  4IBE A;  3FUU A;  3CF0 A;  4G3O A;  3KSJ A;  1TH3 A;  2CRU A;  1NVM A;  1PJQ A;  2LTU A;  2LVO C;  3LW5 F;  4F1I A;  1QAN A;  4CIS A;  4JV5 M;  2F5N A;  4WP2 A;  4BBA A;  2GNO A;  4GHL A;  2I7N A;  3VKG A;  2HAK A;  3T38 A;  1PJS A;  1Q39 A;  3HJS A;  2KA6 B;  3NBI A;  5FLX S;  2VQE M;  3EIH A;  1IN4 A;  3HU1 A;  4IBC A;  4JN6 A;  4DV5 M;  1NNJ A;  1L2B A;  3SMS A;  1DGG A;  2KRK A;  2KW0 A;  4NL4 H;  4UN2 B;  2DEN A;  3HU3 A;  3I01 M;  2QPA A;  3AJI B;  1QAO A;  3IG8 A;  3FTC A;  4GIT A;  1ZAE A;  2OO9 A;  1NNU C;  4FD2 A;  2WSE F;  4M0D A;  3U61 A;  3FD9 A;  4NXN M;  3THG A;  1XC8 A;  1R2Z A;  3LCV B;  5IZ7 D;  3A98 B;  1WR1 B;  3K2L A;  3HJQ A;  4LJ5 A;  4FCV A;  5EXT A;  2ZBK B;  1C7Y A;  3R8F A;  3BOS A;  4NXM M;  2KHH A;  2Y0T A;  2YNM D;  3KOX E;  3HHX A;  1D0K A;  2LH0 A;  3J2P B;  2JNH A;  2X4A A;  5ITT A;  1K82 A;  2UUC M;  3GLG A;  2VF7 A;  1Z5B A;  5JI3 E;  3KP0 E;  3I51 A;  4MM3 B;  2JA2 A;  4DV0 M;  1XXH B;  2RGH A;  3TWK A;  4MGH A;  4DUY M;  4LRT A;  5ITR A;  1KYI A;  2X8A A;  2C5R A;  1NSF A;  2GQF A;  5IT9 S;  1NO1 A;  1AUA A;  1QUS A;  1E32 A;  1R7R A;  1JR3 A;  2QP9 X;  4HEO A;  3AKZ A;  4LF4 M;  1R2Y A;  2C98 A;  5IRE B;  3SC3 A;  1PJJ A;  1HNW M;  5GKN A;  2K6B A;  2I7P A;  2XFS A;  4MGZ E;  5DYI A;  2KZS A;  3HWS A;  4DR5 M;  1XMO M;  1IXR C;  5KO3 A;  3HU2 A;  3A46 A;  4LGY A;  1MX0 A;  2R4E A;  2KDL A;  3V76 A;  4X66 M;  4X62 M;  5EP1 A;  3ZC7 B;  2KNZ A;  3FKE A;  4LF7 M;  2CV0 A;  3KSX A;  3QWL A;  5ITQ A;  2ZAN A;  4AKI A;  1YSY A;  3AOE A;  4FWH A;  4P16 A;  3D8L A;  1TH2 A;  1Z5C A;  3RGP A;  2EJS A;  2KXE A;  4I8O A;  4AW4 A;  3UGJ A;  3RGS A;  1IBK M;  3HHY A;  1XHB A;  4R71 A;  3GPU A;  2Z3X A;  4DV7 M;  4JI7 M;  4M0W A;  1OTR A;  4NC6 A;  1VEJ A;  1HT1 E;  2YR0 A;  4X65 M;  4B3M M;  5FTL A;  3CF6 E;  2N35 A;  4D80 A;  2O5R A;  2MH8 A;  1GVN A;  2CHV A;  1IQP A;  2FS1 A;  3K9O A;  5EP4 A;  3TWL A;  4DV6 M;  4LJ6 A;  3R9X B;  3MJ5 A;  3B89 A;  3GLI A;  3GPP A;  2RKO A;  5EXS A;  1NY6 A;  3L29 A;  3U6Q A;  2W82 A;  1QAQ A;  3L26 A;  4DV2 M;  