3K92A

Crystal structure of a e93k mutant of the majour bacillus subtilis glutamate dehydrogenase rocg
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
418
structure length
418
Chain Sequence
b'SKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-specific glutamate dehydrogenase
publication title Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 160
structure length 418
sequence length 418
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.2: Glutamate dehydrogenase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3k92A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k92A03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3k92A02
4IDCA 1NHWA 1X0VA 1P31A 3F5SA 3DHEA 3Q9UA 3G17A 3OA2A 3W8FA 3UCXA 3ROKA 3HB5X 4M87A 2WMDA 5AYVA 2BHLA 3WIEA 4E5KA 3HDHA 4GGPA 1PL8A 2W2LD 1YWGO 4JQCA 4BKRA 2W8ZA 4OL9A 3KYBA 1PJTA 4RPLA 5KJFA 3OP4A 2IDZA 4FDAA 5EQDA 1KYQA 1M66A 2PKQO 1NFQA 3EYWA 2HO5A 4L73A 1DPGA 1H0KA 5CFZA 5L3ZA 4XB1A 3HB4X 3UAGA 4BMSA 4YJFA 4J1QA 3B1KA 5L4SA 4CM6A 3JD4A 1EVZA 2RAFA 4AJIA 3FCOA 4JBHA 2B36A 2FPGA 4CLHA 4F3YA 4PCVA 2VRCD 1NM5A 4J16A 3PQEA 1NX6A 1VL8A 1B0AA 4IGFA 4E5NA 4R51A 2X1HA 5I7VA 2YHIA 2RH4A 3FNEA 5L4LA 2O3JA 2AHRA 4CLDA 4NIMA 1CYDA 4EUEA 2YY7A 2I67A 2PLAA 1K2WA 5JYEA 2Y0CA 1QP8A 4NHEA 4WECA 2Y1GA 1E7RA 3GEGA 4BMVA 2FWMX 5A5FA 2O3SA 3H3FA 1C0PA 3WBBA 3V2UA 4JBGA 3ASUA 5KVVA 4W9NC 4XIJA 3H65A 4TRMA 2WM3A 3E48A 1YXMA 4OXYA 3RBZA 1OC4A 3M6IA 3VH4A 3WFIA 5JYDA 3I9NA 2EXXA 5JE8A 5C5IA 1WDMA 2D0IA 1RYEA 3ASVA 5IDXA 1PQUA 2EKPA 1SB8A 2PZJA 2DUUA 4WLFA 1NPDA 1OBFO 2Q2VA 5TGDA 1V8BA 1HDCA 2VRCA 4R3NA 4H3VA 2NVUB 4CL8A 1PS8A 1H9AA 1W0CA 2IZ1A 3F6YA 4A10A 2JFHA 2OMEA 5GZ1A 3VZPA 3WICA 4B4WA 4J0FA 3W4IA 1VM6A 1LDYA 2B0JA 3RAJA 1SO8A 3AOEC 1YJ8A 4TVOA 3LT2A 2HQ1A 4YXFA 4F6CA 2VWPA 1NAIA 4G2NA 4YDRA 3Q2KA 1MG0A 1X7GA 3F4BA 5GZ6A 4BO3A 1HE5A 3E9MA 4BKUA 5A4DA 5L53A 4Z9XA 4Z0PA 4GX5A 3D3WA 5F1KA 4WLNA 4BKQA 3WGTA 4NJMB 4YPOA 4ZD6A 1XEAA 1A5ZA 3ORFA 4IM7A 5DCUA 3TJRA 3ZWAA 5JS6A 1NBOA 3I6IA 4YT5A 2ZIZA 3HADA 1DLIA 1K0UA 1P1JA 4YT2A 2C0CA 4TZTA 5ER6A 4XZ3A 1EFKA 5DULA 4ID9A 3F4LA 1P33A 3OECA 4E6PA 2AQKA 3QWBA 4RPHA 1XWFA 4PLTA 2P68A 3D0OA 1ENZA 3D1LA 3IUPA 3KV3O 3KZVA 3WMWA 3K9QO 3OQBA 4CM8B 1QG6A 4XQCA 2WD7A 3KYDB 1ZSYA 3SJ7A 4D44A 1R6DA 5TQVA 4K28A 4BO0A 3OJOA 3O8QB 4ZJUA 2NM0A 3DBHB 1E6WA 1YDWA 2EF1A 2NV6A 4LK3A 5B4UA 2W2KA 1JA9A 5JMWA 2UUPA 3NGLA 3WQQA 1T25A 4E0BA 2X4GA 5DOVA 2RCYA 1YDEA 5JCJA 3I23A 3CMCO 5DP1A 4D7AA 1XU7A 5B4VA 4WOKA 3GDOA 4GLOA 1LU9A 1D8AA 3A28A 4Y98A 2C5EA 3BHIA 4RZHA 1PZHA 5JSFA 3U5TA 4ITUA 2PR2A 1ZO8A 3NKLA 1QYXA 3INTA 3NTOA 1T2FA 1BRMA 4AJOA 5FYDA 3TFQA 3LC1O 1UR5A 4MVJD 1KY4A 2VHVA 2WEKA 4OXNA 1F8FA 1I5RA 3N58A 2XPCA 1Y7TA 3RROA 3U49A 4CMIB 3PVZA 2ZKLA 4PZEA 1GEEA 2HMVA 1FDSA 1ZCJA 4WOJA 3JSAA 3RQSA 2C7VA 3GPDG 4HFJA 1NASA 1YQGA 2FP4A 3GGOA 4JX8A 3H3JA 3ZWYA 3RUHA 5I9MA 2E49A 3NT2A 2NSDA 4MP3A 4PN3A 1F0YA 3L9WA 4X54A 1IPEA 4CMEC 1ZSVA 4OXKA 5T8KC 1OOEA 4BNWA 4M54A 3PQDA 2GGSA 1Y5MA 5TC4A 2YW9A 3PIIA 3AWDA 4MO2A 1E7QA 4RVDA 1PJCA 3WYBA 1A4UA 3U62A 1MUUA 1PJ2A 3HFSA 1B26A 4J90A 3VOSA 4IS3A 4R9SA 4CM7A 4MVJA 3KSDO 4YEDA 3RU7A 5HS4A 1QYCA 2B37A 2X23A 3M1AA 4IPTA 2F00A 8LDHA 2BELA 4CMHA 3I9LA 3LLVA 5A9SB 2VYVD 1GDHA 5KIAA 1YB4A 2CZCA 3QY9A 3HJAA 3WWZA 2WWRA 4HBGA 4IIUA 3PZBA 1GL3A 2IXBA 2ZYAA 3QIVA 1JWAB 5G0VA 4B7CA 3GDFA 5HWSA 5IZ4A 4PG4A 4KUGA 4J9VA 4TQGA 3VH1A 3VZSA 3H9QA 3GN2A 1I3KA 1UXJA 4CJXA 4AVYA 2WE8A 1EQ2A 1LC3A 4XGIA 1QSGA 3JCZA 4PGFA 4Y6PA 5JW6A 2DT5A 1KIFA 1UP7A 2DBRA 2JCYA 3DO5A 3MTJA 1IY8A 1KC3A 1JW9B 4IY1A 2AG8A 1YS4A 3UVEA 4DYDA 1IL0A 5BNFA 3ENNA 3P2YA 1HDRA 1DEHA 1GQQA 2ZYDA 4CM4B 4CLXA 4MP8A 3W6ZA 1B16A 3W4KA 2GYYA 1LBEA 4IMPA 4A7PA 4OQYA 2PNFA 1DOHA 3PLNA 3S55A 3BMNB 3AI1A 4LW8A 4M1QA 2OGUA 1GCUA 3PJEA 4JP2A 4PRLA 3WX0A 2HK8A 5CDUA 4ALLA 3JD1A 4TKLA 3W6UA 2HDHA 3I4CA 1BDMA 1TB4A 4NZ9A 5G0SA 3I6QA 5CHEA 1X13A 4XR4A 4XQEA 2R6JA 3IS3A 3JQ9A 3EVNA 2NTVA 1U2GA 3H5RA 3GNSA 4UUOA 5L51A 1V9LA 5KVCA 1Q0QA 1WAMA 1Z74A 3MWDB 1ZK0A 4GWKA 5BSEA 3IMFA 4J3FA 2VZ8A 1P9LA 4RGBA 2HRZA 3PHIA 4CMBA 3RIHA 4XDZA 1JKIA 4J1TA 3E6AA 1MG5A 5EMHA 1PQPA 4E2YA 1I2BA 3CUKA 4E3ZA 1S6YA 1FMCA 2VUUA 4PG5A 3ZV4A 3QVWA 4PLWA 2PFGA 2PZKA 4B7XA 2DPGA 1B7GO 2AQIA 1MP0A 1ML3A 2PH3A 3BHJA 2VTEA 4Y8VA 5TNXA 4AICA 1NR1A 2NVWA 2Y99A 2NU8A 3PHLA 4MVJP 2AMFA 3V2HA 4CMAA 1EQUA 4NJMA 3KEQA 4TVBA 3K6JA 1JVSA 4LCEA 1FF9A 5T5QA 4P22A 1E6EA 2Q45A 3BHMA 1QRRA 3WIDA 1A72A 3MJ4A 4FC6A 4BNFA 2OP0A 4Q3NA 1VKOA 4XEHA 3ZV3A 1GCOA 4XR9A 2D5AA 3OF2A 3JD0A 4KQXA 1GEGA 1LDNA 4FFMA 4QX6A 1UZNA 3ZNNA 2QX7A 3ADOA 4YQYA 4DRYA 1PJBA 4MIEA 1HZZA 3T4EA 3TWOA 1Y8RB 1F12A 4RPJA 4UAGA 4RZIA 3ZHXA 1GQYA 1VPDA 3VZQA 4CM8A 1FDWA 4RO0A 5F1OA 3O8QA 1HL3A 3DBHA 3INRA 3NDRA 1C1XB 1BXZA 1EVIA 4OIMA 3FRJA 1MFZA 2C07A 3GMDA 1ZEMA 2Q3EA 4OSOA 2DVMA 4NJOA 2AA3A 1JLLA 1LXCA 1O8CA 4QT0A 1O89A 1VSUA 4HWKA 1NR7A 1HDOA 2EGHA 3ZWNA 1L7DA 2A94A 2OFPA 4XYLA 4XRRA 3WQSB 3DHYA 4QXMA 1ID1A 3RBVA 3VKVA 3TF5A 4MKRA 3LVFO 4EBFA 1DC4A 4U6QA 5B12A 1Q7CA 2X86A 4GH5A 