2L09A

Solution nmr structure of protein asr4154 from nostoc sp. pcc7120 northeast structural genomics consortium target id nsr143
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MNLRWTSEAKTKLKNIPFFARSQAKARIEQLARQAEQDIVTPELVEQARLEFGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Asr4154 protein
publication title NMR Solution Structure of asr4154 from Nostoc sp. PCC7120 Northeast Structural Genomics target ID Nsr143
rcsb
source organism Nostoc sp.
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08369 PCP_red Proto-chlorophyllide reductase 57 kD subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.550 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l09A01
2YNMD 2KRUA 2L09A
chains in the Genus database with same CATH superfamily
4FW9A 4B3TM 2QENA 2N35A 2GNOA 2KNZA 1WGLA 2G8LA 3GLIA 2DKLA 3V76A 3FRIA 2DWLA 2L09A 4B7FA 3J7AS 1ZV1A 5FSWA 4FVMA 4IBEA 2EUCA 2DWZB 2VQFM 1A5TA 4PD2A 4M0WA 5EP4A 4NSRA 1JR3D 3SAWA 2JY5A 1IN4A 2I7NA 3GLHA 2C96A 2J7NA 1NV9A 4MGKE 3FKEA 4DUZM 1XC8A 4WP2A 2F5PA 5KQ8A 2BJWA 2LHGA 2EKKA 1KSFX 4R7GA 3U6MA 1Y8GA 1YUBA 2KW0A 1NVMA 1JB0F 3FRHA 2MR9A 2DAKA 3HJ8A 5ITXE 4DR5M 2UUCM 4JI6M 3T15A 3SAUA 3CTWB 3FTEA 4FWDA 4AQYM 3GRUA 3U6EA 1L2DA 3L27A 3GRYA 3AOEC 3SAVA 3AFHA 4L78A 2L7HA 3TL4X 3U5ZB 3U61A 4JI7M 2R18A 3TWMA 1E9RA 4NRVA 2MGWA 4GC9A 4LRTA 4D82A 3UGJA 2NQ8C 2APLA 3M0EA 2LBCA 4BBAA 1G3IA 4PDGA 1PRBA 2AHMA 3H4MA 4KODA 3GLGB 3ZCBB 1Z5AA 4XBOA 1AIPC 1OJLA 2JP7A 4LZZA 3R8FA 4Z6YA 2DAIA 1V92A 2KXEA 3B9PA 4UN2B 5LMUM 4DV4M 1PJTA 3PFIA 3Q8XA 2KZUA 3SBJA 1R4GA 3KSXA 3AOGA 3GLIE 4IBFA 2F5NA 2JNHA 1KFVA 4HL4A 2OQ4A 3AV0A 3L26A 2UXBM 3I51A 3FYCA 3A42A 4DBGB 1HNWM 1QYRA 4IBCA 4YY3M 3CF0A 4L8RC 1ZAEA 3FTDA 3SYKA 3LCUA 2CWBA 2KDLA 1NO1A 3GLHE 2XH9A 4M0DA 2ZAMA 4M9SA 3T1YM 4DUYM 1I4WA 3KXEC 1RU3A 2DNAA 2RGOA 3C3EA 5EP2A 4NSOB 2ZTDA 3SASA 1ZQ9A 2Q2EB 3FUXA 4G4OA 1H6UA 1SXJB 1FNNA 3J81S 2UUBM 1HQYE 1QDRA 1YSYA 3JR5A 3U6QA 2RKOA 2XSZD 3D8LA 1E32A 1S3SA 2R44A 4LCBA 3WHLA 1Z5BA 1VEGA 1XHBA 2FH0A 1AUAA 2ZM6M 1IBKM 4TUWA 3ZQJA 1QAQA 2XGNA 5EQTA 3PNVA 1DGHB 1OAIA 1SXJD 2M5ZA 2D7HA 2CFOA 5KQDA 5ITTA 3SATA 3VLFB 3TE6A 3VFDA 3K9OA 4ANRA 1PJJA 3FE3A 3W68A 4B3MM 3R9XB 2XFSA 3GRRA 4XGIA 1J09A 5EP3A 2R65A 4FCVA 4CJ6A 1Q3BA 2HWJA 4G6ZA 4DR7M 2KNAA 3QAUA 1XWIA 3U60B 3U6SA 1PM5A 2C98A 2LXEA 1X37A 3I04M 1WXQA 4LJ4A 3SMPA 2LVQD 3GLFB 4LFAM 5FLXS 4Z8XA 2FOIC 4JI8M 5BPVA 2Y20A 1NJGA 3LQQA 1G4AE 4M9ZA 5JI3E 3FD9A 1TH3A 2L2DA 1LV7A 2VQEM 4DV3M 1NNJA 3CF2A 2DXIA 4RKUF 5EXXA 2QZ4A 3NBIA 4BB9A 1XXHE 2LNHC 3KOYE 4B7GA 2JWSA 1QAMA 1GO5A 1DGBA 1QZEA 2WZJA 4GHAA 3KDSE 3RGPA 3B7QA 3U6DA 4QNMA 1OQYA 3HU3A 2HHHM 2L7IA 2HKJA 1G71A 1I94M 4EIWA 3C3DA 4KT0F 2F5SA 3HX3A 3KP1E 4RF0A 3FUUA 4KO8A 2R0IA 1D2NA 1K82A 3TWKA 2GQFA 4OVZA 1SXJC 2JY7A 4MB7A 4KHPM 4PT5A 2VF7A 4GEWA 2JUJA 1P3QQ 3SHGB 1C1KA 3HGIA 3LVVA 3SFZA 4YHHM 3U6CA 3U61B 4L16A 5E26A 3HZJA 3JR4A 1FJGM 4LF8M 1CUKA 1E9SA 1L8QA 1IN5A 5FTLA 2D7EA 2ZBKB 2L6OA 5KPRA 4G4NA 1R7RA 3U6LA 4F1IA 3HY5A 2QBYA 4JI2M 4I81A 2DZOB 2QHOB 3VDPA 1XNRM 1TH2A 4ITQA 1T3TA 2K6BA 1QUTA 3TQSA 3J2PB 1DGGA 2MROB 3PNYA 4IBDA 3W67A 2KHHA 2BWEA 3HHZA 5BR8M 4CISA 2F4VM 3L25A 3GP1A 2HCBA 2Y21A 5FTNA 1QDTA 1UM8A 1YLAA 3KOXE 3DFZA 1OTRA 4NRWA 4DR6M 2MH8A 2WSEF 4A3VB 4LRSA 1IBLM 1TDHA 1VDDA 1WHCA 3B74A 1JQJC 3PVSA 5KO3A 1G59A 1IXSA 3DZDA 4LGMA 3KFUG 3U6PA 1QANA 1EFUB 3AJIB 3M6AA 3W0FA 4AG5A 4LF4M 4REZA 2CHQA 3K1JA 4I8OA 2LHCA 3K8ZA 2Z4SA 5ITRA 2CUZA 2DZNB 2X8AA 4GKJM 1TH4A 3SHFA 2R4JA 2ZTCA 4JI5M 1VEJA 2UU9M 3GRVA 3J7BA 1TR8A 2LVAA 3M7GA 4S12A 