2OOBA

Crystal structure of the uba domain from cbl-b ubiquitin ligase in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
b'LENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2oobA00
1T43A 2DAEA 2LVPC 2QSFX 2DKLA 1VDLA 1WR1B 1HT2E 4HEOA 1Q02A 1MN3A 1TTEA 1VEJA 2K0BX 1NV8A 2JUJA 2OOAA 2EKFA 2MROB 3F92A 1VG5A 2EJSA 2DENA 2OO9A 1WIVA 1VEKA 2BWBA 2HWJA 4F1IA 3GLFE 3MMPA 1WGNA 5JI2E 1BVSA 1T6OA 1QZEA 1UFZA 2DAMA 1ZMWA 2DI0A 2JY5A 2L2DA 2MGWA 1HT1E 4G3OA 2L4FA 1G4AE 2LBCA 3FE3A 3LCUA 1IXSA 2JZ1A 3B89A 2MJ5B 2QHOB 2QNJA 2JY6B 3E46A 4GEWA 1YLAA 2K9DA 2ZTDA 2KNZA 1NV9A 2OOBA 2JZ0A 3GLIE 2DHYA 1SG9A 1WJ7A 1Y8GA 1IFYA 2BWEA 1KYIA 2KNVA 3T6PA 2HAKA 1CUKA 2DAGA 3FRHA 1ZMVA 2JY7A 3H4JA 1G3IA 2JNHA 4DBGB 2CWBA 1F4IA 2DAKA 4Q7JA 2O25A 3FRIA 1ZV1A 1G41A 2G3QA 1E94E 2KHHA 2LVOC 1ZMUA 2ZTCA 3E21A 2DNAA 1R4GA 1PGYA 3IECA 3LCVB 1JR3E 2LVNC 1WHCA 2B3TA 1V92A 2H5XA 1VQ1A 4R71A 1WGLA 3K9OA 1C7YA 2LTUA 1AIPC 2JP7A 2DAIA 4WP2A 2KNAA 2JY8A 2LVQD 1A5TA 1DV0A 1XB2B 3GLHE 1OAIA 2CP8A 3K9PA 2EKKA 1VEGA 5DFLA 1EFUB 3BBZA 1HQYE 2RRUA 1OKSA 2R0IA 1DO2A 2L4EA 1OTRA 3IHPA 1IM2A 2MR9A 2DZLA 1DO0A 1TR8A 1XXHE 1P3QQ 2LVAA 2WZJA 3GLGE 1OQYA 4F2LA 1HJPA 4UN2B 1GO5A
chains in the Genus database with same CATH superfamily
1H6UA 2LVPC 1IXRC 1Z5AA 3H4MA 2QZ4A 1WR1B 1HT2E 1NJGA 1Q02A 3KOZE 4FWHA 4NRWA 1WXQA 3JR5A 3JAMS 3I4YA 2J5YA 3R8FA 4K0KM 1IY0A 2W82A 1NV8A 2JUJA 4JI1M 1J09A 2R4EA 1QUTA 4YHHM 3U6MA 2UXCM 3F92A 4IBBA 3SARA 2DENA 2XFSA 1K82A 4EIWA 3NBIA 4F1IA 3B7QA 4L15A 3LVWA 5F3WA 3VDUA 4LZZA 3FTCA 3RGPA 1T6OA 3VKGA 2P5TA 2QP9X 2JY5A 4LFAM 3VK7A 2MGWA 1HT1E 3SBJA 1NHWC 3D8BA 4D81A 2F4VM 2RGHA 2F5QA 4MGYE 4W5WA 5C1BA 3U6DA 1DGHA 4YY3M 1IXSA 1IY2A 2LNHC 4BLCA 3JR4A 4L8RC 4MH0E 2ZTDA 1PRBA 3GLIE 1NSFA 5LMUM 2LH0A 1NO1A 2DHYA 2LHGA 3AJIB 1SXJE 1WJ7A 3HX3A 4IBFA 3UZUA 3KOWE 5H37D 2DZOB 1HR0M 1W5TA 4L78A 1K3WA 4G4NA 4X62M 4BB9A 3QYEA 1Q3CA 2HKJA 3QAUA 2XLJA 1GABA 2RKOA 1XXHB 3KVWA 5ITYA 2GNOA 3GLGA 2VQFM 