4YHHM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4yhhM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4yhhM02
2F5NA 4KHPM 3SASA 2ZBKB 3DOAA 3GP1A 3GQ3A 2OQ4A 4JI0M 2F5PA 2F5OA 3VK8A 4LFBM 3U6EA 3SBJA 1N32M 4DR7M 1Q39A 4LFCM 3JAMS 4CISA 4JI5M 4JI4M 2Q2EB 5ITUA 4DUZM 3GPUA 4JI3M 3VK7A 1NNJA 4DV5M 3GQ5A 1Z5AA 4PDGA 2UUBM 1HNXM 5FLXS 4X64M 3U6QA 4YHHM 4DV7M 4DR6M 1Q3CA 2VQEM 1K3WA 4GKJM 1L1ZA 4DV3M 4JI7M 4LF9M 3C58A 5ITQA 4DV1M 3TWMA 2XZFA 4DV0M 4B3MM 2F5QA 4NRWA 4JI8M 3T1HM 1K3XA 2XZUA 1TDZA 1MU5A 5BR8M 1PJJA 3GPXA 4DR2M 4G4OA 2F4VM 1R2ZA 4NXNM 5ITXE 3U6LA 1N36M 1XNQM 4YY3M 1I94M 2ZM6M 3U6PA 4B3RM 3A45A 4K0KM 1EE8A 3OTOM 1HNWM 4DUYM 4JI6M 2HHHM 1MX0A 1J5EM 3U6SA 3J7AS 1XMQM 3GPPA 1L2DA 1XC8A 4LF7M 4DR4M 1R2YA 4JV5M 3U6MA 5A2QS 4X65M 4DR3M 3TWLA 3U6DA 1PM5A 1KFVA 3SARA 4NRVA 3A42A 5LMUM 2UUAM 4PD2A 3GPYA 4PCZA 4OX9M 1Z59A 4G4QA 4DV6M 4AQYM 4G4NA 4LF4M 3TWKA 4LF6M 2VQFM 1L2BA 1N33M 2HKJA 1HNZM 1XMOM 4G4RA 3JR5A 2E5LM 1Q3BA 4MB7A 5ITXA 3U6CA 1FJGM 4X62M 1Z5BA 1IBLM 4NXMM 4LF8M 2UUCM 3J81S 1Z5CA 2UU9M 1IBKM 5IWAM 4DR5M 4PDIA 2EA0A 1L2CA 1IBMM 3SATA 3JR4A 3GQ4A 1K82A 1XNRM 4JYAM 4ITQA 5ITRA 1L1TA 4GKKM 1N34M 1PJIA 2UXCM 2OPFA 5ITYA 4JI1M 4B3TM 3A46A 2F5SA 5IT9S 5LMNM 3SAWA 4JI2M 4LFAM 4B3SM 3SAUA 3W0FA 3T1YM 3GO8A 4LF5M 1TDHA 4DR1M 3U6OA 4DV2M 5ITTA 4DV4M 3SAVA 2UXDM 4X66M 1HR0M 3J80S 2UXBM
chains in the Genus database with same CATH superfamily
2KNVA 3HU2A 2F5NA 2EKKA 4B08A 3LW5F 3I01M 3GRRA 3KSJA 1HT1E 3DOAA 3HWSA 1DGHB 3GP1A 2QBYA 2F5OA 3VK8A 3B89A 2DAIA 3E9SA 4I81A 3SBJA 4DR7M 3SMSA 4XK8F 1GJSA 4CHTB 1GABA 2WZJA 4PT5A 2LVQD 2JUJA 3UK6A 3KVWA 3GLFB 3QAUA 2VF7A 4LRSA 4QHSA 2Q2EB 2KZUA 3GLHA 1OJLA 2G3QA 4L6V6 3GPUA 4AI6A 5DYGA 1OTRA 4JI3M 3GQ5A 2YNMD 4FD2A 2UUBM 1H6UA 4R3DA 4FVMA 5FTJA 4X64M 3U6QA 4DR6M 1LTMA 1YLAA 3SHGB 1EFUB 4MGZE 4KO8A 2HAKA 1WR1B 4JI7M 1V33A 3C58A 5ITQA 3A98B 3WHKA 4B3MM 3FYCA 2R46A 4JI8M 2WSEF 5KO3A 1UFZA 1GO5A 2DKLA 2MH8A 2O01F 3LMMA 5BR8M 3HKPA 4IBBA 2L2DA 2DAEA 2MROB 4S12A 3GPXA 3B7ZA 1IN8A 1JR3A 2H1RA 2Y0TA 4LGMA 5ITXE 2C98A 2W82A 1IN5A 1I94M 1QAMA 2ZM6M 3AOGA 4M0DA 4MGHA 2KRUA 1VG5A 1EE8A 1MN3A 2JY5A 4IBKA 2QPAA 5KPRA 2CFOA 4D80A 3U6SA 4LJAA 5EP1A 4RNAA 3L28A 3FTFA 2RKOA 3FKEA 1KFVA 1PM5A 3SARA 2D7GA 4PCZA 4GITA 3IECA 2DENA 4IBCA 1R5LA 1QAOA 3GLGE 4LF4M 2RGOA 3HY5A 3VDUA 1ZMWA 3LCVB 3T6PA 4LF6M 3TL4X 2R4EA 5EXPA 2LTUA 2KXEA 2LNHC 2R0IA 2LHGA 3LCUA 3T15A 3MHVC 4FWHA 3RGSA 2E5LM 1IFYA 3TQSA 1IN6A 1Q3BA 4MB7A 5EJCA 1DGHA 1ZAEA 1NSFA 4WP2A 4R7GA 1SXJA 4LY6A 2R6FA 1OIPA 1SXJC 3J81S 1Z5CA 1XB2B 3Q8GA 2A5YB 1NJFA 1IBMM 4PDIA 3NBXX 2QZ4A 3I04M 2CV1A 2L7HA 4OVZB 2VDBB 2OO9A 4JYAM 3CF6E 4ITQA 5EXSA 3UZUA 3HHWA 1JR3D 4W5WA 1PJIA 4JXJA 2BJWA 2MJ5B 3RE8A 4LGYA 3K1JA 1ORYB 2DVWB 4LRTA 3ZCBB 3LVWA 1G4AE 3SAWA 3U5ZB 1IXSB 4TUWA 4Z8XA 2APLA 4GIPA 7CATA 3WHLA 3H4JA 3LQRA 3W0FA 3T1YM 2UXDM 1P3QQ 1X37A 5FTLA 2C9CA 4IBDA 2LVAA 1QQWA 4BB9A 1WIVA 4REZA 4M9ZA 1E9SA 1TH4A 1GKIA 2ZBKB 2DXIA 1VEJA 4JI0M 2Z8YM 2CV0A 1JR3E 3VKHA 1KYIA 1Q39A 3AOEA 2JY7A 5IREB 5FTNA 1A5TA 3HJSA 1TR8A 3GLIE 2X4AA 2KA6B 4LJ5A 2XFTA 4FCWA 3K92A 1ZMVA 4CIZA 3JAMS 4JI5M 3PNYA 4JI4M 1Z6TA 3FUVA 1MJGM 4DUZM 4LG2A 2KHHA 3FUUA 4I5SA 3NWLA 3K8ZA 1OIZA 2FFJA 4DV5M 4PDGA 1GLNA 2GQFA 4GC9A 4NC6A 3RGPA 3TPZA 2R18A 3UMMA 4YHHM 2YQZA 4KLNA 2CE7A 4IJEA 1T3TA 2EKFA 1IXRC 3L25A 2VQEM 5EP2A 2LBCA 1QDRA 1K3WA 1N75A 4B7FA 5DNYA 4LF9M 3D8BA 3TWMA 2XZFA 1VEGA 2DZLA 2C9OA 4B7HA 1T43A 1WXQA 2M60A 3T1HM 2XZUA 2DZNB 4GEWA 3U60A 4AZFA 4DR2M 3AFHA 2DHRA 4Y28F 2KNAA 4II7A 4NXNM 4OW0A 2LVPC 2LH0A 2DHYA 4MM3B 1XNQM 4YY3M 1VQ1A 3D8LA 2CP8A 3RFWA 1SXJE 4HEOA 5EP3A 2K6BA 4LJ6A 1DGBA 1OKSA 2L09A 4EIWA 2ERCA 4B3RM 5IZ7D 5C1BA 1N77A 1HNWM 4OVZA 2D7EA 2RGHA 1J5EM 1DO0A 3TE6A 1NHWC 3T38A 1OFIA 1YUBA 3PVSA 5EQTA 1I4WA 2FE8A 3GPPA 1XMQM 1XC8A 1L2DA 4XBOA 3J7AS 4LF7M 1OFHA 1R4GA 1R2YA 1D0MA 5A2QS 