4YHHM

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4yhhM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4yhhM02
4NXMM 2ZBKB 4LF9M 1KFVA 4B3MM 3T1HM 5ITXA 1PJJA 5ITUA 4X66M 1PM5A 1Z5BA 2UXCM 2UXDM 3SAWA 3GPPA 4DV5M 2OQ4A 4ITQA 3C58A 1J5EM 4JI4M 4LF8M 3A45A 1MX0A 5ITXE 1HNXM 1NNJA 3VK8A 4LF7M 1Q39A 4YHHM 1Q3CA 4NRWA 2OPFA 3TWKA 1XNRM 2UUCM 3U6SA 3JR4A 3J80S 1L1ZA 3W0FA 5LMNM 4JV5M 4LFBM 4LF6M 3TWLA 3GP1A 1FJGM 1XMOM 1N34M 1TDZA 1IBMM 4DR1M 4DV3M 4DV7M 2F5QA 3DOAA 3U6LA 2XZUA 1R2YA 4MB7A 5ITRA 4GKJM 3U6CA 2HKJA 2UU9M 4OX9M 5IWAM 3U6OA 1XC8A 1EE8A 2VQEM 1I94M 4DR3M 3OTOM 3U6DA 4PDIA 1Q3BA 2ZM6M 4JI1M 4DV4M 1HR0M 1TDHA 3GQ5A 4DV2M 3GQ3A 3SAVA 5A2QS 4B3SM 4LFAM 4G4NA 4DR7M 1L2BA 1R2ZA 1K3WA 1L2DA 4DV1M 4YY3M 1Z5CA 4JI7M 4G4OA 4KHPM 4DUZM 1PJIA 3SATA 3GPUA 4LF4M 3J81S 3GPYA 1L2CA 3SASA 4DR2M 4AQYM 5LMUM 4JYAM 5BR8M 1L1TA 4X62M 3SAUA 4JI5M 3SBJA 2F5PA 2UUBM 1N33M 1K3XA 1Z59A 3U6MA 3J7AS 5ITTA 1XMQM 2XZFA 4K0KM 5FLXS 2Q2EB 1MU5A 3JAMS 1HNWM 3GO8A 4G4RA 3U6EA 3TWMA 4JI0M 1IBKM 2F5SA 1Z5AA 5IT9S 2VQFM 4DR5M 1N36M 4B3TM 3U6QA 1XNQM 4B3RM 3SARA 4DV6M 1IBLM 4JI2M 1K82A 4JI3M 2F5OA 5ITQA 4DR4M 4NRVA 3A42A 2E5LM 1N32M 2F4VM 4NXNM 5ITYA 4DV0M 4DR6M 4G4QA 4X65M 3T1YM 3JR5A 2HHHM 4GKKM 4LF5M 3GQ4A 4CISA 4X64M 3U6PA 4JI6M 3VK7A 2UUAM 4PD2A 4DUYM 2UXBM 3GPXA 3A46A 4PDGA 1HNZM 2EA0A 4LFCM 2F5NA 4JI8M 4PCZA
chains in the Genus database with same CATH superfamily
1XB2B 2V6ZM 4LF9M 2DAMA 3FE3A 2DWLA 3E21A 1LV7A 4L15A 2QBYB 2CUZA 3T1HM 4B3MM 2LH0A 4TUWA 5EP3A 5ITUA 5EQTA 2JXNA 2RRUA 1UFZA 3MHVC 3U5ZA 1VG5A 4XK8F 4LJ7A 8CATA 1IFYA 4DV5M 1SXJC 4L6V6 4LF8M 2QSFX 2P5TA 5EXSA 1HT1E 4A3VB 3A45A 2DI0A 2VDBB 3M0EA 1NNJA 1D0MA 1D0LA 3C3DA 4YHHM 2CHQA 4NRWA 3W0LB 2UUCM 2DHRA 2EO2A 3K92A 3W0FA 1A5TA 2X49A 2V1UA 2AHMA 1FJGM 1IY0A 2F5QA 1TDZA 4DR1M 3AKZA 5JI3E 3MJ5A 1QZEA 3U6LA 2XZUA 3FTEA 2DAKA 1HJPA 3C3EA 4R71A 2DENA 1UM8A 2HKJA 3HX3A 1G8PA 4OX9M 1NHWC 1YE9A 1G71A 2GQFA 2KZUA 2WSFF 4LRTA 3L25A 5L8RF 3KP0E 2APLA 1ZMWA 2C9CA 2CEAA 2YNMD 3B89A 1DO0A 5FTLA 1IXSB 4PDIA 3U6DA 1Q3BA 5KPZA 1WGNA 4JI1M 3FUUA 1HR0M 3CF2A 3GQ5A 3SAVA 4EIWA 2JY5A 4G4NA 2JY6B 4CGYB 3Q8XA 4DV1M 3NBIA 4P17A 3U5ZB 4JN6A 3QWLA 2GNOA 3LCUA 3HHYA 4QHTA 4BB9A 4GH9A 1XWIA 3I01M 2BJWA 4IBKA 3GPYA 2CHVA 3KSXA 1JR3D 2BWBA 4B7HA 3GLIA 4AKGA 1IN6A 4AQYM 2C9OA 4JYAM 4FCTA 1DGGA 1QUSA 1QQWA 2QQ8A 5E6JA 2UUBM 2XFTA 1N33M 4M0WA 4D81A 1R6BX 5ITTA 2XZFA 1N75A 1DGHB 2CWBA 3BXWA 1OAIA 4GRIA 2LVAA 1VDDA 2LNHC 3ILKA 1QANA 1IXRC 1TH3A 1X37A 3UK6A 1C7YA 3VFDA 1NY5A 4KLNA 1XXHB 4DR5M 1N36M 2HCBA 3KXEC 3ZC7B 3FTFA 2XSZD 2Z4SA 1ZAEA 3SARA 4M9XA 3QYEA 1OKSA 2EJSA 1WIVA 3KVWA 3L2AA 4MGZE 1IBLM 4L78A 4OVZB 4JI3M 4QOZC 2QCUA 4DR4M 1HQCA 2DAEA 1GL7A 2LHGA 1N32M 5ITYA 4DV0M 4HL4A 2I7NA 3HGIA 3HJSA 4LJ4A 4LJAA 4G4QA 3KFUG 4DR6M 3B74A 3CF0A 3GQ4A 2EUCA 2CV0A 3E46A 4G3OA 4JI6M 3U61A 3AOGA 5FTMA 4PDGA 3R9XB 1D2NA 2L4FA 1VEGA 5DYIA 1ORYB 4QNRA 3VLFB 1SG9A 2DVWB 1S3SA 4MGKE 4FW9A 3VDPA 3FRIA 4PCZA 5KPRA 4NXMM 3J7BA 3BBZA 3HY5A 4MGHA 1QDRA 2Y21A 4M0DA 2KDLA 2L09A 4I81A 1KSFX 3H4MA 4M9ZA 4Z8XA 4FWGA 4PT5A 3B7NA 4X66M 3UGJA 3LMMA 4RF1A 2UXCM 1N78A 2UXDM 3IECA 3WHLA 1OTRA 2XEPA 3GLHA 4AZFA 2X8AA 4JI4M 2LWXA 3SMSA 2ERCA 1NV8A 5ITXE 1HNXM 3LVWA 2C5RA 3K9PA 2LTUA 4QNMA 1Q3CA 2D7GA 2QHOB 2HWJA 1GJTA 4KT0F 3LVVA 2ZAMA 5LMNM 4MM3B 2CV1A 3LCVB 1OJLA 1GKIA 1N34M 1AIPC 3GRRA 4L4UA 1IQPA 3DOAA 3KDSE 3PNVA 5IREB 1R2YA 4MB7A 4D82A 4B7GA 4GKJM 2QP9X 3U6CA 3FUTA 3T15A 1OFIA 1MJGM 2JA2A 3GRYA 2MH8A 2DWZB 1E32A 3KOZE 1VEKA 3U6OA 1EE8A 2MGWA 2VQEM 1I94M 3TL4X 3K2LA 3CTWB 1NSFA 4FWDA 2ZANA 3TPZA 2DAIA 3TQSA 1KYIA 4DV4M 2KNVA 4CJ6A 3GQ3A 2G8LA 5A2QS 4IBIA 1IM2A 3MMPA 2XFSA 4LJ5A 5FTJA 5C18A 1PJSA 1P3QQ 2O01F 3KOWE 2B3TA 2C99A 3GRVA 1Z5CA 1CUKA 4AW4A 3FD9A 1PJTA 3RFWA 4KHPM 1NNUC 2D7HA 4F1IA 1GO5A 1PJIA 1G4AE 1GABA 1QAMA 3GPUA 7CATA 2Y0QA 4LF4M 4NC6A 3AFHA 