3K92A

Crystal structure of a e93k mutant of the majour bacillus subtilis glutamate dehydrogenase rocg
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
418
structure length
418
Chain Sequence
b'SKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-specific glutamate dehydrogenase
publication title Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 160
structure length 418
sequence length 418
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.2: Glutamate dehydrogenase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k92A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k92A03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3k92A02
3AU9A 1L7DA 3RFXA 3ICCA 2F00A 3GQVA 4Q9NA 2XPCA 1PQUA 3KSDO 5L4SA 5ENDA 2VYNA 3U9LA 3PLRA 4RL6A 4MVJG 5ENVA 4BMSA 4RF3A 4TQGA 3IMFA 3TZCA 2BFAA 3MJVA 4OO3A 3ZV4A 4FBGA 4HY3A 3PHGA 3TSCA 2AHRA 3HN7A 2I3GA 4M8SA 5IDWA 1N2SA 3DZIA 3LK7A 1E7YA 4JJIA 3K8ZA 3D64A 4OXNA 4D42A 3I9NA 3HB5X 1VPDA 2A9FA 4E0BA 5FYDA 4RPKA 3K92A 2YHIB 5DOVA 3C85A 3HADA 3TL3A 2NV6A 1GQQA 3GY0A 4JJGA 3CMMA 4OSPA 1I3KA 2PH5A 1P1IA 4WCFA 3LT2A 4CODB 1HYHA 2Q46A 3U4HA 1PS8A 3EY4A 2IEDA 5ILOA 3PDUA 3ENNA 4CV3A 4BO6A 4BNVA 2I76A 2VWHA 4BMNA 1F12A 4FFOA 4GAEA 3SX2A 2WM3A 1LLQA 1SBYA 2Q4EA 4RJTA 1U8FO 2VUTA 3QW2A 2HUNA 2PZKA 1A7KA 4F46A 1PIWA 5HA5A 4A0SA 2IE0A 1ENYA 3JCZA 3Q9UA 5EQFA 4NI5A 3EW7A 4L4RA 1GD1O 3W8EA 1H9BA 3PIIA 3RVDA 3BMQA 4FS3A 2VZ9A 5DNAA 2OORA 4CLDA 4Y6RA 3GF4A 4Q39A 3Q9NA 1T24A 1DDOA 4J7XA 1XCBA 3IDSA 3JQ8A 1YO6A 2D4AA 1F06A 5CEEA 4YRDA 5HS6A 4Z6KA 4GWGA 3TOZA 4YDRA 2DUUA 4MP8A 1A9YA 3WFJA 2FZEA 3GG9A 2IXBA 2RHCA 4NJMB 3AWDA 5JCJA 1ID1A 4ZRNA 1M76A 3JD4A 2YYYA 1BVRA 2OP0A 3B70A 5EIOA 1R4NB 5JDCC 2JHGA 4YVFA 4A5OA 2O3JA 4XRGA 4ND1A 1FDTA 5IF3A 4AG3A 1A5ZA 4AJKA 1FF9A 1XWFA 4R01A 1X15A 2X8LA 3SEFA 4YPOA 3G1UA 4K6FA 4BB6A 4E5MA 1O6ZA 3ZW9A 3PJEA 1N7HA 4IDAA 4BKRA 1LDEA 2AG5A 4BNHA 2VYVD 2X0IA 3WIEA 2VRCA 3S2EA 2ZTLA 4WPGA 1HXHA 3VAZA 2D5AA 3PPIA 4MP3A 2BGLA 2OOSA 3QY9A 3DBHA 5GMOA 4F6LA 1Q0QA 4XJTA 5BR7A 2AEJA 3ETEA 4UAGA 4CLOB 1LDNA 3OMLA 4RQUA 1E7MA 1I32A 1DBVO 3FD8A 3CIFA 4XD2A 5HWSA 2A92A 5JPIA 4LSMA 3DR3A 3MJSA 3TDKA 4DRYA 5HRUA 1Q7CA 1Z7EA 1LNQA 4NDNE 5A3JA 5KVCA 1K6JA 2H9IA 2V6FA 1LBEA 1SAYA 4L0QA 5CP8A 4NMHA 1YS4A 2C2XA 3DWFA 1YONA 4A2CA 2HCTA 1HF3A 4B7XA 4R1NA 4CM4B 3G3EA 3P19A 4MVJA 1HDYA 1XELA 4HP8A 4XQEA 3V8BA 3JQEA 2GN6A 2JCVA 1C0LA 3DAGA 3MOIA 5LDGA 2BH9A 2H6EA 4CMIB 3ZWWA 3GDFA 1EE9A 4YACA 1GU7A 2O2SA 3VKVA 4M87A 4W99A 2D1YA 1J0XO 1KC1A 4ID9A 4QEDA 1VJTA 1YBMA 3KXDA 3Q2KA 4PRLA 4KQXA 5TF4A 1IPFA 1PJLA 4NJOA 4HNGA 3R1IA 1R15A 1T4BA 2I5PO 4RO0A 5TSDA 1IHYA 1ZK3A 1PR3A 1ZJYA 3GUYA 1XLTA 5EERA 4R1TA 4E3ZA 3TZHA 5CPBA 4UUOA 4FN4A 4W82A 5TC4A 2GZ3A 4OQZA 3ROPA 5A3VA 3L6EA 4J1NA 5IDXA 1Y81A 5J23A 1DSSG 1GUYA 3ENKA 2Q2WA 3F4LA 2GERA 2ZJ1A 1Z73A 1JVBA 1LQTA 3L9XA 1UXJA 3ASVA 1UXGA 3QVWA 1UP6A 4JNKA 1ZEJA 3GAZA 4A27A 2VT3A 4AJPA 3ON5A 4E12A 5CDGA 1LSUA 1P74A 1PS9A 4DLAA 3FPCA 3D4OA 3X2FA 1UDCA 3ZWOA 4AL4A 5IG2A 3C1TA 1BG6A 1LX6A 1MGOA 3F5SA 4E2ZA 4Z9YA 3RSHA 3W8DA 1ZFNA 4NG5A 2X22A 3B6ZA 3GRKA 4IJKA 5L95A 4JXKA 2C07A 1LRLA 1A4UA 1R4MA 4MIEA 4IM7A 2UUPA 4DPMA 4BGUA 5KJ1A 1GYQA 1KERA 4QT0A 4TRRA 4GX2A 4M54A 4J3FA 2JHFA 4XYMA 1QMGA 1KC3A 2CDCA 1EUZA 1Y8QA 4CL3A 2WSBA 4KUHA 3ASUA 2HK9A 1V35A 4DPLA 4IDGA 5IFLA 5CHEA 4U8GA 5L45A 3IOYA 3VZSA 3GGOA 5JCXA 1NX6A 4R16A 3DBLA 5I8ZA 4N54A 4MKXA 2XXBA 1TB4A 4MVJH 3IKTA 3ADOA 3GGPA 1P0FA 2DFVA 1H0KA 8ADHA 2VHVA 3MWDB 3EDMA 5JY1A 1QLJA 3ZWCA 4DIFA 3M2TA 3VVBA 3COSA 3VC7A 2FN7A 1F8FA 4FGWA 2IDZA 1C0IA 4FC7A 3WLFA 2EWMA 1VSUA 3H6KA 4YXFA 4RZHA 4R4JA 2Y93A 3QP9A 4WLNA 4BMVA 3FBGA 3HJAA 1K3TA 2YV1A 2Y99A 1JKJA 1ZSYA 2OZPA 4UUNA 1E5QA 4CV0A 5JYEA 1IE3A 1T2CA 4AVYA 3MWEB 2PR2A 5ITVA 1HRDA 4ALIA 3RKUA 2EJWA 1C1DA 4GI2A 1I10A 2YJZA 3GEMA 5JLAA 5ICMA 5K6AC 1Y9EA 3I9KA 4ZVVA 4GX0A 1EK6A 5L40A 3FR7A 4EUEA 2Q1WA 1U3UA 2Q1TA 4R41A 2FZWA 3QWAA 1C1XB 3WJAA 3VVCA 3NT4A 1MXHA 2NVUA 2B5VA 4RF4A 3WOHA 4E4YA 2UVDA 4QFDA 3WG9A 4II3A 4RVUA 1XYGA 5C7IO 1IZ9A 3MJTA 4RVFA 4WNIA 4ALJA 4CQMA 3IP1A 1EQUA 1U7TA 4TVBA 1DFGA 4TVOA 3JYNA 3WJ7A 1TA4A 3DBRA 2Q4BA 2ZTMA 4D41A 2OP1A 4TKLA 4LVUA 3FHLA 2CD9A 4JP2A 1B8VA 3RQSA 7MDHA 2Q49A 3JV7A 3LT4A 4Q3EA 1HDCA 4PGFA 4CR8A 4WLVA 4J7UA 4ZQGA 5KNLA 3D5QA 3BMNB 3DMTC 1DAOA 2BRUA 3HFSA 3O38A 1BDMA 4R5MA 1HDXA 3F6YA 4OMUA 4YJHB 5KVSA 2OUIA 2PGDA 3ZW8A 5AXDA 4UEJA 1MG5A 4NBTA 3NGLA 4TZKA 4IS2A 3RBVA 1KVSA 4DTIA 4CM8A 3DHYA 2WD7A 3K6JA 1MP0A 1RPNA 3AI3A 4IDDA 3DMYA 2QIOA 3O8QA 3PFFA 4UEKA 4XDZA 3TN7A 2Z95A 5DT9A 4IS3A 3KTDA 1ADGA 1D1SA 2B37A 2HKIA 3BTVA 1SC6A 4KOAA 4IDCA 1KVTA 3IJRA 4IUYA 1PJ4A 3EVNA 1ZVMA 3RUDA 5FI3A 1JKIA 3BYZA 4BKOA 4DMLA 4NQZA 4ZA2A 1GAEO 3CE6A 4O63O 4XCVA 1KEPA 1UH5A 3QHAA 1E6WA 3BIOA 3I9JA 4HWKA 3GVIA 1NNUA 5A5FA 5CFZA 1MX3A 4DVJA 4PCVA 1NFRA 1TI7A 5HM8A 1F0YA 3H7AA 5CAEA 1JKFA 2Y68A 2VUUA 3PQDA 3TPCA 4BO5A 1B3BA 1PR9A 4J9VA 3D7LA 4IXTA 1JWBB 3GH3A 1QP8A 2WMDA 4CM9D 1P44A 2GPTA 3WYEA 2R00A 4ZQBA 3ZWAA 3JQAD 4F6CA 2AA3A 2J5KA 3NDRA 1SEVA 