3L29A 3GQ3A 4MGHA 2CV0A 4GMQA 3A45A 1WIVA 2WSFF 1NY6A 4FCWA 3QYEA 1J7KA 2DWMA 2YR0A 3FUTA 3LVWA 2UUAM 2MJ5B 4Q7JA 4AG6A 1IM2A 2DI0A 4JI4M 4AKHA 1OKSA 1ZMVA 2Y0QA 1SG9A 3VDUA 3U6OA 4GRIA 3UZUA 2KZSA 4NXMM 4JI3M 4QOZC 2Y0TA 3UJNA 2FNAA 1XXHA 4HEOA 2VF8A 4L15A 3VKGA 2G5GX 2A5YB 3HJQA 4K0KM 2K47A 1DO0A 1LTMA 5EXSA 1IY0A 3HU1A 4F2LA 3HJSA 3MHVC 3UK6A 3U5ZA 1XMQM 5E6JA 5DNYA 1K3WA 3VKHA 4LG2A 3TPZA 1ZMWA 1GJTA 2R6FA 2K0BX 5C1BA 3LMMA 3GO8A 3IG5A 4CIZA 1OIPA 2H1RA 4GC5A 4L4UA 1KYIA 4QHTA 2XF3A 5FTJA 4PDIA 1YE9A 3B7ZA 3E21A 3KOZE 3QWLA 1N33M 1OFHA 2I7PA 1QAOA 5DYIA 2HL7A 1WGNA 4LJ5A 4CHTB 2CHVA 3C58A 4M9XA 1VG5A 5FTMA 1NY5A 4JI1M 4L6V6 4LF9M 3GQ5A 3A46A 1D0LA 3KW6A 2LWXA 4LF6M 4LZJA 3W0LB 1W5SA 4HLQA 1PJSA 2G3QA 4P17A 7CATA 2K9DA 1Q02A 2JZ0A 5H37D 3KS8A 1E94E 1C7YA 2CP8A 4LJ7A 4IBBA 1L1TA 4GKKM 4W5WA 2H5XA 4DR2M 1GJSA 1R2ZA 3KSJA 3NWLA 2BWBA 4FD2A 3GLIB 3FUVA 2DWNA 1TF0B 2L4EA 2ZAOA 3FYDA 1PJIA 1GL7A 2CRUA 4OVZB 4G3OA 4FCTA 1HQCA 1GL6A 2C5RA 2OO9A 1TGUA 4I5SA 2LTUA 4MM3B 4GIPA 4OX9M 5EXPA 1Q3CA 3ZH9B 2YNMD 5KPTA 2CV1A 1K3XA 1NHGC 1PGYA 3GLHB 3RGSA 3IECA 2VIIA 1L1ZA 2C9CA 1MJGM 2DZLA 2XFTA 5FTKA 2OOBA 2JZ1A 3T38A 1DV0A 4JI0M 3CGWA 4WW0A 1HT1E 4CGYB 4AKIA 2J7OA 1N32M 2KNVA 3B7NA 2DHRA 4NXNM 2DAGA 2OPFA 2WSCF 4FWGA 2JY8A 4NL4H 2JY6B 2FS1A 1ZMUA 3E9SA 3OTOM 1D0MA 1HR0M 1HJPA 4GITA 3BXWA 3PXGA 8CATA 3GLGE 3DA1A 1N36M 3SARA 2R62A 1QVRA 2C99A 2CHGA 3AOEA 3VK8A 1VQ1A 4PCZA 2V1UA 3L2AA 5EXTA 2JXNA 2F5QA 5L8RF 1IXSB 1IN6A 2XLJA 3HWSA 4OU7A 3GQ4A 1Z5CA 2DENA 5IZ7D 4IIWA 4MGIE 4WURA 3KP0E 2R45A 3GLFA 4GHLA 1OFIA 2W82A 3FUWA 2L4FA 2RGHA 1HNZM 2FE8A 3BBZA 1OIZA 3HHWA 1NNUC 5KPZA 3MJ5A 3T1HM 1Q39A 2LH0A 4R3DA 2DHYA 2YFQA 1XNQM 2P5TA 2FFJA 4RNAA 3DOAA 3IG8A 4KLNA 1N77A 3Q8GA 1R5LA 3UMMA 2UXCM 1N78A 4LJ8A 2Z7JA 4IBKA 3GPXA 1SXJE 3D8BA 1W5TA 4DV0M 3THGA 1GKIA 3IHPA 4IJEA 4II7A 2F5OA 2OOAA 4LGYA 3ZC7B 1TTEA 3VK7A 1VDLA 1G41A 1N34M 1Z6TA 1JR3A 1PJQA 3HHXA 1TDZA 3EIHA 4QOSA 4LFCM 1GLNA 1XXHB 4LJ6A 3L28A 5ITUA 4QNRA 1R6BX 2LVNC 2EJSA 2R46A 4MH0E 4XK8F 3LW5F 4DV7M 1L2BA 4NOOB 2CEAA 1F4IA 2V1CA 1D0KA 3NBXX 2RRUA 2DVWB 2X49A 3AL0C 4R71A 1QUSA 5ITQA 3KOWE 3WHKA 2KEBA 4D81A 3LCVB 5DFLA 2UXDM 2QSFX 2D7GA 1ORYB 4G4RA 3RE8A 5EP1A 3E46A 1MX0A 4X65M 3J80S 3GPUA 3HU2A 4LJAA 2DAEA 2LVPC 2M60A 2EO2A 1XB2B 1EIJA 4JN6A 4G4QA 1GABA 4IJFA 2BJVA 2KRUA 3K9PA 3C9PA 2O25A 2O01F 5C18A 1QZMA 2CV2A 1GVNA 2DAMA 3I01M 4JXJA 4LJ9A 4ZPXA 3GLFE 4AI6A 1EE8A 3MMPA 5DYGA 3LQRA 2J5YA 2HAKA 1DO2A 2YQZA 4MGYE 2X4AA 3RFWA 3J27B 1J5EM 3KS4A 1IN8A 3CF6E 3A98B 3KVWA 4LFBM 3SYLA 4B08A 2O5RA 3B89A 3GPYA 3SMSA 3FTFA 2ERCA 3HKPA 1NHWC 4I4LA 1NV8A 3GLGA 2Z4RA 1IQPA 3FTCA 4AKGA 4JV5M 5A2QS 3GPPA 3AKZA 1IXRC 4DR4M 5LMNM 5IT9S 1NJFA 4IBIA 3I4VA 4OW0A 2BNKA 1JR3E 4LF7M 2C9OA 5GKNA 3F92A 2Z8YM 2JA2A 2R4EA 4DV1M 1BVSA 4BLCA 4DR1M 2KRKA 3JAMS 4LY6A 3SC3A 1UFZA 4LF5M 1V34A 4FWHA 2QP9X 1OAOC 2Z3XA 1IFYA 5ITYA 3I4YA 1IY1A 2KA6B 1G8PA 5IREB 5JI2E 2QNJA 1MN3A 4P16A 3K2LA 2EKFA 1R2YA 3HHYA 3K92A 2CE7A 2XSZA 3EIEA 1DGFA 1WR1B 2XZFA 1L2CA 1V33A 4X62M 3H4JA 4DR3M 5EJCA 1IXZA 2EA0A 3T6PA 1IN7A 1SXJA 4X66M 4IBGA 4DV6M 4AZFA 4DV5M 4X64M 2E5LM 4RF1A 2QPAA 5ITXA 1WJ7A 4QHSA 1XMOM 2B3TA 4NC6A 3MK6A 4Y28F 2XEPA 1IBMM 1T6OA 2VDBB 2QBYB 3E4RA 1NSFA 4DV2M 1DGHA 1N75A 4B7HA 4JYAM 2QQ8A 1MU5A 4IBJA 1T43A 5F3WA 2LVOC 2XZUA 2ZANA 3ILKA 3QYBA 1HNXM 1VEKA 4GH9A 4B3RM 2V6ZM 4MGZE 1HT2E 1Z59A 3BOSA 4B3SM 4D80A 1QQWA 1IY2A 5IWAM 3U60A 2QCUA 4AW4A 3TWLA
chains in the Genus database with same CATH topology