4DR3M 2O25A 2DWZB 2Z4RA 4NRVA 4GHLA 3HJ8A 1YE9A 4L15A 1XWIA 4OX9M 2FOIC 3SHFA 1J09A 4G4QA 1IM2A 2HL7A 4NL4H 2XGNA 2Y20A 1XXHE 3SYLA 3CF0A 1JB0F 5BPVA 3TWKA 2DI0A 3B74A 3PFIA 4OU7A 4M9SA 2VQFM 1R6BX 1L2BA 1N33M 1HNZM 1CUKA 2YR0A 1D0LA 4Q7JA 8CATA 5F3WA 5FSWA 1VEKA 4D81A 2EUCA 2QNJA 2L4FA 3NBIA 3KFUG 2CHGA 2L4EA 2CHVA 3FRIA 3DFZA 3FUTA 2DAGA 2KZSA 3B9PA 3UJNA 1TH2A 2UUCM 3I51A 1S3SA 1IBKM 2UU9M 1PJQA 1OAIA 1L2CA 2DAKA 3SATA 1IXZA 3E4RA 3KOYE 3PXGA 3GQ4A 3AL0C 3QYEA 5KQ8A 5ITRA 1HJPA 4MGYE 1WJ7A 4GKKM 1NY5A 3QYBA 2XSZA 2G8LA 4P17A 1TF0B 3BOSA 2B3TA 4QNRA 3C3EA 2BWBA 4BBAA 3GRUA 2F5SA 2JNHA 3KW6A 1QZEA 5LMNM 4B7GA 4D82A 1PJSA 2V1UA 3CF2A 4LFAM 3SAUA 2DAMA 1GJTA 1PGYA 5KPTA 4LF5M 5ITTA 2O5RA 1E9RA 4I4LA 4HLQA 1HR0M 2LHCA 4MH0E 3J80S 2UXBM 3GLGB 3HU1A 2ZAOA 1NHGC 3U61B 1NY6A 2X8AA 3R8FA 2N35A 2OQ4A 3GQ3A 2WSCF 4LFBM 1N32M 4XGIA 3GLFA 5KPZA 1G3IA 2K47A 1V92A 4L16A 4LFCM 1G8PA 5FTMA 4DBGB 3BXWA 3GLHE 5JI2E 2C96A 2Y21A 2QBYB 5EXTA 4QOSA 3HZJA 1QDTA 3LQQA 3CGWA 2J5YA 3GRVA 3IHPA 5DFLA 2XF3A 5ITUA 2JWSA 5GKNA 3VLFB 1GL7A 5H37D 3VKGA 5C18A 3VK7A 1NNJA 1Z5AA 2DWLA 2QQ8A 1HNXM 5FLXS 3VFDA 2YFQA 2CEAA 2EO2A 3IG5A 3LVVA 1AIPC 3UGJA 4IBFA 4DV7M 2JA2A 3M7GA 1Q3CA 2FH0A 2BNKA 3EIHA 1RU3A 1L1ZA 4DV3M 2FNAA 2XSZD 2L6OA 3ILKA 3C3DA 4NRWA 2HCBA 2F5QA 2C99A 1OQYA 1FNNA 1WGLA 1WGNA 1IY1A 1NV9A 1TH3A 3E46A 4KT0F 1W5SA 2KRKA 1TDZA 5EP4A 1MU5A 3K9OA 2C5RA 3AOEC 2MR9A 3FD9A 1R2ZA 2EJSA 3HJQA 3U6LA 5E26A 3L26A 4FCTA 3U6PA 2K0BX 3A45A 2V1CA 3KXEC 2KW0A 4DUYM 2HHHM 4JI6M 1QZMA 1HQYE 4JN6A 4M9XA 2XLJA 1KSFX 2OOBA 2DWNA 4BLCA 4JV5M 2XH9A 2K9DA 3ZQJA 3ZC7B 3GLIB 3L27A 4GMQA 4X65M 3U6MA 3TWLA 3U6DA 3DZDA 1PRBA 1VDDA 2R4JA 3A42A 3J7BA 2J7NA 4L78A 4PD2A 2UUAM 1C1KA 2BWEA 2QENA 4G3OA 3MK6A 4AQYM 4G4NA 1JQJC 2ZANA 3DA1A 2WSFF 5E6JA 3AV0A 2OOAA 5DYIA 1XMOM 1GL6A 2X49A 3GLGA 3MJ5A 2AHMA 3IG8A 4I8OA 3R9XB 3JR5A 3AKZA 1VDLA 4KODA 1FJGM 4RKUF 1IN4A 2DZOB 2VF8A 1Z5BA 5KQDA 2JXNA 1OAOC 1V34A 2JZ0A 3GLFE 4QNMA 3M0EA 5IWAM 4DR5M 2EA0A 4WURA 1K82A 1XNRM 2BJVA 3M6AA 1SXJB 1W5TA 1QUTA 3I4YA 4P16A 1QANA 1N34M 3U5ZA 1IXSA 3FYDA 1GVNA 3CTWB 5ITYA 4JI1M 3MMPA 4IBIA 3SFZA 4LJ4A 4B3TM 2J7OA 5IT9S 4A3VB 4LZZA 3K2LA 3VDPA 1QVRA 4CJ6A 4WW0A 4JI2M 4ANRA 2LWXA 5L8RF 3GO8A 4DR1M 4IBJA 3U6OA 2KDLA 3K9PA 1IY2A 4LJ9A 3KP1E 4AW4A 3ZH9B 1XXHB 3V76A 2NQ8C 3L2AA 1E32A 4M0WA 2QSFX 2Z4SA 1TGUA 2RRUA 1G59A 4QOZC 1D0KA 3BBZA 4KHPM 2QP9X 3SASA 1TTEA 2F5PA 2GNOA 3U6EA 4FCVA 1IQPA 4MGKE 4GHAA 1YSYA 4LZJA 2DNAA 3B7QA 1EIJA 2XEPA 4IBEA 2ZTCA 3QWLA 3J2PB 4UN2B 4CISA 2CUZA 3GLIA 4IIWA 1F4IA 1BVSA 3HHXA 1DV0A 3FUWA 2I7NA 3PNVA 4HL4A 1DO2A 3SMPA 2Z3XA 4AKHA 1XHBA 2MGWA 1QYRA 2XFSA 4IJFA 1N78A 4GRIA 1NVMA 1ZMUA 1ZQ9A 3FTCA 4GKJM 5JI3E 4F2LA 2V6ZM 4DV1M 1NNUC 4AG6A 4DV0M 2FS1A 1AUAA 1K3XA 3HHYA 3HHZA 4Z6YA 1Q02A 3HX3A 1PJJA 4AG5A 4RF0A 2KNZA 1SG9A 3FE3A 4G4OA 2F4VM 3F92A 1N36M 1J7KA 2JY8A 2LVNC 3Q8XA 1LV7A 2QHOB 1R7RA 3GRYA 3U60B 4K0KM 3OTOM 1G71A 1MX0A 3C9PA 1NJGA 3FRHA 1IY0A 3KS4A 2I7PA 3FTDA 3W0LB 4DR4M 3KDSE 3B7NA 4MGIE 3GLHB 2LXEA 4FWGA 2LVOC 5LMUM 2R45A 3GPYA 3HU3A 1Z59A 3H4MA 2Y0QA 2ZTDA 1G41A 3EIEA 3I4VA 2R65A 4RF1A 4CGYB 2VIIA 4NSRA 1Y8GA 3SC3A 4L8RC 1DGFA 4DV6M 4NSOB 3KS8A 3KP0E 4F1IA 4QHTA 2M5ZA 1ZV1A 1PJTA 2HKJA 1XXHA 2CWBA 2ZAMA 2JY6B 2H5XA 2CV2A 3THGA 4G4RA 1D2NA 2JP7A 5FTKA 3KOZE 4FWDA 1IN7A 5ITXA 3U6CA 2R62A 5EXXA 2G5GX 3W67A 1E94E 3J27B 4X62M 1HQCA 1IBLM 1QAQA 4NXMM 3FUXA 4LF8M 4ZPXA 1NO1A 3E21A 4NOOB 3SYKA 1WHCA 4LJ7A 3KOWE 1NV8A 3JR4A 2DWMA 3W68A 4L4UA 2P5TA 2HWJA 4GC5A 1L1TA 4GH9A 4G6ZA 2R44A 1QUSA 4IBGA 2UXCM 2QCUA 2OPFA 3HGIA 3FTEA 2KEBA 1DGGA 4R71A 3A46A 2JZ1A 2Z7JA 2CRUA 1L8QA 1UM8A 1HT2E 1T6OA 4AKIA 1SXJD 2CHQA 2L7IA 4FW9A 3U61A 4LJ8A 4B3SM 3KOXE 1TDHA 3AJIB 3L29A 4DV2M 4LCBA 4DV4M 3SAVA 2D7HA 3KSXA 4X66M 1C7YA 4AKGA
chains in the Genus database with same CATH topology
