3K92A

Crystal structure of a e93k mutant of the majour bacillus subtilis glutamate dehydrogenase rocg
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
418
structure length
418
Chain Sequence
SKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD-specific glutamate dehydrogenase
publication title Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties
pubmed doi rcsb
source organism Bacillus subtilis
total genus 160
structure length 418
sequence length 418
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.2: Glutamate dehydrogenase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k92A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k92A03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3k92A02
2FMUA 3JQCA 3V2GA 2UV8A 3EVNA 4ZGWA 2P5UA 4MKXA 4R68A 2B36A 2OXIA 3ABIA 1I33A 3P19A 3AUTA 2J5QA 3MZ0A 4E5NA 1AHIA 3A4VA 1RPNA 5LDGA 2WYWA 3ETEA 3PQDA 2GUGA 4JROA 4UUPA 5JNLA 4D3FA 3OJFA 1VL8A 2Q99A 1OMOA 5CPBA 3GDGA 2HMWA 4ZRMA 1FDVA 2VWGA 3I6QA 3S2FA 2FY8A 4CQLB 2QQ5A 5L7TA 5ILGA 2W8ZA 1UR5A 2C5AA 3VZQA 4RVUA 3OQ1A 4YAEA 2AG5A 2VHWA 1E6WA 1K6IA 2W2KB 3FF4A 4Y6SA 2DBVO 1R4MB 2C82A 4MVJE 3HDQA 1MFZA 1DIBA 4MIEA 2IEDA 1EFKA 2GGSA 4GVLA 2JHFA 5L51A 5H83A 1HZJA 1T4DA 4WUVA 4URFA 1Z82A 2E49A 4YDRA 3L9WA 4MP3A 2PZJA 3ST7A 8LDHA 3RFVA 1KEWA 2QRJA 3NGXA 2RIRA 2HJRA 1IYZA 1PGJA 3EW7A 4XQCA 3TJRA 3FTPA 1PJTA 1B7GO 4M49A 1GYQA 3TOXA 1GYPA 4J7CA 1VC2A 3U4DA 1Y5MA 2NTJA 2ZYDA 3P5SA 4YAKA 4JLWA 4WCFA 3IL2A 3JQ7A 1N9GA 1JKIA 4RJTA 1XU9A 1UZLA 2PNFA 4YTEA 1G1AA 2PKQP 3H6KA 3ZN2A 1E7YA 5EIOA 4R3WA 3Q9UA 2BH9A 2BFPA 4ZJUA 4MO2A 4CMCA 3PP8A 2NLOA 4L4RA 3WGGA 1NXQA 4CM8B 2DTEA 3CE6A 4U8GA 4NJMB 2G0TA 3DMTA 4NFSA 4CMHA 4IBOA 1XSEA 2YJZA 1LX6A 1LLCA 3WMXA 1Q1NA 3RQSA 4YJHA 1HEUA 2OBNA 4PG4A 1XA0A 4IJUA 3Q9NA 1OC4A 3GVHA 2J3HA 4IDBA 5HRUA 1BVRA 3OIFA 1I3MA 4H16A 5F5NA 5I7VA 4QTZA 1BXZA 2WSBA 3NEPX 5A02A 3H2ZA 1PZHA 3GGOA 4BL5A 4N5LA 1HDCA 2DPGA 3HFSA 3H9QA 4GX5A 4PIVA 4ZHSA 3MJEA 3BXXA 3GEDA 4CMBA 3LT2A 1TT5B 3B20A 2EW2A 3BMNB 1CWUA 3VDQA 3S1LA 2NV6A 3C7AA 2YZ7A 3QP9A 1DC6A 4TRMA 5IG2A 1X14A 1EDOA 4BKUA 1P1FA 3EC7A 3EK2A 3B1KA 4L4XA 1D1SA 4L0QA 4RPKA 2HUNA 1SEVA 1F8FA 2FOIA 2JD0A 4IJKA 4ALLA 1E3SA 1N92A 1Y81A 2NWQA 5CFZA 5JO0A 4MVJF 2X23A 1P3DA 5L4LA 3OMLA 1KIFA 4GX0A 2EERA 1XHLA 3CKYA 2Z1NA 4WASA 1NPYA 1YBAA 5TQVA 1EUCA 3GR6A 3FBGA 4ALNA 5JSFA 4E4YA 4RLHA 3S55A 3VH1A 2EGHA 2X0RA 3U4IA 1DC3A 4MP6A 5KJFA 5HA5A 3GVXA 4ALIA 5JDCC 2C2XA 3AJRA 3DXFA 2VQ3A 1I0ZA 4A0SA 2FZEA 1XQ1A 1PQUA 4PZEA 4YRDA 2GPTA 3ADPA 5G0VA 1QYXA 5FF9A 4D0RA 4D7AA 1H5QA 1I30A 1JKFA 3AOEC 4IIUA 2YV3A 3TF5A 1RYEA 4OXNA 1P0CA 3R3JA 4LCEA 2HO5A 2IYPA 1PZFA 3H4VA 1J5PA 4R9SA 4B79A 2XXBA 3RROA 4E32A 2EG9A 2WEKA 3LC1O 3LLVA 4QSMA 4CQLA 4NU6A 3WR5A 1IUKA 3KRTA 4CMEA 3I1JA 1M6HA 2EWMA 2Q50A 1X1EA 1EQUA 2I9PA 3TFOA 1FDWA 2PD6A 2ZCUA 1R4MA 3QSGA 4J0FA 3WJAA 1Q7CA 5IFLA 2VZ9A 4A5OA 4P4LA 5HWSA 2PGJA 4BNUA 3KSZO 2J5KA 5JMWA 1NQAO 5JC1A 1XG5A 1PGNA 3R1IA 4GX1A 3WIEA 4CV0A 3JQ6A 5CP8A 2A94A 2CSUA 1NR1A 4J43A 4NG5A 3TZKA 2YYYA 3D7LA 3BTSA 5JYEA 1UH5A 1TA4A 4CM1A 1CIVA 5KIAA 3DZJA 3B1JA 4K6CA 1KBZA 1ZUD1 3RAJA 3JD4A 3MJ4A 2GSDA 4CODB 2GD1O 2Y1FA 4HP8A 2VNAA 3OH8A 4DWVA 4TMFA 2O23A 3AU8A 1GFSA 3IJPA 2W2LD 1GY8A 1BW9A 1SMKA 1MC5A 1B3BA 3K6JA 1JWAB 1ISMA 4O1MA 3W8EA 1JVSA 4MDHA 1EE2A 4CM8A 4YT2A 2QYSA 2NTNA 4XJSA 3S2EA 4WLUA 5KVSA 1YDEA 3PHIA 4DIOA 2NNLD 1F14A 2WJPA 2X7HA 3JD2A 4Q3CA 4RDHA 4AJNA 3U0BA 4WEQA 5HS6A 3QVXA 3QJ5A 2OMEA 5IZCC 3NGLA 2HK8A 3BTVA 4PLZA 2B37A 1V3TA 1PJ4A 4R3NA 1A27A 1ZO8A 1E7SA 2YY7A 4IZHA 9LDBA 3DC2A 2VRBA 3PJFA 5GZ1A 4FCCA 1Y9AA 3FR8A 1GQQA 2IEBA 3JYOA 3VPSA 3ROQA 3U62A 3H3JA 3DHYA 4LSMA 3WJ7A 4DPKA 4EUHA 4WEOA 4YWJA 5B37A 2A92A 1ENZA 4UUNA 3BMNA 2JFFA 1KC1A 4W99A 2HAEA 3OA2A 4CM9D 1C14A 5KVVA 4I9NA 2ZJ0A 4J90A 3V1TC 4CM7A 1QV7A 1PJ3A 5IJZA 5IN4A 2H63A 3RU9A 3C7CB 3W4KA 4YB8A 3L6OO 4ALJA 3NUGA 4GWKA 4EZBA 4LMRA 4A7PA 1VE9A 4RQUA 2DU8A 4X54A 3ZNNA 2ZTLA 2OBYA 3H9GA 1ZJYA 2PH5A 4NBRA 2V65A 5TLSA 1GUYA 1U5CA 3QWBA 2A35A 3IP1A 3OSUA 4ID9A 1B8UA 4R4JA 5GZ6A 4MIYA 3ZNPA 5KJ1A 4R1SA 3GUYA 4F6CA 3I9MA 4FB5A 2D8AA 1VL6A 2YHIB 1Y9EA 3UCFA 3GZ4A 3ZHZA 5K6AA 1FJHA 3QW2A 4XB2A 4NIMA 4FSHA 5MDHA 4UREA 2IZZA 1Y8RB 1ONPA 1NYTA 3INGA 4GQAA 3JQ9C 5FI5A 2UDPA 3C1AA 4PLHA 1WP4A 2VUSA 1RM3A 3ZU3A 4CMIB 4KUHA 3L4BC 3KHUA 4J3FA 4GVXA 4RVSA 3OP4A 2CDAA 3M1LA 4Q3DA 2G76A 2POQX 2UUOA 4BNWA 3FPCA 4HFJA 1ZXLA 2X86A 1IB6A 3WQRA 3ZV6A 3KO8A 3WX0A 1V3VA 3JTMA 3GGGA 1YL5A 1CQJA 2VOJA 2V6FA 4OO3A 4IS3A 4J91A 1UP7A 2D2IA 3ORFA 3INRA 2WE8A 4LRSB 1BHSA 4XR9A 3KYCB 1SOWA 4YJFB 4TRRA 4L8VA 1ML3A 4MKRA 1DAPA 4BNNA 4B3JA 4OHUA 3P2YA 2O4UX 4U6SA 3IUPA 1DJQA 1Z73A 4HNGA 4E5PA 2EP7A 5ENVA 1JAXA 3NRCA 1JVBA 3OF2A 1QKIA 2AMFA 5EPOA 3GZNB 3ZU4A 2VN8A 4FIZA 4ZQBA 3E18A 3WWYA 2VYVA 1Y5RA 3HDYA 3NDIA 1HSOA 3ITKA 3JQFA 3LU1A 2PV7A 4XZ3A 1VJ0A 2CVOA 3ZU2A 2RHCA 1RM4A 4MP8A 4J1SA 1NWCA 2GZ2A 4YAJA 4YR9A 1E1NA 2D3TA 3KM0A 4BIIA 4HBGA 4JJIA 3WLFA 2FHSA 3CUKA 4OGWA 4I08A 4P22A 2DKNA 4HV4A 5DZSA 1GEEA 3EDMA 2O2YA 1R0KA 3AI1A 4E21A 