5G0WA 3RVDA 2GSDA 2OHXA 3QV1A 4HFRA 4NI5A 4DA9A 3UCEA 3U09A 1F14A 5KJEA 2WTBA 3DMTC 3ONDA 2UV8A 2Z1MA 3LU1A 3C1OA 4KUHA 3GH3A 4WE3A 1JTVA 1DC3A 5DF1A 4CMIA 2HMWA 4Y67A 1PR3A 2QQ5A 3ST7A 1P1RA 4E33A 3LZ6A 3SLKA 5COBA 3JQ8A 1RM0A 4J7XA 1NPTO 4TZKA 3SLGA 3LYLA 3RUDA 5L40A 1U4SA 1P0CA 1H93A 3DOJA 5THKA 3EVTA 1Y8QB 4UEKA 3BYZA 1C0LA 3NJ8A 4YVFA 3QWFA 3MJTA 3TSCA 3BIOA 3ZV5A 2FY8A 1XQ1A 2IXAA 5JY6A 2G76A 3IUSA 4RDHA 2OXIA 1B14A 3OQ1A 1WW8A 3LSYA 3Q1LA 2O2YA 3VVCA 4B7UA 1BG6A 2Q46A 2V6GA 1B8VA 4RV9A 4CR6A 4Y6RA 5IZCA 1Z6ZA 3MJCA 3ZWOA 1W6UA 1I3NA 4YJHA 4JP3A 2O48X 4BV8A 4Q3AA 2X5JO 3EK2A 4CM5A 5DP2A 5ITWA 5IDQA 3F1LA 2WYWA 3I9KA 4CM9D 4D45A 2PTGA 5T64A 1A71A 4ZQFA 4LSMA 4UUNA 4LISA 3JQDA 1E7YA 3BMQB 5A9SA 3R6DA 3RKUA 5JBIA 4P38A 4OYRA 3V8BA 4U6SA 3AU8A 3JQAB 2C5AA 4K6FA 1U7HA 3UW3A 4EI2A 4MPDA 3HDQA 1ZK3A 1VC2A 3R0IA 1Z75A 4JLWA 3I9MA 4ZQGA 4NK5A 4E4YA 2JAHA 4L76A 4R9RA 2O3UA 4II2A 1NVTA 1PWXA 1D1SA 2VNSA 1PTJA 3D5QA 3H9EO 1FDTA 1X14A 3ONFA 1QR6A 4AFNA 5ADHA 2YYYA 4MKZA 4WEQA 2AEFA 4BGIA 3VTFA 4CM4A 3D3WB 1B15A 1U8XX 3L4BA 4MVJH 4RF5A 3L6EA 2VNAA 4IZIA 4NU6A 3ZV6A 1X1TA 5EIOA 1GYPA 1E1MA 4PRKA 3FNGA 2Q2WA 4H7PA 2PD3A 3BMNA 4I08A 2W4QA 5JC1A 1Y81A 1PJQA 3E18A 3EGOA 5AXAA 3GZNB 2O7QA 3ZU2A 1WDLA 3MEQA 1JQBA 3RKRA 1E3EA 2E82A 4CMGA 4KUEA 4DPMA 3FN4A 3R3JA 4J1NA 2JFFA 5EJ2A 1N7GA 5H83A 2AEMA 2I66A 1WNTA 2HMTA 4NBWA 1BDBA 3R3SA 1ZIDA 4NBUA 1CRWG 3MOGA 2GZ2A 5KTKA 2VUTA 4BO6A 4E2ZA 4YJGA 4U5QA 2OBYA 3TZCA 1H2BA 4QECA 3W8EA 1YB1A 4DIFA 1XU9A 2OORA 2Y1CA 3DAFA 2A9FA 1O0SA 1VJTA 3QE3A 4Q3EA 4BNHA 4CV1A 1EE2A 1FDUA 1V3UA 3K73O 5A9TA 1EMDA 3JQFA 1Q1NA 1C14A 5TT1A 1NVMB 1LX6A 1GY8A 4YAKA 4F45A 2QRKA 5T57A 3NRCA 2YUTA 4OMUA 1DRWA 1N1GA 5A02A 3FWNA 2ZB7A 1HDZA 1HRDA 1PX0A 5AXDA 1TA4A 3IP3A 4L75A 2NADA 3S2IA 4TROA 2FN7A 1YBVA 4KZPA 4ZVVA 4MIYA 1DAPA 1SAYA 5DDIP 3ZGYA 3DAPA 1Y8RA 2EV9A 1GUFA 1TXGA 4B8ZA 4D3DA 1C0IA 3WWYA 4IQ0A 3F1KA 3H6KA 4ZHSA 2NTNA 1ENYA 3FD8A 1T1SA 1YRLA 4WGGA 3RC9A 3E03A 5ENVA 1O6ZA 1PL7A 5JAMA 1C1XA 3GHHA 1BVUA 3LT4A 2FPPA 1E1NA 1RJWA 2GCGA 4E2WA 1JVBA 1ZK1A 3NX4A 3BTVA 4J6FA 1YE3A 1ISMA 1CQIA 2BI8A 3KSUA 1CERA 1NP3A 1MA0A 4PIVA 4MIOA 4AJNA 5KNLA 2GUGA 1KS9A 3ABIA 4RVUA 4QQRA 4FPXA 3D64A 4U0JA 5BNIA 5DZSA 4DMLA 4WKGA 1JDJA 4I5EA 3GNQA 2BGMA 1ONPA 3IAHA 4BNGA 1DRVA 1H5QA 4B4OA 4E2XA 3D7LA 2PGJA 4IDEA 3DXFA 3OJLA 4MVJF 4R01A 2QIOA 4YT8A 2G0TA 3MJVA 1C1DB 1TI7A 4FIZA 5KOIA 1GTMA 2D8AA 4UUMA 5LC1A 3U0BA 1N2SA 4ALJA 5A5EA 2GD1O 3WGIA 3C7AA 3VPHA 4DGSA 3WYCA 1GZ3A 4WNCA 5LDHA 3E9NA 5FF9A 1KC1A 4I8XA 3X2EA 5TLSA 3HWRA 4DLBA 3ZWPA 2AQHA 1E7MA 3DOCA 4EW6A 5JMPA 4BNUA 3F5QA 3EW7A 3WR5A 1LJ8A 1Y8QA 4Z9FA 1PZFA 2YV1A 1PS9A 1HLDA 2IEBA 3JQAD 3DZIA 3CKYA 4W99A 1R37A 5EQFA 3HN7A 2Q99A 2IRWA 3IJRA 3RCBA 4FSHA 3FR8A 3ZI0A 1KOLA 3FPLA 4UUPA 3DONA 1KERA 4BB5A 3OM9A 5TJHA 1RPNA 3KLPX 5COQA 4BO2A 5I9LA 3AY3A 4FW8A 3OJFA 1G1AA 1P1HA 2UAGA 5CDTA 3FI9A 3KRTA 4A5OA 3GA0A 1EBFA 1JN0A 3PDJA 4Z0HO 3JD2A 2ZJ1A 3S2EA 3E82A 2NU9A 4H16A 1XDWA 4JN6B 2AXQA 2DU8A 2GNAA 2VWHA 4BNZA 5HA5A 3A4VA 3WGGA 3E5MA 1KVTA 2VUSA 4OM8A 2EEZA 3HDJA 3K5PA 3BMQA 3ROMA 4UREA 1R66A 4NBTA 3GRPA 3MZ0A 2J3IA 3TZQA 1QV7A 4AJPA 3VPSA 3JQAA 4JJGA 3FSRA 2AG5A 3PGXA 1E3JA 1UXIA 1DBVO 3ETGA 2NQTA 4I9NA 5T6BA 5ER9A 2C54A 4H15A 4UVDA 4RVHA 1LSOA 4BL5A 4AJJA 5G2OA 1ISHA 1PSDA 2Y1FA 3OIDA 4GKBA 3JQ9C 3DB2A 4PLVA 3I52A 1M76A 1GZ4A 1ZZEA 1TT5B 2HK9A 2VZ0A 3AFMA 3PI7A 5F5NA 3H5AA 3INGA 1MB4A 1P1KA 3UF0A 2FSVA 5H82A 2EJVA 1JKJA 1PWZA 5BSFA 3I5MA 3DQPA 4OJNA 4QO8A 5JCJD 1NAHA 2LDXA 4O59O 4Z9YA 1KVUA 3OH8A 8ADHA 4HNHA 2IYPA 5GY7A 3AY7A 4FOSA 4FBGA 9LDBA 1VL6A 3UGKA 4GMGA 3GZNA 4J1SA 4BS9A 2QZZA 4AJHA 4A03A 1J0XO 1E5QA 4FJ1A 2B4TO 4U7WA 2ZB8A 1ZBQA 3I4FA 3LC2O 1QLJA 4GX2A 3DTYA 1QXSA 3PP8A 4P4NA 2CF6A 3QVXA 1Q0LA 4GX1A 1GD1O 1R0SA 1E3IA 2WDZA 3PTZA 5BT9A 3LF1A 1U9JA 4YACA 3RJ5A 4WJZA 3ZHBA 5BSGA 1GR0A 1LQTA 1XIVA 1E7SA 3A1NA 3PRJA 3Q6IA 4BNKA 4GQAA 4YR9A 2WJPA 3MTGA 5FI5A 3H5NA 4M86A 1XQ6A 3W1VA 4BOYA 1T2DA 3JQ7B 1LUAA 2C82A 4ZRMA 4A2CA 4PLPA 4GLLA 3SX2A 3VH3A 3PJGA 4OOFA 4W4TA 1RYDA 3GVCA 2G82A 5U1PA 4D3FA 1H2HA 3SC4A 4PG8A 4RDIA 3MWEB 2VQ3A 4GX0A 2Y93A 3U9LA 4IDGA 5A3JA 1YL7A 4BNMA 1D3AA 1U8FO 4OO3A 2J3HA 4ZICA 5J23A 3GRKA 1ISIA 1ZK2A 1EVYA 2CMDA 4FFOA 3ONEA 4CMCA 3QW2A 4NK4A 4MVJE 4BGUA 2DM6A 4C7JA 2P4HX 3KBOA 1LLDA 3AOGA 3PDUA 4RF2A 1GU7A 3FHLA 3JQ8B 4G65A 1LRLA 2O3QA 1NQOA 4JIGA 1Q7BA 4BO5A 2EP5A 4LMPA 3T4XA 4R1UA 2ET6A 4JK3A 4PLZA 1BWSA 4CUJA 4G81A 1P3DA 1HETA 2GZ1A 4ZQHA 3ON5A 4DL9A 3A06A 3GEMA 3K30A 3WOHA 4IJUA 1BSVA 3GVPA 3W8DA 5DNAA 3VPXA 3WNVA 4EZBA 3DMYA 5L95A 3OJ0A 4YJHB 5FEUA 4TRJA 4AL4A 4EJMA 2Q1TA 3OIGA 4R1NA 1UH5A 2JHFA 1HWYA 3QA9A 2GN8A 1VLLA 1IOLA 4N5NA 1WMBA 3DL2A 4KQWA 4B8WA 3PYXA 4NH4A 3WDSA 4RF4A 4GL4A 3JQ6A 1V3VA 4OHUA 1PL6A 3S8MA 1IYZA 1HXHA 3PPIA 2G1UA 3O03A 2X58A 1DSSG 3O4RA 5IZCC 1KBZA 4XWYA 1ORRA 1ISJA 1C1DA 4NFHA 3DZBA 3VDQA 1EK6A 1LSSA 2Q4EA 2BLLA 2WSBA 1P1FA 3FTPA 4DWVA 7MDHA 1IULA 4WLOA 2TMDA 2DLDA 1VKNA 4W7HA 2BGKA 3GDGA 3WTBA 2XAAA 1PGQA 1ULSA 4QEDA 1M6HA 1HE3A 2NTJA 4YJDA 