3HU2A 2F5NA 4B08A 3GRRA 3KSJA 1HT1E 3DOAA 3HWSA 1DGHB 3GP1A 2QBYA 2F5OA 3VK8A 4I81A 3E9SA 3SBJA 4DR7M 3SMSA 4CHTB 4PT5A 3UK6A 3KVWA 3GLFB 3QAUA 4LRSA 4QHSA 2Q2EB 2KZUA 3GLHA 1OJLA 3GPUA 4AI6A 5DYGA 4JI3M 3GQ5A 2YNMD 4FD2A 2UUBM 1H6UA 4R3DA 4FVMA 5FTJA 4X64M 3U6QA 4DR6M 3SHGB 4MGZE 4KO8A 4JI7M 3C58A 5ITQA 3A98B 3WHKA 4B3MM 3FYCA 2R46A 4JI8M 5KO3A 3LMMA 5BR8M 3HKPA 4IBBA 4S12A 3GPXA 1IN8A 1JR3A 2H1RA 2Y0TA 4LGMA 5ITXE 2C98A 2W82A 1IN5A 1I94M 1QAMA 2ZM6M 3AOGA 4M0DA 4MGHA 2KRUA 1EE8A 4IBKA 2QPAA 5KPRA 2CFOA 4D80A 3U6SA 4LJAA 5EP1A 4RNAA 3L28A 3FTFA 2RKOA 3FKEA 1KFVA 1PM5A 3SARA 2D7GA 4PCZA 4GITA 4IBCA 1QAOA 4LF4M 2RGOA 3VDUA 4LF6M 3TL4X 2R4EA 5EXPA 2KXEA 2LNHC 3T15A 3MHVC 4FWHA 3RGSA 2E5LM 3TQSA 1IN6A 1Q3BA 4MB7A 5EJCA 1DGHA 1ZAEA 1NSFA 4R7GA 1SXJA 4LY6A 1SXJC 3J81S 1Z5CA 2A5YB 1NJFA 1IBMM 4PDIA 2QZ4A 2L7HA 4OVZB 4JYAM 3CF6E 4ITQA 5EXSA 3UZUA 3HHWA 1JR3D 4W5WA 1PJIA 4JXJA 2BJWA 3RE8A 4LGYA 3K1JA 1ORYB 2DVWB 4LRTA 3ZCBB 3LVWA 1G4AE 3SAWA 3U5ZB 1IXSB 4TUWA 4Z8XA 4GIPA 7CATA 3WHLA 3LQRA 3W0FA 3T1YM 2UXDM 1X37A 5FTLA 2C9CA 4IBDA 1QQWA 4BB9A 4REZA 4M9ZA 1E9SA 1TH4A 1GKIA 2ZBKB 2DXIA 4JI0M 2CV0A 3VKHA 1KYIA 1Q39A 3AOEA 5IREB 5FTNA 3HJSA 2X4AA 2KA6B 4LJ5A 2XFTA 4FCWA 3K92A 3JAMS 4JI5M 3PNYA 4JI4M 1Z6TA 3FUVA 4LG2A 4DUZM 3FUUA 4I5SA 3NWLA 3K8ZA 4DV5M 2FFJA 4PDGA 1GLNA 4GC9A 3TPZA 3RGPA 2R18A 3UMMA 4YHHM 2YQZA 4KLNA 2CE7A 4IJEA 1T3TA 3L25A 1IXRC 2VQEM 5EP2A 1K3WA 1N75A 4B7FA 5DNYA 4LF9M 3D8BA 3TWMA 2XZFA 4B7HA 2C9OA 1WXQA 2M60A 3T1HM 2XZUA 2DZNB 3U60A 4AZFA 4DR2M 3AFHA 2DHRA 4II7A 4NXNM 4OW0A 2LH0A 1XNQM 4MM3B 4YY3M 3D8LA 3RFWA 1SXJE 5EP3A 4EIWA 4LJ6A 1DGBA 4B3RM 2L09A 2ERCA 5IZ7D 5C1BA 1N77A 1HNWM 4OVZA 2D7EA 2RGHA 1J5EM 1DO0A 3TE6A 1NHWC 3T38A 1OFIA 1YUBA 3PVSA 5EQTA 1I4WA 2FE8A 3GPPA 1XMQM 1XC8A 1L2DA 4XBOA 3J7AS 4LF7M 1OFHA 1R2YA 5A2QS 4DR3M 2DWZB 2Z4RA 4NRVA 4GHLA 3HJ8A 1YE9A 4L15A 1XWIA 4OX9M 2FOIC 3SHFA 1J09A 4G4QA 1IM2A 2HL7A 4NL4H 2XGNA 2Y20A 3SYLA 3CF0A 5BPVA 3TWKA 3PFIA 4OU7A 4M9SA 2VQFM 1R6BX 1L2BA 1N33M 1HNZM 2YR0A 5F3WA 8CATA 5FSWA 4D81A 2EUCA 3NBIA 3KFUG 2CHGA 2CHVA 3DFZA 3FUTA 2KZSA 3B9PA 3UJNA 1TH2A 2UUCM 3I51A 1S3SA 1IBKM 2UU9M 1L2CA 3SATA 1IXZA 3E4RA 3KOYE 3PXGA 3GQ4A 3AL0C 5KQ8A 5ITRA 4MGYE 4GKKM 1NY5A 2XSZA 2G8LA 3BOSA 4QNRA 4BBAA 3GRUA 2F5SA 3KW6A 5LMNM 4B7GA 4D82A 2V1UA 3CF2A 4LFAM 3SAUA 5KPTA 4LF5M 5ITTA 2O5RA 1E9RA 4I4LA 4HLQA 1HR0M 3J80S 4MH0E 2UXBM 3GLGB 3HU1A 2ZAOA 1NHGC 3U61B 1NY6A 2X8AA 3R8FA 2OQ4A 3GQ3A 4LFBM 1N32M 4XGIA 3GLFA 5KPZA 1G3IA 2K47A 4L16A 4LFCM 1G8PA 5FTMA 5JI2E 2C96A 2Y21A 2QBYB 5EXTA 4QOSA 3LQQA 3GRVA 2XF3A 5ITUA 5GKNA 3VLFB 1GL7A 5H37D 3VKGA 5C18A 3VK7A 1NNJA 1Z5AA 2DWLA 1HNXM 5FLXS 3VFDA 2YFQA 2CEAA 2EO2A 3IG5A 3LVVA 3UGJA 4IBFA 4DV7M 2JA2A 3M7GA 1Q3CA 2BNKA 3EIHA 1L1ZA 4DV3M 2FNAA 2XSZD 2L6OA 3ILKA 4NRWA 2HCBA 2F5QA 2C99A 1FNNA 1IY1A 1TH3A 1W5SA 2KRKA 1TDZA 5EP4A 1MU5A 2C5RA 3AOEC 3FD9A 1R2ZA 3HJQA 3U6LA 5E26A 3L26A 4FCTA 3U6PA 3A45A 2V1CA 3KXEC 2KW0A 4DUYM 2HHHM 4JI6M 1QZMA 1HQYE 4JN6A 4M9XA 2XLJA 1KSFX 2DWNA 4BLCA 4JV5M 2XH9A 3GLIB 3ZC7B 3U6MA 3L27A 4GMQA 4X65M 3TWLA 3U6DA 3DZDA 1VDDA 3J7BA 2R4JA 3A42A 2J7NA 4L78A 4PD2A 2UUAM 1C1KA 2QENA 3MK6A 4AQYM 4G4NA 1JQJC 2ZANA 3DA1A 5E6JA 3AV0A 5DYIA 1XMOM 1GL6A 2X49A 3GLGA 3MJ5A 2AHMA 3IG8A 4I8OA 3R9XB 3JR5A 3AKZA 4KODA 1FJGM 1IN4A 2DZOB 1Z5BA 5KQDA 4QNMA 3M0EA 5IWAM 4DR5M 2EA0A 4WURA 1K82A 1XNRM 2BJVA 3M6AA 1SXJB 1W5TA 3I4YA 4P16A 1QANA 1N34M 3U5ZA 3FYDA 1GVNA 3CTWB 5ITYA 4JI1M 3SFZA 4IBIA 4LJ4A 4B3TM 2J7OA 5IT9S 4A3VB 4LZZA 3K2LA 3VDPA 1QVRA 4WW0A 4JI2M 2LWXA 3GO8A 4DR1M 4IBJA 3U6OA 1IY2A 4LJ9A 3KP1E 4AW4A 3ZH9B 1XXHB 2NQ8C 3L2AA 1E32A 4M0WA 2Z4SA 1TGUA 1G59A 4QOZC 4KHPM 2QP9X 3SASA 2F5PA 3U6EA 4FCVA 1IQPA 4MGKE 4GHAA 1YSYA 4LZJA 2XEPA 4IBEA 3QWLA 3J2PB 4CISA 2CUZA 3GLIA 4IIWA 3HHXA 3FUWA 2I7NA 3PNVA 4HL4A 1DO2A 3SMPA 2Z3XA 4AKHA 1XHBA 4IJFA 1QYRA 2XFSA 1N78A 4GRIA 1NVMA 1ZQ9A 3FTCA 4GKJM 