2L09A

Solution nmr structure of protein asr4154 from nostoc sp. pcc7120 northeast structural genomics consortium target id nsr143
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MNLRWTSEAKTKLKNIPFFARSQAKARIEQLARQAEQDIVTPELVEQARLEFGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asr4154 protein
publication title NMR Solution Structure of asr4154 from Nostoc sp. PCC7120 Northeast Structural Genomics target ID Nsr143
rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08369 PCP_red Proto-chlorophyllide reductase 57 kD subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.550 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l09A01
2L09A 2YNMD 2KRUA
chains in the Genus database with same CATH superfamily
2X4AA 2P5TA 4JI2M 2WZJA 3FUTA 4Y28F 3AOEA 3QYEA 3VLFB 3PNYA 2A5YB 3A42A 1OFHA 8CATA 3UZUA 2KNVA 5E6JA 2YFQA 5FTLA 1SXJE 4LJ8A 3KS4A 1ZMWA 2KRUA 4OVZA 1XMQM 4LZZA 4NRWA 1YLAA 3CF2A 3B9PA 4FVMA 2UU9M 3FKEA 3GLFB 4JV5M 2APLA 2LWXA 2GQFA 3FYDA 4S12A 5FTNA 3KOXE 4D81A 2K6BA 3HHZA 2WSCF 1QUSA 4G4OA 1R6BX 1OIZA 1TH2A 4KLNA 4CGYB 4TUWA 3LMMA 1Y8GA 3IG5A 4GEWA 5EXXA 1VG5A 4OW0A 1G8PA 2HL7A 4LF6M 1XXHB 3RGPA 1NSFA 3K9OA 3GLFA 1IFYA 4GHAA 1X37A 3DOAA 3ZH9B 2XEPA 5C18A 2L09A 4OVZB 4W5WA 2XGNA 4R3DA 2XH9A 1GLNA 2YNMD 1XXHA 5FLXS 2B3TA 3ZCBB 1MN3A 2XSZD 1QVRA 2G8LA 2QZ4A 4MH0E 5DNYA 1PJSA 4DR5M 1L1ZA 3I01M 4L4UA 5BPVA 2DHRA 4R7GA 4YHHM 1R2ZA 2HKJA 3NBIA 4DR3M 1S3SA 4LZJA 2MJ5B 5A2QS 3GLIB 3UMMA 3U6OA 1RU3A 3A98B 3KP1E 3KVWA 4LGYA 1QAOA 3K9PA 3GP1A 2JP7A 1TDZA 5EQTA 3TWKA 4NOOB 4LCBA 5EXSA 2LVNC 2DNAA 1OAIA 3DA1A 2WSEF 3R8FA 3ZC7B 3QWLA 3J27B 3GLIA 2LXEA 1K3WA 2R46A 4M9ZA 3DZDA 4IBCA 2FFJA 2HHHM 2QHOB 2XSZA 4LJ9A 3U6MA 2QCUA 2KZUA 1EIJA 1GKIA 1WHCA 3T15A 3KW6A 3SATA 3H4JA 4DV0M 4EIWA 2QPAA 3SBJA 3HKPA 1ORYB 3AFHA 4MGIE 1IN4A 1ZMVA 2KRKA 3KOZE 5H37D 3UGJA 3KSXA 1N33M 4R71A 2FS1A 2JZ1A 2J5YA 2XFTA 1HNZM 7CATA 1QZMA 1XNRM 1OKSA 4NL4H 4Z6YA 4DR2M 2KNZA 2DWMA 4M0DA 2DZOB 2UUCM 2EKKA 2RKOA 2ZANA 1EFUB 1JQJC 2JNHA 1SXJD 3B74A 1E9SA 3J80S 1NJGA 1DGBA 1GL7A 1HQCA 3PVSA 1G41A 4CHTB 3KOYE 2DZNB 5KPTA 2DXIA 3UK6A 5DFLA 5GKNA 2MROB 1E9RA 1D0KA 1WIVA 2JUJA 4K0KM 4YY3M 4JI5M 3WHLA 2XLJA 2KHHA 1IN6A 3JAMS 1HR0M 4OU7A 1F4IA 3PXGA 1R4GA 4G4RA 3FUXA 2EJSA 2R62A 1SXJB 2KNAA 5KPZA 3F92A 3I4YA 1ZAEA 2KXEA 3K1JA 4X66M 3SAVA 4IBFA 4L6V6 1N78A 3GLGB 1OIPA 1V33A 1G71A 3FUVA 3K92A 1TDHA 4NSOB 2Y0TA 3A45A 3LW5F 3VKHA 1LV7A 3HX3A 3D8LA 1SXJA 1J09A 1OQYA 2D7GA 1BVSA 2L2DA 2DZLA 3GLGA 4X65M 2F5SA 4D82A 3RGSA 1IBLM 4GITA 2OOAA 2YR0A 3AOGA 3B7QA 4NXNM 4MB7A 4LF7M 2F5OA 1MJGM 2D7EA 3U61B 4DUZM 2QSFX 4DV1M 3TL4X 2L7IA 2H1RA 4DV2M 3MJ5A 5KPRA 1GJTA 3HZJA 3SYLA 3Q8GA 4LFCM 2LH0A 3VK7A 1DGGA 3U61A 2DAKA 3GQ5A 4B7GA 2FOIC 1YUBA 2YQZA 4B08A 1OAOC 3I4VA 1NJFA 4GKKM 4KT0F 3TWMA 3FRHA 2FH0A 2R6FA 3CF0A 2VF8A 2G5GX 3LCVB 3D8BA 3GLGE 4LJ5A 5EXPA 3ZQJA 1TTEA 1WGLA 3MMPA 2C5RA 5EXTA 1TR8A 2CHQA 4B3RM 2DVWB 3HHXA 4M9XA 4DUYM 2BWBA 4QHSA 2ZAOA 1L8QA 2JXNA 1R7RA 1DV0A 2WSFF 1YE9A 2CV1A 3LVVA 2LNHC 4JI4M 2BJWA 2ZTCA 4GMQA 4RNAA 3GQ3A 1WJ7A 1L2BA 3PNVA 3LCUA 3C58A 1N32M 1VEJA 2QQ8A 2R45A 4PDIA 4NRVA 1IBKM 1MX0A 4IIWA 1D0MA 1NNUC 1NY5A 1IXZA 3FE3A 4A3VB 3HJSA 3GPYA 4GHLA 2RGOA 1QANA 2K0BX 1PGYA 4KO8A 2KA6B 4LFBM 2CE7A 3FTDA 4NSRA 3U6LA 2XZUA 4AQYM 1XB2B 3CGWA 3SAWA 2DI0A 3KS8A 5E26A 1OFIA 1QDRA 2C9OA 3HGIA 5ITXE 5ITTA 3U6SA 2DHYA 1GABA 1D0LA 1Q02A 1C7YA 2ERCA 4Q7JA 5FTMA 4G4QA 2JA2A 2CV2A 2Y0QA 4IBDA 2JZ0A 3PFIA 2XFSA 2DWZB 3U6DA 3ILKA 1AUAA 3QAUA 2F4VM 3FD9A 2G3QA 4MGZE 2XZFA 3HU2A 3TPZA 4IBGA 