4ANRA 4DR4M 1F4IA 2DAKA 1OIZA 4Q7JA 2F5SA 2XSZA 5FTNA 4B3SM 3HY5A 2LVOC 3K1JA 3E21A 2N35A 1I4WA 4MGKE 2UUCM 4B7GA 1DGHB 4DV6M 1IXSB 5ITQA 1GLNA 2DWMA 1PJSA 2C9CA 2R62A 1N78A 2KZSA 3TL4X 3DOAA 4GRIA 4NXMM 3L29A 1VQ1A 2JXNA 3AOEC 1R2ZA 4DR1M 4REZA 3FD9A 4CHTB 3J2PB 3K9OA 2VF7A 2V6ZM 4IJEA 4MGHA 4JYAM 2LTUA 3LVVA 3TE6A 2JP7A 1E9SA 2KNAA 2ZANA 2LVQD 4B08A 4LCBA 2C99A 2DWZB 1R7RA 3SFZA 1V33A 3ZCBB 3K2LA 4PDIA 3GLGB 4FD2A 3GLHE 3KP1E 1YE9A 2EA0A 3C9PA 2DVWB 3SMPA 3J81S 1KSFX 4AQYM 4LF6M 3B74A 4IBIA 3BBZA 1HQYE 4LFCM 2X4AA 1OKSA 4DV5M 1JR3D 4JI2M 2Y21A 1D2NA 2Y0TA 3A45A 3GLIA 1EIJA 4PDGA 1IXZA 1TGUA 4LRTA 1SXJA 3DZDA 1TR8A 1XXHE 1GKIA 1P3QQ 4JI0M 4AKIA 1KFVA 2HL7A 3HJQA 2LVAA 3U61A 1OJLA 5KQ8A 4M9SA 4JI6M 1N75A 3KP0E 3AKZA 3WHKA 5BPVA 1G59A 3GRRA 1TH4A 3LMMA 3THGA 4DR6M 3SYLA 4TUWA 3R9XB 3FUWA 3J80S 3FUXA 2KXEA 4A3VB 1T43A 1IY1A 3HU3A 1YSYA 4L6V6 4MB7A 3HHYA 2KZUA 2A5YB 2O01F 3Q8GA 2Z7JA 4GKJM 2CHGA 4NXNM 2KDLA 1TTEA 1VEJA 2K0BX 4KT0F 3LW5F 2EKFA 1TDZA 1PJTA 5L8RF 1XHBA 2EJSA 3EIHA 3HGIA 2G5GX 1XMOM 4PD2A 1W5SA 3PFIA 3T15A 3GLIB 4LF4M 3GLFE 2BNKA 2K6BA 4JI4M 1NVMA 1SXJB 3CF6E 3GQ5A 2DHRA 4M0WA 1UFZA 4FW9A 2DAMA 1NNJA 3LQRA 3U61B 1Z59A 3CGWA 1EE8A 1N77A 2L4FA 2UXBM 4LGMA 3KW6A 1IN4A 3LCUA 4L16A 1NHGC 2JZ1A 2R4JA 4DV7M 2QHOB 3U6SA 2QNJA 2JY6B 4LJ7A 3GLHA 3IG5A 1IN6A 1YLAA 2K9DA 4X65M 2KNZA 3T1YM 3IG8A 2JZ0A 3U6PA 3HHXA 3SHFA 1N36M 1L1TA 1Y8GA 5FTKA 4CJ6A 2K47A 1UM8A 2BWEA 2Z4SA 3L28A 5ITRA 4I8OA 5GKNA 1DGBA 2KNVA 4DUZM 4LF9M 1GL6A 1PJJA 5FLXS 3UGJA 4NRVA 4PT5A 3RFWA 1Z6TA 1ZMVA 2JY7A 1XXHA 3H4JA 4I4LA 3PVSA 4XGIA 2VF8A 2JNHA 5FTMA 4JI8M 4RF0A 1IQPA 1TH2A 3UMMA 4OW0A 2O25A 1N34M 3BOSA 1ZV1A 1G41A 3FKEA 2QPAA 3FRIA 4QHTA 2KHHA 4I81A 2E5LM 2F5OA 5FSWA 3SAUA 4GHLA 1QQWA 2DZNB 3WHLA 1R4GA 5KPTA 1PGYA 1OFHA 2L7HA 4JN6A 1S3SA 1JR3E 3DFZA 3VFDA 4NSOB 1FNNA 3B9PA 1IBKM 3GLHB 3KS8A 4I5SA 2B3TA 2Y20A 3AL0C 4M9ZA 1PM5A 2ZAMA 2L09A 3GPPA 3I04M 4G4QA 1IN7A 1XWIA 1WGLA 3UK6A 1T3TA 4RNAA 4FWGA 