5JI3E 2V6ZM 4DV1M 1NNUC 4AG6A 4DV0M 1K3XA 3HHYA 3HHZA 4Z6YA 1PJJA 4AG5A 4RF0A 4G4OA 2F4VM 1N36M 1J7KA 3Q8XA 1LV7A 1R7RA 3GRYA 3U60B 4K0KM 3OTOM 1MX0A 1NJGA 1IY0A 3KS4A 2I7PA 3FTDA 3W0LB 4DR4M 3KDSE 4MGIE 3GLHB 2LXEA 4FWGA 5LMUM 2R45A 3GPYA 3HU3A 1Z59A 3H4MA 2Y0QA 3EIEA 1G41A 3I4VA 4RF1A 2R65A 2CV1A 4CGYB 2VIIA 4NSRA 4L8RC 3SC3A 1DGFA 4DV6M 4NSOB 3KS8A 3KP0E 4QHTA 2M5ZA 2HKJA 1XXHA 2ZAMA 2CV2A 3THGA 4G4RA 1D2NA 5FTKA 3KOZE 4FWDA 1IN7A 5ITXA 3U6CA 2R62A 5EXXA 2G5GX 4X62M 1E94E 3J27B 1HQCA 1IBLM 1QAQA 4NXMM 3FUXA 4LF8M 4ZPXA 4NOOB 3SYKA 4LJ7A 3KOWE 3JR4A 2DWMA 4L4UA 2P5TA 4GC5A 1L1TA 4GH9A 4G6ZA 4IBGA 2UXCM 2QCUA 2OPFA 3HGIA 3FTEA 2KEBA 1DGGA 3A46A 2Z7JA 1L8QA 1UM8A 1HT2E 4AKIA 1SXJD 2CHQA 2L7IA 4FW9A 3U61A 4LJ8A 4B3SM 3KOXE 1TDHA 3AJIB 3L29A 4DV2M 4LCBA 4DV4M 3SAVA 2D7HA 3KSXA 4X66M 4AKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5N A;  4KHP M;  3SAS A;  2ZBK B;  3DOA A;  3GP1 A;  3GQ3 A;  2OQ4 A;  4JI0 M;  2F5P A;  2F5O A;  3VK8 A;  4LFB M;  3U6E A;  3SBJ A;  1N32 M;  4DR7 M;  1Q39 A;  4LFC M;  3JAM S;  4CIS A;  4JI5 M;  4JI4 M;  2Q2E B;  5ITU A;  4DUZ M;  3GPU A;  4JI3 M;  3VK7 A;  1NNJ A;  4DV5 M;  3GQ5 A;  1Z5A A;  4PDG A;  2UUB M;  1HNX M;  5FLX S;  4X64 M;  3U6Q A;  4YHH M;  4DV7 M;  4DR6 M;  1Q3C A;  2VQE M;  1K3W A;  4GKJ M;  1L1Z A;  4DV3 M;  4JI7 M;  4LF9 M;  3C58 A;  5ITQ A;  4DV1 M;  3TWM A;  2XZF A;  4DV0 M;  4B3M M;  2F5Q A;  4NRW A;  4JI8 M;  3T1H M;  1K3X A;  2XZU A;  1TDZ A;  1MU5 A;  5BR8 M;  1PJJ A;  3GPX A;  4DR2 M;  4G4O A;  2F4V M;  1R2Z A;  4NXN M;  5ITX E;  3U6L A;  1N36 M;  1XNQ M;  4YY3 M;  1I94 M;  2ZM6 M;  3U6P A;  4B3R M;  3A45 A;  4K0K M;  1EE8 A;  3OTO M;  1HNW M;  4DUY M;  4JI6 M;  2HHH M;  1MX0 A;  1J5E M;  3U6S A;  3J7A S;  1XMQ M;  3GPP A;  1L2D A;  1XC8 A;  4LF7 M;  4DR4 M;  1R2Y A;  4JV5 M;  3U6M A;  5A2Q S;  4X65 M;  4DR3 M;  3TWL A;  3U6D A;  1PM5 A;  1KFV A;  3SAR A;  4NRV A;  3A42 A;  5LMU M;  2UUA M;  4PD2 A;  3GPY A;  4PCZ A;  4OX9 M;  1Z59 A;  4G4Q A;  4DV6 M;  4AQY M;  4G4N A;  4LF4 M;  3TWK A;  4LF6 M;  2VQF M;  1L2B A;  1N33 M;  2HKJ A;  1HNZ M;  1XMO M;  4G4R A;  3JR5 A;  2E5L M;  1Q3B A;  4MB7 A;  5ITX A;  3U6C A;  1FJG M;  4X62 M;  1Z5B A;  1IBL M;  4NXM M;  4LF8 M;  2UUC M;  3J81 S;  1Z5C A;  2UU9 M;  1IBK M;  5IWA M;  4DR5 M;  4PDI A;  2EA0 A;  1L2C A;  1IBM M;  3SAT A;  3JR4 A;  3GQ4 A;  1K82 A;  1XNR M;  4JYA M;  4ITQ A;  5ITR A;  1L1T A;  4GKK M;  1N34 M;  1PJI A;  2UXC M;  2OPF A;  5ITY A;  4JI1 M;  4B3T M;  3A46 A;  2F5S A;  5IT9 S;  5LMN M;  3SAW A;  4JI2 M;  4LFA M;  4B3S M;  3SAU A;  3W0F A;  3T1Y M;  3GO8 A;  4LF5 M;  1TDH A;  4DR1 M;  3U6O A;  4DV2 M;  5ITT A;  4DV4 M;  3SAV A;  2UXD M;  4X66 M;  1HR0 M;  3J80 S;  2UXB M; 
#chains in the Genus database with same CATH topology
 2KNV A;  3HU2 A;  2F5N A;  2EKK A;  4B08 A;  3LW5 F;  3I01 M;  3GRR A;  3KSJ A;  1HT1 E;  3DOA A;  3HWS A;  1DGH B;  3GP1 A;  2QBY A;  2F5O A;  3VK8 A;  3B89 A;  2DAI A;  3E9S A;  4I81 A;  3SBJ A;  4DR7 M;  3SMS A;  4XK8 F;  1GJS A;  4CHT B;  1GAB A;  2WZJ A;  4PT5 A;  2LVQ D;  2JUJ A;  3UK6 A;  3KVW A;  3GLF B;  3QAU A;  2VF7 A;  4LRS A;  4QHS A;  2Q2E B;  2KZU A;  3GLH A;  1OJL A;  2G3Q A;  4L6V 6;  3GPU A;  4AI6 A;  5DYG A;  1OTR A;  4JI3 M;  3GQ5 A;  2YNM D;  4FD2 A;  2UUB M;  1H6U A;  4R3D A;  4FVM A;  5FTJ A;  4X64 M;  3U6Q A;  4DR6 M;  1LTM A;  1YLA A;  3SHG B;  1EFU B;  4MGZ E;  4KO8 A;  2HAK A;  1WR1 B;  4JI7 M;  1V33 A;  3C58 A;  5ITQ A;  3A98 B;  3WHK A;  4B3M M;  3FYC A;  2R46 A;  4JI8 M;  2WSE F;  5KO3 A;  1UFZ A;  1GO5 A;  2DKL A;  2MH8 A;  2O01 F;  3LMM A;  5BR8 M;  3HKP A;  4IBB A;  2L2D A;  2DAE A;  2MRO B;  4S12 A;  3GPX A;  3B7Z A;  1IN8 A;  1JR3 A;  2H1R A;  2Y0T A;  4LGM A;  5ITX E;  2C98 A;  2W82 A;  1IN5 A;  1I94 M;  1QAM A;  2ZM6 M;  3AOG A;  4M0D A;  4MGH A;  2KRU A;  1VG5 A;  