4FW9A 4B3TM 2QENA 2G8LA 3GLIA 2DWLA 2L09A 4B7FA 3J7AS 5FSWA 4FVMA 4IBEA 2EUCA 2DWZB 2VQFM 4PD2A 4M0WA 5EP4A 4NSRA 1JR3D 3SAWA 1IN4A 2I7NA 3GLHA 2C96A 2J7NA 4MGKE 4DUZM 3FKEA 1XC8A 2F5PA 5KQ8A 2BJWA 1KSFX 4R7GA 3U6MA 1YUBA 5ITXE 2KW0A 1NVMA 3HJ8A 4DR5M 2UUCM 4JI6M 3T15A 3SAUA 3CTWB 3FTEA 4FWDA 4AQYM 3GRUA 3U6EA 1L2DA 3L27A 3GRYA 3AOEC 3SAVA 3AFHA 4L78A 2L7HA 3TL4X 3U5ZB 3U61A 4JI7M 2R18A 3TWMA 1E9RA 4NRVA 4GC9A 4LRTA 4D82A 3UGJA 2NQ8C 3M0EA 4BBAA 1G3IA 4PDGA 2AHMA 3H4MA 4KODA 3GLGB 3ZCBB 1Z5AA 4XBOA 1OJLA 4LZZA 3R8FA 4Z6YA 5LMUM 2KXEA 3B9PA 4DV4M 3PFIA 3Q8XA 2KZUA 3SBJA 2F5NA 3KSXA 3AOGA 4IBFA 1KFVA 4HL4A 2OQ4A 3AV0A 3L26A 2UXBM 3I51A 3FYCA 3A42A 1HNWM 1QYRA 4IBCA 4YY3M 3CF0A 4L8RC 1ZAEA 3FTDA 3SYKA 2XH9A 4M0DA 2ZAMA 4M9SA 3T1YM 4DUYM 1I4WA 3KXEC 2RGOA 5EP2A 4NSOB 3SASA 1ZQ9A 2Q2EB 3FUXA 4G4OA 1H6UA 1SXJB 1FNNA 3J81S 2UUBM 1HQYE 1YSYA 3JR5A 3U6QA 2RKOA 2XSZD 3D8LA 1E32A 1S3SA 4LCBA 3WHLA 1Z5BA 1XHBA 2ZM6M 4TUWA 1IBKM 1QAQA 2XGNA 5EQTA 3PNVA 1DGHB 1SXJD 2M5ZA 2D7HA 2CFOA 5KQDA 5ITTA 3SATA 3VLFB 3TE6A 3VFDA 1PJJA 4B3MM 3R9XB 2XFSA 3GRRA 4XGIA 1J09A 5EP3A 2R65A 4FCVA 1Q3BA 4G6ZA 4DR7M 3QAUA 1XWIA 3U60B 3U6SA 1PM5A 2C98A 2LXEA 1X37A 1WXQA 4LJ4A 3SMPA 3GLFB 4LFAM 5FLXS 4Z8XA 2FOIC 4JI8M 5BPVA 2Y20A 1NJGA 3LQQA 1G4AE 4M9ZA 5JI3E 3FD9A 1TH3A 2VQEM 1LV7A 1NNJA 4DV3M 3CF2A 2DXIA 5EXXA 2QZ4A 3NBIA 4BB9A 2LNHC 3KOYE 4B7GA 1QAMA 1DGBA 4GHAA 3KDSE 3RGPA 3U6DA 4QNMA 3HU3A 2HHHM 2L7IA 2HKJA 1I94M 4EIWA 2F5SA 3KP1E 4RF0A 3FUUA 4KO8A 1D2NA 1K82A 3TWKA 4OVZA 1SXJC 4MB7A 4KHPM 4PT5A 3SHGB 1C1KA 3HGIA 3LVVA 3SFZA 4YHHM 3U6CA 3U61B 4L16A 5E26A 3JR4A 1FJGM 4LF8M 1E9SA 1L8QA 1IN5A 5FTLA 2D7EA 2ZBKB 2L6OA 5KPRA 4G4NA 1R7RA 3U6LA 2QBYA 4JI2M 4I81A 2DZOB 3VDPA 1XNRM 1TH2A 4ITQA 1T3TA 3TQSA 3J2PB 1DGGA 3PNYA 4IBDA 4CISA 3L25A 3HHZA 5BR8M 2F4VM 3GP1A 2HCBA 2Y21A 5FTNA 1UM8A 3KOXE 3DFZA 4NRWA 4DR6M 4A3VB 4LRSA 1IBLM 1TDHA 1VDDA 5KO3A 1JQJC 3PVSA 1G59A 3DZDA 4LGMA 3KFUG 3U6PA 1QANA 3AJIB 3M6AA 3W0FA 4AG5A 4LF4M 4REZA 2CHQA 3K1JA 4I8OA 3K8ZA 2Z4SA 5ITRA 2CUZA 2DZNB 2X8AA 4GKJM 1TH4A 3SHFA 2R4JA 4JI5M 2UU9M 3GRVA 3J7BA 3M7GA 4S12A 3GQ3A 4DR4M 3L29A 2CV0A 4MGHA 4GMQA 3A45A 1NY6A 4FCWA 2DWMA 1J7KA 2YR0A 3FUTA 3LVWA 2UUAM 4AG6A 1IM2A 4JI4M 4AKHA 2Y0QA 3VDUA 3U6OA 4GRIA 3UZUA 2KZSA 4NXMM 4JI3M 4QOZC 2Y0TA 3UJNA 2FNAA 1XXHA 4L15A 3VKGA 2G5GX 2A5YB 3HJQA 4K0KM 2K47A 1DO0A 5EXSA 1IY0A 3HU1A 3HJSA 3MHVC 3UK6A 3U5ZA 1XMQM 5E6JA 5DNYA 1K3WA 3VKHA 4LG2A 3TPZA 5C1BA 3LMMA 3GO8A 3IG5A 4L4UA 2H1RA 4GC5A 5FTJA 1KYIA 4QHTA 2XF3A 4PDIA 1YE9A 3KOZE 3QWLA 1N33M 1OFHA 2I7PA 1QAOA 5DYIA 2HL7A 4LJ5A 4CHTB 2CHVA 3C58A 4M9XA 5FTMA 4JI1M 1NY5A 4LF9M 3GQ5A 3A46A 3KW6A 2LWXA 4LF6M 4LZJA 3W0LB 1W5SA 4HLQA 7CATA 5H37D 3KS8A 1E94E 4LJ7A 4IBBA 1L1TA 4GKKM 4W5WA 4DR2M 1R2ZA 3KSJA 3NWLA 4FD2A 2DWNA 3GLIB 3FUVA 2ZAOA 3FYDA 1PJIA 1GL7A 4OVZB 4FCTA 1HQCA 1GL6A 2C5RA 4I5SA 1TGUA 4MM3B 4OX9M 4GIPA 5EXPA 1Q3CA 3ZH9B 2YNMD 5KPTA 2CV1A 1K3XA 1NHGC 3GLHB 3RGSA 2VIIA 1L1ZA 2C9CA 5FTKA 2XFTA 3T38A 4JI0M 4WW0A 1HT1E 4CGYB 4AKIA 2J7OA 1N32M 2DHRA 4NXNM 2OPFA 4FWGA 4NL4H 3E9SA 3OTOM 1HR0M 4GITA 8CATA 3PXGA 3DA1A 1N36M 3SARA 2R62A 1QVRA 2C99A 2CHGA 3AOEA 3VK8A 4PCZA 2V1UA 3L2AA 5EXTA 2F5QA 1IXSB 1IN6A 2XLJA 3HWSA 4OU7A 3GQ4A 1Z5CA 5IZ7D 4IIWA 4MGIE 4WURA 3KP0E 2R45A 3GLFA 4GHLA 3FUWA 1OFIA 2W82A 2RGHA 1HNZM 2FE8A 3HHWA 1NNUC 5KPZA 3MJ5A 3T1HM 1Q39A 2LH0A 4R3DA 2YFQA 1XNQM 2P5TA 2FFJA 4RNAA 3DOAA 3IG8A 4KLNA 1N77A 3UMMA 2UXCM 1N78A 4LJ8A 2Z7JA 4IBKA 3GPXA 1SXJE 3D8BA 1W5TA 4DV0M 3THGA 1GKIA 4IJEA 4II7A 2F5OA 3ZC7B 4LGYA 3VK7A 1G41A 1N34M 1Z6TA 1JR3A 3HHXA 1TDZA 3EIHA 4QOSA 4LFCM 