3K92A

Crystal structure of a e93k mutant of the majour bacillus subtilis glutamate dehydrogenase rocg
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
418
structure length
418
Chain Sequence
SKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-specific glutamate dehydrogenase
publication title Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 160
structure length 418
sequence length 418
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.2: Glutamate dehydrogenase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k92A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k92A03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3k92A02
1EFLA 1I33A 3INRA 4BV8A 4BB6A 3SLKA 3D1LA 1F06A 4HUJA 2PV7A 5GZ1A 2Q3EA 1AXEA 2QX7A 1UP4A 4HFRA 4HNHA 4BNUA 2PA3A 1YDWA 1YQXA 4W9NC 1Y7TA 1OAAA 3DMYA 4ESOA 1HL3A 3NJ4A 2WWRA 1FMCA 1VKNA 4EDFA 2CVZA 4CM3A 2P4QA 4CLRB 1QXSA 4UUNA 3FNHA 4Q3NA 1B15A 1X1EA 1DHRA 2GGSA 1QG6A 2TMDA 3W6UA 3FWZA 4ZGWA 4WLOA 1U8XX 1D8AA 1N92A 1PGOA 3GZNB 1NP3A 2ET6A 1GTMA 5F5NA 4YAIA 1HDGO 3V8BA 3PIDA 2UUPA 3D3EA 1JWBB 3D3WA 3LT2A 4J9UE 1LX6A 4R51A 3RC7A 3PQDA 1DIHA 4IPTA 3TQHA 5I8WA 3C7CB 2DFDA 3JQ8B 3TZCA 3NX4A 1SOWA 2F1KA 3L4BA 1QV6A 3JQBC 1NR1A 1XU7A 4AFNA 3DBLB 3I9MA 2Z5LA 4B4UA 3VPGA 1RYDA 5JBIA 3RROA 4AG3A 2GYYA 3DZGA 4WK6A 2IZ0A 1UXHA 4D45A 3E5RA 3TOZA 3DXFA 1F17A 2D5CA 2R6JA 1O6ZA 1H6BA 1RWBA 2C59A 3ZHYA 5A05A 1GU7A 1H9BA 7ADHA 2O48X 2VN8A 3JYNA 2EW2A 1NVMB 3AUTA 3TOXA 5TX7A 2PTGA 3AY7A 1QP8A 1G0NA 2YZ7A 3WTCA 1OOEA 3ON5A 1SPXA 1EVYA 3OSUA 1DRVA 4CV0A 3RUIA 3JQ9C 2WMDA 3VC7A 4FFNA 4UEJA 5B1YA 3H9UA 1GPJA 2RAFA 1LLCA 3JQ7A 3PHGA 4H3VA 2C5EA 1HSZA 1JDJA 2CVOA 1BDBA 2Y1CA 1U7TA 3ITKA 3PVZA 4NFHA 4ZU3A 2EV9A 1BXGB 3WWYA 1XGKA 4P22A 2NVWA 4MP6A 3RSHA 4FJ1A 4YAJA 4S3MA 1YVEI 2D0IA 1ZIDA 3OQBA 4RVFA 3WQQA 4A03A 4E30A 4BO3A 1E7RA 3U09A 3QA9A 4ZRNA 2C0CA 4DBVO 3EZLA 5ER9A 1XELA 1G6KA 4BGEA 2GCGA 1KVUA 1BG6A 1P33A 1L7EA 4Z9YA 1DRUA 4ILKA 2JFHA 1PJBA 9LDTA 2NQTA 1KERA 4PFJA 2IDZA 3JQGA 4CLOA 3V2HA 1ENYA 3U49A 4IXTA 1NWHA 3WIEA 4TVBA 3DZJA 1P44A 4CM9D 1JVBA 1T4DA 2VZ8A 4QUKA 4YT5A 3ZGYA 3IP3A 4NQZA 1JVSA 1U5CA 4HP8A 4XIYA 2PZJA 4MVJA 1GYQA 3UFXA 3MJSA 4XQ9A 1NYTA 3BZUA 3WGQA 1H5QA 1WPQA 5JSFA 3M2PA 1LSSA 3VPFA 5C5IA 3WDSA 1DO8A 1B7GO 1E5LA 2Y0DA 2CY0A 2OBYA 4GLOA 4CM7A 4S1VA 3GNQA 1ULUA 3DC2A 5F1OA 3WOHA 5IXYA 5U4QA 1PL8A 1UDAA 1XU9A 1NQ5A 2NTVA 1P1RA 3LVFO 5KJ6A 5I8ZA 2CZCA 4NK5A 4R54A 1DLJA 3VTFA 3H3JA 5JAQA 4I9HA 2HDHA 3GMDA 3KV3O 1PJCA 2RH8A 3B70A 3MJVA 5TS3A 1KIFA 3DO5A 1ZBQA 2VWHA 3P19A 2DBVO 3JQ9A 4IJUA 3WYEA 3AWDA 3GUYA 1BWSA 3N58A 3Q11A 1ADFA 1KYQA 4OQYA 3BTOA 4O59O 1F12A 1JAXA 3HFGA 3OM9A 1PR3A 1ENZA 3M2TA 1SZJG 1E3SA 2GZ3A 2O4CA 2Y66A 3E9QA 4CMIB 1U28A 3V2GA 2VNAA 4QECA 5KJ1A 1EQUA 1KY5A 1N2SA 2BI7A 5I9MA 1UUFA 3EY4A 5FEUA 3ZV4A 4AJNA 1A72A 1Y6JA 1U4OA 3WLFA 1B26A 1TI7A 5TF4A 3VDRA 2I3AA 3BMOB 1LUAA 3S2IA 1GUZA 4TKMA 2UVDA 4O5OA 2X9VA 4ZQEA 4H7PA 4IZIA 4CV2A 1QR6A 1E6UA 4L73A 1VRWA 3WGYA 5CDTA 4Q3CA 4JNKA 3IAHA 3B1KA 4JP2A 3UGKA 5TJHA 2ZTVA 3MJTA 3NEPX 1I24A 1BVUA 3JQ6A 3QWIA 5A9SA 3OJEA 3DTTA 3HDYA 4FC6A 4LGVA 1E6WA 2GF2A 1M6HA 2PNFA 1U3VA 4I8XA 4RV9A 4IDEA 4LISA 2B4RO 4OXYA 3KEOA 4ZA2A 1VSUA 3DBHA 3AUUA 3DOOA 4GWGA 1R66A 1EVZA 3RC9A 2Y1OA 1VC2A 2SCUA 4FFOA 2PLAA 2W2KB 3D4PA 4BO2A 4BNKA 3ZWPA 4A5OA 3BA1A 1J5PA 3ROKA 4XB2A 3E9NA 2HJRA 4YAKA 1HDRA 2OGUA 3HB4X 1QMGA 4JBGA 2LDBA 1HE5A 1LBEA 4NH4A 1E3WB 3G1UA 4BNTA 3PWZA 2V6FA 4PG7A 1BXKA 1K6XA 1Q2XA 2OP1A 4R3NA 4E3ZA 2P4HX 4XQGA 3S1LA 2V7PA 4RZIA 1NXQA 3WJ7A 1GPDG 1N1EA 4ALKA 1IYZA 1P9LA 1LSOA 1UDCA 1JLLA 1PJ2A 2D59A 3IUSA 5A04A 3AU9A 4NU5A 1F0YA 2WDZA 1N9GB 3JYOA 1U3TA 3RBZA 3CIFA 1UXJA 3BMQB 4DPLA 2EJWA 1W73A 2GNAA 4A73A 5KJCA 1ULSA 2ZYDA 1N7HA 2C2YA 3NDRA 2Q2QA 1HTBA 3KM0A 4YQZA 1ZEJA 4RDIA 2VHXA 1TVEA 3TZQA 3FN4A 3OQ6A 3WNVA 3IKTA 4IGEA 3AM3A 1IE3A 1CERA 1DC5A 4NU6A 4C7JA 1T25A 3EW7A 4U0JA 4BL5A 1YJ8A 5LDGA 2VHWA 2EERA 3JD1A 4BGVA 3KYCB 2GDZA 1O95A 1XA0A 3F47A 1PS9A 4O0LA 3DZHA 4J90A 4ALLA 4ZQHA 4L76A 1PZEA 4BO9A 2NTNA 3QVTA 1YKFA 3EAGA 1WWKA 5KKCA 1C0IA 4R01A 3QWAA 1M75A 5JC1A 1FDWA 3ZWWA 4Z3KA 4EEZA 4DC0A 1NTOA 5DF1A 2IRWA 3BMNB 4R5HA 3E03A 2QRJA 2X5KO 4BO0A 4E31A 3FPCA 3AOEA 2IYPA 4PLHA 3GEMA 3OF2A 5COQA 3RJ9A 1P1KA 4ALMA 1NQTA 4UVGA 4J1NA 1ZSYA 1J0XO 1Y9EA 1HDYA 1PS8A 3RU9A 3UHAA 4B7UA 2E6UX 5IN5A 4KDEA 1CJCA 1LC3A 3OJ0A 3ZW9A 2GLXA 3GNSA 3AOGA 1M66A 2PWZA 1M76A 3LLVA 3UAGA 1X7GA 3IQDB 3MWDB 3WGTA 4DREA 1H9AA 1S7CA 1O8CA 3QWBA 1HLPA 1V3TA 4FIZA 1ISIA 1E7MA 4FN4A 3GVXA 4AJOA 1ZK3A 1I3KA 1ZK4A 1DPGA 1I2ZA 4NJOA 4YRAA 1A9ZA 1R4MA 2WD7A 2NACA 1EBUA 3GG2A 5B4TA 5JE8A 3L77A 4GLLA 4RF5A 4U6SA 5JAZA 1R0KA 1UXIA 5DULA 3U4DA 1SNYA 3RC2A 3UCXA 1VJTA 4D3SA 5TRTA 3IIEA 4A2CA 1ZK1A 4N54A 1H94A 1PGPA 2AW5A 2BFAA 3EGOA 4Q3EA 2P2SA 5TC4A 1NFRA 2Y99A 4CL3A 4E5YA 3WXBA 4JLWA 2C7GA 1YL7A 3NV9A 3Q9UA 1YB4A 1HE3A 1OFGA 3O03A 1B0AA 5C7LO 2A92A 3PRJA 2YDYA 2NQ8A 3GEGA 3IUPA 4F46A 3ROQA 2G1UA 1HYHA 5A9RA 5L51A 4NBTA 5ENDA 1X7DA 2AXQA 3BHIA 4UUOA 3GRPA 3HDQA 4W6ZA 5AQ1A 4GX0A 