2L09A

Solution nmr structure of protein asr4154 from nostoc sp. pcc7120 northeast structural genomics consortium target id nsr143
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MNLRWTSEAKTKLKNIPFFARSQAKARIEQLARQAEQDIVTPELVEQARLEFGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of asr4154 from Nostoc sp. PCC7120 Northeast Structural Genomics target ID Nsr143
rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords Asr4154 protein
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08369 PCP_red Proto-chlorophyllide reductase 57 kD subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.550 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l09A01
2KRUA 2YNMD 2L09A
chains in the Genus database with same CATH superfamily
3U6LA 2DHYA 1HQCA 3CTWB 4OVZB 2Z4SA 1QDRA 2D7GA 2RRUA 3BXWA 3PVSA 3LCVB 1R5LA 4MH0E 1IY1A 4YY3M 1N34M 1NNJA 2WSEF 2Y21A 3CF0A 3CF2A 4NRVA 2R4EA 2KZUA 3JR5A 1PRBA 2X49A 3SAWA 2VF8A 1KYIA 1OIPA 1PGYA 4LY6A 3AOGA 3R9XB 2UXCM 2HAKA 4HL4A 1XMOM 1TF0B 4B3SM 4PCZA 4HEOA 4I8OA 2O25A 2KNZA 2XFSA 4II7A 3K92A 4DV3M 1AUAA 4L78A 5KPTA 4DV5M 2X8AA 3KS8A 1HNXM 2C5RA 2WSCF 1NY5A 1WIVA 2CV0A 4LJAA 3GRVA 1E32A 4D80A 3R8FA 3AOEA 4GRIA 3DZDA 1MU5A 4XGIA 1PJTA 5DYIA 2G8LA 2O01F 5ITUA 3Q8XA 2R0IA 4BBAA 1J5EM 3HJ8A 3K9PA 2EO2A 1GJTA 4A3VB 3B9PA 4JI4M 1LTMA 2LVAA 3HHWA 5EP2A 1IBKM 4GKJM 1QUTA 4DR5M 3LQQA 4B7GA 3KVWA 3UMMA 4M0WA 3A45A 4OW0A 2E5LM 1GKIA 4MB7A 1QVRA 1X37A 2J5YA 4AI6A 3RE8A 4CJ6A 2UXDM 2UU9M 2M5ZA 3SAVA 3OTOM 4NL4H 2UUCM 4JI3M 1WGLA 3J80S 4PT5A 3HGIA 4I4LA 4IBKA 2R62A 3FUUA 5DFLA 2JXNA 1TDZA 4GHLA 3KOWE 4GH9A 1ZAEA 3EIHA 1HR0M 2L09A 3FTFA 4G4NA 5IWAM 2CV1A 3VFDA 4GHAA 3UGJA 2JY7A 5C18A 3GPUA 3B89A 1Z5CA 1IN8A 3SAUA 2XF3A 2YR0A 4QNMA 4B08A 1D2NA 3MMPA 3KP0E 4KLNA 4LGMA 3GRYA 5E26A 2F5NA 3QYBA 1G59A 4IBJA 3T6PA 2OOBA 1R7RA 1XXHB 2V6ZM 4GIPA 3SASA 2EA0A 3PXGA 3JR4A 2L7HA 3HY5A 4X65M 5FTJA 5A2QS 3GLIE 3PNVA 1SXJB 2DKLA 3L29A 3T15A 5DNYA 3HWSA 1NSFA 2K9DA 3KW6A 4GEWA 3GLIB 2QPAA 4QHSA 1N75A 3CF6E 4WW0A 1UFZA 2Z3XA 5JI3E 3VKGA 1KFVA 4LJ9A 3W0FA 3KOYE 4NXNM 3GLIA 1DGHB 1NO1A 4BB9A 3M7GA 3U60A 2C96A 5C1BA 5KO3A 1QANA 1XXHA 4DV4M 2EKKA 4LJ8A 3L27A 3J7AS 2MGWA 2ZTDA 5ITYA 3GLHE 3FRHA 1XB2B 2DNAA 2APLA 4MGHA 2JA2A 3J2PB 1VQ1A 2I7PA 1PJSA 2QCUA 2V1CA 3E9SA 3PNYA 3U6OA 4LGYA 1R6BX 1WJ7A 4DV2M 2GQFA 4IBCA 3V76A 4IBFA 1QAMA 1GO5A 4DR7M 1PJIA 1E9SA 5F3WA 3SATA 4L15A 4OX9M 2I7NA 3KOZE 4GC9A 3SMPA 1GLNA 4TUWA 3J7BA 4FWDA 5FTMA 1R2ZA 2LWXA 1EFUB 4LF6M 1N33M 1JQJC 2CV2A 4GMQA 3U6SA 4B3MM 3TWMA 4IIWA 1D0LA 1UM8A 3SMSA 3GPXA 1VG5A 2KW0A 4R3DA 1HNWM 1IN7A 3J81S 3KXEC 2K6BA 2R4JA 3B74A 1OTRA 4DR1M 4JI5M 2DVWB 1FNNA 3GPPA 4FWGA 2MR9A 1E94E 3E4RA 4EIWA 2XLJA 3VK7A 4JXJA 1FJGM 4Z6YA 1IQPA 5KQDA 1JR3E 2CEAA 3B7QA 3L25A 4LF9M 2DWLA 1L8QA 4ITQA 2JWSA 3W68A 2VF7A 1OAIA 2KDLA 2FH0A 3GLFB 5EXTA 3L28A 2R45A 4IBIA 1DV0A 2V1UA 4L16A 2ERCA 3FUXA 1IXZA 5EP1A 4NOOB 3C9PA 3UJNA 4DBGB 2F5OA 1IN5A 3UZUA 2EJSA 3T38A 1HT1E 2CRUA 4LF5M 3KDSE 7CATA 2VQFM 4FW9A 1DO2A 3K1JA 1VEGA 4FVMA 5FSWA 1KSFX 1YSYA 2KXEA 3QYEA 4FWHA 4I81A 5FLXS 4G4OA 3K9OA 5E6JA 1EE8A 2W82A 3H4MA 1A5TA 3GLFA 1XMQM 2XFTA 1T6OA 4G4RA 1DGGA 4DUZM 3U5ZB 2QZ4A 1R2YA 3MJ5A 2LXEA 1C7YA 2JNHA 2NQ8C 4MM3B 4LZZA 4IBBA 1IBLM 1QZEA 2B3TA 2XH9A 2Y0QA 2BWEA 3GQ4A 4GITA 4DV6M 1G8PA 2ZANA 2FE8A 3I01M 2HCBA 2OOAA 5IZ7D 3TL4X 4AG6A 2DZNB 1JR3D 4M9SA 3MHVC 1OAOC 1V92A 1IXSA 3I04M 3T1HM 4DR4M 4DR2M 5GKNA 4M9ZA 1SXJD 2CP8A 1NHWC 1Z59A 5LMUM 1NV8A 3M6AA 1C1KA 4XBOA 3FRIA 3QAUA 4LJ4A 1DGHA 3FTCA 4LCBA 3U60B 1HNZM 3RGSA 3AL0C 