1GVNA 4CIZA 1L2CA 2JZ1A 3SASA 3PNYA 2R46A 3H4JA 4UN2B 3SMPA 2R18A 1ZMUA 4IBEA 1DGBA 5BR8M 4HLQA 1OQYA 3SFZA 1Z59A 3TE6A 3VKGA 2LVNC 4K0KM 2XF3A 1E94E 5FLXS 1TTEA 2CFOA 2Q2EB 2R4EA 2CRUA 3QAUA 1HNWM 3V76A 3ZH9B 2L4EA 3GO8A 1IN7A 3HWSA 1IBKM 3U60A 3UMMA 3I4VA 4KODA 1WGLA 2DZNB 3I4YA 3U6QA 2OOBA 2DWMA 4IBDA 4KO8A 4II7A 2F5OA 4AG6A 1SXJA 1VQ1A 3A42A 2E5LM 2M60A 3UZUA 2L2DA 4NXNM 4AG5A 3UJNA 4GHLA 1PGYA 4QHSA 1PJQA 2Y20A 3KW6A 4HEOA 3JR5A 5EXTA 2HHHM 3ZCBB 4AI6A 5GKNA 2J7OA 3FKEA 1YUBA 5DYGA 4Z6YA 2J5YA 4BLCA 1G3IA 2RKOA 1HT2E 3VK7A 2O25A 1DGFA 4Y28F 2UUAM 3AOEA 1NO1A 3LW5F 3KOYE 1F4IA 2R45A 2WZJA 2R65A 2VIIA 4IBGA 2D7EA 2G5GX 2LXEA 2JP7A 1OIZA 5EJCA 4I5SA 4RNAA 4LGYA 1G41A 3K8ZA 4NSOB 4R7GA 5EP2A 4RKUF 3RGSA 4LFCM 3C9PA 5FTNA 4ANRA 2ZBKB 2DKLA 5BPVA 1NHGC 2MJ5B 4F2LA 1V92A 4LGMA 2WSEF 4XGIA 2Y0TA 3VKHA 3HJ8A 3NBXX 3FTCA 1WR1B 3KS4A 5DNYA 3HZJA 3SHGB 3SAWA 1R5LA 4GHAA 3GLHE 1QAOA 2FS1A 2Z4RA 1EIJA 2JNHA 3C58A 4GMQA 1I4WA 1MX0A 2V1CA 4IBFA 4IBJA 1EFUB 4IJFA 4LF7M 1Q39A 4GC5A 4B08A 1YLAA 1ZMVA 2MROB 3FUWA 3SHFA 2OPFA 1XNRM 1ZV1A 3U6SA 4IBCA 3J80S 2KA6B 3L29A 1L8QA 4OW0A 3JR4A 3GLGA 2Z3XA 1OIPA 3TWLA 4LF6M 3RE8A 1DO2A 4WURA 2KZSA 1V34A 3KS8A 3E9SA 2JY7A 1IY1A 2DZOB 1TR8A 3PVSA 5EXPA 1H6UA 5ITRA 2RGOA 4LRSA 4IJEA 3GLFA 1C1KA 4AKHA 2R6FA 5IWAM 3NWLA 4OU7A 3I04M 1T43A 4LCBA 3OTOM 3KP1E 2G3QA 4LZJA 3PXGA 1SXJE 4NSRA 1QVRA 4JXJA 3DZDA 1GL6A 1IXZA 1QAQA 4LFAM 4DR7M 3HKPA 2JUJA 1R2ZA 1K3WA 2YR0A 1N77A 1L2BA 1L2DA 4WP2A 3FYCA 2QPAA 4QOSA 3SYLA 1E9SA 4DUZM 3FUVA 4P16A 3HJQA 2RGHA 3MK6A 3FRHA 3J81S 5KO3A 3Q8GA 5LMUM 2L6OA 2QENA 2R4JA 1L1TA 2Z7JA 4MGYE 3GLHB 4I8OA 5FTKA 4X62M 3SAUA 1NVMA 4BBAA 3SBJA 2F5PA 1J7KA 4FWHA 2NQ8C 2QZ4A 1IN5A 1QYRA 3A98B 1XHBA 1T6OA 3U6MA 2ZTCA 2FE8A 3EIHA 1VDLA 2LVOC 4NOOB 1T3TA 2W82A 1WJ7A 4FCWA 2LBCA 4S12A 4G4RA 2K0BX 3TWMA 1ZQ9A 2DAGA 1E9RA 2F5SA 1Z5AA 4GITA 2VQFM 4MH0E 4D80A 3CF6E 4CHTB 4B3RM 2BJVA 4Q7JA 3L28A 4GEWA 3HHXA 5EP1A 3GPXA 3GLGE 1K82A 1IN4A 3GLFB 3GRUA 4NRVA 1XXHA 2H1RA 3FYDA 3K1JA 1OFHA 3HHZA 1NJGA 2QNJA 3W68A 2DZLA 1SXJD 2FH0A 2H5XA 2DHYA 2OOAA 4CISA 4OVZA 2K9DA 2VF7A 2YQZA 3J27B 3LQQA 3L27A 1WXQA 3IG5A 3GLFE 4PD2A 4DUYM 2FNAA 1QDTA 2R0IA 2XLJA 2UXBM 2LHCA 1TGUA 2JY8A 3A46A 1YSYA 3B7ZA 1PRBA 3K9OA 4RF0A 3BOSA 2ZTDA 2F5NA 4JI8M 3TWKA 2L7IA 2ZAOA 1W5SA 1WHCA 4NL4H 1KFVA 3SYKA 2R44A 4MGIE 2K6BA 5ITXA 1TH2A 1PJJA 4IIWA 1RU3A 2DWNA 1PM5A 1Z5BA 2L7HA 2DNAA 2OO9A 5EP4A 3GPPA 2OQ4A 4ITQA 1J5EM 1SXJB 3FTDA 2C96A 1J09A 5DFLA 3THGA 2LVQD 3VK8A 2KRKA 2YFQA 2CE7A 1JQJC 4DBGB 1IXSA 3U61B 1FNNA 4JV5M 2JWSA 4LFBM 3DA1A 3HU3A 3U60B 3GP1A 1XMOM 1IBMM 4DV3M 2J7NA 4DV7M 3VDUA 3KOXE 1IY2A 2K47A 2XGNA 5E26A 1Y8GA 2HAKA 2A5YB 3D8LA 4XBOA 2KEBA 1L1ZA 2UU9M 4LJ8A 2DXIA 1IN8A 3QYBA 1XC8A 4LJ6A 1JB0F 3PFIA 4LJ9A 3AL0C 4DR3M 4AKIA 2X4AA 3AJIB 4FD2A 5IZ7D 3RGPA 1QUTA 5EXXA 2ZM6M 4L16A 1HQYE 2MR9A 5JI2E 1TDHA 3M6AA 1BVSA 4DV2M 2CP8A 1D0KA 1JR3E 5KQ8A 1R7RA 4WW0A 2R62A 4B3SM 4REZA 4ZPXA 1NV9A 2CHGA 4YY3M 1NY6A 3L26A 2N35A 3ZQJA 3W67A 4JI7M 2WSCF 3B9PA 3HU2A 3DFZA 4G4OA 2XH9A 4GC9A 3GLGB 3SATA 1GLNA 2HL7A 2KW0A 1Z6TA 4M9SA 1JR3A 2CV2A 4W5WA 3EIEA 4GIPA 3HHWA 2FOIC 3HU1A 4LZZA 4DR2M 1NJFA 2BWEA 2Z8YM 2I7PA 4JI5M 2KXEA 3LQRA 1AUAA 1XXHE 1G59A 1K3XA 3J7AS 2QBYA 1XMQM 5C1BA 1TF0B 3KSJA 4R3DA 5KQDA 1MU5A 3JAMS 3AV0A 2FFJA 4FCVA 2XSZA 4I4LA 2O5RA 4B7FA 2EKKA 1LTMA 3U6EA 3J2PB 4JI0M 1Q02A 1QZMA 2C98A 3I51A 5F3WA 5IT9S 4FVMA 3B7QA 2KRUA 4G6ZA 3GLIB 4B3TM 2BNKA 4LG2A 2KNAA 1XNQM 1VEJA 3D8BA 4IBBA 3WHKA 4DV6M 3T38A 1V33A 4JI2M 1GJSA 5KPTA 5ITQA 3SC3A 1DGHA 2F4VM 2EKFA 3CGWA 4LY6A 5H37D 1OAOC 3R8FA 4X65M 2JZ0A 1W5TA 3GLIE 3T1YM 4LF5M 4GKKM 3M7GA 2VF8A 1MN3A 2M5ZA 5FSWA 1R4GA 4X64M 3U6PA 2KNZA 2KHHA 4L8RC 1TH4A 3F92A 3E4RA 3T6PA 1HNZM 3IHPA 2EA0A 2LVPC 3AOEC 3IG8A 3FUXA 1DV0A
chains in the Genus database with same CATH topology
