The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
160
|
sequence length |
418
|
structure length |
418
|
Chain Sequence |
b'SKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
NAD-specific glutamate dehydrogenase
|
publication title |
Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties
pubmed doi rcsb |
source organism |
Bacillus subtilis
|
molecule tags |
Oxidoreductase
|
total genus |
160
|
structure length |
418
|
sequence length |
418
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
1.4.1.2: Glutamate dehydrogenase. |
pdb deposition date | 2009-10-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00208 | ELFV_dehydrog | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
A | PF02812 | ELFV_dehydrog_N | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helicase, Ruva Protein; domain 3 | Helicase, Ruva Protein; domain 3 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Leucine Dehydrogenase, chain A, domain 1 |