1EE8 A;  1MN3 A;  2JY5 A;  4IBK A;  2QPA A;  5KPR A;  2CFO A;  4D80 A;  3U6S A;  4LJA A;  5EP1 A;  4RNA A;  3L28 A;  3FTF A;  2RKO A;  3FKE A;  1KFV A;  1PM5 A;  3SAR A;  2D7G A;  4PCZ A;  4GIT A;  3IEC A;  2DEN A;  4IBC A;  1R5L A;  1QAO A;  3GLG E;  4LF4 M;  2RGO A;  3HY5 A;  3VDU A;  1ZMW A;  3LCV B;  3T6P A;  4LF6 M;  3TL4 X;  2R4E A;  5EXP A;  2LTU A;  2KXE A;  2LNH C;  2R0I A;  2LHG A;  3LCU A;  3T15 A;  3MHV C;  4FWH A;  3RGS A;  2E5L M;  1IFY A;  3TQS A;  1IN6 A;  1Q3B A;  4MB7 A;  5EJC A;  1DGH A;  1ZAE A;  1NSF A;  4WP2 A;  4R7G A;  1SXJ A;  4LY6 A;  2R6F A;  1OIP A;  1SXJ C;  3J81 S;  1Z5C A;  1XB2 B;  3Q8G A;  2A5Y B;  1NJF A;  1IBM M;  4PDI A;  3NBX X;  2QZ4 A;  3I04 M;  2CV1 A;  2L7H A;  4OVZ B;  2VDB B;  2OO9 A;  4JYA M;  3CF6 E;  4ITQ A;  5EXS A;  3UZU A;  3HHW A;  1JR3 D;  4W5W A;  1PJI A;  4JXJ A;  2BJW A;  2MJ5 B;  3RE8 A;  4LGY A;  3K1J A;  1ORY B;  2DVW B;  4LRT A;  3ZCB B;  3LVW A;  1G4A E;  3SAW A;  3U5Z B;  1IXS B;  4TUW A;  4Z8X A;  2APL A;  4GIP A;  7CAT A;  3WHL A;  3H4J A;  3LQR A;  3W0F A;  3T1Y M;  2UXD M;  1P3Q Q;  1X37 A;  5FTL A;  2C9C A;  4IBD A;  2LVA A;  1QQW A;  4BB9 A;  1WIV A;  4REZ A;  4M9Z A;  1E9S A;  1TH4 A;  1GKI A;  2ZBK B;  2DXI A;  1VEJ A;  4JI0 M;  2Z8Y M;  2CV0 A;  1JR3 E;  3VKH A;  1KYI A;  1Q39 A;  3AOE A;  2JY7 A;  5IRE B;  5FTN A;  1A5T A;  3HJS A;  1TR8 A;  3GLI E;  2X4A A;  2KA6 B;  4LJ5 A;  2XFT A;  4FCW A;  3K92 A;  1ZMV A;  4CIZ A;  3JAM S;  4JI5 M;  3PNY A;  4JI4 M;  1Z6T A;  3FUV A;  1MJG M;  4DUZ M;  4LG2 A;  2KHH A;  3FUU A;  4I5S A;  3NWL A;  3K8Z A;  1OIZ A;  2FFJ A;  4DV5 M;  4PDG A;  1GLN A;  2GQF A;  4GC9 A;  4NC6 A;  3RGP A;  3TPZ A;  2R18 A;  3UMM A;  4YHH M;  2YQZ A;  4KLN A;  2CE7 A;  4IJE A;  1T3T A;  2EKF A;  1IXR C;  3L25 A;  2VQE M;  5EP2 A;  2LBC A;  1QDR A;  1K3W A;  1N75 A;  4B7F A;  5DNY A;  4LF9 M;  3D8B A;  3TWM A;  2XZF A;  1VEG A;  2DZL A;  2C9O A;  4B7H A;  1T43 A;  1WXQ A;  2M60 A;  3T1H M;  2XZU A;  2DZN B;  4GEW A;  3U60 A;  4AZF A;  4DR2 M;  3AFH A;  2DHR A;  4Y28 F;  2KNA A;  4II7 A;  4NXN M;  4OW0 A;  2LVP C;  2LH0 A;  2DHY A;  4MM3 B;  1XNQ M;  4YY3 M;  1VQ1 A;  3D8L A;  2CP8 A;  3RFW A;  1SXJ E;  4HEO A;  5EP3 A;  2K6B A;  4LJ6 A;  1DGB A;  1OKS A;  2L09 A;  4EIW A;  2ERC A;  4B3R M;  5IZ7 D;  5C1B A;  1N77 A;  1HNW M;  4OVZ A;  2D7E A;  2RGH A;  1J5E M;  1DO0 A;  3TE6 A;  1NHW C;  3T38 A;  1OFI A;  1YUB A;  3PVS A;  5EQT A;  1I4W A;  2FE8 A;  3GPP A;  1XMQ M;  1XC8 A;  1L2D A;  4XBO A;  3J7A S;  4LF7 M;  1OFH A;  1R4G A;  1R2Y A;  1D0M A;  5A2Q S;  4DR3 M;  2O25 A;  2DWZ B;  2Z4R A;  4NRV A;  4GHL A;  3HJ8 A;  1YE9 A;  4L15 A;  1XWI A;  4OX9 M;  2FOI C;  3SHF A;  1J09 A;  4G4Q A;  1IM2 A;  2HL7 A;  4NL4 H;  2XGN A;  2Y20 A;  1XXH E;  3SYL A;  3CF0 A;  1JB0 F;  5BPV A;  3TWK A;  2DI0 A;  3B74 A;  3PFI A;  4OU7 A;  4M9S A;  2VQF M;  1R6B X;  1L2B A;  1N33 M;  1HNZ M;  1CUK A;  2YR0 A;  1D0L A;  4Q7J A;  8CAT A;  5F3W A;  5FSW A;  1VEK A;  4D81 A;  2EUC A;  2QNJ A;  2L4F A;  3NBI A;  3KFU G;  2CHG A;  2L4E A;  2CHV A;  3FRI A;  3DFZ A;  3FUT A;  2DAG A;  2KZS A;  3B9P A;  3UJN A;  1TH2 A;  2UUC M;  3I51 A;  1S3S A;  1IBK M;  2UU9 M;  1PJQ A;  1OAI A;  1L2C A;  2DAK A;  3SAT A;  1IXZ A;  3E4R A;  3KOY E;  3PXG A;  3GQ4 A;  3AL0 C;  3QYE A;  5KQ8 A;  5ITR A;  1HJP A;  4MGY E;  1WJ7 A;  4GKK M;  1NY5 A;  3QYB A;  2XSZ A;  2G8L A;  4P17 A;  1TF0 B;  3BOS A;  2B3T A;  4QNR A;  3C3E A;  2BWB A;  4BBA A;  3GRU A;  2F5S A;  2JNH A;  3KW6 A;  1QZE A;  5LMN M;  4B7G A;  4D82 A;  1PJS A;  2V1U A;  3CF2 A;  4LFA M;  3SAU A;  2DAM A;  1GJT A;  1PGY A;  5KPT A;  4LF5 M;  5ITT A;  2O5R A;  1E9R A;  4I4L A;  4HLQ A;  1HR0 M;  2LHC A;  4MH0 E;  3J80 S;  2UXB M;  3GLG B;  3HU1 A;  2ZAO A;  1NHG C;  3U61 B;  1NY6 A;  2X8A A;  3R8F A;  2N35 A;  2OQ4 A;  3GQ3 A;  2WSC F;  