2V6ZM 4LF9M 2DWLA 4L15A 1LV7A 4B3MM 2QBYB 2CUZA 3T1HM 2LH0A 4TUWA 5EP3A 5ITUA 5EQTA 3MHVC 3U5ZA 4LJ7A 8CATA 4DV5M 1SXJC 4LF8M 2P5TA 5EXSA 1HT1E 4A3VB 3A45A 3M0EA 1NNJA 4YHHM 2CHQA 4NRWA 3W0LB 2UUCM 2DHRA 2EO2A 3K92A 3W0FA 2X49A 2V1UA 2AHMA 1FJGM 1IY0A 2F5QA 1TDZA 4DR1M 3AKZA 5JI3E 3MJ5A 3U6LA 2XZUA 3FTEA 1UM8A 2HKJA 1G8PA 4OX9M 1NHWC 1YE9A 4LRTA 2KZUA 3L25A 3KP0E 2YNMD 2C9CA 2CEAA 3U6DA 1DO0A 5FTLA 1IXSB 4PDIA 1Q3BA 5KPZA 4JI1M 3FUUA 1HR0M 3CF2A 3GQ5A 3SAVA 4EIWA 4G4NA 4CGYB 3Q8XA 4DV1M 3NBIA 3U5ZB 4JN6A 3QWLA 3HHYA 4QHTA 4BB9A 4GH9A 1XWIA 4IBKA 2BJWA 3GPYA 2CHVA 3KSXA 1JR3D 4B7HA 3GLIA 4AKGA 1IN6A 4AQYM 2C9OA 4JYAM 4FCTA 1DGGA 1QQWA 5E6JA 2UUBM 2XFTA 1N33M 4M0WA 4D81A 1R6BX 5ITTA 2XZFA 1N75A 1DGHB 4GRIA 1VDDA 2LNHC 3ILKA 1QANA 1IXRC 1TH3A 1X37A 3UK6A 3VFDA 1NY5A 4KLNA 1XXHB 4DR5M 1N36M 2HCBA 3KXEC 3ZC7B 3FTFA 2XSZD 2Z4SA 1ZAEA 3SARA 4M9XA 3L2AA 1IBLM 3KVWA 4MGZE 4L78A 4OVZB 4JI3M 4QOZC 2QCUA 4DR4M 1HQCA 1GL7A 1N32M 5ITYA 4DV0M 4HL4A 2I7NA 3HGIA 3HJSA 4LJ4A 4LJAA 4G4QA 3KFUG 4DR6M 3CF0A 3GQ4A 2EUCA 2CV0A 4JI6M 3U61A 3AOGA 5FTMA 4PDGA 3R9XB 1D2NA 5DYIA 1ORYB 4QNRA 3VLFB 2DVWB 1S3SA 4MGKE 4FW9A 3VDPA 4PCZA 5KPRA 4NXMM 3J7BA 4MGHA 2Y21A 4M0DA 2L09A 4I81A 1KSFX 3H4MA 4M9ZA 4Z8XA 4FWGA 4PT5A 4X66M 3UGJA 3LMMA 4RF1A 2UXCM 1N78A 2UXDM 3WHLA 3GLHA 2XEPA 4AZFA 2X8AA 4JI4M 2LWXA 3SMSA 2ERCA 5ITXE 1HNXM 3LVWA 2C5RA 4QNMA 1Q3CA 2D7GA 3LVVA 2ZAMA 5LMNM 4MM3B 2CV1A 1OJLA 1GKIA 1N34M 3GRRA 4L4UA 1IQPA 3DOAA 3KDSE 3PNVA 5IREB 1R2YA 4MB7A 4D82A 4B7GA 4GKJM 2QP9X 3U6CA 3FUTA 3T15A 1OFIA 2JA2A 3GRYA 3KOZE 2DWZB 1E32A 3U6OA 1EE8A 2VQEM 1I94M 3TL4X 3K2LA 3CTWB 1NSFA 4FWDA 2ZANA 3TPZA 3TQSA 4DV4M 1KYIA 3GQ3A 2G8LA 5A2QS 4IBIA 1IM2A 5FTJA 2XFSA 4LJ5A 5C18A 3KOWE 2C99A 3GRVA 1Z5CA 4AW4A 3FD9A 3RFWA 4KHPM 1NNUC 2D7HA 1PJIA 1G4AE 1QAMA 3GPUA 7CATA 2Y0QA 4LF4M 3AFHA 1GVNA 1L2CA 3SASA 3PNYA 2R46A 3SMPA 2R18A 4IBEA 1DGBA 5BR8M 4HLQA 3SFZA 1Z59A 3TE6A 3VKGA 4K0KM 2XF3A 1E94E 5FLXS 2CFOA 2Q2EB 2R4EA 3QAUA 1HNWM 3ZH9B 3GO8A 1IN7A 3HWSA 1IBKM 3U60A 3UMMA 3I4VA 4KODA 2DZNB 3I4YA 3U6QA 2DWMA 4IBDA 4KO8A 4II7A 2F5OA 4AG6A 1SXJA 3A42A 2E5LM 2M60A 3UZUA 4NXNM 4AG5A 3UJNA 4GHLA 4QHSA 2Y20A 3KW6A 3JR5A 2HHHM 5EXTA 4AI6A 3ZCBB 5GKNA 2J7OA 3FKEA 1YUBA 5DYGA 4Z6YA 4BLCA 1G3IA 2RKOA 1HT2E 3VK7A 1DGFA 2UUAM 3AOEA 3KOYE 2R45A 2R65A 2VIIA 4IBGA 2D7EA 2G5GX 2LXEA 5EJCA 3GPXA 4I5SA 4RNAA 4LGYA 1G41A 3K8ZA 4NSOB 4R7GA 5EP2A 3RGSA 4LFCM 5FTNA 2ZBKB 5BPVA 1NHGC 4LGMA 4XGIA 2Y0TA 3VKHA 3HJ8A 3FTCA 3KS4A 5DNYA 3SHGB 3SAWA 4GHAA 1QAOA 2Z4RA 3C58A 4GMQA 1I4WA 1MX0A 2V1CA 4IBFA 4IBJA 4IJFA 4LF7M 1Q39A 4GC5A 4B08A 3SHFA 2OPFA 3FUWA 1XNRM 3U6SA 4IBCA 3J80S 2KA6B 3L29A 1L8QA 4OW0A 3JR4A 3GLGA 2Z3XA 1L1ZA 3TWLA 4LF6M 3RE8A 1DO2A 4WURA 2KZSA 3KS8A 3E9SA 1IY1A 2DZOB 3PVSA 5EXPA 1H6UA 5ITRA 2RGOA 4LRSA 4IJEA 3GLFA 1C1KA 4AKHA 5IWAM 3NWLA 4OU7A 3OTOM 4LCBA 3KP1E 4LZJA 3PXGA 1SXJE 4NSRA 1QVRA 4JXJA 3DZDA 1GL6A 1IXZA 1QAQA 4LFAM 4DR7M 3HKPA 1R2ZA 1K3WA 1L2BA 2YR0A 1N77A 1L2DA 3FYCA 2QPAA 4QOSA 3SYLA 1E9SA 4DUZM 3FUVA 4P16A 3HJQA 2RGHA 3MK6A 3J81S 5KO3A 5LMUM 2L6OA 2QENA 2R4JA 1L1TA 2Z7JA 4MGYE 3GLHB 4I8OA 5FTKA 4X62M 3SAUA 1NVMA 4BBAA 3SBJA 2F5PA 1J7KA 4FWHA 2NQ8C 2QZ4A 1IN5A 1QYRA 3A98B 1XHBA 3U6MA 2FE8A 3EIHA 4NOOB 1T3TA 2W82A 4FCWA 4S12A 4G4RA 3TWMA 1ZQ9A 1E9RA 2F5SA 1Z5AA 4GITA 2VQFM 4MH0E 4D80A 3CF6E 4CHTB 4B3RM 2BJVA 3L28A 3HHXA 5EP1A 1K82A 1IN4A 3GLFB 3GRUA 4NRVA 1XXHA 2H1RA 3FYDA 3K1JA 1OFHA 3HHZA 1NJGA 1SXJD 4CISA 4OVZA 2YQZA 3J27B 3LQQA 3L27A 1WXQA 3IG5A 4PD2A 4DUYM 2FNAA 2XLJA 2UXBM 1TGUA 3A46A 1YSYA 4RF0A 3BOSA 2F5NA 4JI8M 3TWKA 2L7IA 2ZAOA 1W5SA 4NL4H 1KFVA 3SYKA 4MGIE 5ITXA 1TH2A 1PJJA 4IIWA 2DWNA 1PM5A 1Z5BA 2L7HA 5EP4A 3GPPA 2OQ4A 4ITQA 1J5EM 1SXJB 3FTDA 2C96A 1J09A 3THGA 3VK8A 2KRKA 2YFQA 2CE7A 1JQJC 3U61B 1FNNA 4JV5M 4LFBM 3DA1A 3HU3A 3U60B 3GP1A 1XMOM 1IBMM 4DV3M 2J7NA 4DV7M 3VDUA 3KOXE 1IY2A 2K47A 2XGNA 5E26A 2A5YB 