3UCFA 1NFQA 2BKAA 1PEDA 3U4IA 1LDBA 3K5PA 3EYWA 3UH1A 4AJJA 3WGTA 1I30A 1V0JA 2O4CA 4PLTA 2R2GA 3BTOA 3GMDA 1B26A 3BZUA 4XWYA 5TX7A 3GLQA 5CG1A 2HMTA 2OBYA 1QG6A 5KKAA 1R6DA 3AOEC 2A35A 4FJ1A 3PQEA 2C2YA 4PG4A 1HE4A 1E3LA 3WGZA 1ZW1A 1NVTA 4HX5A 4EBFA 3BMQB 3PTZA 2Y66A 4XEHA 3ZHXA 5C7LO 2AE2A 5MGBA 4PZDA 5KJEA 1EVYA 3WLEA 3G49A 3QLJA 1SNYA 3GHHA 3NYWA 5B12A 2PKRA 4B8WA 1NPYA 1OMOA 1WVGA 4Q3AA 2PWZA 1V3UA 1RJWA 1KVRA 5F5NA 3DEYX 1YRLA 3WICA 1FXSA 3D4NA 3KO8A 5DOZA 5TS3A 3LVFO 2DU8A 1AGNA 2CDBA 1Z74A 1BXGA 3I6QA 2W90A 1X1EA 5TT1A 1EQ2A 1LLCA 1GDHA 1MFZA 3E1KA 4ALLA 3W4KA 1FK8A 1YDWA 4QTZA 1V6AA 4CMEA 4RPLA 5BNFA 3V5NA 1YB5A 2B36A 4E21A 3RFVA 4P38A 3JQDA 2Z5LA 3SJUA 3RC7A 5EPOA 4OQYA 2O3SA 2EP5A 4EJ6A 3AK4A 1E92A 4FD3A 4CV2A 1GYRA 4I5DA 2DC1A 1YQDA 3RC9A 2SCUA 4E5PA 3DBHB 4J1QA 5B4UA 4BGVA 4ZU3A 1KEVA 2ET6A 1NM5A 3FNGA 3KYCB 4INAA 3VPSA 2D2IA 1DO8A 1N92A 3E5MA 3QIVA 5CPFA 2NNLD 2RBEA 1GZ3A 3BTUA 3JQBA 1M75A 3VKUA 1MUUA 1LC0A 1YB4A 1YB1A 2AG8A 3I3OA 1H93A 2VRBA 2E37A 3EMKA 1LC3A 2VWQA 4BO4A 3ETDA 1ADFA 3F1KA 3F1LA 4IQ0A 5BSFA 4YT8A 4YCAA 3INRA 4O1MA 2VNSA 3TJRA 3GAFA 3NJ8A 4RORA 5K9ZA 3OBBA 3E6AA 3PJGA 4I5GA 4L9RA 3OICA 1IULA 1Y5RA 3VH3A 2UAGA 2O3UA 3ONDA 5JMWA 2FSSA 4J2OA 3AUTA 3W6ZA 4L74A 4W7IA 3TFOA 3K31A 3LC7O 4XKJA 5IZCA 1QV7A 5KTKA 4ZJUA 4I08A 5FFFA 3EVTA 2X9NA 3QWFA 4AJOA 2VYVA 4GWKA 4RVDA 4H15A 2J3HA 2VNAA 1O0SA 5DCWA 2VOEA 1T4DA 2AEFA 1G0NA 2AQHA 3M1LA 4RZIA 3RIHA 3U3XA 4NFSA 5KCZA 2ZYAA 1R66A 1NP3A 4B4VA 3I9OA 4LCJA 3OM9A 4KWHA 2EHDA 5CEFA 4WJZA 2PZLA 5U4QA 5GZ6A 1DAPA 2W98A 1NWCA 3G1TA 1I3NA 1E7SA 2DAPA 3ZH2A 4XX0A 3WWYA 2NWQA 5L53A 2JCXA 5C37A 1SCUA 4S3MA 3IUPA 1GCOA 4HNHA 4KDFA 3U49A 2Q2VA 1O5IA 4BGIA 3L4SO 2IYPA 2HMVA 1X7GA 4MOWA 3C1OA 4ND4A 4K9DA 1K0UA 1LI4A 3D3WA 5LC1A 2X0JA 2C59A 5I7VA 5F5LA 2FR1A 4DC1A 4B3HA 1JU9A 3FR8A 4DMMA 2I66A 1JLLA 2WD8A 4J9UE 3ZV3A 5FEUA 2HRBA 3WSWA 1E3IA 1W0CA 3IAHA 2PGJA 3H9EO 4U0KA 5TLSA 4YJGA 7ADHA 2GZ2A 4Y6PA 1R4MB 1RM3A 1WNTA 2B69A 2OHXA 1UUFA 3PDJA 3D3EA 2I3AA 2JJYA 4I9NA 1VRWA 1OAAA 3E9NA 4BNYA 5I9LA 5A9RA 3DOCA 4OHUA 4RPGA 4RPJA 1Y8QB 4YT4A 1XQ1A 3BHIA 2H63A 2PD3A 4E32A 3NTRA 1E3EA 5JDIC 3I6IA 5C5IA 1U2GA 4RDHA 5JFOA 1ZK4A 1ZSNA 3KZVA 4YJDA 1N5DA 2E6UX 3DBLB 3GT0A 1XKQA 4RVGA 4J1TA 3BMCA 3RCBA 3IS3A 1ONPA 3SC6A 2DBZA 5JY6A 1MC4A 4WEQA 3CPSA 4QXMA 2CFCA 2D3TA 3U09A 4NBWA 4WNCA 4PFJA 2VHZA 3JYQA 4Z9FA 3T4XA 3GRPA 2NACA 3Q11A 1YXMA 4YAIA 1UAYA 4JIGA 1PS0A 4ZQHA 3L77A 4ZQFA 4A7PA 4D46A 3R3JA 1UDBA 3WB9A 4BKQA 4E6PA 4GPD1 1QYXA 2QX7A 4OJNA 4DXHA 1U28A 1U7HA 1SO8A 4ALKA 1DC6A 3QWHA 3AOGA 2PNFA 3PQFA 5BSGA 3OJEA 3QVOA 2EP7A 2NTJA 3BA1A 4ILKA 1DRWA 3DFUA 4AJIA 2CF5A 2J6IA 1HE5A 4BVAA 2RIRA 3KBOA 5JDCA 1PJSA 3TQHA 1GEGA 2D0IA 4U7WA 1EDOA 1Y6JA 1QV6A 4DLLA 3HB4X 3F3SA 2CVOA 2PA3A 4PZEA 1CDOA 4DQUA 4JJFA 4CM1A 3T7CA 4MPDA 3I1JA 1KOLA 3HSKA 1IB6A 2V6MA 4WCDA 3UVEA 2NVUB 5CDTA 2B35A 5G0UA 1F8GA 1FJHA 4CUZA 1FDUA 4ROSA 4OSOA 4CV1A 2V7PA 3ZU4A 1K89A 3I9LA 1GPDG 1WDLA 4CQMB 2HJSA 1QYWA 1C0PA 4R1UA 4W9NA 1LLUA 1MG0A 3DBRB 3VZPA 4Y67A 4IGEA 1WMBA 3P2OA 4IQGA 2HK7A 4Z0TA 4Y98A 5TIIA 4LK3A 1PGPA 3H9JA 3C3XA 3ONFA 1YH3A 3OQ6A 2CSUA 3ROMA 3CZRA 4LN1A 2Y1CA 2VZ0A 3FTPA 1IYZA 1IZ0A 5DBGA 3SJ7A 3KOUA 4BNJA 1YVEI 2ZJ0A 4UUMA 2PKQO 1QSGA 4J91A 3GFGA 3P7MA 4CM8B 2HQ1A 1Y5MA 2WD7B 3ZWBA 1MFPA 3ZV6A 3GZNA 3INTA 3ZNOA 3GN1A 1NYTA 4R68A 4B7CA 3GC6A 1WDMA 4KTVE 1Z75A 4BOYA 2B4QA 1DLJA 1DJNA 5ADHA 1NHWA 3RKRA 4UEOA 1E1LA 4S1VA 3PRJA 4W4TA 5BT9A 1LSSA 2FRDA 3RASA 2GDZA 3RUFA 4UUPA 3IKVA 2XXJA 4HBGA 2OL4A 1EEHA 3WX0A 1ISMA 2XAAA 3H9GA 4U0JA 4XIYA 5AQ1A 5A05A 2EF1A 4I8XA 4QSMA 1RM4A 3M2PA 1AXGA 4P8RA 2Q3EA 3CTMA 5B37A 1HDOA 1VL8A 4FFPA 5A4DA 3V2HA 2O48X 1T2EA 3TWOA 3L0DA 3MEQA 1ISGA 3WQQA 4BNMA 2EKQA 3HHPA 1E6EA 4BUCA 3RU7A 1Y8RA 3JQ6A 1ADCA 1CJCA 1GZ6A 4OKNA 3H4VA 1GYPA 4DPKA 4HFJA 3ZU2A 3DZHA 1HT0A 4M1QA 4UULA 5K0ZA 2CY0A 2W4QA 1EUDA 1H2BA 4HFRA 1I24A 1VJ1A 3FTNA 1E3WA 4CL8A 3PYLA 5I7EA 3OHSX 5IDYA 4CQLA 3H2ZA 5I9MA 3SBOA 1NQ5A 1I01A 3WSVA 3AU8A 2GN4A 3TNLA 4B8ZA 2YY7A 2YZ7A 5JAMA 5A1TA 3ZGYA 3ZWNA 2JD2A 3BHMA 1HETA 2Z1MA 2IODA 2BFMA 3LZ6A 3P5SA 4GMGA 4E2WA 4AICA 1P31A 4BNNA 5CDYA 3OFSA 4IJVA 1SPXA 2NU7A 4FR5A 3S2FA 4Y6SA 1HSZA 2CMDA 5JO0A 3ZI0A 3AFMA 1LA2A 1PJ2A 1EVJA 2FP4A 2YW9A 3U0BA 1GUFA 5TQVA 2P5YA 4P4LA 3QWIA 2IZ0A 3ZN2A 5IAAA 2ZCUA 4E2XA 3AUUA 3I4CA 3UXYA 4HFNA 2VQ3A 1DLIA 1BXGB 5L7WA 3SLKA 1KETA 1I2CA 2Y0DA 3QRWA 1IPEA 1V3VA 4CM9A 3A9WA 1IOLA 4L4SA 4NBRA 4NNJA 5T67A 1MB4A 3ABIA 3AI1A 3JQAA 3JD2A 4JK3A 3BXXA 1KVUA 2E49A 3O26A 5GZ3A 3V2UA 5DDIP 3TRIA 4NU6A 3B1FA 4B4UA 3QV1A 1TEHA 2V65A 5DULA 3ZZNA 1CF2O 2ZIZA 1NR7A 2RCYA 4K6CA 1EFLA 2O50A 4LRTB 5BSEA 1LSOA 1SOWA 2VCYA 4E5NA 3CH6A 1TLTA 1ML3A 2O7QA 4BNIA 1E1NA 4YA6A 3DQPA 4M49A 5K6AA 1A27A 2BI7A 2LDBA 3VDRA 4ND2A 5A9TA 1TVEA 4K26A 2GF2A 4FOSA 3AI2A 4GSKA 5LCXA 1KEUA 1KVQA 3T4EA 4YYZA 1DFHA 1U3VA 1Q2XA 2PKQP 2ZQYA 1H94A 4YRAA 1AHIA 3KYDA 4MKZA 4NHEA 1LSJA 5BNTA 5FF9A 4DIOA 3JQFC 3H9UA 4WLOA 4CUJA 5JSFA 4A26A 3K30A 4FJ0A 3DTTA 3RJ5A 1PZGA 2GUGA 1J6UA 2NTNA 5ICSA 4BO7A 