1GLNA 1XXHB 4LJ6A 3L28A 5ITUA 4QNRA 1R6BX 2R46A 4MH0E 4DV7M 1L2BA 4NOOB 2CEAA 2V1CA 3AL0C 2DVWB 2X49A 5ITQA 3KOWE 3WHKA 2KEBA 4D81A 2UXDM 2D7GA 1ORYB 4G4RA 3RE8A 5EP1A 3GPUA 1MX0A 4X65M 3J80S 3HU2A 4LJAA 2M60A 2EO2A 4JN6A 4G4QA 4IJFA 2BJVA 2KRUA 5C18A 2CV2A 1QZMA 1GVNA 4JXJA 4LJ9A 4ZPXA 4AI6A 1EE8A 5DYGA 3LQRA 2YQZA 1DO2A 4MGYE 1J5EM 2X4AA 3RFWA 3J27B 3KS4A 1IN8A 3CF6E 3A98B 3KVWA 4LFBM 3SYLA 4B08A 2O5RA 3GPYA 3SMSA 3FTFA 2ERCA 3HKPA 1NHWC 4I4LA 3GLGA 2Z4RA 1IQPA 3FTCA 4AKGA 4JV5M 5A2QS 3GPPA 3AKZA 1IXRC 5LMNM 5IT9S 1NJFA 4IBIA 3I4VA 4OW0A 2BNKA 4LF7M 2C9OA 5GKNA 2JA2A 2R4EA 4DV1M 4BLCA 4DR1M 2KRKA 3JAMS 4LY6A 3SC3A 4LF5M 4FWHA 2QP9X 2Z3XA 5ITYA 3I4YA 1IY1A 2KA6B 1G8PA 5IREB 5JI2E 4P16A 3K2LA 1R2YA 3HHYA 3K92A 2CE7A 2XSZA 3EIEA 1DGFA 2XZFA 1L2CA 4X62M 4DR3M 5EJCA 1IXZA 2EA0A 1IN7A 1SXJA 4X66M 4IBGA 4DV6M 4AZFA 4DV5M 4X64M 2E5LM 4RF1A 2QPAA 5ITXA 4QHSA 1XMOM 3MK6A 1IBMM 2XEPA 2QBYB 3E4RA 1NSFA 4DV2M 1DGHA 1N75A 4B7HA 4JYAM 1MU5A 4IBJA 5F3WA 2XZUA 2ZANA 3ILKA 1HNXM 4GH9A 4B3RM 2V6ZM 4MGZE 1HT2E 1Z59A 3BOSA 4B3SM 4D80A 1QQWA 1IY2A 5IWAM 3U60A 2QCUA 4AW4A 3TWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNM D;  2KRU A;  2L09 A; 
#chains in the Genus database with same CATH topology
 4FW9 A;  4B3T M;  2QEN A;  2N35 A;  2GNO A;  2KNZ A;  1WGL A;  2G8L A;  3GLI A;  2DKL A;  3V76 A;  3FRI A;  2DWL A;  2L09 A;  4B7F A;  3J7A S;  1ZV1 A;  5FSW A;  4FVM A;  4IBE A;  2EUC A;  2DWZ B;  2VQF M;  1A5T A;  4PD2 A;  4M0W A;  5EP4 A;  4NSR A;  1JR3 D;  3SAW A;  2JY5 A;  1IN4 A;  2I7N A;  3GLH A;  2C96 A;  2J7N A;  1NV9 A;  4MGK E;  3FKE A;  4DUZ M;  1XC8 A;  4WP2 A;  2F5P A;  5KQ8 A;  2BJW A;  2LHG A;  2EKK A;  1KSF X;  4R7G A;  3U6M A;  1Y8G A;  1YUB A;  2KW0 A;  1NVM A;  1JB0 F;  3FRH A;  2MR9 A;  2DAK A;  3HJ8 A;  5ITX E;  4DR5 M;  2UUC M;  4JI6 M;  3T15 A;  3SAU A;  3CTW B;  3FTE A;  4FWD A;  4AQY M;  3GRU A;  3U6E A;  1L2D A;  3L27 A;  3GRY A;  3AOE C;  3SAV A;  3AFH A;  4L78 A;  2L7H A;  3TL4 X;  3U5Z B;  3U61 A;  4JI7 M;  2R18 A;  3TWM A;  1E9R A;  4NRV A;  2MGW A;  4GC9 A;  4LRT A;  4D82 A;  3UGJ A;  2NQ8 C;  2APL A;  3M0E A;  2LBC A;  4BBA A;  1G3I A;  4PDG A;  1PRB A;  2AHM A;  3H4M A;  4KOD A;  3GLG B;  3ZCB B;  1Z5A A;  4XBO A;  1AIP C;  1OJL A;  2JP7 A;  4LZZ A;  3R8F A;  4Z6Y A;  2DAI A;  1V92 A;  2KXE A;  3B9P A;  4UN2 B;  5LMU M;  4DV4 M;  1PJT A;  3PFI A;  3Q8X A;  2KZU A;  3SBJ A;  1R4G A;  3KSX A;  3AOG A;  3GLI E;  4IBF A;  2F5N A;  2JNH A;  1KFV A;  4HL4 A;  2OQ4 A;  3AV0 A;  3L26 A;  2UXB M;  3I51 A;  3FYC A;  3A42 A;  4DBG B;  1HNW M;  1QYR A;  4IBC A;  4YY3 M;  3CF0 A;  4L8R C;  1ZAE A;  3FTD A;  3SYK A;  3LCU A;  2CWB A;  2KDL A;  1NO1 A;  3GLH E;  2XH9 A;  4M0D A;  2ZAM A;  4M9S A;  3T1Y M;  4DUY M;  1I4W A;  3KXE C;  1RU3 A;  2DNA A;  2RGO A;  3C3E A;  5EP2 A;  4NSO B;  2ZTD A;  3SAS A;  1ZQ9 A;  2Q2E B;  3FUX A;  4G4O A;  1H6U A;  1SXJ B;  1FNN A;  3J81 S;  2UUB M;  1HQY E;  1QDR A;  1YSY A;  3JR5 A;  3U6Q A;  2RKO A;  2XSZ D;  3D8L A;  1E32 A;  1S3S A;  2R44 A;  4LCB A;  3WHL A;  1Z5B A;  1VEG A;  1XHB A;  2FH0 A;  1AUA A;  2ZM6 M;  1IBK M;  4TUW A;  3ZQJ A;  1QAQ A;  2XGN A;  5EQT A;  3PNV A;  1DGH B;  1OAI A;  1SXJ D;  2M5Z A;  2D7H A;  2CFO A;  5KQD A;  5ITT A;  3SAT A;  3VLF B;  3TE6 A;  3VFD A;  3K9O A;  4ANR A;  1PJJ A;  3FE3 A;  3W68 A;  4B3M M;  3R9X B;  2XFS A;  3GRR A;  4XGI A;  1J09 A;  5EP3 A;  2R65 A;  4FCV A;  4CJ6 A;  1Q3B A;  2HWJ A;  4G6Z A;  4DR7 M;  2KNA A;  3QAU A;  1XWI A;  3U60 B;  3U6S A;  1PM5 A;  2C98 A;  