3D8LA 4XBOA 2KEBA 2UU9M 4LJ8A 2DXIA 1IN8A 1XC8A 4LJ6A 3PFIA 4LJ9A 3AL0C 4DR3M 4AKIA 2X4AA 3AJIB 4FD2A 5IZ7D 3RGPA 5EXXA 2ZM6M 4L16A 1HQYE 5JI2E 1TDHA 3M6AA 4DV2M 5KQ8A 1R7RA 4WW0A 2R62A 4B3SM 4REZA 4ZPXA 2CHGA 4YY3M 1NY6A 3L26A 4JI7M 4G4OA 3B9PA 3HU2A 3DFZA 2XH9A 4GC9A 3GLGB 3SATA 1GLNA 2HL7A 2KW0A 1Z6TA 4M9SA 1JR3A 2CV2A 4W5WA 3EIEA 4GIPA 3HHWA 2FOIC 3HU1A 4LZZA 4DR2M 1NJFA 2I7PA 4JI5M 2KXEA 3LQRA 1G59A 1K3XA 3J7AS 2QBYA 1XMQM 5C1BA 3KSJA 4R3DA 5KQDA 1MU5A 3JAMS 4FCVA 2FFJA 3AV0A 2XSZA 4I4LA 2O5RA 4B7FA 3U6EA 3J2PB 4JI0M 1QZMA 2C98A 3I51A 5F3WA 5IT9S 4FVMA 2KRUA 4G6ZA 3GLIB 4B3TM 2BNKA 4LG2A 1XNQM 3D8BA 4IBBA 3WHKA 4DV6M 3T38A 4JI2M 5KPTA 5ITQA 3SC3A 1DGHA 2F4VM 4LY6A 5H37D 3R8FA 4X65M 3T1YM 1W5TA 4GKKM 4LF5M 3M7GA 2M5ZA 5FSWA 4X64M 3U6PA 4L8RC 1TH4A 3E4RA 1HNZM 2EA0A 3AOEC 3IG8A 3FUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM M;  2ZBK B;  4LF9 M;  1KFV A;  4B3M M;  3T1H M;  5ITX A;  1PJJ A;  5ITU A;  4X66 M;  1PM5 A;  1Z5B A;  2UXC M;  2UXD M;  3SAW A;  3GPP A;  4DV5 M;  2OQ4 A;  4ITQ A;  3C58 A;  1J5E M;  4JI4 M;  4LF8 M;  3A45 A;  1MX0 A;  5ITX E;  1HNX M;  1NNJ A;  3VK8 A;  4LF7 M;  1Q39 A;  4YHH M;  1Q3C A;  4NRW A;  2OPF A;  3TWK A;  1XNR M;  2UUC M;  3U6S A;  3JR4 A;  3J80 S;  1L1Z A;  3W0F A;  5LMN M;  4JV5 M;  4LFB M;  4LF6 M;  3TWL A;  3GP1 A;  1FJG M;  1XMO M;  1N34 M;  1TDZ A;  1IBM M;  4DR1 M;  4DV3 M;  4DV7 M;  2F5Q A;  3DOA A;  3U6L A;  2XZU A;  1R2Y A;  4MB7 A;  5ITR A;  4GKJ M;  3U6C A;  2HKJ A;  2UU9 M;  4OX9 M;  5IWA M;  3U6O A;  1XC8 A;  1EE8 A;  2VQE M;  1I94 M;  4DR3 M;  3OTO M;  3U6D A;  4PDI A;  1Q3B A;  2ZM6 M;  4JI1 M;  4DV4 M;  1HR0 M;  1TDH A;  3GQ5 A;  4DV2 M;  3GQ3 A;  3SAV A;  5A2Q S;  4B3S M;  4LFA M;  4G4N A;  4DR7 M;  1L2B A;  1R2Z A;  1K3W A;  1L2D A;  4DV1 M;  4YY3 M;  1Z5C A;  4JI7 M;  4G4O A;  4KHP M;  4DUZ M;  1PJI A;  3SAT A;  3GPU A;  4LF4 M;  3J81 S;  3GPY A;  1L2C A;  3SAS A;  4DR2 M;  4AQY M;  5LMU M;  4JYA M;  5BR8 M;  1L1T A;  4X62 M;  3SAU A;  4JI5 M;  3SBJ A;  2F5P A;  2UUB M;  1N33 M;  1K3X A;  1Z59 A;  3U6M A;  3J7A S;  5ITT A;  1XMQ M;  2XZF A;  4K0K M;  5FLX S;  2Q2E B;  1MU5 A;  3JAM S;  1HNW M;  3GO8 A;  4G4R A;  3U6E A;  3TWM A;  4JI0 M;  1IBK M;  2F5S A;  1Z5A A;  5IT9 S;  2VQF M;  4DR5 M;  1N36 M;  4B3T M;  3U6Q A;  1XNQ M;  4B3R M;  3SAR A;  4DV6 M;  1IBL M;  4JI2 M;  1K82 A;  4JI3 M;  2F5O A;  5ITQ A;  4DR4 M;  4NRV A;  3A42 A;  2E5L M;  1N32 M;  2F4V M;  4NXN M;  5ITY A;  4DV0 M;  4DR6 M;  4G4Q A;  4X65 M;  3T1Y M;  3JR5 A;  2HHH M;  4GKK M;  4LF5 M;  3GQ4 A;  4CIS A;  4X64 M;  3U6P A;  4JI6 M;  3VK7 A;  2UUA M;  4PD2 A;  4DUY M;  2UXB M;  3GPX A;  3A46 A;  4PDG A;  1HNZ M;  2EA0 A;  4LFC M;  2F5N A;  4JI8 M;  4PCZ A; 
#chains in the Genus database with same CATH topology
 1XB2 B;  2V6Z M;  4LF9 M;  2DAM A;  3FE3 A;  2DWL A;  3E21 A;  1LV7 A;  4L15 A;  2QBY B;  2CUZ A;  3T1H M;  4B3M M;  2LH0 A;  4TUW A;  5EP3 A;  5ITU A;  5EQT A;  2JXN A;  2RRU A;  1UFZ A;  3MHV C;  3U5Z A;  1VG5 A;  4XK8 F;  4LJ7 A;  8CAT A;  1IFY A;  4DV5 M;  1SXJ C;  4L6V 6;  4LF8 M;  2QSF X;  2P5T A;  5EXS A;  1HT1 E;  4A3V B;  3A45 A;  2DI0 A;  2VDB B;  3M0E A;  1NNJ A;  1D0M A;  1D0L A;  3C3D A;  4YHH M;  2CHQ A;  4NRW A;  3W0L B;  2UUC M;  2DHR A;  2EO2 A;  3K92 A;  3W0F A;  1A5T A;  2X49 A;  2V1U A;  2AHM A;  1FJG M;  1IY0 A;  2F5Q A;  1TDZ A;  4DR1 M;  3AKZ A;  5JI3 E;  3MJ5 A;  1QZE A;  3U6L A;  2XZU A;  3FTE A;  2DAK A;  1HJP A;  3C3E A;  4R71 A;  2DEN A;  1UM8 A;  2HKJ A;  3HX3 A;  1G8P A;  4OX9 M;  1NHW C;  1YE9 A;  1G71 A;  2GQF A;  2KZU A;  2WSF F;  4LRT A;  3L25 A;  5L8R F;  3KP0 E;  2APL A;  1ZMW A;  2C9C A;  2CEA A;  2YNM D;  3B89 A;  1DO0 A;  5FTL A;  1IXS B;  4PDI A;  3U6D A;  1Q3B A;  5KPZ A;  1WGN A;  4JI1 M;  3FUU A;  1HR0 M;  3CF2 A;  3GQ5 A;  3SAV A;  4EIW A;  2JY5 A;  4G4N