3K9QO 3O4RA 1WMBA 4WCFB 4II3A 2UUOA 3MTJA 3SVTA 1FF9A 1PGQA 4WECA 4IMPA 4X54A 2I5PO 4AICA 4BUCA 3A06A 4OSPA 4DXHA 2DC1A 2HMSA 1UXGA 4TZKA 3R3SA 4BNYA 3BTUA 3TZ6A 3PZBA 1NQOA 3FD8A 4GWKA 3WGOA 3KB6A 4QO8A 4XQEA 4DA9A 3H9QA 4UAGA 3DEYX 2OORA 6LDHA 3QW2A 3H5AA 3JQAD 4RF3A 4OXKA 1XR3A 5CEJA 3RUDA 4TMFA 5CDUA 3KOUA 4NBWA 1R16A 4CMJA 1AN9A 3RUHA 2VRBA 4NDNE 2D2IA 5ES3A 2ZKLA 1R4NA 4FBGA 4NBRA 5I9LA 5IDQA 3PI7A 2WE8A 4E5PA 4W4TA 3JSAA 4ZICA 3NT4A 4HWKA 5BNFA 3RC1A 4BQPA 2NTJA 4XYLA 3OIDA 5CPBA 1A27A 1O9BA 2XXBA 1Z7BA 3GHYA 4J0FA 5G0WA 4MIOA 1ORRA 3INGA 3ZH2A 3UH1A 4JJFA 4RLSA 4DMMA 2FPIA 3DR3A 4XIJA 3VZQA 4RPGA 2WSBA 2DQ4A 4WLVA 4JCOA 4FQ8A 3STHA 5IFLA 3PJFA 1HDXA 4UREA 4BOYA 2PH3A 3A28A 1ISMA 4CQMD 5FI3A 4A10A 3ZHXA 5TT0A 3O38A 3H8VA 5IDXA 5DP1A 3ZWVA 1LLUA 5HS4A 4N5MA 5JDIC 5EQFA 3ZNNA 2CF6A 3LT4A 2JAHA 4BO6A 1K0UA 4JJGA 1W0CA 2JD1A 2NVBA 1V35A 1VL0A 4RCVA 3DFUA 5A5FA 4XYBA 1JTVA 1YJQA 3G3EA 4MVJI 2NU7A 3SXPA 1QYDA 1D7OA 3QV1A 4MVJE 5G0SA 5A3VA 3VTZA 4KQXA 4IGFA 3F6YA 4R68A 5CDSA 1N5DA 3B20A 2BGKA 3LC7O 3D64A 3I4FA 5BSEA 4DYVA 1XLTA 5HS6A 4JK3A 4A27A 1LDGA 4JGBA 2G76A 4BKQA 1Z6ZA 5G0UA 1HKUA 2BD0A 3TFQA 1KVQA 2V6GA 2H5LA 4B8WA 5JAMA 4CMCA 2O3SA 1L1FA 3ZHZA 3ITDA 3AFMA 4WLUA 1QYWA 4DIOA 1JAYA 3QIVA 4E5MA 4OOEA 3I6QA 4BNHA 3IJRA 5T8KC 2FHSA 2ZJ1A 1SMKA 1YBVA 4M8SA 4TRJA 5JCXA 1R15A 4Q3BA 1I01A 2VHYA 2OBNA 4ROSA 5F3RA 4Z0PA 1EZ4A 2AE1A 5I7EA 3GGPA 2HLPA 3VPSA 1T1SA 4YA6A 1E3EA 3KZVA 5FYDA 1LDMA 3RU7A 1BHSA 2O3QA 5ITWA 2I67A 3PHIA 4HKTA 2AG5A 5IZCA 3HJAA 3ONDA 4PG4A 3I9KA 4GL4A 4I5FA 4PCVA 5KCZA 4DYDA 5AXAA 3PPIA 5HRUA 2FOIA 5G4KB 3V1YA 3GC6A 4PZEA 2BGLA 4FFRA 3FCOA 3WMWA 5JYDA 1QYXA 3OFSA 3JQAB 1Z75A 2PGJA 2HK9A 1FDVA 3ETDA 2RH4A 4OSOA 4R1NA 2FZWA 5G2OA 2AHRA 3E82A 5FF9A 1MP0A 4CM1A 1C1XA 1NAHA 5CDGA 2ZTMA 4WJZA 1UH5A 1ENOA 4AJEA 4CM5A 3ZZNA 3JQFC 2PD4A 2I76A 1YDEA 3V1UA 3QLJA 1MX3A 1IULA 1V0JA 3GK3A 4NJMA 1DFGA 5GY7A 3LQFA 2Y1GA 1ADBA 2J8ZA 3MCVA 3GOHA 1IHXA 3BXXA 1LRLA 3ANMA 4FFMA 2ZB7A 1XSEA 5TLSA 3B1JA 1E1NA 5BSGA 4GKBA 2ZB4A 4JIGA 3RJ5A 3ZU3A 3FWNA 4MKZA 4CQMB 5F1PA 2CD9A 2YV1A 4K6CA 3RBVA 3A1NA 3ZI0A 3EVTA 4B4WA 4RDHA 1HDOA 1UZLA 3DMTA 4CJXA 1ZK2A 3BTSA 2A4KA 1KEVA 4II2A 2AEMA 1XIVA 3GLQA 1UZNA 1MXFA 1ONNA 2YDXA 2QG4A 4NK4A 4YBZA 4PLWA 1YBAA 4OIMA 2X4GA 3GR6A 1S6YA 1O5IA 3FF4A 4ITUA 4W7IA 3GAZA 5JNLA 2EW8A 2VCYA 3A9WA 5JC8A 1P45A 3OJFA 5EQDA 3SX2A 3JYLA 4J3FA 4BKUA 1TT5B 1DOHA 1K2WA 2BFPA 3BMCB 3QQPA 1EEHA 3ZWAA 3M6IA 2VOEA 2EIHA 3F4LA 1VKOA 3RKUA 1E7QA 5ICSA 1Y8QA 1SEPA 4FOSA 2QRKA 3OIGA 2ZQZA 1YRLA 2EKPA 1LU9A 2HO5A 1NVGA 1Q7BA 1Q7CA 1BXZA 5HM8A 1VJ1A 4XDYA 1WZEA 1MC4A 1ZXBA 3QY9A 1ZMOA 3HZZA 4D79A 3DB2A 3IS3A 4I9UA 1B8PA 1EUZA 4CM8A 4JBHA 2HMVA 2XF8A 2GUGA 1X1TA 2X86A 1VLLA 4WGGA 2PY6A 2YYYA 2J5KA 3QVOA 2OHXA 5FWNA 2BFMA 4EW6A 3QJ5A 4D46A 1G0OA 5AYVA 2TMGA 1YO6A 3D5QA 5K6AA 2ILTA 5JLAA 2Y1EA 4N18A 2VYVA 5IJZA 1LDEA 3R3JA 4ONEA 1PL7A 3T4EA 3C8MA 5B4VA 1MB4A 2GERA 3HSKA 2D3TA 5A9TA 3KRTA 3ETGA 4LK3A 3JQDA 2IYOA 5ILGA 4KUEA 1LSUA 3AY6A 4HV4A 5L45A 1E0DA 3V1TC 1XKQA 3CTMA 3ENKA 2X23A 5CAEA 5TNXA 1JKIA 4RGBA 3WSWA 4YR9A 5JMWA 2EJVA 3PP8A 1HYGA 2AEJA 3U4IA 4QTZA 1FK8A 1WVGA 2VRCD 2JJYA 1WP4A 3RQSA 4CMAA 2E82A 4G81A 1XWFA 3F46A 2JL1A 4FGWA 3AY3A 4Y6RA 1DJQA 1ONOA 4QQRA 2HK7A 3DAPA 3I4CA 4ZD6A 5KVQA 2Y67A 1P1JA 1XCBA 2CDBA 1H6CA 2IXAA 4LSWA 4AJKA 4E0BA 5AXBA 4ZJUA 4MVJP 1Q1NA 1V3VA 1I36A 3RKRA 3T7CA 2C82A 2P9CA 3MEQA 3RBXA 4CMGA 3GFGA 1B3RA 3WGZA 4RVGA 3ROMA 3WQSB 1Y9AA 1SBYA 2ZK7A 1JWAB 4KZPA 1A7KA 4GX1A 4RPKA 3RFVA 4J7UA 5L95A 4PLPA 1H0KA 3JQ7B 1E6EA 4CM6A 4DBZA 1C1DA 5I7SA 4BIIA 3RVDA 4BNGA 1BSVA 3I9JA 1ZNQO 2DBZA 2O2SA 4FCCA 4DMLA 4L4RA 3W8FA 4QEDA 4D41A 1I32A 3N74A 3ONFA 3FRJA 3EZYA 3TSCA 2JFGA 2C20A 3MJCA 4FJ2A 5MGBA 4WOJA 4IMRA 4UULA 1J49A 1PZFA 4EI2A 4ZQFA 3IL2A 2F00A 2FSSA 3AK4A 4D0SA 4WLEA 3CSDA 3LLSA 4W9NA 1VI2A 3WS7A 2J5RA 3R1IA 3HHPA 1YL6A 3JQGB 4HNGA 4CLOB 1I3NA 1ZO8A 3SBOA 3NGXA 2HCTA 4LN1A 4IIUA 3GQVA 3AJRA 3HUDA 5U1PA 1GEGA 4YAEA 4AJIA 4M49A 4NZ9A 1K5HA 4XGNA 4PLZA 5JCJD 2H9IA 3MZ0A 3HN7A 4F45A 4XX0A 1ZZEA 4YJFB 5AVOA 2X9GA 4RQTA 1VSVA 2PGLA 5CPFA 1LQTA 4GSLA 5LC1A 2JCYA 4H16A 3ULKA 3H2ZA 2Q1TA 4YAGA 1KY4A 4YJHB 3C1TA 2FPPA 5F5LA 1YS4A 2PGDA 1B8UA 3H6KA 3JQBA 2ZCUA 2B4TO 2X1HA 3WWZA 1A71A 3F3SA 1GADO 2QYSA 2VTEA 5H82A 3HB5X 5IN4A 4MP8A 1Y5RA 1I2CA 3EMKA 5IDWA 5THKA 3KXDA 1OZAA 1IY8A 3DBRA 3ZWMA 1O89A 4Y6PA 1DBVO 2VT3A 1E7WA 4NG5A 4WLNA 4UEKA 5HA5A 3OA2A 3IP1A 4IDCA 1GDHA 1CWUA 1QYVA 4IDBA 4WEQA 2PH5A 3M1LA 1WMAA 2UDPA 2IEBA 5BSHA 3S2GA 4P8RA 1DIGA 1DIAA 1ZH8A 4WNIA 4YB8A 4F3YA 2DUWA 4R16A 1MG0A 1GQ2A 3GRKA 3JTMA 5EESA 4ND2A 4ZQGA 4DPKA 3RWBA 1KC1A 2X58A 2C5AA 4J1SA 1RKXA 4MPDA 3NAQA 4GGOA 3JD2A 1TEHA 4H15A 3Q2IA 3D0OA 4XRRA 3I1JA 3R0IA 4J4TA 2CMDA 3FR7A 1OI7A 5G4LA 1K89A 4LMPA 4XZ3A 4HBGA 2IEDA 1CDOA 1YB5A 3P2YA 4L8VA 4LCEA 1JKFA 1E7YA 2I66A 5A9SB 2NNLD 3X2EA 4BO1A 3S2FA 4DLLA 5DN9A 1OMOA 1HF3A 3NRCA 4LRTB 1EUCA 3W4JA 4KTTE 3FR8A 3DBHB 5CFZA 2HRZA 1IPEA 1E1LA 3EHEA 3EUWA 4MKXA 5KWEA 1ZK0A 2QZ9A 3BMOA 4R1UA 4XYMA 3VH1A 