4LFB M;  1N32 M;  4XGI A;  3GLF A;  5KPZ A;  1G3I A;  2K47 A;  1V92 A;  4L16 A;  4LFC M;  1G8P A;  5FTM A;  4DBG B;  3BXW A;  3GLH E;  5JI2 E;  2C96 A;  2Y21 A;  2QBY B;  5EXT A;  4QOS A;  3HZJ A;  1QDT A;  3LQQ A;  3CGW A;  2J5Y A;  3GRV A;  3IHP A;  5DFL A;  2XF3 A;  5ITU A;  2JWS A;  5GKN A;  3VLF B;  1GL7 A;  5H37 D;  3VKG A;  5C18 A;  3VK7 A;  1NNJ A;  1Z5A A;  2DWL A;  2QQ8 A;  1HNX M;  5FLX S;  3VFD A;  2YFQ A;  2CEA A;  2EO2 A;  3IG5 A;  3LVV A;  1AIP C;  3UGJ A;  4IBF A;  4DV7 M;  2JA2 A;  3M7G A;  1Q3C A;  2FH0 A;  2BNK A;  3EIH A;  1RU3 A;  1L1Z A;  4DV3 M;  2FNA A;  2XSZ D;  2L6O A;  3ILK A;  3C3D A;  4NRW A;  2HCB A;  2F5Q A;  2C99 A;  1OQY A;  1FNN A;  1WGL A;  1WGN A;  1IY1 A;  1NV9 A;  1TH3 A;  3E46 A;  4KT0 F;  1W5S A;  2KRK A;  1TDZ A;  5EP4 A;  1MU5 A;  3K9O A;  2C5R A;  3AOE C;  2MR9 A;  3FD9 A;  1R2Z A;  2EJS A;  3HJQ A;  3U6L A;  5E26 A;  3L26 A;  4FCT A;  3U6P A;  2K0B X;  3A45 A;  2V1C A;  3KXE C;  2KW0 A;  4DUY M;  2HHH M;  4JI6 M;  1QZM A;  1HQY E;  4JN6 A;  4M9X A;  2XLJ A;  1KSF X;  2OOB A;  2DWN A;  4BLC A;  4JV5 M;  2XH9 A;  2K9D A;  3ZQJ A;  3ZC7 B;  3GLI B;  3L27 A;  4GMQ A;  4X65 M;  3U6M A;  3TWL A;  3U6D A;  3DZD A;  1PRB A;  1VDD A;  2R4J A;  3A42 A;  3J7B A;  2J7N A;  4L78 A;  4PD2 A;  2UUA M;  1C1K A;  2BWE A;  2QEN A;  4G3O A;  3MK6 A;  4AQY M;  4G4N A;  1JQJ C;  2ZAN A;  3DA1 A;  2WSF F;  5E6J A;  3AV0 A;  2OOA A;  5DYI A;  1XMO M;  1GL6 A;  2X49 A;  3GLG A;  3MJ5 A;  2AHM A;  3IG8 A;  4I8O A;  3R9X B;  3JR5 A;  3AKZ A;  1VDL A;  4KOD A;  1FJG M;  4RKU F;  1IN4 A;  2DZO B;  2VF8 A;  1Z5B A;  5KQD A;  2JXN A;  1OAO C;  1V34 A;  2JZ0 A;  3GLF E;  4QNM A;  3M0E A;  5IWA M;  4DR5 M;  2EA0 A;  4WUR A;  1K82 A;  1XNR M;  2BJV A;  3M6A A;  1SXJ B;  1W5T A;  1QUT A;  3I4Y A;  4P16 A;  1QAN A;  1N34 M;  3U5Z A;  1IXS A;  3FYD A;  1GVN A;  3CTW B;  5ITY A;  4JI1 M;  3MMP A;  4IBI A;  3SFZ A;  4LJ4 A;  4B3T M;  2J7O A;  5IT9 S;  4A3V B;  4LZZ A;  3K2L A;  3VDP A;  1QVR A;  4CJ6 A;  4WW0 A;  4JI2 M;  4ANR A;  2LWX A;  5L8R F;  3GO8 A;  4DR1 M;  4IBJ A;  3U6O A;  2KDL A;  3K9P A;  1IY2 A;  4LJ9 A;  3KP1 E;  4AW4 A;  3ZH9 B;  1XXH B;  3V76 A;  2NQ8 C;  3L2A A;  1E32 A;  4M0W A;  2QSF X;  2Z4S A;  1TGU A;  2RRU A;  1G59 A;  4QOZ C;  1D0K A;  3BBZ A;  4KHP M;  2QP9 X;  3SAS A;  1TTE A;  2F5P A;  2GNO A;  3U6E A;  4FCV A;  1IQP A;  4MGK E;  4GHA A;  1YSY A;  4LZJ A;  2DNA A;  3B7Q A;  1EIJ A;  2XEP A;  4IBE A;  2ZTC A;  3QWL A;  3J2P B;  4UN2 B;  4CIS A;  2CUZ A;  3GLI A;  4IIW A;  1F4I A;  1BVS A;  3HHX A;  1DV0 A;  3FUW A;  2I7N A;  3PNV A;  4HL4 A;  1DO2 A;  3SMP A;  2Z3X A;  4AKH A;  1XHB A;  2MGW A;  1QYR A;  2XFS A;  4IJF A;  1N78 A;  4GRI A;  1NVM A;  1ZMU A;  1ZQ9 A;  3FTC A;  4GKJ M;  5JI3 E;  4F2L A;  2V6Z M;  4DV1 M;  1NNU C;  4AG6 A;  4DV0 M;  2FS1 A;  1AUA A;  1K3X A;  3HHY A;  3HHZ A;  4Z6Y A;  1Q02 A;  3HX3 A;  1PJJ A;  4AG5 A;  4RF0 A;  2KNZ A;  1SG9 A;  3FE3 A;  4G4O A;  2F4V M;  3F92 A;  1N36 M;  1J7K A;  2JY8 A;  2LVN C;  3Q8X A;  1LV7 A;  2QHO B;  1R7R A;  3GRY A;  3U60 B;  4K0K M;  3OTO M;  1G71 A;  1MX0 A;  3C9P A;  1NJG A;  3FRH A;  1IY0 A;  3KS4 A;  2I7P A;  3FTD A;  3W0L B;  4DR4 M;  3KDS E;  3B7N A;  4MGI E;  3GLH B;  2LXE A;  4FWG A;  2LVO C;  5LMU M;  2R45 A;  3GPY A;  3HU3 A;  1Z59 A;  3H4M A;  2Y0Q A;  2ZTD A;  1G41 A;  3EIE A;  3I4V A;  2R65 A;  4RF1 A;  4CGY B;  2VII A;  4NSR A;  1Y8G A;  3SC3 A;  4L8R C;  1DGF A;  4DV6 M;  4NSO B;  3KS8 A;  3KP0 E;  4F1I A;  4QHT A;  2M5Z A;  1ZV1 A;  1PJT A;  2HKJ A;  1XXH A;  2CWB A;  2ZAM A;  2JY6 B;  2H5X A;  2CV2 A;  3THG A;  4G4R A;  1D2N A;  2JP7 A;  5FTK A;  3KOZ E;  4FWD A;  1IN7 A;  5ITX A;  3U6C A;  2R62 A;  5EXX A;  2G5G X;  3W67 A;  1E94 E;  3J27 B;  4X62 M;  1HQC A;  1IBL M;  1QAQ A;  4NXM M;  3FUX A;  4LF8 M;  4ZPX A;  1NO1 A;  3E21 A;  4NOO B;  3SYK A;  1WHC A;  4LJ7 A;  3KOW E;  1NV8 A;  3JR4 A;  2DWM A;  3W68 A;  4L4U A;  2P5T A;  2HWJ A;  4GC5 A;  1L1T A;  4GH9 A;  4G6Z A;  2R44 A;  1QUS A;  4IBG A;  2UXC M;  2QCU A;  2OPF A;  3HGI A;  3FTE A;  2KEB A;  1DGG A;  4R71 A;  3A46 A;  2JZ1 A;  2Z7J A;  2CRU A;  1L8Q A;  1UM8 A;  1HT2 E;  1T6O A;  4AKI A;  1SXJ D;  2CHQ A;  2L7I A;  4FW9 A;  3U61 A;  4LJ8 A;  4B3S M;  3KOX E;  1TDH A;  3AJI B;  3L29 A;  4DV2 M;  4LCB A;  4DV4 M;  3SAV A;  2D7H A;  3KSX A;  4X66 M;  1C7Y A;  4AKG A; 