A;  2JY6 B;  4CGY B;  3Q8X A;  4DV1 M;  3NBI A;  4P17 A;  3U5Z B;  4JN6 A;  3QWL A;  2GNO A;  3LCU A;  3HHY A;  4QHT A;  4BB9 A;  4GH9 A;  1XWI A;  3I01 M;  2BJW A;  4IBK A;  3GPY A;  2CHV A;  3KSX A;  1JR3 D;  2BWB A;  4B7H A;  3GLI A;  4AKG A;  1IN6 A;  4AQY M;  2C9O A;  4JYA M;  4FCT A;  1DGG A;  1QUS A;  1QQW A;  2QQ8 A;  5E6J A;  2UUB M;  2XFT A;  1N33 M;  4M0W A;  4D81 A;  1R6B X;  5ITT A;  2XZF A;  1N75 A;  1DGH B;  2CWB A;  3BXW A;  1OAI A;  4GRI A;  2LVA A;  1VDD A;  2LNH C;  3ILK A;  1QAN A;  1IXR C;  1TH3 A;  1X37 A;  3UK6 A;  1C7Y A;  3VFD A;  1NY5 A;  4KLN A;  1XXH B;  4DR5 M;  1N36 M;  2HCB A;  3KXE C;  3ZC7 B;  3FTF A;  2XSZ D;  2Z4S A;  1ZAE A;  3SAR A;  4M9X A;  3QYE A;  1OKS A;  2EJS A;  1WIV A;  3KVW A;  3L2A A;  4MGZ E;  1IBL M;  4L78 A;  4OVZ B;  4JI3 M;  4QOZ C;  2QCU A;  4DR4 M;  1HQC A;  2DAE A;  1GL7 A;  2LHG A;  1N32 M;  5ITY A;  4DV0 M;  4HL4 A;  2I7N A;  3HGI A;  3HJS A;  4LJ4 A;  4LJA A;  4G4Q A;  3KFU G;  4DR6 M;  3B74 A;  3CF0 A;  3GQ4 A;  2EUC A;  2CV0 A;  3E46 A;  4G3O A;  4JI6 M;  3U61 A;  3AOG A;  5FTM A;  4PDG A;  3R9X B;  1D2N A;  2L4F A;  1VEG A;  5DYI A;  1ORY B;  4QNR A;  3VLF B;  1SG9 A;  2DVW B;  1S3S A;  4MGK E;  4FW9 A;  3VDP A;  3FRI A;  4PCZ A;  5KPR A;  4NXM M;  3J7B A;  3BBZ A;  3HY5 A;  4MGH A;  1QDR A;  2Y21 A;  4M0D A;  2KDL A;  2L09 A;  4I81 A;  1KSF X;  3H4M A;  4M9Z A;  4Z8X A;  4FWG A;  4PT5 A;  3B7N A;  4X66 M;  3UGJ A;  3LMM A;  4RF1 A;  2UXC M;  1N78 A;  2UXD M;  3IEC A;  3WHL A;  1OTR A;  2XEP A;  3GLH A;  4AZF A;  2X8A A;  4JI4 M;  2LWX A;  3SMS A;  2ERC A;  1NV8 A;  5ITX E;  1HNX M;  3LVW A;  2C5R A;  3K9P A;  2LTU A;  4QNM A;  1Q3C A;  2D7G A;  2QHO B;  2HWJ A;  1GJT A;  4KT0 F;  3LVV A;  2ZAM A;  5LMN M;  4MM3 B;  2CV1 A;  3LCV B;  1OJL A;  1GKI A;  1N34 M;  1AIP C;  3GRR A;  4L4U A;  1IQP A;  3DOA A;  3KDS E;  3PNV A;  5IRE B;  1R2Y A;  4MB7 A;  4D82 A;  4B7G A;  4GKJ M;  2QP9 X;  3U6C A;  3FUT A;  3T15 A;  1OFI A;  1MJG M;  2JA2 A;  3GRY A;  2MH8 A;  2DWZ B;  1E32 A;  3KOZ E;  1VEK A;  3U6O A;  1EE8 A;  2MGW A;  2VQE M;  1I94 M;  3TL4 X;  3K2L A;  3CTW B;  1NSF A;  4FWD A;  2ZAN A;  3TPZ A;  2DAI A;  3TQS A;  1KYI A;  4DV4 M;  2KNV A;  4CJ6 A;  3GQ3 A;  2G8L A;  5A2Q S;  4IBI A;  1IM2 A;  3MMP A;  2XFS A;  4LJ5 A;  5FTJ A;  5C18 A;  1PJS A;  1P3Q Q;  2O01 F;  3KOW E;  2B3T A;  2C99 A;  3GRV A;  1Z5C A;  1CUK A;  4AW4 A;  3FD9 A;  1PJT A;  3RFW A;  4KHP M;  1NNU C;  2D7H A;  4F1I A;  1GO5 A;  1PJI A;  1G4A E;  1GAB A;  1QAM A;  3GPU A;  7CAT A;  2Y0Q A;  4LF4 M;  4NC6 A;  3AFH A;  1GVN A;  4CIZ A;  1L2C A;  2JZ1 A;  3SAS A;  3PNY A;  2R46 A;  3H4J A;  4UN2 B;  3SMP A;  2R18 A;  1ZMU A;  4IBE A;  1DGB A;  5BR8 M;  4HLQ A;  1OQY A;  3SFZ A;  1Z59 A;  3TE6 A;  3VKG A;  2LVN C;  4K0K M;  2XF3 A;  1E94 E;  5FLX S;  1TTE A;  2CFO A;  2Q2E B;  2R4E A;  2CRU A;  3QAU A;  1HNW M;  3V76 A;  3ZH9 B;  2L4E A;  3GO8 A;  1IN7 A;  3HWS A;  1IBK M;  3U60 A;  3UMM A;  3I4V A;  4KOD A;  1WGL A;  2DZN B;  3I4Y A;  3U6Q A;  2OOB A;  2DWM A;  4IBD A;  4KO8 A;  4II7 A;  2F5O A;  4AG6 A;  1SXJ A;  1VQ1 A;  3A42 A;  2E5L M;  2M60 A;  3UZU A;  2L2D A;  4NXN M;  4AG5 A;  3UJN A;  4GHL A;  1PGY A;  4QHS A;  1PJQ A;  2Y20 A;  3KW6 A;  4HEO A;  3JR5 A;  5EXT A;  2HHH M;  3ZCB B;  4AI6 A;  5GKN A;  2J7O A;  3FKE A;  1YUB A;  5DYG A;  4Z6Y A;  2J5Y A;  4BLC A;  1G3I A;  2RKO A;  1HT2 E;  3VK7 A;  2O25 A;  1DGF A;  4Y28 F;  2UUA M;  3AOE A;  1NO1 A;  3LW5 F;  3KOY E;  1F4I A;  2R45 A;  2WZJ A;  2R65 A;  2VII A;  4IBG A;  2D7E A;  2G5G X;  2LXE A;  2JP7 A;  1OIZ A;  5EJC A;  4I5S A;  4RNA A;  4LGY A;  1G41 A;  3K8Z A;  4NSO B;  4R7G A;  5EP2 A;  4RKU F;  3RGS A;  4LFC M;  3C9P A;  5FTN A;  4ANR A;  2ZBK B;  2DKL A;  5BPV A;  1NHG C;  2MJ5 B;  4F2L A;  1V92 A;  4LGM A;  2WSE F;  4XGI A;  2Y0T A;  3VKH A;  3HJ8 