1T4BA 3CH6A 4KTTE 1OAAA 2X6TA 4DYVA 4J49A 1X1EA 1A27A 2FZWA 3GVIA 5A04A 4BHTA 4XYBA 3C1AA 5IN4A 4CV0A 5F3RA 4WLUA 1NWCA 5AOVA 4LRTB 2ZTUA 3GG9A 1YGYA 5A03A 3JTMA 4B3HA 1E7WA 3JYPA 1UDAA 1LDMA 1ZH8A 2PD4A 4IQGA 3H9JA 1LI4A 3EMKA 5FWNA 2B35A 1EDOA 2NLOA 3WQRA 1MLDA 1GV1A 3WYEA 1UZLA 1Z7BA 3DHNA 1W73A 2R00A 3BZUA 1S7CA 3G49A 3L4BC 4XIYA 4GVXA 4M49A 1BMDA 4ZU3A 5H81A 4R4JA 4IMRA 1XELA 4R5MA 5AXBA 2XXJA 1WWKA 2BFPA 3C1TA 2ZK7A 4EUFA 4WLEA 1LRJA 1ULUA 2IZ0A 2ZTLA 1XLTA 4YJGB 4DIBA 1I10A 2GRAA 3DZFA 3ZN2A 1AXEA 1E5LA 1RM5A 2ZB4A 4KWHA 3FBTA 1T24A 5C7LO 1GYQA 4BKPA 1A9YA 2PV7A 5JDIA 5HTOA 4NMHA 3QWHA 3TDKA 1YONA 2Y1OA 3DWFA 4BQPA 2BD0A 5ITVA 5K0ZA 2QZ9A 1TT5A 1V35A 2DBQA 2HSDA 4U0KA 1SEPA 1LLCA 3ZH2A 4PFJA 1WLYA 2YV3A 4NFSA 4JNKA 4EJ0A 2JD0A 4R69A 1RM4A 4Z3DA 1JAYA 3HG7A 2DTDA 2AE1A 2ZQYA 3VPGA 2VHWA 3IL2A 2X5OA 3GG2A 1H94A 4J4BA 4RLHA 2EWMA 1EK5A 2D59A 5HBRA 3TPCA 2E48A 3ADPA 4INAA 4NBRA 4WUVA 1SZJG 1DAOA 1DO8A 1E0DA 3IKTA 2O2SA 5EPOA 1V6AA 3OICA 3IDSA 3QQPA 3IP1A 2SCUA 1XGKA 3ENKA 2B69A 4XQGA 1Z82A 2D5CA 3CIFA 4IGEA 4TMFA 4EGFA 3JQFC 4Z6KA 1UXKA 2UDPA 3FTNA 3TRIA 3ZU4A 3R1IA 4ZQEA 3TNLA 1K3TA 3WBFA 1FXSA 3E1KA 5EN4A 4CL3A 3V1UA 2DBVO 3DAGA 3SXPA 4GMFA 3NUGA 3BTUA 3UHAA 3GFGA 2Y05A 3PFWO 3HQ4O 3UXYA 1A4IA 3ROQA 4PLYA 3Q2IA 1OC2A 1CJCA 3QVTA 1DXYA 1R16A 2UYYA 5T67A 3B70A 3BMCB 1R0KA 3KHUA 1XHLA 4I5FA 4KMSA 3JQ7A 4L74A 1UAGA 2O23A 2GERA 4HKTA 4D3SA 3O38A 2P5YA 2AQ8A 4CLRB 4FD3A 3FPCA 4XYEA 3DZJA 1DJQA 1I0ZA 5MGBA 3TL2A 2YDXA 4TRRA 1YB5A 4A27A 1DIAA 1N7HA 3CINA 3RBXA 2P4QA 1PJ4A 1M2WA 2FR8A 2QYSA 3H4VA 4MOWA 1GV0A 2Y1DA 3NDIA 2EG9A 1L7EA 1LNQA 2Q2QA 3B20A 2J5QA 3ZDFA 4UULA 1SOVA 5G0TA 3GFBA 1V0JA 3C7CB 4CUKA 4TRNA 1KVRA 3EY4A 2J3JA 1J4AA 3BA1A 3WLEA 4XYMA 3ZWBA 2EP7A 3TN7A 1Y6JA 4XRGA 1ZMTA 1Z7EA 4P4GA 4NBVA 4EUHA 4XX0A 1ZMOA 2R2GA 2X5KO 5F5LA 5DN9A 2HK7A 3DEYX 1WXDA 5CEJA 1WDKA 1ZW1A 2ZYGA 1HKUA 2WYVA 4GSKA 4DMMA 3JV7A 2DQ4A 3CZRA 3T7EA 1ZXBA 3ITDA 4JJIA 1HE4A 2Y1EA 3GN1A 3JQEA 5JAZA 3RJ9A 4DLLA 3E9QA 3K8ZA 4R5HA 1NXQA 4CPDA 3GOHA 4DQUA 3A9WA 1E1KA 3DDNA 2C59A 5G0UA 1H6BA 1QYWA 3WGHA 4D43A 5JAQA 2YZ7A 3L6DA 3O9ZA 4YQZA 5TRTA 5ILGA 1I8TA 2UUOA 3ZWXA 5AVOA 5ICSA 4D41A 3L9XA 1HEUA 5JO0A 1HDYA 3GVXA 1T4DA 1WPQA 3N74A 4WCFA 7ADHA 1KY5A 3UOGA 4HADA 1AHIA 2ZATA 4J9UE 4W7IA 5I9NA 1FK8A 2Y66A 3WGYA 3WXBA 1AXGA 3QJ5A 4R54A 4IJWA 1EUDA 2GZ3A 3EHEA 4RPGA 3OJEA 3RD5A 3TOXA 2WD8A 1DLJA 4UEOA 2E4AA 3HHPA 4O63O 3WMXA 1P74A 4RCVA 4D46A 4CLOB 3RWBA 3D5TA 5GZ3A 2GASA 1U3TA 3B6ZA 2VN8A 4WEOA 2PK3A 5FFFA 3OMLA 1T26A 4ZGWA 3K2BA 1LDEA 4Q3CA 3ICPA 4WK6A 3C24A 5BSHA 1HDGO 4WPGA 3UFXA 2H9IA 1E6UA 2X7HA 3GNTA 3PGJA 2YJZA 2AW5A 3PYMA 3TQHA 1ISFA 4TKMA 4GAEA 2P2SA 1F17A 1XSEA 3I1JA 1ADGA 2X8LA 3GGPA 3SBOA 5KJCA 5HRUA 2W90A 1T1RA 1ZK4A 3DBLB 3VAZA 4GI2A 4I5DA 4IXWA 5TX7A 1O5IA 1U7TA 2I99A 2EW2A 3KTDA 4KP7A 2O50A 3GUCA 2BMAA 3C85A 5B37A 3AY6A 3TZKA 2FRDA 3RSHA 3RUIA 5CG1A 4NPCA 1HTBA 3RUCA 3U3XA 2E37A 2NWQA 2CY0A 5A3VA 4N7RA 2Y0DA 4RL6A 5KCZA 5L4NA 1ADFA 3QLJA 1VE9A 5F21A 3CXRA 4RVFA 3RI3A 5IF3A 1B8UA 1U4OA 3B1FA 5U4QA 2JJYA 3I83A 4IDDA 2HKIA 3UICA 3JQBA 5K6AA 1UUFA 4J2OA 4WASA 4FGSA 3CPSA 3OEYA 4L9RA 3SEFA 4LCJA 2WE7A 4L8VA 4K6CA 2IEDA 4OKNA 3KO8A 1HSZA 5IXSA 5AQ1A 1EBUA 1MX3A 3GAFA 5HS6A 1LEHA 3DZHA 2CDCA 4IBOA 4J4HA 3CZMA 1I24A 4DQVA 5JAIA 3LQFA 1UDBA 1A9ZA 1QKIA 2FMUA 4FGWA 4M8SA 5A1TA 5I8WA 1R0LA 3C8MA 5AXCA 4PLCA 5ENDA 4N18A 3RFXA 4DC1A 2O7SA 4J0EA 4Z3KA 3SVTA 1HDXA 1EVJA 6LDHA 3ZCXA 3QHAA 4D79A 2YQ5A 4G5HA 4N5MA 5G4KA 3AUSA 4NU5A 4EYEA 2AE2A 5A06A 1RM3A 3GEDA 1KEUA 4CR7A 2UVDA 5DBFA 3P2OA 4XKJA 1R4MB 5TJ9A 2PWZA 4UVEA 4Q3DA 4BNNA 5BQFA 3DTTA 3AUAA 1B3BA 1JAXA 2I6TA 2O3TA 4HFMA 1IB6A 3JYNA 3JD3A 2CDAA 3AUUA 3BMCA 2Y67A 2P9CA 3LDHA 4FC7A 2AEJA 5CPBA 4XD2A 3KUXA 4BGVA 4EDFA 1IUKA 5TS3A 1DB3A 5C7OO 4CLRA 3NEPX 5JO9A 2HMUA 2Q1UA 1U5CA 1HYEA 2B4RO 2QG4A 3G1TA 3JQGB 3PWKA 4RF3A 3RC1A 1X0XA 1U3WA 2VZ9A 4P8RA 4ALNA 4AJLA 1T2EA 1BHSA 4JJFA 4JXKA 2JCVA 4D0RA 4FB5A 2POQX 1PJSA 3PFFA 2H5LA 2ZQZA 3FF4A 3O26A 4BQRA 3NJ4A 2OBNA 3DFZA 5FI3A 4Q9NA 2CFCA 3CMMA 3PQFA 4J7UA 5F1PA 4D0SA 9LDTA 5KKAA 1PGJA 1DC5A 2HU2A 3Q9NA 3EAGA 3AUTA 2CNBA 3AW9A 3DBRB 1OFGA 3VC7A 3L07A 3PHJA 1E3SA 2O4UX 1R4NB 4UVHA 5CPFA 1LSJA 2PA3A 3WSVA 2Y0EA 4BO9A 5IJZA 1WZEA 4MKXA 4WNIA 1EUZA 3KB6A 3ZW9A 1GZ6A 1UXHA 3NAQA 1KEVA 1U3UA 4HP8A 2YFQA 2HRBA 3DFUA 1A7KA 4RQTA 2B5VA 4E5PA 4ND3A 3KETA 5IN5A 1KVSA 3ZWWA 4E5YA 4JGBA 2PGDA 5CDGA 4YTEA 4CV2A 5ICMA 1DIRA 5DCYA 4XCVA 4YRAA 4MP6A 1HT0A 1Q2XA 2PD6A 2PZLA 5KJ1A 3EC7A 3IIEA 1ZJYA 2HUNA 2V6BA 4RJTA 5B4TA 4R68A 1KVQA 2QYTA 2I3AA 2XF8A 1N1EA 2B4QA 2ZCUA 4PVCA 1LDGA 4OSPA 4KOAA 4BNIA 3L6OO 5DT9A 5I7EA 1H9BA 3P7MA 3FR7A 4IINA 4M55A 1U5AA 3S2FA 3GUYA 1ISGA 3IKVA 2Z95A 4B4VA 5A9RA 1YKFA 1ZUD1 3WNQA 2VWQA 2C29D 1I36A 1LSUA 3PZRA 1QV6A 2VOEA 1U2DA 4QFCA 2W2LA 4RPKA 3P5SA 3OSUA 3G0OA 4R41A 4AJ1A 4DC0A 4CLOA 1Q7GA 2Q1WA 4XGNA 4BMNA 4PLGA 1K89A 3U4CA 3NT4A 2R00C 3PHGA 1OMOA 1I3MA 2CD9A 1LA2A 1PS0A 4IXTA 3B1JA 1VJ1A 3HDYA 4R1TA 1X7DA 2VCYA 4QSMA 2O3RA 1BXGB 3WJAA 2FZEA 4IZHA 4KTVE 