3W0FA 1C7YA 1PJIA 3HJSA 3GLFA 4GHAA 4QHSA 1V34A 1A5TA 5KO3A 2L6OA 2KRUA 1XB2B 1MJGM 4JV5M 4LFBM 3GQ3A 1XC8A 2NQ8C 4JI5M 2CP8A 3V76A 1GJTA 1VEGA 1I94M 2XEPA 1L2BA 3K8ZA 1MU5A 1X37A 4KO8A 2CHVA 4IBDA 5E6JA 4HL4A 1DO2A 1G71A 1OTRA 3KS4A 2MR9A 3VLFB 5KPZA 1D0MA 3U6EA 4II7A 4OU7A 1DO0A 5FTJA 4B7FA 1XNRM 4AG5A 2O5RA 1J5EM 4M9XA 2WZJA 4AKGA 3E9SA 4FCWA 3TWKA 1J7KA 4R3DA 5DNYA 3GLFB 1HNXM 2L7IA 4JI3M 1L2DA 3M6AA 2KRKA 4RKUF 2C5RA 2J7OA 1Q3BA 2DKLA 4HEOA 3U6OA 4KHPM 3GO8A 1MN3A 4P16A 4IBEA 3SATA 1ZQ9A 3HHWA 1NY5A 3PXGA 2OOAA 3GRYA 1JR3A 3KOXE 2MROB 3QYBA 3GPUA 3ZC7B 3AOEA 1VG5A 2OO9A 2XGNA 2KA6B 1WIVA 1SXJC 1VEKA 2HWJA 5IREB 2QBYA 3M7GA 3MMPA 1WGNA 2OPFA 1Z5CA 4AKHA 1BVSA 4CIZA 2DI0A 5EP3A 3TWMA 2YFQA 3PNYA 3HWSA 4JI7M 2LBCA 1YUBA 5FTLA 1D0LA 5ITXA 2DWLA 5DYIA 2QENA 2WSEF 3U5ZA 2DWNA 1QZMA 1C1KA 3LQQA 1PJQA 3E46A 4LJ8A 5EJCA 4G6ZA 2OOBA 4D80A 2XZFA 4WW0A 4NSRA 4FCVA 1SG9A 2UUBM 4DR3M 1VDDA 2D7HA 4RF1A 5ITTA 3CF2A 4DR7M 4R7GA 1KYIA 3TWLA 4B3RM 3I51A 2CV2A 2XF3A 3DA1A 5BR8M 1NNUC 3FUTA 2QBYB 2R46A 3KDSE 3T6PA 2HAKA 2M5ZA 1CUKA 4IBGA 5EQTA 3HKPA 3OTOM 3RGSA 4G4OA 1G3IA 4B7HA 4B3TM 1Q39A 2D7EA 1RU3A 4MM3B 4GC9A 5IZ7D 4DBGB 4DR5M 1IBLM 1K3XA 3VKHA 1IBMM 2ZM6M 4LJ4A 3FTDA 2Z4RA 3QWLA 2X8AA 3AOGA 2G3QA 1E94E 3L25A 4BBAA 1ZMUA 5KPRA 2BJWA 3IECA 3E4RA 3LCVB 3TPZA 5EP2A 3U5ZB 3ZH9B 2F5NA 2JWSA 4JXJA 4QOSA 4FCTA 1GVNA 3TQSA 4LF8M 1WHCA 7CATA 1OAOC 2H5XA 3VK8A 3SAVA 4Y28F 5EXTA 4R71A 2LHCA 3GRVA 1HNZM 2C98A 2BJVA 4MGZE 2X49A 3J7AS 3EIEA 3U6QA 3D8LA 1NJFA 4HLQA 5C18A 1R2YA 4QNMA 4GIPA 3GPXA 3W67A 1DV0A 1ORYB 3GRUA 4DUYM 3SMSA 4Z6YA 4IBKA 2HCBA 3B7ZA 4OX9M 4D82A 4LF7M 3BXWA 2EKKA 3NWLA 4GC5A 4LY6A 4OVZB 4DR2M 2AHMA 1QANA 2FS1A 3W0LB 5E26A 4Z8XA 2C96A 4WURA 2R0IA 3PNVA 2OQ4A 2L4EA 3IHPA 1LTMA 3MJ5A 1IM2A 3A42A 1QVRA 2HHHM 1N33M 4IIWA 2R6FA 4FVMA 4XBOA 4QOZC 3GQ4A 2EO2A 4GKKM 1GL7A 5JI3E 2YR0A 3U60A 2QCUA 4AZFA 3MHVC 5IWAM 4X66M 1OIPA 1DGFA 1TDHA 2ERCA 1QDRA 3ZQJA 3U6LA 3I4VA 2LWXA 1D0KA 