1W5TA 3SHGB 4IBIA 1N34M 5LMUM 1IXSB 1XWIA 4P17A 3T6PA 3VKGA 1SG9A 3L29A 3MK6A 1R2YA 2L7HA 1C1KA 2VIIA 2UUAM 3RE8A 3SMSA 2UXDM 4PT5A 4G3OA 1HT2E 2ZBKB 3DFZA 1E32A 2Z3XA 1IXSA 1IN8A 1Z5BA 2R18A 2Z4RA 3LQQA 2L6OA 1Q3BA 2Y20A 3I04M 1Q39A 1IBMM 2Z7JA 1FNNA 2UXCM 4I4LA 1PJIA 1PJTA 3AL0C 4AKIA 4WP2A 3L26A 3T1YM 2R4JA 2C9CA 5EP2A 4L16A 4FCTA 3SC3A 1L2DA 2CV0A 4LJ4A 2DAEA 1QAMA 1XC8A 1L1TA 1L2CA 3GLHE 3JR5A 3JR4A 2M5ZA 1N77A 1QQWA 1ZQ9A 2GNOA 3KP0E 5DYIA 1J7KA 3BOSA 4L8RC 4MGHA 2CUZA 3I51A 2QP9X 4FWGA 3TE6A 2W82A 3LQRA 4DV3M 2I7PA 2KW0A 5KQ8A 3FUUA 4GC9A 4QHTA 4DR4M 1KYIA 2L4FA 3Q8XA 4WW0A 3W0FA 4AW4A 2D7HA 3W0LB 3K8ZA 3HU3A 1XMOM 4QOSA 1YSYA 2M60A 4JI8M 1IY1A 1V34A 4Z8XA 1Z5CA 4I8OA 2V6ZM 3C9PA 4DR1M 2F5QA 4B3MM 1Z59A 4GH9A 4DR6M 3CTWB 3KXEC 1R5LA 2BNKA 1P3QQ 3QYBA 4IBKA 4ITQA 1IQPA 4HEOA 4REZA 5DYGA 4QNRA 4RKUF 2MR9A 3E9SA 2RRUA 3L2AA 3TQSA 3C3DA 1NHGC 2JY5A 4BB9A 4LRTA 3FTFA 3E46A 3HHYA 3W68A 4FD2A 1PJJA 2X8AA 4FWDA 5IREB 2DWNA 2V1UA 3FTEA 3GRYA 2LVPC 2H5XA 1IXRC 3EIHA 4LY6A 5ITUA 3NBXX 3MHVC 4QOZC 4LJAA 2CHVA 4AKHA 1DO0A 1VEKA 1T3TA 2CRUA 3GRUA 1TGUA 1LTMA 1UFZA 3GPXA 4DV5M 1A5TA 3SAUA 3HHWA 1HNWM 4GKJM 2CFOA 2VDBB 4ZPXA 1NNJA 4LF4M 4HLQA 3IHPA 4L15A 1Z6TA 3IECA 4FCWA 2DAMA 3BXWA 3KSJA 4KODA 1CUKA 3SHFA 2UUBM 3OTOM 1IN5A 5L8RF 5ITXA 1V92A 4MGKE 2ZAMA 4JI7M 4IJEA 3VDUA 4GRIA 3J7BA 2LTUA 4DV7M 5JI2E 4M9SA 2OQ4A 1XHBA 2BWEA 4AI6A 2JWSA 1G59A 1JR3E 4B7HA 3U6CA 1DGFA 2J7NA 2K9DA 4PCZA 4LF8M 4LGMA 5IT9S 3AOEC 5KO3A 4MGYE 2DENA 3GPPA 2DKLA 5ITRA 1VEGA 3T1HM 4QNMA 4FWHA 3VDPA 2LHGA 3SFZA 2LBCA 3SASA 1QYRA 1JB0F 1I4WA 1HQYE 4FW9A 4BBAA 2K47A 4UN2B 4JI1M 1G4AE 2CP8A 2C96A 4JXJA 4JI6M 3KOWE 4D80A 1W5SA 4RF0A 1OTRA 1NY6A 4RF1A 4HL4A 2KEBA 3L27A 4JI0M 4DBGB 1T6OA 3L28A 4OX9M 4LJ7A 3B7ZA 2XF3A 1I94M 2HAKA 5EP3A 4LFAM 4MM3B 2Q2EB 3FYCA 4JYAM 3RFWA 5BR8M 3FRIA 4ANRA 4XGIA 4L78A 3GQ4A 4DR7M 5FTJA 3HY5A 3IG8A 3H4MA 2MH8A 4PD2A 2UXBM 2R0IA 3GLHB 5EJCA 1WGNA 2JY7A 1PJQA 2CHGA 2Y21A 3B89A 3T38A 3U6PA 4GC5A 5FTKA 4LF9M 1IN7A 2C99A 3HWSA 4XBOA 4I5SA 1HJPA 1NHWC 1PRBA 2FE8A 2LVAA 3U6EA 4LJ6A 3UJNA 2HWJA 3GLHA 2LVOC 4BLCA 4CIZA 4XK8F 2J7OA 3GRRA 1K3XA 4B3TM 2EUCA 1ZMUA 2F5NA 1HT1E 2KZSA 4II7A 2EA0A 2HCBA 3THGA 3U6QA 3HU1A 2O5RA 3GLFE 3C3EA 1GVNA 1HNXM 1NV8A 2V1CA 3HJQA 4KHPM 4G4NA 1QUTA 2LHCA 4JN6A 4AKGA 4FCVA 4AG5A 2VQEM 4WURA 1QAQA 2QBYB 3FUWA 2AHMA 3AKZA 2EKFA 1TH3A 1OJLA 1XXHE 3V76A 5KQDA 4B3SM 1QZEA 1DO2A 2CWBA 2QENA 2R65A 3GPUA 3B7NA 5LMNM 1D2NA 1H6UA 5C1BA 2ZTDA 1J5EM 3E4RA 1VDLA 2O01F 2ZM6M 1GL6A 2RGHA 2QBYA 3AV0A 3TWLA 1KSFX 2N35A 2OOBA 2Z8YM 1N36M 2MGWA 3E21A 4IBJA 4CJ6A 2QNJA 3KDSE 3M0EA 5ITYA 3AJIB 2Z4SA 1XNQM 1NV9A 2L4EA 3CF6E 4PDGA 1VDDA 1IY0A 3VK8A 5F3WA 3L25A 4I81A 2JY8A 1JR3D 5FSWA 3GLIE 3KFUG 4IBEA 1UM8A 4F2LA 4AG6A 5EP1A 3SMPA 3J81S 1G3IA 2FNAA 3HJ8A 3WHKA 3GO8A 1FJGM 5IZ7D 1EE8A 3R9XB 2VF7A 2CEAA 3BBZA 1Z5AA 1VQ1A 1IY2A 4DV4M 2OO9A 5IWAM 2R44A 4X64M 2KDLA 4AZFA 3U60B 2OPFA 1E94E 3J7AS 1MU5A 4B7FA 4G6ZA 4X62M 1AIPC 2I7NA 1PM5A 3FTCA 1Q3CA 2E5LM 5JI3E 2O25A 2LVQD 2R4EA 3K2LA 5EP4A 4IJFA 4CISA 2F5PA 1GO5A 2NQ8C 1JR3A 3U60A 1ZV1A 3J2PB 1TF0B 3LVWA 4LF5M 2DAIA 3SARA 3NWLA 2BJVA 2C98A 3U5ZB 4NXMM 5ITQA 4DV6M 4M0WA 4LG2A 2DWLA 2X49A 1SXJC 1WXQA 1DGHB 3M6AA 4LRSA 3EIEA 1KFVA 4F1IA 1GJSA 1NO1A 1IM2A 4NC6A 4P16A 1TH4A 3A46A 2VQFM 1T43A 3SYKA 3VFDA 2EO2A 3M7GA 3GRVA 3W67A 1NVMA 3U5ZA 4IBBA 4JI3M 2JY6B 2DAGA 1N75A 1DGHA 4GIPA 1WR1B 1K82A 1QDTA
chains in the Genus database with same CATH topology