4CM9A 1YVEI 3ICCA 2VWQA 4N18A 3NDRA 4U7WA 3PIDA 1BSVA 1VLLA 2ZB3A 3N7UA 4PLWA 5G2OA 2YQ5A 4D44A 2JHGA 5JC8A 4PVDA 1PQPA 4NQZA 3H9UA 1IPFA 4ND3A 1VM6A 3DHNA 1EE9A 1P1IA 4L9RA 1K5HA 1KY5A 1MUUA 1C1DB 4AJ4A 5I8WA 3FNGA 3GEGA 3K92A 2CVZA 1U4SA 5C7OO 2CMDA 3NKLA 4QO8A 2GNAA 3RUHA 3HZZA 2DC1A 4H7PA 3FWZA 3V5NA 3H5AA 4PG8A 3DAGA 3JQAB 2HK7A 4GGOA 3ZI0A 5DNAA 4YT5A 4DBVO 1GPJA 2ZIZA 4LW8A 4E5YA 2GDZA 1PJBA 3L07A 3F5SA 4CQMB 1BGVA 4RVFA 3M1AA 1C1XB 1IL0A 4OIMA 5ILOA 5ICMA 2DUUA 3GGPA 3UCEA 2YQ4A 2OUIA 1GL3A 2I3AA 2PH3A 3COSA 3K73O 4WCFC 4BKPA 4YT4A 2WTBA 3AUAA 1UAYA 4OKIA 1YO6A 4A73A 5C7LO 2A4KA 2Y0CA 2P9EA 3WICA 4BNLA 5IXYA 4ESOA 1IZ9A 1FK8A 1LNQA 3WQSB 1Y6JA 1WLYA 4GKBA 3UAGA 4MVJD 4MPDA 1TB4A 1CRWG 1A72A 1X7HA 3JQAD 1ZXBA 5KTKA 4FJ2A 1A9YA 4XX0A 5G4KA 1Y1PA 3DMTC 3H8VA 1A7KA 2BFOA 3H7AA 5DBGA 2O48X 2ZB4A 3C85A 4CQMD 1YH3A 3ON5A 4BNGA 1Y8RA 1EVJA 2Y05A 3HNPA 5COQA 4LVCA 3I52A 4IQGA 4RPHA 1DRWA 4CMIA 1BDBA 1E3JA 4Z3DA 3DOJA 3HSKA 4KDFA 3LVFO 1ULSA 4WLEA 3T7CA 2HRZA 3RWBA 1EUDA 3DZIA 3DZFA 4EBFA 4MVJH 3PDJA 1P77A 1EMDA 4R1NA 3WXBA 1HF3A 2Q2VA 3G1UA 1RYDA 2UYYA 3WSVA 2NSDA 1N7GA 1LRLA 1E7WA 2B69A 1H9BA 1DDOA 2B35A 4L74A 4Q9NA 1LEHA 1WWKA 1A7AA 2GZ1A 4R1UA 3GG2A 1XELA 2VUUA 4OJNA 4TRNA 5I8ZA 1I24A 4XB1A 1XWFA 3TDKA 4F46A 4TSKA 1PSDA 2NU8A 1F06A 4I1IA 1YBVA 2C5EA 1JTVA 1PGPA 3KBOA 1XEAA 2I65A 3KYCA 4Y8VA 4YJFA 2H9IA 3TL2A 4CV1A 3PDUA 3ZW8A 4M54A 5G0WA 1LSUA 3MJCA 3SXPA 2CY0A 4RQTA 4EJ6A 1LLQA 4BNTA 4EUEA 5AQ1A 5IDYA 3GDOA 5MGBA 2IZ0A 3ZHYA 2J8ZA 2OGUA 4XKJA 2W98A 4YRBA 2WDZA 4R5MA 3GZNA 4Q3EA 4DBZA 3ZV5A 5HTOA 3RD5A 1U7HA 3DFUA 3PJEA 1PJ2A 2LDXA 4BMSA 4DVJA 1V8BA 3Q6IA 4YCAA 2AEMA 2WE7A 1UZNA 3I9LA 1DSSG 2ILTA 1K6XA 3OIGA 1A4UA 4GL4A 3PHJA 4CR8A 1MG5A 3VC7A 2JAHA 2VYND 4A03A 5IDWA 3PYXA 4INAA 5KJ6A 3IMFA 2Q1UA 4FOOA 1GQYA 2FZWA 5A3JA 2E37A 1NM5A 2VCYA 2E48A 4IY1A 2Q1TA 4WLFA 4BNXA 1M6WA 1YB5A 4AJIA 3BHJA 4UEOA 1MXFA 4BO8A 2Q3EA 5TX7A 3UVEA 2SCUA 1RKXA 3NJ8A 4JBIA 1H6AA 1BMDA 3AOGA 1Y8QA 4U5QA 4XIYA 1MFPA 4CLDA 2VT2A 4CMJA 4FGWA 2EV9A 1DIHA 4PG6A 4CMEC 4PN3A 4DYVA 2DQ4A 3RFTA 1NPDA 3I9NA 3ZNOA 3PFWO 4BHTA 4C4OA 2YDYA 3DBLA 3WYCA 1PS0A 5I9NA 2FPIA 4PZCA 1E5QA 3JQ8A 3L4SO 3QVWA 4GLOA 2HDHA 4J4HA 3QLJA 2OP0A 3JQAA 4J1TA 1KOLA 1VJ1A 1QG6A 1VJTA 4LSWA 1NTOA 1EZ4A 2D59A 4LCJA 3L6DA 2F1KA 3K2EA 3JQGB 2BGMA 3PGJA 4FDAA 3PEFA 4RZHA 3I9JA 1EVIA 3NTOA 1N2SA 2QRLA 3QWAA 4XRRA 3VVBA 1C1XA 3FNHA 3ZZNA 2Y1GA 2NVWA 2XF8A 4HFNA 5F1OA 3DTTA 4TKLA 1SB9A 2FR0A 2HMSA 3DHEA 3OHSX 3RKUA 4BKRA 1DO8A 3TN7A 1N1GA 2GCGA 3ZWYA 4N5NA 4K26A 4ND1A 4WNIA 5TC4A 1KVQA 1PIWA 3MTJA 5JLAA 4NHEA 5BR7A 4BKQA 2GF2A 4OQZA 4ZRNA 5CPFA 4OL9A 2DT5A 1JA9A 3D3WB 3SLKA 3U9LA 3L77A 5JY1A 2WMDA 5DOVA 1R0LA 3OECA 3ZWBA 1HL3A 4IM7A 3DAPA 1GZ4A 2OP1A 2EGGA 1HDYA 3I83A 1P33A 2A9FA 5IDXA 1E3IA 4FFOA 3BTOA 2EP5A 3IUSA 2YV1A 2WD7B 3D3EA 4DPLA 3HDHA 2C0CA 3GT0A 2X9VA 4Q3AA 2NM0A 4NR0A 4XQ9A 3C8MA 1E0DA 4J7UA 3PRJA 3GPDG 1HETA 5A9TA 4CM4B 2TMGA 3F1LA 3W4JA 3PYMA 1QLJA 2D0IA 2HCTA 1Z6ZA 1PGQA 3GFGA 4ITUA 3BAZA 3PHHA 1NVMB 2GLXA 2PKRA 4CMAA 5CDUA 5JDIA 1OI7A 3JD3A 1C3VA 3NT4A 5LDHA 5KVCA 1M66A 1XU7A 2DAPA 1M76A 1I10A 1HYEA 1DIRA 2P91A 4WK6A 4XCVA 4XGIA 3SJ7A 1NWHA 7ADHA 3ROPA 1ZFNA 3E1KA 3ZWOA 1QMGA 2BFMA 1S6YA 3TSCA 2X0JA 1ZK3A 1ZIDA 4G81A 4KP7A 3ENNA 4KUGA 4O6VA 3ZWMA 4EW6A 2W4QA 3ZW9A 2VYNA 4FFLA 2PGDA 1UXHA 1AUPA 2C59A 4KMSA 4NU5A 1OC2A 5ES3A 3DBVO 1LRJA 2AEJA 5F3RA 1BRMA 4BO1A 1DFHA 1WZEA 1UAGA 5ITVA 4YA6A 3LZ6A 1ZMOA 4KTVE 4BQPA 3W4IA 3TFQA 1AHHA 3OM9A 2VUTA 4PLYA 3UHAA 4RF5A 3KZVA 4PG5A 4CMGA 3M2TA 5C5IA 2ZJ1A 5K6AC 4D46A 2IYOA 3L9XA 2I76A 3GLQA 3NJ4A 4WOKA 3EVTA 4FFMA 1V6AA 3D64A 3RFXA 3ICPA 3RUDA 2QZZA 1T2FA 1W4ZA 2DVMA 2YFHA 3PJGA 1QR6A 3RC1A 3FTNA 4AJEA 5JS6A 3SEFA 4FD3A 3UF0A 1RJWA 4Z9FA 4IDAA 3GVIA 4QEDA 1QYDA 3GF4A 3GPIA 3CINA 4IPTA 4AJHA 4DREA 1K6JA 4NDNE 3IP3A 1EK5A 4GSLA 3OEYA 1YRLA 2X58A 3WGHA 1O89A 5KJCA 1UXGA 1DEHA 1WZIA 1SB8A 4PRLA 3QWFA 1EDZA 2DBRA 1L1FA 2EJWA 1C0LA 3IC5A 4BO9A 2I6TA 1VSUA 3VAZA 4BOYA 4MVJI 4CLOB 4O5OA 1P74A 1YONA 4EJMA 4UEKA 2DFVA 4BGVA 1UZMA 2BELA 2D1YA 2HKIA 3FCOA 2C54A 4CR7A 2PD4A 5JO9A 1YS4A 1G0NA 2C7GA 1YWGO 2HMTA 3JQGA 4UVIA 4ZQFA 1J49A 1AN9A 3VZSA 4XDZA 2PZLA 1D1TA 4RL6A 5L7YA 3TRIA 1E1LA 1WW8A 3RI3A 1GV0A 1LTHR 2YV2A 1HYHA 3DOOA 4OYRA 3RIHA 1EVZA 4ND2A 1VKNA 4R16A 1I3NA 4PLCA 4O0LA 1GUFA 1B8VA 1KERA 2IXAA 4E0BA 1X7GA 2DTDA 4NBUA 3MOGA 2CDBA 3PPIA 4Z6KA 1K0UA 2E4AA 1WXDA 4C7KA 4BNVA 4D3SA 3JSAA 3I5MA 4PLGA 4R51A 3CMCO 1TXGA 4PG7A 4JJFA 1SBYA 1T1RA 5T5QA 3CSDA 3QHAA 1ZK4A 3EZLA 5DBFA 1JW9B 1N1EA 1M67A 2H1SA 4BO0A 1TLTA 2EKPA 1H0KA 4N54A 1ZSYA 1YJ8A 4FS3A 1WDLA 5K9ZA 1BXGB 4OSPA 1U28A 3E9QA 1Z7EA 2O3SA 5JW6A 5TJ9A 3S2IA 1D7OA 3E9MA 3TZQA 3AUUA 5JCJD 1HT0A 2ZQYA 3KTDA 3PGXA 2R6JA 4Z3KA 3GOHA 2BGKA 2RCYA 1OBFO 1U2DA 3A14A 5IXSA 1UDCA 3ROKA 4XWYA 5H82A 1U3UA 4EJ0A 1SOVA 4Y6PA 3JQBA 2O2SA 4N7RA 1UXKA 3BHIA 2NQTA 2TMDA 2W2KA 3DZKA 1PZGA 3O8QB 3A9WA 1LXCA 1ISGA 3F3SA 3VH2A 3WBBA 2OZPA 5F1PA 1MX3A 5EMHA 1KEVA 2Y99A 5B12A 1ZJZA 3F4BA 2R00A 3KETA 1PWZA 2B4TO 4R5HA 3JQDA 2E82A 