A;  3NBX X;  3FTC A;  1WR1 B;  3KS4 A;  5DNY A;  3HZJ A;  3SHG B;  3SAW A;  1R5L A;  4GHA A;  3GLH E;  1QAO A;  2FS1 A;  2Z4R A;  1EIJ A;  2JNH A;  3C58 A;  4GMQ A;  1I4W A;  1MX0 A;  2V1C A;  4IBF A;  4IBJ A;  1EFU B;  4IJF A;  4LF7 M;  1Q39 A;  4GC5 A;  4B08 A;  1YLA A;  1ZMV A;  2MRO B;  3FUW A;  3SHF A;  2OPF A;  1XNR M;  1ZV1 A;  3U6S A;  4IBC A;  3J80 S;  2KA6 B;  3L29 A;  1L8Q A;  4OW0 A;  3JR4 A;  3GLG A;  2Z3X A;  1OIP A;  3TWL A;  4LF6 M;  3RE8 A;  1DO2 A;  4WUR A;  2KZS A;  1V34 A;  3KS8 A;  3E9S A;  2JY7 A;  1IY1 A;  2DZO B;  1TR8 A;  3PVS A;  5EXP A;  1H6U A;  5ITR A;  2RGO A;  4LRS A;  4IJE A;  3GLF A;  1C1K A;  4AKH A;  2R6F A;  5IWA M;  3NWL A;  4OU7 A;  3I04 M;  1T43 A;  4LCB A;  3OTO M;  3KP1 E;  2G3Q A;  4LZJ A;  3PXG A;  1SXJ E;  4NSR A;  1QVR A;  4JXJ A;  3DZD A;  1GL6 A;  1IXZ A;  1QAQ A;  4LFA M;  4DR7 M;  3HKP A;  2JUJ A;  1R2Z A;  1K3W A;  2YR0 A;  1N77 A;  1L2B A;  1L2D A;  4WP2 A;  3FYC A;  2QPA A;  4QOS A;  3SYL A;  1E9S A;  4DUZ M;  3FUV A;  4P16 A;  3HJQ A;  2RGH A;  3MK6 A;  3FRH A;  3J81 S;  5KO3 A;  3Q8G A;  5LMU M;  2L6O A;  2QEN A;  2R4J A;  1L1T A;  2Z7J A;  4MGY E;  3GLH B;  4I8O A;  5FTK A;  4X62 M;  3SAU A;  1NVM A;  4BBA A;  3SBJ A;  2F5P A;  1J7K A;  4FWH A;  2NQ8 C;  2QZ4 A;  1IN5 A;  1QYR A;  3A98 B;  1XHB A;  1T6O A;  3U6M A;  2ZTC A;  2FE8 A;  3EIH A;  1VDL A;  2LVO C;  4NOO B;  1T3T A;  2W82 A;  1WJ7 A;  4FCW A;  2LBC A;  4S12 A;  4G4R A;  2K0B X;  3TWM A;  1ZQ9 A;  2DAG A;  1E9R A;  2F5S A;  1Z5A A;  4GIT A;  2VQF M;  4MH0 E;  4D80 A;  3CF6 E;  4CHT B;  4B3R M;  2BJV A;  4Q7J A;  3L28 A;  4GEW A;  3HHX A;  5EP1 A;  3GPX A;  3GLG E;  1K82 A;  1IN4 A;  3GLF B;  3GRU A;  4NRV A;  1XXH A;  2H1R A;  3FYD A;  3K1J A;  1OFH A;  3HHZ A;  1NJG A;  2QNJ A;  3W68 A;  2DZL A;  1SXJ D;  2FH0 A;  2H5X A;  2DHY A;  2OOA A;  4CIS A;  4OVZ A;  2K9D A;  2VF7 A;  2YQZ A;  3J27 B;  3LQQ A;  3L27 A;  1WXQ A;  3IG5 A;  3GLF E;  4PD2 A;  4DUY M;  2FNA A;  1QDT A;  2R0I A;  2XLJ A;  2UXB M;  2LHC A;  1TGU A;  2JY8 A;  3A46 A;  1YSY A;  3B7Z A;  1PRB A;  3K9O A;  4RF0 A;  3BOS A;  2ZTD A;  2F5N A;  4JI8 M;  3TWK A;  2L7I A;  2ZAO A;  1W5S A;  1WHC A;  4NL4 H;  1KFV A;  3SYK A;  2R44 A;  4MGI E;  2K6B A;  5ITX A;  1TH2 A;  1PJJ A;  4IIW A;  1RU3 A;  2DWN A;  1PM5 A;  1Z5B A;  2L7H A;  2DNA A;  2OO9 A;  5EP4 A;  3GPP A;  2OQ4 A;  4ITQ A;  1J5E M;  1SXJ B;  3FTD A;  2C96 A;  1J09 A;  5DFL A;  3THG A;  2LVQ D;  3VK8 A;  2KRK A;  2YFQ A;  2CE7 A;  1JQJ C;  4DBG B;  1IXS A;  3U61 B;  1FNN A;  4JV5 M;  2JWS A;  4LFB M;  3DA1 A;  3HU3 A;  3U60 B;  3GP1 A;  1XMO M;  1IBM M;  4DV3 M;  2J7N A;  4DV7 M;  3VDU A;  3KOX E;  1IY2 A;  2K47 A;  2XGN A;  5E26 A;  1Y8G A;  2HAK A;  2A5Y B;  3D8L A;  4XBO A;  2KEB A;  1L1Z A;  2UU9 M;  4LJ8 A;  2DXI A;  1IN8 A;  3QYB A;  1XC8 A;  4LJ6 A;  1JB0 F;  3PFI A;  4LJ9 A;  3AL0 C;  4DR3 M;  4AKI A;  2X4A A;  3AJI B;  4FD2 A;  5IZ7 D;  3RGP A;  1QUT A;  5EXX A;  2ZM6 M;  4L16 A;  1HQY E;  2MR9 A;  5JI2 E;  1TDH A;  3M6A A;  1BVS A;  4DV2 M;  2CP8 A;  1D0K A;  1JR3 E;  5KQ8 A;  1R7R A;  4WW0 A;  2R62 A;  4B3S M;  4REZ A;  4ZPX A;  1NV9 A;  2CHG A;  4YY3 M;  1NY6 A;  3L26 A;  2N35 A;  3ZQJ A;  3W67 A;  4JI7 M;  2WSC F;  3B9P A;  3HU2 A;  3DFZ A;  4G4O A;  2XH9 A;  4GC9 A;  3GLG B;  3SAT A;  1GLN A;  2HL7 A;  2KW0 A;  1Z6T A;  4M9S A;  1JR3 A;  2CV2 A;  4W5W A;  3EIE A;  4GIP A;  3HHW A;  2FOI C;  3HU1 A;  4LZZ A;  4DR2 M;  1NJF A;  2BWE A;  2Z8Y M;  2I7P A;  4JI5 M;  2KXE A;  3LQR A;  1AUA A;  1XXH E;  1G59 A;  1K3X A;  3J7A S;  2QBY A;  1XMQ M;  5C1B A;  1TF0 B;  3KSJ A;  4R3D A;  5KQD A;  1MU5 A;  3JAM S;  3AV0 A;  2FFJ A;  4FCV A;  2XSZ A;  4I4L A;  2O5R A;  4B7F A;  2EKK A;  1LTM A;  3U6E A;  3J2P B;  4JI0 M;  1Q02 A;  1QZM A;  2C98 A;  3I51 A;  5F3W A;  5IT9 S;  4FVM A;  3B7Q A;  2KRU A;  4G6Z A;  3GLI B;  4B3T M;  2BNK A;  4LG2 A;  2KNA A;  1XNQ M;  1VEJ A;  3D8B A;  4IBB A;  3WHK A;  4DV6 M;  3T38 A;  1V33 A;  4JI2 M;  1GJS A;  5KPT A;  5ITQ A;  3SC3 A;  1DGH A;  2F4V M;  2EKF A;  3CGW A;  4LY6 A;  5H37 D;  1OAO C;  3R8F A;  4X65 M;  2JZ0 A;  1W5T A;  3GLI E;  3T1Y M;  4LF5 M;  4GKK M;  3M7G A;  2VF8 A;  1MN3 A;  2M5Z A;  5FSW A;  1R4G A;  4X64 M;  3U6P A;  2KNZ A;  2KHH A;  4L8R C;  1TH4 A;  3F92 A;  3E4R A;  3T6P A;  1HNZ M;  3IHP A;  2EA0 A;  2LVP C;  3AOE C;  3IG8 A;  3FUX A;  1DV0 A; 