2ZBKB 4JI1M 2F5QA 3TWKA 1ZMWA 4WP2A 2VQEM 1TH3A 2CHGA 2J7OA 3GPYA 1SXJA 2JUJA 1IY0A 3IHPA 4JV5M 2J7NA 1L2CA 3E21A 2CFOA 2MROB 3HJSA 3GO8A 2BJWA 4KT0F 1TDHA 2FFJA 1N77A 3ILKA 4LG2A 2HKJA 2ZAOA 1ZQ9A 2K0BX 3HHXA 1CUKA 4CHTB 4L4UA 4FCTA 4MGYE 4CIZA 4LFBM 3J27B 3MK6A 3GLGE 3HU1A 5DYGA 1I94M 4L8RC 3AJIB 2JY8A 3KSJA 1QQWA 4LRTA 3KOXE 4AZFA 4LFCM 1NJFA 1NVMA 3Q8GA 1TH4A 3FTDA 3GLHB 2LVOC 2R44A 3FKEA 4FD2A 2EKFA 1XNRM 2C9CA 4Y28F 3HHYA 1WHCA 1WR1B 3U61B 1QZMA 2R6FA 3U6CA 1R4GA 4NRWA 2KRKA 2P5TA 2XSZD 2C99A 1YE9A 2DAMA 1WXQA 2L6OA 5KQ8A 1T3TA 2Z8YM 2H1RA 1IXSB 2XGNA 3K2LA 4Z8XA 1IXRC 1QAOA 1K3XA 4RKUF 2LBCA 1D0MA 1OFIA 1MJGM 2QP9X 3FYCA 1J09A 3BBZA 2ZM6M 3BOSA 1L2DA 1N32M 1F4IA 5H37D 1QUSA 1XXHE 2KNVA 5KPRA 1V34A 2Z7JA 2XZFA 4LRSA 4B7HA 2CHQA 1P3QQ 1NHGC 5EP4A 5BPVA 3DFZA 2WSFF 3KFUG 3AFHA 2FS1A 4RF1A 3VLFB 3U6EA 3ZQJA 1OJLA 3U5ZA 3TWLA 4AKGA 3CGWA 1V33A 1I4WA 4QHTA 1GL6A 2WZJA 3ZC7B 3ZCBB 4JI6M 5EP3A 1E9RA 3FUTA 3PFIA 2HHHM 3TPZA 4ZPXA 4MGZE 2H5XA 2FOIC 5FTKA 1AIPC 2JY5A 1TTEA 2FNAA 1YUBA 4REZA 3ZH9B 2QSFX 4LFAM 2R18A 2JP7A 3LMMA 4OVZA 1NNUC 2EUCA 2VDBB 2DHRA 3A42A 3NWLA 4LZJA 2RKOA 1VEKA 3LQRA 3LVWA 2BJVA 3KSXA 2JZ1A 5EXPA 1PJQA 1SG9A 3IG5A 2QNJA 4PDIA 2LVNC 4K0KM 1W5SA 2LTUA 2DZLA 3U6PA 2LHCA 1L1TA 5ITRA 4NC6A 1TR8A 2YNMD 1S3SA 3FUWA 3A46A 2Y0TA 5EQTA 1T43A 3AOEC 1Z5AA 3FE3A 2DWMA 1TGUA 3DA1A 1GABA 3IECA 4IBDA 1J7KA 3GLFE 4B3RM 2JY6B 1Q02A 4P16A 5LMNM 1MN3A 2K47A 4NSOB 4PD2A 2L7IA 1G41A 2L2DA 1Q39A 4R71A 2C9OA 3SFZA 3L26A 4I5SA 1VEJA 4AKHA 2QHOB 4Q7JA 5KPZA 2O5RA 4JI7M 2R46A 2LHGA 4QOSA 4F2LA 2UUBM 1EIJA 2DAIA 3SARA 2L4FA 2C98A 3FYDA 3B7NA 3LVVA 1Y8GA 1Z5BA 4M0DA 3UK6A 2KA6B 4FCWA 4W5WA 1XC8A 2BWBA 2F5SA 3HHZA 4DV7M 1OFHA 2N35A 3VKHA 2D7HA 1K3WA 3GLGB 2KNAA 2VIIA 4JI2M 1ZMUA 1VDDA 2Q2EB 3HZJA 3W67A 4S12A 5ITTA 3DOAA 3WHLA 4LF7M 3M0EA 4MGIE 1GL7A 4G3OA 4LJ5A 1IY2A 2KZSA 3SC3A 4LF4M 3C3EA 3H4JA 2X4AA 5EXSA 2DZOB 4UN2B 4X64M 2OPFA 3EIEA 1HJPA 1ZV1A 2HL7A 2UUAM 1SXJC 3NBIA 4IBGA 4NSRA 4BLCA 4AG5A 2DAEA 1G71A 5EXXA 1GJSA 5IT9S 2KHHA 4FCVA 3SHFA 2UXBM 1OQYA 3D8BA 2DXIA 3HJQA 4RF0A 1H6UA 3KS4A 3THGA 5BR8M 3U6DA 3TE6A 3GQ3A 4AQYM 1VDLA 3AV0A 3IG8A 2DI0A 2ZAMA 3GRRA 4JN6A 2BNKA 1TH2A 4IJEA 4LJ6A 3HX3A 4D81A 2QBYB 2R65A 2DAGA 1ZMVA 2LH0A 1DGFA 1G3IA 1WGNA 4JYAM 1ORYB 2LVPC 2F5PA 3NBXX 1PJJA 4ANRA 3A98B 4LF8M 2JZ0A 2LNHC 4F1IA 3W0LB 3GP1A 2D7EA 5FTNA 3LW5F 3E46A 1Q3CA 4OU7A 4JI0M 2DENA 2MJ5B 5L8RF 4DR3M 4GKKM 1MX0A 3B7ZA 2XEPA 1BVSA 1XWIA 1JR3A 3SBJA 3U6MA 2OQ4A 3SHGB 4P17A 1JB0F 1HT2E 4IBEA 5EJCA 4PDGA 5JI2E 2XZUA 1XNQM 2CHVA 3L2AA 4MGKE 3GRUA 4KODA 4M9XA 2L4EA 3C3DA 4XK8F 3I51A 3T1YM 2XSZA 3VK8A 3U61A 5ITXA 2M60A 3RFWA 2LVQD 4GC5A 4AW4A 3GLHA 1LV7A 2G5GX 2A5YB 4DV0M 1L1ZA 3D8LA 1IM2A 4RNAA 3FTEA 3SYKA 4YHHM 1SXJE 4CISA 3SYLA 4G4QA 2DWNA 3KP1E 2Z4RA 3HU3A 8CATA 4CGYB 1NV9A 4D82A 3FUVA 4X62M 4KHPM 1OKSA 4DV1M 1Z6TA 4B7FA 2AHMA 3AKZA 2QBYA 1IN4A 1DGBA 2F4VM 1YLAA 3GQ5A 5FTLA 4WURA 2MH8A 2OO9A 1DO0A 4IJFA 4DUYM 1IBMM 3HU2A 1HQYE 5IREB 3RGPA 1PM5A 5ITQA 3C58A 1W5TA 3QWLA 1IFYA 1GVNA 3HKPA 4G6ZA 1NY6A 2Y20A 2CUZA 3VDUA 1K82A 1OIZA 3WHKA 1IN6A 2YQZA 3JAMS 4JI8M 3GLGA 2CWBA 4DR6M 2RGHA 2CE7A 4QNRA 3U6QA 1N36M 3LCUA 1Q3BA 3I4VA 4QOZC 1NJGA 4KO8A 3VDPA 1RU3A 2KRUA 2DAKA 2KEBA 2YFQA 3F92A 3FD9A 4X66M 3I4YA 1XHBA 5ITXE 3TQSA 1QAQA 2RGOA 2DWZB 4NXMM 4R7GA 2GNOA 1QYRA 4AKIA 1G4AE 1N78A 4B3TM 2QENA 1QDTA 2G3QA 1D0KA 2QQ8A 3K8ZA 4LJ7A 1L2BA 4HLQA 4L6V6 2ZTCA 2HWJA
chains in the Genus database with same CATH topology