4I8XA 2EF1A 2Y66A 1KETA 3H9JA 2Q4EA 3OFSA 1F12A 2XOXA 1Z75A 1DHTA 2Q45A 3FPLA 3SBOA 4KWHA 1Q7BA 1H6DA 3HHPA 3QY9A 5DBIA 3ITDA 4H15A 4E5MA 4XR4A 1XKQA 4RCVA 3GN1A 1ZSNA 4OMUA 3KEOA 5BT9A 1VSVA 4TKMA 3ASVA 3NAQA 3W6ZA 4AJ1A 1R12A 4PLFA 3ZV3A 1UXJA 3JYNA 5G0TA 1ZK0A 3B6ZA 2Y68A 3WFJA 2AXQA 3C7DB 1YDWA 2QZ9A 1ZEMA 4WPGA 3G3EA 1LDEA 4NJMA 4MVJP 5AOVA 4YQYA 1KS9A 1X0VA 3JCZA 4G5HA 2ZB7A 1DXYA 5COAA 3RUCA 1P1RA 1RWBA 1QSGA 2YFQA 1KVTA 1LBEA 2FRDA 2OOSA 2D5CA 3ZGYA 4BKOA 4HXYA 3VHRA 3HJAA 4B7CA 2DUWA 1HLDA 3HQ4O 1B2LA 4NZ9A 3BMCB 1Q0HA 2CZCA 2X4GA 2Z1MA 3GNTA 3UKOA 2HMUA 4CLRB 2JD1A 4TVOA 1NVGA 2G1UA 1VPDA 5B4UA 4CLOA 1E6UA 2WYUA 2AQ8A 1CQIA 2B5WA 1MC4A 1UDAA 4KWIA 1TT5A 4EYEA 3C1TA 3TWOA 3K8ZA 4LRTB 4OXYA 4BMVA 2JL1A 2JAPA 3E48A 3TQHA 3RBVA 3GN2A 2O3TA 2I67A 3M6IA 4ZVVA 3G17A 2DFDA 3ZH2A 4LISA 4GI2A 1PR9A 4FR5A 3U49A 1Y7TA 1SCUA 4GPD1 4H3VA 1SPXA 2JFHA 1IULA 1WNTA 3MJTA 4PVCA 4QFDA 1D8AA 1NASA 3UOGA 4JGBA 5CEEA 5JCJA 2FSVA 3FRJA 4WLVA 4ZQGA 2JD2A 2HRBA 4AJOA 4RF2A 1P31A 3I9OA 6ADHA 3RCBA 2GN8A 3W8FA 2ZB8A 4A2CA 4E13A 4ILKA 3HB4X 3CZRA 4MIOA 1PL6A 4WECA 3BMQB 1QXSA 1DFIA 3EY4A 1O5IA 3GRPA 1GUZA 3HDJA 3T4XA 1ZBQA 1E7QA 3IDSA 3SC6A 2DTXA 2VOEA 5FFFA 5FEUA 1PEDA 4JBGA 5L3ZA 3S8MA 1I3KA 3ZWWA 1NHWA 3QVOA 4S1VA 3NT5A 1DAOA 4IDDA 1ZSVA 3ZWXA 2IE0A 2O7QA 1HDZA 5L7WA 1QYVA 1R6DA 1E3EA 3BIOA 4IMPA 4E12A 4XGKA 4GWGA 5KVQA 1T2AA 2JCVA 4B8ZA 1I2CA 1J0XO 1PWXA 2ZYAA 3EUWA 4B4WA 3HFGA 1YGYA 4LN1A 4WKGA 3ZV4A 3VDRA 4I5FA 1PTJA 4W9NA 1HZZA 3KSDO 1W6UA 2G17A 4QFCA 2X8LA 3NX4A 4QX6A 1X13A 5T57A 1I01A 2PK3A 3ZU5A 2W2LA 4BO5A 4ND4A 1Z7BA 1MXHA 5ADHA 1XCBA 3QVSA 4RVGA 5A5FA 3KLPX 4B4OA 4J1NA 4MOWA 2GZ3A 3LSYA 4DIFA 4RO0A 3IKTA 4BB5A 3DFZA 1PGOA 4OQYA 5KKAA 1QYCA 3WTCA 3DZBA 5ICSA 2VHXA 3WTBA 2HQ1A 1ZMTA 1HTBA 4RV9A 1PJQA 2DLDA 5AVOA 1UXIA 3MTGA 1WDKA 1H2BA 1R4NB 4BNMA 3PQEA 4HFMA 1A71A 3VPGA 5TF4A 3GK3A 4YRAA 1ZZEA 2CVQA 1PL7A 3BHMA 2PGLA 4FPXA 1LLDA 4J16A 1W73A 4II3A 2I3GA 4LVUA 5DN9A 1YQGA 4FGSA 3ENKA 4B8WA 1LSSA 3OEWA 2QIOA 2Y1CA 1ORRA 3KVOA 1U7TA 5EL0A 1U1IA 3AI3A 3RVDA 5ER9A 5CDSA 4DLLA 2EJVA 1NNUA 3D4PA 5TRTA 2PY6A 2I66A 1AXEA 1QP8A 3W1VA 1BWSA 2AA3A 2NTVA 4M55A 2G82A 5HS4A 1AE1A 4JNKA 1LUAA 2FP4A 5JDIC 2PZMA 4M1QA 1FDUA 3ZHBA 2CF5A 3ANMA 3TOZA 2Q46A 4XGNA 3HE3A 4BNHA 4DMMA 1NPTO 1Q0LA 1HKUA 3HADA 4QT0A 4N5MA 5KNLA 1BVUA 1GPDG 1P9LA 5T8KA 5EQDA 4E30A 1C0IA 1N8KA 4HFRA 3TZ6A 3DEYX 5EESA 3F4LA 4XYLA 2DBQA 2HU2A 4GLLA 5TNXA 3ETDA 2XAAA 3VZPA 1GEGA 2QYTA 3C1OA 4L76A 4KOAA 4RVDA 1DJNA 1NVTA 3LK7A 1UUFA 3K96A 1C0PA 4E3ZA 3MJSA 1PQWA 1HDOA 1FXSA 1PZEA 5F5LA 5K0ZA 2NU7A 3TNLA 5BQFA 1DB3A 5TT1A 1MB4A 3I4FA 4Q3NA 4U6QA 1KC3A 3CTMA 3IKVA 5EJ2A 2I99A 4ZICA 3WIDA 4XDYA 1CDOA 5CDTA 3LC7O 1MG0A 3C24A 1DIGA 3A1NA 3ZWAA 4UVHA 1PR3A 2YHIA 5GZ3A 4TROA 3F5QA 3BMQA 4W7IA 4EUFA 1ENOA 1WPQA 1B14A 1B3RA 3D5QA 3QIVA 1H9AA 3PYLA 1YXMA 1ZKMA 3SC4A 1IY8A 2Z5LA 3RC7A 5C7IO 1R0SA 4JN6B 3RKRA 3JYLA 5CHEA 2O50A 3IAHA 1DIAA 2J3JA 3VKVA 1KVUA 4BNIA 1YOVB 2P2SA 5BNTA 4MVJG 4R41A 1V35A 4OXKA 5TIIA 4JCOA 3E9NA 2O7SA 1V9LA 3RC9A 3WNQA 4IJVA 1VL0A 4AG3A 4CL3A 1E7MA 1JKJA 5JXWA 4XQGA 2J6IA 1S7CA 1E7RA 1ZCJA 4EEXA 1FDSA 3EAGA 2AQIA 3WOHA 1UP4A 5ER6A 3C3XA 3HB5X 5IDQA 2PWZA 4D41A 4IINA 4A27A 4BQRA 4OOFA 1B16A 4FC6A 3SVTA 2Y1EA 2EEZA 3PFFA 3V1UA 1NHGA 3H5RA 4YJDA 1TT7A 4ZU3A 5IZ4A 3VH4A 5DF1A 4CV2A 3Q11A 3KYBA 3WDSA 1DRVA 5DP1A 3AY6A 2GN9A 3NV9A 1B15A 2CF6A 2X6TA 4J4BA 3KYDB 1DFGA 1D4FA 1P45A 2P5YA 4XQEA 2GO1A 2OHXA 2CD9A 2V6GA 1LSJA 1HLPA 4J7XA 2BLLA 3EGOA 3WG9A 3PTZA 5I9MA 3AI2A 1H6BA 1X1TA 2VHVA 4IJWA 4AJLA 4B4VA 2VHYA 5CDYA 3LQFA 1SZJG 3UUWA 4E5KA 1ADBA 3H3FA 5DCUA 3WS7A 5L4NA 2AW5A 1R4NA 3L0DA 1I2BA 5J23A 4EDFA 5ITWA 4NFHA 4E33A 3F1KA 2GRAA 3QWIA 2F00A 1NQ5A 1VI2A 4W6ZA 4CLEA 1FDTA 1SC6A 4IIVA 1I32A 1QRRA 4WCFB 1U8XX 3JQ7B 1HXHA 3JD1A 1PJSA 3PWKA 4YVFA 2CDCA 1H93A 4FQ8A 5L9AA 4CUJA 1E6EA 2HSDA 4G2NA 3VPHA 5JFOA 3K30A 1JWBB 3PQFA 4QO7A 3EYWA 2VRCD 3JQBC 1DRUA 3I4CA 1C1DA 1M2WA 3WQQA 4BO4A 3UCXA 1R66A 4YJHB 3OJEA 3M2PA 4IDFA 3T4EA 1QYWA 1V3UA 2PFGA 3R3SA 4MVJA 4U0KA 3WYEA 4NI5A 2JCXA 4K28A 4QXMA 4BNZA 3JQ9A 1FMCA 4TZKA 4XJTA 3SLGA 3Q1LA 3WGTA 4G65A 3KEQA 4RVHA 5GMOA 2R00C 1XLTA 5HM8A 1GTMA 2PA3A 2Q1SA 2WD8A 3UW3A 3R0IA 4NNJA 5L40A 1B0AA 3UFXA 4CQMA 4CUKA 1ADGA 2BRUA 4BGEA 4K1LA 4OOEA 4JK3A 5IAAA 3W6UA 5C37A 3CIFA 3GC6A 3K2BA 1MGOA 3PHGA 3JV7A 4ZD6A 1QV6A 1CJCA 5TT0A 4UVDA 2B83A 1UP6A 4OH1A 1NR7A 3BMOB 4DLBA 1DC4A 3MOIA 3FWNA 4BNJA 1LRKA 3X2EA 3ONDA 4R01A 3MCVA 5KKCA 5AXBA 1HRDA 4DQUA 4QQRA 1H94A 1H2HA 3A28A 4LGVA 4DA9A 3ETGA 4O63O 1JLLA 3GNQA 3W8DA 4D43A 1KVSA 5T64A 3Q2KA 4BNYA 5FI3A 5DP2A 3WNVA 4J1QA 2NVBA 1F17A 2B0JA 4Y6RA 1I8TA 1E1KA 1EK6A 5BSHA 1KEUA 3WGZA 1RM0A 4GMGA 2BHLA 3PVZA 1BTOA 3Q0EA 3H2SA 5TSDA 5A03A 5I9LA 5JBIA 3VVCA 1OZAA 3PI7A 5AYVA 5A4DA 3N58A 1D3AA 3ANLA 2X9NA 3IJRA 5CG1A 5A3VA 1NFFA 2YUTA 4WLOA 1NQOA 5CG2A 3WGYA 5CEJA 4B3IA 1GCOA 4RLSA 4PLVA 1LQUA 3UXYA 4E2ZA 4YPOA 1NP3A 1ONOA 2BKAA 5IF3A 4HKTA 3QWHA 3AM4A 2AQKA 1HDXA 3G0OA 3IQDB 1XQ6A 4FJ0A 4JX8A 5L95A 4AJ2A 1YQDA 3K5PA 2GERA 4F45A 