3DC2A 2GLXA 2CVOA 2FR0A 3PWSA 3DBLA 3SJUA 1QMGA 1TVEA 4B79A 3U4HA 3WLFA 4C7KA 4YT4A 3EUWA 3H8VA 5JDIC 4RLSA 3ANNA 1NWHA 1M67A 3MJSA 3GMSA 3STHA 4BIIA 2EHDA 4E32A 4E30A 1OI7A 3QWAA 4ND1A 3GK3A 3BXXA 3M2PA 3ZNOA 2ZCVA 2DPHA 2VHZA 3D4PA 3F46A 3JQCA 1EUCA 4QO7A 1SOWA 1BGVA 3WJ7A 5I7FA 2B83A 1ONOA 4O5OA 3BTSA 2ZTVA 3UUWA 1AHHA 1ADBA 1XA0A 1J6UA 3VHRA 1R12A 3UN1A 4DQXA 1ADCA 4HX5A 3DOOA 1E92A 1LLQA 3OIFA 2XOXA 3ROPA 1YQXA 3UCFA 3LT1A 2PKRA 1UXGA 3ZNQA 4ALIA 2TMGA 3TFOA 2Q1SA 3RUFA 1MC4A 3GPIA 1PU2A 4L4SA 5IXYA 4ZRNA 3H9GA 3IC5A 3E5RA 2ILTA 3HNPA 2YFHA 1GPDG 4U8GA 5B1YA 3A14A 3DR3A 1BW9B 1VI2A 3PHHA 4YAIA 4F6LA 2X0RA 2QHXA 1ZSNA 2E6UX 3KYCB 1C3VA 4I5GA 1HE2A 4CV3A 3G1UA 4XB2A 1QLHA 3V5NA 1Q0HA 1L1FA 3D3EA 1NQAO 3HN2A 4LGVA 1KEWA 5JXWA 4IIVA 1H6AA 4NR0A 5GMOA 1CETA 3COSA 5THQA 4DBVO 2CSUA 4LSWA 1E3WB 4EEZA 2Q4BA 4K1LA 4DTIA 3JYQA 3OHSX 4YCAA 1R4MA 3GT0A 1GUYA 5JY1A 2JKVA 1C0KA 4CQMB 4ZQBA 4UVGA 2BGLA 3AM4A 4CR8A 2BRUA 4R3WA 2VT2A 4DVJA 4NQZA 2I3GA 5C3MA 4ZA2A 1DJNA 4BNYA 2D2IA 3MCVA 1WVGA 1MC5A 1Y5RA 4S1VA 4MVJI 1GYRA 1UP6A 3PYLA 5JDCA 2OL4A 2NQ8A 3JQGA 3NTRA 4YB8A 5COAA 3ZWVA 3TZ6A 1G0NA 2BFMA 3GQVA 2Z1NA 1SMKA 4PLFA 4ROSA 1I01A 2JL1A 1YL6A 3ITKA 4ND2A 4WCFB 4HXYA 2I76A 3GAZA 5I8ZA 4AG3A 2J6IA 2Y68A 4BNTA 4R16A 1I30A 1T2CA 1XR3A 4NDNE 2QW8A 3S2GA 2HCTA 2PKQP 5KWEA 1GUZA 2EJWA 4IS2A 4OH1A 4OOEA 2V6MA 4ALMA 3DBRA 3K92A 3FNHA 6ADHA 1TEHA 1EZ4A 2OO5A 4NG5A 1R4NA 1IHXA 4CQLB 4ND4A 5IAAA 3K96A 4B3JA 2XXBA 3RUAA 4BO1A 3ICCA 1HF3A 4J7CA 2DUWA 4WCFC 3BMOB 1EEHA 3IQDB 3KEOA 1LC0A 4AJ2A 2OP1A 2JAPA 4C4OA 4CM3A 1UDCA 2EERA 3WGZA 4AJEA 4Q3BA 3ZWCA 1U1IA 3AJRA 3WSWA 3VPFA 3EZYA 4RORA 1MV8A 1N8KA 3HUDA 3DZKA 2DBZA 5HM8A 4NFYA 4CODB 2P91A 4BKOA 2IZZA 5BNTA 5TIIA 4E31A 3P19A 1HLPA 1G6KA 4BO8A 2X0JA 4N54A 5JLAA 4JBIA 1XCBA 1GFSA 3AM5A 3LK7A 4GWGA 3E8XA 3MOIA 4PG6A 1BTOA 3RUEA 2FPIA 3ZWMA 2V7PA 1O94A 5LDGA 3V1TC 1YQDA 4TWRA 4PZDA 4BO7A 4HNGA 3AK4A 1WMAA 2RBEA 4W9NA 4FCCA 4Y6SA 3H9UA 4I9UA 1E3LA 3ANMA 4BB6A 3CSDA 3WS7A 3VVBA 2IYOA 2CVZA 4ILKA 2CDBA 4D42A 4BGEA 2VTDA 4BNVA 1LTHR 4I1IA 5EL0A 2VYVA 4LVCA 2RHCA 4OGWA 4CMJA 4MVJG 4PG7A 1G0OA 1GPJA 3FBGA 4NNJA 3PK0A 4EJ6A 1ENPA 2GR9A 3TL3A 2P9EA 1BVRA 3ZU3A 2BKAA 1GAEO 3PLRA 2VOJA 2VHYA 1YVEI 1KETA 5I7SA 4BNXA 4QTZA 3AOEA 1MXHA 4II3A 2V6FA 2ZJ0A 1D1TA 2HLPA 3M1LA 2I5PO 4YRDA 3Q11A 4FFLA 4AJ4A 4E12A 3HFGA 4MJLA 2GN9A 5DOZA 2BFAA 3JQBC 4FFPA 2W98A 5ES3A 5K6AC 3QVOA 1BXGA 1VSVA 4FJ0A 4XA8A 4URFA 2NVUA 3VZRA 3ZNPA 4CMKA 3GVHA 4ESOA 4Q39A 2H1SA 4ONEA 2HAEA 5CP8A 3RU9A 2C2XA 3ETEA 4A0SA 4P4LA 2H6EA 2G5CA 2B5WA 3F9IA 5CDYA 1UJMA 2D4AA 1IZ9A 1U3VA 1DC6A 1SB9A 5G4KB 1TT7A 5TSDA 3V1YA 5BR7A 1N9GB 3ZU5A 3TZHA 4PLHA 1PGOA 3K2EA 3TOZA 5EESA 2GF2A 1PJ3A 4LMRA 1DFGA 1FJHA 2RH8A 4YAEA 2Z5LA 3BTOA 4E21A 3WGQA 2BFOA 3C3XA 1I2ZA 4MVJM 4OAQA 3I3OA 1PZEA 1HYHA 2J5KA 1NYTA 2LDBA 5CAEA 2NU6A 3HSKA 3OA0A 2YV2A 1LDBA 4J2HA 3PJFA 4YAJA 1CQJA 4DBZA 2QRLA 1NTOA 2PY6A 1JWBB 3GC6A 4W6ZA 1H6DA 4MDHA 2IE0A 3AU9A 4PZCA 1T2AA 3QP9A 4JROA 3GLQA 4YWJA 2DTEA 5G4LA 3UKOA 4DPLA 3HE3A 1W8DA 3H7AA 3L77A 5DBGA 4DUPA 3GF4A 4YAGA 2FOIA 1SCUA 4CQMD 4YRBA 4J4TA 1DIHA 4A26A 3RFTA 2D1YA 1M6WA 4KDFA 1DHRA 3FWZA 5CEEA 4FFRA 1A7AA 2DAPA 3KYDA 2I65A 5IDWA 1Y1PA 2EGGA 3OEWA 1BW9A 3LLSA 4W82A 1DFHA 3ANLA 4OQZA 1P77A 4ALKA 3KYCA 4BNJA 1PIWA 4UVIA 4DXHA 2EKQA 1UP4A 4LRSB 4J43A 4A73A 1PJLA 2JHGA 4K9DA 4O6VA 4DLAA 2BH9A 4QUKA 5A05A 1VRWA 2YQ4A 1NVGA 3S1LA 4FOOA 4WLVA 1R15A 4GPD1 1X7HA 3CE6A 1E3WA 2F1KA 2GPTA 5EERA 1HZJA 4BUCA 5C7IO 2HMSA 5JNLA 4XJSA 1F8GA 1YOVB 4GVLA 4PVDA 4DIOA 4IJKA 4K26A 3WG9A 4CQMA 4CUZA 3UH1A 1ARZA 4LVUA 3VDRA 2PGLA 4GBJA 3NT5A 3ZW8A 1GQ2A 1O9BA 4CLEA 3N7UA 4CMEA 2C2YA 3NV9A 2X9GA 1OZAA 4WCDA 5IDYA 5DCWA 5T8KA 3GHYA 1JKFA 3FNFA 4ZN6A 1Y9AA 3QRWA 4GSLA 1DIBA 1K6XA 3L4SO 5IFLA 3WTCA 4YJFB 1QYDA 1ZVMA 2X22A 3C7DB 1V3TA 3VH2A 4XGKA 5L7TA 2O4CA 2Q49A 5L7YA 1SC6A 2YDYA 1XKQA 4FR5A 1SBYA 2CVQA 3LF2A 5U9CA 2H63A 3F3SA 2YHIB 2J3KA 1MFPA 4F46A 4TSKA 4XYGA 1SPXA 2OOSA 5KVQA 2GO1A 5C37A 2J8ZA 4I9HA 4FFNA 3ZHZA 3NDJA 1Y9EA 2X0IA 2P9GA 4CQLA 3AI3A 3H2ZA 5KJ6A 4GGOA 1AE1A 1K5HA 3KVOA 2BF7A 1UAYA 2JD2A 3AM3A 1YL5A 3PWZA 3T7CA 1SEVA 2VRBA 1NQ5A 2RIRA 3RC2A 3GY0A 2EW8A 2JFGA 1P1IA 3BMOA 3D4NA 3HZZA 1YBAA 3RC7A 5MDHA 3AI2A 3NGXA 1NPYA 2A92A 2CUKA 1NFFA 1AUPA 4Z0TA 3EDMA 4QFDA 3G3EA 1K6JA 1QORA 1VJ0A 2J5RA 1D7OA 2VYND 3KSZO 3LC7O 1NFRA 5CEFA 4XJTA 4R1SA 2NNLD 4L4RA 2GN6A 4DREA 5L45A 5JFOA 4E13A 1VL0A 1CEQA 1NHGA 1H6CA 3VTZA 3CTMA 4KWIA 5DBIA 2X0NA 1LLUA 3JYOA 2PH5A 2EKLA 1DIGA 3DZGA 3WFJA 1LRKA 3AFNA 4N5LA 1P44A 1PGPA 3W4JA 3M2TA 3BAZA 2OZPA 3JYLA 1M75A 1XG5A 3U4IA 1PGNA 3NYWA 2A4KA 4CM9A 2VT3A 4FJ2A 2FHSA 2GN4A 3D4OA 3I9JA 4IQ8A 5K9ZA 1D4FA 2YHUA 3GR6A 4O1MA 3I9OA 1DFIA 1ONNA 1EDZA 2GDZA 1I32A 3NTQA 3OFSA 1K6IA 5ILOA 4LN1A 3EZLA 2A35A 3V2GA 2C20A 4L0QA 3H2SA 2VYNA 5L9AA 1J49A 2QRJA 3K31A 3RFVA 3Q3CA 1CF2O 1AN9A 1P45A 2VHXA 3ETDA 3QWIA 1PEDA 3KOUA 3ZHYA 1CIVA 3RASA 4AJKA 3ULKA 2NU7A 4RVSA 4DPKA 1U28A 1YO6A 4FQ8A 3WB9A 3PIDA 4IDBA 3VKUA 5LCXA 5TT0A 2DFDA 3IOYA 3OETA 