4J6FA 2FSVA 4IBOA 4E32A 4CR6A 1VJ0A 1SEVA 5COAA 3AUSA 4OMUA 4J4BA 3Q1LA 2DT5A 1PWZA 1AHHA 1Q0QA 3C7DB 4IDGA 3LC2O 4PZDA 4NIMA 4D3DA 1PWXA 3V2UA 4LRSB 2C2XA 3VAZA 2VUTA 5JDCC 2C07A 4YT4A 4RPLA 4DPMA 1JKJA 3FBGA 3FBTA 1GV1A 4BO5A 4E2ZA 1BW9A 5ADHA 1JQBA 1CYDA 2BF7A 1E3LA 1KBZA 3TZKA 4FD3A 5GMOA 3LT0A 4HFMA 3UCFA 1LDYA 1GR0A 2OZPA 5T5QA 3W8DA 3ZNQA 4IY1A 1LLQA 2B83A 1GCOA 4UVHA 1A5ZA 3GMSA 4DQUA 4YRDA 3W4IA 3C85A 3E18A 3E8XA 1N1GA 4BKPA 2WTBA 2D8AA 2VTDA 1IHYA 4ID9A 1LNQA 3HG7A 4IZHA 3IKVA 4KQWA 4CM9A 1SB8A 3Q0EA 1BVRA 4HFNA 5F21A 2DLDA 5DCUA 3CE6A 3WGGA 4CLEA 4CV1A 3ICCA 3SC6A 1GAEO 1B8VA 1WZIA 4KUGA 3RASA 5BNTA 1ISFA 3MJ4A 3F9IA 3CEAA 3WSVA 4RVHA 3GA0A 4YXFA 2NADA 2ZB3A 1PR9A 4OHUA 1V6AA 1X15A 3RUEA 4MVJG 4RF2A 4JXKA 4LMRA 1NAIA 4LW8A 3PWKA 1UJMA 4G5HA 3ZV3A 2YV2A 1ZMTA 4IDFA 4L4XA 1JN0A 2QW8A 3BMQA 3GN2A 4E33A 4XGIA 1LA2A 4C4OA 5HBRA 5KJEA 1TLTA 1PTJA 1EE9A 2X7HA 4K6FA 4I1IA 3PGJA 2QIOA 2WEKA 1OC4A 4W7HA 1KEUA 4N5LA 1YOVB 3COSA 3U9LA 4GH5A 5CP8A 1I2BA 3KSUA 3DZFA 3ZU5A 3PZRA 5DNAA 3R6DA 4N5NA 3PDUA 2DVMA 3P2OA 1WW8A 1NFQA 4QFDA 5IF3A 1PQUA 5EMHA 5DOVA 1U9JA 1GZ6A 3GVHA 1W8DA 3IC5A 3Q6IA 2E4AA 2DTXA 4YJGA 3KSZO 2YFQA 4BNJA 4RQUA 5T6BA 4J1TA 5JFOA 2ZCVA 4KOAA 3WIDA 3UXYA 5DCYA 1GFSA 3H9GA 2DAPA 2VNSA 4LCJA 1YL5A 4WCFC 4XD2A 2WD7B 2WYWA 4FPXA 3QSGA 3ZU4A 3DZBA 4PG6A 3OMLA 4BHTA 2ZYAA 1IZ0A 1HWYA 3D5TA 3HDHA 5MDHA 3U0BA 1N8KA 4J49A 3ABIA 4MOWA 1B2LA 1GZ3A 4UUMA 3FNFA 1GCUA 1EMDA 1P31A 4U8GA 3RIHA 3D4NA 1I3LA 1HE2A 1ZSVA 4CQLA 4KWHA 3C24A 4J43A 2JAPA 4EUHA 1H6DA 3K96A 1Z45A 4CMKA 2O23A 3KVOA 2R00C 2FR1A 2NLOA 3AI2A 2O2YA 4B3HA 2IZ1A 5CG1A 5L40A 2CDCA 4AVYA 3NYWA 2VUUA 3DTYA 4ZVVA 4UUPA 4RORA 1P1IA 5JS6A 2V6BA 4R5MA 1PJ3A 4LVCA 4BNVA 4BNLA 3DBVO 3DOJA 1XHLA 3ADPA 3K2BA 4RO0A 2WYVA 2HU2A 4OXNA 5BNIA 3ANLA 1GQYA 3SLGA 3KO8A 5KOIA 1IB6A 1GYRA 2PD3A 3KYDB 3NKLA 4UVEA 4AJ4A 5C7IO 2W2LD 3H65A 3QP9A 1QRRA 4IINA 2X0IA 1FXSA 3C3XA 1QYCA 4PZCA 1ADGA 1KVTA 3PWSA 1NHGA 1ZEMA 2GN6A 2ZQYA 1VM6A 2FZEA 4A0SA 4Z0HO 1T2FA 3NUGA 1LXCA 2J6IA 3HE3A 2VYND 1DC4A 3IMFA 4RLHA 5EERA 3AM4A 2LDXA 2VOJA 3GG9A 3TNLA 1YBMA 4TRNA 3IJPA 2EEZA 1ZUD1 3G79A 4BGUA 1JW9B 1ZFNA 4RL6A 3L6OO 1HE4A 4IJKA 5HTOA 1YONA 5THQA 2J5QA 3SEFA 3AI1A 3W1VA 3BHMA 1UP6A 2IE0A 3D4OA 2V6MA 1IUKA 2B0JA 4A26A 1FJHA 4IDDA 4YRBA 3SJ7A 4XB1A 1M2WA 3CH6A 4R3WA 1FDUA 4BO7A 5GZ3A 5CHEA 2P9GA 4ND4A 3WGHA 4FSHA 4TRRA 1SCUA 3VVBA 3OETA 2ZTUA 3BHJA 3UF0A 2OMEA 2YQ5A 3TL3A 2Y68A 1R0LA 3NDIA 2HJSA 4RJTA 4FR5A 5K0ZA 4MIEA 5JW6A 1YQDA 2EP5A 1U1IA 5BQFA 1T1RA 3PYMA 1RJWA 2Q99A 5EINA 4EUFA 5A5EA 4QSMA 4PLFA 4CUZA 1C3VA 2Q2WA 4FDAA 3FNEA 1N7GA 4U7WA 4CR7A 4UVIA 3U62A 1XEAA 3VKVA 3PJEA 2CDAA 4CMHA 1CEQA 1LTHR 1XDWA 4LVUA 5DBIA 3K6JA 4IM7A 4QFCA 4HX5A 3PYXA 5DT9A 4AJLA 1NFFA 3G1TA 3JD0A 1H6AA 4CLXA 2FRDA 3OA0A 3F1LA 4OJNA 1ZKMA 3KTDA 2R2GA 4OL9A 5L3ZA 5TSDA 2B5WA 1H93A 1MC5A 1UP7A 1LJ8A 2QYTA 3D7LA 1SAYA 3KYBA 1YH3A 1T26A 2NVUA 2VWGA 4PRLA 1PJLA 4CUJA 2Q49A 3NGLA 1K3TA 3ASVA 2BELA 2DKNA 4P4LA 3C7AA 5TIIA 2GZ1A 2OXIA 3INTA 4JJIA 3LT1A 2P91A 3S2EA 4BNWA 4B3JA 4E2WA 1R37A 1P0CA 5JY1A 4WKGA 4R1TA 4BNIA 1Y1PA 4HFJA 5I7VA 1YB1A 5B37A 3PJGA 1ZVMA 3EK2A 4NMHA 3I9LA 2VYVD 5C3MA 4TVOA 3E5MA 3Q2KA 2VUSA 4AJPA 3HWRA 1NPDA 2CF5A 3FTNA 1QKIA 4OYRA 2P68A 4IJWA 2O50A 1HEUA 3WG9A 4CL8A 4D0RA 4E21A 1UR5A 1H2HA 1PJSA 5BSFA 1Y8RB 3NDJA 3O8QA 2ZATA 1TB4A 5EPOA 4NNJA 4CLHA 1Z73A 4XYEA 1C0KA 1U4SA 2X9NA 5CEEA 5JDIA 3KLPX 4RVDA 3ZV5A 3PHHA 1A9YA 4IQ8A 4IS2A 4DLBA 4QX6A 5IG2A 2EGGA 2FR8A 2NU6A 4NBUA 2EG9A 2XOXA 4YCAA 5A03A 2YQ4A 3AU8A 4HADA 3RI3A 2JD2A 1R12A 4L75A 3TL2A 1QLJA 3O26A 4DIBA 3OEYA 2PKQP 1IL0A 5B4UA 4J1QA 4EEXA 2YHIA 3WFIA 4DGSA 5A06A 2E37A 1IZ9A 1MFPA 3F4BA 4YT8A 4MJLA 3U4CA 4J7CA 3CINA 1HETA 5EL0A 4CM4B 2D1YA 1RM0A 4OH1A 2D4AA 1DC3A 2GO1A 3LC1O 2PKQO 5FI5A 2G0TA 1KC3A 2YV3A 3S55A 1YWGO 4YTEA 1GV0A 2FR0A 2X0RA 1LDBA 1UAGA 2IODA 3PFWO 3PDJA 1P1FA 1BMDA 1KEWA 2X8LA 3G17A 3DHNA 4DUPA 5IZ4A 2NU8A 5T8KA 3ZHBA 4XEHA 3RFTA 3WBBA 2W98A 7MDHA 2QRLA 3GVPA 2JCVA 2PFGA 5LCXA 4EGFA 1X14A 3RUCA 3DAFA 1DAOA 1UZMA 2OOSA 1JA9A 5KVCA 1EBFA 1Y8QB 3JV7A 5H83A 1V3UA 2O7SA 4XRGA 5U9CA 2A94A 4BNFA 3E6AA 3L4BC 1SC6A 3ANNA 3DHEA 4GMGA 3VHRA 3ZNPA 4M55A 4U5QA 1BRMA 1GL3A 4OO3A 2PKRA 2NSDA 2DFVA 5EN4A 5JO9A 2AQKA 4CM8B 2GSDA 4FB5A 3GF4A 4TZTA 4WE3A 3ZCXA 5JO0A 3GAFA 2W8ZA 1EE2A 2Y93A 1U8FO 1Q0HA 1Y5MA 5TGDA 1GD1O 4MVJD 3PLNA 1T24A 2G17A 4J2OA 5DDIP 3A14A 3K2EA 4EZBA 1MG5A 3AW9A 3JQFA 1UDBA 3VDQA 1P77A 1PQPA 4FFPA 4JROA 8ADHA 2EGHA 3I83A 1ZW1A 3ZWYA 1PU2A 4NFSA 1ADCA 3K30A 3T7EA 4Q9NA 4BGIA 4GGPA 2WM3A 3GFBA 4AJ1A 3BYZA 4F6LA 4OKIA 2JHGA 4ALIA 5A4DA 1PJQA 5KIAA 2J3KA 4ZHSA 1EFKA 4MINA 2Z95A 2PD6A 2NV6A 3D3WB 3GZ4A 1P1HA 4XA8A 4E4YA 1PJ4A 4R41A 3PHJA 3GDFA 2O3TA 2DPGA 4RF4A 5F1KA 2V65A 4YQYA 3T4XA 4G65A 2ZJ0A 5JAIA 3AFNA 4KDFA 5BR7A 2WYUA 3TJRA 4K9DA 4WNCA 2AQIA 4CLRA 4OM8A 3OJOA 1T2AA 1MLDA 2OFPA 2AE2A 1W4ZA 3RCBA 1LRJA 1HZJA 3IOYA 3GUCA 1ZXLA 4J16A 1I8TA 3CMCO 1Q0LA 3QVWA 2GR9A 4GSKA 4DLAA 1DJNA 3WGIA 3P7MA 1NBOA 3GZNA 1NM5A 4WEOA 1C14A 1L7DA 4XYGA 5AOVA 