2LXE A;  1X37 A;  3I04 M;  1WXQ A;  4LJ4 A;  3SMP A;  2LVQ D;  3GLF B;  4LFA M;  5FLX S;  4Z8X A;  2FOI C;  4JI8 M;  5BPV A;  2Y20 A;  1NJG A;  3LQQ A;  1G4A E;  4M9Z A;  5JI3 E;  3FD9 A;  1TH3 A;  2L2D A;  1LV7 A;  2VQE M;  4DV3 M;  1NNJ A;  3CF2 A;  2DXI A;  4RKU F;  5EXX A;  2QZ4 A;  3NBI A;  4BB9 A;  1XXH E;  2LNH C;  3KOY E;  4B7G A;  2JWS A;  1QAM A;  1GO5 A;  1DGB A;  1QZE A;  2WZJ A;  4GHA A;  3KDS E;  3RGP A;  3B7Q A;  3U6D A;  4QNM A;  1OQY A;  3HU3 A;  2HHH M;  2L7I A;  2HKJ A;  1G71 A;  1I94 M;  4EIW A;  3C3D A;  4KT0 F;  2F5S A;  3HX3 A;  3KP1 E;  4RF0 A;  3FUU A;  4KO8 A;  2R0I A;  1D2N A;  1K82 A;  3TWK A;  2GQF A;  4OVZ A;  1SXJ C;  2JY7 A;  4MB7 A;  4KHP M;  4PT5 A;  2VF7 A;  4GEW A;  2JUJ A;  1P3Q Q;  3SHG B;  1C1K A;  3HGI A;  3LVV A;  3SFZ A;  4YHH M;  3U6C A;  3U61 B;  4L16 A;  5E26 A;  3HZJ A;  3JR4 A;  1FJG M;  4LF8 M;  1CUK A;  1E9S A;  1L8Q A;  1IN5 A;  5FTL A;  2D7E A;  2ZBK B;  2L6O A;  5KPR A;  4G4N A;  1R7R A;  3U6L A;  4F1I A;  3HY5 A;  2QBY A;  4JI2 M;  4I81 A;  2DZO B;  2QHO B;  3VDP A;  1XNR M;  1TH2 A;  4ITQ A;  1T3T A;  2K6B A;  1QUT A;  3TQS A;  3J2P B;  1DGG A;  2MRO B;  3PNY A;  4IBD A;  3W67 A;  2KHH A;  2BWE A;  3HHZ A;  5BR8 M;  4CIS A;  2F4V M;  3L25 A;  3GP1 A;  2HCB A;  2Y21 A;  5FTN A;  1QDT A;  1UM8 A;  1YLA A;  3KOX E;  3DFZ A;  1OTR A;  4NRW A;  4DR6 M;  2MH8 A;  2WSE F;  4A3V B;  4LRS A;  1IBL M;  1TDH A;  1VDD A;  1WHC A;  3B74 A;  1JQJ C;  3PVS A;  5KO3 A;  1G59 A;  1IXS A;  3DZD A;  4LGM A;  3KFU G;  3U6P A;  1QAN A;  1EFU B;  3AJI B;  3M6A A;  3W0F A;  4AG5 A;  4LF4 M;  4REZ A;  2CHQ A;  3K1J A;  4I8O A;  2LHC A;  3K8Z A;  2Z4S A;  5ITR A;  2CUZ A;  2DZN B;  2X8A A;  4GKJ M;  1TH4 A;  3SHF A;  2R4J A;  2ZTC A;  4JI5 M;  1VEJ A;  2UU9 M;  3GRV A;  3J7B A;  1TR8 A;  2LVA A;  3M7G A;  4S12 A;  3L29 A;  3GQ3 A;  4MGH A;  2CV0 A;  4GMQ A;  3A45 A;  1WIV A;  2WSF F;  1NY6 A;  4FCW A;  3QYE A;  1J7K A;  2DWM A;  2YR0 A;  3FUT A;  3LVW A;  2UUA M;  2MJ5 B;  4Q7J A;  4AG6 A;  1IM2 A;  2DI0 A;  4JI4 M;  4AKH A;  1OKS A;  1ZMV A;  2Y0Q A;  1SG9 A;  3VDU A;  3U6O A;  4GRI A;  3UZU A;  2KZS A;  4NXM M;  4JI3 M;  4QOZ C;  2Y0T A;  3UJN A;  2FNA A;  1XXH A;  4HEO A;  2VF8 A;  4L15 A;  3VKG A;  2G5G X;  2A5Y B;  3HJQ A;  4K0K M;  2K47 A;  1DO0 A;  1LTM A;  5EXS A;  1IY0 A;  3HU1 A;  4F2L A;  3HJS A;  3MHV C;  3UK6 A;  3U5Z A;  1XMQ M;  5E6J A;  5DNY A;  1K3W A;  3VKH A;  4LG2 A;  3TPZ A;  1ZMW A;  1GJT A;  2R6F A;  2K0B X;  5C1B A;  3LMM A;  3GO8 A;  3IG5 A;  4CIZ A;  1OIP A;  2H1R A;  4GC5 A;  4L4U A;  1KYI A;  4QHT A;  2XF3 A;  5FTJ A;  4PDI A;  1YE9 A;  3B7Z A;  3E21 A;  3KOZ E;  3QWL A;  1N33 M;  1OFH A;  2I7P A;  1QAO A;  5DYI A;  2HL7 A;  1WGN A;  4LJ5 A;  4CHT B;  2CHV A;  3C58 A;  4M9X A;  1VG5 A;  5FTM A;  1NY5 A;  4JI1 M;  4L6V 6;  4LF9 M;  3GQ5 A;  3A46 A;  1D0L A;  3KW6 A;  2LWX A;  4LF6 M;  4LZJ A;  3W0L B;  1W5S A;  4HLQ A;  1PJS A;  2G3Q A;  4P17 A;  7CAT A;  2K9D A;  1Q02 A;  2JZ0 A;  5H37 D;  3KS8 A;  1E94 E;  1C7Y A;  2CP8 A;  4LJ7 A;  4IBB A;  1L1T A;  4GKK M;  4W5W A;  2H5X A;  4DR2 M;  1GJS A;  1R2Z A;  3KSJ A;  3NWL A;  2BWB A;  4FD2 A;  3GLI B;  3FUV A;  2DWN A;  1TF0 B;  2L4E A;  2ZAO A;  3FYD A;  1PJI A;  1GL7 A;  2CRU A;  4OVZ B;  4G3O A;  4FCT A;  1HQC A;  1GL6 A;  2C5R A;  2OO9 A;  1TGU A;  4I5S A;  2LTU A;  4MM3 B;  4GIP A;  4OX9 M;  5EXP A;  1Q3C A;  3ZH9 B;  2YNM D;  5KPT A;  2CV1 A;  1K3X A;  1NHG C;  1PGY A;  3GLH B;  3RGS A;  3IEC A;  2VII A;  1L1Z A;  2C9C A;  1MJG M;  2DZL A;  