1Z5A A;  5FTJ A;  3HHZ A;  2VF8 A;  2LHG A;  5DFL A;  5F3W A;  3WHK A;  1BVS A;  2DWL A;  4B7H A;  4NRW A;  1IN8 A;  1VG5 A;  1ZQ9 A;  1W5T A;  4OX9 M;  1NY5 A;  2CEA A;  5ITX A;  3KVW A;  3SYL A;  3IG5 A;  4Z8X A;  1DO2 A;  3T1Y M;  1L1Z A;  1KSF X;  2DXI A;  1T6O A;  3EIE A;  3AOG A;  4GRI A;  1Y8G A;  2QCU A;  2K47 A;  1V92 A;  2VDB B;  5KPZ A;  4NOO B;  3QYB A;  2WSF F;  4NSO B;  4D81 A;  1IY2 A;  2KRU A;  1GJS A;  1QUT A;  3AOE C;  1HNX M;  4EIW A;  3ZCB B;  4KO8 A;  3M7G A;  3SAW A;  1XNQ M;  2BJV A;  2LHC A;  3GRY A;  2G8L A;  4IJF A;  1EIJ A;  4DR4 M;  3KFU G;  2D7H A;  2HL7 A;  2DAG A;  3SHG B;  2C9C A;  4FWD A;  3VFD A;  2DWN A;  4RF1 A;  1IN7 A;  3W0F A;  4DR2 M;  7CAT A;  1AIP C;  1ZMU A;  4JI1 M;  2VQF M;  1J5E M;  5E26 A;  2RRU A;  1IFY A;  1TDH A;  1OFH A;  1F4I A;  3J80 S;  5KPT A;  3DOA A;  2DZO B;  2Y0Q A;  2Z7J A;  1L1T A;  5FTM A;  4PDI A;  2JUJ A;  4IBK A;  2XSZ D;  2XZU A;  4LJ4 A;  4B3T M;  1OKS A;  2APL A;  1TDZ A;  1CUK A;  3L2A A;  4NSR A;  4OW0 A;  2FNA A;  3GLI B;  5KQD A;  4DR7 M;  3VKH A;  1DGB A;  2UU9 M;  3PVS A;  4R7G A;  4CIZ A;  3UMM A;  2Z4S A;  3T6P A;  1WXQ A;  4FCW A;  2CWB A;  3U5Z B;  2ZAO A;  1N34 M;  3C3E A;  2J7O A;  3U6P A;  2F5O A;  4K0K M;  1WIV A;  2R62 A;  3HHW A;  4FW9 A;  1TTE A;  2L09 A;  3RFW A;  4HL4 A;  2R6F A;  4JI2 M;  2FE8 A;  4LG2 A;  4B3R M;  2UXC M;  3NWL A;  1HNZ M;  3FYD A;  1L8Q A;  2L7I A;  1EFU B;  4G4R A;  4XGI A;  2NQ8 C;  1R6B X;  2QQ8 A;  2J5Y A;  4OU7 A;  3GPX A;  1TF0 B;  2JXN A;  2JZ1 A;  2BNK A;  2QHO B;  1YE9 A;  2EA0 A;  3ZQJ A;  2UUA M;  2DVW B;  2F4V M;  4JYA M;  4AKH A;  3B7Q A;  1J09 A;  1XB2 B;  4FCT A;  4JI0 M;  3LCU A;  5ITY A;  3W0L B;  3JR5 A;  3U5Z A;  4B08 A;  3E21 A;  4GH9 A;  1QDR A;  3T1H M;  4LCB A;  4DR1 M;  2MJ5 B;  2DHY A;  3GLH E;  3U6L A;  3BBZ A;  1VDD A;  3LVV A;  4HLQ A;  2R65 A;  3C3D A;  4IJE A;  5ITU A;  4QHT A;  4BLC A;  1V34 A;  3K8Z A;  1VEK A;  5BR8 M;  2HCB A;  3J81 S;  3ZH9 B;  3TPZ A;  2F5Q A;  2CHQ A;  5A2Q S;  3KOW E;  4I81 A;  2CE7 A;  1N78 A;  2QZ4 A;  1SXJ A;  