3U6LA 1HQCA 3CTWB 4OVZB 2Z4SA 3PVSA 2D7GA 4YY3M 4MH0E 1N34M 1IY1A 1NNJA 3CF0A 2Y21A 3CF2A 4NRVA 2R4EA 2KZUA 3JR5A 2X49A 3SAWA 1KYIA 3R9XB 4LY6A 3AOGA 2UXCM 4HL4A 1XMOM 4B3SM 4PCZA 4I8OA 4II7A 2XFSA 3K92A 4DV3M 4L78A 5KPTA 4DV5M 2X8AA 3KS8A 1HNXM 2C5RA 1NY5A 2CV0A 4LJAA 3GRVA 1E32A 4D80A 3R8FA 3AOEA 4GRIA 3DZDA 1MU5A 4XGIA 5DYIA 2G8LA 5ITUA 3Q8XA 4BBAA 1J5EM 3HJ8A 2EO2A 4A3VB 3B9PA 4JI4M 5EP2A 3HHWA 4GKJM 1IBKM 4DR5M 3LQQA 4B7GA 3KVWA 3UMMA 4M0WA 3A45A 4OW0A 2E5LM 1GKIA 4MB7A 1QVRA 1X37A 4AI6A 3RE8A 2UXDM 2UU9M 2M5ZA 3SAVA 3OTOM 4NL4H 2UUCM 4JI3M 3J80S 4PT5A 3HGIA 4I4LA 4IBKA 2R62A 3FUUA 1TDZA 4GHLA 3KOWE 4GH9A 1ZAEA 3EIHA 1HR0M 2L09A 3FTFA 4G4NA 5IWAM 2CV1A 3VFDA 4GHAA 3UGJA 5C18A 3GPUA 1Z5CA 1IN8A 3SAUA 2XF3A 2YR0A 4QNMA 4B08A 1D2NA 4KLNA 3KP0E 4LGMA 3GRYA 5E26A 2F5NA 1G59A 4IBJA 1R7RA 1XXHB 2V6ZM 4GIPA 3SASA 2EA0A 3PXGA 3JR4A 2L7HA 4X65M 5A2QS 5FTJA 1N36M 3PNVA 1SXJB 3T15A 3L29A 5DNYA 3HWSA 1NSFA 3KW6A 3GLIB 2QPAA 4QHSA 1N75A 3CF6E 4WW0A 3VKGA 2Z3XA 5JI3E 1KFVA 4LJ9A 3W0FA 3KOYE 4NXNM 3GLIA 1DGHB 4BB9A 3U60A 3M7GA 2C96A 5C1BA 5KO3A 1QANA 1XXHA 4DV4M 4LJ8A 3L27A 3J7AS 5ITYA 4MGHA 2JA2A 3J2PB 2I7PA 2QCUA 2V1CA 3E9SA 3PNYA 3U6OA 4LGYA 1R6BX 4DV2M 4IBCA 4IBFA 1QAMA 4DR7M 1PJIA 1E9SA 5F3WA 3SATA 4L15A 4OX9M 2I7NA 3KOZE 4GC9A 3SMPA 1GLNA 4TUWA 4FWDA 3J7BA 5FTMA 1R2ZA 2LWXA 4LF6M 1N33M 1JQJC 2CV2A 4GMQA 3U6SA 4B3MM 3TWMA 4IIWA 1UM8A 3SMSA 3GPXA 2KW0A 4R3DA 1HNWM 1IN7A 3J81S 3KXEC 2R4JA 4DR1M 4JI5M 2DVWB 1FNNA 3GPPA 4FWGA 3E4RA 1E94E 4EIWA 2XLJA 3VK7A 4JXJA 1FJGM 4Z6YA 1IQPA 5KQDA 2CEAA 3L25A 4LF9M 2DWLA 1L8QA 4ITQA 3GLFB 5EXTA 3L28A 2R45A 4IBIA 2V1UA 4L16A 2ERCA 3FUXA 1IXZA 5EP1A 4NOOB 3UJNA 2F5OA 1IN5A 3UZUA 3T38A 1HT1E 4LF5M 3KDSE 7CATA 2VQFM 4FW9A 1DO2A 3K1JA 4FVMA 5FSWA 5FLXS 1KSFX 1YSYA 2KXEA 4FWHA 4G4OA 4I81A 5E6JA 1EE8A 2W82A 3H4MA 3GLFA 1XMQM 2XFTA 4G4RA 1DGGA 4DUZM 3U5ZB 2QZ4A 1R2YA 3MJ5A 2LXEA 2NQ8C 4MM3B 4LZZA 4IBBA 1IBLM 2XH9A 2Y0QA 3GQ4A 4GITA 4DV6M 1G8PA 2ZANA 2FE8A 5IZ7D 2HCBA 3TL4X 4AG6A 2DZNB 1JR3D 4M9SA 3MHVC 3T1HM 4DR4M 4DR2M 5GKNA 4M9ZA 1SXJD 1NHWC 1Z59A 5LMUM 3M6AA 1C1KA 4XBOA 3QAUA 4LJ4A 1DGHA 3FTCA 4LCBA 3U60B 1HNZM 3RGSA 3AL0C 2ZBKB 4JI1M 2F5QA 3TWKA 2VQEM 1TH3A 2CHGA 2J7OA 3GPYA 1SXJA 1IY0A 4JV5M 2J7NA 1L2CA 2CFOA 3HJSA 3GO8A 2BJWA 1TDHA 2FFJA 1N77A 3ILKA 4LG2A 2HKJA 2ZAOA 1ZQ9A 3HHXA 4CHTB 4L4UA 4FCTA 4MGYE 4LFBM 3J27B 3MK6A 3HU1A 5DYGA 1I94M 4L8RC 3AJIB 3KSJA 4LRTA 1QQWA 3KOXE 4AZFA 4LFCM 1NJFA 1NVMA 1TH4A 3FTDA 3GLHB 3FKEA 4FD2A 1XNRM 2C9CA 3HHYA 3U61B 1QZMA 3U6CA 4NRWA 2KRKA 2P5TA 2XSZD 2C99A 1YE9A 2L6OA 1WXQA 5KQ8A 1T3TA 2H1RA 1IXSB 2XGNA 3K2LA 4Z8XA 1IXRC 1QAOA 1K3XA 1OFIA 2QP9X 3FYCA 1J09A 2ZM6M 3BOSA 1L2DA 1N32M 5H37D 5KPRA 2Z7JA 2XZFA 4LRSA 4B7HA 2CHQA 5EP4A 1NHGC 5BPVA 3DFZA 3KFUG 3AFHA 4RF1A 3VLFB 3U6EA 3U5ZA 1OJLA 4AKGA 3TWLA 1I4WA 4QHTA 1GL6A 3ZC7B 3ZCBB 4JI6M 5EP3A 1E9RA 3FUTA 3PFIA 2HHHM 3TPZA 4ZPXA 4MGZE 2FOIC 5FTKA 2FNAA 1YUBA 4REZA 3ZH9B 4LFAM 2R18A 3LMMA 4OVZA 1NNUC 2EUCA 2DHRA 3A42A 3NWLA 4LZJA 2RKOA 3LQRA 3LVWA 2BJVA 3KSXA 5EXPA 3IG5A 4PDIA 4K0KM 1W5SA 3U6PA 1L1TA 5ITRA 2YNMD 1S3SA 3FUWA 3A46A 2Y0TA 5EQTA 3AOEC 1Z5AA 2DWMA 1TGUA 3DA1A 4IBDA 1J7KA 4B3RM 4P16A 5LMNM 2K47A 4NSOB 4PD2A 2L7IA 1G41A 1Q39A 2C9OA 3SFZA 3L26A 4I5SA 4AKHA 5KPZA 2O5RA 4JI7M 2R46A 4QOSA 2UUBM 3SARA 2C98A 3FYDA 3LVVA 1Z5BA 4M0DA 3UK6A 2KA6B 4FCWA 4W5WA 1XC8A 2F5SA 3HHZA 4DV7M 1OFHA 3VKHA 2D7HA 1K3WA 3GLGB 2VIIA 4JI2M 1VDDA 2Q2EB 4S12A 5ITTA 3DOAA 3WHLA 4LF7M 3M0EA 4MGIE 1GL7A 4LJ5A 1IY2A 2KZSA 3SC3A 4LF4M 2X4AA 5EXSA 2DZOB 4X64M 2OPFA 3EIEA 2HL7A 2UUAM 1SXJC 3NBIA 4IBGA 4NSRA 4BLCA 4AG5A 5EXXA 