2X4AA 2P5TA 4JI2M 3FUTA 3AOEA 3VLFB 3PNYA 2A5YB 3A42A 1OFHA 8CATA 3UZUA 5E6JA 2YFQA 5FTLA 1SXJE 4LJ8A 3KS4A 2KRUA 4OVZA 1XMQM 4LZZA 4NRWA 3CF2A 3B9PA 4FVMA 2UU9M 3FKEA 3GLFB 4JV5M 5FTNA 2LWXA 4S12A 3FYDA 4D81A 3HHZA 3KOXE 5IT9S 4G4OA 1R6BX 1TH2A 4KLNA 4CGYB 4TUWA 3LMMA 3IG5A 5EXXA 4OW0A 1G8PA 2HL7A 4LF6M 1XXHB 3RGPA 1NSFA 3GLFA 4GHAA 1X37A 3DOAA 3ZH9B 2XEPA 5C18A 2L09A 4W5WA 2XGNA 4R3DA 2XH9A 1GLNA 2YNMD 1XXHA 5FLXS 3ZCBB 2XSZD 1QVRA 2G8LA 2QZ4A 4MH0E 5DNYA 4DR5M 1L1ZA 4L4UA 1R2ZA 5BPVA 2DHRA 4R7GA 4YHHM 2HKJA 3NBIA 4DR3M 1S3SA 4LZJA 5A2QS 3GLIB 3UMMA 3U6OA 3A98B 3KP1E 3KVWA 4LGYA 1QAOA 3GP1A 1TDZA 5EQTA 3TWKA 4NOOB 4LCBA 5EXSA 3DA1A 3R8FA 3ZC7B 3QWLA 3J27B 3GLIA 2LXEA 1K3WA 2R46A 4M9ZA 3DZDA 4IBCA 2FFJA 2HHHM 2XSZA 4LJ9A 3U6MA 2QCUA 2KZUA 1GKIA 3T15A 3KW6A 3SATA 4DV0M 4EIWA 2QPAA 3SBJA 3HKPA 1ORYB 3AFHA 4MGIE 1IN4A 2KRKA 3KOZE 5H37D 3UGJA 3KSXA 1N33M 2XFTA 1HNZM 7CATA 1QZMA 1XNRM 4NL4H 4Z6YA 4DR2M 2DWMA 4M0DA 2DZOB 2UUCM 2RKOA 2ZANA 1JQJC 1SXJD 3J80S 1E9SA 1NJGA 1DGBA 1GL7A 1HQCA 3PVSA 1G41A 4CHTB 3KOYE 2DZNB 5KPTA 2DXIA 3UK6A 5GKNA 1E9RA 4K0KM 4YY3M 4JI5M 3WHLA 2XLJA 1HR0M 1IN6A 3JAMS 4OU7A 3PXGA 4G4RA 3FUXA 2R62A 1SXJB 5KPZA 3I4YA 1ZAEA 2KXEA 3K1JA 4X66M 3SAVA 4IBFA 1N78A 3GLGB 3FUVA 3K92A 1TDHA 4NSOB 2Y0TA 3A45A 3VKHA 1LV7A 3D8LA 1SXJA 1J09A 2D7GA 3GLGA 4X65M 2F5SA 4D82A 3RGSA 1IBLM 4GITA 2YR0A 3AOGA 4NXNM 4MB7A 4LF7M 2F5OA 2D7EA 3U61B 4DUZM 4DV1M 3TL4X 2L7IA 2H1RA 4DV2M 3MJ5A 5KPRA 3SYLA 4LFCM 2LH0A 3VK7A 1DGGA 3U61A 3GQ5A 4B7GA 2FOIC 1YUBA 2YQZA 4B08A 3I4VA 1NJFA 4GKKM 3TWMA 3CF0A 2G5GX 3D8BA 4LJ5A 5EXPA 2C5RA 5EXTA 2CHQA 4B3RM 2DVWB 3HHXA 4M9XA 4DUYM 4QHSA 2ZAOA 1L8QA 1R7RA 1YE9A 2CV1A 3LVVA 2LNHC 4JI4M 2BJWA 4GMQA 4RNAA 3GQ3A 1L2BA 3PNVA 3C58A 1N32M 2R45A 4PDIA 4NRVA 1IBKM 1MX0A 4IIWA 1NNUC 1NY5A 1IXZA 4A3VB 3HJSA 3GPYA 4GHLA 2RGOA 1QANA 4KO8A 2KA6B 4LFBM 2CE7A 3FTDA 4NSRA 3U6LA 2XZUA 4AQYM 3SAWA 3KS8A 5E26A 1OFIA 2C9OA 5ITXE 3HGIA 3U6SA 5ITTA 2ERCA 5FTMA 4G4QA 2JA2A 2CV2A 2Y0QA 4IBDA 3PFIA 2XFSA 2DWZB 3U6DA 3ILKA 3QAUA 2F4VM 3FD9A 4MGZE 2XZFA 3HU2A 3TPZA 4IBGA 1W5TA 3SHGB 4IBIA 1N34M 5LMUM 1IXSB 1XWIA 3VKGA 3L29A 3MK6A 1R2YA 2L7HA 1C1KA 2VIIA 2UUAM 3RE8A 3SMSA 2UXDM 4PT5A 1HT2E 2ZBKB 3DFZA 1E32A 2Z3XA 1IN8A 1Z5BA 2R18A 2Z4RA 3LQQA 2L6OA 1Q3BA 2Y20A 1Q39A 1IBMM 2Z7JA 1FNNA 2UXCM 4I4LA 1PJIA 4AKIA 3AL0C 3L26A 3T1YM 2R4JA 2C9CA 5EP2A 4L16A 4FCTA 3SC3A 1L2DA 2CV0A 4LJ4A 1L1TA 1QAMA 1XC8A 1L2CA 3JR5A 3JR4A 2M5ZA 1N77A 1QQWA 1ZQ9A 3KP0E 5DYIA 1J7KA 3BOSA 4L8RC 4MGHA 2CUZA 3I51A 2QP9X 4FWGA 3TE6A 2W82A 3LQRA 4DV3M 2I7PA 2KW0A 5KQ8A 3FUUA 4GC9A 4QHTA 4DR4M 1KYIA 3Q8XA 4WW0A 3W0FA 4AW4A 2D7HA 3W0LB 3K8ZA 3HU3A 1XMOM 4QOSA 1YSYA 2M60A 4JI8M 1IY1A 4Z8XA 1Z5CA 4I8OA 2V6ZM 4DR1M 2F5QA 4B3MM 1Z59A 4GH9A 4DR6M 3CTWB 3KXEC 2BNKA 4IBKA 4ITQA 1IQPA 4REZA 5DYGA 4QNRA 3TQSA 3E9SA 3L2AA 1NHGC 4BB9A 4LRTA 3FTFA 3HHYA 4FD2A 1PJJA 2X8AA 4FWDA 5IREB 2DWNA 2V1UA 3FTEA 3GRYA 1IXRC 3EIHA 4LY6A 5ITUA 4QOZC 3MHVC 4LJAA 2CHVA 4AKHA 1DO0A 1T3TA 3GRUA 1TGUA 3GPXA 4DV5M 3SAUA 3HHWA 1HNWM 4GKJM 2CFOA 1NNJA 4ZPXA 4LF4M 4HLQA 4L15A 1Z6TA 4FCWA 4KODA 3KSJA 3SHFA 2UUBM 1XNQM 3OTOM 1IN5A 5ITXA 4MGKE 4JI7M 2ZAMA 4IJEA 3VDUA 4GRIA 3J7BA 4DV7M 5JI2E 4M9SA 2OQ4A 1XHBA 4AI6A 1G59A 4B7HA 3U6CA 1DGFA 2J7NA 4PCZA 4LF8M 4LGMA 3AOEC 5KO3A 4MGYE 3GPPA 5ITRA 3T1HM 4QNMA 4FWHA 3VDPA 3SFZA 3SASA 1QYRA 1I4WA 4FW9A 1HQYE 4BBAA 2K47A 4JI1M 1G4AE 2C96A 4JXJA 4JI6M 3KOWE 4D80A 1W5SA 4RF0A 1NY6A 4RF1A 4HL4A 2KEBA 3L27A 4JI0M 3L28A 4OX9M 4LJ7A 2XF3A 1I94M 5EP3A 4LFAM 4MM3B 2Q2EB 3FYCA 4JYAM 3RFWA 5BR8M 4XGIA 4L78A 3GQ4A 4DR7M 5FTJA 3IG8A 3H4MA 4PD2A 2UXBM 3GLHB 5EJCA 