2EERA 5BNIA 3SVTA 3NT5A 1SOVA 1WPQA 4BNFA 3L9WA 5A9SB 3GEGA 3Q0EA 2Y05A 5I9NA 3OH8A 4NBVA 4QX6A 3UUWA 4AFNA 4A03A 4O59O 5CDUA 1GQYA 4GLLA 1RWBA 1X13A 1EBUA 3AY7A 3R6DA 1B8UA 4RLHA 3LF2A 3JYPA 3DBVO 2JFHA 3DMTA 1PTJA 3GK3A 1XHLA 2I65A 3DOJA 1CETA 4OH1A 2DUWA 3HQ4O 1WWKA 2Y1GA 2RH4A 3F4BA 4AJ4A 5JC8A 4FIZA 2NU9A 2PV7A 3GGGA 4CM6A 4GQAA 3FNEA 4J4TA 2ZTVA 5KVVA 2QQ5A 4MVJP 2IEBA 3HWRA 3P2YA 1DHTA 1DXYA 4IZIA 4DA9A 1B0AA 5CG2A 3OA2A 4DQVA 2H5LA 1SB9A 3DXFA 4MKRA 2PFGA 4KUEA 2Y1DA 4YT2A 1U5AA 4XR9A 4QO8A 4RPHA 1EBFA 1PZEA 5DP2A 2NU6A 1F17A 3D3WB 4N7RA 4BQPA 1V8BA 3TZQA 2C5EA 4OOFA 1JAXA 1P77A 3JD3A 2O4UX 4IIUA 1EDZA 2X23A 3PYMA 3RBXA 2PH3A 1D7OA 3H8VA 2GSDA 5ES3A 4MO2A 2VHYA 1M66A 1HDZA 1PWZA 1HDGO 1M6WA 1TT5B 1ZXBA 3QVXA 2UV8A 3KSZO 3L07A 4J0FA 4YJGB 1YQXA 1UAGA 2VWPA 3A28A 3GDOA 4D0SA 1UZNA 3FPLA 4A10A 4E5YA 1LU9A 4WLFA 1SEPA 1EFKA 3GVHA 1ZEMA 3IC5A 3ROKA 4CLRA 4O5OA 3FWNA 1DB3A 4Y9DA 4KDEA 1HZJA 3QVSA 2YQ5A 3RUHA 3RFTA 4IY1A 1WZEA 4M89A 5IN5A 3GPDG 4PN3A 2BELA 5IJZA 2V6BA 2JD1A 1CIVA 3QA9A 1LLDA 1X7DA 2IZZA 1QRRA 1XU7A 1S6YA 2YFQA 4URFA 3BMCB 4ND3A 4YAGA 2WDZA 3PWKA 5AYVA 3OJFA 1D1TA 3BMOA 5JW6A 1EVZA 3AOEA 2GR9A 4GVXA 2DFDA 1DJQA 1NTOA 1I0ZA 3D1LA 1JVSA 4AJLA 4H16A 1HLPA 3RROA 1M6HA 1YBAA 1ISJA 1U1IA 4EUFA 2Q50A 4EGFA 2Q1SA 1Y7TA 1HKUA 1LDMA 3H3FA 3GDGA 4DLBA 3PWZA 4IJUA 1ENPA 1E7QA 2DPGA 3DTYA 4XA8A 5DZSA 2GGSA 2QRJA 5F1PA 4PLWA 2HO5A 2IRWA 1SMKA 3RI3A 3A14A 5THKA 2NVWA 3OJLA 5JNLA 3DZJA 1IHXA 3UAGA 3EZLA 2UUOA 3FRJA 3D4PA 4JBGA 4WOJA 4TWRA 2RHRA 4LRSB 1UXHA 3RAJA 1P3DA 4JN6B 1DC5A 1YKFA 5JAQA 1E1KA 1YQGA 1NASA 1ZSVA 4YAEA 5T5QA 3GVCA 2VT2A 1ARZA 3INGA 4TZTA 1P1RA 1AUPA 3GEDA 4CJXA 4ESOA 4II2A 3ZNPA 3MTJA 1PGOA 2DBVO 4Z0HO 3CEAA 3MCVA 3LT0A 4JX8A 1I5RA 3I23A 1TXGA 2FPPA 3JYLA 4QFCA 4XRRA 4BIIA 2BFPA 2Q99A 4HFMA 3LQFA 2YDXA 3NEPX 2PD4A 1Z45A 4NJMA 1WW8A 5KKCA 5L3ZA 4WCFB 1EE2A 3F46A 3PFWO 2YV2A 1ZH8A 1ORRA 3C24A 1CWUA 4FGSA 2PY6A 5G0TA 2X7HA 3GVXA 4BNZA 1VLLA 5A03A 2CUKA 4I5EA 2UYYA 3U5TA 2X5KO 3LT1A 3WYBA 1ENZA 4CM5A 4EW6A 1BXKA 2O3RA 1P1FA 1LUAA 2EGHA 3DZKA 4OXYA 1PGJA 3WIDA 2PZMA 4CUKA 4L8VA 1IY8A 4CMCA 4IJWA 3V1UA 1Q7BA 3AM3A 1LTHR 4NPCA 1PJTA 1W8DA 1JTVA 2DVMA 1PJBA 3PEFA 4I9UA 1H6CA 2ZCVA 1NQAO 1UP7A 3KB6A 2DTXA 3GZNB 4YB8A 2DKNA 3VPFA 1PGQA 1DRUA 1RYEA 3JQ8B 4PVCA 2O2YA 5COAA 3VTZA 4CLOA 4BKUA 4RVHA 4WEOA 1Q0LA 4UVHA 4E30A 3V1TC 2HK8A 1DIAA 3KM0A 2NQTA 3WYCA 1LDYA 2VTEA 4R1SA 3WGYA 3E9MA 4CR6A 1B14A 2FPIA 2X6TA 3I52A 3Q2IA 4R3NA 1T1SA 2C54A 4WLEA 4CM7A 3FI9A 3PGXA 5AXAA 2D8AA 1UXKA 1BW9A 4CM4A 3RUAA 3RUEA 2ZB8A 3PGJA 1E1MA 4FDAA 1ZO8A 4B3JA 2DT5A 3OJ0A 1NQTA 1GZ4A 4NR0A 4DGSA 3NTQA 4OKIA 1IL0A 4JBHA 2FY8A 1N9GA 1GFSA 4BNKA 4CMIA 3ULKA 4YTEA 4DBZA 3OEYA 4YT5A 1G0OA 1Y8RB 4HUJA 3DL2A 3RU9A 5B1YA 4PG7A 4XYBA 5T8KC 3U4DA 4WGGA 4EJMA 3GNTA 1LJ8A 3TZ6A 4B79A 2ZB7A 3WGOA 4NK4A 1ZXLA 1PQWA 4FFMA 1E3WB 1HL3A 3HNPA 1DIBA 1NAIA 4CQLB 2CDAA 2QW8A 2HJRA 4RV9A 5F3RA 4D7AA 4RCVA 4OXKA 1ADBA 3NDIA 3PK0A 1GTMA 5L51A 4PIVA 3DZBA 2YFHA 4YJFA 2P9CA 3E82A 2H1SA 3UN1A 1ZK1A 1PQPA 2CF6A 2CNBA 3FNFA 5H82A 1L1FA 3WS7A 1ISHA 1NFFA 3C8MA 3WBFA 2PGLA 2ZK7A 3A4VA 2EXXA 5JDIA 3ADPA 2Z1NA 4WOKA 3UCXA 1K6XA 2GYYA 4Q3DA 3K73O 1NWHA 2FPGA 4XGIA 3NX4A 3W4JA 4D44A 1HTBA 5JMPA 1JAYA 4PLVA 4W6ZA 2FWMX 5MDHA 1BGVA 3VZRA 1AE1A 5KWEA 3UHAA 3IL2A 5EMHA 4MINA 5ER6A 3FN4A 4WASA 1Y9AA 3SXPA 4P4GA 5BQFA 4BO1A 2WYVA 4IGFA 4YRBA 1P1KA 1N1EA 1H6AA 3WTCA 2GLXA 3AW9A 4R5HA 1RM5A 4YAKA 3PHJA 1ZMTA 4OGWA 4WECA 3ROQA 4YQYA 3W8FA 3JQ9C 1QR6A 5G4KA 4B3IA 1PL7A 1ZKMA 3AJRA 3OQBA 1V3TA 3WR5A 1LXCA 1T1RA 4QECA 4PG6A 2HMSA 1YL6A 3WFIA 3OSUA 1BDBA 2D59A 3CXRA 1ZBQA 8LDHA 4OL9A 3A1NA 1B8PA 1H5QA 1GV1A 3FWZA 1M2WA 3PJFA 1B7GO 3KYDB 3GR6A 3R0IA 4EUHA 1OBFO 2I67A 1X0VA 3S8MA 5L7TA 1QLHA 4XGKA 3D5TA 2G82A 5H83A 3LSYA 4JBIA 3PP8A 3WGQA 2J3KA 1HE3A 2HMUA 4BGEA 1DC3A 4LGVA 1EMDA 3H9QA 4J16A 3WQRA 4XZ3A 2QG4A 4L75A 4MVJM 1ONOA 4ONEA 1UR5A 2G1UA 2GZ1A 4O0LA 2X5OA 3NRCA 1UP4A 4AJNA 3AUSA 1NVGA 2QRKA 3DONA 3LLSA 1VE9A 2J3JA 3RBZA 4FFRA 2P9GA 3ANNA 3T7EA 3CINA 5C3MA 2UDPA 1GPJA 4KP7A 2NUAA 1E3SA 3LF1A 3PHLA 2WE8A 2FHSA 3ZU3A 1G1AA 3AM4A 4IBOA 4J7CA 1HZZA 2O7SA 4GL4A 4BL5A 1C1XA 2WYWA 3MZ0A 2EEZA 2ILTA 3U62A 1XU9A 4AJ1A 4ZICA 5TGDA 1I8TA 4IMPA 2VOJA 3OQ1A 4JP3A 4F45A 3AY6A 9LDTA 5L9AA 4IDFA 1BTOA 5T6BA 5A06A 2X4GA 2NU8A 2X86A 3FNHA 4NFHA 1B16A 1LRJA 4TKMA 2GNAA 2W2KA 1PX0A 3HDJA 3KETA 4GKVA 3X2EA 3A06A 1ZIDA 1T26A 4TROA 1LRKA 1P45A 2NTVA 3C1AA 3GUCA 2Y1OA 1YJQA 1NHGA 1ZMOA 3BTSA 4DIBA 3C7CB 3NAQA 4YJHA 1XG5A 3DAFA 1C1DB 3MJCA 4R69A 2PZJA 4FFLA 2ZYGA 4PLPA 3WGGA 4GGPA 5TT0A 1MXFA 3AM5A 2HDHA 1J4AA 4C7KA 3CZMA 4BNUA 1BSVA 4XYEA 4DYVA 3GHYA 1WZIA 1PSDA 5L4LA 5A04A 3TFQA 3L6DA 3NTOA 2AW5A 1W73A 4E2YA 1DPGA 3L4BC 2W8ZA 3VHRA 2FOIA 4JGBA 1YDEA 4DREA 1GR0A 3WXBA 4XB1A 4J49A 4K1LA 5TJ9A 1DIRA 4CLRB 1HDRA 5L4NA 3NV9A 1B15A 4JQCA 3S2GA 5JYDA 2X5JO 3ZHZA 1FDVA 3HDHA 2EGGA 2ZTUA 3E48A 2NLOA 4GLOA 3RD5A 4CPDA 3H65A 2G76A 1H2HA 3EGOA 2C0CA 3KUXA 5G0WA 2JKVA 3BMOB 4E31A 2DLDA 2GN9A 4E13A 1WDKA 4PLHA 4E33A 4L73A 3DZFA 