5IT9S 4FCVA 3SHFA 2UXBM 3D8BA 2DXIA 3HJQA 4RF0A 1H6UA 3KS4A 3THGA 5BR8M 3U6DA 3TE6A 3GQ3A 4AQYM 3AV0A 3IG8A 2ZAMA 3GRRA 4JN6A 2BNKA 1TH2A 4IJEA 4LJ6A 4D81A 2QBYB 2R65A 2LH0A 1DGFA 1G3IA 4JYAM 1ORYB 2F5PA 1PJJA 3A98B 4LF8M 2LNHC 3GP1A 3W0LB 2D7EA 5FTNA 1Q3CA 4OU7A 4JI0M 4DR3M 4GKKM 1MX0A 2XEPA 1XWIA 1JR3A 3SBJA 3U6MA 2OQ4A 3SHGB 1HT2E 4IBEA 5EJCA 5JI2E 4PDGA 1XNQM 2XZUA 2CHVA 3L2AA 4MGKE 3GRUA 4KODA 4M9XA 3I51A 3T1YM 2XSZA 3VK8A 3U61A 5ITXA 2M60A 3RFWA 4GC5A 4AW4A 3GLHA 1LV7A 2G5GX 2A5YB 4DV0M 1L1ZA 3D8LA 1IM2A 4RNAA 3FTEA 3SYKA 4YHHM 4CISA 3SYLA 4G4QA 2DWNA 3KP1E 2Z4RA 3HU3A 8CATA 4CGYB 4D82A 3FUVA 4X62M 4KHPM 4DV1M 1Z6TA 4B7FA 2AHMA 3AKZA 2QBYA 1IN4A 1DGBA 2F4VM 3GQ5A 5FTLA 4WURA 1DO0A 4IJFA 4DUYM 1IBMM 3HU2A 1HQYE 5IREB 3RGPA 1PM5A 5ITQA 3C58A 1W5TA 3QWLA 1GVNA 3HKPA 4G6ZA 1NY6A 2Y20A 2CUZA 3VDUA 1K82A 3WHKA 1IN6A 2YQZA 3JAMS 4JI8M 3GLGA 4DR6M 2RGHA 2CE7A 4QNRA 3U6QA 1Q3BA 3I4VA 4QOZC 1NJGA 4KO8A 3VDPA 2KRUA 2KEBA 2YFQA 3FD9A 4X66M 3I4YA 1XHBA 5ITXE 3TQSA 1QAQA 2RGOA 2DWZB 4NXMM 4R7GA 1QYRA 4AKIA 1G4AE 1N78A 4B3TM 2QENA 3K8ZA 4LJ7A 1L2BA 4HLQA 1SXJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRU A;  2YNM D;  2L09 A; 
#chains in the Genus database with same CATH topology
 3U6L A;  2DHY A;  1HQC A;  3CTW B;  4OVZ B;  2Z4S A;  1QDR A;  2D7G A;  2RRU A;  3BXW A;  3PVS A;  3LCV B;  1R5L A;  4MH0 E;  1IY1 A;  4YY3 M;  1N34 M;  1NNJ A;  2WSE F;  2Y21 A;  3CF0 A;  3CF2 A;  4NRV A;  2R4E A;  2KZU A;  3JR5 A;  1PRB A;  2X49 A;  3SAW A;  2VF8 A;  1KYI A;  1OIP A;  1PGY A;  4LY6 A;  3AOG A;  3R9X B;  2UXC M;  2HAK A;  4HL4 A;  1XMO M;  1TF0 B;  4B3S M;  4PCZ A;  4HEO A;  4I8O A;  2O25 A;  2KNZ A;  2XFS A;  4II7 A;  3K92 A;  4DV3 M;  1AUA A;  4L78 A;  5KPT A;  4DV5 M;  2X8A A;  3KS8 A;  1HNX M;  2C5R A;  2WSC F;  1NY5 A;  1WIV A;  2CV0 A;  4LJA A;  3GRV A;  1E32 A;  4D80 A;  3R8F A;  3AOE A;  4GRI A;  3DZD A;  1MU5 A;  4XGI A;  1PJT A;  5DYI A;  2G8L A;  2O01 F;  5ITU A;  3Q8X A;  2R0I A;  4BBA A;  1J5E M;  3HJ8 A;  3K9P A;  2EO2 A;  1GJT A;  4A3V B;  3B9P A;  4JI4 M;  1LTM A;  2LVA A;  3HHW A;  5EP2 A;  1IBK M;  4GKJ M;  1QUT A;  4DR5 M;  3LQQ A;  4B7G A;  3KVW A;  3UMM A;  4M0W A;  3A45 A;  4OW0 A;  2E5L M;  1GKI A;  4MB7 A;  1QVR A;  1X37 A;  2J5Y A;  4AI6 A;  3RE8 A;  4CJ6 A;  2UXD M;  2UU9 M;  2M5Z A;  3SAV A;  3OTO M;  4NL4 H;  2UUC M;  4JI3 M;  1WGL A;  3J80 S;  4PT5 A;  3HGI A;  4I4L A;  4IBK A;  2R62 A;  3FUU A;  5DFL A;  2JXN A;  1TDZ A;  4GHL A;  3KOW E;  4GH9 A;  1ZAE A;  3EIH A;  1HR0 M;  2L09 A;  3FTF A;  4G4N A;  5IWA M;  2CV1 A;  3VFD A;  4GHA A;  3UGJ A;  2JY7 A;  5C18 A;  3GPU A;  3B89 A;  1Z5C A;  1IN8 A;  3SAU A;  2XF3 A;  2YR0 A;  4QNM A;  4B08 A;  1D2N A;  3MMP A;  3KP0 E;  4KLN A;  4LGM A;  3GRY A;  5E26 A;  2F5N A;  3QYB A;  1G59 A;  4IBJ A;  3T6P A;  2OOB A;  1R7R A;  1XXH B;  2V6Z M;  4GIP A;  3SAS A;  2EA0 A;  3PXG A;  3JR4 A;  2L7H A;  3HY5 A;  4X65 M;  5FTJ A;  5A2Q S;  3GLI E;  3PNV A;  1SXJ B;  2DKL A;  3L29 A;  3T15 A;  5DNY A;  3HWS A;  1NSF A;  2K9D A;  3KW6 A;  4GEW A;  3GLI B;  2QPA A;  4QHS A;  1N75 A;  3CF6 E;  4WW0 A;  1UFZ A;  2Z3X A;  5JI3 E;  3VKG A;  1KFV A;  4LJ9 A;  3W0F A;  3KOY E;  4NXN M;  3GLI A;  1DGH B;  1NO1 A;  4BB9 A;  3M7G A;  3U60 A;  2C96 A;  5C1B A;  5KO3 A;  1QAN A;  1XXH A;  4DV4 M;  2EKK A;  4LJ8 A;  3L27 A;  3J7A S;  2MGW A;  2ZTD A;  5ITY A;  3GLH E;  3FRH A;  1XB2 B;  2DNA A;  2APL A;  4MGH A;  2JA2 A;  3J2P B;  1VQ1 A;  2I7P A;  1PJS A;  2QCU A;  2V1C A;  3E9S A;  3PNY A;  3U6O A;  4LGY