1YQGA 2YHUA 3Q3CA 4J0EA 1WDKA 1U3UA 3MOIA 1X7HA 4PVDA 4BNZA 3OICA 3JQCA 4GQAA 4L0QA 2BRUA 4ALJA 1C1DB 3W6ZA 1DIRA 3DWFA 4GMFA 1RM3A 2ZB8A 3JQ8A 3OBBA 4E5NA 4WUVA 1J4AA 3DONA 3X2FA 3UKOA 2HRBA 1PJTA 4B7CA 1B3BA 3DBLA 5KTKA 2W4QA 1GYPA 4QT0A 4INAA 5L7WA 1WNTA 4GVLA 4DRYA 2X0NA 1Z74A 1KS9A 2O3RA 2JD0A 2Z1NA 3B1FA 4JN6B 3L4SO 1A7AA 4FW8A 2Q2VA 4OKNA 3UOGA 1DFIA 4M54A 4XJSA 4D44A 4EUEA 4GPD1 3MWEB 4MIYA 1AXGA 1DXYA 4Y67A 2PK3A 3EYWA 3QVSA 4OAQA 4FJ0A 5EIOA 4I5DA 3VKUA 2DU8A 3K5PA 4NR0A 3GT0A 4Q3DA 2ZTLA 1R0SA 3QHAA 4BKOA 1ISGA 4JP3A 4RVSA 5IAAA 5L9AA 3FI9A 3EVNA 4MVJF 5TJ9A 4XWYA 5L4LA 3I52A 3U5TA 3SC4A 1IPFA 1XG5A 4PLYA 4D42A 4E13A 3ETEA 1BXGA 1SOVA 3N7UA 1HDZA 1PZHA 4E2XA 2DTDA 3GEDA 2RCYA 5DBGA 2B35A 3QE3A 3WFJA 1CETA 1E77A 4KTVE 2HAEA 3H9JA 4Z3DA 1GQQA 1Z82A 3ADOA 2RHRA 1DEHA 4CMBA 2HKIA 1AGNA 2G82A 1ZSNA 1HDCA 3PLRA 1ISHA 5CEFA 2Y0EA 4ZRMA 2JCXA 2VZ0A 1W6UA 4MO2A 4BB5A 3DBRB 1XYGA 1MUUA 3ZW8A 2GN4A 3LF1A 2VWPA 5A02A 3GDGA 4GI2A 5DCWA 1BDMA 2CUKA 1PX0A 4XKJA 3C1AA 3M1AA 3DAGA 5ENVA 3HN2A 3WX0A 4YJFA 2AMFA 4B8ZA 1HT0A 3GN1A 3KHUA 2I9PA 1V9LA 3WYBA 2EKLA 2EXXA 3LK7A 1EVJA 4YJHA 4M87A 4BQRA 2OUIA 5L53A 4GBJA 3CXRA 2OL4A 1ZCJA 1D4FA 2CNBA 4FFLA 4FOOA 2VHVA 3W8EA 4EJ0A 3LSYA 3U3XA 1AUPA 4R1SA 4DIFA 4IQ0A 5KJFA 3OQ1A 2FY8A 2Q45A 5GZ6A 1MGOA 2UYYA 2RHCA 4BV9A 2PZKA 2DTEA 3TPCA 5KKAA 1AE1A 3H5NA 3UCEA 1ZJZA 2PZLA 1M67A 3UICA 4B7XA 3L9WA 2GPTA 4Z9FA 1CRWG 1NR7A 1VL8A 4M1QA 3UVEA 2VRCA 3KBOA 2OP0A 1VE9A 4BMSA 4KWIA 1I30A 1MFZA 3ZWNA 2Y05A 3GGOA 4RPHA 4BO4A 3RAJA 1H2BA 3TF5A 2I6TA 1CQIA 3PFFA 4DVJA 3ZV6A 3OH8A 4YVFA 4CMIA 5CDYA 4XDZA 3ST7A 1NX6A 4LSMA 4UEOA 3ONEA 4NFYA 2J3IA 3BIOA 5L4NA 3TWOA 1ML3A 1WDMA 3OP4A 5JXWA 5TQVA 5JY6A 3QWFA 3WR5A 4IUYA 1LQUA 2P5UA 3NT2A 3CPSA 3ZN2A 4BKRA 2CFCA 3I23A 1I10A 3E9MA 3K31A 1O94A 3K8ZA 2J3JA 1DLIA 2FWMX 1EK6A 4YYZA 3OEWA 3H7AA 3QWHA 1GEEA 1TXGA 4YT2A 4J4HA 4J7XA 1P3DA 1PGJA 3BAZA 3WNQA 2HMWA 4N7RA 3PQFA 2QZZA 4R69A 1ID1A 2HK8A 4Y6SA 4Q3AA 4WPGA 4BNXA 4D3FA 5L7TA 3NT5A 2HMUA 3DL2A 4R9SA 1BW9B 4OOFA 1GUFA 5JMPA 3K92A 3L0DA 2I99A 3FNGA 2G5CA 4BO8A 2YJZA 4K28A 4P4GA 5AXDA 3AOEC 2O3UA 5G0TA 2XAAA 3IDSA 4PVCA 1K6JA 2Q46A 2W2KA 4AL4A 3DQPA 1B14A 2A35A 1TA4A 5JCJA 1D1SA 1EDOA 3HADA 3GHHA 3PEFA 5K9ZA 1EDZA 1NHWA 4PRKA 4CMEC 1E5QA 1X0XA 4C7KA 1WLYA 1C0PA 4MDHA 1LSJA 4YWJA 1PSDA 5J23A 1HRDA 1BTOA 1E3WA 2OO5A 1O0SA 1LI4A 3VZRA 3GH3A 1ISJA 4GKVA 3VVCA 1T2DA 2GN9A 3ASUA 4CV3A 1JU9A 1DC6A 2B4QA 4RPJA 5EJ2A 4CLDA 4E5KA 2GD1O 2VHZA 2BFOA 4Y8VA 5LDHA 3PGXA 3GPDG 3I9OA 1AHIA 2O4UX 4PG5A 1N9GA 4YEDA 5I9NA 2GASA 2HUNA 1F8FA 1U5AA 2PZMA 4JX8A 3S8MA 1LEHA 3QVXA 3KETA 4PN3A 1T2EA 3NTOA 4GAEA 1U2DA 4BMVA 2O7QA 4DWVA 1ONPA 3HQ4O 1EK5A 2B37A 3AM5A 4E12A 4E2YA 4NHEA 1HZZA 1SO8A 4I5GA 1EVIA 1UXKA 3L6EA 1E3IA 3PQEA 4EYEA 1LC0A 4XQCA 4TROA 3GGGA 1CF2O 3KYCA 3H9EO 2YFHA 4WOKA 4YJGB 3LF2A 2BLLA 3G49A 4U0KA 4ND5A 4ALNA 3I9NA 4BVAA 4CPDA 5JDCA 3JQEA 3F5QA 4K1LA 4YDRA 1E1MA 2B69A 5BT9A 3WB9A 2JKVA 4YPOA 2Q1UA 3L9XA 5C7OO 1HYEA 3DOCA 2X22A 3KEQA 1HXHA 1P74A 1R4MB 3BMNA 5G0VA 1QV7A 5L7YA 3B6ZA 4TSKA 4OGWA 5T67A 5L4SA 1YXMA 4XR4A 1YOVA 3UUWA 2RBEA 2B36A 1TT7A 4NPCA 1Y81A 4DQXA 4EJ6A 4CQLB 1G1AA 3ENNA 2UAGA 3WBFA 4CMEA 1U3WA 1KVSA 2GZ2A 3WLEA 1T2CA 3GVCA 4MVJH 2YY7A 3WMXA 3GVIA 2GRAA 3UN1A 4B79A 4RZHA 1UAYA 4OQZA 2NUAA 2WJPA 4KUHA 3AUAA 1I0ZA 3VOSA 1E3JA 3F5SA 4QO7A 4KMSA 2BGMA 4GVXA 4R4JA 4F6CA 2HSDA 1SB9A 4XR9A 3DDNA 1XQ6A 2ZIZA 1CQJA 5DOZA 4O1MA 4U6QA 4PLGA 3CZMA 4L74A 1KETA 5T64A 3OHSX 1VPDA 3KSDO 2VZ9A 4B3IA 2NM0A 1NVTA 3JYPA 3PTZA 2B5VA 3VH3A 5DZSA 1DIBA 2PR2A 4G2NA 3TRIA 5IDYA 3W4KA 3FHLA 3UW3A 3F1KA 3TDKA 3TN7A 1FDSA 1NNUA 4PIVA 2XXJA 1A4UA 3JD3A 4P38A 2Y1DA 2BHLA 5I7FA 1D1TA 3CUKA 2X5JO 2JFFA 1LDNA 4I5EA 2E49A 3LU1A 5COBA 3VH4A 5ITVA 2Q50A 1MXHA 6ADHA 1CIVA 1DHTA 3MOGA 5KNLA 8LDHA 3LYLA 1B16A 1LRKA 5H81A 2ZYGA 4L4SA 4URFA 2YUTA 5B12A 1R4NB 4IJVA 4NI5A 3NTQA 4UVDA 2H63A 4WCFA 2Q4BA 4MVJM 4ND3A 3LZ6A 1WAMA 1KOLA 3KYDA 3GDOA 3PIIA 1QLHA 3I6IA 1MV8A 3DFZA 4DC1A 4W99A 9LDBA 1RPNA 3ZWOA 4BMNA 4FS3A 2DPHA 2P9EA 2Y1FA 4ZQBA 1U7HA 4PLTA 4Z0TA 2Q1SA 1NPTO 3CKYA 3WQRA 1X13A 5ICMA 2Y0CA 2C7VA 3O9ZA 5TT1A 4PLCA 1DSSG 4DTIA 5IZCC 5HWSA 1HLDA 1ZJYA 3NJ8A 4M86A 2UV8A 1GZ4A 1GY8A 4DQVA 1T4BA 4HXYA 4FC7A 2R00A 2HQ1A 4JBIA 1R6DA 1NASA 3JYQA 3K73O 2FPGA 1ENPA 4TKLA 3E48A 3PK0A 1GUYA 3I3OA 1EUDA 3CMMA 2EKQA 2NWQA 2X6TA 3WYCA 3ORFA 1YGYA 3KLMX 2AEFA 2DBRA 1BGVA 1OBFO 3OECA 4O6VA 4J9VA 3ZDFA 2H1SA 1LLDA 2VT2A 3VZPA 3TFOA 5KVVA 1V8BA 3EC7A 3DZIA 1QSGA 4EJMA 3JCZA 4YJDA 1I3MA 2NVUB 1PQWA 3H2SA 3RD5A 2P5YA 1NWCA 3GPIA 2BH9A 3ZWCA 3A4VA 4Y98A 5KVSA 3H4VA 4Q39A 3E1KA 4IXWA 2FP4A 3CZRA 4I08A 4GX5A 1PZGA 2VWQA 1KEPA 2EF1A 1HSOA 1QORA 1M6WA 3RFXA 3MJEA 3GY0A 4MKRA 4XGKA 4IS3A 2BI8A 3ICPA 3RUAA 4BNNA 1OC2A 3HFSA 3DMTC 2Q4EA 2DUUA 2AA3A 3NTRA 4CUKA 4IIVA 1PIWA 1Q7GA 1XQ1A 2CSUA 3H3FA 3G0OA 2O3JA 4O63O 1PGNA 4FGSA 2C29D 1RM4A 3WICA 4YACA 3O8QB 1E1KA 3ZWXA 4XCVA 4TRMA 2X5OA 1C1XB 4ND1A 5JPIA 2A9FA 1MA0A 4P4NA 2QQ5A 4A7PA 2I65A 5ILOA 4AJ2A 3ZU2A 3ZWBA 1PL6A 4I9NA 4NJMB 1E7SA 