2CHGA 2Y21A 3T38A 3U6PA 4GC5A 5FTKA 4LF9M 1IN7A 2C99A 3HWSA 4XBOA 4I5SA 1NHWC 2FE8A 3U6EA 4LJ6A 3UJNA 3GLHA 4BLCA 2J7OA 3GRRA 1K3XA 4B3TM 2EUCA 2F5NA 1HT1E 2KZSA 4II7A 2EA0A 2HCBA 3THGA 3U6QA 3HU1A 2O5RA 1GVNA 1HNXM 2V1CA 3HJQA 4KHPM 4G4NA 4JN6A 4AKGA 4FCVA 4AG5A 2VQEM 4WURA 1QAQA 2QBYB 3FUWA 2AHMA 3AKZA 1TH3A 1OJLA 5KQDA 4B3SM 2QENA 1DO2A 2R65A 3GPUA 5LMNM 1D2NA 1H6UA 5C1BA 1J5EM 3E4RA 2ZM6M 2QBYA 1GL6A 2RGHA 3AV0A 3TWLA 1KSFX 1N36M 4IBJA 3KDSE 3M0EA 5ITYA 3AJIB 2Z4SA 3CF6E 4PDGA 1VDDA 1IY0A 3VK8A 5F3WA 3L25A 4I81A 1JR3D 5FSWA 3KFUG 4IBEA 1UM8A 4AG6A 5EP1A 3SMPA 3J81S 1G3IA 2FNAA 3HJ8A 3WHKA 3GO8A 1FJGM 5IZ7D 1EE8A 3R9XB 2CEAA 1Z5AA 1IY2A 4DV4M 5IWAM 4X64M 4AZFA 3U60B 2OPFA 1E94E 3J7AS 1MU5A 4B7FA 4G6ZA 4X62M 2I7NA 1PM5A 3FTCA 1Q3CA 2E5LM 5JI3E 2R4EA 3K2LA 5EP4A 4IJFA 4CISA 2F5PA 2NQ8C 1JR3A 3U60A 3J2PB 3LVWA 4LF5M 3SARA 3NWLA 2BJVA 2C98A 3U5ZB 4NXMM 5ITQA 4DV6M 4M0WA 4LG2A 2DWLA 2X49A 1SXJC 1WXQA 1DGHB 3M6AA 4LRSA 3EIEA 1KFVA 4P16A 1IM2A 1TH4A 3A46A 2VQFM 3SYKA 3VFDA 2EO2A 3M7GA 3GRVA 3U5ZA 1NVMA 4IBBA 4JI3M 1N75A 1DGHA 4GIPA 4OVZB 1K82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L09 A;  2YNM D;  2KRU A; 
#chains in the Genus database with same CATH topology
 2X4A A;  2P5T A;  4JI2 M;  2WZJ A;  3FUT A;  4Y28 F;  3AOE A;  3QYE A;  3VLF B;  3PNY A;  2A5Y B;  3A42 A;  1OFH A;  8CAT A;  3UZU A;  2KNV A;  5E6J A;  2YFQ A;  5FTL A;  1SXJ E;  4LJ8 A;  3KS4 A;  1ZMW A;  2KRU A;  4OVZ A;  1XMQ M;  4LZZ A;  4NRW A;  1YLA A;  3CF2 A;  3B9P A;  4FVM A;  2UU9 M;  3FKE A;  3GLF B;  4JV5 M;  2APL A;  2LWX A;  2GQF A;  3FYD A;  4S12 A;  5FTN A;  3KOX E;  4D81 A;  2K6B A;  3HHZ A;  2WSC F;  1QUS A;  4G4O A;  1R6B X;  1OIZ A;  1TH2 A;  4KLN A;  4CGY B;  4TUW A;  3LMM A;  1Y8G A;  3IG5 A;  4GEW A;  5EXX A;  1VG5 A;  4OW0 A;  1G8P A;  2HL7 A;  4LF6 M;  1XXH B;  3RGP A;  1NSF A;  3K9O A;  3GLF A;  1IFY A;  4GHA A;  1X37 A;  3DOA A;  3ZH9 B;  2XEP A;  5C18 A;  2L09 A;  4OVZ B;  4W5W A;  2XGN A;  4R3D A;  2XH9 A;  1GLN A;  2YNM D;  1XXH A;  5FLX S;  2B3T A;  3ZCB B;  1MN3 A;  2XSZ D;  1QVR A;  2G8L A;  2QZ4 A;  4MH0 E;  5DNY A;  1PJS A;  4DR5 M;  1L1Z A;  3I01 M;  4L4U A;  5BPV A;  2DHR A;  4R7G A;  4YHH M;  1R2Z A;  2HKJ A;  3NBI A;  4DR3 M;  1S3S A;  4LZJ A;  2MJ5 B;  5A2Q S;  3GLI B;  3UMM A;  3U6O A;  1RU3 A;  3A98 B;  3KP1 E;  3KVW A;  4LGY A;  1QAO A;  3K9P A;  3GP1 A;  2JP7 A;  1TDZ A;  5EQT A;  3TWK A;  4NOO B;  4LCB A;  5EXS A;  2LVN C;  2DNA A;  1OAI A;  3DA1 A;  2WSE F;  3R8F A;  3ZC7 B;  3QWL A;  3J27 B;  3GLI A;  2LXE A;  1K3W A;  2R46 A;  4M9Z A;  3DZD A;  4IBC A;  2FFJ A;  2HHH M;  2QHO B;  2XSZ A;  4LJ9 A;  3U6M A;  2QCU A;  2KZU A;  1EIJ A;  1GKI A;  1WHC A;  3T15 A;  3KW6 A;  3SAT A;  3H4J A;  4DV0 M;  4EIW A;  2QPA A;  3SBJ A;  3HKP A;  1ORY B;  3AFH A;  4MGI E;  1IN4 A;  1ZMV A;  2KRK A;  3KOZ E;  5H37 D;  3UGJ A;  3KSX A;  1N33 M;  4R71 A;  2FS1 A;  2JZ1 A;  2J5Y A;  2XFT A;  1HNZ M;  7CAT A;  1QZM A;  1XNR M;  1OKS A;  4NL4 H;  4Z6Y A;  4DR2 M;  2KNZ A;  2DWM A;  4M0D A;  2DZO B;  2UUC M;  2EKK A;  2RKO A;  2ZAN A;  1EFU B;  1JQJ C;  2JNH A;  1SXJ D;  3B74 A;  1E9S A;  3J80 S;  1NJG A;  1DGB A;  1GL7 A;  1HQC A;  3PVS A;  1G41 A;  4CHT B;  3KOY E;  2DZN B;  5KPT A;  2DXI A;  3UK6 A;  5DFL A;  5GKN A;  2MRO B;  1E9R A;  1D0K A;  1WIV A;  2JUJ A;  4K0K M;  4YY3 M;  4JI5 M;  3WHL A;  2XLJ A;  2KHH A;  1IN6 A;  3JAM S;  1HR0 M;  4OU7 A;  1F4I A;  3PXG A;  1R4G A;  4G4R A;  3FUX A;  2EJS A;  2R62 A;  1SXJ B;  2KNA A;  5KPZ A;  3F92 A;  3I4Y