A;  1R6B X;  1WJ7 A;  4DV2 M;  2GQF A;  4IBC A;  3V76 A;  4IBF A;  1QAM A;  1GO5 A;  4DR7 M;  1PJI A;  1E9S A;  5F3W A;  3SAT A;  4L15 A;  4OX9 M;  2I7N A;  3KOZ E;  4GC9 A;  3SMP A;  1GLN A;  4TUW A;  3J7B A;  4FWD A;  5FTM A;  1R2Z A;  2LWX A;  1EFU B;  4LF6 M;  1N33 M;  1JQJ C;  2CV2 A;  4GMQ A;  3U6S A;  4B3M M;  3TWM A;  4IIW A;  1D0L A;  1UM8 A;  3SMS A;  3GPX A;  1VG5 A;  2KW0 A;  4R3D A;  1HNW M;  1IN7 A;  3J81 S;  3KXE C;  2K6B A;  2R4J A;  3B74 A;  1OTR A;  4DR1 M;  4JI5 M;  2DVW B;  1FNN A;  3GPP A;  4FWG A;  2MR9 A;  1E94 E;  3E4R A;  4EIW A;  2XLJ A;  3VK7 A;  4JXJ A;  1FJG M;  4Z6Y A;  1IQP A;  5KQD A;  1JR3 E;  2CEA A;  3B7Q A;  3L25 A;  4LF9 M;  2DWL A;  1L8Q A;  4ITQ A;  2JWS A;  3W68 A;  2VF7 A;  1OAI A;  2KDL A;  2FH0 A;  3GLF B;  5EXT A;  3L28 A;  2R45 A;  4IBI A;  1DV0 A;  2V1U A;  4L16 A;  2ERC A;  3FUX A;  1IXZ A;  5EP1 A;  4NOO B;  3C9P A;  3UJN A;  4DBG B;  2F5O A;  1IN5 A;  3UZU A;  2EJS A;  3T38 A;  1HT1 E;  2CRU A;  4LF5 M;  3KDS E;  7CAT A;  2VQF M;  4FW9 A;  1DO2 A;  3K1J A;  1VEG A;  4FVM A;  5FSW A;  1KSF X;  1YSY A;  2KXE A;  3QYE A;  4FWH A;  4I81 A;  5FLX S;  4G4O A;  3K9O A;  5E6J A;  1EE8 A;  2W82 A;  3H4M A;  1A5T A;  3GLF A;  1XMQ M;  2XFT A;  1T6O A;  4G4R A;  1DGG A;  4DUZ M;  3U5Z B;  2QZ4 A;  1R2Y A;  3MJ5 A;  2LXE A;  1C7Y A;  2JNH A;  2NQ8 C;  4MM3 B;  4LZZ A;  4IBB A;  1IBL M;  1QZE A;  2B3T A;  2XH9 A;  2Y0Q A;  2BWE A;  3GQ4 A;  4GIT A;  4DV6 M;  1G8P A;  2ZAN A;  2FE8 A;  3I01 M;  2HCB A;  2OOA A;  5IZ7 D;  3TL4 X;  4AG6 A;  2DZN B;  1JR3 D;  4M9S A;  3MHV C;  1OAO C;  1V92 A;  1IXS A;  3I04 M;  3T1H M;  4DR4 M;  4DR2 M;  5GKN A;  4M9Z A;  1SXJ D;  2CP8 A;  1NHW C;  1Z59 A;  5LMU M;  1NV8 A;  3M6A A;  1C1K A;  4XBO A;  3FRI A;  3QAU A;  4LJ4 A;  1DGH A;  3FTC A;  4LCB A;  3U60 B;  1HNZ M;  3RGS A;  3AL0 C;  2ZBK B;  4JI1 M;  2F5Q A;  3TWK A;  1ZMW A;  4WP2 A;  2VQE M;  1TH3 A;  2CHG A;  2J7O A;  3GPY A;  1SXJ A;  2JUJ A;  1IY0 A;  3IHP A;  4JV5 M;  2J7N A;  1L2C A;  3E21 A;  2CFO A;  2MRO B;  3HJS A;  3GO8 A;  2BJW A;  4KT0 F;  1TDH A;  2FFJ A;  1N77 A;  3ILK A;  4LG2 A;  2HKJ A;  2ZAO A;  1ZQ9 A;  2K0B X;  3HHX A;  1CUK A;  4CHT B;  4L4U A;  4FCT A;  4MGY E;  4CIZ A;  4LFB M;  3J27 B;  3MK6 A;  3GLG E;  3HU1 A;  5DYG A;  1I94 M;  4L8R C;  3AJI B;  2JY8 A;  3KSJ A;  1QQW A;  4LRT A;  3KOX E;  4AZF A;  4LFC M;  1NJF A;  1NVM A;  3Q8G A;  1TH4 A;  3FTD A;  3GLH B;  2LVO C;  2R44 A;  3FKE A;  4FD2 A;  2EKF A;  1XNR M;  2C9C A;  4Y28 F;  3HHY A;  1WHC A;  1WR1 B;  3U61 B;  1QZM A;  2R6F A;  3U6C A;  1R4G A;  4NRW A;  2KRK A;  2P5T A;  2XSZ D;  2C99 A;  1YE9 A;  2DAM A;  1WXQ A;  2L6O A;  5KQ8 A;  1T3T A;  2Z8Y M;  2H1R A;  1IXS B;  2XGN A;  3K2L A;  4Z8X A;  1IXR C;  1QAO A;  1K3X A;  4RKU F;  2LBC A;  1D0M A;  1OFI A;  1MJG M;  2QP9 X;  3FYC A;  1J09 A;  3BBZ A;  2ZM6 M;  3BOS A;  1L2D A;  1N32 M;  1F4I A;  5H37 D;  1QUS A;  1XXH E;  2KNV A;  5KPR A;  1V34 A;  2Z7J A;  2XZF A;  4LRS A;  4B7H A;  2CHQ A;  1P3Q Q;  1NHG C;  5EP4 A;  5BPV A;  3DFZ A;  2WSF F;  3KFU G;  3AFH A;  2FS1 A;  4RF1 A;  3VLF B;  3U6E A;  3ZQJ A;  1OJL A;  3U5Z A;  3TWL A;  4AKG A;  3CGW A;  1V33 A;  1I4W A;  4QHT A;  1GL6 A;  2WZJ A;  3ZC7 B;  3ZCB B;  4JI6 M;  5EP3 A;  1E9R A;  3FUT A;  3PFI A;  2HHH M;  3TPZ A;  4ZPX A;  4MGZ E;  2H5X A;  2FOI C;  5FTK A;  1AIP C;  2JY5 A;  1TTE A;  2FNA A;  1YUB A;  4REZ A;  3ZH9 B;  2QSF X;  4LFA M;  2R18 A;  2JP7 A;  3LMM A;  4OVZ A;  1NNU C;  2EUC A;  2VDB B;  2DHR A;  3A42 A;  3NWL A;  4LZJ A;  2RKO A;  1VEK A;  3LQR A;  3LVW A;  2BJV A;  3KSX A;  2JZ1 A;  5EXP A;  1PJQ A;  1SG9 A;  3IG5 A;  2QNJ A;  4PDI A;  2LVN C;  4K0K M;  1W5S A;  2LTU A;  2DZL A;  3U6P A;  2LHC A;  1L1T A;  5ITR A;  4NC6 A;  1TR8 A;  2YNM D;  1S3S A;  3FUW A;  3A46 A;  2Y0T A;  5EQT A;  1T43 A;  3AOE C;  1Z5A A;  3FE3 A;  2DWM A;  1TGU A;  3DA1 A;  1GAB A;  3IEC A;  4IBD A;  1J7K A;  3GLF E;  4B3R M;  2JY6 B;  1Q02 A;  4P16 A;  5LMN M;  1MN3 A;  2K47 A;  4NSO B;  4PD2 A;  2L7I A;  1G41 A;  2L2D A;  1Q39 A;  4R71 A;  2C9O A;  3SFZ A;  3L26 A;  4I5S A;  1VEJ A;  4AKH A;  2QHO B;  4Q7J A;  5KPZ A;  2O5R A;  4JI7 M;  2R46 A;  2LHG A;  4QOS A;  4F2L A;  2UUB M;  1EIJ A;  2DAI A;  3SAR A;  2L4F A;  2C98 A;  3FYD A;  3B7N A;  3LVV A;  1Y8G A;  1Z5B A;  4M0D A;  3UK6 A;  2KA6 B;  4FCW A;  4W5W A;  1XC8 A;  2BWB A;  2F5S A;  3HHZ A;  4DV7 M;  1OFH A;  2N35 A;  3VKH A;  2D7H A;  1K3W A;  3GLG B;  2KNA A;  2VII A;  4JI2 M;  1ZMU A;  1VDD A;  2Q2E B;  3HZJ A;  3W67 A;  4S12 A;  5ITT A;  3DOA A;  3WHL A;  4LF7 M;  3M0E A;  4MGI E;  1GL7 A;  4G3O A;  4LJ5 A;  1IY2 A;  2KZS A;  3SC3 A;  4LF4 M;  3C3E A;  3H4J A;  2X4A A;  5EXS A;  2DZO B;  4UN2 B;  4X64 M;  2OPF A;  3EIE A;  1HJP A;  1ZV1 A;  2HL7 A;  2UUA M;  1SXJ C;  3NBI A;  4IBG A;  4NSR A;  4BLC A;  4AG5 A;  2DAE A;  1G71 A;  5EXX A;  1GJS A;  5IT9 S;  2KHH A;  4FCV A;  3SHF A;  2UXB M;  1OQY A;  3D8B A;  2DXI A;  3HJQ A;  4RF0 A;  1H6U A;  3KS4 A;  3THG A;  5BR8 M;  3U6D A;  3TE6 A;  3GQ3 A;  4AQY M;  1VDL A;  3AV0 A;  3IG8 A;  2DI0 A;  2ZAM A;  3GRR A;  4JN6 A;  2BNK A;  1TH2 A;  4IJE A;  4LJ6 A;  3HX3 A;  4D81 A;  2QBY B;  2R65 A;  2DAG A;  1ZMV A;  2LH0 A;  1DGF A;  1G3I A;  1WGN A;  4JYA M;  1ORY B;  2LVP C;  2F5P A;  3NBX X;  1PJJ A;  4ANR A;  3A98 B;  4LF8 M;  2JZ0 A;  2LNH C;  4F1I A;  3W0L B;  3GP1 A;  2D7E A;  5FTN A;  3LW5 F;  3E46 A;  1Q3C A;  4OU7 A;  4JI0 M;  2DEN A;  2MJ5 B;  5L8R F;  4DR3 M;  4GKK M;  1MX0 A;  3B7Z A;  2XEP A;  1BVS A;  1XWI A;  1JR3 A;  3SBJ A;  3U6M A;  2OQ4 A;  3SHG B;  4P17 A;  1JB0 F;  1HT2 E;  4IBE A;  5EJC A;  4PDG A;  5JI2 E;  2XZU A;  1XNQ M;  2CHV A;  3L2A A;  4MGK E;  3GRU A;  4KOD A;  4M9X A;  2L4E A;  3C3D A;  4XK8 F;  3I51 A;  3T1Y M;  2XSZ A;  3VK8 A;  3U61 A;  5ITX A;  2M60 A;  3RFW A;  2LVQ D;  4GC5 A;  4AW4 A;  3GLH A;  1LV7 A;  2G5G X;  2A5Y B;  4DV0 M;  1L1Z A;  3D8L A;  1IM2 A;  4RNA A;  3FTE A;  3SYK A;  4YHH M;  1SXJ E;  4CIS A;  3SYL A;  4G4Q A;  2DWN A;  3KP1 E;  2Z4R A;  3HU3 A;  8CAT A;  4CGY B;  1NV9 A;  4D82 A;  3FUV A;  4X62 M;  4KHP M;  1OKS A;  4DV1 M;  1Z6T A;  4B7F A;  2AHM A;  3AKZ A;  2QBY A;  1IN4 A;  1DGB A;  2F4V M;  1YLA A;  3GQ5 A;  5FTL A;  4WUR A;  2MH8 A;  2OO9 A;  1DO0 A;  4IJF A;  4DUY M;  1IBM M;  3HU2 A;  1HQY E;  5IRE B;  3RGP A;  1PM5 A;  5ITQ A;  3C58 A;  1W5T A;  3QWL A;  1IFY A;  1GVN A;  3HKP A;  4G6Z A;  1NY6 A;  2Y20 A;  2CUZ A;  3VDU A;  1K82 A;  1OIZ A;  3WHK A;  1IN6 A;  2YQZ A;  3JAM S;  4JI8 M;  3GLG A;  2CWB A;  4DR6 M;  2RGH A;  2CE7 A;  4QNR A;  3U6Q A;  1N36 M;  3LCU A;  1Q3B A;  3I4V A;  4QOZ C;  1NJG A;  4KO8 A;  3VDP A;  1RU3 A;  2KRU A;  2DAK A;  2KEB A;  2YFQ A;  3F92 A;  3FD9 A;  4X66 M;  3I4Y A;  1XHB A;  5ITX E;  3TQS A;  1QAQ A;  2RGO A;  2DWZ B;  4NXM M;  4R7G A;  2GNO A;  1QYR A;  4AKI A;  1G4A E;  1N78 A;  4B3T M;  2QEN A;  1QDT A;  2G3Q A;  1D0K A;  2QQ8 A;  3K8Z A;  4LJ7 A;  1L2B A;  4HLQ A;  4L6V 6;  2ZTC A;  2HWJ A; 
#chains in the Genus database with same CATH homology