2JD0A 5L7YA 4XQ9A 3G0OA 4BHTA 1QXSA 4GVLA 4IDBA 5EINA 3U4CA 1ZK2A 3LLVA 1CRWG 3W4IA 1HSOA 3S1LA 5FWNA 4IXWA 4FB5A 5EQDA 1MC5A 4QQRA 2EJVA 2AEMA 4KZPA 3UF0A 4EZBA 1H6DA 3ZWVA 1HYGA 2AQIA 3O8QB 1QYVA 1VC2A 1O95A 4GX5A 4G2NA 2B4TO 1FDWA 5CEJA 1ZCJA 2WWRA 1T2DA 4IZHA 1C14A 3GZ4A 3OECA 4ZQEA 1BMDA 4R9RA 4LCEA 5I8WA 5IZ4A 4RLSA 1F14A 1H6BA 3PLNA 5T57A 4BNTA 2ZKLA 2X0NA 1NQOA 3WTBA 4MIOA 1S7CA 4R54A 3E03A 3TOXA 2Q2QA 1BVUA 1T25A 3QWBA 1M67A 1R12A 1R0KA 3PZRA 3IJPA 3O03A 2QRLA 4N18A 5HBRA 1JWAB 4AJHA 4GSLA 1VKNA 4QO7A 4XJSA 1JN0A 3B1JA 4R3WA 1ENOA 1Z82A 4UVEA 4YEDA 3ZWYA 4BNXA 5IXYA 1OOEA 4TMFA 4BO0A 2OO5A 4Z3DA 3UW3A 2IXAA 3WMXA 3JQCA 2BI8A 3E8XA 3IQDB 1MLDA 2ZB3A 3OP4A 3VOSA 2P9EA 1XIVA 5F1KA 2RAFA 3GOHA 3ZU5A 4B4OA 5GZ1A 2Q1UA 1D8AA 5LDHA 5DP1A 1EUCA 2FSVA 3JQFA 5JAZA 5IN4A 4CLHA 3RC1A 1XQ6A 2PD6A 5JO9A 1CQJA 3K9QO 1O9BA 1QYDA 1DHRA 4FC6A 1EK5A 6ADHA 1ISFA 1GEEA 3R3SA 4UVIA 4W7HA 5G0SA 4PRKA 4N5NA 4J6FA 3GFBA 2C5AA 3HN2A 3JQ7A 4L76A 4IDEA 4H3VA 3JSAA 2OFPA 4WCFC 3KYCA 4W9NC 3NT2A 3I4FA 2I9PA 2F1KA 2FR0A 1P33A 2QZ9A 3EUWA 4MJLA 5BSHA 4J4BA 3KLPX 2JFFA 2W2LD 4PLGA 1C3VA 3SLGA 3E5RA 3GG2A 1XDWA 2DTDA 3FSRA 4BB5A 2DQ4A 2HRZA 3DAPA 2HSDA 4BKPA 1VL6A 1BW9B 3M1AA 4CMBA 2NQ8A 3JYOA 1A71A 3H5RA 3PWSA 5AOVA 4D45A 4DL9A 3VH1A 1NAHA 3KLMX 1U9JA 2E48A 1GCUA 4OIMA 2ZQZA 1N9GB 2DTEA 3F9IA 4NH4A 3HUDA 3JD1A 3V2GA 4BO8A 3BAZA 3LDHA 4Z0PA 3RC2A 2JFGA 2ZYDA 3I5MA 3DHEA 3UCEA 4TRJA 3RWBA 1KS9A 2I99A 4UVGA 2DBRA 4ND5A 3OEWA 3H2SA 4E5KA 3HZZA 3NKLA 4FW8A 3QJ5A 1KYQA 2P68A 3AFNA 2GN8A 3N74A 1U3WA 4NIMA 2X1HA 2JL1A 2VN8A 5GY7A 5JXWA 1L7EA 1KY5A 1UJMA 4D43A 1XGKA 2Y0EA 3ZHBA 2J5QA 4N5MA 4O6VA 3DHNA 3OIDA 1U4OA 4WKGA 3GPIA 1J5PA 3KVOA 5KOIA 3N58A 1PZFA 3IUSA 5G2OA 4RQTA 1K5HA 3CSDA 4YJFB 3TL2A 3VZQA 4PLZA 2I6TA 2G17A 4G5HA 1QORA 3KYBA 4Q3NA 1LEHA 2IZ1A 2YHUA 4DBVO 5U9CA 5DCUA 3ZNQA 1YOVA 3AUAA 4CLEA 5KJFA 4LMPA 5ER9A 4A73A 4QUKA 3JQGA 3V1YA 2CVQA 4YR9A 1E77A 4EYEA 3UICA 3NDJA 1NPTO 3GNQA 3RJ9A 2C7VA 3WGHA 2BD0A 2BF7A 2Y1EA 5AVOA 3G17A 1NVMB 1CQIA 4D0RA 3E9QA 4NBUA 2J8ZA 4LW8A 2VYND 1G6KA 5DCYA 4BV8A 1D3AA 3KRTA 5EN4A 1LQUA 2AQ8A 5THQA 3ZCXA 4EDFA 4EEXA 5EESA 1ZNQO 3ZWPA 2BFOA 3I83A 4NU5A 4BNGA 4ZRMA 3H5NA 3VH2A 3CUKA 3AY3A 1SB8A 4DQXA 5G4LA 1ZUD1 1H9AA 2J5RA 1V9LA 5G4KB 5TRTA 1XR3A 2XF8A 1E7WA 2C29D 3EAGA 5KIAA 5JS6A 1X14A 1DIHA 3O9ZA 4GGOA 1DIGA 3PIDA 1CEQA 2YUTA 5KJCA 1VL0A 1FMCA 1XA0A 3QVTA 4Q3CA 1YL7A 1O8CA 4R51A 5H81A 3GA0A 1K6IA 2X58A 5C7OO 2WJPA 2PLAA 5I7SA 1MA0A 5JC1A 5HTOA 2JAHA 1NXQA 3GVPA 3FF4A 4MIYA 4P22A 1KBZA 4PZCA 1PWXA 3IIEA 3KHUA 2QYSA 4PLYA 3WWZA 4CMJA 2BGMA 4HADA 4OM8A 1A9ZA 4IQ8A 4FPXA 2Y1FA 3ORFA 3VPGA 1E6UA 2TMGA 5HS4A 2NADA 2VHXA 1P9LA 2BMAA 4ZN6A 3ONEA 3WNQA 3GMSA 2AXQA 3L6OO 5TNXA 3C7DB 5G0VA 3KV3O 2XOXA 1WLYA 2ZATA 2QHXA 2Y67A 1TT7A 4OOEA 3FBTA 1JA9A 2CVZA 1ONNA 1A7AA 3WDSA 1X0XA 3K2EA 3PJDA 4KUGA 1I3LA 4J1SA 1VSVA 1DEHA 3FCOA 4Q3BA 1Q0HA 3K96A 9LDBA 4D3SA 2YHIA 4JLWA 2NVBA 1GUZA 3ITDA 2LDXA 4XIJA 1I36A 5JCJD 2C82A 2G5CA 4IINA 5DN9A 3ZNNA 2POQX 4M86A 3EHEA 2P5UA 1I2BA 2O3TA 4NFYA 1WAMA 2W2KB 3QQPA 3ZV5A 1BHSA 3RUCA 2X9GA 4K28A 4U5QA 1FDSA 2D5CA 5EJ2A 3QE3A 1OFGA 3PVZA 1GY8A 1YWGO 4EEZA 4C7JA 5F1OA 3UOGA 2VHWA 4NZ9A 4LVCA 4IIVA 1PJ3A 1ZZEA 3OA0A 2EW8A 5U1PA 1UXIA 1Q1NA 1GL3A 2V6GA 4XB2A 3HFGA 6LDHA 3STHA 4YWJA 2VRCD 4M55A 3N7UA 3G79A 3DB2A 2VZ8A 4PG8A 1J49A 3B20A 3CMCO 4FFNA 4KWIA 1OC4A 3PXXA 1U2DA 2Q45A 3EZYA 4CMGA 3S2IA 1JDJA 4ZHSA 3NJ4A 3DZGA 1E3JA 4MDHA 5T8KA 3MOGA 4XYGA 3ICPA 3D0OA 3OIGA 1K2WA 1GQ2A 1YBVA 1YGYA 5B4TA 4RDIA 4ALNA 3LC2O 4XGNA 2P2SA 4XQCA 2EKPA 2VWGA 1AXEA 3VPXA 2EV9A 3OF2A 3VDQA 2ZB4A 2C20A 3EK2A 1R4NA 1O94A 1AN9A 1O89A 2AE1A 2E82A 1JQBA 4MVJD 1ULSA 1DOHA 4JROA 2B5WA 1PJCA 3M6IA 2CZCA 2GCGA 3LC1O 4KMSA 1WMAA 3I9MA 3PI7A 2TMDA 2OXIA 2HLPA 3SC4A 4GBJA 2YV3A 1D4FA 4MVJE 1GADO 3NUGA 4BO3A 4MVJI 3HG7A 1YE3A 2GO1A 3W1VA 1MV8A 3HDQA 3F47A 2FMUA 1W6UA 5FI5A 1Z6ZA 4JCOA 4RF2A 1I3MA 2WTBA 3O4RA 4ITUA 4WLUA 1EVIA 4DYDA 1QYCA 2AMFA 2P91A 3PYXA 2X0RA 3MTGA 4HXYA 2PTGA 4UREA 4J0EA 1R16A 5COBA 1YL5A 4CM3A 4J43A 1LDGA 1E0DA 1CERA 4PVDA 2B4RO 2A94A 3PZBA 1PZHA 1DFIA 2RH8A 4J2HA 5DBIA 5JE8A 4RVSA 3ZWMA 1KEWA 1PJQA 1VJ0A 3Q6IA 4D3FA 3JQ9A 4OYRA 2AQKA 2JAPA 1YJ8A 2Y0CA 1W4ZA 2WYUA 3TZKA 3UGKA 4FCCA 1E7RA 1I33A 4BO9A 5B4VA 2GRAA 4RGBA 4GMFA 2BHLA 4KQWA 2HU2A 1GV0A 4G65A 1HYEA 1JW9B 2EIHA 3WBBA 2YQ4A 4Y8VA 4RF5A 1R37A 2QYTA 3DFZA 1R0LA 1VM6A 3PHIA 1HEUA 4NK5A 1NR1A 5DF1A 4D3DA 2PK3A 2DPHA 3KSUA 2A4KA 4EITA 4IMRA 1KIFA 4P4NA 4XYLA 4YAJA 3LU1A 5AXCA 1PL6A 3QSGA 2B83A 3F5QA 3DC2A 3B1KA 2JCYA 2EG9A 2HAEA 5ILGA 4FSHA 2OGUA 5F21A 3MJEA 1P1JA 1HWYA 1XSEA 3JQ7B 2VTDA 4J4HA 2P4QA 4FJ2A 1NPDA 4CMHA 3S55A 4HV4A 1X7HA 1VKOA 4AJEA 4LSWA 3OETA 2G0TA 3W6UA 1DC4A 4XDYA 3BHJA 1Y1PA 3Q1LA 2FR8A 2R00C 5IXSA 5TJHA 4DWVA 4C4OA 1RYDA 1BWSA 1X1TA 4YBZA 3MJ4A 1PL8A 1R0SA 4G81A 4D79A 1BRMA 1T2FA 3PHHA 4DUPA 1SZJG 1P1HA 3DO5A 4BO2A 2OBNA 3UKOA 2WEKA 2WE7A 2X9VA 3ZHYA 2OMEA 3IP3A 3WQSB 3Q3CA 5A9SA 4J90A 5DBFA 2EKLA 5A02A 3NGXA 3JQAB 1B3RA 5COQA 2E4AA 2BLLA 4GKBA 