#chains in the Genus database with same CATH homology
 3HU2 A;  2F5N A;  4B08 A;  3GRR A;  3KSJ A;  1HT1 E;  3DOA A;  3HWS A;  1DGH B;  3GP1 A;  2QBY A;  2F5O A;  3VK8 A;  4I81 A;  3E9S A;  3SBJ A;  4DR7 M;  3SMS A;  4CHT B;  4PT5 A;  3UK6 A;  3KVW A;  3GLF B;  3QAU A;  4LRS A;  4QHS A;  2Q2E B;  2KZU A;  3GLH A;  1OJL A;  3GPU A;  4AI6 A;  5DYG A;  4JI3 M;  3GQ5 A;  2YNM D;  4FD2 A;  2UUB M;  1H6U A;  4R3D A;  4FVM A;  5FTJ A;  4X64 M;  3U6Q A;  4DR6 M;  3SHG B;  4MGZ E;  4KO8 A;  4JI7 M;  3C58 A;  5ITQ A;  3A98 B;  3WHK A;  4B3M M;  3FYC A;  2R46 A;  4JI8 M;  5KO3 A;  3LMM A;  5BR8 M;  3HKP A;  4IBB A;  4S12 A;  3GPX A;  1IN8 A;  1JR3 A;  2H1R A;  2Y0T A;  4LGM A;  5ITX E;  2C98 A;  2W82 A;  1IN5 A;  1I94 M;  1QAM A;  2ZM6 M;  3AOG A;  4M0D A;  4MGH A;  2KRU A;  1EE8 A;  4IBK A;  2QPA A;  5KPR A;  2CFO A;  4D80 A;  3U6S A;  4LJA A;  5EP1 A;  4RNA A;  3L28 A;  3FTF A;  2RKO A;  3FKE A;  1KFV A;  1PM5 A;  3SAR A;  2D7G A;  4PCZ A;  4GIT A;  4IBC A;  1QAO A;  4LF4 M;  2RGO A;  3VDU A;  4LF6 M;  3TL4 X;  2R4E A;  5EXP A;  2KXE A;  2LNH C;  3T15 A;  3MHV C;  4FWH A;  3RGS A;  2E5L M;  3TQS A;  1IN6 A;  1Q3B A;  4MB7 A;  5EJC A;  1DGH A;  1ZAE A;  1NSF A;  4R7G A;  1SXJ A;  4LY6 A;  1SXJ C;  3J81 S;  1Z5C A;  2A5Y B;  1NJF A;  1IBM M;  4PDI A;  2QZ4 A;  2L7H A;  4OVZ B;  4JYA M;  3CF6 E;  4ITQ A;  5EXS A;  3UZU A;  3HHW A;  1JR3 D;  4W5W A;  1PJI A;  4JXJ A;  2BJW A;  3RE8 A;  4LGY A;  3K1J A;  1ORY B;  2DVW B;  4LRT A;  3ZCB B;  3LVW A;  1G4A E;  3SAW A;  3U5Z B;  1IXS B;  4TUW A;  4Z8X A;  4GIP A;  7CAT A;  3WHL A;  3LQR A;  3W0F A;  3T1Y M;  2UXD M;  1X37 A;  5FTL A;  2C9C A;  4IBD A;  1QQW A;  4BB9 A;  4REZ A;  4M9Z A;  1E9S A;  1TH4 A;  1GKI A;  2ZBK B;  2DXI A;  4JI0 M;  2CV0 A;  3VKH A;  1KYI A;  1Q39 A;  3AOE A;  5IRE B;  5FTN A;  3HJS A;  2X4A A;  2KA6 B;  4LJ5 A;  2XFT A;  4FCW A;  3K92 A;  3JAM S;  4JI5 M;  3PNY A;  4JI4 M;  1Z6T A;  3FUV A;  4LG2 A;  4DUZ M;  3FUU A;  4I5S A;  3NWL A;  3K8Z A;  4DV5 M;  2FFJ A;  4PDG A;  1GLN A;  4GC9 A;  3TPZ A;  3RGP A;  2R18 A;  3UMM A;  4YHH M;  2YQZ A;  4KLN A;  2CE7 A;  4IJE A;  1T3T A;  3L25 A;  1IXR C;  2VQE M;  5EP2 A;  1K3W A;  1N75 A;  4B7F A;  5DNY A;  4LF9 M;  3D8B A;  3TWM A;  2XZF A;  4B7H A;  2C9O A;  1WXQ A;  2M60 A;  3T1H M;  2XZU A;  2DZN B;  3U60 A;  4AZF A;  4DR2 M;  3AFH A;  2DHR A;  4II7 A;  4NXN M;  4OW0 A;  2LH0 A;  1XNQ M;  4MM3 B;  4YY3 M;  3D8L A;  3RFW A;  1SXJ E;  5EP3 A;  4EIW A;  4LJ6 A;  1DGB A;  4B3R M;  2L09 A;  2ERC A;  5IZ7 D;  5C1B A;  1N77 A;  1HNW M;  4OVZ A;  2D7E A;  2RGH A;  1J5E M;  1DO0 A;  3TE6 A;  1NHW C;  3T38 A;  1OFI A;  1YUB A;  3PVS A;  5EQT A;  1I4W A;  2FE8 A;  3GPP A;  1XMQ M;  1XC8 A;  1L2D A;  4XBO A;  3J7A S;  4LF7 M;  1OFH A;  1R2Y A;  5A2Q S;  4DR3 M;  2DWZ B;  2Z4R A;  4NRV A;  4GHL A;  3HJ8 A;  1YE9 A;  4L15 A;  1XWI A;  4OX9 M;  2FOI C;  3SHF A;  1J09 A;  4G4Q A;  1IM2 A;  2HL7 A;  4NL4 H;  2XGN A;  2Y20 A;  3SYL A;  3CF0 A;  5BPV A;  3TWK A;  3PFI A;  4OU7 A;  4M9S A;  2VQF M;  1R6B X;  1L2B A;  1N33 M;  1HNZ M;  2YR0 A;  5F3W A;  8CAT A;  5FSW A;  4D81 A;  2EUC A;  3NBI A;  3KFU G;  2CHG A;  2CHV A;  3DFZ A;  3FUT A;  2KZS A;  3B9P A;  3UJN A;  1TH2 A;  2UUC M;  3I51 A;  1S3S A;  1IBK M;  2UU9 M;  1L2C A;  3SAT A;  1IXZ A;  3E4R A;  3KOY