 3U6L A;  1HQC A;  3CTW B;  4OVZ B;  2Z4S A;  3PVS A;  2D7G A;  4YY3 M;  4MH0 E;  1N34 M;  1IY1 A;  1NNJ A;  3CF0 A;  2Y21 A;  3CF2 A;  4NRV A;  2R4E A;  2KZU A;  3JR5 A;  2X49 A;  3SAW A;  1KYI A;  3R9X B;  4LY6 A;  3AOG A;  2UXC M;  4HL4 A;  1XMO M;  4B3S M;  4PCZ A;  4I8O A;  4II7 A;  2XFS A;  3K92 A;  4DV3 M;  4L78 A;  5KPT A;  4DV5 M;  2X8A A;  3KS8 A;  1HNX M;  2C5R A;  1NY5 A;  2CV0 A;  4LJA A;  3GRV A;  1E32 A;  4D80 A;  3R8F A;  3AOE A;  4GRI A;  3DZD A;  1MU5 A;  4XGI A;  5DYI A;  2G8L A;  5ITU A;  3Q8X A;  4BBA A;  1J5E M;  3HJ8 A;  2EO2 A;  4A3V B;  3B9P A;  4JI4 M;  5EP2 A;  3HHW A;  4GKJ M;  1IBK M;  4DR5 M;  3LQQ A;  4B7G A;  3KVW A;  3UMM A;  4M0W A;  3A45 A;  4OW0 A;  2E5L M;  1GKI A;  4MB7 A;  1QVR A;  1X37 A;  4AI6 A;  3RE8 A;  2UXD M;  2UU9 M;  2M5Z A;  3SAV A;  3OTO M;  4NL4 H;  2UUC M;  4JI3 M;  3J80 S;  4PT5 A;  3HGI A;  4I4L A;  4IBK A;  2R62 A;  3FUU A;  1TDZ A;  4GHL A;  3KOW E;  4GH9 A;  1ZAE A;  3EIH A;  1HR0 M;  2L09 A;  3FTF A;  4G4N A;  5IWA M;  2CV1 A;  3VFD A;  4GHA A;  3UGJ A;  5C18 A;  3GPU A;  1Z5C A;  1IN8 A;  3SAU A;  2XF3 A;  2YR0 A;  4QNM A;  4B08 A;  1D2N A;  4KLN A;  3KP0 E;  4LGM A;  3GRY A;  5E26 A;  2F5N A;  1G59 A;  4IBJ A;  1R7R A;  1XXH B;  2V6Z M;  4GIP A;  3SAS A;  2EA0 A;  3PXG A;  3JR4 A;  2L7H A;  4X65 M;  5A2Q S;  5FTJ A;  1N36 M;  3PNV A;  1SXJ B;  3T15 A;  3L29 A;  5DNY A;  3HWS A;  1NSF A;  3KW6 A;  3GLI B;  2QPA A;  4QHS A;  1N75 A;  3CF6 E;  4WW0 A;  3VKG A;  2Z3X A;  5JI3 E;  1KFV A;  4LJ9 A;  3W0F A;  3KOY E;  4NXN M;  3GLI A;  1DGH B;  4BB9 A;  3U60 A;  3M7G A;  2C96 A;  5C1B A;  5KO3 A;  1QAN A;  1XXH A;  4DV4 M;  4LJ8 A;  3L27 A;  3J7A S;  5ITY A;  4MGH A;  2JA2 A;  3J2P B;  2I7P A;  2QCU A;  2V1C A;  3E9S A;  3PNY A;  3U6O A;  4LGY A;  1R6B X;  4DV2 M;  4IBC A;  4IBF A;  1QAM A;  4DR7 M;  1PJI A;  1E9S A;  5F3W A;  3SAT A;  4L15 A;  4OX9 M;  2I7N A;  3KOZ E;  4GC9 A;  3SMP A;  1GLN A;  4TUW A;  4FWD A;  3J7B A;  5FTM A;  1R2Z A;  2LWX A;  4LF6 M;  1N33 M;  1JQJ C;  2CV2 A;  4GMQ A;  3U6S A;  4B3M M;  3TWM A;  4IIW A;  1UM8 A;  3SMS A;  3GPX A;  2KW0 A;  4R3D A;  1HNW M;  1IN7 A;  3J81 S;  3KXE C;  2R4J A;  4DR1 M;  4JI5 M;  2DVW B;  1FNN A;  3GPP A;  4FWG A;  3E4R A;  1E94 E;  4EIW A;  2XLJ A;  3VK7 A;  4JXJ A;  1FJG M;  4Z6Y A;  1IQP A;  5KQD A;  2CEA A;  3L25 A;  4LF9 M;  2DWL A;  1L8Q A;  4ITQ A;  3GLF B;  5EXT A;  3L28 A;  2R45 A;  4IBI A;  2V1U A;  4L16 A;  2ERC A;  3FUX A;  1IXZ A;  5EP1 A;  4NOO B;  3UJN A;  2F5O A;  1IN5 A;  3UZU A;  3T38 A;  1HT1 E;  4LF5 M;  3KDS E;  7CAT A;  2VQF M;  4FW9 A;  1DO2 A;  3K1J A;  4FVM A;  5FSW A;  5FLX S;  1KSF X;  1YSY A;  2KXE A;  4FWH A;  4G4O A;  4I81 A;  5E6J A;  1EE8 A;  2W82 A;  3H4M A;  3GLF A;  1XMQ M;  2XFT A;  4G4R A;  1DGG A;  4DUZ M;  3U5Z B;  2QZ4 A;  1R2Y A;  3MJ5 A;  2LXE A;  2NQ8 C;  4MM3 B;  4LZZ A;  4IBB A;  1IBL M;  2XH9 A;  2Y0Q A;  3GQ4 A;  4GIT A;  4DV6 M;  1G8P A;  2ZAN A;  2FE8 A;  5IZ7 D;  2HCB A;  3TL4 X;  4AG6 A;  2DZN B;  1JR3 D;  4M9S A;  3MHV C;  3T1H M;  4DR4 M;  4DR2 M;  5GKN A;  4M9Z A;  1SXJ D;  1NHW C;  1Z59 A;  5LMU M;  3M6A A;  1C1K A;  4XBO A;  3QAU A;  4LJ4 A;  1DGH A;  3FTC A;  4LCB A;  3U60 B;  1HNZ M;  3RGS A;  3AL0 C;  2ZBK B;  4JI1 M;  2F5Q A;  3TWK A;  2VQE M;  1TH3 A;  2CHG A;  2J7O A;  3GPY A;  1SXJ A;  1IY0 A;  4JV5 M;  2J7N A;  1L2C A;  2CFO A;  3HJS A;  3GO8 A;  2BJW A;  1TDH A;  2FFJ A;  1N77 A;  3ILK A;  4LG2 A;  2HKJ A;  2ZAO A;  1ZQ9 A;  3HHX A;  4CHT B;  4L4U A;  4FCT A;  4MGY E;  4LFB M;  3J27 B;  3MK6 A;  3HU1 A;  5DYG A;  