#chains in the Genus database with same CATH homology
 2V6Z M;  4LF9 M;  2DWL A;  4L15 A;  1LV7 A;  4B3M M;  2QBY B;  2CUZ A;  3T1H M;  2LH0 A;  4TUW A;  5EP3 A;  5ITU A;  5EQT A;  3MHV C;  3U5Z A;  4LJ7 A;  8CAT A;  4DV5 M;  1SXJ C;  4LF8 M;  2P5T A;  5EXS A;  1HT1 E;  4A3V B;  3A45 A;  3M0E A;  1NNJ A;  4YHH M;  2CHQ A;  4NRW A;  3W0L B;  2UUC M;  2DHR A;  2EO2 A;  3K92 A;  3W0F A;  2X49 A;  2V1U A;  2AHM A;  1FJG M;  1IY0 A;  2F5Q A;  1TDZ A;  4DR1 M;  3AKZ A;  5JI3 E;  3MJ5 A;  3U6L A;  2XZU A;  3FTE A;  1UM8 A;  2HKJ A;  1G8P A;  4OX9 M;  1NHW C;  1YE9 A;  4LRT A;  2KZU A;  3L25 A;  3KP0 E;  2YNM D;  2C9C A;  2CEA A;  3U6D A;  1DO0 A;  5FTL A;  1IXS B;  4PDI A;  1Q3B A;  5KPZ A;  4JI1 M;  3FUU A;  1HR0 M;  3CF2 A;  3GQ5 A;  3SAV A;  4EIW A;  4G4N A;  4CGY B;  3Q8X A;  4DV1 M;  3NBI A;  3U5Z B;  4JN6 A;  3QWL A;  3HHY A;  4QHT A;  4BB9 A;  4GH9 A;  1XWI A;  4IBK A;  2BJW A;  3GPY A;  2CHV A;  3KSX A;  1JR3 D;  4B7H A;  3GLI A;  4AKG A;  1IN6 A;  4AQY M;  2C9O A;  4JYA M;  4FCT A;  1DGG A;  1QQW A;  5E6J A;  2UUB M;  2XFT A;  1N33 M;  4M0W A;  4D81 A;  1R6B X;  5ITT A;  2XZF A;  1N75 A;  1DGH B;  4GRI A;  1VDD A;  2LNH C;  3ILK A;  1QAN A;  1IXR C;  1TH3 A;  1X37 A;  3UK6 A;  3VFD A;  1NY5 A;  4KLN A;  1XXH B;  4DR5 M;  1N36 M;  2HCB A;  3KXE C;  3ZC7 B;  3FTF A;  2XSZ D;  2Z4S A;  1ZAE A;  3SAR A;  4M9X A;  3L2A A;  1IBL M;  3KVW A;  4MGZ E;  4L78 A;  4OVZ B;  4JI3 M;  4QOZ C;  2QCU A;  4DR4 M;  1HQC A;  1GL7 A;  1N32 M;  5ITY A;  4DV0 M;  4HL4 A;  2I7N A;  3HGI A;  3HJS A;  4LJ4 A;  4LJA A;  4G4Q A;  3KFU G;  4DR6 M;  3CF0 A;  3GQ4 A;  2EUC A;  2CV0 A;  4JI6 M;  3U61 A;  3AOG A;  5FTM A;  4PDG A;  3R9X B;  1D2N A;  5DYI A;  1ORY B;  4QNR A;  3VLF B;  2DVW B;  1S3S A;  4MGK E;  4FW9 A;  3VDP A;  4PCZ A;  5KPR A;  4NXM M;  3J7B A;  4MGH A;  2Y21 A;  4M0D A;  2L09 A;  4I81 A;  1KSF X;  3H4M A;  4M9Z A;  4Z8X A;  4FWG A;  4PT5 A;  4X66 M;  3UGJ A;  3LMM A;  4RF1 A;  2UXC M;  1N78 A;  2UXD M;  3WHL A;  3GLH A;  2XEP A;  4AZF A;  2X8A A;  4JI4 M;  2LWX A;  3SMS A;  2ERC A;  5ITX E;  1HNX M;  3LVW A;  2C5R A;  4QNM A;  1Q3C A;  2D7G A;  3LVV A;  2ZAM A;  5LMN M;  4MM3 B;  2CV1 A;  1OJL A;  1GKI A;  1N34 M;  3GRR A;  4L4U A;  1IQP A;  3DOA A;  3KDS E;  3PNV A;  5IRE B;  1R2Y A;  4MB7 A;  4D82 A;  4B7G A;  4GKJ M;  2QP9 X;  3U6C A;  3FUT A;  3T15 A;  1OFI A;  2JA2 A;  3GRY A;  3KOZ E;  2DWZ B;  1E32 A;  3U6O A;  1EE8 A;  2VQE M;  1I94 M;  3TL4 X;  3K2L A;  3CTW B;  1NSF A;  4FWD A;  2ZAN A;  3TPZ A;  3TQS A;  4DV4 M;  1KYI A;  3GQ3 A;  2G8L A;  5A2Q S;  4IBI A;  1IM2 A;  5FTJ A;  2XFS A;  4LJ5 A;  5C18 A;  3KOW E;  2C99 A;  3GRV A;  1Z5C A;  4AW4 A;  3FD9 A;  3RFW A;  4KHP M;  1NNU C;  2D7H A;  1PJI A;  1G4A E;  1QAM A;  3GPU A;  7CAT A;  2Y0Q A;  4LF4 M;  3AFH A;  1GVN A;  1L2C A;  3SAS A;  3PNY A;  2R46 A;  3SMP A;  2R18 A;  4IBE A;  1DGB A;  5BR8 M;  4HLQ A;  3SFZ A;  1Z59 A;  3TE6 A;  3VKG A;  4K0K M;  2XF3 A;  1E94 E;  5FLX S;  2CFO A;  2Q2E B;  2R4E A;  3QAU A;  1HNW M;  3ZH9 B;  3GO8 A;  1IN7 A;  3HWS A;  1IBK M;  3U60 A;  3UMM A;  3I4V A;  4KOD A;  2DZN B;  3I4Y A;  3U6Q A;  2DWM A;  4IBD A;  4KO8 A;  4II7 A;  2F5O A;  4AG6 A;  1SXJ A;  3A42 A;  2E5L M;  2M60 A;  3UZU A;  4NXN M;  4AG5 A;  3UJN A;  4GHL A;  4QHS A;  2Y20 A;  3KW6 A;  3JR5 