1YJQA 3CEAA 4J91A 2P5UA 2WD7B 4JCOA 5CG2A 4S3MA 4E5MA 5JCXA 3Q0EA 4HY3A 1Z73A 2NVBA 2RHRA 1XYGA 3G79A 4YYZA 4YBZA 2W2KB 4XQ9A 1HSOA 1HYGA 3KM0A 1LQUA 4YA6A 5KKCA 1B3RA 1B2LA 2DKNA 2DFVA 2PZMA 1CDOA 4HUJA 4B3IA 2FSSA 4XDYA 2JD1A 4OKIA 1UZMA 1N9GA 1SNYA 3MJEA 1DHTA 1ZNQO 1I2CA 2I9PA 1I33A 3OBBA 1IZ0A 4O0LA 1QYVA 1W4ZA 1X15A 2X9VA 2HJSA 2X9NA 1O95A 3PEFA 1PR9A 1MXFA 1ZEJA 4MINA 2ZTMA 2D3TA 5TF4A 3OQ6A 1N92A 1P0FA 2NUAA 4Y9DA 2V65A 1I3LA 1DRUA 2JCXA 1FDVA 3LT0A 1WZIA 4RVGA 1ZFNA 1F06A 3PXXA 3QVSA 4HFNA 5JPIA 4EITA 1J5PA 3WGOA 1IHYA 4BV9A 5EINA 2NACA 2FR1A 1IE3A 4FN4A 1E1LA 1IPFA 2HJRA 4L4XA 2G17A 1PQWA 4GKVA 1PZGA 3DBVO 1GADO 1ENOA 2DTXA 3SC6A 1ZJZA 1Z45A 3PJDA 1BXKA 2C7GA 1WP4A 2IODA 4EEXA 4M89A 5JC8A 4RQUA 5L7WA 5CDSA 1B8PA 4HV4A 1NQTA 3IJPA 2CF5A 4BVAA 3GZ4A 3KLMX 1KEPA 4ND5A 3GGGA 5KVSA 1EFLA 1TLTA 3X2FA 2OUIA 3QSGA 1ZXLA 3ZZNA 2WYUA 3DMTA 4KDEA 1JU9A 3U4DA 2DC1A 1ZKMA 3F47A 1E77A 3L0DA 2Q50A 1EE9A 2EIHA 5IG2A 1NNUA 1AGNA 4IJVA 5JDCC 1YBMA 3KXDA 4BNLA 1YH3A 4IDFA 2BI7A 4CM1A 4FS3A 4IDAA 1CWUA 2VWGA 4IUYA 4B4UA 2ZB3A 4BO4A 1RWBA 4UEJA 1RKXA 1N5DA 1MGOA 1DDOA 1YOVA
chains in the Genus database with same CATH superfamily
1NHWA 4XCXA 1Y9JA 1HG1A 1F1BA 2V4MA 1RWKA 1I1QB 5AYVA 2Z2JA 4E5KA 2WJWA 2W2LD 4RPLA 2QJWA 2UYQA 2KM1A 1XKTA 1EVKA 4L73A 3RTGA 4CQJA 4Y1RA 4F2PA 4BMSA 3NANA 3B1KA 4CM6A 4S04A 4P35A 5LB2A 3WFZA 3O93A 3DE7X 4YHBA 1VBFA 3NYIA 3CT4A 5EJ7A 1YA8A 1NM5A 3PQEA 1FRFS 1A97A 2BMVA 1SVSA 3U61B 5HIAA 5GKNA 2A1TS 2FK8A 3KKMA 1E66A 4WW0A 3SNKA 3KPYA 4C5BA 5HFNA 4JBGA 5GTDA 5KVVA 1OT3A 4TRMA 2C57A 3KQWA 4YLGA 3JWJA 5HZHA 3DQQA 5C5IA 5JECA 1X1SA 2ONCA 1IXSA 1SQGA 1SO8A 1NA5A 3LT2A 4B32A 2BEVA 5J4LA 1T29A 1TA9A 4WLNA 3PC2A 4QELA 3TLXA 2ZJ2A 3VNVA 2BEUB 4IM7A 3ZWAA 2I4TA 1KR5A 1K0UA 2C0CA 3K35A 2Q7DA 2HRCA 1GSHA 1PQ4A 2H9YA 2Y1KA 1NT4A 4PLTA 2Q3JA 3D0OA 4LX8A 1PK8A 3IUPA 4XVQA 4MQ4A 2JIDA 4TYWA 1QG6A 1IQPA 4C89A 2XD4A 4XM2A 2NM0A 3N2EA 4F1JA 3USES 5ITXE 5B4UA 3QPAA 1CIPA 4Z1MD 4E0BA 1SIBE 5DOVA 1KQOA 1XMVA 5BQPA 621PA 3H04A 2FRVA 1TOAA 1UM8A 3KS8A 2CLEB 3DOHA 5G1PA 3Q5EA 1NDUA 4MVJD 3IP5A 4YCNA 1PJJA 4WOJA 1YQGA 4KQ9A 2N3ZA 3G7NA 3QFTA 1H3FA 5I9MA 3TNYA 2NX2A 2AXPA 4DUZM 3SZLA 3MFQA 3HHXA 3PE6A 5T8KC 4IJ5A 4ZAYA 3MTQA 5LVAA 3LE8A 4FVTA 5C31A 3LC0A 3L8YA 3NBYC 3MB8A 3LLVA 4MS4B 2V55B 2G67A 2HBYA 5B3JC 4DMCA 1WF3A 3QIVA 3NXKA 3N53A 1IZZA 3VH1A 3W5HA 4FX5A 2IXFA 1OU0A 1QAMA 1AB6A 5AI8A 1VKJA 4YONB 3T1TA 1DEHA 4CM4B 3G2OA 1ZJ6A 3O8LA 2XUHA 1JG2A 3U61A 1B16A 2JJ2D 4ZIRB 4BU0A 2GILA 1DOHA 5D5HA 3T7DA 5CDUA 2RGXA 4NCAA 2PQ2A 4FGJA 3I4CA 5CHEA 4O4LA 3IS3A 4RH0A 1J2RA 3JYHA 2CZQA 5ERXA 1Q0QA 1Z74A 1EVQA 3P2EA 3EEOA 3W78A 1GNVA 2WHRA 4AY3A 3E6AA 1XVAA 3LXXA 1I2BA 3LX4A 1KI8A 2DAMA 2PZKA 1L4HA 4AICA 4AYWA 2AMFA 2NUAB 3DUFB 1EKXA 2BEUA 3WWDA 1QRRA 3I34X 1Q1EA 1GCOA 3AIMA 1LDNA 2XDYA 4W1SA 1XNHA 2B20A 4YP6A 3HHYA 4UU0A 1FA9A 1FUYB 3QXGA 1RQRA 2KWIA 2Q3EA 2YMQA 2DVMA 3KZ1E 2APLA 4EB3A 4UNIA 4BPRA 2XF2A 5AWFC 5JNVA 5LQJA 4BFTA 3BD8A 4OHRA 3VRHA 4P3PA 4KQKA 3CEPB 2ILVA 3HKDA 4Z4HA 1F0PA 1D07A 3DMTC 1WIVA 3M7GA 3KB2A 3NBQA 2BDUA 1Y4SA 3LU1A 2F5NA 1N2GA 1E94E 2GETA 4WE3A 1DC3A 3G2IA 4JOBA 1P1RA 1RM0A 2C5FA 5L40A 3B53X 5A2QS 3NJ8A 1QQWA 4B3TB 2FY8A 3H11B 2O2YA 3G85A 3K9OA 1LJLA 3BDAA 4HDCA 3OKPA 3A27A 4QQ8A 3KYIB 4Q3AA 2X5JO 5EHQA 4LJ5A 2ISQA 1XZNA 4I1VA 3JZMA 3AF6A 3RS5A 2HA0A 5GAJA 3JQDA 4W5RA 3PFBA 4MS4A 2B8JA 3RKUA 1CHDA 5JBIA 4OYRA 1U99A 5TMDA 2WAAA 1QQBA 1JDVA 1S7GA 1UJ6A 1H65A 4LGCA 2VNSA 1RW4A 5TEVA 4WEQA 4TTQA 1U8TA 4CM4A 2MSWA 3L4BA 2FEAA 4ZIRA 3LQKA 1X1TA 1R4GA 5EIOA 3GEEA 3FNQA 3P9RA 4FOPA 2PRJA 5LUBA 2BKLA 1YI8A 2O7QA 3ZU2A 4DGQA 3FN4A 5H83A 1BDBA 2I4NA 1J0AA 4F92B 2AG1A 2R7KA 4E5UA 2VF7A 1EXMA 2B8NA 4FHCA 1YB1A 3JXEA 5K0BA 2B78A 3K73O 1EMDA 3DUFA 3KL2A 5EIWA 2DWLA 4FMPA 2XT9A 1KQFA 4CHTB 1HDZA 4UHJA 3HTXA 3P26A 2IHUA 3ND5A 4ARBA 1G41A 1DAPA 1WZ2A 3IUNA 3EVDA 3CB2A 5GIOE 1ENYA 1GG5A 4FWBA 3T06B 2HA7A 3RTEA 5KVAA 1ZNZA 3UMMA 5DM4A 4P08A 1C7EA 1MA0A 1G5PA 1KS9A 1G55A 4FPXA 4CIYA 3WWOA 4A6EA 1ONPA 4QUHA 4XFDA 3UW1A 3HB9A 1H5NA 2QWXA 3K53A 3BX1A 1FXUA 5GM2A 1UWVA 1PRBA 4WNCA 5EE1A 1PW7A 2VPPA 4J0DA 3TDNA 3IAXA 5JMPA 2CV0A 3P1JA 2FMXA 4WY2A 2IEBA 3QVUA 1N33B 2DKOA 3GX1A 3H11A 5TV2A 3TQRA 2J4DA 3GYGA 1X77A 4MW6A 4PYIA 3OJFA 1G1AA 6ABPA 4B71A 3JD2A 2QNRA 3WHLA 3W5DA 1VHJA 3TLGB 4BLQA 2FQ1A 5HF8A 4TLEA 3DT8A 3H4TA 1P9RA 3G2LA 4DJTA 3Q15C 1I13A 2CFTA 1RAIA 2NQTA 5T6BA 4RVHA 5G2OA 3OIDA 3I52A 1BKSB 3GJQA 1OKKA 1P1KA 3UF0A 3T3MB 2EJVA 4Z7JA 4Y30A 3EIWA 4Q03A 1RHKA 3H2KA 4FYJA 4J1TC 4JGGA 1DTWB 3FJOA 4J1SA 2VJLA 2IDKA 4II7A 1Z4PX 1QLJA 1PN3A 1UBHS 1R5BA 4TYNA 1GG2A 1L4LA 1WS6A 5BRJA 3PJGA 4W4TA 1G8SA 4EHAA 2GVNA 3A36A 4BNMA 4ZO6A 3C3WA 4N3GA 4YUWA 3N8NA 4P7FA 1LLDA 2QEQA 1TJ3A 3JQ8B 1SC3A 1C81A 2KE5A 1O57A 4CUJA 4HVAA 1NBEA 1ESMA 1BSVA 4TUYB 4JKOA 4B46A 1RU3A 5H02A 3RAPR 5AM4A 5ALPA 3KZCA 5AM1A 3DL2A 1I2DA 2OMKA 1V3VA 3E35A 3N86A 2OYRA 4GP9A 1IYZA 2G1UA 3FVWA 2JGNA 1DSSG 1U2QA 2J4CA 1GPKA 1YACA 4MS3B 3L49A 3LPAA 1Q39A 5K2OA 3IG8A 1E58A 1W4LA 1X8LA 2C2MA 1V11B 