A;  1ZAE A;  2KXE A;  3K1J A;  4X66 M;  3SAV A;  4IBF A;  4L6V 6;  1N78 A;  3GLG B;  1OIP A;  1V33 A;  1G71 A;  3FUV A;  3K92 A;  1TDH A;  4NSO B;  2Y0T A;  3A45 A;  3LW5 F;  3VKH A;  1LV7 A;  3HX3 A;  3D8L A;  1SXJ A;  1J09 A;  1OQY A;  2D7G A;  1BVS A;  2L2D A;  2DZL A;  3GLG A;  4X65 M;  2F5S A;  4D82 A;  3RGS A;  1IBL M;  4GIT A;  2OOA A;  2YR0 A;  3AOG A;  3B7Q A;  4NXN M;  4MB7 A;  4LF7 M;  2F5O A;  1MJG M;  2D7E A;  3U61 B;  4DUZ M;  2QSF X;  4DV1 M;  3TL4 X;  2L7I A;  2H1R A;  4DV2 M;  3MJ5 A;  5KPR A;  1GJT A;  3HZJ A;  3SYL A;  3Q8G A;  4LFC M;  2LH0 A;  3VK7 A;  1DGG A;  3U61 A;  2DAK A;  3GQ5 A;  4B7G A;  2FOI C;  1YUB A;  2YQZ A;  4B08 A;  1OAO C;  3I4V A;  1NJF A;  4GKK M;  4KT0 F;  3TWM A;  3FRH A;  2FH0 A;  2R6F A;  3CF0 A;  2VF8 A;  2G5G X;  3LCV B;  3D8B A;  3GLG E;  4LJ5 A;  5EXP A;  3ZQJ A;  1TTE A;  1WGL A;  3MMP A;  2C5R A;  5EXT A;  1TR8 A;  2CHQ A;  4B3R M;  2DVW B;  3HHX A;  4M9X A;  4DUY M;  2BWB A;  4QHS A;  2ZAO A;  1L8Q A;  2JXN A;  1R7R A;  1DV0 A;  2WSF F;  1YE9 A;  2CV1 A;  3LVV A;  2LNH C;  4JI4 M;  2BJW A;  2ZTC A;  4GMQ A;  4RNA A;  3GQ3 A;  1WJ7 A;  1L2B A;  3PNV A;  3LCU A;  3C58 A;  1N32 M;  1VEJ A;  2QQ8 A;  2R45 A;  4PDI A;  4NRV A;  1IBK M;  1MX0 A;  4IIW A;  1D0M A;  1NNU C;  1NY5 A;  1IXZ A;  3FE3 A;  4A3V B;  3HJS A;  3GPY A;  4GHL A;  2RGO A;  1QAN A;  2K0B X;  1PGY A;  4KO8 A;  2KA6 B;  4LFB M;  2CE7 A;  3FTD A;  4NSR A;  3U6L A;  2XZU A;  4AQY M;  1XB2 B;  3CGW A;  3SAW A;  2DI0 A;  3KS8 A;  5E26 A;  1OFI A;  1QDR A;  2C9O A;  3HGI A;  5ITX E;  5ITT A;  3U6S A;  2DHY A;  1GAB A;  1D0L A;  1Q02 A;  1C7Y A;  2ERC A;  4Q7J A;  5FTM A;  4G4Q A;  2JA2 A;  2CV2 A;  2Y0Q A;  4IBD A;  2JZ0 A;  3PFI A;  2XFS A;  2DWZ B;  3U6D A;  3ILK A;  1AUA A;  3QAU A;  2F4V M;  3FD9 A;  2G3Q A;  4MGZ E;  2XZF A;  3HU2 A;  3TPZ A;  4IBG A;  1W5T A;  3SHG B;  4IBI A;  1N34 M;  5LMU M;  1IXS B;  1XWI A;  4P17 A;  3T6P A;  3VKG A;  1SG9 A;  3L29 A;  3MK6 A;  1R2Y A;  2L7H A;  1C1K A;  2VII A;  2UUA M;  3RE8 A;  3SMS A;  2UXD M;  4PT5 A;  4G3O A;  1HT2 E;  2ZBK B;  3DFZ A;  1E32 A;  2Z3X A;  1IXS A;  1IN8 A;  1Z5B A;  2R18 A;  2Z4R A;  3LQQ A;  2L6O A;  1Q3B A;  2Y20 A;  3I04 M;  1Q39 A;  1IBM M;  2Z7J A;  1FNN A;  2UXC M;  4I4L A;  1PJI A;  1PJT A;  3AL0 C;  4AKI A;  4WP2 A;  3L26 A;  3T1Y M;  2R4J A;  2C9C A;  5EP2 A;  4L16 A;  4FCT A;  3SC3 A;  1L2D A;  2CV0 A;  4LJ4 A;  2DAE A;  1QAM A;  1XC8 A;  1L1T A;  1L2C A;  3GLH E;  3JR5 A;  3JR4 A;  2M5Z A;  1N77 A;  1QQW A;  1ZQ9 A;  2GNO A;  3KP0 E;  5DYI A;  1J7K A;  3BOS A;  4L8R C;  4MGH A;  2CUZ A;  3I51 A;  2QP9 X;  4FWG A;  3TE6 A;  2W82 A;  3LQR A;  4DV3 M;  2I7P A;  2KW0 A;  5KQ8 A;  3FUU A;  4GC9 A;  4QHT A;  4DR4 M;  1KYI A;  2L4F A;  3Q8X A;  4WW0 A;  3W0F A;  4AW4 A;  2D7H A;  3W0L B;  3K8Z A;  3HU3 A;  1XMO M;  4QOS A;  1YSY A;  2M60 A;  4JI8 M;  1IY1 A;  1V34 A;  4Z8X A;  1Z5C A;  4I8O A;  2V6Z M;  3C9P A;  4DR1 M;  2F5Q A;  4B3M M;  1Z59 A;  4GH9 A;  4DR6 M;  3CTW B;  3KXE C;  1R5L A;  2BNK A;  1P3Q Q;  3QYB A;  4IBK A;  4ITQ A;  1IQP A;  4HEO A;  4REZ A;  5DYG A;  4QNR A;  4RKU F;  2MR9 A;  3E9S A;  2RRU A;  3L2A A;  3TQS A;  3C3D A;  1NHG C;  2JY5 A;  4BB9 A;  4LRT A;  3FTF A;  3E46 A;  3HHY A;  3W68 A;  4FD2 A;  1PJJ A;  2X8A A;  4FWD A;  5IRE B;  2DWN A;  2V1U A;  3FTE A;  3GRY A;  2LVP C;  2H5X A;  1IXR C;  3EIH A;  4LY6 A;  5ITU A;  3NBX X;  3MHV C;  4QOZ C;  4LJA A;  2CHV A;  4AKH A;  1DO0 A;  1VEK A;  1T3T A;  2CRU A;  3GRU A;  1TGU A;  1LTM A;  1UFZ A;  3GPX A;  4DV5 M;  1A5T A;  3SAU A;  3HHW A;  1HNW M;  4GKJ M;  2CFO A;  2VDB B;  4ZPX A;  1NNJ A;  4LF4 M;  4HLQ A;  3IHP A;  4L15 A;  1Z6T A;  3IEC A;  4FCW A;  2DAM A;  3BXW A;  3KSJ A;  4KOD A;  1CUK A;  3SHF A;  2UUB M;  3OTO M;  1IN5 A;  5L8R F;  5ITX A;  1V92 A;  4MGK E;  2ZAM A;  4JI7 M;  4IJE A;  3VDU A;  4GRI A;  3J7B A;  2LTU A;  4DV7 M;  5JI2 E;  4M9S A;  2OQ4 A;  1XHB A;  2BWE A;  4AI6 A;  2JWS A;  1G59 A;  1JR3 E;  4B7H A;  3U6C A;  1DGF A;  2J7N A;  2K9D A;  4PCZ A;  4LF8 M;  4LGM A;  5IT9 S;  3AOE C;  5KO3 A;  4MGY E;  2DEN A;  3GPP A;  2DKL A;  5ITR A;  1VEG A;  3T1H M;  4QNM A;  4FWH A;  3VDP A;  2LHG A;  3SFZ A;  2LBC A;  3SAS A;  1QYR A;  1JB0 F;  1I4W A;  1HQY E;  4FW9 A;  4BBA A;  2K47 A;  4UN2 B;  4JI1 M;  1G4A E;  2CP8 A;  2C96 A;  4JXJ A;  4JI6 M;  3KOW E;  4D80 A;  1W5S A;  4RF0 A;  1OTR A;  1NY6 A;  4RF1 A;  4HL4 A;  2KEB A;  3L27 A;  4JI0 M;  4DBG B;  1T6O A;  3L28 A;  4OX9 M;  4LJ7 A;  3B7Z A;  2XF3 A;  1I94 M;  2HAK A;  5EP3 A;  4LFA M;  4MM3 B;  2Q2E B;  3FYC A;  4JYA M;  3RFW A;  5BR8 M;  3FRI A;  4ANR A;  4XGI A;  4L78 A;  3GQ4 A;  4DR7 M;  5FTJ A;  3HY5 A;  3IG8 A;  3H4M A;  2MH8 A;  4PD2 A;  2UXB M;  2R0I A;  3GLH B;  5EJC A;  1WGN A;  2JY7 A;  1PJQ A;  2CHG A;  2Y21 A;  3B89 A;  3T38 A;  3U6P A;  4GC5 A;  5FTK A;  4LF9 M;  1IN7 A;  2C99 A;  3HWS A;  4XBO A;  4I5S A;  1HJP A;  1NHW C;  1PRB A;  2FE8 A;  2LVA A;  3U6E A;  4LJ6 A;  3UJN A;  2HWJ A;  3GLH A;  2LVO C;  4BLC A;  4CIZ A;  4XK8 F;  2J7O A;  3GRR A;  1K3X A;  4B3T M;  2EUC A;  1ZMU A;  2F5N A;  1HT1 E;  2KZS A;  4II7 A;  2EA0 A;  2HCB A;  3THG A;  3U6Q A;  3HU1 A;  2O5R A;  3GLF E;  3C3E A;  1GVN A;  1HNX M;  1NV8 A;  2V1C A;  3HJQ A;  4KHP M;  4G4N A;  1QUT A;  2LHC A;  4JN6 A;  4AKG A;  4FCV A;  4AG5 A;  2VQE M;  4WUR A;  1QAQ A;  2QBY B;  3FUW A;  2AHM A;  3AKZ A;  2EKF A;  1TH3 A;  1OJL A;  1XXH E;  3V76 A;  5KQD A;  4B3S M;  1QZE A;  1DO2 A;  2CWB A;  2QEN A;  2R65 A;  3GPU A;  3B7N A;  5LMN M;  1D2N A;  1H6U A;  5C1B A;  2ZTD A;  1J5E M;  3E4R A;  1VDL A;  2O01 F;  2ZM6 M;  1GL6 A;  2RGH A;  2QBY A;  3AV0 A;  3TWL A;  1KSF X;  2N35 A;  2OOB A;  2Z8Y M;  1N36 M;  2MGW A;  3E21 A;  4IBJ A;  4CJ6 A;  2QNJ A;  3KDS E;  3M0E A;  5ITY A;  3AJI B;  2Z4S A;  1XNQ M;  1NV9 A;  2L4E A;  3CF6 E;  4PDG A;  1VDD A;  1IY0 A;  3VK8 A;  5F3W A;  3L25 A;  4I81 A;  2JY8 A;  1JR3 D;  5FSW A;  3GLI E;  3KFU G;  4IBE A;  1UM8 A;  4F2L A;  4AG6 A;  5EP1 A;  3SMP A;  3J81 S;  1G3I A;  2FNA A;  3HJ8 A;  3WHK A;  3GO8 A;  1FJG M;  5IZ7 D;  1EE8 A;  3R9X B;  2VF7 A;  2CEA A;  3BBZ A;  1Z5A A;  1VQ1 A;  1IY2 A;  4DV4 M;  2OO9 A;  5IWA M;  2R44 A;  4X64 M;  2KDL A;  4AZF A;  3U60 B;  2OPF A;  1E94 E;  3J7A S;  1MU5 A;  4B7F A;  4G6Z A;  4X62 M;  1AIP C;  2I7N A;  1PM5 A;  3FTC A;  1Q3C A;  2E5L M;  5JI3 E;  2O25 A;  2LVQ D;  2R4E A;  3K2L A;  5EP4 A;  4IJF A;  4CIS A;  2F5P A;  1GO5 A;  2NQ8 C;  1JR3 A;  3U60 A;  1ZV1 A;  3J2P B;  1TF0 B;  3LVW A;  4LF5 M;  2DAI A;  3SAR A;  3NWL A;  2BJV A;  2C98 A;  3U5Z B;  4NXM M;  5ITQ A;  4DV6 M;  4M0W A;  4LG2 A;  2DWL A;  2X49 A;  1SXJ C;  1WXQ A;  1DGH B;  3M6A A;  4LRS A;  3EIE A;  1KFV A;  4F1I A;  1GJS A;  1NO1 A;  1IM2 A;  4NC6 A;  4P16 A;  1TH4 A;  3A46 A;  2VQF M;  1T43 A;  3SYK A;  3VFD A;  2EO2 A;  3M7G A;  3GRV A;  3W67 A;  1NVM A;  3U5Z A;  4IBB A;  4JI3 M;  2JY6 B;  2DAG A;  1N75 A;  1DGH A;  4GIP A;  1WR1 B;  1K82 A;  1QDT A; 
#chains in the Genus database with same CATH homology