5CDGA 1A9ZA 2FPPA 4KUEA 1EBUA 1L7DA 1IHYA 4Z0PA 1LI4A 1T25A 3HN7A 1EFLA 1YQXA 4GGPA 2C20A 3DMYA 4RF3A 3JD0A 4P8RA 2P68A 3NTQA 4PZDA 2BI7A 4Y98A 1SO8A 1G0OA 1MLDA 4L4SA 3R6DA 2X5KO 2FR1A 4GH5A 1HE3A 1U5AA 4J2HA 3KYDA 4NBWA 1Q0QA 3Q2IA 3DTYA 3UICA 1X15A 2Q1WA 4QECA 3UN1A 1FF9A 4M89A 1N7HA 2AG8A 4AICA 4CMKA 1LQTA 4WLNA 4CLXA 4Z0HO 5G4LA 2WYVA 5AXDA 4NBVA 4PLPA 4XYGA 4DQVA 3WYBA 1SAYA 2YDXA 1I5RA 2VRCA 3CEAA 5DDIP 4PGFA 2NACA 3B1FA 4BO6A 4IDEA 3AU9A 4EI2A 2O4CA 1O0SA 2IRWA 3NYWA 3A06A 5A04A 1T24A 2VTDA 3E5MA 1ADFA 4GKVA 1ZH8A 3LDHA 2AHRA 4CJXA 2BI8A 3GDFA 2DM6A 3INTA 1K2WA 2QRKA 3DZGA 1YB4A 5KWEA 2FWMX 4TQGA 1U4OA 5JPIA 3QVTA 3P2OA 3E5RA 3OETA 4EEZA 1SNYA 2OFPA 5A05A 2ZTMA 1BW9B 3VPFA 3B70A 4WJZA 1UJMA 3G1TA 1LDMA 3BA1A 4W9NC 1U9JA 3TZCA 3VH3A 1ISFA 3O4RA 2C2YA 3ROMA 2O3RA 1HWYA 5DOZA 4IXWA 1GZ3A 2X0IA 2VZ8A 3QRWA 4HADA 1E3LA 4L73A 4M8SA 1YL6A 1LDBA 1ENPA 4ZN6A 2YW9A 5A5EA 3RBXA 4UVGA 1T2CA 3GHHA 2AQHA 3DQPA 4FW8A 1AGNA 3PZRA 4J2OA 2AE2A 1HSZA 2ET6A 4E2XA 3MJVA 1IHXA 2ZTVA 3BZUA 3GHYA 2H5LA 1L7EA 1YB1A 2FN7A 3AW9A 5L4SA 4UAGA 4ZA2A 1ZK2A 1GCUA 1M75A 1MV8A 3JQFC 1XYGA 2R2GA 1IPEA 4EGFA 3BMOA 4AJJA 3WGIA 1DOHA 2OO5A 5T6BA 3K9QO 1ZNQO 4TWRA 1TI7A 3NTRA 1T1SA 2EKLA 1U8FO 4HUJA 1ZEJA 3D3WA 1YKFA 2ZK7A 1LLUA 5EN4A 2FSSA 1NX6A 1F0YA 3FNEA 1O95A 3D5TA 3FD8A 4UUOA 3WFIA 2XPCA 1J4AA 3AM5A 2VTEA 1GAEO 4WNCA 4AJPA 2WD7A 4YQZA 3U4HA 1E3WB 3OJOA 4UULA 3RSHA 3DO5A 2OL4A 3FHLA 2WM3A 3LT0A 3WGOA 1XR3A 4BO3A 5A1TA 4J0EA 2JKVA 1K89A 2FR8A 3PIIA 3VZRA 4IZIA 4CM4A 3EMKA 3ZWNA 4YAIA 4D0SA 5H81A 4NFYA 1VRWA 3P7MA 5T8KC 1JDJA 3QV1A 1A5ZA 5BSGA 4KDEA 5JAIA 1ISHA 1C0KA 2J3KA 3O9ZA 4BNFA 4PRKA 5B1YA 3L6EA 3RBZA 1P1JA 4I9HA 3FNFA 3ONEA 3GNSA 4XYBA 4DC1A 5LC1A 1RM5A 3AK4A 1YE3A 4LMPA 3I6IA 1JAYA 2V6MA 4IGFA 1PS8A 3IIEA 5TGDA 4C7JA 3OJ0A 4DUPA 1WDMA 5JMPA 2HJSA 4CLHA 3WBFA 4AVYA 1ZW1A 2PZKA 1YJQA 2Y0EA 5G0SA 4XYEA 5BSFA 1ADCA 1P1KA 2GN6A 3KLMX 3GEMA 5DCYA 1I3LA 3QQPA 2E6UX 1PJCA 3V1YA 4O59O 3G49A 1LJ8A 3F46A 2VHZA 2HLPA 4FN4A 4B3HA 1R16A 4YJGB 1CETA 1NAHA 3GRKA 8ADHA 3RUIA 4YAGA 2C7VA 5JAZA 4HWKA 2EXXA 5EERA 4IQ0A 5U4QA 3CMMA 5U1PA 3AWDA 1ULUA 3LYLA 4ALMA 4CL8A 1QORA 3FI9A 1PU2A 3O38A 4DRYA 4RPLA 4ZQHA 1BG6A 2V7PA 1P44A 3LT4A 3KXDA 2NVUB 1XIVA 3PZBA 3RUFA 4FJ1A 1U3WA 5TJHA 3WLEA 5B4TA 2Q4BA 2V6BA 4DXHA 1VKOA 4WE3A 2ZCVA 2VNSA 3FSRA 4FFPA 1K3TA 3VOSA 5JY6A 4DMLA 1IOLA 5F1KA 3G79A 1E5LA 4ALKA 2RH8A 4D45A 2VYVD 3PLNA 5AXAA 4DYDA 5COBA 3AFMA 1NBOA 3E03A 1LDYA 3FN4A 5KJEA 2CNBA 4W4TA 3U4CA 5FYDA 4YXFA 1GU7A 5T67A 3H9EO 1EVYA 3D4NA 2JJYA 4QUKA 3RUAA 3WMWA 2BD0A 1ARZA 2UVDA 3AUSA 4JXKA 3PLRA 2BGLA 4NJOA 3ZWCA 1DLJA 1UDBA 2JFGA 4LK3A 2X1HA 4BGIA 5A06A 4JP2A 3GY0A 4E6PA 1Z74A 3GVCA 4A10A 4W82A 5I7EA 3DL2A 2C07A 1ZK1A 2NUAA 1T2DA 4XRGA 4R69A 3ZWPA 3DAFA 2J3IA 1EEHA 2O3JA 1KY4A 5EINA 1ISJA 1X0XA 4P38A 2VWHA 1GZ6A 5F21A 5L45A 4BVAA 1BXGA 3IOYA 1KVRA 4ZQEA 3LF2A 1GDHA 5I7SA 2HMVA 4RPGA 1E3WA 3K31A 5G4KB 3KOUA 3GAZA 1LA2A 4CM6A 5I7FA 1PS9A 3LT1A 4XD2A 3D4OA 4RZIA 1JQBA 4AL4A 5JCXA 1Z45A 1JN0A 3UGKA 4IS2A 4Q3BA 2I5PO 2NADA 4CPDA 3OBBA 5TS3A 5L53A 4B7XA 3H5NA 3DZHA 2EHDA 1Q2XA 3SJUA 2BF7A 4BUCA 2NU9A 1WMAA 4XIJA 3O8QA 5JE8A 2PLAA 3ADOA 3OICA 2CFCA 3D1LA 3ZDFA 4AJKA 4BV8A 3V8BA 5G0UA 5B4VA 1LU9A 1LDNA 2UAGA 3D0OA 3EZYA 4MINA 4CUZA 2VZ0A 3DBRB 1EBFA 4GX2A 4I9UA 4I5GA 1X7DA 3AY7A 3LC2O 3F6YA 4WGGA 1MA0A 3WSWA 2IDZA 4DQXA 5ENDA 2Q2QA 3GH3A 4BO7A 2X0NA 2H6EA 1LSOA 1E1MA 3RASA 4DIBA 3ULKA 4DL9A 3QE3A 3UH1A 1XDWA 2C29D 3O26A 2PTGA 4BB6A 3MWEB 4M87A 1WMBA 3NDJA 3OIDA 4YYZA 5U9CA 5C3MA 3GVPA 2RH4A 3H65A 1DBVO 4GMFA 2PKQO 5KOIA 3F9IA 4Q39A 4U0JA 1HDRA 1O8CA 4YJGA 2Y93A 4J4TA 4R54A 3DR3A 4BMNA 3PWZA 3V2UA 4EITA 3HUDA 4NK4A 5THKA 1NAIA 2ZQZA 4PLTA 4CV3A 1O94A 2HK9A 1KEPA 3FR7A 3S2GA 3BYZA 4ONEA 1KYQA 3BMCA 4KZPA 4Z0TA 1HE4A 1BDMA 2NVUA 4FC7A 3VTZA 3CZMA 2AEFA 4K6FA 2WWRA 4CLRA 2B4QA 2VWPA 3PXXA 4Z9YA 5JDCA 4YT8A 1P1HA 4K9DA 1HDGO 2PR2A 2X5OA 4JQCA 4B7UA 1NFQA 3Q3CA 3PJDA 4S3MA 2P4HX 3DB2A 3ZNQA 4DC0A 1OFGA 5CEFA 3TZHA 1LDGA 2RHRA 3DWFA 3AOEA 1DC5A 2CUKA 4JJGA 4WCDA 1Y8QB 4YBZA 1I2ZA 3MWDB 2GASA 4RORA 4OKNA 4II2A 1ISIA 1IZ0A 2AE1A 2RAFA 3KSUA 5DCWA 3WB9A 1LC3A 2IXBA 4NH4A 3LF1A 4D79A 4IUYA 4F3YA 3DBLB 4DTIA 4BGUA 4IMRA 3JQ8B 5KCZA 5IN5A 3DDNA 9LDTA 3HWRA 2GR9A 3EHEA 4IXTA 2DPHA 3OQ6A 2Q49A 3E8XA 3ONFA 5BNFA 2IZ1A 3ASUA 1QLHA 4MJLA 3TPCA 4F6LA 5FWNA 1T4BA 1WAMA 4RPJA 3U3XA 4HNHA 3DOCA 3ZHXA 3DBHB 4KQXA 4OSOA 1CF2O 1P0FA 3DONA 5DULA 4TRJA 5DT9A 3KB6A 4CM3A 4YACA 3VPXA 1R37A 1PL8A 1CERA 3HN2A 4R1TA 3PHLA 5A9RA 3U5TA 3F47A 1W0CA 4OM8A 4FFRA 1YBMA 4KTTE 4CR6A 1EQ2A 1MP0A 1E77A 4NPCA 5A9SB 3GMDA 3OQBA 2D5AA 1A4IA 3LLSA 3MEQA 1J6UA 3AY3A 2G5CA 4Z9XA 5LCXA 4KQWA 2X5JO 3KV3O 3VTFA 3RJ5A 5GY7A 4NK5A 3I9KA 1OOEA 4P4GA 4W7HA 5EQFA 1U3TA 1U2GA 3HG7A 4YEDA 4Y67A 4GSKA 1HE5A 4UUMA 3CXRA 1OAAA 3U09A 1F8GA 3RUEA 1Q7GA 1CEQA 1IE3A 4HY3A 3OA0A 4PCVA 1G6KA 5IZCA 4E2YA 3DBRA 1GV1A 1TVEA 1AXGA 3E82A 2EKQA 2EW8A 2QG4A 3QA9A 5JAMA 1GD1O 1N5DA 4XA8A 4ND5A 4D42A 3I23A 4E2WA 4DPMA 6LDHA 2VT3A 2P9GA 1B26A 3JYQA 4NMHA 4RDIA 3VKUA 