4YJDA 1DGQA 3CH6A 3Q7QA 4KTTE 1G6OA 1DUVG 1FFHA 3UJAA 2JH3A 3GVIA 3FGNA 3KSJA 5F3RA 5E8RA 3V8PA 4R3UC 5E8JA 3FM9A 4XVHA 5JIBA 1ZH8A 4JI2B 1TDJA 2OLKA 5KYYB 3EXG2 2HHHB 2H3HA 1BWQA 1V92A 1IQUA 3TLGA 4PRZA 3TM4A 2Q4OA 1U5BB 2IU3A 3IA2A 3DYIA 2LW7A 5JZ9A 1IPHA 1UOPA 4NS4A 5EJCA 3OLXA 1NRJB 2FJUA 1Z22A 5HTOA 1DXOA 1RM4A 4IUDS 3G68A 5DTJA 2C0PA 2AE1A 3AESB 2DEUA 1AD2A 5K1ZA 5EMNA 5KTNA 4JBXA 1IVNA 1RRGA 5CK5A 3NVDA 1DAOA 3IKTA 2B69A 1DTWA 1PEKE 3UXEA 3UK2A 1CZUA 4PGGA 3NP9A 4ZOLF 3WYNA 3UHAA 2BCJQ 2GBPA 3U7RA 5C1PA 1R16A 2UZIR 4I6GA 1DQRA 3DMFA 4NONA 2P5YA 2DERA 4NYIQ 2PGOA 3ETCA 4HJXA 1ONBA 2YRFA 3COYA 4B6GA 1IC6A 2A9OA 2PYIA 1C7FA 2FFHA 1J4AA 4L3VA 4XYMA 1U6JA 2EP7A 1ZMTA 4URYR 5AOCA 2B2CA 2IYRA 1T2UA 1EIWA 1ZA1A 1XF1A 4MAAA 2YICA 3HO8A 3PL5A 1JIIA 2Y1EA 4JZKA 3KT0A 1SXJD 1NVUQ 2P7HA 3HKBB 4CI9A 4TUYA 5JAQA 1F51E 3GJZA 3GLRA 3ORYA 4KO4S 5IWAB 1KSJA 1RRVA 2QTGA 4HZGA 4J9UE 3JZFA 3R2JA 1NLMA 2PKXA 2WD8A 2XCOA 4LJ9A 4MS3A 2R79A 3RWBA 2RJNA 1MTOA 4WEOA 3AF0A 3PC4A 1JP7A 3IPYA 1V11A 1QTQA 5BQ5A 4MV5A 5HUQA 2R2AA 2YZMA 3SBOA 2Q3FA 5AHXA 3T5DA 3KWLA 2HXYA 1DT5A 3KVYA 5ALVA 5KYYA 3A6FA 2NTYC 4BLPA 3RUCA 4RL6A 1U5BA 5F21A 3CH4B 4B74A 4S1NA 2IP1A 3N3AC 3VHXB 5THXA 4FLFA 3E1SA 1XEWY 2AOTB 3PDHA 4RTMA 3KO8A 4G8JA 5IXSA 5FFMA 1UQRA 3ZBTA 2AIRA 3WSTA 5K3DA 3LQFA 4M8SA 3FTQA 3IVAA 3AESA 4RUKA 4Z3KA 4YO8A 3G82C 4N5MA 4PZZA 2QAIA 1EBBA 5DBFA 2QQGA 4HAOA 4M1EA 4ER7A 2CMFA 2V1UA 2QY9A 2J31A 2Y21A 3RGPA 3KUXA 4X61A 4UU8A 4DIEA 2MYNA 4L5IA 4AJLA 1T2EA 4RACA 3P2MA 1W4BA 5KWJA 2WG0A 4DBGB 3EVAA 5EHXA 2F5PA 3TTSA 2X6RA 3PHJA 3PXCX 4EHNA 1LSJA 2HA6A 5J3JA 4O4JF 1MIOB 4BLVA 4TT3D 1Z08A 3F49S 5AKGA 2Q1XA 4JSRA 3HKBA 3L18A 2OBLA 3OLVA 2BMFA 3BDIA 3COZA 2IUYA 1GGEA 1ICEA 1VHTA 1V39A 2B4QA 4I8DA 5DU2A 2HEGA 4KYVA 4E5DA 5I7EA 1YRHA 2H4WA 3TLMA 3RT1A 1TF5A 5K3CA 1HYBA 2XMBA 3R5FA 1AZLA 2NSHA 1T4GA 1MC8A 1P8JA 1DX4A 3CNLA 4S35A 1UJNA 4WY8A 2CXPA 4FKZA 1PS0A 1TQ4A 1PKEA 4R1TA 3KTOA 2Z9BA 2A59A 1NATA 2WD9A 4RZSA 4ZYVA 4XTRA 2G8LA 4HVLA 3ANNA 1H66A 5FULA 4DV1B 2UKDA 4MGZE 1UXOA 1YZYA 3QBTA 2VHZA 4PFSA 1Z15A 1Y1LA 4C78A 3MLBA 4LG1A 5ADVA 3Q7EA 1ADBA 3VHXA 2IHJA 1TU4A 3R23A 3HACA 2EZ9A 2NN3C 4IHQA 4Q1DA 1BW9B 5BV2P 1QLHA 3DEHA 4MWTA 4LGVA 1H6AA 3WRXA 1VYHA 1WUKS 1V5EA 5LIRA 2JNWA 4YCAA 1K8QA 3NTUA 3NXSA 2BGLA 4IIJF 2QMUA 4DVJA 5AM3A 3GZTB 1KO5A 1MC5A 3RSFA 4UM5A 4MVJI 5JDCA 3ZJTA 3ZOKA 3ROGA 1MZPA 2PN1A 4LC1A 5BQ3A 4D6XA 2HT6A 4YRKA 1Z4IA 3E46A 4GEGA 3QYPA 1DAMA 2MDTA 4GPTA 3WNZA 3P2IA 3K9CA 3GO4A 5CVVA 2OM6A 1L5FA 1KO1A 2XXBA 1Q84A 5IM4A 3Q4GA 3VOAA 2YRWA 1NZFA 4C4OA 1Y6FA 1T8PA 5FCDA 5D86A 4X41A 3WSWA 2G83A 5DYIA 1YRBA 1UM9B 1HLPA 2X0JA 1HLGA 2ZBGA 5LMZA 2PMCA 3HDGA 4PG6A 5LDGA 4B9AA 1C0EA 3FZQA 4H7JA 4FP9A 2ZRKA 4NEGA 3ANMA 3RVRA 3HA2A 4J3NA 5AHOA 3ZLVA 4D42A 1G19A 2C4NA 4D4HA 5E4FA 3PEWA 4DMKA 3BCSA 5F78A 2MSNA 2ZJ0A 1UF9A 2E3JA 2XGSA 3HXTA 2OLJA 1Z2OX 2AKYA 4DSTA 3JQBC 1XNJA 3IQFA 2K2WA 2HL6A 5GOZA 1U3VA 5I9BA 2NXEA 1VHQA 1E1RA 4YMVA 1KMHA 4LZZA 3R9KA 2HXSA 4EG7A 3PJFA 1KO7A 1NTOA 4GYWA 4XGRA 4UPEA 5G4LA 3HXPA 3L77A 4KXYA 3SYMA 2RKWA 2H8KA 3FOBA 1FLVA 4YHHM 1ZAEA 3TKLA 3RKSA 1BW9A 1XWIA 1P77A 1VECA 1I94B 1U0TA 3HY4A 4F4HA 1R8YA 3AHHA 5EJGA 3S1AB 4FHFA 4QL3A 3SQXA 3ZXSA 1UOEA 1FFYA 2O8DB 1QH0A 4YP7A 1YOVB 3A0UA 2I54A 4LVUA 3P9KA 4IBFA 4LHXA 1EP3B 4B9EA 2WSCF 3GHYA 5IFLA 3WTCA 1IY2A 3VH2A 3QVMA 4S12A 1SC6A 3ZDZB 2XMDA 2ZSJA 3VNAA 5EKXA 2WU8A 1R0WA 3FMFA 2QDKA 1J39A 4RD4A 3KVOA 1HT1E 3H2IA 4RK6A 3IBCA 1QC5B 2HQBA 3RS8A 3KSZO 1NFRA 5KB3A 3QPBA 1UM9A 4ZRDA 4ZODA 1OZGA 3REGA 4V38A 3ZDDA 4YXWA 1P44A 2OZPA 3A1TA 2OAP1 2JLRA 2FHSA 1D4FA 1ZCAA 4BUJA 2ID9A 3EXIB 4DNOA 4DEYA 2PWAA 1E9EA 1P45A 2VHXA 2FHPA 5A1JA 2P3QA 3OHMA 7MHTA 3Q3EA 4XLZA 3W6NA 1GTSA 5LCXA 1L5ZA 2P5UA 3VBEA 3AKYA 4HY3A 2W6QA 3LXUX 3H2BA 3KM0A 4B6PA 4HDKA 4HYYA 5ITTA 3DLBA 2Z4RA 1Z18A 5KQDA 4ZYTA 3QW4B 3P45A 5F98A 1YCHA 3ELBA 1FFGA 4BV9A 2UU9M 2HJRA 2YY5A 4EEXA 3VYSB 4WOBA 2QTHA 4DSZA 1TLTA 3QSGA 1NZDA 3S1AA 3F47A 1OYOA 2ORYA 4CM1A 1VP9A 2O8DA 3UJPA 1MGOA 1YOVA 2JBHA 4FLEA 3G17A 4CDRA 1JFVA 3DD5A 4E08A 2H1WA 2OO5C 4W1PA 1QGED 5IS2A 3UPUA 5GGYA 1PR0A 3HB4X 5DM60 1XTUA 1XZEA 4GP7A 5KYTA 5ITZB 3QGMA 2R87A 2ACVA 2EJUA 2X4AA 3QMWA 2RH4A 1A5BB 3W7BA 3GLSA 1X1RA 3B9PA 2C42A 4RQBA 1WU7A 4V03A 4NIMA 3NM4A 1KS2A 4NHEA 4KG7A 5EMJA 2ZT8A 4A0GA 4JU9A 4RPIA 4ARZB 1NN3A 1TUBB 1PFUA 3LTNC 3JVUA 3P9QA 4M9SA 1GGVA 1QC5A 2X19A 5GINE 1V7QA 4GPBA 2ZUCA 4YDRA 4K6MA 5IT9S 3V1LA 2JFBA 4B85A 3VSEA 4CVNA 4EKEA 1LKZA 5DCUA 3GRRA 4YRSA 3OMXA 1A9OA 2R5NA 2G9NA 4AO7A 2G3QA 3LIIA 4OVZB 1G20E 2LTAA 3E15A 1P33A 3OECA 3GEHA 4JWTA 5K3BA 3LI2A 2UYOA 4UFPA 4XQCA 3ANYB 5TQVA 1JMKC 4K28A 3OJOA 3O8QB 4U2BA 3WQQA 1PYOA 1G2IA 1YDEA 4TTJA 4D7AA 4WOKA 1D8AA 1EXNA 4XX1A 3BHIA 1U31A 4FNMA 3U5TA 5DNCA 4RTNA 4F3TA 1EDEA 2FXIA 1XDUA 4AJOA 3DPIA 2BW0A 4L02A 2R18A 3GPDG 4TYMA 3GGOA 4V0KA 2WIDA 4PN3A 4RGYA 1LF0A 1H2YA 5HVNA 1AN0A 3BJZA 4DJFC 1OX4B 4C9BA 2J41A 4G89A 2ZR0A 3DYBA 2RC5A 3MELA 1NF9A 2X23A 2Q3HA 2BELA 2H7XA 4IIUA 4C4YA 4IXDA 2BHSA 2OV2A 3GDFA 3Q7RA 