1I94 M;  4L8R C;  3AJI B;  3KSJ A;  4LRT A;  1QQW A;  3KOX E;  4AZF A;  4LFC M;  1NJF A;  1NVM A;  1TH4 A;  3FTD A;  3GLH B;  3FKE A;  4FD2 A;  1XNR M;  2C9C A;  3HHY A;  3U61 B;  1QZM A;  3U6C A;  4NRW A;  2KRK A;  2P5T A;  2XSZ D;  2C99 A;  1YE9 A;  2L6O A;  1WXQ A;  5KQ8 A;  1T3T A;  2H1R A;  1IXS B;  2XGN A;  3K2L A;  4Z8X A;  1IXR C;  1QAO A;  1K3X A;  1OFI A;  2QP9 X;  3FYC A;  1J09 A;  2ZM6 M;  3BOS A;  1L2D A;  1N32 M;  5H37 D;  5KPR A;  2Z7J A;  2XZF A;  4LRS A;  4B7H A;  2CHQ A;  5EP4 A;  1NHG C;  5BPV A;  3DFZ A;  3KFU G;  3AFH A;  4RF1 A;  3VLF B;  3U6E A;  3U5Z A;  1OJL A;  4AKG A;  3TWL A;  1I4W A;  4QHT A;  1GL6 A;  3ZC7 B;  3ZCB B;  4JI6 M;  5EP3 A;  1E9R A;  3FUT A;  3PFI A;  2HHH M;  3TPZ A;  4ZPX A;  4MGZ E;  2FOI C;  5FTK A;  2FNA A;  1YUB A;  4REZ A;  3ZH9 B;  4LFA M;  2R18 A;  3LMM A;  4OVZ A;  1NNU C;  2EUC A;  2DHR A;  3A42 A;  3NWL A;  4LZJ A;  2RKO A;  3LQR A;  3LVW A;  2BJV A;  3KSX A;  5EXP A;  3IG5 A;  4PDI A;  4K0K M;  1W5S A;  3U6P A;  1L1T A;  5ITR A;  2YNM D;  1S3S A;  3FUW A;  3A46 A;  2Y0T A;  5EQT A;  3AOE C;  1Z5A A;  2DWM A;  1TGU A;  3DA1 A;  4IBD A;  1J7K A;  4B3R M;  4P16 A;  5LMN M;  2K47 A;  4NSO B;  4PD2 A;  2L7I A;  1G41 A;  1Q39 A;  2C9O A;  3SFZ A;  3L26 A;  4I5S A;  4AKH A;  5KPZ A;  2O5R A;  4JI7 M;  2R46 A;  4QOS A;  2UUB M;  3SAR A;  2C98 A;  3FYD A;  3LVV A;  1Z5B A;  4M0D A;  3UK6 A;  2KA6 B;  4FCW A;  4W5W A;  1XC8 A;  2F5S A;  3HHZ A;  4DV7 M;  1OFH A;  3VKH A;  2D7H A;  1K3W A;  3GLG B;  2VII A;  4JI2 M;  1VDD A;  2Q2E B;  4S12 A;  5ITT A;  3DOA A;  3WHL A;  4LF7 M;  3M0E A;  4MGI E;  1GL7 A;  4LJ5 A;  1IY2 A;  2KZS A;  3SC3 A;  4LF4 M;  2X4A A;  5EXS A;  2DZO B;  4X64 M;  2OPF A;  3EIE A;  2HL7 A;  2UUA M;  1SXJ C;  3NBI A;  4IBG A;  4NSR A;  4BLC A;  4AG5 A;  5EXX A;  5IT9 S;  4FCV A;  3SHF A;  2UXB M;  3D8B A;  2DXI A;  3HJQ A;  4RF0 A;  1H6U A;  3KS4 A;  3THG A;  5BR8 M;  3U6D A;  3TE6 A;  3GQ3 A;  4AQY M;  3AV0 A;  3IG8 A;  2ZAM A;  3GRR A;  4JN6 A;  2BNK A;  1TH2 A;  4IJE A;  4LJ6 A;  4D81 A;  2QBY B;  2R65 A;  2LH0 A;  1DGF A;  1G3I A;  4JYA M;  1ORY B;  2F5P A;  1PJJ A;  3A98 B;  4LF8 M;  2LNH C;  3GP1 A;  3W0L B;  2D7E A;  5FTN A;  1Q3C A;  4OU7 A;  4JI0 M;  4DR3 M;  4GKK M;  1MX0 A;  2XEP A;  1XWI A;  1JR3 A;  3SBJ A;  3U6M A;  2OQ4 A;  3SHG B;  1HT2 E;  4IBE A;  5EJC A;  5JI2 E;  4PDG A;  1XNQ M;  2XZU A;  2CHV A;  3L2A A;  4MGK E;  3GRU A;  4KOD A;  4M9X A;  3I51 A;  3T1Y M;  2XSZ A;  3VK8 A;  3U61 A;  5ITX A;  2M60 A;  3RFW A;  4GC5 A;  4AW4 A;  3GLH A;  1LV7 A;  2G5G X;  2A5Y B;  4DV0 M;  1L1Z A;  3D8L A;  1IM2 A;  4RNA A;  3FTE A;  3SYK A;  4YHH M;  4CIS A;  3SYL A;  4G4Q A;  2DWN A;  3KP1 E;  2Z4R A;  3HU3 A;  8CAT A;  4CGY B;  4D82 A;  3FUV A;  4X62 M;  4KHP M;  4DV1 M;  1Z6T A;  4B7F A;  2AHM A;  3AKZ A;  2QBY A;  1IN4 A;  1DGB A;  2F4V M;  3GQ5 A;  5FTL A;  4WUR A;  1DO0 A;  4IJF A;  4DUY M;  1IBM M;  3HU2 A;  1HQY E;  5IRE B;  3RGP A;  1PM5 A;  5ITQ A;  3C58 A;  1W5T A;  3QWL A;  1GVN A;  3HKP A;  4G6Z A;  1NY6 A;  2Y20 A;  2CUZ A;  3VDU A;  1K82 A;  3WHK A;  1IN6 A;  2YQZ A;  3JAM S;  4JI8 M;  3GLG A;  4DR6 M;  2RGH A;  2CE7 A;  4QNR A;  3U6Q A;  1Q3B A;  3I4V A;  4QOZ C;  1NJG A;  4KO8 A;  3VDP A;  2KRU A;  2KEB A;  2YFQ A;  3FD9 A;  4X66 M;  3I4Y A;  1XHB A;  5ITX E;  3TQS A;  1QAQ A;  2RGO A;  2DWZ B;  4NXM M;  4R7G A;  1QYR A;  4AKI A;  1G4A E;  1N78 A;  4B3T M;  2QEN A;  3K8Z A;  4LJ7 A;  1L2B A;  4HLQ A;  1SXJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...