4J2HA 3OJLA 1Z7EA 2QHXA 1YE3A 3HNPA 4EITA 2POQX 2W2LA 4QXMA 2EHDA 2Z1MA 4AJJA 3MTGA 3LDHA 3PYLA 5CG2A 3QRWA 3VH2A 1RYEA 4KP7A 5G4KA 4CR8A 2YHIB 2Q1WA 3OIFA 4J91A 2J3HA 4BS9A 5IXSA 1WXDA 3JQAA 2BMAA 1K6IA 4IQGA 4RVUA 4XJTA 2VYNA 2EWMA 2WD8A 3RUFA 4PGFA 3L6DA 4Z6KA 3PXXA 4Z9XA 3DHYA 1Y8RA 4B4VA 1PS0A 2HMTA 2D5AA 4TWRA 1VL6A 2CVQA 2NU9A 3FPLA 1I5RA 4K26A 3C1OA 2C54A 4GX2A 4WCDA 1WDLA 3SJUA 5K6AC 1DRWA 3H5RA 3ZNOA 5C37A 3L07A 4HY3A 1IOLA 2IZZA 1D3AA 2YW9A 2RIRA 5FFFA 5AXCA 3ROPA 3TZHA 4TQGA 2FN7A 3VZSA 1C0LA 4W82A 2E48A 1P0FA 3HDJA 4R9RA 1PEDA 4BNMA 4CODB 4D7AA 4PLVA 3BTVA 5DP2A 1E92A 5T57A 3WTBA 2W90A 3FTPA 2BKAA 3I5MA 4CQMA 4PG8A 1DDOA 3DZKA 4B4OA 1ARZA 1A4IA 2VQ3A 4CM4A 1J6UA 4AJHA 5A3JA 3Q9NA 5ER6A 1FDTA 4MP3A 4JQCA 4Y9DA 4IDAA 3V5NA 2JHFA 1F14A 2WE7A 1DAPA 2X0JA 2DM6A 4EBFA 3VPHA 3GNTA 4M89A 2H6EA 3WJAA 5A1TA 4WLFA 2AG8A 3KUXA 1F8GA 4DL9A 4D43A 2XPCA 3EDMA 2DBQA 4ZN6A 2IXBA 2AQHA 5DBFA 1KVRA 4NBVA 1U2GA 3VPXA 4L9RA 1EQ2A 1DFHA 3JD4A 1NQAO 5JYEA 1TT5A 3BMCA 3FSRA 4E6PA 2EP7A 4WASA 2FMUA 1RM5A 1DB3A 3PJDA 1NPYA 3PHLA 3U4HA 2I3GA 3AI3A 3P5SA 2AQ8A 1X0VA 2GN8A
chains in the Genus database with same CATH superfamily
4BV8A 3FYUB 4F71A 3PNOA 4EWLA 2ZYWX 4RJJA 2WVAA 3O4GA 4I19A 1ZOPA 1GNRA 1W19A 5GKNA 3WA7A 4JC0A 5KC9A 3UHFA 1U3DA 3LVQE 1JA1A 2GGSA 1O6FA 1L2CA 2I2CA 1GJRA 2ET6A 2ZDQA 5F5NA 4R51A 3D3WA 1KJQA 1DIHA 4PYKA 1XUOA 3IAS6 4YFYA 2JBAA 3FVWA 4YRSA 5JECA 2IZ0A 3TOZA 4UUAA 1SHZA 2R6JA 4OPMA 2DAIA 3N6VA 3AUTA 2X19A 4BIMA 3AY7A 4CIDA 1SPXA 1KA9H 3N2IA 2WMDA 3E27A 2Z43A 1GPJA 3MSCA 2A2ZA 4EZEA 1N7JA 3GA5A 1BQ4A 2XXAA 4NFHA 4ZU3A 1B4DA 5C52B 3WWYA 3OG9A 1A5AB 2JJ1A 2Q7OE 4OX9M 1KVUA 1BG6A 4LXUA 4R8KA 1RCFA 1JXQA 2NQTA 4OHVA 3M4XA 1G5FA 3JQGA 4XUEA 4A0QA 3PVSA 4JBYA 4CM9D 1SVOA 3IP3A 3KQUA 2BBTA 3X0DA 4DR7M 5ALWA 2DHCA 5C5IA 5DYYA 4JGGA 1UBCA 3UGJA 2ZSIA 4QDUA 4TV8A 5HKBA 1P2VA 3PXAA 2YZGA 4ARIA 3BTOA 3DVAA 3RLIA 3M2TA 1SZJG 3MBOA 3DNPA 1U4OA 1SXJB 3IEXA 2P5SA 3QKRB 1SRRA 2ZUBA 3H4IA 5CVDA 3HVHA 3MWJA 5D51S 2IS1A 2GBIA 2ZYHA 4B6OA 1M34B 2AI2A 1E3DA 2B4RO 5K0NA 1CS4C 2VP4A 3PITA 4BNKA 3JAMA 1ZOIA 4Q5IA 3E9NA 1HDRA 3WMEA 3EGIA 2LXEA 4JKYA 2V6FA 4PG7A 2QJTA 4IXMA 4NXMB 3WJ7A 1ZP6A 4ALKA 1Z29A 1G5HA 4NU5A 1N9GB 1U3TA 2OK7A 2IH4A 2GMWA 2EJWA 1L8XA 3OTGA 3K2IA 5LQJA 1IXSB 1C9MA 4YQZA 2CXTA 4RDIA 1G7RA 1UDXA 1M1YB 3IKTA 3OPNA 1KYYA 4KAFA 4LFAB 4NYMR 3KYCB 5EIEA 4ALLA 2D7HA 3EG5A 2NTNA 2P90A 2XMSA 3K2LA 2Q0HA 4MUKA 4R01A 4BBJA 4WIAA 1OA0A 4DXAA 3ZWWA 2QD2A 2IRWA 5G1OA 3BKXA 5FOTA 4TSFA 1G7SA 1KR2A 2QVYX 3ORYA 1P29A 4QL3A 1R4AA 3B53X 4J1NA 1ZSYA 3ONNA 1Y9EA 4ZYWA 3GNSA 4P0TA 2GVNA 3OLQA 1X7GA 1YZKA 1E7MA 1WMFA 2G70A 3EIWA 3LXMA 1SOAA 3VV2A 1DAEA 3DF7A 3NBUA 2MDTA 3GD5A 5A5VA 3HXMA 3FWKA 3KKOA 1OCEA 4X1KB 4B34A 2ZUSA 1Z4OA 2A3RA 4JLWA 2M5ZA 3NV9A 5MN6A 1YB4A 3PT9A 4GP6A 1DWUA 4OLBA 4FD2A 4MPTA 4NYIQ 4RTRA 1M72A 1W36D 1F9EA 5ENDA 3BREA 1TMYA 2B5OA 3R7DA 4EYKA 3DV0A 4AP9A 3SVTA 3IAFA 4AICA 4BNYA 6Q21A 1NQOA 2H5EA 3SZLA 1AUQA 4UAGA 1S9DA 2L7HA 4QLOA 3A4LA 1XR3A 3FGPA 1GP2A 1FEZA 3Q8XA 4TLEA 2MMCA 1V4BA 4IHKA 2OTCA 3U5ZB 3E7DA 1R4NA 1T5IA 3WAKA 2XXBA 1K92A 3LBYA 3CEPB 4COOA 5KHAA 2B6HA 4DR3B 2ODPA 2G4LA 3H8VA 4OFZA 4HS4A 10MHA 1VOTA 5BWNA 2CF6A 1EINA 1K0UA 3BERA 5LMUM 3VU1A 1VCMA 4RH1A 1C8KA 1ZISA 1KKLA 4G0WA 1TO2E 4MB2A 1JEEA 5IBQA 4H7EA 3RK4A 2WTAA 5G0UA 3GROA 4W5RA 3SEQA 1UBKS 3PNPA 3KE9A 4HQLA 2R6R1 4IDHA 4QUJA 3M6WA 1MNQA 3I9KA 4I5FA 4MHSA 5BNZA 1T29A 5C8YB 2BGLA 4I46A 3G0BA 3SSAA 3IOMA 3OQJA 1VRCA 1CZUA 3QI2A 1NLFA 4Q37A 1KE2A 1J2JA 5CDGA 4XI9A 4Y1FA 4RENA 3GK3A 4RTSA 3MQFA 3FMVA 1XQXA 1Y9JA 2O5VA 5BSGA 2J5BA 2B92A 3H1GA 5CXQA 2XYGA 1V16B 3Q6NA 4DDVA 3ZC3A 2GPAA 1JJVA 1HDOA 4DR6M 3P26A 5HUJA 5LPNA 1ONNA 1NONA 1U0BB 2GVDC 1YDHA 5IKEA 3L8YA 2E5LM 3CEMA 3R2JA 4YRPA 1BGXT 3JYLA 4AP6A 1DOHA 3ZWAA 1DCKA 1JPUA 2A5LA 3HXQA 3F4LA 1E7QA 1SEPA 3IMKA 4YDSA 1YRLA 1WHTB 2KM1A 4XDYA 1YZQA 2XNCA 1MABA 2MINB 4PAWA 4EECA 3B1VA 1T3ZA 2OPFA 2GUGA 1X1TA 4EY4A 2HQBA 3KCNA 1W6RA 2QENA 3D5QA 2BFBB 4JBLA 2ZE5A 4NJEA 1E9RA 4V39A 3V4OA 2W6NA 3JQDA 4HAZA 4KR0A 2AYYA 1HC7A 4LFBM 4UQOA 2EJVA 5ALHA 3AUXA 4IYJA 3DE7X 1JDUA 2BIFA 2O8DB 2JL1A 3AY3A 3L7AA 1XK6A 3GA7A 3QIAA 2P3OA 4AAYA 2CDBA 2BFEB 4V24A 4ZVMA 1HURA 3G7NA 2ZBRA 5TQJA 5KSZA 2N0SA 4BQQA 1K2VN 3F5DA 4BNGA 2WZBA 5I9IA 4LPKA 2QTRA 3HCNA 3EZYA 5IULC 3GP5A 5MGBA 1E1QD 4UULA 4ZQFA 5AM1A 1RRVA 1T91A 3MWEA 1VI2A 3OZTA 2J33A 2HLDA 4ERNA 3BJMA 5ANRB 3ANYB 5U1PA 4YRZA 4MGKR 3ZKWA 3MZ0A 3GQBB 2X7JA 4OP3A 3UFXB 4C4AA 2LHCA 5CR9A 2FPPA 5FJJA 3NHYA 1KDOA 3WWZA 3OX4A 4OFBA 3NV7A 3KXDA 1OZAA 4MEJA 2ERCA 2NNWB 1BHO1 2ZWPA 1BWRA 3IQHX 3BXPA 1KARA 4KT0F 5BYKA 821PA 4L4YA 1MX0A 2G0NA 2ZCJA 1YTUA 2LIVA 2X4DA 4ZCQA 2NZVG 2NOAA 3JD2A 3AUJB 1JHZA 3NOQA 1TDZA 2REQB 1EFRD 2PG3A 4YRQA 3N8KA 1YHNA 1YB5A 1R4GA 2Y20A 1M83A 2ZAMA 3MNFA 1G8MA 3KPJA 3V6LA 4ZOQI 5DN9A 1NW3A 3HJSA 1W4CA 1JFRA 4P16A 4CT5A 1U2DC 3QVLA 1T5DX 4LJ9A 1IPEA 4TZ0A 3TBHA 2BFNA 4EY7A 1P73A 1J9ZA 3VYTB 4NIMA 3N2KB 1L4EA 4OQMA 2QN6A 2GEJA 4FWGA 1L5SA 1BS1A 5B57C 1KBZA 4BV2A 2VDPB 