3ILK A;  5FTN A;  4QOZ C;  4D82 A;  1G8P A;  4ITQ A;  4JI8 M;  3J27 B;  2V1U A;  3LVW A;  4XK8 F;  5KQ8 A;  3E4R A;  4I4L A;  1JQJ C;  3VK7 A;  1I94 M;  2B3T A;  1J7K A;  4PT5 A;  2BWE A;  4CHT B;  2G3Q A;  2DZL A;  1N36 M;  3HX3 A;  1L2D A;  1QVR A;  1IXZ A;  2DAM A;  2MGW A;  4FVM A;  4B3S M;  4AKG A;  2KNV A;  4IIW A;  1PM5 A;  1LTM A;  1ZMV A;  2EUC A;  5C18 A;  4F2L A;  4PD2 A;  5E6J A;  3TWM A;  3HZJ A;  1YUB A;  4L78 A;  3UJN A;  2KEB A;  1OFI A;  3KS4 A;  3SAV A;  4MGY E;  3HKP A;  3SHF A;  2XGN A;  3FTD A;  5EJC A;  3FRI A;  5LMN M;  4LZJ A;  1PGY A;  1QQW A;  2CHG A;  3FE3 A;  1QDT A;  2BWB A;  4FWG A;  1MU5 A;  3W67 A;  1D0L A;  1QZE A;  4KOD A;  1N32 M;  4B7F A;  2AHM A;  3GQ3 A;  1C1K A;  3BXW A;  4MGI E;  3J7A S;  4LFA M;  2WSC F;  2D7G A;  1D0M A;  1XXH E;  2ERC A;  1DO0 A;  5C1B A;  2XZF A;  3QYE A;  2H5X A;  1JR3 E;  4W5W A;  2KNA A;  4YHH M;  2FFJ A;  3KS8 A;  3GLF A;  1DGF A;  5FSW A;  2XSZ A;  1HQC A;  2HHH M;  2J7N A;  1JB0 F;  3Q8G A;  3MK6 A;  2KZU A;  4IBF A;  3GLF E;  3GP1 A;  3FUT A;  1DV0 A;  3DA1 A;  3E9S A;  4RKU F;  3NBX X;  1K3X A;  3SAS A;  4LF5 M;  1IN6 A;  5DNY A;  3FTE A;  2XLJ A;  1G3I A;  4GKK M;  3FYC A;  2DWZ B;  3KW6 A;  4DR3 M;  1QZM A;  2C96 A;  1GL7 A;  2Z8Y M;  1FNN A;  2C99 A;  1IM2 A;  4MGK E;  3A45 A;  3T15 A;  2O25 A;  3GQ5 A;  3C58 A;  3KDS E;  1SXJ B;  1HR0 M;  2K0B X;  3H4M A;  2EO2 A;  1NV8 A;  1PJT A;  2DAK A;  3FUX A;  2V6Z M;  4Z6Y A;  2JY7 A;  2XH9 A;  1E9S A;  3I04 M;  3J7B A;  3GPY A;  1N77 A;  5LMU M;  3DZD A;  4M9Z A;  4G4O A;  2Q2E B;  1OAI A;  2QNJ A;  2LXE A;  2CV1 A;  1FJG M;  4QHS A;  5ITX E;  2HKJ A;  2EKK A;  4IBJ A;  2RGO A;  2UXB M;  2L4F A;  3GLH A;  3SYK A;  4GIP A;  3SMP A;  4GC9 A;  2DAE A;  4L8R C;  2R0I A;  3A42 A;  2LBC A;  4M9S A;  3WHL A;  1JR3 D;  3SAT A;  3H4J A;  3LMM A;  4DBG B;  2ZTC A;  3SAR A;  1T3T A;  3U6E A;  1WHC A;  2H1R A;  2R46 A;  4L15 A;  3IEC A;  3HY5 A;  3PNV A;  4PCZ A;  3HJ8 A;  1SXJ E;  3RE8 A;  3K9P A;  2QBY A;  2CUZ A;  1SXJ D;  2QSF X;  1IXS A;  4LJ7 A;  4YY3 M;  2EKF A;  1WJ7 