3GDHA 3MMNA 3VZSA 3M3PA 2SHKA 2ZYVX 2FAXA 1I3KA 2CUZA 3PE3A 1EE1A 3AH8A 1G7TA 1GL7A 2QLLA 4KV7A 8GPBA 1UKYA 4IY1A 5ITZA 2VF2A 1GU1A 1VMIA 3DTVA 4M1TA 1K4KA 2R46A 4ARZA 3I6QA 1TUBA 3DE0X 2R6JA 2NTVA 2H8GA 4QG7A 1L5OA 5EE5B 5JJ5A 2AUMA 1TF7A 2QDXA 1R8SA 4CT0A 4NU0A 1TTQB 2PUVA 2VUUA 1B7GO 1K9VF 1JPVA 2P3OA 2QS9A 1Z28A 4KLCA 2AF3C 2FZVA 4JYAM 3PPVA 2GLTA 4TVBA 3IBYA 4B44A 1A5AB 3M9LA 4FC6A 2AZTA 3E0QA 2Z9CA 4MZDA 1M34B 3THOA 4OVZA 2A0YA 4MKIA 4GMHA 4YQYA 1R00A 3C3DA 2FOXA 1G2PA 1T8SA 1QG4A 4G01B 1DGHB 1G98A 4JT8A 5F1OA 2KJQA 3O8QA 3FRJA 2C07A 2AA3A 3NBUA 1O89A 4HWKA 4KDCA 3SASA 1E60A 1NVEA 3M70A 5JASA 1U1CA 5GJWC 4BECA 4OUKX 3R9IA 3HZHA 2H1CA 1C8KA 2XLBA 3WK4A 2GCNA 4KQMA 1LD3A 3V00A 5E6UB 3VO9A 3HU3A 5DF1A 3AUJB 3IEIA 2EKZA 2V1CA 3WYGA 3SLKA 1WZUA 5DNWA 2NZXA 2O1XA 3LYLA 4RNDB 1KMNA 1UMCB 2ZYIA 3BH6A 2HQRA 4IDNA 2E87A 1P7ZA 1WW8A 3GLFB 1OX4A 4B75A 5I5EA 1T1JA 4BV8A 1AA9A 3AFOA 2IU4A 3HGMA 3QE9Y 1FPQA 1L7MA 3GFQA 3IIIA 4UUNA 1OZFA 1NBME 2H4FA 2RIPA 4B3MM 1CT9A 4MPDA 4IHJF 4C0KA 4OX9Y 4LXUA 4NK5A 1QR6A 5ADHA 1MC1A 3O6VA 3GPPA 2HM7A 4Q4HB 1ZU5A 5AVVA 1TTHA 3FNGA 4FHGA 1TM2A 3T3EA 2Q0SA 2JFFA 2HMTA 3VZDA 3ZY4A 3M7IA 1ZICA 1DO2A 1BJKA 4ZYZA 3GQ4A 4I6JA 3I45A 4WBSA 1T8UA 3W8EA 4O4IF 4CV1A 2H11A 3TRKA 1IVYA 4L8FA 4FWIB 1Q1NA 1Z59A 2W42A 3A0RB 3DH0A 1R18A 4X7PA 3NRBA 1EG2A 1M34A 4Y1FA 3P0HA 4YRZA 1DGHA 5CM2Z 3LUAA 4CIBA 3OQPA 4H7FA 3HBAA 4NC6A 1C0IA 4ZHSA 4R1QA 4Y7CA 3R7NA 2I8LA 3FYSA 4BQOA 2GCGA 4PHTA 1Z5ZA 3KSUA 5CNJA 1FX1A 2JIZA 4Z49A 3F67A 2F9MA 4UPDA 3ABIA 3D0KA 2VDPB 2WQZA 4QQRA 1L4BA 2A3RA 2DP4E 3A4NA 4E4TA 1ULBA 4DMLA 1SM4A 5JSQA 3Q5GA 2Q2NA 3TD2A 2R6CA 3Q7SA 2VI5A 4WKNA 4A8HA 4L8YA 2C9CA 1MX5A 5I7HA 5LDHA 5FF9A 3AEZA 2VYFA 5F9HA 1UMCA 3F5QA 2HF8A 2YV1A 1XXLA 5DGXA 2JGMA 3HU2A 2JGDB 1TF0B 2EWWA 5TJHA 5BW8A 2RCNA 2B3TA 3SF8B 2AR0A 3T6KA 5AK3A 3UHPA 2AXQA 1N2CB 1TQ2A 4LOLA 1U81A 5IAJA 4GOLD 3GRPA 4HWTA 2MH8A 1AS3A 4AJPA 4Z4FA 5IUKC 3ZZUA 1GXSA 2R8PA 1JAZA 2AC4A 3L7KA 2IWRA 4AJJA 2JS7A 2H1RA 2GVZC 4FZRA 1I6WA 4Q4HA 1GCIA 4NCJA 3OH8A 4JT4A 4HNHA 1XMIA 4CFYA 2QZZA 5LQSA 2CFSA 3C7TA 3IQEA 2X4IA 1R0SA 1E3IA 1OFVA 3GBPA 4YR9A 4YALA 4L72A 2OO9A 2C5LA 3QPUA 4DNQA 3VH3A 4UE6A 1PG2A 3GLIE 5CJ2A 4R98A 2BV3A 3DOUA 4EFLA 4LS3A 3LDFA 2P9HA 1WY5A 4FFOA 4E1AA 3QW2A 3HM9A 4WRRA 3UMCA 3AOGA 2IS6A 5GONA 3LL7A 4FYXA 4K9MA 3T8YA 4RE6A 1ZOOA 2YVUA 4GNRA 3OIUA 3WOHA 2PJDA 3KUKA 1N0UA 3W8DA 1SHUX 2YJNA 4UMEA 1AS2A 4EJMA 3SS9X 1XAIA 1RDFA 2XCQA 4V1CI 3MD9A 5AOAA 3WDSA 1K2VN 4OQ4A 1BVYF 1WUTA 3DP7A 3PD1A 4CF5A 4ZANA 2OM2A 3GDGA 2FPKA 4RKWA 5A4AA 5B2EA 2JLAA 4REQA 1OAAA 1R6XA 1FW6A 1A27A 2VJPA 3RS2A 2JGDA 5HKKD 4BLWA 5I4IA 3UM9A 3BKXA 1QQ5A 2HPAA 5LQKA 3WVNA 1GV1A 2GYVA 4FX2A 1N2CA 1Z7BA 1Q95A 4IBDA 4CIVA 4IMRA 2CFOA 2IZ0A 1FVOA 1E69A 5CLJA 3QKRA 4K8RB 1FFCA 1RBZA 5JDIA 3MBOA 4NMHA 3TDKA 2BD0A 2ZTSA 1MAVA 5LP6B 1R64A 4I4NA 1FYXA 2ZR8A 2X5OA 1Z5UA 2JFYA 1BROA 2OORC 3HLYA 2ESRA 1E0DA 3OICA 3IP1A 3QBDA 4IGEA 5IBCA 3KJFA 1FXSA 3GEIA 4DHEA 4NXMB 3PFWO 5CB4F 3IUEA 4PLYA 4GEWA 4LF8B 4XDGA 4M4SA 1VFPA 2HCBA 1W29A 3FPCA 3JZIA 1DJQA 2Z98A 3TL2A 3WKBA 2YDXA 2NZVG 3WADA 1A2BA 3VKGA 1U65A 3WKEA 2MROB 1A76A 2X0FA 3C1UA 2XSZD 3NTVA 4PFQA 1Y6JA 3PBKA 2RHBA 1WDKA 2JAQA 2MYTA 5HZGA 3M4YA 4MCAA 3KQOA 4CPDA 3PEEA 5B2FA 2O9JA 3ZPXA 3CYFA 3RHSA 5BUQA 3SX4A 4X64M 4YPVA 5J2TF 3ZWXA 2FFRA 3M83A 4X1IB 1W94A 3N74A 5F1YA 4WCFA 2XQKA 1GNSA 3R0XA 1H23A 3EUFA 3NYRA 1FK8A 3WGYA 2ADFA 3DOIA 1W48A 3LL4A 5EI5A 3M33A 3EPLA 3L8DA 4UEOA 5FFNA 1TECE 1E79A 1Z4JA 3SFVA 3LGSA 3L6UA 1P6XA 4LCBA 4DADA 2OPHA 4IIGA 3WGLA 3SS7X 4NDAA 5AVTA 3H1EA 5ERYA 4AMYA 4JI4B 1FEZA 3LLUA 1TAQA 4I5DA 4JI0M 3D31A 1R0RE 2EWVA 3W3AH 5FUWA 1DUSA 2E37A 4M1KA 4IO0A 4HN2A 1VE9A 3KAPA 2BPOA 2O2GA 2ZYRA 5K8IA 6YASA 1S3IA 4NKRA 2XA1A 3IX7A 4X6LA 2CDCA 4IBOA 1GAQA 3O8CA 5LP6A 4MV0A 2RGHA 2V0CA 2XXAB 1QUTA 2O8FB 4DC1A 3QHAA 4NX2A 1BH2A 4NU5A 2AE2A 1KEUA 4CR7A 4LZAA 1GKYA 2Z3XA 1VB5A 1M2HA 5AW0A 3AV3A 3ZKAA 5IHXA 4M53A 5HM6A 1XTKA 3HXLA 2I6TA 3HO1A 1R9MA 2HJWA 2C58A 4ZVNA 4L7VA 3LDUA 1Z0SA 5BVGB 4BLUA 3AR3A 1J00A 1X0XA 4D0RA 4CKCA 2IIQA 3KYJB 2Z2ZA 5ALLA 3OT5A 1QFMA 5CVCA 4J7UA 3KE8A 2HU2A 4V0NA 1W49A 2G5GX 3B78A 3LHFA 1N0HA 1XDZA 1JLSA 4G0XA 4QYWA 5LL6P 2WJ3A 5IJZA 1KEVA 2AS0A 1T6NA 5CDGA 5ICMA 3ZOZA 3VR2D 4E51A 2W00A 2FPIB 2DWMA 1OFHA 1PDOA 4L9SA 2VP2A 4YRIA 4X1IA 3C3YA 1ES9A 2J45A 2ZI9A 3S2FA 4CHGA 1XROA 1BHQ1 2IF0A 2C29D 1I36A 3B5JA 1VEJA 3C15C 2CXNA 4TXMA 2FZ4A 1OFUX 1G71A 1DV2A 3WL6A 2EKBA 2PANA 3NWPA 2JGJA 2O3RA 2PZFA 3EFOB 3EUWA 4BIIA 3PRHA 4B3XA 1EWVA 2YNMA 2WP0A 4EKGA 1SKAA 1N7IA 4IG4A 1LPBB 1P2FA 3D9QX 5CFNA 4FI3C 1BGVA 4EHKA 3ZHUA 2WF7A 5EE3A 2GKOA 3D3KA 1J6UA 1SA0B 4HX5A 5CYFA 1E92A 2Z83A 5BWLA 2BWEA 3G89A 3MAAC 1G3MA 3SHFA 5JPDA 2XXAA 1ZSNA 3UO8B 2O8FA 4EAQA 2YWCA 1Y8GA 2CSUA 2WU4A 5KNCD 2ZSKA 2XWQA 1ABBA 3K0CC 1C0KA 4W8GA 4ZQBA 3TLYA 2IYEA 4CR8A 2VT2A 5SZJA 2EVWX 4IWXA 4MTCA 3VAAA 1G17A 2CKMA 1R74A 5I8PA 5BVGA 1J99A 2RKBA 2E89A 2NZUG 1VB3A 1BN7A 1MU0A 2CL5A 2NQ8A 1C8BA 5KSOA 1F5SA 3P71T 2B98A 5F2OA 1YVUA 4HXYA 4BNTA 1JI0A 