 2X4A A;  2P5T A;  4JI2 M;  3FUT A;  3AOE A;  3VLF B;  3PNY A;  2A5Y B;  3A42 A;  1OFH A;  8CAT A;  3UZU A;  5E6J A;  2YFQ A;  5FTL A;  1SXJ E;  4LJ8 A;  3KS4 A;  2KRU A;  4OVZ A;  1XMQ M;  4LZZ A;  4NRW A;  3CF2 A;  3B9P A;  4FVM A;  2UU9 M;  3FKE A;  3GLF B;  4JV5 M;  5FTN A;  2LWX A;  4S12 A;  3FYD A;  4D81 A;  3HHZ A;  3KOX E;  5IT9 S;  4G4O A;  1R6B X;  1TH2 A;  4KLN A;  4CGY B;  4TUW A;  3LMM A;  3IG5 A;  5EXX A;  4OW0 A;  1G8P A;  2HL7 A;  4LF6 M;  1XXH B;  3RGP A;  1NSF A;  3GLF A;  4GHA A;  1X37 A;  3DOA A;  3ZH9 B;  2XEP A;  5C18 A;  2L09 A;  4W5W A;  2XGN A;  4R3D A;  2XH9 A;  1GLN A;  2YNM D;  1XXH A;  5FLX S;  3ZCB B;  2XSZ D;  1QVR A;  2G8L A;  2QZ4 A;  4MH0 E;  5DNY A;  4DR5 M;  1L1Z A;  4L4U A;  1R2Z A;  5BPV A;  2DHR A;  4R7G A;  4YHH M;  2HKJ A;  3NBI A;  4DR3 M;  1S3S A;  4LZJ A;  5A2Q S;  3GLI B;  3UMM A;  3U6O A;  3A98 B;  3KP1 E;  3KVW A;  4LGY A;  1QAO A;  3GP1 A;  1TDZ A;  5EQT A;  3TWK A;  4NOO B;  4LCB A;  5EXS A;  3DA1 A;  3R8F A;  3ZC7 B;  3QWL A;  3J27 B;  3GLI A;  2LXE A;  1K3W A;  2R46 A;  4M9Z A;  3DZD A;  4IBC A;  2FFJ A;  2HHH M;  2XSZ A;  4LJ9 A;  3U6M A;  2QCU A;  2KZU A;  1GKI A;  3T15 A;  3KW6 A;  3SAT A;  4DV0 M;  4EIW A;  2QPA A;  3SBJ A;  3HKP A;  1ORY B;  3AFH A;  4MGI E;  1IN4 A;  2KRK A;  3KOZ E;  5H37 D;  3UGJ A;  3KSX A;  1N33 M;  2XFT A;  1HNZ M;  7CAT A;  1QZM A;  1XNR M;  4NL4 H;  4Z6Y A;  4DR2 M;  2DWM A;  4M0D A;  2DZO B;  2UUC M;  2RKO A;  2ZAN A;  1JQJ C;  1SXJ D;  3J80 S;  1E9S A;  1NJG A;  1DGB A;  1GL7 A;  1HQC A;  3PVS A;  1G41 A;  4CHT B;  3KOY E;  2DZN B;  5KPT A;  2DXI A;  3UK6 A;  5GKN A;  1E9R A;  4K0K M;  4YY3 M;  4JI5 M;  3WHL A;  2XLJ A;  1HR0 M;  1IN6 A;  3JAM S;  4OU7 A;  3PXG A;  4G4R A;  3FUX A;  2R62 A;  1SXJ B;  5KPZ A;  3I4Y A;  1ZAE A;  2KXE A;  3K1J A;  4X66 M;  3SAV A;  4IBF A;  1N78 A;  3GLG B;  3FUV A;  3K92 A;  1TDH A;  4NSO B;  2Y0T A;  3A45 A;  3VKH A;  1LV7 A;  3D8L A;  1SXJ A;  1J09 A;  2D7G A;  3GLG A;  4X65 M;  2F5S A;  4D82 A;  3RGS A;  1IBL M;  4GIT A;  2YR0 A;  3AOG A;  4NXN M;  4MB7 A;  4LF7 M;  2F5O A;  2D7E A;  3U61 B;  4DUZ M;  4DV1 M;  3TL4 X;  2L7I A;  2H1R A;  4DV2 M;  3MJ5 A;  5KPR A;  3SYL A;  4LFC M;  2LH0 A;  3VK7 A;  1DGG A;  3U61 A;  3GQ5 A;  4B7G A;  2FOI C;  1YUB A;  2YQZ A;  4B08 A;  3I4V A;  1NJF A;  4GKK M;  3TWM A;  3CF0 A;  2G5G X;  3D8B A;  4LJ5 A;  5EXP A;  2C5R A;  5EXT A;  2CHQ A;  4B3R M;  2DVW B;  3HHX A;  4M9X A;  4DUY M;  4QHS A;  2ZAO A;  1L8Q A;  1R7R A;  1YE9 A;  2CV1 A;  3LVV A;  2LNH C;  4JI4 M;  2BJW A;  4GMQ A;  4RNA A;  3GQ3 A;  1L2B A;  3PNV A;  3C58 A;  1N32 M;  2R45 A;  4PDI A;  4NRV A;  1IBK M;  1MX0 A;  4IIW A;  1NNU C;  1NY5 A;  1IXZ A;  4A3V B;  3HJS A;  3GPY A;  4GHL A;  2RGO A;  1QAN A;  4KO8 A;  2KA6 B;  4LFB M;  2CE7 A;  3FTD A;  4NSR A;  3U6L A;  2XZU A;  4AQY M;  3SAW A;  3KS8 A;  5E26 A;  1OFI A;  2C9O A;  5ITX E;  3HGI A;  3U6S A;  5ITT A;  2ERC A;  5FTM A;  4G4Q A;  2JA2 A;  2CV2 A;  2Y0Q A;  4IBD A;  3PFI A;  2XFS A;  2DWZ B;  3U6D A;  3ILK A;  3QAU A;  2F4V M;  3FD9 A;  4MGZ E;  2XZF A;  3HU2 A;  3TPZ A;  4IBG A;  1W5T A;  3SHG B;  4IBI A;  1N34 M;  5LMU M;  1IXS B;  1XWI A;  3VKG A;  3L29 A;  3MK6 A;  1R2Y A;  2L7H A;  1C1K A;  2VII A;  2UUA M;  3RE8 A;  3SMS A;  2UXD M;  4PT5 A;  1HT2 E;  2ZBK B;  3DFZ A;  1E32 A;  2Z3X A;  1IN8 A;  1Z5B A;  2R18 A;  2Z4R A;  3LQQ A;  2L6O A;  1Q3B A;  2Y20 A;  1Q39 A;  1IBM M;  2Z7J A;  1FNN A;  2UXC M;  4I4L A;  1PJI A;  4AKI A;  3AL0 C;  3L26 A;  3T1Y M;  2R4J A;  2C9C A;  5EP2 A;  4L16 A;  4FCT A;  3SC3 A;  