3GG9A 4P4NA 3JQEA 4BS9A 2PD3A 2FPGA 4DLAA 2LDBA 1W8DA 4I5EA 2Q2WA 4M86A 4AFNA 4Y9DA 4J9VA 4UEJA 1GYRA 2ZKLA 1XGKA 1WVGA 3GMSA 5HBRA 2O3QA 1CYDA 1N9GB 4J6FA 3N74A 1EUZA 3RC2A 1R15A 1T2EA 2UUPA 3GA0A 4HX5A 1JU9A 4XYMA 4CM5A 4FBGA 2GN4A 2GYYA 3PK0A 3WGQA 2RBEA 4I5DA 4TVBA 1E92A 2Y67A 3GFBA 1ENYA 4E31A 1V0JA 2O3UA 2QW8A 2Z95A 1DHRA 3PWSA 4GBJA 4PFJA 4JP3A 3FBTA 3BTUA 3RJ9A 4MVJM 3GUCA 3JYPA 5JAQA 3TL3A 7MDHA 4GAEA 1GADO 1O9BA 3L4BA 2BFAA 3O03A 4IDGA 4JIGA 3AFNA 3GAFA 4L75A 4BV9A 1U3VA 3I3OA 4A26A 3V2HA 3WWZA 3IS3A 4BO2A 1ID1A 2X22A 1NQTA 4JBHA 5CAEA 1PX0A 2X9GA 3GQVA 4R9RA 4RGBA 4IGEA 3RU7A 3ANNA 4WOJA 2OORA 4BNKA 4XEHA 2B5VA 1T26A 4UVEA 4J49A 2J5RA 4FOSA 2D4AA 2ZATA 3ZCXA 5THQA 1GR0A 1H6CA 2JCYA 2YHUA 2XXJA 2ZTUA 3AM3A 3OJLA 2BMAA 1B8PA 4FFNA 3CH6A 2DBZA 3E6AA 1LC0A 1YL7A 4J9UE 1HE2A 2W90A 4RF4A 4TZTA 2QX7A 3X2FA 3DBHA 1PJLA 4OAQA 2EIHA 1I36A 1BXKA 1O6ZA 3NT2A 3STHA 2P4QA 5JYDA 2NQ8A 2NU6A 1HYGA 2QHXA 4MKZA 1SEPA 3SX2A 3T7EA 4DGSA 5BNIA 2IODA 4D3DA 2Y0DA 4ROSA 4IQ8A 3KUXA 2P9CA 2ZYGA 1YOVA 1TEHA 3CPSA 5BSEA 3ZWVA 4B4UA 4IDCA 5A9SA 1DLIA 1DPGA 1NFRA 5AXCA 1ONNA 1ZVMA 1GQ2A 2Y1DA 4NBTA 2Y1OA 2B4RO
chains in the Genus database with same CATH superfamily
3VO1A 4YLGA 1FVFA 3P19A 3MUNA 1J56A 3V2IA 3LRPA 4UUPA 2PRKA 1VL8A 2Q99A 4ZQIA 5CBKA 5L7TA 2G4CA 4LOLA 2R86A 4M83A 1Z2DA 5F2KA 5CK5A 5HGJA 4NC9A 2JHFA 2V7BA 4URFA 1ZL2A 2PZJA 3BVPA 1X7WB 3PR2B 4M0PA 4XX1A 1PJTA 4UOZA 4ARIA 1WETA 3ZN2A 1EFAA 1Z18A 1R0RE 2ORYA 2IYUA 4R2KA 2DTEA 5E6RA 5G3YA 2BZ0A 2J9XB 4CMHA 4P83A 1J25A 2PFSA 1FU8A 3LUFA 1NNSA 3AKCA 3MLBA 3Q9NA 1P1BA 4MUMA 1Y89A 2P4UA 3GPPA 2VDLB 2EF0A 3EZ2A 3HFSA 2CKDA 3IBYA 3S1LA 2NV6A 3T5PA 1X80B 1JQEA 3FGNA 4JOBA 1SEVA 1YKGA 1RWVA 1ND5A 3TXAA 4YK7A 4GX0A 3HCCA 3SASA 2BWEA 4TLLB 5IRCD 3OAAA 2KDLA 3RT7A 4ALIA 5JDCC 1L7NA 1K7FB 5DI3A 5D01A 2UZ3A 3EBLA 1IBSA 1DJMA 1QYXA 5EWLB 2OD7A 3GLVA 1TVKA 1LBQA 1VKZA 2O8BA 1SKUA 2HO5A 5I51A 1C7QA 1WUTA 4EK9A 1I2AA 4DV7B 5FLYA 2PUWA 2ZR8A 2ANCA 1VXOA 1XLUA 1NRWA 2JJ2A 2QNJA 3OKPA 2WNSA 4IIBA 2PGJA 4EL0A 4ZTUB 4MHTA 4UM9B 3NHFA 3EDYA 3JPYA 1RFLA 3UXEA 4HS4A 5FTWA 1P7CA 1BMFA 4Y2PA 2W70A 3Q9SA 4DV4M 1G8JA 2QRHA 2TYSB 2Q6IA 1E9DA 2C2WA 2F1JA 3QF4A 3BIJA 1E2LA 1ZJ4A 1VP9A 2Z2IA 2X1LA 1J2EA 4MDHA 2FP3A 1NLYA 1PNQA 1X1AA 4YMHA 3EGEA 4KWEA 1NNI1 3MTAA 4LNHA 2R7NA 2BGWA 1V3TA 2AFHE 1T5HX 3HGMA 2Z9BA 1Y9AA 4O02B 1ZICA 1HUQA 8ATCA 2GM4A 5BW5A 2WTEA 5FWYA 2XCUA 4J90A 4CM7A 1CUUA 3PXAA 2XSZA 1Y33E 3USZA 3F6RA 2G5TA 4RQUA 2DU8A 2OHVA 2NU7B 4QULA 2V65A 1T9GS 1QONA 2A35A 4MUBA 2A88A 1B8UA 3GUYA 3ELYA 3P71T 2YFKA 1UM9B 5MDHA 4Y6LA 4LSZA 5K0JA 3MAJA 1E99A 1CR0A 1W0JA 5ALNA 3FOBA 4YONB 4KSYA 5HBGA 5LP6B 3NBMA 2OORC 4LC9A 4QOZC 4QAQA 3PEVA 3CRRA 3N70A 1O4VA 4A8JA 4NESA 2NPFA 2O01F 4I66A 4YJFB 3VK7A 4L8VA 721PA 3LUHA 4OHUA 3D4BA 2W82A 1R64A 4Y2XA 5IT9A 1DJQA 4B7GA 1GGNA 4N0EA 3GZNB 3BIWA 1Y5RA 1LNSA 3OY2A 3KHKA 1YLAA 1VJ0A 2IOQA 4NC6A 2GZ2A 5HF9A 1JSLA 4DNQA 1KY3A 3ACDA 2AN3A 1JEDA 4DBGB 1U04A 4OV6B 2WNHA 2YQ5A 3IQEA 1Z0KA 1JFRA 3AFHA 5JQGB 3IECA 4N0MA 3PE3A 5ELMA 3PQ5A 3FNGA 3GEGA 4YAWA 1FMJA 2H31A 5LA6A 4A3VB 1X3SA 3PNKA 4BFWA 1GPJA 2YVQA 1E61A 2BKEA 1WU8A 3I39X 4QA9A 4TMYA 5IULC 4TMXA 1TCAA 4GLFA 1U1EA 4G8BA 1VRCA 3AG6A 4BVKA 3A2LA 4WNAB 1HFEL 4G4IA 1U8CB 1IXYA 1JALA 4NZZA 3EGXB 3I30X 5FI0B 2JIPA 2EOAA 3HSKA 4RY0A 5BMVF 4KDFA 1L4HA 3DZFA 4LJYA 3WXBA 3G1UA 1XMQM 3CU5A 1HNXM 3B3QA 4HDOB 5I8ZA 4IMJB 3TDKA 4IQFA 3KYCA 4GPIB 3U17A 2F9MA 3GDOA 3LCJA 4JLUA 2OGUA 4XKJA 3HM2A 4KGDA 3RD5A 1U7HA 1VG9B 3DFUA 5EZSA 3IBGA 1YS9A 4NZOA 4Q12A 1DSSG 5TPWB 1MG5A 3AJ9A 1EGHA 4UDXX 5KJ6A 3DOIA 2UXDM 1Y8ZA 3TKYA 2GQFA 3PX2A 5JU6A 2VZEA 5JXIA 3AOGA 1Y8QA 2INGX 2HQSA 2ISSD 4E08A 2VRWA 4MRPA 1X3LA 3BE6A 3SJZA 2G5PA 3AINA 4GC9A 1YAJA 2IH2A 2HDHA 4J4HA 1POXA 4JWKA 4GNKA 2V7GA 3A6HA 3A58B 4ER0A 2BMDA 3PX3A 4TKLA 3EFOA 2PGNA 3DHEA 2AWNA 2YZMA 4JI2B 3NVDA 3ASZA 3D3WB 3QI2A 1RRVA 4IM7A 2EDCA 1JECA 1HDYA 2C3YA 5DNWA 3GP5A 3IIIA 2QRPA 3ZE7A 4YCCA 2V5VA 2NM0A 1HX7A 5KPRA 3W78A 2IZ6A 3B89A 1KJYA 1GGVA 1JEQB 2TMGA 4Y1GA 4A8TA 2OXRA 2D0IA 2HCTA 3OUUA 3PHHA 3ZJYA 2R1VA 4Q7JB 3CYFA 5C8ZA 3SJ7A 4YRMA 3Q0TA 7ADHA 5K8JB 5EXEA 3TSCA 2YVLA 4U9UA 1KAGA 2R1UA 1OC2A 1UAGA 4YA6A 4EF6A 3DKKA 4NZNA 3FMFA 4ER5A 4AN0A 4EFMA 3VHXA 3BRCA 2DVMA 4IR7A 3L0SA 3GVIA 3NWPA 2XOKA 2VQFB 3AY0A 3M5DA 1KJQA 1WZIA 5KPJA 4NCIA 4BQSA 2W6ZA 4PAMA 2I62A 2KE5A 4BGVA 4FQ5A 1WXGA 3I6YA 5CA1A 4QREA 3FCOA 1YS4A 4BU0A 3ORRA 4BZXA 3EIEA 1LTHR 1X86B 3RIHA 3E23A 1AQYA 1K88A 4PLCA 1B8VA 4QLOA 3H8JA 4B2IA 1YRBA 2QN6A 3HA3A 1KEEB 1XHBA 2HT6A 4P80A 1G2IA 2JI4A 2QUBA 4I46A 3E9MA 1AK1A 4OPMA 5KYWB 3FDXA 2ARKA 1YS6A 1U2DA 4MJ7A 3LBAA 2LIPA 3JQBA 3IV9A 4LXYA 1SKYB 1PZGA 1QHXA 3A9WA 1KIMA 1ISGA 3ODGA 1NZDA 4K6OA 1ATIA 1K8ZB 1VP3A 5AVRA 1X7WA 1UBMS 1EFDN 1Z75A 2I4NA 5DI9A 1MKYA 1LF5A 4TKMA 5G0TA 2QTVB 3W04A 2Y68A 3KJIA 4LXHA 1Z5VA 3U3DA 3KQMA 1W76A 1Q17A 5JHGB 3IPXA 2FCAA 1Y6FA 1CZLA 3GNTA 2JD1A 1YV9A 4ZV7A 5KNDA 4MV3A 2ODQA 3R2JA 2W42A 3EIHA 3HB7A 1QH8B 2I67A 3GB9A 3HYTA 4YMVA 1SCUA 4BMCA 4QFDA 1SBTA 4I55A 4GKJB 2JD2A 