E;  3PXG A;  3GQ4 A;  3AL0 C;  5KQ8 A;  5ITR A;  4MGY E;  4GKK M;  1NY5 A;  2XSZ A;  2G8L A;  3BOS A;  4QNR A;  4BBA A;  3GRU A;  2F5S A;  3KW6 A;  5LMN M;  4B7G A;  4D82 A;  2V1U A;  3CF2 A;  4LFA M;  3SAU A;  5KPT A;  4LF5 M;  5ITT A;  2O5R A;  1E9R A;  4I4L A;  4HLQ A;  1HR0 M;  3J80 S;  4MH0 E;  2UXB M;  3GLG B;  3HU1 A;  2ZAO A;  1NHG C;  3U61 B;  1NY6 A;  2X8A A;  3R8F A;  2OQ4 A;  3GQ3 A;  4LFB M;  1N32 M;  4XGI A;  3GLF A;  5KPZ A;  1G3I A;  2K47 A;  4L16 A;  4LFC M;  1G8P A;  5FTM A;  5JI2 E;  2C96 A;  2Y21 A;  2QBY B;  5EXT A;  4QOS A;  3LQQ A;  3GRV A;  2XF3 A;  5ITU A;  5GKN A;  3VLF B;  1GL7 A;  5H37 D;  3VKG A;  5C18 A;  3VK7 A;  1NNJ A;  1Z5A A;  2DWL A;  1HNX M;  5FLX S;  3VFD A;  2YFQ A;  2CEA A;  2EO2 A;  3IG5 A;  3LVV A;  3UGJ A;  4IBF A;  4DV7 M;  2JA2 A;  3M7G A;  1Q3C A;  2BNK A;  3EIH A;  1L1Z A;  4DV3 M;  2FNA A;  2XSZ D;  2L6O A;  3ILK A;  4NRW A;  2HCB A;  2F5Q A;  2C99 A;  1FNN A;  1IY1 A;  1TH3 A;  1W5S A;  2KRK A;  1TDZ A;  5EP4 A;  1MU5 A;  2C5R A;  3AOE C;  3FD9 A;  1R2Z A;  3HJQ A;  3U6L A;  5E26 A;  3L26 A;  4FCT A;  3U6P A;  3A45 A;  2V1C A;  3KXE C;  2KW0 A;  4DUY M;  2HHH M;  4JI6 M;  1QZM A;  1HQY E;  4JN6 A;  4M9X A;  2XLJ A;  1KSF X;  2DWN A;  4BLC A;  4JV5 M;  2XH9 A;  3GLI B;  3ZC7 B;  3U6M A;  3L27 A;  4GMQ A;  4X65 M;  3TWL A;  3U6D A;  3DZD A;  1VDD A;  3J7B A;  2R4J A;  3A42 A;  2J7N A;  4L78 A;  4PD2 A;  2UUA M;  1C1K A;  2QEN A;  3MK6 A;  4AQY M;  4G4N A;  1JQJ C;  2ZAN A;  3DA1 A;  5E6J A;  3AV0 A;  5DYI A;  1XMO M;  1GL6 A;  2X49 A;  3GLG A;  3MJ5 A;  2AHM A;  3IG8 A;  4I8O A;  3R9X B;  3JR5 A;  3AKZ A;  4KOD A;  1FJG M;  1IN4 A;  2DZO B;  1Z5B A;  5KQD A;  4QNM A;  3M0E A;  5IWA M;  4DR5 M;  2EA0 A;  4WUR A;  1K82 A;  1XNR M;  2BJV A;  3M6A A;  1SXJ B;  1W5T A;  3I4Y A;  4P16 A;  1QAN A;  1N34 M;  3U5Z A;  3FYD A;  1GVN A;  3CTW B;  5ITY A;  4JI1 M;  3SFZ A;  4IBI A;  4LJ4 A;  4B3T M;  2J7O A;  5IT9 S;  4A3V B;  4LZZ A;  3K2L A;  3VDP A;  1QVR A;  4WW0 A;  4JI2 M;  2LWX A;  3GO8 A;  4DR1 M;  4IBJ A;  3U6O A;  1IY2 A;  4LJ9 A;  3KP1 E;  4AW4 A;  3ZH9 B;  1XXH B;  2NQ8 C;  3L2A A;  1E32 A;  4M0W A;  2Z4S A;  1TGU A;  1G59 A;  4QOZ C;  4KHP M;  2QP9 X;  3SAS A;  2F5P A;  3U6E A;  4FCV A;  1IQP A;  4MGK E;  4GHA A;  1YSY A;  4LZJ A;  2XEP A;  4IBE A;  3QWL A;  3J2P B;  4CIS A;  2CUZ A;  3GLI A;  4IIW A;  3HHX A;  3FUW A;  2I7N A;  3PNV A;  4HL4 A;  1DO2 A;  3SMP A;  2Z3X A;  4AKH A;  1XHB A;  4IJF A;  1QYR A;  2XFS A;  1N78 A;  4GRI A;  1NVM A;  1ZQ9 A;  3FTC A;  4GKJ M;  5JI3 E;  2V6Z M;  4DV1 M;  1NNU C;  4AG6 A;  4DV0 M;  1K3X A;  3HHY A;  3HHZ A;  4Z6Y A;  1PJJ A;  4AG5 A;  4RF0 A;  4G4O A;  2F4V M;  1N36 M;  1J7K A;  3Q8X A;  1LV7 A;  1R7R A;  3GRY A;  3U60 B;  4K0K M;  3OTO M;  1MX0 A;  1NJG A;  1IY0 A;  3KS4 A;  2I7P A;  3FTD A;  3W0L B;  4DR4 M;  3KDS E;  4MGI E;  3GLH B;  2LXE A;  4FWG A;  5LMU M;  2R45 A;  3GPY A;  3HU3 A;  1Z59 A;  3H4M A;  2Y0Q A;  3EIE A;  1G41 A;  3I4V A;  4RF1 A;  2R65 A;  2CV1 A;  4CGY B;  2VII A;  4NSR A;  4L8R C;  3SC3 A;  1DGF A;  4DV6 M;  4NSO B;  3KS8 A;  3KP0 E;  4QHT A;  2M5Z A;  2HKJ A;  1XXH A;  2ZAM A;  2CV2 A;  3THG A;  4G4R A;  1D2N A;  5FTK A;  3KOZ E;  4FWD A;  1IN7 A;  5ITX A;  3U6C A;  2R62 A;  5EXX A;  2G5G X;  4X62 M;  1E94 E;  3J27 B;  1HQC A;  1IBL M;  1QAQ A;  4NXM M;  3FUX A;  4LF8 M;  4ZPX A;  4NOO B;  3SYK A;  4LJ7 A;  3KOW E;  3JR4 A;  2DWM A;  4L4U A;  2P5T A;  4GC5 A;  1L1T A;  4GH9 A;  4G6Z A;  4IBG A;  2UXC M;  2QCU A;  2OPF A;  3HGI A;  3FTE A;  2KEB A;  1DGG A;  3A46 A;  2Z7J A;  1L8Q A;  1UM8 A;  1HT2 E;  4AKI A;  1SXJ D;  2CHQ A;  2L7I A;  4FW9 A;  3U61 A;  4LJ8 A;  4B3S M;  3KOX E;  1TDH A;  3AJI B;  3L29 A;  4DV2 M;  4LCB A;  4DV4 M;  3SAV A;  2D7H A;  3KSX A;  4X66 M;  4AKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...