1L2D A;  2CV0 A;  4LJ4 A;  1L1T A;  1QAM A;  1XC8 A;  1L2C A;  3JR5 A;  3JR4 A;  2M5Z A;  1N77 A;  1QQW A;  1ZQ9 A;  3KP0 E;  5DYI A;  1J7K A;  3BOS A;  4L8R C;  4MGH A;  2CUZ A;  3I51 A;  2QP9 X;  4FWG A;  3TE6 A;  2W82 A;  3LQR A;  4DV3 M;  2I7P A;  2KW0 A;  5KQ8 A;  3FUU A;  4GC9 A;  4QHT A;  4DR4 M;  1KYI A;  3Q8X A;  4WW0 A;  3W0F A;  4AW4 A;  2D7H A;  3W0L B;  3K8Z A;  3HU3 A;  1XMO M;  4QOS A;  1YSY A;  2M60 A;  4JI8 M;  1IY1 A;  4Z8X A;  1Z5C A;  4I8O A;  2V6Z M;  4DR1 M;  2F5Q A;  4B3M M;  1Z59 A;  4GH9 A;  4DR6 M;  3CTW B;  3KXE C;  2BNK A;  4IBK A;  4ITQ A;  1IQP A;  4REZ A;  5DYG A;  4QNR A;  3TQS A;  3E9S A;  3L2A A;  1NHG C;  4BB9 A;  4LRT A;  3FTF A;  3HHY A;  4FD2 A;  1PJJ A;  2X8A A;  4FWD A;  5IRE B;  2DWN A;  2V1U A;  3FTE A;  3GRY A;  1IXR C;  3EIH A;  4LY6 A;  5ITU A;  4QOZ C;  3MHV C;  4LJA A;  2CHV A;  4AKH A;  1DO0 A;  1T3T A;  3GRU A;  1TGU A;  3GPX A;  4DV5 M;  3SAU A;  3HHW A;  1HNW M;  4GKJ M;  2CFO A;  1NNJ A;  4ZPX A;  4LF4 M;  4HLQ A;  4L15 A;  1Z6T A;  4FCW A;  4KOD A;  3KSJ A;  3SHF A;  2UUB M;  1XNQ M;  3OTO M;  1IN5 A;  5ITX A;  4MGK E;  4JI7 M;  2ZAM A;  4IJE A;  3VDU A;  4GRI A;  3J7B A;  4DV7 M;  5JI2 E;  4M9S A;  2OQ4 A;  1XHB A;  4AI6 A;  1G59 A;  4B7H A;  3U6C A;  1DGF A;  2J7N A;  4PCZ A;  4LF8 M;  4LGM A;  3AOE C;  5KO3 A;  4MGY E;  3GPP A;  5ITR A;  3T1H M;  4QNM A;  4FWH A;  3VDP A;  3SFZ A;  3SAS A;  1QYR A;  1I4W A;  4FW9 A;  1HQY E;  4BBA A;  2K47 A;  4JI1 M;  1G4A E;  2C96 A;  4JXJ A;  4JI6 M;  3KOW E;  4D80 A;  1W5S A;  4RF0 A;  1NY6 A;  4RF1 A;  4HL4 A;  2KEB A;  3L27 A;  4JI0 M;  3L28 A;  4OX9 M;  4LJ7 A;  2XF3 A;  1I94 M;  5EP3 A;  4LFA M;  4MM3 B;  2Q2E B;  3FYC A;  4JYA M;  3RFW A;  5BR8 M;  4XGI A;  4L78 A;  3GQ4 A;  4DR7 M;  5FTJ A;  3IG8 A;  3H4M A;  4PD2 A;  2UXB M;  3GLH B;  5EJC A;  2CHG A;  2Y21 A;  3T38 A;  3U6P A;  4GC5 A;  5FTK A;  4LF9 M;  1IN7 A;  2C99 A;  3HWS A;  4XBO A;  4I5S A;  1NHW C;  2FE8 A;  3U6E A;  4LJ6 A;  3UJN A;  3GLH A;  4BLC A;  2J7O A;  3GRR A;  1K3X A;  4B3T M;  2EUC A;  2F5N A;  1HT1 E;  2KZS A;  4II7 A;  2EA0 A;  2HCB A;  3THG A;  3U6Q A;  3HU1 A;  2O5R A;  1GVN A;  1HNX M;  2V1C A;  3HJQ A;  4KHP M;  4G4N A;  4JN6 A;  4AKG A;  4FCV A;  4AG5 A;  2VQE M;  4WUR A;  1QAQ A;  2QBY B;  3FUW A;  2AHM A;  3AKZ A;  1TH3 A;  1OJL A;  5KQD A;  4B3S M;  2QEN A;  1DO2 A;  2R65 A;  3GPU A;  5LMN M;  1D2N A;  1H6U A;  5C1B A;  1J5E M;  3E4R A;  2ZM6 M;  2QBY A;  1GL6 A;  2RGH A;  3AV0 A;  3TWL A;  1KSF X;  1N36 M;  4IBJ A;  3KDS E;  3M0E A;  5ITY A;  3AJI B;  2Z4S A;  3CF6 E;  4PDG A;  1VDD A;  1IY0 A;  3VK8 A;  5F3W A;  3L25 A;  4I81 A;  1JR3 D;  5FSW A;  3KFU G;  4IBE A;  1UM8 A;  4AG6 A;  5EP1 A;  3SMP A;  3J81 S;  1G3I A;  2FNA A;  3HJ8 A;  3WHK A;  3GO8 A;  1FJG M;  5IZ7 D;  1EE8 A;  3R9X B;  2CEA A;  1Z5A A;  1IY2 A;  4DV4 M;  5IWA M;  4X64 M;  4AZF A;  3U60 B;  2OPF A;  1E94 E;  3J7A S;  1MU5 A;  4B7F A;  4G6Z A;  4X62 M;  2I7N A;  1PM5 A;  3FTC A;  1Q3C A;  2E5L M;  5JI3 E;  2R4E A;  3K2L A;  5EP4 A;  4IJF A;  4CIS A;  2F5P A;  2NQ8 C;  1JR3 A;  3U60 A;  3J2P B;  3LVW A;  4LF5 M;  3SAR A;  3NWL A;  2BJV A;  2C98 A;  3U5Z B;  4NXM M;  5ITQ A;  4DV6 M;  4M0W A;  4LG2 A;  2DWL A;  2X49 A;  1SXJ C;  1WXQ A;  1DGH B;  3M6A A;  4LRS A;  3EIE A;  1KFV A;  4P16 A;  1IM2 A;  1TH4 A;  3A46 A;  2VQF M;  3SYK A;  3VFD A;  2EO2 A;  3M7G A;  3GRV A;  3U5Z A;  1NVM A;  4IBB A;  4JI3 M;  1N75 A;  1DGH A;  4GIP A;  4OVZ B;  1K82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...