2GN8A 2FSUA 2NUTB 5DM2A 3L43A 5ERXA 2V7VA 2WHXA 2Z3VA 1PEDA 5L8RF 4JBGA 5EWLA 5FPYA 1BDHA 3ZWWA 1HT2E 1ZSVA 3ZWXA 1TU3A 4A23A 3VPCA 5E7JA 2ZJ6A 4RTKA 1X38A 3BIOA 4F1KA 5KVQA 2LVOC 4ZVQA 1M33A 4FZ5A 4UPVA 2QRVA 1G63A 1Z4IA 3FLEA 4KQFA 3SM3A 1I13A 3IKTA 4BB5A 4I4TF 4MWEA 2C4MA 4UFNA 4IIGA 3AF4A 1TD9A 3HN6A 3LPMA 3I73A 1WDKA 4H6WA 4RANA 2WG2A 3GK3A 4FT4A 2BDEA 4NCXA 4H17A 3UK1A 1TKBA 1G42A 1PCXA 1MMFB 4RYLA 1AXEA 3H3XA 1LUAA 1F0NA 3BD8A 3JRNA 3H2JA 4FLMA 1AU9A 1T8WA 7ABPA 5KNLA 4D97A 3VU0A 1KPGA 1KH2A 2XNJA 4FFWA 1MU5A 2QZ4A 4EY3A 4HUTA 1PP4A 3MJSA 4KPUA 1W7AA 1PZEA 2NU7A 1R2YA 3TNLA 5BQFA 1DQYA 2Z6UA 4F06A 4BKMA 3I4FA 2HF2A 3V46A 2CVPA 3CTMA 4EM6A 4JI4B 4QOGA 7REQB 4OBWA 4EUFA 2I03A 1B3RA 4R71A 1KSFX 1G5IA 1CZNA 5TF0A 4EA9A 3VKVA 5BQOA 3IFSA 3SX4A 2C5FA 3AB8A 2J33A 4AG3A 2AHMA 1VL0A 1S7CA 1J0AA 1OXBB 3D1VA 3SQDA 5KHOC 4HNRA 2DQSA 3IAFA 1RYZA 1D2RA 3CCCA 3N8NA 4LA4A 5BW6B 1UBCA 2OFOA 2QN2A 4FP9A 3U6LA 1VYHA 4IIWA 4BX3A 2B3DA 1NVXQ 1F8XA 3RH0A 3T9FA 4MGZR 5CGZA 3SJCA 2BLLA 5I9MA 4B4VA 3LQFA 1SZJG 5J23A 5ITWA 3RAGA 4II7A 4DSNA 1EKXA 3UXMA 4ZOCA 1ZW6A 4QBHA 2VBFA 2JIRA 5E4JA 1OV6A 1DXOA 2CDCA 3B9BA 3GELA 2X15A 2CP8A 5JQGA 1JXQA 1JWBB 3PQFA 4FVTA 4RD4A 4GFDA 1RAEA 2PFGA 4QD3A 4CIVA 2C3PA 2XVMA 4CF3A 3VSEA 3HACA 3GFPA 1HT3A 2QZJA 3UW3A 2WYHA 4L4ZA 2QROA 2AMLA 2RFLA 1FXWA 3AR4A 3K2BA 4UZSA 3DMGA 1VBKA 4R01A 3A28A 4WN9A 4PDIA 2JJMA 4WNAA 4RZQA 2QW0X 1F17A 1N3IA 3EGXA 3PXCX 3S29A 2XRZA 5GTDA 3Q0EA 4KQ6A 5JBIA 4TWZA 4DAOA 1ZH2A 3RYCA 3IJRA 1JB1A 3N8KA 3T4PA 1NQOA 1N2CE 3BGVA 1SULA 1GILA 1YNSA 4TQ9A 4ZHQB 3SHTA 3IQDB 1ZAYA 3D5EA 4P2GA 4QDJA 4WK2B 4X65B 3KAPA 2Y0BA 5K3BA 2QGZA 2XNDA 4EENA 2FPKA 4F7WA 4GH5A 4CF6A 1MBZA 1Z6PA 4NBWA 2VBGA 1X15A 1YDMA 2ZM6M 1EXDA 2H0RA 1E2BA 3NDBB 4R8RA 5AXDA 1RHJA 2H4YA 3S7ZA 3L6BA 1XEXB 1IN1A 4DR6M 3EIUA 3LDHA 4BXOB 1UDXA 4ESVA 4OGFA 2PKCA 1CNFA 2OFPA 2HR1A 3O8RA 4W1QA 1GWNA 1IC6A 5AD1A 4PZUA 4XCQA 1IRIA 5JXGA 2EX0A 1LDBA 4Z7JA 3S70A 2D2XA 2GYVA 2IV2X 3BZWA 1F8UA 2B4YA 3UAVA 4OATA 1SVSA 2DPXA 2Y1WA 3HU3A 4AC9A 1VHWA 5HQ3B 1ZNQO 2R8YA 4RETA 4D9MA 4B0PA 5ALUA 2NUAB 2GBLC 1SC4A 4HUJA 4L7VA 3D3WA 3EISA 5FOQA 2Z3ZA 1BDJA 4GPZA 3U4HA 1M8FA 1MORA 3U48A 1J21A 3RSHA 1RCTE 3QLVC 4WY2A 4Y9SA 3LWBA 3J81k 4IZIA 3QV1A 2XV1A 5GP1A 1C0KA 2J3KA 1VZ3A 2E89A 4Q1FA 3HWX1 5E38A 5D3MB 2IYFA 2YWGA 1RM5A 4H35A 2JIZA 3O4HA 2Y0EA 5D1HA 3MJRA 1VMIA 2G88A 2Q62A 1BMQA 1I3LA 4JY7A 1AMUA 5FNZA 4PTZA 4UCFA 4DUZB 1LJ8A 2VHZA 3LO8A 1KQFA 3FKEA 1CETA 2JGEA 5JAZA 4N1AA 4CL8A 2RC5A 2WJ4A 3A1TA 1BG6A 1P44A 4AUNA 1H42A 4FI3C 3FRIA 3EWNA 2N35A 2IF0A 2AFIA 4W1PA 3W77A 2DUMA 2QUKA 5I7HA 1GNLA 3LGXA 4X60A 3RDPA 1WUYA 3DW1X 2GBFA 3IR6A 1BU5A 1HYBA 3LY8A 4LK3A 5EIHA 5IAOA 3IALA 1YVPA 2C4TA 3GVCA 4ZV9A 5E3IA 3KC2A 1N0UA 1SFRA 3GJYA 2CFTA 2AK3A 2IEGA 3QYBA 3HB0A 5F21A 1KMHB 2NVOA 3C6QA 1X94A 4BVJA 2ZXEA 5FOWA 1M2OB 5EXPA 1FS5A 2ZJ2A 4RTLA 4RZIA 2OHGA 1T5LA 4DV7M 4TKVB 2WJAA 2D7DA 3NPAA 3A6ZA 1FLVA 1VHQA 2ASEA 2Z09A 2IHNA 4KLRA 3JWPA 3LC2O 4FLFA 2E18A 3AGQA 3IPCA 3S44A 1SU8A 2B7LA 3AYZB 4QEKA 4X7RA 3TRKA 4BB6A 4AWBA 1MT0A 3T7TA 2QTVA 3SBEA 4EVRA 2SKEA 3K6RA 3A9TA 1UBEA 4J4TA 4MRAA 1KI8A 2OD2A 2GJSA 2AD5A 4CKWB 1GGFA 1YZYA 3WO1A 2Q2NA 1U2PA 2DP4E 3Q3GE 1ES9A 4LKRA 1ST3A 5ECWA 1GZ5A 2EKFA 3HYSA 2QN8A 3H75A 3LVRE 3LFHA 4EGAA 1XO1A 1QH8A 4D79A 3AF0A 4GICA 3IIKA 4MYRA 2XT9A 1B76A 5I5EA 2XTNA 1JDSA 3KSXA 3ONFA 1LI7A 5FWNA 3LPAA 3A25A 5FOTA 2NUTA 1FNDA 4DEXA 3GLHB 4PYQA 3CUTA 3NXKA 4LXUA 1EWRA 1JSCA 3KVWA 4Q3LA 1YBMA 4FN5A 4L22A 5A9SB 2FHPA 1ESCA 2NZXA 4KLCA 3A3PA 3MEQA 2G5CA 2K7FA 1UCFA 5FWXA 4OQXA 1PRBA 1QRUA 2EX4A 4A36A 2CNLA 3VSDA 5EQFA 2CBZA 1O5OA 2HC9A 1WXXA 3E2MA 3DULA 2CWBA 1NW6A 3RUEA 3I5XA 1DWPA 4TTAA 1XI2A 1P3Y1 3ZYCA 2V98A 1FRFS 4I1SA 4D42A 1EGVB 3JYQA 3FYUC 3IP9A 5DHRA 3NATA 4F4UA 1A82A 3VU9B 5C51B 1M0EA 4UCWA 4M86A 1OZHA 3WBJA 4RV5A 3M6WA 4C5CA 3A2NA 2JGMA 1JU9A 4EY5A 1OWLA 3G2OA 4DE5A 5A1JA 3WKEA 3WGQA 2W83A 4AQDA 5JCZA 1WCYA 2QZSA 3VO2A 3GFOA 1OH6A 3CRW1 3QBVA 3EVAA 1E3DA 2Q3MA 1QU3A 2Q21A 4CVNA 2MSLA 4C4PA 1U3VA 2H1OA 1EE1A 2PUHA 1I7NA 1ID1A 2PBRA 4HVLA 4WK4B 1F3OA 4BNKA 2RHOA 2Q3HA 1P60A 2V7QA 4PBSA 2XITA 3VC2A 3ZC7B 3P4YA 4J9UE 3NEYA 2RGEA 2AX3A 1VMDA 2O7NA 4KODA 5FTNA 3LIIA 1H85A 4IDCA 4HL4A 4LQDA 4HOYA 1XCPA 2XUHA 4HDCA 3OTHA 1WCXA 3V2GA 2UV8A 1RKQA 3ABIA 3M6LA 2C8JA 2R46A 2HN9A 2PLRA 2ZAIA 1UBKS 1D4OA 1U81A 2VBCA 4AMZA 3AV0A 2GPWA 1DGGA 3E53A 1JT9A 4W5TA 1U65A 3WADA 2IT1A 5C4IA 2DULA 1T4DA 4L72A 4MP3A 4LIPD 3N7AA 1PRYA 2QRJA 3E1SA 2O20A 1PGJA 4XQCA 5CFNA 3H1FA 2B8JA 2ZBQA 3RSCA 3IL2A 4BMXA 3ZGVA 2EJCA 1N8NA 3NV7A 3FWHA 5BSRA 1TGUA 3FLMA 1EJ6A 2E2WA 2QMEA 4NJMB 2CJFA 3ZCUA 1YA6A 3VVLA 4ZCSA 3U6BA 4PG4A 2XFTA 2OOAA 3OIFA 4RLQA 4H16A 2HL7A 1XA3A 2Y2VA 1U7ZA 2XGGA 2ZUFA 4J2TA 3ROFA 1UFKA 4PZ9A 3F97A 4QFMA 3V33A 3RJTA 1X14A 1KR2A 3JZIA 5LKAA 3QQ5A 1COZA 4C04A 4JI2M 3B53X 4GLJA 3EDQA 4W9MC 3K2IA 3GLUA 3E15A 5TQVA 1OE0A 4DR7M 4KQIA 2H65A 2QRMA 2W6QA 1E8DA 4OI2A 3FJOA 3RC3A 4ZHQA 4P3NA 2CUZA 3F6SA 3D02A 1RLIA 5CBPA 3TF5A 5ICGA 1RXWA 1J5EB 5KNBH 3EXFB 4U7DA 2EG9A 