4HEA1 1JSCA 2EJWA 2ZR9A 4KITB 4AZ3A 5IAAA 4ND4A 1XCOA 2WB2A 3OCJA 3MW8A 3WGZA 1WMSA 2C1ZA 5GJCA 1G9TA 3GBSA 3RK0A 2CSXA 3HI4A 5HM8A 3KJGA 3LH5A 1X7ZB 4OU5A 2FPIA 3V1TC 4PZDA 2CL6X 3DV0B 3VYWA 3IR5A 4FCCA 3H9UA 2QQ0A 3OFND 2GTIA 5LPNA 5AKEA 2VQDA 4HYQA 4QNRA 4Y2YA 4YRDA 4UZSA 1EB9A 1U11A 5ALQA 1RC8A 4X8OA 2O7VA 3SLRA 1KTIA 4P53A 2ZSIA 2II6A 3EFOA 3ZDQA 2H6EA 5B58C 1B0ZA 4B6SA 3X1DA 4R71A 2XUIA 1SC9A 1Z68A 3G0DA 2H29A 1ABFA 2WFZA 3ZE2B 3L8FA 3L0SA 3BCRA 1CJBA 1UBGA 1RWWA 1SA0A 2H0RA 2ODNA 3SYRA 5KQRA 1U6KA 4DXAA 5CLLA 4LXGA 3RFTA 3MUEA 2PO7A 2I65A 4PM4A 4Q9IA 2FJPA 3QOYA 2JHGA 1KWGA 5DSTA 1M6EX 5EIXA 5A62A 4IL5A 1SK9A 3P20A 1P7PA 4G63A 5DXAA 3NT5A 3HS3A 3H99A 1NJ2A 1OZAA 4G9BA 5T8KA 1Y9AA 2OWDA 4OUDB 1NY5A 4RZUA 3L0OA 4YJFB 1CRZA 1JHPA 3L1UA 3OWXA 2VXYA 1SBYA 3PNKA 2YHIB 1WBJB 1MFPA 2O0LA 5B3JA 3ZHZA 1JR3E 4Z5XA 3MTAA 1K6MA 3A3YA 3AM3A 1YL5A 3W5CA 3PWZA 1YBAA 4L5YA 3AI2A 5C80A 3H18A 4QPCA 1ZOIA 1XHBA 2I6UA 5JFOA 4DUYB 4WT7A 1GGNA 3E4CA 2WZQA 1H8EA 1X7ZA 2D2EA 3VX4A 2PH5A 1XCGB 2B21A 3H4JA 2XUJA 2F3SA 5J4VA 3M2TA 1TZBA 3DV0A 4REMA 1JH9A 1G60A 3DA8A 1W5TA 2ZFUA 1XYYA 2LR0A 1XTSA 1AQIA 1QP0A 3VKUA 3I5XA 3R8CA 4F4IA 4JCOA 1C3XA 1YHZA 3ASYA 2YXPX 2GPJA 4YA6A 5CYOA 1B1CA 3ND6A 2DJIA 1CUBA 1NVDA 2IX3A 2JD1A 4M0PA 4BMZA 2X9VA 2HJSA 4MINA 4M9RA 4S1TA 2NUAA 1RPTA 3UMGA 3H19A 3UTCA 3T5TA 3L43A 4QOHA 3PFKA 4QT4A 4JJ8A 2K6BA 4MUHA 5EINA 3WIOA 3N2KB 4K2HA 1C7YA 4Q7QA 3D4BA 1GADO 3DGFC 3N8DA 2RAVA 3H2JA 2OOKA 1O1YA 3GFFA 2J5XA 4G26A 3M9WA 4P93A 5HX7A 3RSZA 1MJHA 2OCLA 3ZVKA 3DMTA 4TUWA 2HIMA 3U4DA 4IDOA 4RZ2A 2OA0A 1QGUB 4BNLA 1KORA 2WJIA 4B4UA 4ME6A 3MG9A 1QE5A 3L0CA 4FE4A 2YWGA 1U9CA 1SQFA 4EQ6B 4M87A 4FXPA 1PV2A 4WCVA 3HHEA 3WHKA 4OYLA 3H0CA 1UK8A 4A1FA 4S24A 5T4BA 5KJFA 3IAS1 2XB8A 1XNRM 5FBVB 2XNDA 2QRNA 4OUDA 2XADA 2W7TA 4YJFA 4KE9A 2VBCA 4AZ0B 3K0AB 2HUPA 2H1FA 1EFRA 4WOCA 4CLHA 4F3YA 2VRCD 1PK9A 4RKFA 1O6FA 2YHIA 4NL4H 1SCIA 4LG2A 1YC5A 1QP8A 4J0IA 1OI4A 1QCCA 4C2BA 3HR7A 4U9UA 4B0OA 5IH3A 3PGLA 2DLNA 2ZCJA 5LUAA 5JE8A 3V6LA 1QAQA 2EKPA 2REBA 2DUUA 5TGDA 1V8BA 1BE8A 3VXKA 3C5HA 3U6QA 3FPJA 5EZQA 4J0FA 1FFSA 2VIIA 2QLMA 1Y1KE 2CLHB 2IL1A 2OKCA 3X43A 2EKKA 3OTGA 3WGTA 4NJMB 1YMVA 5K7SA 3ZUGA 2V0GA 3VC2A 3DHWC 1DLIA 1QHXA 2X4DA 3FZGA 5DULA 1ZW6A 4E6PA 4M0WA 3R7BA 1OU4A 1W47A 1C9NA 1C4XA 4ZEVA 5EMMA 1J2YA 1ZSYA 1MDBA 4BO0A 1P1BA 3LO8A 1COZA 3ESDA 2OBFA 4ANRA 3B3FA 3NVKI 4TWJA 1KZ1A 4LF6M 2GHQA 2ZRQA 1JDBC 4CHTA 1C9JA 1TPZA 3ML1A 3LC1O 4BTVA 4DA4A 2VHVA 3N2KA 2ODPA 3SEQA 2QPAA 4OM7A 3A6PC 2O20A 4KHZA 1ESDA 3OLCX 5LBIA 1OTHA 3CRW1 2YW9A 3QNMA 5DXFA 1JJIA 1Q3BA 2XNHA 3IERA 1VA4A 1QGUA 2XCSB 2LP4Y 4IS3A 4R9SA 3Q3HA 4M38A 2F00A 1ZN7A 4EQ6A 1K88A 4F4UA 3EPKA 1L5LA 2J0UB 1GL3A 4AI6A 1Z5BA 1GJRA 1OWLA 1XFDA 2PSJA 4EA6A 1RQ2A 4AZ0A 3K0AA 3IP6A 1E5VA 2X9QA 3WZ2A 1MJFA 3OWOA 1BNCA 2O8VA 3VU8A 1LPPA 1NHGC 2C9OA 2Q9UA 1QB8A 4M1QA 4PV7A 2K87A 3HJFA 4NE7A 3X1JA 3BXPA 3H5RA 4GS5A 2VTBB 4MLDA 3WIVA 3LY8A 2CLFB 5FKJA 1RPZA 4EUKA 4J1TA 5FB3A 1MG5A 1F9EA 2YWHA 4HDMB 2JLXA 2PFGA 3BHJA 4UXHA 4Q0MA 4KPFC 2W2NA 3VO1A 3TTUA 1DMSA 4BFWA 4NJMA 3R41A 3OFKA 4P22A 3HJBA 1G9SA 1UKCA 5EUQB 1K3UB 2GI4A 4FFMA 3OOWA 1ORDA 4DNFA 4G4GA 5KNBD 4AAYA 4K3VA 1QNLA 1GZHB 2I71A 3QA3E 721PA 3Q8GA 2QVXX 3L28A 1O6GA 1WGLA 3BBZA 4HS9A 4EYGA 4NS1A 2E4VA 4EBFA 3WRWA 5EHIA 2GSDA 4P4SB 3LGXA 4C5AA 3PF8A 1PVDA 1RWPA 3KAKA 3R7WB 5M34A 3MQFA 3KHTA 2LVAA 4E33A 3LZ6A 3JQ8A 1C0LA 5IYZF 3ZV5A 2WJ4A 3KEFA 3OQ1A 1KMMA 4NCIA 4U02A 1OGJA 3TWMA 4LJYA 3WK8A 4JP3A 1D2EA 2UXCM 1YV9A 1E61A 5K8TA 2GESA 2N42A 2F90A 1V95A 5CBPB 1JAHA 3WLLA 4ZQFA 4P9NA 3DKKA 3W9BA 4EIWA 5JXGA 3JQAB 2J0UA 2C2ZA 1ZK3A 4JODA 2VUIB 1PNOA 3KXPA 4IW3B 4RENA 4JLJA 4N8DA 2J6BA 4FGZA 3HVJA 3OHPA 3PT9A 2DZNB 4I08A 4BB0A 1E9FA 1ZJ5A 4R8SA 3RKRA 1E3EA 5EXSA 4KUEA 1ZIDA 1TZKA 1UQTA 4BO6A 1QF9A 3VR4H 2NO1A 2WWHA 2QORA 5CA1F 2P2CA 3EZFA 2R8YA 3BM5A 4HN4B 1MORA 4R84A 1OXXK 3QF7A 3K32A 5JXHA 3J2PB 3P9IA 4F97A 3BPSA 2ZPTX 4B8YA 1VEKA 3HRIA 3WYAA 4IQ0A 1DC8A 2NTNA 3LZCA 2BI4A 5F4BA 5C8ZA 3E03A 1OUMA 4J6FA 2IYVA 2ZRBA 5A7HA 2JLCA 3WLPA 4QGHA 4N3CA 4E14A 4U0JA 2GEJA 4X7RA 3BRQA 4I5EA 5DMXA 3RIXA 3ZGXA 2PGJA 4EX6A 2FNAA 1PLJA 3R7WA 4OK3A 3MJVA 4FIZA 5KOIA 2D8AA 4YUZA 2PPLA 2XJ4A 3PX2A 1KC1A 4B3SB 3RE8A 3RF7A 5KUTA 4I8OA 4DFDA 3SEZA 4XJXA 4WX2B 3R6GA 4F8YA 3D2CA 1F0NA 4B43A 5AVYA 2FPWA 4FW8A 1UBTS 1EBFA 1XTZA 2RGBA 1XZPA 2VPTA 1DC7A 1MN6A 1WZCA 2GYWA 2E18A 4J0CA 1T9ZA 3VPSA 3JQAA 5CH3A 3LMMA 3NFYA 3VR1A 1DELA 5ER9A 4NLLA 4ZVMA 2Y1FA 1Q2UA 1GZ4A 2HK9A 3X1XA 2RHGB 4W9MC 1K3WA 3HP7A 5H82A 1AHPA 1OTXA 1SVUA 4UHHA 3KOZE 3MRSA 5KPTA 1V4VA 4GXQA 3I8SA 1YUBA 1CNEA 1CUGA 3DPSA 9LDBA 1FTQA 5KNDH 3IMEA 2YASA 5I48A 4LI0A 1C3OB 4FZ3A 2B34A 2VJDA 4Z4GA 3LBFA 1Q0TA 4LGMA 3P8ZA 4WJZA 4NWIA 1NMXA 3ZU6A 2QVGA 2Y0BA 4PLPA 2AOTA 5BPFA 2RAUA 3C5VA 1KKLA 4RDIA 3MWEB 1MJGA 3CZAA 4OH7A 3VSBA 1U8FO 4OO3A 3COWA 4ZK6A 1GVHA 1MO3A 5FIUA 1EVYA 2CMDA 4QARA 4F84A 3J27B 1GP2A 2OHOA 5INTA 2NO0A 1X92A 3NDBB 3T3IA 4AMZA 2GDJA 5DISB 4PC2A 2GZ1A 1V71A 4EHIA 3IBSA 3A06A 1O5TA 4P98A 4IJUA 2ZAIA