5KJ6A 1RM0A 4CMKA 3WGIA 4IPTA 4TSKA 1EZ4A 1QKIA 1VI2A 2GD1O 2BGKA 3GNSA 3JD0A 3ST7A 1IUKA 1UZMA 2IYOA 1P0CA 1WXDA 5EL0A 3H3JA 3E18A 1N8KA 2HMWA 4FQ8A 3UFXA 3WNVA 1I2ZA 3TF5A 3OJOA 3CKYA 5I7FA 3VTFA 4TRMA 3ETGA 3EC7A 3ITKA 3ZDFA 3HE3A 1E5LA 1XEAA 2NSDA 1HLDA 4XR4A 1ZK0A 4CQMD 3VPHA 3HDYA 4R9SA 5AXBA 4PLCA 4CMEC 1N1GA 1U8XX 4N5LA 4BQRA 4H7PA 2W2LA 4L4XA 4WUVA 1Z7BA 1ISIA 4OAQA 3L4BA 4X54A 2C7GA 4EI2A 2J3IA 4ZGWA 1OI7A 1UZLA 3WMWA 2O3QA 4GX1A 1WP4A 4LISA 1YOVB 1DRVA 3K2BA 3JQGB 2P4HX 3KEOA 4ZD6A 4CLXA 4DC0A 1BXZA 1A72A 5A5EA 2EW2A 4U6QA 4AJ2A 4Z3KA 4PLFA 5CDSA 4I5FA 2O23A 1A4IA 1RKXA 5ITWA 3DDNA 1AHHA 4GH5A 1UDAA 1ZJZA 4UVDA 2DM6A 4BS9A 3JQBC 1HE2A 4BV9A 4XQGA 4B7UA 1TT5A 5JAIA 1U3TA 4WE3A 1KY4A 3JTMA 4I1IA 3LYLA 2NM0A 4PG5A 1T2AA 1PGNA 1C0KA 1OZAA 4ALMA 4YQZA 4F3YA 3ANMA 1B2LA 2YDYA 4MVJF 2QZZA 4B4WA 1ULUA 4MP6A 3ANLA 2VUSA 2DBQA 4CMAA 1N7GA 4HKTA 5T64A 2R6JA 1U4SA 3C7AA 1Q7GA 1OC2A 2B0JA 4I9HA 3VH4A 1CYDA 3DOOA 4U6SA 4WK6A 2GASA 4KTTE 3ZWXA 1NBOA 3GN2A 3KEQA 4FOOA 5IZCC 1U5CA 3OIFA 4TRNA 4EJ0A 5IDQA 3BMNA 4BNWA 4Z9XA 4CR7A 1PU2A 5KVQA 4LMRA 5JBIA 3H5AA 3RUIA 4BNLA
chains in the Genus database with same CATH superfamily
4JYAB 2F00A 1QQ7A 3KL2A 3CVUA 5CM2Z 1FQWA 2XUPA 2ZYTX 5SYNA 4HGQA 4MR9B 4RF3A 4ITRC 5FLYA 2QDKA 1G8SA 1ZJWA 2PT6A 4EYOA 2R66A 3ESZA 5CCBA 4JJGA 3LT2A 5MGNA 2IU4A 1DVRA 3CNQS 5CR9A 4IMIB 5K0EA 2AOTA 2OFFA 2C7OA 2GCPA 3MPOA 1XTBA 4JYAM 3W8EA 1OH8A 3BMQA 1A8UA 5K99A 4HPJB 3Q9NA 2D4AA 5FOWA 2YWCA 5HS6A 2IDKA 1OHHD 5KOJB 2DUUA 4UUAA 1GLNA 3MWFA 5HIKA 2JGRA 4OQNA 2YYYA 2MHCA 4TUWA 2P1ZA 1FOEB 5FJIA 5DNDA 2RBKA 2V55B 4G5FA 3A4NA 2DF8A 2WT8A 1XWFA 3EUAA 3TUZC 4K6FA 2XNCA 2Q3FA 4ZO7A 4E5MA 3AEQB 3PJEA 4GH9A 2P3LA 2X0IA 4UE2A 2QRMA 3OZWA 3PPIA 4BYMA 1QGUB 3DBHA 3E7DA 4ZI5A 3W2EA 2YWEA 1M0SA 5B3JA 1Z5AA 1DBQA 1JSCA 1AXRA 4Q9DA 3B1YA 1RR6A 1V11A 1YONA 3OX2A 4LA4A 2RSLA 4C76A 1JJAA 4XQEA 2C58A 1QH8B 2H54A 2FMXA 4HMQA 3BBZA 2LR0A 1UT5A 1T5DX 3FROA 4RHEA 1HOTA 4KQXA 1XL0A 4OQFA 3RNOA 4BQFA 4KQFA 1KTIA 2PUGA 3CO0S 2PU5A 5EERA 4E3ZA 1A96A 4OTZA 4KKVA 4JYBA 3IRVA 1Y81A 4RMNA 1ZY2A 5F78A 4CW7A 3DA8A 3HABA 1UCFA 2ZPTX 4KMMA 4K1XA 3K15A 2HNBA 3MWJA 3G2MA 2OYCA 3HJGA 1MZPA 1CUCA 4MIEA 1U7OA 3K6SB 1CG6A 4EATA 2JHFA 3MD9A 1KC3A 1EUZA 1Y8QA 4CL3A 2WSBA 4U8GA 3PF8A 2FFQA 4O1IA 4LYEA 5A4MS 4MVJH 5M04A 1NW5A 1FPQA 2Q3MA 4K88A 1ZJJA 3GGCA 7REQA 1KORA 1KE1A 1J8DA 2FN7A 1YSCA 1F8XA 4YXFA 1WCWA 6ABPA 3RIGA 2CJWB 3HV0A 4IH4A 1ETUA 3EC1A 3QMPA 2H2HA 3LPMA 1LZKA 3VYVA 2GZRA 2X1LA 2FZWA 3VVCA 3HVHA 3DFFA 3F3MA 3I09A 4IRMA 3KWFA 4JI7M 2Q4BA 2ZT7A 1XEWY 4PGFA 3OLYA 5JATA 3CLVA 2FPOA 2JFNA 4W8GA 1D4OA 4BLTA 5DHFA 2WIKA 4ZAFA 2PN1A 1YJXA 4JB2A 3EN0A 4KK4A 2QJFA 4UEKA 3YASA 2ODAA 3SOPA 2PMKA 1RWOA 4UM8B 3L1HA 5FP0A 4B48A 5FA5A 1KVTA 1KQOA 1PJ4A 1V8FA 1NMQA 4ZA2A 4MUMA 3L2OB 5KSZA 4ROTA 2DENA 3OTWA 3I9V1 3RVRA 2VH5R 1QGZA 3R5TA 4S1PA 4AZ0B 2VUUA 4HNAA 2Q2OA 1JWBB 4CM9D 3TO5A 4AQYB 4DMKA 1Y9JA 3HHZA 3TOVA 1JWLA 3SS9X 3K4PA 3A4LA 3TUIC 1G71A 4CDGA 1HE4A 5DIZA 5A62A 3HGTA 1PR1A 4O1HA 2E4VA 1AY0A 4MJXA 1JEQB 1NPYA 4BE4A 3WICA 2ACVA 4XUCA 3LVFO 4MWBA 4G4NA 4DSOA 3I2JA 1VXOA 4L28A 4KIGA 3WL6A 4RPLA 4F71A 4Q05A 2AOXA 4KQGA 3ESDA 3CZQA 1E92A 2DFPA 1YQDA 5B4UA 4AQYM 4DV2B 2LKDA 3AVTA 4GDMA 4N8DA 2FCAA 4A1FA 3DLCA 5FOXA 2BMEA 3O8CA 4MYDA 2VNSA 4LOKA 3PJGA 2DR2A 3OICA 4AY5A 2XCUA 5BVHA 3Q7RA 5LUBA 4I08A 4A0FA 4FQ7A 2W22A 2OLJA 1I13A 4QQNA 2ZBEA 1YZYA 4AECA 1SCUA 3K7EA 4DV2M 3L4SO 2ID8A 3QF4A 4HDAA 4MOWA 4M1YA 2H31A 2V6JA 3HJTA 2OQVA 5BQ3A 3L46A 2OFXA 1PT5A 3FHOA 5F3WA 2IHNA 1XP5A 1WNTA 4BRZA 3KYIB 3N7AA 4MI3A 4OHUA 1XQ1A 1GCIA 1E3EA 1U2GA 4EX6A 1MPXA 4RDHA 1ZSNA 4GBMA 2OXEA 2ON6A 4EK9A 3EDOA 3IB6A 3SCZA 4HLUA 4E46A 3R3JA 3UWMA 1U04A 1DC6A 4H08A 3EGXB 3KBOA 4L51A 3GLIB 2JFZA 1Y6JA 3QKTA 4EY7A 4Y0NA 5HCNA 2VDMB 2GN0A 1MABB 3AQ4A 5AJVB 4EWLA 3ELBA 4CQMB 3RU2A 1OXUA 3DBRB 4Y67A 1N3IA 4IQGA 4PSKA 2K7ZA 3SZMA 3KSMA 4AY6A 3QELA 3SJ7A 4CEHB 2PKQO 2OA0A 2HQ1A 1DAGA 2EKDA 1T5HX 3SNHA 1TK2A 3C6ZA 3RKRA 4LRXA 4X64M 1TEXA 2LWXA 4UUPA 4FWTA 1W48A 4DR7B 4GSYA 2V59A 5DN6A 3UHJA 4QYWA 4FGJA 4I8XA 2WAAA 3G5AA 2A9KA 1G7TA 5HVNA 4MPJA 2LXEA 4RD0A 1Y8RA 2UZ3A 3R5HA 3A11A 2W4QA 4CCSA 4KXNA 3A9UA 5CA0F 1G21A 2HF9A 3G0DA 3OHSX 1WHTB 4MGZR 4HQ6A 1PEKE 3EC2A 3BFPA 3KB1A 1WKBA 4GU5A 4C6HA 2X7XA 4IEIA 3ZTTA 3NV7A 2D00A 2CMDA 3OT5A 4W1QA 5AM5A 3KVYA 4DR5M 4DR7M 5I7UA 1PK8A 4YLGA 2O9JA 2GXUA 5DGHA 4BUZA 1EE8A 4M0WA 3O0DA 1BYUA 3L40A 4INJA 2O50A 1ABFA 1T9ZA 4MB2A 3NC1C 3A1WA 2PBFA 3HV2A 1ML3A 3E1GA 3DQPA 3HVUA 1A27A 4CN8A 5JMOA 5CT6A 4GSKA 1KEUA 4RM3A 4PC7A 2RHGB 4E7OA 1A2QA 4TMKA 4DCVA 3GPCA 1Y1QA 3K30A 4JQZA 3L4JA 1J6UA 2CXUA 4AY4A 3DEAA 1RWPA 3H1BA 2ZEJA 4BNFA 2BM0A 5KCMA 1VIVA 5DM2A 1G9TA 4EF6A 3G2OA 3KAQA 3W34A 1NVVR 1XHLA 1WSDA 4FIZA 1AX9A 1KYYA 2WWFA 2C2HA 3HWRA 3BM5A 4X44A 1AK2A 2UZAA 3SU8A 5CLHA 2A5YB 1P3QQ 3IOCA 3SC2B 3W67A 1BVSA 1JLLB 4QM6A 1RAHA 3KPVA 1Y6QA 5ALPA 1SCBA 3HYTA 5TVGA 4WLFA 1SEPA 2JGDA 1E4YA 3DMFA 2BISA 1FSGA 2KWIA 1A82A 3QA9A 4IHKA 4URFA 1WL8A 2ID4A 1GPUA 3URKA 3A1FA 4Y2UA 2G1KA 