1UKZA 3IESA 5DASA 1WKCA 5HZHA 2DPLA 1UJ6A 1TJ5A 2ZCUA 3RT1A 4BQOA 5HWSA 3QENA 1XNGA 3LMKA 1TF5A 4RUKA 3AI7A 4JYPA 3WIEA 2WJIA 1XEXA 2HXGA 1K6MA 3WKAA 3WK7A 2FN3A 4HRAA 5AP9A 2GCEA 5KIAA 1PZNA 4MUFA 5ADUS 3IBTA 1H5UA 2ASVA 4AW4A 3QFHA 4N7BA 2VQFM 4RZ3A 4NX2A 1JLHA 5E6SB 1ISMA 1EE2A 2QYSA 2VT7A 4JHLA 5KWJA 4AJNA 3DUFA 2P77A 2Z8YM 3BTVA 2Z4RA 3FPKA 3PUYA 1NATA 3VR2D 3FMGA 3FR8A 3IKJA 3JYOA 3ZK9A 4HAWA 1TYCA 4EUHA 2JFFA 3U7QA 1KC1A 1IVYA 1ZI9A 4ICIA 2X8JB 3ZZUA 1U2EA 1JMYA 4GWKA 5DTRA 3QEBZ 3GP8A 2C42A 2X2EA 1TM1E 1MJNA 2BR3A 1HYQA 4R8MA 2L7HA 4L27A 4R1SA 3TQTA 3TUZC 3R40A 1Y9EA 5GKNA 3DMPA 2ZRIA 1FMTA 1R6XA 2CDRA 4HRXA 5D3MA 1UMKA 3W1EA 3KU4A 3PICA 3O2NA 3WX0A 4AURA 3H99A 2IY8A 3UJ7A 2DY1A 3GJ8A 1ML3A 1GU0A 4URHA 5CXQA 2JGRA 2O7RA 4JQSA 2DNAA 3RKSA 4N41A 4FIZA 1R74A 3AYXB 1RVV1 2CVOA 4QUAA 3QOXA 4MP8A 1JUDA 4HF7A 4KNVA 4FX5A 1UPBA 3FRHA 4C29A 5ALPA 5DTIA 4AN1A 4HC4A 3A8TA 5JC8A 3WIUA 5I8WA 3BORA 3KJZA 3ETNA 4C4TA 1C8KA 4QO8A 2ZXUA 1NVVQ 3G5UA 1H6UA 2ZIZA 4UHHA 4GKJM 5IAEA 3I0NA 5ICMA 3UCEA 2OUIA 5D5QA 5EIEA 2AW3A 2WTBA 4ESOA 1OHHD 1H4QA 2VSFA 1WEKA 1JDBC 2OBXA 1M2OA 3ZKWA 4XCXA 1V6SA 1Y8RA 2CV1A 3C0KA 4JP5A 3Q87B 2FFJA 5HP4A 4FILA 3STWA 4JLMA 4OJYA 4R1NA 3K72B 1ZM7A 5F2NA 5BT8A 4L95C 4X8HA 1H9BA 2AR9A 1A7AA 1EVLA 4R1UA 1SJ9A 2X3FA 4R2LA 4U02A 4QGHA 3RVLA 1W8IA 3KQNA 3SXPA 2YH2A 4RXTA 3PF8A 2IZ0A 2AF4C 3CJTA 4YRBA 3O0TA 4DCOA 3B7NA 1Q1AA 5DB4A 3VYRB 5DNEA 2AEMA 4R3DA 3PHJA 1XUOA 3L1VA 2ZJBA 3SQWA 2FH0A 1GQYA 3QBEA 1M6WA 2Q7OE 3R6GA 3L04A 2SCUA 3KHTA 4JBIA 3DF7A 5LJIA 1NPDA 1OGIA 2OQRA 2C7BA 3K2QA 2VJKA 4E6EA 4QQFA 5LYYA 4KYVA 3I9JA 1EVIA 3NTOA 1RLMA 2NXEA 3GLHA 4PYKA 3EB9A 3TN7A 5AKGA 2VAWA 2QM7A 4CKEA 1IOZA 4KIJA 4DJDC 5KNCA 2H8GA 4XOIA 4ZRNA 2WHPA 3WK5A 3SLKA 2GM9A 4NFLA 1P33A 5DVZA 1E3IA 1OI2A 3BTOA 2EP5A 3MS2A 2YV1A 4RJIA 1YNOA 1DGHB 3JAKB 1P9NA 4GR4A 2X9VA 4S04A 2YWDA 2O8NA 2VDNB 5FJIA 5HJ2A 1HETA 2H07A 4BASA 1Z0AA 2K47A 2PKRA 2DAPA 4P7FA 3MCWA 1USVA 4PXYA 2X76A 2DHDA 3QI7A 1FTGA 4JC4A 3HDVA 3GFVA 3ENNA 3R5KA 3ZW9A 2PGDA 3DBVO 1XTVA 1CY4A 1XVVA 4WKOA 4L3VA 4DV0B 1ZMOA 4CMGA 5KYGA 3EVTA 3L0CA 3H5OA 3PJGA 3OM1A 3FTNA 4RFVA 2A2ZA 1RJWA 3TTYA 2O2EA 3GF4A 3IT2A 4PQFA 4ZO4A 1SB8A 3QWFA 2EJWA 1M74A 3L01A 4BFZA 1VSUA 2PT9A 1K5DA 1XAIA 5HJ5A 2Q6TA 2E5LB 4NBKA 3MRXA 2VR1A 3B1YA 1SBZA 2LPMA 2ABWA 2VKQA 3TOSA 3PUXA 2YV2A 5JROA 4CDMA 3C9PA 4GI5A 5GJBA 2WKSA 2E4AA 2WMYA 3NEAA 4C7KA 3H05A 4MLCA 1O96A 2X42A 3KJNA 5JCJD 4FHEA 2ZQYA 5J2TB 2HREA 2R6JA 4Z3KA 1TTTA 1WABA 2RCYA 2E3JA 5IXSA 1KZGB 2P30A 2IHJA 3FCUB 1UF9A 5FRDA 1P18A 2H3EA 2NQTA 3GRRA 3U81A 2HI0A 3WBBA 2OZPA 3LHIA 4H27A 1XAGA 5M5BA 2PUJA 4KWHA 3AJIB 4H15A 3G9UA 2XW6A 2QTGA 3JYNA 5HF6A 3QPCA 1JG4A 1KO7A 2A5GA 4NJMA 3I05A 5AOVA 1KS9A 1II8B 4JFAA 1QSGA 4M9XA 2HU7A 2CYBA 1NJ8A 4BKOA 3WLRA 3HUTA 1XRSB 1GG5A 1LS6A 4KN5A 1YIAA 4E14A 3IA7A 3DYVA 3OLCX 1MQAA 1ZGHA 3WV5A 2IPLA 2LVQD 4RTOA 1N2HA 2JAPA 3RJMA 4UTXA 1PZMA 3E48A 3CUWA 5FH9A 2VA8A 2DFDA 1HPLA 3FHOA 3SYNA 2J6CA 1TLFA 5B64A 3UOGA 2HRBA 3T1OA 3U4MA 3EXHC 2NT3A 4TYNA 3EG5A 5EE1A 5AOBA 1J23A 2BBWA 4E2FA 3B5JA 1NHWA 3QVOA 3NT5A 3HCDA 1ZVQA 5LZ9A 3ZHSA 3W5CA 1YGYA 5EE3A 1ZV1A 2WU4A 1RLTA 4RVOA 1I1QB 3IPRA 2G17A 5BY2A 1CJVC 1O6GA 4WXRA 1XCBA 2VZLA 5A5FA 1Z26A 3AHIA 3BKXA 2CLFB 3EXIB 4IG4A 1OXMA 3JR5A 3WKBA 4DILA 2I4OA 1Q3TA 5IARA 4DUZM 2ORVA 3LYHA 5LZ4A 4NBSA 1UXIA 3BWEA 5ITXE 1X8JA 5TF4A 3W5HA 1W73A 3QOFA 4LVUA 4B8WA 4E15A 4K2HA 3ZCTA 3W1VA 4LBYA 2G82A 5JDIC 1HLGA 4OHMA 1NPTO 3DT8A 2SHKA 2A57A 3V34A 4LRTA 2FEAA 2HU2A 4W8OA 4EPVA 2X8JA 1GLGA 5FAKA 3VZPA 5GONA 1RLUA 1EGMB 3C1OA 2DLCX 5EMJA 1ZOLA 2QWXA 1BMTA 3QY0A 2FWPA 2Q3FA 1OYVA 5K0ZA 3E84A 2GBPA 3QUSA 4BJHB 2I99A 3T5AA 3A31A 3QIVA 4BP8A 1R0SA 3RV3A 1N6KA 1VFNA 1G3QA 4MYUA 3RC9A 1PT8A 2QCUA 4YMUA 4EEXA 2PJRA 2FFRA 1ESZA 3KKNA 4YUYA 2DWUA 5TQ0B 2IS4A 3L8GA 5J2UF 3CNNA 4MGIR 2FW9A 4E4RA 4YUZA 1KDTA 4UOQA 3K35A 4OQPA 3ZGOA 1G8GA 1BROA 3G8DA 3CZQA 4I4LA 2AW5A 2QMOA 4Y9TA 1MW9X 5FDFA 2L69A 1KBOA 4W6ZA 4RKQA 1FSGA 4EMTA 1RDFA 1SC1A 4PC2A 3KOZE 2APJA 3RS4A 5ESRA 3WQQA 3C7KA 2JNHA 1ZGBA 4XXHA 2IYSA 1Q0TA 1GCGA 1V3UA 3KEQA 1MO5A 1NQUA 5HM8A 3MK31 2FQXA 5FPHA 3TZLA 3UFXA 5IAAA 1NQVA 1X92A 2YJNA 4ARCA 4UVDA 2C4NA 5J47A 1Z0FA 3MOIA 3C1UA 3M6XA 3ONDA 4L5IA 5AXBA 1AKNA 3H84A 3A0UA 1HR0B 3EA4A 1P5JA 1UDRA 4BQEA 3H11B 1OZFA 4A2PA 4B74A 4F5WA 2ZSEA 5AW5A 2K87A 1B0PA 4Y28F 4RWZA 4JENA 1NFFA 5CG2A 1K2VN 1UFVA 16PKA 3B82A 1Z4QA 1SHLA 5CDGA 2WF7A 3R8XA 4KUEA 2BE7A 3KXKA 4RF3A 1Y4DE 4L4SA 3ANXA 2WOOA 3CW9A 4M89A 2AG8A 2O1EA 4PGMA 4AG6A 4PYNA 1XMSA 1M7GA 4RA9B 4DYHA 1BCRB 3BB4A 2Q8NA 1MOQA 2PXAA 4JJ4A 3AEXA 3U1BA 3A3NA 3UMCA 1G1MA 2IU3A 2ZTMA 1BW9B 4WJZA 3G1TA 3FWKA 2HZ7A 2O0MA 4MPTA 3K8OE 3DF9A 3FZQA 1X19A 5EIXA 1ENPA 1T10A 1SURA 3GHHA 1WLSA 2ET6A 4JITA 4KRYA 4MGIE 3L92A 4DCCA 4XWTA 1GCUA 3JQFC 3FKQA 3WNBA 5DRTA 3O8CA 1XB2B 2QX4A 4HSGA 2FSSA 1QF7A 2ZR0A 4EO7A 2XT6A 5BR4A 1NC3A 3WO0A 1RYMA 2QMHA 3QPVA 1SVMA 1Z7YA 2FR8A 4Z4GA 4KE6A 3M4JA 4EG7A 1F2UB 3TG8A 2ONJA 3KXEC 3UJBA 3FNFA 3GNSA 4DC1A 5KWSA 1FP2A 4AF7A 2V6MA 2P6PA 1MABB 