4AW4A 4UN2B 5ITXE 5EP1A 1QAQA 3L26A 4DV0M 2DAEA 2YNMD 1GJSA 2UXDM 2QSFX 3KSXA 1VDLA 2R45A 4GITA 1L1ZA 1L8QA 2LXEA 2Z8YM 4LRSA 4AI6A 2Z3XA 3SYKA 3FYDA 5IT9S 4DV4M 4LJ9A 2ZBKB 2RGOA 2BWBA 4LJ5A 3J7BA 4P17A 3L27A 1XMQM 1AUAA 5JI2E 3SHGB 2UU9M 2JA2A 4NC6A 1HQCA 1TH3A 4MGIE 3SASA 3MK6A 4G4RA 2FH0A 1MX0A 1QZEA 2CE7A 4NL4H 1QDTA 1ZMWA 3U60B 2L2DA 2I7PA 3C3DA 4G3OA 3GPYA 3C3EA 5ITUA 1TF0B 3ILKA 1G4AE 3FUVA 3FE3A 3FYCA 2XSZD 4QNRA 3B89A 2KEBA 2MJ5B 4IBCA 3RE8A 3GP1A 2QQ8A 2FNAA 2C9OA 3KXEC 4GEWA 5EP4A 2KW0A 1IN5A 3VDPA 4LG2A 2APLA 1NV9A 2ZAOA 5EXXA 1E32A 4GH9A 2GQFA 2MH8A 4ZPXA 3SC3A 1IFYA 1R6BX 3A98B 2FE8A 2V1CA 4NOOB 4AG6A 2CV0A 1QUSA 2CFOA 3B7NA 3SAWA 3UJNA 1R5LA 5A2QS 3HHZA 2DAGA 3FRHA 4GMQA 2R44A 3AFHA 2YQZA 4DV3M 2CWBA 3HU2A 4LZJA 2VIIA 2CV1A 3AV0A 3NBXX 1G8PA 1QAOA 1OFIA 5KQDA 1ZAEA 3HJ8A 2ZTCA 4M0DA 1N32M 2DNAA 3I01M 2CUZA 4L4UA 2CRUA 2LVNC 3M0EA 4PCZA 1V92A 4CISA 2I7NA 3CTWB 2F5PA 2VQEM 1HNWM 3A46A 2Y0QA 4FWDA 1XNQM 3FTFA 2D7GA 1SXJD 2WSFF 3J27B 1LV7A 3CF0A 2DXIA 4B3MM 4ITQA 1DGGA 3FUUA 2XZUA 2Q2EB 2FFJA 1AIPC 3KSJA 2DAIA 2R18A 4WP2A 2XFTA 2JY8A 2VDBB 4IBJA 4S12A 2H1RA 3Q8XA 1FJGM 4CGYB 1Z5BA 2XH9A 4IJFA 5LMNM 1JQJC 2CEAA 2WSCF 8CATA 2J7NA 1OAIA 2EUCA 3K9PA 3K92A 4OVZA 5DFLA 1EFUB 3C58A 3T38A 2RRUA 1QYRA 2R65A 4KODA 1E9RA 2G8LA 2M60A 4LGYA 2CHQA 3HZJA 3L2AA 4LJAA 4X64M 1JB0F 3U6CA 2UUAM 4LF5M 2DZLA 4KLNA 3W68A 3T1HM 1IN8A 3KFUG 4DV2M 2V1UA 5EXPA 4DV1M 5DYGA 3GLGE 5EXSA 1L2CA 4XK8F 1GO5A 1OQYA 1QAMA 2FOIC 1HJPA 3HU1A 4F2LA 3KOYE 4LJ6A 3FTEA 1NY6A
chains in the Genus database with same CATH topology
1T43A 2DAEA 2LVPC 2QSFX 2DKLA 1VDLA 1WR1B 1HT2E 4HEOA 1Q02A 1MN3A 1TTEA 1VEJA 2K0BX 1NV8A 2JUJA 2OOAA 2EKFA 2MROB 3F92A 1VG5A 2EJSA 2DENA 2OO9A 1WIVA 1VEKA 2BWBA 2HWJA 4F1IA 3GLFE 3MMPA 1WGNA 5JI2E 1BVSA 1T6OA 1QZEA 1UFZA 2DAMA 1ZMWA 2DI0A 2JY5A 2L2DA 2MGWA 1HT1E 4G3OA 2L4FA 1G4AE 2LBCA 3FE3A 3LCUA 1IXSA 2JZ1A 3B89A 2MJ5B 2QHOB 2QNJA 2JY6B 3E46A 4GEWA 1YLAA 2K9DA 2ZTDA 2KNZA 