1FNMA 2G67A 2Q50A 4EGFA 3BS4A 2CK3D 2I8CA 1K7EB 2C98A 3MJHA 2JLAA 3DZJA 5HPYB 2UUOA 1E79A 3T12A 2WFMA 3EXIA 3M6VA 4LRSB 4K9MA 2AXPA 1VL1A 3MCVA 2UZIR 2BFPA 2JIBA 1AQLA 3OIVA 3FNBA 4RJ2A 3R75A 2O25A 3P9RA 3TW8A 4PT5A 3C24A 1D0LA 1KPGA 4QWWA 3HPQA 4MRRA 2UZ1B 3ZLJA 3V4RA 3D7MA 2CUKA 3LT1A 5AW6A 4LDAA 2O3RA 4OXYA 1D6NA 1A88A 3ROFA 1Z26A 3H4MA 3AM3A 1OBOA 2VDWA 3BD8A 4POAA 1RYEA 3JQ8B 2HSEA 4E30A 1JJ7A 1WMEA 1B14A 2FPIA 4LZNA 4F8YA 3F8WA 5IULC 4CM4A 3I58A 1ORDA 1GZ4A 4HTFB 4ZOLB 3CUEF 6CHYA 3V6LA 4OVKA 1US8A 1G8MA 4EJMA 1GZ7A 1D04A 1Q83A 4J29A 1PQWA 1W34A 2IHUA 3ETLA 1MB3A 4C4TA 1ZN2A 3NDIA 5E3IA 3B53X 4LF9M 2QUZA 3E82A 4NLLA 3CHYA 1E9VA 4ZU6X 5KAPA 1JI3A 1CUJA 2A84A 2FP4B 2O2IA 3T1NA 3K73O 4FIDA 4ZEWA 2B1IA 1A95A 1WD7A 4NC9A 2A5GA 4WNYA 4PXYA 3LDUA 3W3ZB 5LPNA 1P1KA 4P16A 3NXKA 1IK4A 3JQ9C 4NICA 5G4KA 4WSOA 5B57C 4QOIA 3G2HA 5HJ5A 1SBNE 3K1AB 5DPMA 3CZPA 3TW4A 1GKYA 2P0EA 2WMYA 1V96A 4K7JA 5DSTA 2HPVA 1SKMA 1WU7A 3QFSA 3VKGA 3K8YA 2QG4A 5IUNC 3HXPA 1ONOA 4JEMA 4BU1A 4OQXA 1FRZA 3U61B 3M3DA 1ZLXA 5FTWA 3ICWA 3R9IA 2HYDA 1C1XA 1BGXT 1I2MA 1RRPA 3OQ1A 3AY6A 1J2JA 2PX5A 4AKTA 3PG5A 2Y0TA 4D3YA 1GO2A 5GJBA 2QM3A 1NNSA 4ESHA 2QM7A 1PP4A 3GUCA 2JS7A 4N3AA 1QPBA 2B82A 1N8SA 3N0TA 2BONA 1AG9A 3GFPA 1J4AA 3G1WA 1BSVA 4M9XA 1QQ5A 3IAEA 3L4BC 2Q0SA 1YDEA 3OQJA 3WXBA 2QJOA 3BC1A 1QBGA 3T9BA 3R6TA 1FDVA 4JLJA 3C14C 3E48A 4WVLA 5G0WA 2QENA 5I51A 1DELA 4BHTA 3BMXA 1I3CA 1HSOA 1PFUA 1NZFA 3MT0A 4OF4A 4MRVA 5P21A 5LIPA 4GR4A 5EJIA 1O3YA 1QYVA 1HR0M 4X97A 5A6SA 2HNAA 5CLFA 1BMDA 5JAUA 4LCEA 4DC9A 3O4HA 4P54A 3F8SA 5T57A 4US2R 1X2EA 4C4YA 1U1EA 4ERNA 4UVEA 3MPUA 1OOEA 3WMXA 4RIHA 5BQOA 4AZ3B 4LFCB 3QXCA 5GONB 5DGTA 3PEYA 4NZOA 1KQNA 2C8LA 4RCZA 1DHRA 2VQ6A 4L76A 1TTTA 3KKOA 3ZDRA 1WW2A 2E4ZA 1DAMA 4GD3Q 3NHSA 1KO8A 4QXAA 5EHQA 4ZAZA 2CXQA 3QTBA 3Q0IA 4OX9M 2F9LA 4BKPA 3ZZ0A 3JYOA 4UZFA 3EZGA 5C5DA 4G09A 2WPNA 3VH1A 3HPRA 5EGNA 4M37A 4DY4A 3DHEA 3OE5A 1E98A 3PA8A 3AEZA 2GVDC 2C2OA 3IP9A 3QJ5A 2XNKA 3PFHA 5JCZA 4E5UA 5CK4A 1KY5A 1P4RA 3DHNA 3AY0A 3NHFA 3GJXC 1Q6ZA 5J5AA 3Q8XB 4WVFA 5KNCD 3EA0A 5U9CA 1SUDA 2P9FA 4LFAM 4A73A 4NECA 2VP0A 1VG0B 2BZ0A 3KOOA 1GG2A 4Z6YA 5LP6F 2VDVE 2WNSA 3QUAA 2VYND 3KRTA 3TZEA 5CIQA 4EEXA 4GL2A 4NU5A 2XWJI 3MWYW 2H9AA 3CKMA 4K6KA 5BSUA 2IIPA 3AERA 4FYWA 5C81A 1ZUD1 1OWLA 5TRTA 1XR3A 1JUDA 3O9ZA 2VPZA 1QZ3A 3PIDA 1DE0A 5KJCA 3NP9A 1XA0A 5K2MA 2X58A 4I19A 1NXQA 3FF4A 4BZQA 4CGZA 2YRFA 1RJFA 4DV1M 4KC0A 3EVCA 2Q29A 3TX6A 2BGWA 2X2PA 1J2UA 2PIAA 2V8OA 4Q3KA 1JA9A 2OESA 3PEUA 1DEHA 1QVAA 5BWBA 1ZIYA 1NBIA 4JLWA 1W4AA 5E7IA 5CT8A 4UBJA 3FZEA 1WAMA 3M70A 4OHZA 1ZD1A 2D5CA 3ZHRA 2HRCA 4PZUA 3TLGB 5U1PA 3UUGA 2F90A 6LDHA 3CNHA 2QD4A 3K5HA 2PLFA 1RI3A 2IHZA 4ZO4A 5IWAM 2A33A 1YDMA 3Q15C 2QROA 1DJMA 3OIGA 3GZJA 5B4TA 1YRAA 2C97A 1HBJA 3LG2A 4G63A 3VDQA 3R7DA 1PJCA 1O5OA 2ZAYA 4MVJE 3UNXA 1GADO 2JGEA 4Q4JA 5FI5A 1EIZA 5AT1A 2A3RA 1Y5NA 1QYCA 1PWYE 5D2CA 1J8YF 2JLYA 3GRZA 5TDHA 1N5RA 4N6NA 1YJBA 2HA2A 1R6BX 1YL5A 3PZBA 2A94A 1TCBA 3JASA 5TMEA 1W4RA 4CF6A 4CL0A 1F2TA 5JRZA 2JAPA 3MTEA 5AK3A 3HN6A 1PJRA 4HDKA 1GV0A 1TJ4A 1GA6A 3G9XA 3C2QA 3QXJA 3RK1A 3VKWA 4I5IA 2D06A 5D3MB 1LVGA 1P7PA 1NNUC 3VR2A 2ORWA 4OLHA 5ILGA 2RHBA 2VUIB 2W0SA 3MFYA 1DC4A 2JA1A 1Q12A 5HF5A 3F90A 4CEJB 5TJHA 5K3BA 4FGZA 1BWSA 3K9PA 4MGZE 4DUPA 4ZYLA 4JVSB 3A31A 4DRXB 3WQSB 1MBZA 1B3RA 5BP7A 1EZ4A 2R62A 4FSDA 1X80B 1V5WA 3UV3A 1LB1B 3OD5A 5AVTA 3CQ9A 1JR4A 4N5LA 4E7PA 2J7OA 4WUVA 5HRAA 3IAUA 1CJUC 3NHYA 1VYTA 4WFJA 3C48A 1ZU4A 2Q5OA 3NM6B 4WFKA 1P7CA 1RLJA 1L7PA 2VH1A 4DV0B 2DMRA 4LJ7A 5EHGA 1A4IA 3M4ZA 3E4RA 5FPPA 2QE7D 4QODA 5LMZA 4CQJA 4PG5A 1EE1A 4QG3A 5ERGB 3RH0A 2XUGA 5EG5A 5K6RA 1C3XA 5IZCC 1QANA 1ZL0A 3A6ZA 5JCPA 3JWHA 3RUIA 4ZI2A 3W7BA 1XXHE 3EEQA 3N07A 4MA4A 1BS9A 1Q95A 4MVJG 1F6WA 2PWAA 3FDIA 2DWZB 4MHSA 5KQGA 5B6JA 1FYWA 2Z1DA 2PHZA 3HJQA 1LW6E 4E0BA 5FYDA 2W6OA 1H5NA 3VNBA 2ZSIA 5KSOA 2C1EA 3TDMA 2BEJA 2DZOB 3DD5A 1XJ5A 1L2DA 4BNVA 3RLFA 1L4FA 3VYRB 3N2KA 3HU2A 4F8JA 1ENYA 4YLYA 1SPBS 3FY4A 1H69A 2LRHA 1Z4LA 3FUCA 4HVLA 3O3CA 4KLNA 1GABA 1KTVA 5K5EA 5FI1B 4XSGA 3WGLA 4HNTA 4DGQA 1BVRA 4Q21A 3TAHA 3BEDA 1D0IA 4UHDA 5FAXA 4FEAA 3OZDA 4HXFB 1O6ZA 4MP3A 3IEVA 4XPIA 3BJMA 4OI0A 1LDNA 1DWQA 1VEJA 3PSHA 4RQUA 1E7MA 2WFLA 1DBVO 4XWTA 3T7JA 3G13A 1CV2A 1Z7EA 3W7VA 1YS4A 2Z2YA 2C2XA 4FFVA 1BVYF 4X1KA 1XELA 1DQNA 2BH9A 4X60A 4AF7A 4Q4AA 4MMYB 2L6OA 1D2HA 1DUSA 1GKLA 2HHCA 3VTKA 3HCEA 2MSLA 3G5TA 2DUJA 4BVKA 2D5IA 4OPMA 1QDRA 3LVRE 2G63A 2IPXA 5FA8A 2W83A 1DZ3A 5A3VA 4B6QA 1B6GA 4CNBA 1MIOA 4A16A 2P5TA 2FPMA 4NHOA 1P3JA 2P78A 1WCIA 4KLAA 3FPCA 4QRHA 5AW5A 3TBHA 4AL4A 1OLXA 4Z9YA 2IP1A 1J8VA 3MAGA 3NWLA 2YBEA 2Q3HA 4TL9A 4M0MA 4LPKA 1QFXA 1NX6A 3NVKI 3ZE6A 2XAUA 1QIGA 4ZT2A 3VVBA 2ZRPA 4FGWA 2HCFA 1E2PA 5E3JA 5I8PA 3PNSA 5D7BA 4FHCA 3TQRA 1U1FA 2R25B 3IODA 1MEJA 5JJBA 4YP0A 1P6XA 5CHYA 3LCMA 5FD8A 3D6JA 1MENA 3CX4A 1IBCA 4ALIA 1T1EA 5JLAA 3E5HA 3HMKA 5CFLA 4GX0A 2XB2A 5G1PA 3WJAA 3NT4A 2B5VA 1G66A 2EX1A 3RTAA 1DJOA 2BEVA 4EFLA 4RWEA 3Q2OA 1CZRA 4G0WA 4G4GA 1TUIA 2NSYA 4JMLA 2V98A 3COZA 4HNRA 5KNLA 3AO0B 5TMBA 4CKEB 3D6HA 1ZOIA 3ZW8A 5I7AA 5FUYA 3TRJA 2C2MA 3EMVA 3DE7X 4IICA 4QPPA 4QOJA 4YMGA 4KQ2A 2DERA 4MYSA 2A88A 3BTVA 4NMLA 3IJRA 3QEOA 4HL6A 4IVRA 3U80A 4NQZA 3BT7A 1GAEO 3CE6A 3NW9A 1CCWA 3BIOA 3JAMA 3GVIA 3BRQA 1NFRA 3ZZMA 1D03A 1B3BA 2AA3A 5JAPA 4DIFA 5TX7A 4EB6B 4BFTA 2JZ1A 4EDHA 2ATIA 1RC8A 4PG4A 1E3LA 5I9TA 5B12A 3UAZA 5F5NA 4RXMA 2VKTA 3O47A 4L2IA 1OX5A 2GUWA 4CMEA 3E05A 4P38A 2Z5LA 2ZT5A 1POWA 1F2VA 3K72B 2PMCA 1JG3A 4E5PA 2C8JA 2QNJA 4HDRA 1AS0A 1M54A 1FY2A 3KYCB 4D4GA 1OVGA 2RBEA 2FF5A 2XYPA 1G2IA 4B35A 1LC0A 4DZRA 4ZC1A 3ILYA 1MH9A 1YHYA 3E22A 4ARAA 4JR0A 1RI2A 4I5GA 4OFWA 4BQEA 1YA6A 4L74A 5AOBA 5FFFA 5KWVA 4AJOA 5LP6C 1Y1SA 1NMSA 4RANA 1R50A 5AH0A 3I9OA 4F0JA 4WACA 2R47A 4NNPA 3B7QA 1PK7A 4QBTA 4K9DA 3HDTA 3ZWKA 1EVLA 2DHCA 4ZOAA 3ZV3A 3WGJA 4OHYA 1YI1A 2GZ2A 3W9BA 2IVZA 2Y77A 4I9NA 3T7IA 2CHEA 2KI5A 4AW9A 1M6EX 3HA2A 8GPBA 1XKQA 3HXQA 2I8AA 3P2KA 4R6XA 1O58A 5JY6A 1MC4A 2XOKA 2CFCA 4EQZA 3T3MB 2R48A 4ZQHA 4ZQFA 4D46A 3WB9A 3UT5B 1Z17A 1QDLB 2PVPA 4LOJA 1BXRA 2P6NA 2QV0A 1QHEA 2FWRA 3EXEB 5JDCA 2NOAA 3RSCA 1N6OA 3WRWA 1KZGB 5I7HA 2MSWA 3I3SR 4UNSA 4P7FA 2EG5A 4N3GA 4CV1A 4MROA 1EFVA 3ZCRA 3E4DA 3QYBA 4Y98A 1E3QA 4BFLA 1A5TA 1OH5A 1SCJA 3LQRA 2NZXA 4WD3A 5BR1A 4NRDA 2JANA 2R8PA 3E2MA 4UUMA 3PV0A 5JWOA 3QX3A 1QP0A 4TOIA 1QC5A 1TJ5A 2W6IA 3H9CA 3KU4A 4QGSA 3O94A 2E1PA 1FFCA 4FFPA 3QBEA 1YVPA 2IH2A 2J6CA 1NQUA 1XXHB 2VHEA 1CJCA 2XFSA 4HFJA 2HQSA 3DZHA 3EJWA 3ICQB 1EUDA 2I2BA 3NCHA 1CJTC 1IIBA 4TTVA 1SHJA 4B8ZA 2GN4A 2DJ5A 2VSFA 1AUVA 4EG6A 4MR7A 2XVYA 2WT4A 4CCYA 1VZ2A 1EX9A 4TV9F 5K45A 4BMOB 3GDHA 4OHBA 4TMYA 5CB0A 2OG2A 1EUYA 5L7WA 1AB5A 1DGQA 4YMVA 1KH2A 4CT0A 2VJNA 3A9WA 2XTAA 5T67A 5DW0A 1JX6A 4MS3A 2V03A 1SOUA 4EHFA 4AKHA 2PBLA 3VDRA 2OCIA 5DHPA 1OXTA 3T5PA 3L7YA 4K9LA 2OQIA 4DIOA 2IOHA 5ALKA 3L7IA 2NZ2A 3VZDA 2WILA 2O0LA 1XCOA 2QV7A 5BNIA 4KN8A 1AVTA 5KX5A 4AFNA 4JUFA 3R6DA 1NJFA 3DMTA 3IIIA 5HE8A 2MINB 1CETA 4OH1A 4KOEC 4ZQCB 1I7PA 4AJ4A 3K6KA 3WO1A 4X92A 5BSRA 5F2KA 2JZCA 3IPLA 3H83A 1FLDA 2H5LA 2I1VB 1JEAA 2QIPA 5HX7A 1CUDA 4Y18A 4X1OA 3IVMA 4IIUA 1JPVA 3D3KA 3CUSA 3LBAA 2ZREA 2GSDA 1O97D 2DX7A 5BOVA 2W93A 3B6IA 2JIPA 2EYUA 2VWPA 4A10A 3I8SA 1N7IA 3J7AC 4HWOA 5CA0A 3Q5GA 4OXRA 2V6BA 1D0SA 4G37A 3IAM6 3UPDA 1XDDA 5LNK1 2XNSA 1FEZA 2WOJA 3QEJA 4RTSA 5SV2A 1SQSA 3UPTA 4M1SA 4CKBA 3P8ZA 2HLHA 3S99A 5CD9A 2BUCA 4JJ7A 4KQMA 2JH3A 5JAQA 1F3LA 1ZSVA 1TCAA 2I54A 5JARA 3OD1A 3LQFA 1QH0A 3AONB 3DQZA 1EA7A 3U2QA 4FWHA 2V9CA 1EJ0A 1KGSA 5DI9A 2Q6VA 3DVQX 4RSMA 2X5KO 1FYDA 3DZKA 5FOSA 2X15A 4DSZA 3WJ2A 4LTMA 4ZODA 5K8JB 3EMBA 1H6CA 5COAA 1EGMB 2HADA 1RDFA 3Q5DA 5DTJA 2VTEA 3WGYA 1WV1A 3PGXA 3J2PB 3ISVA 5DVZA 4TGLA 4H2DA 2DT5A 3WK6A 4YTEA 2VBCA 3DVSX 4HUJA 3DM9B 4DABA 5A0FA 2PSDA 4RKWA 1H3FA 3UAOA 2IXFA 4NCHA 5CFRA 1RU3A 4Y1EA 3DZBA 3DWGA 2CHVA 3D4LA 1ISHA 3C8MA 3QFFA 3PR3A 4JYCA 3NETA 4EABA 5FTJA 1YNOA 3NALA 1Y4UA 4M0DA 3VO8A 1CNEA 4YIHA 4BV2A 1JAYA 2WF9A 4F5EA 4NX2A 4ARUA 3EZ9A 4DV4B 4P4GA 1XTJA 1HC7A 2XIJA 3RS9A 1B93A 2O0MA 1LV8A 2KSQA 2FRVA 3C5HA 3GOQA 1HQYE 2Q3LA 1CB7A 1QQTA 1ZBQA 5EZYA 1VG5A 4YMSA 5FI0B 1E1RD 1HL7A 1Z15A 1EWQA 2XZUA 4TWJA 4XGKA 3WQRA 1GDTA 1YDFA 2WG0A 5FHRA 3TVTA 1MOSA 4G2TA 4KP7A 1WBDA 4IBOA 4DV4M 2O7SA 4OXXA 3HHEA 4FDUA 4Q1VA 3U7IA 1M2GA 5T6BA 1RQ7A 2X86A 2R68A 1O94D 4PQRA 4Q9KA 4EA8A 1NUQA 2K2WA 1FVXA 1LRKA 4OP2A 4DIBA 2LW7A 3HJCA 1T13A 2PXCA 1ORTA 4PO9A 4GGPA 1AQUA 2NZ8A 4FFSA 5A5VA 3CZMA 1TNDA 2BFEB 1ZBDA 3U4AA 1JQKA 4WNAB 4N47A 1KXJA 1HE1C 3AW8A 1WULS 2I7NA 1YVUA 1H8HA 4KO8A 1N2HA 3P26A 4D96A 1WUIS 2B1JA 2R97A 3IV9A 1V6SA 1RC1A 4PIPA 3LO8A 1M1YE 3VSCA 3IPYA 2WJGA 1L7XA 5IVPA 3WOVA 1S9HA 1G41A 3ZHTA 3ZGZA 2XT6A 3CBGA 3JARB 5EIWA 2B4TO 1CW2B 3HEMA 1SELA 4PINA 1F14A 1VGQA 4QYMA 3IMCA 3VKFA 4WXEA 1ZMVA 2AG0A 4J0KA 5L6MB 1R12A 1JN0A 2VL7A 4TMFA 4EJFA 4UBLA 3F3YA 3P52A 3OP4A 3ROEA 3A04A 1XIVA 1USUA 1JSRA 5CXQA 1AU9A 2XMGA 1D8AA 4GPZA 1J0BA 4HGPA 3TMKA 2ZJ2A 3PCRB 3IELA 4OD0A 2XE4A 1NC1A 1JLHA 3FKSD 1E3DA 4NMMA 3I4FA 2CD7A 2QZ9A 5FLKA 2DH5A 3ZXXA 4WIAA 1X39A 2IF0A 3SLGA 5F52A 1R0CA 4F4FA 2HHJA 1XRSB 2V1CA 2AFIA 3RNLA 1TEVA 5DTQA 4DG5A 2M6RA 3M1AA 5I9SA 3COWA 2ZYDA 5KTRA 4ZTBA 3M5WA 3NIWA 1OH6A 1MX5A 3CONA 1KZ6A 1TADA 2VSXA 4FW8A 3U7QB 2QN1A 4KE8A 4GNKA 3EVZA 5GONF 1U0GA 2J5QA 4O6VA 1JHUA 3TXAA 3FETA 2BGRA 2YCLA 2O0JA 4AZVA 4DLUA 3UK1A 3MINA 2P2NA 3KYBA 1N4AA 3SIPA 4H1VA 3C8ZA 5BV0A 3I8XA 1WXXA 3UICA 2IEZA 2QLFA 5AVOA 4K9NA 1NVMB 4Q1AA 4C03A 3A6EA 2VQSA 5GIPE 1JRLA 3LVVA 1XAGA 2QMHA 3VH2A 1ZD9A 2XUHA 4JI7B 4HB0A 1DIHA 3G0GA 2Q21A 1VL0A 4U7FA 3QVTA 2H3EA 5H81A 2IU6A 3UAYA 1HURA 1I4EB 1AKVA 4CMJA 4XOUA 4QNMA 3ONEA 1X7XA 3L6OO 2XOXA 5D87A 4OBXA 1B74A 3WO0A 3LZCA 3DV9A 1P73A 3IXMA 3D3JA 3FIJA 2FQYA 3BK1A 5JCJD 1FLAA 4FBMA 2O3TA 4LF7M 1UK7A 5LSAA 1T9DA 2H9YA 2OV4A 1OFGA 1GTRA 1Z2DA 2GBGA 2VF7A 1SXHA 3LH5A 4BLUA 2Z8XA 4G0UA 2OBBA 1NXSA 2AR7A 2BFBA 3IV7A 4WFIA 3PENA 1Z7WA 4IJFA 3D0OA 2IOYA 1YGYA 3VOTA 3M3HA 4XQCA 3O3NB 3SASA 2AE1A 1IY2A 2P0YA 3KT0A 2CZCA 4IRXA 3EWIA 3PGVA 3SC4A 