A;  1QAM A;  1DGH B;  2DWM A;  1KFV A;  2OOA A;  4QNR A;  1OIZ A;  3LQR A;  4WW0 A;  3GRV A;  4OVZ A;  3SAU A;  3FRH A;  4MH0 E;  1IY0 A;  4GEW A;  4PDG A;  4JI5 M;  1N75 A;  4B7G A;  3B7N A;  1D2N A;  1XWI A;  2P5T A;  3FUW A;  3UK6 A;  3I4V A;  2DAI A;  8CAT A;  2MR9 A;  3B7Z A;  3B9P A;  3U6D A;  2JY5 A;  5H37 D;  4DUZ M;  1WGL A;  3K92 A;  4BB9 A;  4LF9 M;  3OTO M;  4GMQ A;  5L8R F;  1VEG A;  1IBL M;  1H6U A;  2ZTD A;  2JY6 B;  4JXJ A;  5EP3 A;  1Z6T A;  4LFC M;  1E9R A;  2K9D A;  3M0E A;  1ZMW A;  1XNR M;  1Q02 A;  4TUW A;  3SBJ A;  3GLI E;  3AFH A;  4I5S A;  1OQY A;  3K1J A;  4II7 A;  1QYR A;  5DYG A;  4G4Q A;  1W5S A;  1L2C A;  3TQS A;  5BPV A;  3KP1 E;  3I4Y A;  2YFQ A;  1P3Q Q;  3GRR A;  3CTW B;  1Q3B A;  2QBY B;  2DHR A;  4DR6 M;  3U60 A;  5IWA M;  1GO5 A;  4S12 A;  2DZN B;  2R44 A;  2D7E A;  4JI6 M;  4LJ8 A;  3PNY A;  1GL6 A;  1HQY E;  1GAB A;  2E5L M;  4KLN A;  1GJT A;  1Z59 A;  4GKJ M;  2DKL A;  1NHW C;  3D8B A;  2Z4R A;  2UXD M;  4X64 M;  2L2D A;  4LRS A;  3L25 A;  2MRO B;  1OIP A;  4JI3 M;  3PFI A;  4LF8 M;  5FTK A;  1PJI A;  3KOY E;  1TR8 A;  4L6V 6;  1N33 M;  4LGM A;  4LFB M;  3VDP A;  4L4U A;  2L4E A;  1OJL A;  2A5Y B;  4CJ6 A;  1VQ1 A;  4Q7J A;  3TL4 X;  3U6C A;  3VK8 A;  2F5S A;  4LZZ A;  1NJF A;  2FH0 A;  3F92 A;  2CP8 A;  4A3V B;  1Q3C A;  2DI0 A;  2L7H A;  1ZV1 A;  2HWJ A;  2FOI C;  5EQT A;  1WGN A;  2M5Z A;  1A5T A;  1HT2 E;  1MN3 A;  1GKI A;  1UFZ A;  3DFZ A;  1SG9 A;  3MMP A;  3Q8X A;  1LV7 A;  3LQQ A;  2R45 A;  1SXJ C;  4RF0 A;  3JR4 A;  2OQ4 A;  1DGH A;  1G4A E;  3GLG B;  1G71 A;  1NJG A;  1GLN A;  3AV0 A;  4IBI A;  4LJ9 A;  3IHP A;  2VII A;  1YLA A;  4ZPX A;  3GRU A;  4LY6 A;  2ZAM A;  2C9O A;  2V1C A;  1NHG C;  1TGU A;  3C9P A;  4KHP M;  2XFT A;  4NRV A;  4OVZ B;  3GLG E;  2XF3 A;  4AG5 A;  3GLF B;  3JAM S;  4GC5 A;  4R3D A;  2QEN A;  3U6S A;  2YQZ A;  2CV2 A;  3B74 A;  1K3W A;  3U60 B;  3L27 A;  2JZ0 A;  1NV9 A;  5EXX A;  3U61 B;  4IBD A;  2LNH C;  3M6A A;  2CFO A;  1PRB A;  5JI2 E;  2LVQ D;  4WUR A;  4DV4 M;  1MJG M;  4ANR A;  2L6O A;  1XMQ M;  4IBB A;  4KT0 F;  2BJW A;  4XBO A;  1IY1 A;  4G6Z A;  4AQY M;  3MHV C;  1XXH A;  2R18 A;  4LJA A;  3VLF B;  1UM8 A;  3U6O A;  4LF6 M;  1ORY B;  2G5G X;  4CGY B;  2WZJ A;  1OAO C;  1S3S A;  2JP7 A;  4L16 A;  4RNA A;  1G41 A;  4QOS A;  3SFZ A;  2R4J A;  3GO8 A;  3CGW A;  4Y28 F;  5EP2 A;  2UUB M;  3E46 A;  4G4N A;  3U6M A;  4AI6 A;  4MB7 A;  3VDU A;  1G59 A;  2X49 A;  1X37 A;  1I4W A;  3FUV A;  3GQ4 A;  4DV1 M;  3AL0 C;  1R5L A;  1IBM M;  4JI4 M;  2XEP A; 
#chains in the Genus database with same CATH homology
 2JY5 A;  2G3Q A;  1WGL A;  2DZL A;  1VDL A;  1R4G A;  1VEG A;  1HJP A;  2ZTD A;  5DFL A;  2JY6 B;  2DAM A;  2LVP C;  2MGW A;  2OOB A;  1BVS A;  2K9D A;  2KNV A;  1VG5 A;  1ZMW A;  1ZMV A;  1Q02 A;  4F2L A;  3GLI E;  1OQY A;  2JY8 A;  1DO2 A;  1E94 E;  1T43 A;  2LVN C;  2DNA A;  1T6O A;  1P3Q Q;  1Y8G A;  2LVA A;  3FRI A;  1V92 A;  1PGY A;  3FE3 A;  2BWB A;  4G3O A;  1GO5 A;  1QZE A;  2LTU A;  2LVO C;  1HQY E;  4F1I A;  4WP2 A;  1XXH E;  2DKL A;  1DO0 A;  2DAG A;  2HAK A;  2H5X A;  1JR3 E;  2KNA A;  1AIP C;  1ZMU A;  2L2D A;  2MRO B;  2RRU A;  4UN2 B;  1IFY A;  2DEN A;  1F4I A;  1TR8 A;  2OO9 A;  2JUJ A;  3GLF E;  1OKS A;  1DV0 A;  3LCV B;  1CUK A;  2L4E A;  1WR1 B;  1VQ1 A;  4Q7J A;  1G3I A;  3F92 A;  2CP8 A;  1C7Y A;  2DI0 A;  2HWJ A;  1ZV1 A;  3T6P A;  2CWB A;  1WGN A;  2KHH A;  1A5T A;  1HT2 E;  1MN3 A;  1UFZ A;  1WIV A;  1SG9 A;  3MMP A;  1IM2 A;  1TTE A;  2O25 A;  1G4A E;  2JNH A;  2K0B X;  3IHP A;  1NV8 A;  2DAK A;  1YLA A;  1EFU B;  2JY7 A;  1KYI A;  1OAI A;  2JZ1 A;  2QNJ A;  3GLG E;  2QHO B;  2EKK A;  4HEO A;  2L4F A;  1XB2 B;  2DAE A;  3LCU A;  2R0I A;  2JZ0 A;  1NV9 A;  2LBC A;  3E21 A;  3H4J A;  4DBG B;  2ZTC A;  5JI2 E;  2MJ5 B;  2DHY A;  2LVQ D;  3GLH E;  1WHC A;  3BBZ A;  3IEC A;  2KNZ A;  1VEK A;  3K9P A;  2QSF X;  1IXS A;  2EKF A;  2EJS A;  1WJ7 A;  4R71 A;  2WZJ A;  2JP7 A;  1OTR A;  2OOA A;  1G41 A;  1VEJ A;  1HT1 E;  3E46 A;  3FRH A;  4GEW A;  3K9O A;  2DAI A;  2MR9 A;  2B3T A;  3B89 A;  2BWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...