1NV9A 2OOBA 2JZ0A 3GLIE 2DHYA 1SG9A 1WJ7A 1Y8GA 1IFYA 2BWEA 1KYIA 2KNVA 3T6PA 2HAKA 1CUKA 2DAGA 3FRHA 1ZMVA 2JY7A 3H4JA 1G3IA 2JNHA 4DBGB 2CWBA 1F4IA 2DAKA 4Q7JA 2O25A 3FRIA 1ZV1A 1G41A 2G3QA 1E94E 2KHHA 2LVOC 1ZMUA 2ZTCA 3E21A 2DNAA 1R4GA 1PGYA 3IECA 3LCVB 1JR3E 2LVNC 1WHCA 2B3TA 1V92A 2H5XA 1VQ1A 4R71A 1WGLA 3K9OA 1C7YA 2LTUA 1AIPC 2JP7A 2DAIA 4WP2A 2KNAA 2JY8A 2LVQD 1A5TA 1DV0A 1XB2B 3GLHE 1OAIA 2CP8A 3K9PA 2EKKA 1VEGA 5DFLA 1EFUB 3BBZA 1HQYE 2RRUA 1OKSA 2R0IA 1DO2A 2L4EA 1OTRA 3IHPA 1IM2A 2MR9A 2DZLA 1DO0A 1TR8A 1XXHE 1P3QQ 2LVAA 2WZJA 3GLGE 1OQYA 4F2LA 1HJPA 4UN2B 1GO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T43 A;  2DAE A;  2LVP C;  2QSF X;  2DKL A;  1VDL A;  1WR1 B;  1HT2 E;  4HEO A;  1Q02 A;  1MN3 A;  1TTE A;  1VEJ A;  2K0B X;  1NV8 A;  2JUJ A;  2OOA A;  2EKF A;  2MRO B;  3F92 A;  1VG5 A;  2EJS A;  2DEN A;  2OO9 A;  1WIV A;  1VEK A;  2BWB A;  2HWJ A;  4F1I A;  3GLF E;  3MMP A;  1WGN A;  5JI2 E;  1BVS A;  1T6O A;  1QZE A;  1UFZ A;  2DAM A;  1ZMW A;  2DI0 A;  2JY5 A;  2L2D A;  2MGW A;  1HT1 E;  4G3O A;  2L4F A;  1G4A E;  2LBC A;  3FE3 A;  3LCU A;  1IXS A;  2JZ1 A;  3B89 A;  2MJ5 B;  2QHO B;  2QNJ A;  2JY6 B;  3E46 A;  4GEW A;  1YLA A;  2K9D A;  2ZTD A;  2KNZ A;  1NV9 A;  2OOB A;  2JZ0 A;  3GLI E;  2DHY A;  1SG9 A;  1WJ7 A;  1Y8G A;  1IFY A;  2BWE A;  1KYI A;  2KNV A;  3T6P A;  2HAK A;  1CUK A;  2DAG A;  3FRH A;  1ZMV A;  2JY7 A;  3H4J A;  1G3I A;  2JNH A;  4DBG B;  2CWB A;  1F4I A;  2DAK A;  4Q7J A;  2O25 A;  3FRI A;  1ZV1 A;  1G41 A;  2G3Q A;  1E94 E;  2KHH A;  2LVO C;  1ZMU A;  2ZTC A;  3E21 A;  2DNA A;  1R4G A;  1PGY A;  3IEC A;  3LCV B;  1JR3 E;  2LVN C;  1WHC A;  2B3T A;  1V92 A;  2H5X A;  1VQ1 A;  4R71 A;  1WGL A;  3K9O A;  1C7Y A;  2LTU A;  1AIP C;  2JP7 A;  2DAI A;  4WP2 A;  2KNA A;  2JY8 A;  2LVQ D;  1A5T A;  1DV0 A;  1XB2 B;  3GLH E;  1OAI A;  2CP8 A;  3K9P A;  2EKK A;  1VEG A;  5DFL A;  1EFU B;  3BBZ A;  1HQY E;  2RRU A;  1OKS A;  2R0I A;  1DO2 A;  2L4E A;  1OTR A;  3IHP A;  1IM2 A;  2MR9 A;  2DZL A;  1DO0 A;  1TR8 A;  1XXH E;  1P3Q Q;  2LVA A;  2WZJ A;  3GLG E;  1OQY A;  4F2L A;  1HJP A;  4UN2 B;  1GO5 A; 