A;  2HHH M;  5EXT A;  4AI6 A;  3ZCB B;  5GKN A;  2J7O A;  3FKE A;  1YUB A;  5DYG A;  4Z6Y A;  4BLC A;  1G3I A;  2RKO A;  1HT2 E;  3VK7 A;  1DGF A;  2UUA M;  3AOE A;  3KOY E;  2R45 A;  2R65 A;  2VII A;  4IBG A;  2D7E A;  2G5G X;  2LXE A;  5EJC A;  3GPX A;  4I5S A;  4RNA A;  4LGY A;  1G41 A;  3K8Z A;  4NSO B;  4R7G A;  5EP2 A;  3RGS A;  4LFC M;  5FTN A;  2ZBK B;  5BPV A;  1NHG C;  4LGM A;  4XGI A;  2Y0T A;  3VKH A;  3HJ8 A;  3FTC A;  3KS4 A;  5DNY A;  3SHG B;  3SAW A;  4GHA A;  1QAO A;  2Z4R A;  3C58 A;  4GMQ A;  1I4W A;  1MX0 A;  2V1C A;  4IBF A;  4IBJ A;  4IJF A;  4LF7 M;  1Q39 A;  4GC5 A;  4B08 A;  3SHF A;  2OPF A;  3FUW A;  1XNR M;  3U6S A;  4IBC A;  3J80 S;  2KA6 B;  3L29 A;  1L8Q A;  4OW0 A;  3JR4 A;  3GLG A;  2Z3X A;  1L1Z A;  3TWL A;  4LF6 M;  3RE8 A;  1DO2 A;  4WUR A;  2KZS A;  3KS8 A;  3E9S A;  1IY1 A;  2DZO B;  3PVS A;  5EXP A;  1H6U A;  5ITR A;  2RGO A;  4LRS A;  4IJE A;  3GLF A;  1C1K A;  4AKH A;  5IWA M;  3NWL A;  4OU7 A;  3OTO M;  4LCB A;  3KP1 E;  4LZJ A;  3PXG A;  1SXJ E;  4NSR A;  1QVR A;  4JXJ A;  3DZD A;  1GL6 A;  1IXZ A;  1QAQ A;  4LFA M;  4DR7 M;  3HKP A;  1R2Z A;  1K3W A;  1L2B A;  2YR0 A;  1N77 A;  1L2D A;  3FYC A;  2QPA A;  4QOS A;  3SYL A;  1E9S A;  4DUZ M;  3FUV A;  4P16 A;  3HJQ A;  2RGH A;  3MK6 A;  3J81 S;  5KO3 A;  5LMU M;  2L6O A;  2QEN A;  2R4J A;  1L1T A;  2Z7J A;  4MGY E;  3GLH B;  4I8O A;  5FTK A;  4X62 M;  3SAU A;  1NVM A;  4BBA A;  3SBJ A;  2F5P A;  1J7K A;  4FWH A;  2NQ8 C;  2QZ4 A;  1IN5 A;  1QYR A;  3A98 B;  1XHB A;  3U6M A;  2FE8 A;  3EIH A;  4NOO B;  1T3T A;  2W82 A;  4FCW A;  4S12 A;  4G4R A;  3TWM A;  1ZQ9 A;  1E9R A;  2F5S A;  1Z5A A;  4GIT A;  2VQF M;  4MH0 E;  4D80 A;  3CF6 E;  4CHT B;  4B3R M;  2BJV A;  3L28 A;  3HHX A;  5EP1 A;  1K82 A;  1IN4 A;  3GLF B;  3GRU A;  4NRV A;  1XXH A;  2H1R A;  3FYD A;  3K1J A;  1OFH A;  3HHZ A;  1NJG A;  1SXJ D;  4CIS A;  4OVZ A;  2YQZ A;  3J27 B;  3LQQ A;  3L27 A;  1WXQ A;  3IG5 A;  4PD2 A;  4DUY M;  2FNA A;  2XLJ A;  2UXB M;  1TGU A;  3A46 A;  1YSY A;  4RF0 A;  3BOS A;  2F5N A;  4JI8 M;  3TWK A;  2L7I A;  2ZAO A;  1W5S A;  4NL4 H;  1KFV A;  3SYK A;  4MGI E;  5ITX A;  1TH2 A;  1PJJ A;  4IIW A;  2DWN A;  1PM5 A;  1Z5B A;  2L7H A;  5EP4 A;  3GPP A;  2OQ4 A;  4ITQ A;  1J5E M;  1SXJ B;  3FTD A;  2C96 A;  1J09 A;  3THG A;  3VK8 A;  2KRK A;  2YFQ A;  2CE7 A;  1JQJ C;  3U61 B;  1FNN A;  4JV5 M;  4LFB M;  3DA1 A;  3HU3 A;  3U60 B;  3GP1 A;  1XMO M;  1IBM M;  4DV3 M;  2J7N A;  4DV7 M;  3VDU A;  3KOX E;  1IY2 A;  2K47 A;  2XGN A;  5E26 A;  2A5Y B;  3D8L A;  4XBO A;  2KEB A;  2UU9 M;  4LJ8 A;  2DXI A;  1IN8 A;  1XC8 A;  4LJ6 A;  3PFI A;  4LJ9 A;  3AL0 C;  4DR3 M;  4AKI A;  2X4A A;  3AJI B;  4FD2 A;  5IZ7 D;  3RGP A;  5EXX A;  2ZM6 M;  4L16 A;  1HQY E;  5JI2 E;  1TDH A;  3M6A A;  4DV2 M;  5KQ8 A;  1R7R A;  4WW0 A;  2R62 A;  4B3S M;  4REZ A;  4ZPX A;  2CHG A;  4YY3 M;  1NY6 A;  3L26 A;  4JI7 M;  4G4O A;  3B9P A;  3HU2 A;  3DFZ A;  2XH9 A;  4GC9 A;  3GLG B;  3SAT A;  1GLN A;  2HL7 A;  2KW0 A;  1Z6T A;  4M9S A;  1JR3 A;  2CV2 A;  4W5W A;  3EIE A;  4GIP A;  3HHW A;  2FOI C;  3HU1 A;  4LZZ A;  4DR2 M;  1NJF A;  2I7P A;  4JI5 M;  2KXE A;  3LQR A;  1G59 A;  1K3X A;  3J7A S;  2QBY A;  1XMQ M;  5C1B A;  3KSJ A;  4R3D A;  5KQD A;  1MU5 A;  3JAM S;  4FCV A;  2FFJ A;  3AV0 A;  2XSZ A;  4I4L A;  2O5R A;  4B7F A;  3U6E A;  3J2P B;  4JI0 M;  1QZM A;  2C98 A;  3I51 A;  5F3W A;  5IT9 S;  4FVM A;  2KRU A;  4G6Z A;  3GLI B;  4B3T M;  2BNK A;  4LG2 A;  1XNQ M;  3D8B A;  4IBB A;  3WHK A;  4DV6 M;  3T38 A;  4JI2 M;  5KPT A;  5ITQ A;  3SC3 A;  1DGH A;  2F4V M;  4LY6 A;  5H37 D;  3R8F A;  4X65 M;  3T1Y M;  1W5T A;  4GKK M;  4LF5 M;  3M7G A;  2M5Z A;  5FSW A;  4X64 M;  3U6P A;  4L8R C;  1TH4 A;  3E4R A;  1HNZ M;  2EA0 A;  3AOE C;  3IG8 A;  3FUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...