4JL5A 2Z2IA 4Y7CA 3CN7A 5F9MA 2EFYA 2VPYA 4OP1A 2C4VA 3FGNA 4HQ0A 1YB2A 1RJEA 1TMGE 1CRPA 2HA4A 2KXEA 1NMXA 3HB1A 2NYVA 1DFIA 1SKBA 3MYYA 2NT4A 1UINA 2FPKA 4N0DA 4X66M 3BILA 3SF8B 1V37A 1ZMWA 3ABQB 1P2BA 4KJXA 3SYRA 4IIBA 3PPVA 1UEXC 2OLKA 2OCKA 3PHIA 4NK5A 4AQDA 1JB1A 2A4KA 5JANA 1EUCB 1W7AA 2F62A 5ITYA 1CQJB 4FWGA 3CN9A 1AGYA 3PICA 2B94A 2PT9A 3I32A 3V2IA 1QPZA 1RKUA 1JQ3A 1Y1PA 4OJYA 1N6IA 1YTLA 2IXEA 4RQAA 3LTEA 3M82A 1Z2OX 1VJCA 1C80A 2PGNA 4UAJA 4LTNA 3QU2A 3BGIA 1G5TA 1TCUA 3A10A 3QYPA 3BWYA 5HG0A 1KRXA 2YWRA 1K7FB 5GAJA 3KQWA 3TF5A 2EKKA 4C5CA 4DIUA 2QVYX 2LIVA 2NSDA 4YMWA 3T1HM 4R9SA 1S7GA 3UWPA 1R27A 2AXEA 3ECCA 3QF7A 3FPEA 4EPRA 1E2QA 3DE4X 2FW0A 3DTVB 1WXHA 4M36A 4I5FA 1X1BA 3CH7A 5ITZB 3H1PA 4H60A 1RYMA 2NM0A 4I66A 4Z1MA 2QS9A 4J0GA 2YJNA 1KMMA 3HJUA 4DG9A 3EAFA 4TYPA 5EJEA 3IAS6 2OQRA 5T3UA 5BVGB 2VPPA 1LPPA 5I9IA 1OKKA 3DWIA 3OIFA 4TRNA 1FYFA 5CB8A 5AICA 5DH9A 2RBGA 4B3RM 1KJIA 4LMAA 3DEJA 4RXUA 2B34A 4H7EA 4TKUB 1C30B 3BGWA 2QCUA 1DG9A 4DIKA 3DAOA 4X64B 4WN9A 1FS6A 3SE0A 3QSYA 1XHFA 4Y3UA 2NO1A 3T7KA 1HNWM 4F4CA 4XGQA 4UDXX 2ZJ4A 1SXJC 4NJEA 1EFAA 1NKSA 4BMNA 1F12A 3H1EA 2F5SA 5F3DA 3IHWA 3COYA 3PGKA 4V38A 5HSGA 1UQRA 3BXEA 4HVTA 1XCBA 4C87A 1UMCA 4Q1BA 4MP8A 4DR5B 3GD7A 4IOKA 2ZE5A 2CLOB 1FP6A 1MA3A 4OXIA 1V8PA 3RE1A 5IEJA 1SC4A 4PO8A 3TQFA 3O2SB 2O2GA 3B12A 4DLPA 5K8TA 4L22A 2K5UA 1T10A 3BWEA 3TWLA 1UK8A 4WPGA 5IAGA 4BRSA 4X62M 4KQ9A 4F6LA 4ZCQA 3ZCPA 5LWQA 3QK7A 3ER6A 5JFTA 4DCOA 5AKYA 3UWOA 3DE3X 4X7RA 1PNVA 2G70A 5L3QB 2HCTA 4OQMA 1M1YB 1II9A 2O07A 3GWZA 3GDFA 3RVQA 3IIJA 4JP8A 2M6LA 3PNYA 3A6FA 5IUKC 3CWCA 2DUNA 3FDJA 1OE0A 4KQCA 2XNDD 3ZX5A 1OFUA 4V0ME 4F04A 4E6EA 4IV0A 2OD7A 5KNDH 3ASVA 5KHOC 2L42A 1CQPA 4DS3A 1LSUA 2P9QA 2A78A 3R23A 2QW1A 2OZKA 4NG5A 1LRLA 4IM7A 4CTKA 4BGUA 3JALB 2F17A 2D7GA 5DW3A 2CDCA 3AUYA 1Z4JA 3I6MA 4IR7A 2B8TA 5L45A 2VXOA 4PHGA 5JHHB 3GJYA 4HD8A 3UFXB 2VHVA 4JHLA 3FM9A 3NWPA 1L8AA 3QP9A 4WLNA 3NAZA 4BMVA 4QARA 1RQNA 1J0DA 2Q27A 4GYWA 3TW0A 2C3OA 3LDFA 1JQEA 2IOQA 5AVXA 1Z16A 1Z22A 4PFSA 3WLNA 2Q1WA 2QQEA 4BU0A 2I29A 3VO2A 1MXHA 3TRDA 4OX9Y 2BFWA 1A7JA 4HDQB 5JISA 3WOHA 5LA6F 4II3A 3V4ZA 2P35A 3HBMA 3VDPA 1FFXA 4D41A 1A9TA 3CY6A 2EX0A 4LVUA 1PBTA 3IQHX 5IBPA 1E6LA 1U5BA 2OHGA 3GT7A 4YJHB 5KVSA 2OUIA 5AXDA 4WY5A 4Q4LA 4TZKA 3H2GA 3AWIA 2QPTA 4E22A 2HIGA 2CBZA 1UDWA 2AK2A 3R7LA 2ALJA 3AJEA 1XWIA 1ODJA 4IX1A 3VGPA 3CNBA 1O87A 2COKA 5ECYA 2QORA 4BKOA 3BYZA 2CYAA 3VU9B 3FCEA 3I04M 3CZCA 4HWKA 1B6TA 3SDZA 1LPAB 2Z2KA 3RGWS 3H7AA 2ZDGA 4JY7A 2ZRNA 2RHTA 4IYJA 1GA1A 5J3JA 1PD0A 1CEXA 2BKAA 2NNWB 1F0NA 1YZUA 4DILA 4MWCA 5EOVA 4LF9B 2HMTA 3IVCA 2XGMA 4EBFA 4XEHA 2ZYUX 4IGKA 3PCTA 4MAAA 2OBFA 2FWBA 1GR1A 2F67A 2L0XA 4OGFA 4CFYA 1X1EA 2PO7A 2CXTA 4QTZA 3V4OA 5CNMA 5JSZA 4E88A 3U4GA 3ONWA 1X8LA 2PMBA 2BTOA 1DU4A 2EP5A 3R7AA 4BGVA 1WUYA 4INAA 3A9CA 1T9CA 4MV5A 4JMPA 1HNNA 2R6ZA 4WERA 3NKVA 4DYHA 2NGRA 4O1MA 3GLKA 4RORA 3SS7X 1AUAA 5DEOA 1VGVA 1K5GA 4DNQA 4CI9A 3AUTA 2RHHA 4DLNA 3K9BA 3EFOB 4JT8A 4D9JA 4DQKA 4XK8F 2AQHA 2WSYB 1JFTA 4NCIA 4NSNA 5JSKA 3GL9A 4WKCA 1NWCA 1QO0A 3GCGA 2P30A 4WINA 4GZ3A 3NWBA 4HNHA 4ARIA 1G17A 1X7GA 3PFCA 3ZQJA 2W6MA 1AQJA 5U4XA 4DC1A 4IHAA 3NS7A 2W6JD 4Q24A 4FKZA 1TKBA 5C52B 5LYYA 3LUKA 4J9UE 1OZGA 3TECE 2Z3WA 2WT9A 2CLDX 1LV7A 2ZBVA 4FYXA 1MO6A 5EYPB 2RGHA 2ZTHA 3KZVA 3U7JA 3P20A 2JGLA 1G64A 4M60A 3Q4GA 2D3TA 1KFJB 3HBLA 4C78A 2G3YA 3CO5A 1EP3B 2QXUA 2NSLA 3G9TA 4ALKA 3RVSA 2OXCA 2TS1A 5BSGA 3K5IA 1JKJB 3A36A 3BA1A 4C04A 2OTCA 1HR0B 1ZM7A 4Q4HA 3PC3A 1PJJA 1MQSA 3K53A 1L6RA 4FXOA 4OP3A 4CM1A 4Y2RA 3ZDQA 5JD5A 1RCTE 2B35A 1FDUA 3ZU4A 4JELA 1GPDG 3BF8A 2GBFA 1RRKA 3ROZA 4M0PA 1WKVA 2Y3IA 4FWBA 1GSAA 4K81B 3ZJUA 2HCRA 4J91A 1OGJA 3EPKA 2P41A 2XVMA 5AUPB 1WDMA 4DUGA 5CUQA 2ENUA 3R3WA 3J7AS 3TLEA 1EEHA 4OX9B 4RV4A 4XIYA 4YUXA 4P6VF 1HDOA 5FNVA 3AFOA 1UEJA 2XQIA 5TPWA 2R6DA 3TTTA 2O57A 2TRSB 1GZ6A 3H4VA 4FWDA 3VR6A 2Q6OA 4G4SO 2HREA 1PK9A 3LDGA 2G7ZA 3CEJA 2C9DA 8AT1A 4RS4A 2PS1A 3KJFA 8OHMA 4G4OA 1P5RA 3RYHA 3MGBA 4YCSA 5BV8A 1XTRA 4OM7A 3P2EA 2X4AA 3KEGA 2WVGA 4LRQA 1CUFA 2TMYA 5ITQA 3KKMA 4LFAB 5FBLB 4AYWA 1VB5A 4Z4CA 2H7YA 1OFHA 4UD6A 4JI6M 2AL7A 3PC7A 1F2UB 1HX7A 3JQAA 1XAIA 5KUTA 3N6XA 2CEAA 2HSGA 2VAXA 4LRTB 5BSEA 1LSOA 2H2DA 3A3NA 3D7RA 3I1FA 3IXQA 4Q7JB 1L0BA 1FQOA 2BI7A 3I53A 1LTKA 3NMUF 3AI2A 4WV3A 3T4EA 2XT0A 1K6MA 4QRDA 1NV9A 1JBKA 3QKSB 1JB9A 4DV1B 4ZVKA 4RK7A 4TXMA 5EC8A 5KQ8A 1VI5A 1ZI9A 1SUPA 4ZQIA 3ZW7A 4E1BA 2CNWA 4KPYA 4QDKA 1R8XA 3M34A 4DJFC 4YY3B 4ZJYA 2WJVA 2ERCA 2RK4A 3PDCA 3X1DA 3DXFA 3ZDBA 4RPHA 1Q77A 2JI6A 4WBNA 4BQPA 4XVRA 1GLGA 5IWAB 4EL0A 3WADA 4R8MA 3DO6A 5ES3A 3KLNA 1KOFA 1M66A 4TMTA 5DHTA 3ZY6A 2Z08A 4GQBA 1OXVA 1QO7A 2DVWB 2HBQA 1VHLA 3EW9A 3FVWA 3N75A 3A6GA 1Q17A 4F1WA 4CLRA 1DB3A 1FFHA 3QVSA 2O8FB 1GQRA 2DI0A 1DX4A 1TU4A 3D9QX 5D8DA 2YFQA 5AYVA 3BMOA 2N9UA 4YQEA 3HP1A 1L5WA 2R1ZA 4YY3M 1ZH6A 5JPCA 1AHPA 3DTYA 1P9NA 2VZEA 2FEXA 1A5SB 3RABA 1E4OA 3WYDA 2Z6AA 3OZCA 1ORYB 1T5SA 1DC5A 4E1VA 3C74A 2JI7A 4H4EA 3AIMA 4A15A 1HK7A 4G1VA 4PPNA 2G8NA 2JGIA