2ECPA 2QYHA 4RU1A 1Z39A 2DZOB 4QEZA 1JFFB 4IV8A 3WMFA 2W2XA 2A1TS 3KLMX 4PRZA 3NBXX 5BO5A 2OZVA 4HH3C 1TZKA 3G49A 3DUWA 3MTQA 5LOVF 4IRMA 2Y76A 4MEJA 5U1PA 1IWOA 3II6X 4EUKA 4DA4A 2WA1A 4LXTA 2HQRA 5SV2A 3G9ZA 1DAKA 5IKOA 2D7HA 2VQEB 3VR6H 2XMRA 4Z9BA 5FTKA 1G2OA 3RK1A 1INLA 5FIUA 1OI4A 1XRNA 3LIPA 5KJEA 3GP3A 3DVLA 3PU6A 1BYIA 4M0LA 4Y2UA 2WUFA 1JE0A 1XZFA 4N76A 3NH9A 3U37A 5EKDA 5BR8M 3OLYA 3MB8A 3DL2A 5HF8A 4GH9A 4PIPA 4BBAA 1SHZA 3P9QA 2BFFA 3QPBA 2VWHA 2B9VA 1ORYB 4KBFA 2PX5A 2YCLA 1ZITA 1OH5A 1Z6QA 1J5EM 4NEQA 1W2HA 4AL4A 1OZGA 5L53A 3WLKX 3M6MD 2BF7A 5LNK1 3L49A 2CFCA 4TLCA 2XMZA 3F5DA 4RD2A 4K6HA 1R0YA 2UVPB 4MYCA 1GTG1 2JGDA 4JFRA 3J81A 3LW8A 3SC2B 4DIBA 4C08A 2C29D 2GXUA 2FUG1 5CW1A 1KEKA 1KZ6A 2F5NA 1L7MA 1II8A 1S01A 2X6QA 4BMNA 2NIPA 4PC6A 4PLTA 4CEIB 4KZPA 1V8DA 4DLSA 2FG6C 2NVUA 4LNAA 1T8PA 4PAQA 1LDGA 4NATA 4WCDA 4YBZA 4POAA 5AK4A 1Y7IA 2XLCA 4G0VA 4S0ZA 3K8QA 1VA5A 4LFBB 2WPDA 3MTEA 2ZI6A 1II0A 2Q49A 2IZ1A 5F9MA 4H7EA 2DH6A 4O4IA 1CF2O 1C9KA 4OM8A 4BVGA 2HM7A 3RK4A 2CLSA 4NPCA 4JSRA 3ZV7A 3OQBA 1ONBA 3ZDZB 4Z86A 1ULZA 1KU6A 2SBTA 3KV3O 3RJ5A 4DIEA 3I9KA 1OOEA 4P4GA 4W7HA 2R47A 5LZ2A 1GPYA 4B46A 5IVDA 5CDHA 1QZZA 4AF6A 4Y67A 4IIHA 3WAGA 3HYNA 1CEQA 4M1ZA 5IZCA 4XVQA 2XBLA 1ZLXA 4MDFA 2WFLA 4P3XA 2XTZA 2EYQA 2CC2A 1W29A 4LECA 2EZTA 4P4NA 3PENA 2LDBA 4DNFA 4LG1A 4LBZA 4ZOLB 4Y9DA 3M5PA 2BPOA 4GOND 1E79D 1RP1A 2ODBA 3GA0A 1OREA 4FBGA 4Q5IA 1W88B 5B36A 4N3GA 2GLUA 5KAPA 4I5DA 5GGYA 5SY9A 2Z95A 1Z5UA 3EWSA 4FMPA 3CA8A 4KK4A 3PEYA 1F5NA 2H1LA 3J2PB 3KS4A 1VDDA 3QW4B 1KJIA 2J9ZB 1N1MA 2J5RA 4OX9Y 2XE4A 3AM3A 1JG7A 2LVNC 1VECA 1XJCA 3JAMS 1KK1A 4ZEOA 4KE7A 3NWBA 2AN5A 4ATNA 4NSRA 2IU0A 4HAVA 5IX8A 2JZNA 1DEAA 2P9CA 2CV2A 3ZWVA 2QW1A 3CSUA 3ZE1B 3W2EA 4A0GA 4D6PA 3ROTA 2XQJA 3A4VA 3DEKA 4C06A 2V55B 3DGEC 4ESEA 5LZ5A 3R8FA 3LQYA 1IDN1 1UT5A 1EWVA 2W6ID 2W8ZA 1Y1QA 5GWXA 1HI9A 1E6WA 2WIKA 4KGVA 4MIEA 1EFKA 1DX6A 2PJDA 3QYEA 3SHGB 2F3RA 3ZE9A 4L1KA 3I76A 3N6XA 1KEWA 2RIRA 1B7GO 2FWNA 3SQOA 4J7CA 2RGXA 4N3BA 4WJKB 2GETA 5HRAA 1UZLA 5DN6A 4D57A 4I14A 1UBLS 3PP8A 5IJ0A 3R7WA 3WGGA 4ZI7F 2IWHA 1XALA 2QAIA 3SQNA 2QS9A 1YTUA 4L16A 2UZ4A 2G6TA 3OWHA 4NE7A 4QPCA 3BE8A 3KSBC 3PGA1 5EQTA 3AVUA 4YRJA 2OZLA 3IUQA 3V4VB 3AQIA 1FE8A 2NUPA 5CFZA 4C21A 4DMHA 1P3DA 3AL2A 4C22A 1MC1A 2IL1A 3VAYA 2IYNA 3HRIA 1FB5A 1DBQA 3R7BA 2EGHA 2X0RA 4HO1X 4F4IA 4PZAA 4O2AA 4FYPA 1HNWB 1CVIA 4LF8B 1SK8A 1ORVA 1QNLA 1I30A 3OFKA 2LNHC 3BXGA 1VCIA 4IIUA 2FEXA 5DM60 4OXNA 1VLVA 2BM9A 1H8ED 3MQ4A 3H4VA 5EHZA 3RROA 1UBUS 1KEZA 2KBEA 2F1OA 3S6JA 3BBZA 1DX4A 4DV0M 4AZSA 2VZ9A 4AS2A 4MV8A 3YASA 3R1IA 3QUQA 2A94A 5CP8A 4J43A 5CT9A 3BQNB 2XT0A 5F3WB 1BCRA 1CVRA 1PEAA 2F5OA 2ZAOA 4ZCRA 2CZGA 4ZZ2A 1H2XA 1G3IA 5LXTB 4X7PA 3NAMA 1BW9A 2RK6A 1W0KA 4NYIQ 2H1RA 3BDVA 1R6AA 3URMA 4JHXA 4YCMA 2GCIA 1B6RA 3I9V1 2E5LM 5IM4A 3QVXA 2W6JD 2OMEA 4KFTA 5EZ5A 3D8LA 3LL7A 1XMPA 1EP1B 3OTWA 1PNVA 2TMKA 1GKUB 2CL0X 2C7QA 5CYGA 2VAPA 2PMEA 3KQQA 3WJ7A 4DPKA 3VUFA 4QGFA 2P2DA 2A92A 2HAEA 3SEZA 4CM9D 1X80A 2EDAA 4KXYA 4LQCA 1XB2A 3KAKA 3ET5A 2GM5A 5C9ZA 2ZCJA 1CJKC 2RGNA 2QAGB 3LG2A 3TLAA 5GZ6A 1CD5A 3WL6A 2RGHA 5SY6A 4ITVA 3ZHZA 5K6AA 4ETMA 1ONPA 5C4MA 2FV8A 4B3BA 3JQ9C 3I01A 2FCRA 4OEHA 3RSOA 1L5LA 3F96A 3FVRA 3O1LA 4PW0A 2P8SA 4QUBA 4FCTA 4Q4CA 2ZAGA 2DAGA 2UUOA 3FPCA 1ZRHA 5C31A 4ZZ0A 1TMKA 1ZXLA 3WKCA 3KO8A 5CLHA 1V3VA 2JAQA 3SFTA 1MABA 2WU0A 1G7RA 3GJ4A 3O74A 1JFFA 2Q6KA 2CWWA 4L5AA 3A10A 3BK2A 5DK4A 4B3JA 3L1JA 1TH3A 4E5PA 1V8OA 2GN0A 1JHOA 2PGIA 3NDIA 4FLEA 1YB2A 5LU9A 3IH5A 4XWKA 1NZFA 3D2LA 3KM0A 4HBGA 4WFKA 4K05A 1FSZA 1GEEA 1SBNE 3EDCA 4P3YA 3TMKA 4D44A 1FOEB 1MCZA 2UUAB 1V39A 5BRAA 3AR8A 3K92A 2CGEA 4MDYA 1E9FA 1XC8A 2DC1A 2ZYWX 3JQAB 2HK7A 3HNOA 4QTXA 3AVYA 4X8LA 4B43A 2H2WA 4AB1A 3KJHA 2GEVA 2PH3A 4WCFC 2B8NA 1MO6A 3IAM1 4MPDA 2ZYRA 1ZXBA 5G02A 2AKEA 5DBGA 1SIOA 1UM9A 3ON5A 2I91A 2JVIA 4YUAA 3ANYB 1IHPA 2JIQA 1C3LA 3MFYA 2VS1A 4MVJH 5LP6A 1RYDA 5HCIA 2FPRA 1LRLA 2B69A 2UVPA 1SVIA 1GNQA 4W5QA 3SC2A 2DAMA 3GRUA 4OJTA 1XLWA 4Y8VA 4MVCA 4YJFA 3QHQA 2P8JA 1E4VA 3FETA 3VOAA 2ZWAA 1XTSA 4G1FA 1C7YA 3GZNA 4DBZA 3FB1A 1RI5A 1UMCB 3JSXA 2ILTA 1NVFA 2D0OB 3D54D 3L7CA 5D6NA 2GJ9A 3CEJA 1AKRA 1MJFA 2Q5LA 3KVVA 4LC1A 2E48A 4IY1A 4WLFA 4BNXA 4X91A 5IJ9B 3BWVA 5JCOC 2YYSA 2J31A 3NOXA 2YDYA 1UANA 2J41A 2JGAA 3HJNA 1KOLA 4J1TA 1CZKA 2W9XA 2OXTA 5KYUB 3K2EA 3R5SA 2BGMA 3ESYA 4HDKB 3LCVB 3FNHA 4U1RA 3ZUGA 2NVWA 3S2ZA 1L8AA 3AHEA 4XVHA 4BKRA 4DLYA 4PY2A 2FDRA 4E4TA 4U7HA 5JY1A 4J0IA 3ZWBA 3KXLA 1GZ4A 1RKBA 2QY6A 3PD0A 2YCBA 1OROA 2H7VA 3SG0A 1Z6ZA 3NBIA 1UMDB 3HYCA 1HJPA 3WC4A 1HYEA 2DERA 5AOCA 4XGIA 3WHPA 5LYJF 2IIBA 4FFLA 4I99A 4NU5A 5IUKC 2PWBA 2VDOB 1WZEA 4X64B 3ETJA 2PH1A 1NVBA 4YCDA 1OSNA 2DHYA 1E2PA 3STTA 3ZIAD 1GN8A 2VAXA 1Y6ZA 4LBWA 5TPWA 3SQXA 2XB4A 3CV3A 1SU4A 3IP3A 5BN1A 3DOUA 2GZAA 2A5LA 2R18A 4Q66C 3CCFA 1UEJA 3HGQA 1GPH1 4U2CA 4EQZA 5SZHB 3N76A 5JO9A 2R44A 4ZQFA 5K03A 2IIVA 1GV0A 3EFBA 3LFUA 3M82A 5F2OA 2OHOA 2JARA 1EESA 1NMYA 1JS1X 4E0BA 2IWRA 3DEZA 3IPAA 4Q9DA 2J87A 2XNSA 4C01A 4PG7A 1Y3HA