1GR0A 1DBIA 2WTBA 4F60A 4YIKA 2GXAA 1VI6A 3SC6A 2RGCA 4F06A 1A76A 3W8NA 2NADA 2KNAA 4OHUA 4BPRA 3EQ7A 4NMLA 4QULA 1TGUA 4CF5A 3ET4A 2K0BX 4Q6WA 1WD5A 4I8IA 3D8BA 3TOSA 2ZBDA 1AV7A 3M6AA 1KP9A 3COSA 3JSXA 1KE1A 2XCUA 4MI9A 5FTJA 3V8NA 5DNAA 3BJIC 3DEJA 3NWBA 1NFQA 1DEOA 2A9VA 2B61A 2Q5IA 5B5SA 7CATA 3IC5A 4QNNA 2PGNA 1W94A 2BEWA 2FEWB 1ZCZA 2WYWA 2XYPA 1GRRA 4FPXA 2FVXA 3QSGA 5TF0A 3V00A 3HXOA 4ZYVA 4OU5A 5GADl 2GWHA 1GZ3A 4UUMA 1PG5A 1UKEA 3MT7A 4GR5A 1M73E 2PEZA 2I4MA 1L8AA 2JK0A 3KVOA 1XNRM 3NYWA 4F4IA 5K8TA 1E5TA 1X86B 3ZI4A 5JS6A 4DUYB 1PJ3A 2M60A 3X3HA 4HLUA 3RRMA 2Q3MA 3TTTA 3H18A 2CB9A 3NKLA 1DTEA 1NG9A 4XQ0A 1QYCA 1T2FA 5CCDA 3HE3A 1E2BA 1V96A 2LDXA 3AM4A 4H3KB 3A1CA 1ZNWA 3QPWA 4RL6A 3LO8A 4BRWA 2ZZMA 4NTZA 3G7SA 3KR2A 3W1VA 1EUDB 4ARZA 2O52A 3PQ3A 4UFNA 4A26A 2HNAA 5MFPA 1P17A 2BHSA 2CLOB 1XHBA 2ZTUA 1QGYA 1Z6GA 3RVJA 3HB1A 3MFQA 4HTFA 1KY3A 1T1RA 2F55A 2GCOB 1V1MB 3UAXA 3DO8A 2GJ9A 3SR0A 1G5QA 1MHTA 1H3NA 2J46A 2P0EA 2J5YA 3R6GA 2XNDD 1QGUB 2VA8A 2ZM5A 5CVUA 1NFFA 3G85A 2F8TA 1CR2A 2GFQA 4HK4A 4EH1A 2QYTA 3E9RA 3QPAA 3D7LA 3NGLA 3IEUA 3LS2A 3D7NA 2QXTA 4EVRA 3B2QA 4FK8A 2WAMA 2VO1A 1MOQA 4DV7M 1ULHA 4WKGA 1Z15A 5P8WA 1G21E 1MAAA 2ZM6B 1RR6A 4ARBA 4ACAA 5C3MA 3CZPA 4MQ6A 1NPDA 1WXXA 2CJWB 3FTNA 1HEUA 3RE1A 2QP3A 4IDPA 4A23A 1C0KA 1TKAA 2O14A 1LBSA 3W3AA 2YQ4A 4K9QA 1C30B 4J6EA 3L5OA 3DTVB 3OEYA 4EEXA 3T3NA 5CVCA 4DCCA 4YTEA 2Z56A 3H8JA 3G17A 3R5HA 5KNDH 1YA8A 4XEHA 3WBBA 5KOHB 3FXAA 3BGDA 1H3FA 3KQPA 3DAFA 4X6XA 1F1JA 3UJDA 2CNOA 2RHGB 1MEOA 2UYOA 1QQAA 1Z47A 4JODA 1V6CA 5K4HA 1L7NA 5BN3A 4FR0A 2NYUA 2AQKA 3BIJA 1YA6A 1LFAA 1CR0A 2CHQA 1U8FO 4HBZA 1V11B 3PLNA 3QF7A 1DV0A 1MG5A 3JQFA 2CNLA 4MWSA 3OT1B 1ADCA 3AEQB 1VG8A 4WBNF 3BYZA 3FOWA 4PANA 1B76A 4Q66C 5E4TA 5ITQA 4MQ5A 2V65A 3GRAA 3LO5A 3KEMA 4HH4A 4CHTB 2G6TA 4REOA 2EZ9A 2ZT7A 2C5LA 3FJ1A 1O57A 2ZIVB 2HZ7A 4M60A 4B5LA 3GUCA 1QVWA 1UKZA 1KR5A 3AHCA 4J7AA 3MOIA 2EJTA 5AJYA 4ZGBA 3O8OB 3DWFA 2XECA 4NX2A 3UYLA 2A9PA 3SJZA 5IAJA 3D4IA 1UINA 1RYYA 4QWMA 5KTKA 4NKRA 2P77A 3TLYA 2Z1NA 2ZJ6A 1A7AA 1HFWA 3UPUA 4C0WA 1E2KA 4NY1A 1R0WA 1KJJA 1R5OA 3GNLA 3OZFA 2FFRA 5AO9A 4JR1A 1BDHA 4KI0A 2H5IA 4E13A 1UMCA 3SYKA 1I94M 2YWDA 3MT0A 2B35A 1J0AA 1KORA 3RSFA 1P2TA 2G82A 2OG1A 4FI3C 2LRHA 1ZI6A 1KSGA 3S1AA 1W6UA 1VPEA 1B1CA 3LF1A 3C1AA 5CCEA 2HDOA 4GRIA 3QK7A 3QUTA 2AMFA 3N8GA 2ZRGA 5GPBA 4M87A 3QELA 2AMJA 1T1IA 4GBJA 4PGHA 4TLDA 1D4FA 4FFLA 1FX1A 1DS6A 2VHVA 2C2GA 1Z13A 4JVMA 5KJFA 1CEYA 2Q5EA 3OF5A 2AFIB 3L1UA 3VR5H 1M67A 4U8HA 1I7QB 2O2EA 3E46A 2IHBA 1NR7A 1SH7A 2VRCA 2OV1A 3GGOA 2EFYA 3HKDA 3QUCA 1AS0A 2UYCA 2DXIA 1K27A 3MWLA 1NX6A 4WY2A 1II8A 1NVVQ 1Z25A 3ENWA 1O94A 3HPRA 2RG7A 4BUZA 1MOZA 5K4AA 2EX1A 1U0OC 4G37A 5LQRA 3O8BA 3KG2A 4D9IA 4R9SA 2BEKA 3FSGA 4QOJA 4LXYA 2I99A 3DV9A 4P4GA 4K9OA 4ESHA 1EXVA 2QQ0A 1I5EA 1WCWA 4Q4LA 2OHOA 1TA4A 1EDOA 3PEFA 4I9FA 2QAGB 2H52A 1MAUA 3IG8A 2XH9A 4MLCA 3KAQA 1BTOA 2I8AA 2JEOA 3NHFA 1P0MA 3H4MA 1U8UA 2XV1A 3EOAI 1FZQA 2BFOA 3UXHA 2VYQA 1AHIA 2XLJA 2UKDA 3FOAA 2B37A 4FDVA 3ILSA 5E0KB 1LC0A 5HOQA 1KZ4A 2BLLA 3X2SA 4BQFA 2C84A 3A4TA 2ZDGA 1H2EA 3LRTA 2EL7A 2BGIA 5I4BA 4CU5A 1TADA 2J45A 2VJBA 1LQ2A 1Z68A 3VO2A 5FXMA 3ROFA 1WXGA 5JD6A 1BJRE 4RDXA 5FNVA 2G71A 1RRCA 1JJFA 3AUAA 5HFJA 3U0VA 2IYTA 1OBCA 1N6NA 1P0PA 1Y4SA 3K70D 2VZ9A 3JYPA 4YK7A 2B21A 1L4FA 3AIOA 2VNJA 3QU7A 1XXHA 1ZMVA 2A5YB 4UM9B 3AY0A 4DWOA 2J3LA 5COBA 5ITVA 2E49A 4AI6A 2QL7A 1EFAA 1MPXA 1SC4A 4TWJA 4MPJA 1Y8CA 3MMPA 1Z4QA 1QLHA 2W2PA 3EXIA 1H65A 2RHOA 3ZKAA 3TUZC 1D07A 2YVUA 3EXG1 1T8PA 3ZZUA 4QAJA 2FN9A 3WRYC 4DQVA 3PL1A 1I2AA 4X97A 2HQ1A 4NL4H 2LBCA 3QNWA 2IITA 3TQTA 3U3MA 3WYCA 1P5HA 2IL1A 1GTRA 1JALA 3EH2A 2VSNA 2AVNA 2O5EA 2P5YA 1PLLA 2R66A 2D4HA 2VSQA 4W8HA 1K5PA 1TQ6A 4U2BA 1OC2A 4GEGA 5IK2A 2PL5A 1IK4A 1TW3A 1LW6E 4O63O 2AWOA 4RANA 3X1WA 4B47A 1NOIA 5JSQA 4ZJPA 3IP9A 1CJVC 1QLWA 1P0QA 3ZU2A 1PW5A 1E7SA 1KI4A 1M8PA 1NG1A 2DRIA 3VH2A 1R27A 2AI3A 1G64A 2J3HA 1XFAA 3CVYA 1WXDA 1JFLA 1Y9DA 3V8MA 4IKPA 2CVQA 4K26A 5GM1A 4C20A 1P3QQ 3TZHA 1USKA 4ZEWA 5DP2A 2JDIA 3GUHA 1NRXA 1MX1A 2QT9A 2YVLA 1R1DA 1G98A 4QOFA 4B4OA 4AJHA 3O31A 5ER6A 1Y8AA 1NMXA 3D7KA 4CBVA 4BVHA 3V5NA 2WBLC 1F14A 1F3OA 1TK3A 3RBAA 3KVRA 5TPWA 3E70C 3KUXA 3EAQA 4ZN6A 5G41A 5KDDA 1KVRA 1PVDA 4YIHA 4OXQA 2PZBA 4NRVA 1HNXB 4WASA 2FMUA 2BAGA 3Q8LA 3PA6A 4C5BA 1NPYA 4UMFA 2AFRA 4OXXA 3NWLA 1K3XA 4TMYA 4D45A 2SECE 1BZYA 4KE8A 1I33A 1JH9A 3FYDA 1QHSA 1CS0B 3SLKA 4HFRA 1AQIA 3DMYA 4AZ3B 3CCFA 2HWKA 4EVQA 4CI0B 3GPBA 3FNHA 5J4KA 1U8XX 5H5JA 4AT1A 2VLBA 4PEVA 1IUNA 1NP3A 5EC8A 2VH1A 1HDGO 3V8BA 2UUPA 5I8WA 1K6MA 3JQ8B 2ZVPX 1KJWA 2ETXA 2PT7A 1XLUA 3THWB 4AG3A 4BLSA 3WGNA 2IP1A 1YFLA 1O6ZA 3R9XA 3WA6A 3GPXA 4EJSC 4C0BA 3OSUA 1DRVA 1SK8A 1XL0A 2H57A 3D0KA 1EHYA 3SSOA 1YDFA 3T7DA 2CVOA 4Y1RB 3VUFA 1XTRA 4JN6A 3RSHA 1U2ZA 4DA7A 1GUBA 3OQBA 4MGIR 1P33A 2BJHA 4K2HA 5JZMA 4XJVA 5DPMA 4JMPA 4CLOA 3EBPA 1CV2A 2VL7A 1SUBA 2VZ8A 3T5AA 2NV0A 3HC7A 4OHWA 4CWAA 4F9GA 2ZRDA 5HIIA 1H5QA 3FPEA 5LQSA 3WDSA 4OCZA 4WZBB 4I8OA 1OFHA 2Q3LA 1E4EA 2LKDA 