2XFT A;  5FTK A;  2OOB A;  2JZ1 A;  3T38 A;  1DV0 A;  4JI0 M;  3CGW A;  4WW0 A;  1HT1 E;  4CGY B;  4AKI A;  2J7O A;  1N32 M;  2KNV A;  3B7N A;  2DHR A;  4NXN M;  2DAG A;  2OPF A;  2WSC F;  4FWG A;  2JY8 A;  4NL4 H;  2JY6 B;  2FS1 A;  1ZMU A;  3E9S A;  3OTO M;  1D0M A;  1HR0 M;  1HJP A;  4GIT A;  3BXW A;  3PXG A;  8CAT A;  3GLG E;  3DA1 A;  1N36 M;  3SAR A;  2R62 A;  1QVR A;  2C99 A;  2CHG A;  3AOE A;  3VK8 A;  1VQ1 A;  4PCZ A;  2V1U A;  3L2A A;  5EXT A;  2JXN A;  2F5Q A;  5L8R F;  1IXS B;  1IN6 A;  2XLJ A;  3HWS A;  4OU7 A;  3GQ4 A;  1Z5C A;  2DEN A;  5IZ7 D;  4IIW A;  4MGI E;  4WUR A;  3KP0 E;  2R45 A;  3GLF A;  4GHL A;  1OFI A;  2W82 A;  3FUW A;  2L4F A;  2RGH A;  1HNZ M;  2FE8 A;  3BBZ A;  1OIZ A;  3HHW A;  1NNU C;  5KPZ A;  3MJ5 A;  3T1H M;  1Q39 A;  2LH0 A;  4R3D A;  2DHY A;  2YFQ A;  1XNQ M;  2P5T A;  2FFJ A;  4RNA A;  3DOA A;  3IG8 A;  4KLN A;  1N77 A;  3Q8G A;  1R5L A;  3UMM A;  2UXC M;  1N78 A;  4LJ8 A;  2Z7J A;  4IBK A;  3GPX A;  1SXJ E;  3D8B A;  1W5T A;  4DV0 M;  3THG A;  1GKI A;  3IHP A;  4IJE A;  4II7 A;  2F5O A;  2OOA A;  4LGY A;  3ZC7 B;  1TTE A;  3VK7 A;  1VDL A;  1G41 A;  1N34 M;  1Z6T A;  1JR3 A;  1PJQ A;  3HHX A;  1TDZ A;  3EIH A;  4QOS A;  4LFC M;  1GLN A;  1XXH B;  4LJ6 A;  3L28 A;  5ITU A;  4QNR A;  1R6B X;  2LVN C;  2EJS A;  2R46 A;  4MH0 E;  4XK8 F;  3LW5 F;  4DV7 M;  1L2B A;  4NOO B;  2CEA A;  1F4I A;  2V1C A;  1D0K A;  3NBX X;  2RRU A;  2DVW B;  2X49 A;  3AL0 C;  4R71 A;  1QUS A;  5ITQ A;  3KOW E;  3WHK A;  2KEB A;  4D81 A;  3LCV B;  5DFL A;  2UXD M;  2QSF X;  2D7G A;  1ORY B;  4G4R A;  3RE8 A;  5EP1 A;  3E46 A;  1MX0 A;  4X65 M;  3J80 S;  3GPU A;  3HU2 A;  4LJA A;  2DAE A;  2LVP C;  2M60 A;  2EO2 A;  1XB2 B;  1EIJ A;  4JN6 A;  4G4Q A;  1GAB A;  4IJF A;  2BJV A;  2KRU A;  3K9P A;  3C9P A;  2O25 A;  2O01 F;  5C18 A;  1QZM A;  2CV2 A;  1GVN A;  2DAM A;  3I01 M;  4JXJ A;  4LJ9 A;  4ZPX A;  3GLF E;  4AI6 A;  1EE8 A;  3MMP A;  5DYG A;  3LQR A;  2J5Y A;  2HAK A;  1DO2 A;  2YQZ A;  4MGY E;  2X4A A;  3RFW A;  3J27 B;  1J5E M;  3KS4 A;  1IN8 A;  3CF6 E;  3A98 B;  3KVW A;  4LFB M;  3SYL A;  4B08 A;  2O5R A;  3B89 A;  3GPY A;  3SMS A;  3FTF A;  2ERC A;  3HKP A;  1NHW C;  4I4L A;  1NV8 A;  3GLG A;  2Z4R A;  1IQP A;  3FTC A;  4AKG A;  4JV5 M;  5A2Q S;  3GPP A;  3AKZ A;  1IXR C;  4DR4 M;  5LMN M;  5IT9 S;  1NJF A;  4IBI A;  3I4V A;  4OW0 A;  2BNK A;  1JR3 E;  4LF7 M;  2C9O A;  5GKN A;  3F92 A;  2Z8Y M;  2JA2 A;  2R4E A;  4DV1 M;  1BVS A;  4BLC A;  4DR1 M;  2KRK A;  3JAM S;  4LY6 A;  3SC3 A;  1UFZ A;  4LF5 M;  1V34 A;  4FWH A;  2QP9 X;  1OAO C;  2Z3X A;  1IFY A;  5ITY A;  3I4Y A;  1IY1 A;  2KA6 B;  1G8P A;  5IRE B;  5JI2 E;  2QNJ A;  1MN3 A;  4P16 A;  3K2L A;  2EKF A;  1R2Y A;  3HHY A;  3K92 A;  2CE7 A;  2XSZ A;  3EIE A;  1DGF A;  1WR1 B;  2XZF A;  1L2C A;  1V33 A;  4X62 M;  3H4J A;  4DR3 M;  5EJC A;  1IXZ A;  2EA0 A;  3T6P A;  1IN7 A;  1SXJ A;  4X66 M;  4IBG A;  4DV6 M;  4AZF A;  4DV5 M;  4X64 M;  2E5L M;  4RF1 A;  2QPA A;  5ITX A;  1WJ7 A;  4QHS A;  1XMO M;  2B3T A;  4NC6 A;  3MK6 A;  4Y28 F;  2XEP A;  1IBM M;  1T6O A;  2VDB B;  2QBY B;  3E4R A;  1NSF A;  4DV2 M;  1DGH A;  1N75 A;  4B7H A;  4JYA M;  2QQ8 A;  1MU5 A;  4IBJ A;  1T43 A;  5F3W A;  2LVO C;  2XZU A;  2ZAN A;  3ILK A;  3QYB A;  1HNX M;  1VEK A;  4GH9 A;  4B3R M;  2V6Z M;  4MGZ E;  1HT2 E;  1Z59 A;  3BOS A;  4B3S M;  4D80 A;  1QQW A;  1IY2 A;  5IWA M;  3U60 A;  2QCU A;  4AW4 A;  3TWL A; 
#chains in the Genus database with same CATH homology
 4FW9 A;  4B3T M;  2QEN A;  2G8L A;  3GLI A;  2DWL A;  2L09 A;  4B7F A;  3J7A S;  5FSW A;  4FVM A;  4IBE A;  2EUC A;  2DWZ B;  2VQF M;  4PD2 A;  4M0W A;  5EP4 A;  4NSR A;  1JR3 D;  3SAW A;  1IN4 A;  2I7N A;  3GLH A;  2C96 A;  2J7N A;  4MGK E;  4DUZ M;  3FKE A;  1XC8 A;  2F5P A;  5KQ8 A;  2BJW A;  1KSF X;  4R7G A;  3U6M A;  1YUB A;  5ITX E;  2KW0 A;  1NVM A;  3HJ8 A;  4DR5 M;  2UUC M;  4JI6 M;  3T15 A;  3SAU A;  3CTW B;  3FTE A;  4FWD A;  4AQY M;  3GRU A;  3U6E A;  1L2D A;  3L27 A;  3GRY A;  3AOE C;  3SAV A;  3AFH A;  4L78 A;  2L7H A;  3TL4 X;  3U5Z B;  3U61 A;  4JI7 M;  2R18 A;  3TWM A;  1E9R A;  4NRV A;  4GC9 A;  4LRT A;  4D82 A;  3UGJ A;  2NQ8 C;  3M0E A;  4BBA A;  1G3I A;  4PDG A;  2AHM A;  3H4M A;  4KOD A;  3GLG B;  3ZCB B;  1Z5A A;  4XBO A;  1OJL A;  4LZZ A;  3R8F A;  4Z6Y A;  5LMU M;  2KXE A;  3B9P A;  4DV4 M;  3PFI A;  3Q8X A;  2KZU A;  3SBJ A;  2F5N A;  3KSX A;  3AOG A;  4IBF A;  1KFV A;  4HL4 A;  2OQ4 A;  3AV0 A;  3L26 A;  2UXB M;  3I51 A;  3FYC A;  3A42 A;  1HNW M;  1QYR A;  4IBC A;  4YY3 M;  3CF0 A;  4L8R C;  1ZAE A;  3FTD A;  3SYK A;  2XH9 A;  4M0D A;  2ZAM A;  4M9S A;  3T1Y M;  4DUY M;  1I4W A;  3KXE C;  2RGO A;  5EP2 A;  4NSO B;  3SAS A;  1ZQ9 A;  2Q2E B;  3FUX A;  4G4O A;  1H6U A;  1SXJ B;  1FNN A;  3J81 S;  2UUB M;  1HQY E;  1YSY A;  3JR5 A;  3U6Q A;  2RKO A;  2XSZ D;  3D8L A;  1E32 A;  1S3S A;  4LCB A;  3WHL A;  1Z5B A;  1XHB A;  2ZM6 M;  4TUW A;  1IBK M;  1QAQ A;  2XGN A;  5EQT A;  3PNV A;  1DGH B;  1SXJ D;  2M5Z A;  2D7H A;  2CFO A;  5KQD A;  5ITT A;  3SAT A;  3VLF B;  3TE6 A;  3VFD A;  1PJJ A;  4B3M M;  3R9X B;  2XFS A;  3GRR A;  4XGI A;  1J09 A;  5EP3 A;  2R65 A;  4FCV A;  1Q3B A;  4G6Z A;  4DR7 M;  3QAU A;  1XWI A;  3U60 B;  3U6S A;  1PM5 A;  2C98 A;  2LXE A;  1X37 A;  1WXQ A;  4LJ4 A;  3SMP A;  3GLF B;  4LFA M;  5FLX S;  4Z8X A;  2FOI C;  4JI8 M;  5BPV A;  2Y20 A;  1NJG A;  3LQQ A;  1G4A E;  4M9Z A;  5JI3 E;  3FD9 A;  1TH3 A;  2VQE M;  1LV7 A;  1NNJ A;  4DV3 M;  3CF2 A;  2DXI A;  5EXX A;  2QZ4 A;  3NBI A;  4BB9 A;  2LNH C;  3KOY E;  4B7G A;  1QAM A;  1DGB A;  4GHA A;  3KDS E;  3RGP A;  3U6D A;  4QNM A;  3HU3 A;  2HHH M;  2L7I A;  2HKJ A;  1I94 M;  4EIW A;  2F5S A;  3KP1 E;  4RF0 A;  3FUU A;  4KO8 A;  1D2N A;  1K82 A;  3TWK A;  4OVZ A;  1SXJ C;  4MB7 A;  4KHP M;  4PT5 A;  3SHG B;  1C1K A;  3HGI A;  3LVV A;  3SFZ A;  4YHH M;  3U6C A;  3U61 B;  4L16 A;  5E26 A;  3JR4 A;  1FJG M;  4LF8 M;  1E9S A;  1L8Q A;  1IN5 A;  5FTL A;  2D7E A;  2ZBK B;  2L6O A;  5KPR A;  4G4N A;  1R7R A;  3U6L A;  2QBY A;  4JI2 M;  4I81 A;  2DZO B;  3VDP A;  1XNR M;  1TH2 A;  4ITQ A;  1T3T A;  3TQS A;  3J2P B;  1DGG A;  3PNY A;  4IBD A;  4CIS A;  3L25 A;  3HHZ A;  5BR8 M;  2F4V M;  3GP1 A;  2HCB A;  2Y21 A;  5FTN A;  1UM8 A;  3KOX E;  3DFZ A;  4NRW A;  4DR6 M;  4A3V B;  4LRS A;  1IBL M;  1TDH A;  1VDD A;  5KO3 A;  1JQJ C;  3PVS A;  1G59 A;  3DZD A;  4LGM A;  3KFU G;  3U6P A;  1QAN A;  3AJI B;  3M6A A;  3W0F A;  4AG5 A;  4LF4 M;  4REZ A;  2CHQ A;  3K1J A;  4I8O A;  3K8Z A;  2Z4S A;  5ITR A;  2CUZ A;  2DZN B;  2X8A A;  4GKJ M;  1TH4 A;  3SHF A;  2R4J A;  4JI5 M;  2UU9 M;  3GRV A;  3J7B A;  3M7G A;  4S12 A;  3GQ3 A;  4DR4 M;  3L29 A;  2CV0 A;  4MGH A;  4GMQ A;  3A45 A;  1NY6 A;  4FCW A;  2DWM A;  1J7K A;  2YR0 A;  3FUT A;  3LVW A;  2UUA M;  4AG6 A;  1IM2 A;  4JI4 M;  4AKH A;  2Y0Q A;  3VDU A;  3U6O A;  4GRI A;  3UZU A;  2KZS A;  4NXM M;  4JI3 M;  4QOZ C;  2Y0T A;  3UJN A;  2FNA A;  1XXH A;  4L15 A;  3VKG A;  2G5G X;  2A5Y B;  3HJQ A;  4K0K M;  2K47 A;  1DO0 A;  5EXS A;  1IY0 A;  3HU1 A;  3HJS