4I9HA 3HHYA 4OJKA 5TS3A 2IBSA 4IOKA 3BULA 2I34A 4JQYA 2FEAA 1MO5A 3N58A 3EIUA 2R4QA 2F9MA 1ENZA 2B8WA 4KQJA 3VPDA 1EQUA 1JVNA 4LRXA 1UUFA 4V3CA 1A72A 3OZSA 1LUAA 5JHHB 2WIJA 4QHYA 1IWOA 1QHFA 2PZFA 3KDPA 2GPYA 1I6MA 1TNDA 1DOAA 2V96A 2HUPA 1M6HA 2PNFA 4OLJA 2QN1A 4LRTA 4LISA 5CH8A 3C8HA 3AUUA 1DTWA 4BO2A 3ZXSA 2YJ5A 1XZFA 3WLAA 2J9RA 1AX9A 3NHBA 1JP7A 3MLBA 2HXGA 5MN4A 3SQMA 2R44A 1HTTA 4LF8B 1NXQA 1A8PA 2XUQA 1ZMWA 4QRHA 2YL2A 2YZNA 4KJXA 2COUA 5KQGA 3E22B 2WDZA 4DPLA 1N1MA 4GQIA 1W73A 3EW9A 2C2YA 3NDRA 4BY9E 1HTBA 3VKFA 4OQDA 5HZHA 2BT4A 2K2WA 1P5ZB 4HN9A 2PQ2A 3O0DA 2NO4A 1ZA2A 4MCIA 3B7NA 5KYWB 1NBAA 3VU0A 1SY7A 2OD9A 3S5UA 4RFLA 3LMKA 1OYVA 1L6IA 3WY9A 2X1MA 1GZ7A 3KXLA 4JI0B 1LC3A 2GX6A 1Y63A 1QF6A 5LQCA 1KH1A 1HLPA 3GVXA 4LRUA 3O73A 1FSGA 4YRAA 4ZT3A 1JG4A 2ZGVA 3EODA 1ECFA 4BWVA 2J7PA 4RKYA 1V48A 1Q3KA 3HFJA 4Y2YA 2N42A 2UUCB 4F5WA 3R3UA 1ZK1A 4N54A 2OYRA 4JI6M 5IS2A 1N2XA 2L17A 4PPGA 3AR8A 3TRJA 1L4BA 3G88A 4P82A 4RK4A 1U8TA 4OQLA 3EXEB 1NIJA 2GD0A 3OPQA 1OGIA 1ST2A 1X7DA 4ZOLF 4NMXB 3GPPA 3IBYA 3TG8A 2AOTB 1RMQA 1SKMA 2BMVA 3HYLA 3LOQA 3EY9A 3T7RA 1PEYA 1R0BA 3FM9A 3GFFA 4YP9A 4B4DA 3UJ3X 3H9QA 3DEYX 2NO0A 3FDIA 1L7XA 5KYNA 1FFWA 2PDAA 3HEAA 3LCRA 4FWTA 2H7VA 5J5VA 3OUTA 5CDUA 2F2TA 5K5EA 5ITRA 1A9TA 3BFJA 3AETB 4NBRA 4AMGA 4ZCSA 4D81A 2W6PA 3QMMA 5CPBA 4O1IA 4LV8B 2XSZA 4KWCA 4RLSA 1JSRA 4XIJA 4FQ8A 3BWCA 2C9YA 4AKIA 4H0CA 5HCIA 4S1TA 3ZWVA 2Z6VA 5FOUA 4TMZA 3OTOM 3DFUA 3F6BX 4XYBA 3C6ZA 1Y7HA 2W6JA 3SXPA 4KQXA 2BGKA 3NM6B 2IV2X 4EF4A 4NZMA 4JK3A 3WKBA 1X6VA 3BXFA 2FPSA 2H5LA 4LGMA 3M33A 3U37A 3P9CA 5AHRA 5I7HA 5DYIA 3AERA 3HKBB 2FHSA 2VLIA 4TRJA 5JCXA 3GRRA 2VHYA 1Z6XA 3Q2OA 4I4LA 2J0QA 1RQ2A 1PLKA 4BLTA 1BHSA 1FQWA 3OAAD 4GL4A 3R7LA 5ECDA 5FOWA 5K45A 1O7JA 2ZE6A 4FFRA 2PGJA 3QPUA 3GLVA 4IX1A 4C78A 5LUBA 4TV9A 2VNKA 1UM8A 4FFMA 4GKBA 4F9FA 4MKZA 2I2AA 4MZDA 2BHRA 1PBNA 1D8TA 2CHVA 4DANA 1B2RA 2C5GA 3ICWA 5IRCD 2QSZA 1JH8A 4LYFA 5B2EA 4HF7A 5A4IS 2YDXA 4ZVRA 2X4GA 2QUJA 3W5SA 5F9HA 2OGZA 3OJFA 1C9KA 4A8JB 2F8LA 1U0SY 4ZVTA 3V4SA 2EIHA 1Y8QA 4FOSA 2QTVA 5LP6F 1VJ1A 1XC7A 3W6PA 1WGLA 1WZEA 1B8PA 3GWGA 3ZY6A 2Q5JA 4KWTA 2EGUA 4CTOA 4J2TA 2FG6C 1Q83A 1GG5A 4BX8A 2O2DA 5J4LA 4IVPA 4LK3A 3WLLA 4DAEA 2ISCA 1ABEA 2LCIA 3AR4A 3P0HA 5CAEA 4EI7A 4LWOA 2AEJA 3G2KA 4ZHQF 1PK9A 3P27A 4UHBA 1BOFA 4CKZA 5CA0A 5AOBA 2BTEA 2LPMA 3CVVA 1GRNA 5E4FA 1PCXA 4F9TA 3T1OA 1QIDA 4EATA 4F6RB 2H3EA 3UA4A 4MO9A 4LC0A 3LUPA 4IMRA 3TZEA 2JVJA 4H6XA 3COYA 4K9NA 1EWVA 4G36A 4HNGA 3MYRA 1XJ0A 1QZ3A 4HDOB 4YAEA 4AJIA 2V7WA 2VI5A 3ZJUA 4L22A 4B3TM 3AV0B 2PWBA 1V71A 3EVDA 1B8UA 3VOTA 3FNBA 5D85A 3H13A 3AEXA 2QW0X 2ZROA 5IN4A 4RGYA 1NVXQ 4YN3A 3EMKA 5IDWA 2L7IA 2LTUA 3EG9A 2ORWA 2GDJA 1GDHA 4IFTA 3UG6A 3E7FA 1KGDA 3UWDA 1U7WA 4U5XA 2IYAA 3M82A 3QFRA 1U3FA 2ZBVA 2XHEA 3MXTA 2FPOA 1IPHA 2BTOA 4H15A 5HHTA 1NBIA 4PSVA 3R0IA 1M8KA 5K8VA 4GWLA 3RHTA 1F7VA 1E7YA 5AVYA 5DBHX 2O8VA 3WGJA 3FGOA 3TUIC 1EGAA 2QE7D 2Z83A 221PA 4HGPA 2DT5A 3RF6A 2C2XA 3VAZA 2G5TA 2BGWA 1GAWA 4RPLA 2PUDA 3FBTA 4FMCF 4BO5A 1GAQA 4G5GA 5ECWA 4FD3A 3LT0A 3OX1A 2QTTA 1RVDA 5F33A 3E8XA 4YJ3B 3NEJA 1IHYA 4MW7A 5BMVB 3U44A 2KYRA 1SUDA 3WGGA 4LHYA 1KMHA 1AT1A 3OZDA 4G4JA 3HCFA 2DFPA 1SIOA 3OD1A 3A32A 1OLUA 3K1TA 2QF7A 2Q2NA 3MAGA 2XMCA 5KYTA 1D1QA 3MUEA 1PX2A 3P0EA 5C3UA 2PWAA 1MT0A 4YJGA 1KAGA 1YV9A 4LCJA 2VNSA 3OE7D 2G80A 2XQGA 3SDBA 4IH1A 1QS0A 4F1KA 5LZ5A 3U0BA 1N8KA 4Y1EA 1FPQA 4FFWA 4UNIA 1ZSVA 3JALA 2Q1XA 2DQYA 4CMKA 5LJLA 1TUBB 4E14A 1QR2A 5FOVA 1NT4A 1LVGA 1I7DA 2LWXA 1ZCAA 4YDHB 1PWHA 2SICE 1E1RA 4QAQA 1H5NA 4LG1A 2W71A 3RYTC 3U7EB 1ZEMA 3DUFB 4A0SA 4MAMA 3NUGA 1XF9A 1KXZA 1ZUD1 5AUQA 1JW9B 2CXSA 2VPQA 3TH5A 1F4PA 3ZIAA 5JS1A 2AFHE 3D4OA 5JJCA 1IUKA 4IDDA 1OXTA 5B1EA 4CKBA 2JI9A 4MIEA 2X8WA 3PYMA 2GEUA 4PGGA 1G16A 4QSMA 3NXKA 3ZBTA 2BZGA 1KO8A 1SXQA 4KE7A 3TUJC 2R1VB 1XDWA 4HGRA 2UZIR 4I6EA 5CB4F 4YAOA 4OL9A 1PNRA 5EZSA 2EU8A 2WM2A 3MCUA 4BTVA 1XDGA 3D8NA 4HEHA 3C7AA 1JU3A 2PSDA 2OXIA 2I7PA 2ZWOA 3MT8A 4U1RA 3NHKA 3G8CA 1R37A 4HH1A 2V6ZM 3CNQS 1UJNA 1SUCA 5B37A 3E5MA 4C0LA 5LQUA 4LFCB 2RGYA 2P68A 1TYDE 1UR5A 1MB3A 2ZATA 3CBQA 4HB0A 4XYEA 4JB8A 4YQFA 3GO4A 2FR8A 4IWXA 5A03A 4LYJA 3O26A 3OHMA 3TB4A 4DIBA 1QB7A 1A9PA 2GJ8A 3TNDA 5J4HA 1O03A 1RM0A 4OH1A 1NMYA 1U2PA 5REQA 4EG0A 1K7SN 3IDZA 1QX4A 3F49S 2GTPA 4JLPA 1UC5B 4FDTA 4YGXB 4Y2VA 2IKSA 1P4AA 1J06A 2PX8A 1YI1A 2H1CA 3GFOA 2OD7A 1VYVA 1UC8A 3E6AA 4OO3A 4C89A 1I0LA 2IZ6A 3FWPA 3LHFA 1GD1O 3THGA 4RLFA 4JJZA 4O8CA 3CVWA 2EGHA 4QVGA 1MHPA 3ZX5A 3B13B 3GFBA 3FETA 2YCLA 3E1GA 2RSLA 1REQB 3HYCA 3GZ4A 3EPLA 2EKDA 5EE9A 2ZUWA 2H4FA 1VJ5A 3IEVA 4TUWA 4K9DA 1CR1A 1IMOA 3L26A 1NC1A 4XFDA 2W6QA 1G38A 1WL8A 4LX8A 5FOSA 5AICA 1AUOA 3DDOA 4LF5B 1G41A 2ZTCA 3PGKA 2PSJA 2RE8A 2FCRA 4DR2M 2QD3A 1K06A 3RU3A 4AN4A 2IH2A 4OKNA 3WB2A 4EUEA 4IBEA 1HQKA 4CF6A 3IPAA 1PV4A 1EB9A 4P32A 2PBZA 4XM0A 2JASA 3JAWA 2DWQA 3U9TA 1WZUA 8AT1A 1Z4PX 2RGXA 3D8UA 5DM70 1ISGA 3A4YA 3VNSA 2XUGA 3K09A 4WKBA 1FP2A 2R7MA 5L4LA 2ZVQX 4PBRA 1W5BA 1OROA 3GEDA 5FADA 2HSZA 4CMBA 3QMPA 3K9LA 4E15A 2VWPA 1CZHA 1Z6TA 3GDGA 2II6A 1NJ2A 5EXEA 2OO3A 2RKBA 3KHUA 3PR2B 3WYBA 1UCFA 4LNUA 1BD4A 2EP8A 1ZN2A 3VR3A 1O95D 2CNBA 4OI2A 1LTMA 5D2CA 3ACBA 4X24A 4FVMA 4K46A 1EFPB 5D84A 1CDEA 1VBKA 2IT1A 4C0JA 2ATIA 5AHKA 1R6TA 2C2OA 5AI6A 1O2DA 1RLOA 5FTLA 2GAOA 5BW6B 4B2LA 3EF1A 2OOAA 1X80A 4HNRA 1LVUA 3KP1E 2FUNB 3UMCA 3QWFA 1RWXA 5LQAA 3K53A 2YXEA 2ZE8A 3L7CA 3QKRA 3PBKA 3TVTA 1CR4A 4J4HA 2W6ID 4ITRC 4UE6A 3GLHE 3GGSA 2VSXA 1M34A 2G5GX 3QEKA 4PYQA 1DGGA 1UPBA 4OY3A 3M3PA 4EYOA 4ASUA 1KZGB 4ATNA 1SVIA 5DNYA 4MV9A 3SF0A 1SUAA 1YB2A 4YWJA 1HRDA 1O0SA 1VHLA 1EP3B 1U7XA 4M99A 3LNCA 5KX5B 1OE0A 1IJFA 1ES9A 1N9GA 3QA3E 4DNFA 4IRMA 2AGVA 1IXSA 4Z1OA 1M1YA 5FB3A 3MTDA 1E3IA 1MRZA 3L25A 2V7QA 3IAAA 3A0RB 2R6CA 3KYCA 5AW5A 2A67A 5F23A 1D0IA 1D2NA 1YK0A 4LECA 5BV2P 2GF9A 1AB6A 2Q1UA 4RIEA 3HCWA 3B6KA 3U60B 5DHSA 1E2PA 1YXMA 1A8UA 1C80A 2Z9CA 5C34B 1I6WA 2VJYA 4KFUA 1CJKC 1DMRA 2C4NA 4QDTA 1N0HA 2FFBA 3VYVA 3BICA 1DAGA 1KZHA 3AZPA 3QPCA 1SB9A 1PHRA 3OHSX 1X9GA 2ZPUA 4X1KA 1AQUA 1VIVA 3VYWA 4C7MA 3W4KA 4XWAA 1FBTA 1KL7A 5FWXB 4MWGA 1JWLA 3QPVA 3AVPA 1TH3A 4RUKA 1SCJA 5AM5A 1ACJA 1DGQA 3HK2A 3I6IA 3DULA 3DFZA 5KNCH 3QXHA 1XPRA 1H1TA 4BE4A 2VJLA 3WQRA 4P3PA 1XEXB 2HKJA 1KF0A 1XF1A 4Q7MB 3TEMA 4QLAA 1ZJYA 3U5ZA 1GZ4A 3UJ7A 2A0KA 2XDYA 3JYQA 3K73O 3JVEA 1MB9A 4EUSA 4HPXB 4EPXA 3DFMA 1NUQA 3IESA 4ZZ2A 3ZZTA 4TM8A 3ZHUA 1LLDA 2VT2A 1V8BA 3TLGA 2RK6A 4YMSA 3C74A 1AKMA 1QG4A 2JWSA 1MO3A 1A2QA 2JAUA 5EZYB 4FN5A 3G23A 5MF6A 1IEVA 1PNOA 5DWQA 4ZCLA 1C3OB 3IQFA 4KSYA 4UDXX 2NZUG 4MLDA 3QITA 3CLSD 1Q7GA 4RHTA 3KWLA 1M2VB 5LD2C 3GRVA 4I9NA 3QYBA 2ENUA 2QHXA 3G2MA 1SQSA 4D4JA 5GIOE 2K6BA 4KP7A 2QT1A 2GF0A 2BMAA 5ITXA 2WD8A 1VHWA 3B6JA 3TCNA 1EU1A 3I6BA 4AMBA 1VL6A 3CWQA 1Z4MA 4H18A 4V0SA 1RWOA 5ED0A 2XDAA 2IWRA 3JVVA 2CW5A 1UOPA 1SC1A 1RBMA 2E48A 2HB6A 2DLCX 4QOHA 3NBXX 4IKEA 4CFYA 2JHFA 2DI0A 4WLFA 3ZD6A 2RGWA 4R1LA 1D6SA 1RW4A 3OUUA 4MDYA 3UUFA 2PFSA 4KYUA 3QKWA 3I2IA 5DYWA 1XZKA 1NQAO 2WM9B 4ZK6A 2YNMD 5CLGA 3V6MA 1NMZA 3PNQA 1V1RB 1WHTA 4JC5A 2LGJA 2RH9B 4BB6A 1TD1A 2MINA 5CLJA 4L50A 3D1LA 1F06A 5ALUA 2XTZA 5ALNA 1KJNA 1JYFA 2ALJA 1RQNA 1IBLB 2RGOA 1EBBA 1A5BB 3IUNA 4LZOA 4L4ZA 1NQVA 1QQ7A 2Q6OA 3S2SA 4MA0A 2WYHA 1T43A 5AMXA 4B6RA 1GTMA 3TQFA 1T1GA 5AI9A 3EISA 2IKQA 3TQHA 3I45A 1XTQA 2D7GA 2PT5A 3WDLA 4TLMB 3C5EA 4H7IA 3DZGA 1UXHA 2O8DA 3DXFA 2D5CA 3ZHYA 3R0XA 4QICA 2PKEA 3VJRA 4Y7DA 4LXQA 3IBFA 5ALJA 2CNKA 1GU1A 3U6PA 1BVYF 3DM5A 2MOKA 2BVNA 4H17A 3PHGA 4H3VA 4QE3A 5B7GA 2EV9A 1J0DA 3I5YA 2GN2A 3Q7EA 1S2OA 3FHJA 1A4RA 2PL3A 3U09A 4AG5A 5EHXA 2JATA 1Z4LA 3ZJ5A 4HR7A 1F8UA 2WSIA 2R751 3I8SA 3H5WA 2B1IA 4M9CA 3AESB 2OZKA 4DV3B 5IWAB 2ERXA 4V0RA 3PDHA 3GQBA 5A6VA 3UFXA 2IOHA 1R2ZA 2PSSA 1NYTA 3BZUA 3WGQA 2OBYA 5EXTA 4ZALA 2J6CA 2O2HA 1HLGA 4K87A 4M2LA 3BSFA 4X7RA 5E8JA 2GSWA 1YRWA 5D01A 3PC3A 5HTKA 2RH8A 3FH0A 3BB3A 3I30X 3BE8A 2R8PA 3O82A 4IJUA 3UAVA 2OQIA 4NNPA 3A26A 2C5SA 1CJSA 1JAXA 2H4HA 1XZ8A 1FB5A 2WFLB 3WGLA 4C29A 3WLFA 2JAQA 5TS2A 4TKMA 3DDZX 4V0QA 3K0AB 4IZIA 4Q3CA 4JNKA 2H59A 2RK4A 1R5BA 2ANBA 1BVUA 1BFDA 2LIPA 1Q21A 3DTTA 4BEWA 3TSAA 3U1VA 4BXOB 1HK7A 3IVCA 2NPIA 4GWGA 1C50A 1EVZA 3ZLUA 1G3QA 4P3YA 1FFGA 1RCUA 1TX4B 4R2WA 4KBFA 4CEIB 4DUZB 4QGHA 5CFNA 5LWHA 3FRIA 3N2KA 1FYEA 3OU6A 3BXHA 2Z8YA 4E3ZA 2ZJOA 2IVZA 3AVQA 1U8CB 1D2RA 3WGUA 1QRAA 3AUKA 5KSYA 5LIPA 4HL6A 3HPQA 1P5JA 3JYOA 3KOMA 1Q15A 3U6OA 4A73A 3FG9A 3HP4A 4I55B 2RJ3A 1FP4B 1G5TA 3EQ8A 1Z4IA 4U6NA 1C8LA 4BO9A 2YR0A 1YKFA 3QVTA 1R8QA 5A6SB 4L02A 1OLSB 4LG2A 4E31A 2QRJA 4JXZA 1BX3A 3OOSA 2WUEA 1L4KA 3DMNA 3NASA 1NHGC 2PKXA 5IMSA 4B7UA 3S4YA 3W67A 5IN5A 1VHTA 4IOLA 2GLXA 4TWAA 2GA9A 1T9BA 2RC5A 3B8EA 2OCGA 1A9ZA 2YVKA 1R4MA 1AQLA 5B4TA 2SHKA 5DULA 5JCOA 1O97C 3LMMA 1PGPA 1FL9A 3ACCA 3EGOA 1U9CA 2K7ZA 2WM8A 2VDJA 2PSFA 1XDSA 3BJEA 1JHUA 1AK1A 4G0OA 2BKEA 2G1UA 4A82A 2CXXA 2OXFA 4EQ6B 3IUJA 1U5BB 4I1YA 2HSGA 5EIBD 2IUUA 4HGNA 3R3SA 1LKZA 4WNAA 4XWWA 4FILA 2OG2A 3HABA 2WIDA 1Q1AA 2VP6A 3H5AA 1IY9A 3ABQB 2JI8A 3ZEIA 2VK8A 3BD9A 3A27A 5IDQA 4W4TA 4F4HA 1OQAA 1A27A 2IOFK 1WF6A 4LF9M 2YWHA 5CK5A 3SEAA 2VG8A 3GL9A 4OD0A 3GJYA 4WADA 1L5HB 4HAVA 4Q3KA 2A4MA 5JDIC 1BAPA 1JFSA 1YT5A 4CKYA 2JD1A 4J94A 2ESRA 2CRUA 3WSTA 2GCOA 1TZJA 2NU7A 1V1MA 2FEXA 4MVJE 4CCWA 2VF2A 4PO9A 1N5DA 4EFNA 4JXXA 1QGUA 4NNOA 1X1CA 4LYGA 2OPBA 4G4OA 3QIVA 2PGIA 2FTKE 5T8KC 4ZAFA 4CJ6A 2WHXA 4RKWA 1R9JA 4ND7A 4Z0PA 4HAOA 1ZLYA 5KOYA 4RZ2A 1S8FA 2HLPA 4U9IS 4LDPA 4YA6A 3KZVA 2O3QA 5ITWA 1XD2B 4QJ4A 4ZU6X 4M36A 5BO5A 2RGNC 1MORA 2F62A 3T4UA 1WVIA 3C5VA 3JQAB 3F96A 3TW8B 1FDVA 3W5VA 1AK2A 2CJWA 4Y2XA 2OPHA 4LMAA 2FPKA 4G8CA 1VJDA 1MX3A 4QTXA 1WMEA 1GTZA 1LRLA 1WXEA 1XSEA 3L7NA 4NP6A 1C30A 4G26A 3DTVA 2BZ1A 4IIYA 4DLUA 2IU0A 3EVTA 1UZLA 1ZK2A 4UOQA 1JL3A 1RU3A 2GYVA 2X1LA 4YBZA 4PLWA 4K40A 5BQ3A 5J58A 1O5IA 4YAUA 1PK7A 2VNHA 4DILA 4MV0A 2D5BA 5JC8A 1THZA 4PO1A 1MN6A 3ZY2A 2Q28A 2BSXA 1OBVA 3OIGA 3SQNA 2ISSD 2I78A 1RLIA 4M7RA 2XCLA 4XOUA 1SHTX 3OQIB 3SFZA 5DNUA 4N8EA 4R9VA 1NVKA 1W0JD 2D7JA 4EW6A 4BQIA 4D46A 3NBZC 1V11A 2EFJA 1EP9A