A;  3MHV C;  3UK6 A;  3U5Z A;  1XMQ M;  5E6J A;  5DNY A;  1K3W A;  3VKH A;  4LG2 A;  3TPZ A;  5C1B A;  3LMM A;  3GO8 A;  3IG5 A;  4L4U A;  2H1R A;  4GC5 A;  5FTJ A;  1KYI A;  4QHT A;  2XF3 A;  4PDI A;  1YE9 A;  3KOZ E;  3QWL A;  1N33 M;  1OFH A;  2I7P A;  1QAO A;  5DYI A;  2HL7 A;  4LJ5 A;  4CHT B;  2CHV A;  3C58 A;  4M9X A;  5FTM A;  4JI1 M;  1NY5 A;  4LF9 M;  3GQ5 A;  3A46 A;  3KW6 A;  2LWX A;  4LF6 M;  4LZJ A;  3W0L B;  1W5S A;  4HLQ A;  7CAT A;  5H37 D;  3KS8 A;  1E94 E;  4LJ7 A;  4IBB A;  1L1T A;  4GKK M;  4W5W A;  4DR2 M;  1R2Z A;  3KSJ A;  3NWL A;  4FD2 A;  2DWN A;  3GLI B;  3FUV A;  2ZAO A;  3FYD A;  1PJI A;  1GL7 A;  4OVZ B;  4FCT A;  1HQC A;  1GL6 A;  2C5R A;  4I5S A;  1TGU A;  4MM3 B;  4OX9 M;  4GIP A;  5EXP A;  1Q3C A;  3ZH9 B;  2YNM D;  5KPT A;  2CV1 A;  1K3X A;  1NHG C;  3GLH B;  3RGS A;  2VII A;  1L1Z A;  2C9C A;  5FTK A;  2XFT A;  3T38 A;  4JI0 M;  4WW0 A;  1HT1 E;  4CGY B;  4AKI A;  2J7O A;  1N32 M;  2DHR A;  4NXN M;  2OPF A;  4FWG A;  4NL4 H;  3E9S A;  3OTO M;  1HR0 M;  4GIT A;  8CAT A;  3PXG A;  3DA1 A;  1N36 M;  3SAR A;  2R62 A;  1QVR A;  2C99 A;  2CHG A;  3AOE A;  3VK8 A;  4PCZ A;  2V1U A;  3L2A A;  5EXT A;  2F5Q A;  1IXS B;  1IN6 A;  2XLJ A;  3HWS A;  4OU7 A;  3GQ4 A;  1Z5C A;  5IZ7 D;  4IIW A;  4MGI E;  4WUR A;  3KP0 E;  2R45 A;  3GLF A;  4GHL A;  3FUW A;  1OFI A;  2W82 A;  2RGH A;  1HNZ M;  2FE8 A;  3HHW A;  1NNU C;  5KPZ A;  3MJ5 A;  3T1H M;  1Q39 A;  2LH0 A;  4R3D A;  2YFQ A;  1XNQ M;  2P5T A;  2FFJ A;  4RNA A;  3DOA A;  3IG8 A;  4KLN A;  1N77 A;  3UMM A;  2UXC M;  1N78 A;  4LJ8 A;  2Z7J A;  4IBK A;  3GPX A;  1SXJ E;  3D8B A;  1W5T A;  4DV0 M;  3THG A;  1GKI A;  4IJE A;  4II7 A;  2F5O A;  3ZC7 B;  4LGY A;  3VK7 A;  1G41 A;  1N34 M;  1Z6T A;  1JR3 A;  3HHX A;  1TDZ A;  3EIH A;  4QOS A;  4LFC M;  1GLN A;  1XXH B;  4LJ6 A;  3L28 A;  5ITU A;  4QNR A;  1R6B X;  2R46 A;  4MH0 E;  4DV7 M;  1L2B A;  4NOO B;  2CEA A;  2V1C A;  3AL0 C;  2DVW B;  2X49 A;  5ITQ A;  3KOW E;  3WHK A;  2KEB A;  4D81 A;  2UXD M;  2D7G A;  1ORY B;  4G4R A;  3RE8 A;  5EP1 A;  3GPU A;  1MX0 A;  4X65 M;  3J80 S;  3HU2 A;  4LJA A;  2M60 A;  2EO2 A;  4JN6 A;  4G4Q A;  4IJF A;  2BJV A;  2KRU A;  5C18 A;  2CV2 A;  1QZM A;  1GVN A;  4JXJ A;  4LJ9 A;  4ZPX A;  4AI6 A;  1EE8 A;  5DYG A;  3LQR A;  2YQZ A;  1DO2 A;  4MGY E;  1J5E M;  2X4A A;  3RFW A;  3J27 B;  3KS4 A;  1IN8 A;  3CF6 E;  3A98 B;  3KVW A;  4LFB M;  3SYL A;  4B08 A;  2O5R A;  3GPY A;  3SMS A;  3FTF A;  2ERC A;  3HKP A;  1NHW C;  4I4L A;  3GLG A;  2Z4R A;  1IQP A;  3FTC A;  4AKG A;  4JV5 M;  5A2Q S;  3GPP A;  3AKZ A;  1IXR C;  5LMN M;  5IT9 S;  1NJF A;  4IBI A;  3I4V A;  4OW0 A;  2BNK A;  4LF7 M;  2C9O A;  5GKN A;  2JA2 A;  2R4E A;  4DV1 M;  4BLC A;  4DR1 M;  2KRK A;  3JAM S;  4LY6 A;  3SC3 A;  4LF5 M;  4FWH A;  2QP9 X;  2Z3X A;  5ITY A;  3I4Y A;  1IY1 A;  2KA6 B;  1G8P A;  5IRE B;  5JI2 E;  4P16 A;  3K2L A;  1R2Y A;  3HHY A;  3K92 A;  2CE7 A;  2XSZ A;  3EIE A;  1DGF A;  2XZF A;  1L2C A;  4X62 M;  4DR3 M;  5EJC A;  1IXZ A;  2EA0 A;  1IN7 A;  1SXJ A;  4X66 M;  4IBG A;  4DV6 M;  4AZF A;  4DV5 M;  4X64 M;  2E5L M;  4RF1 A;  2QPA A;  5ITX A;  4QHS A;  1XMO M;  3MK6 A;  1IBM M;  2XEP A;  2QBY B;  3E4R A;  1NSF A;  4DV2 M;  1DGH A;  1N75 A;  4B7H A;  4JYA M;  1MU5 A;  4IBJ A;  5F3W A;  2XZU A;  2ZAN A;  3ILK A;  1HNX M;  4GH9 A;  4B3R M;  2V6Z M;  4MGZ E;  1HT2 E;  1Z59 A;  3BOS A;  4B3S M;  4D80 A;  1QQW A;  1IY2 A;  5IWA M;  3U60 A;  2QCU A;  4AW4 A;  3TWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...