#chains in the Genus database with same CATH topology
 1H6U A;  2LVP C;  1IXR C;  1Z5A A;  3H4M A;  2QZ4 A;  1WR1 B;  1HT2 E;  1NJG A;  1Q02 A;  3KOZ E;  4FWH A;  4NRW A;  1WXQ A;  3JR5 A;  3JAM S;  3I4Y A;  2J5Y A;  3R8F A;  4K0K M;  1IY0 A;  2W82 A;  1NV8 A;  2JUJ A;  4JI1 M;  1J09 A;  2R4E A;  1QUT A;  4YHH M;  3U6M A;  2UXC M;  3F92 A;  4IBB A;  3SAR A;  2DEN A;  2XFS A;  1K82 A;  4EIW A;  3NBI A;  4F1I A;  3B7Q A;  4L15 A;  3LVW A;  5F3W A;  3VDU A;  4LZZ A;  3FTC A;  3RGP A;  1T6O A;  3VKG A;  2P5T A;  2QP9 X;  2JY5 A;  4LFA M;  3VK7 A;  2MGW A;  1HT1 E;  3SBJ A;  1NHW C;  3D8B A;  4D81 A;  2F4V M;  2RGH A;  2F5Q A;  4MGY E;  4W5W A;  5C1B A;  3U6D A;  1DGH A;  4YY3 M;  1IXS A;  1IY2 A;  2LNH C;  4BLC A;  3JR4 A;  4L8R C;  4MH0 E;  2ZTD A;  1PRB A;  3GLI E;  1NSF A;  5LMU M;  2LH0 A;  1NO1 A;  2DHY A;  2LHG A;  3AJI B;  1SXJ E;  1WJ7 A;  3HX3 A;  4IBF A;  3UZU A;  3KOW E;  5H37 D;  2DZO B;  1HR0 M;  1W5T A;  4L78 A;  1K3W A;  4G4N A;  4X62 M;  4BB9 A;  3QYE A;  1Q3C A;  2HKJ A;  3QAU A;  2XLJ A;  1GAB A;  2RKO A;  1XXH B;  3KVW A;  5ITY A;  2GNO A;  3GLG A;  2VQF M;  4ANR A;  4DR4 M;  1F4I A;  2DAK A;  1OIZ A;  4Q7J A;  2F5S A;  2XSZ A;  5FTN A;  4B3S M;  3HY5 A;  2LVO C;  3K1J A;  3E21 A;  2N35 A;  1I4W A;  4MGK E;  2UUC M;  4B7G A;  1DGH B;  4DV6 M;  1IXS B;  5ITQ A;  1GLN A;  2DWM A;  1PJS A;  2C9C A;  2R62 A;  1N78 A;  2KZS A;  3TL4 X;  3DOA A;  4GRI A;  4NXM M;  3L29 A;  1VQ1 A;  2JXN A;  3AOE C;  1R2Z A;  4DR1 M;  4REZ A;  3FD9 A;  4CHT B;  3J2P B;  3K9O A;  2VF7 A;  2V6Z M;  4IJE A;  4MGH A;  4JYA M;  2LTU A;  3LVV A;  3TE6 A;  2JP7 A;  1E9S A;  2KNA A;  2ZAN A;  2LVQ D;  4B08 A;  4LCB A;  2C99 A;  2DWZ B;  1R7R A;  3SFZ A;  1V33 A;  3ZCB B;  3K2L A;  4PDI A;  3GLG B;  4FD2 A;  3GLH E;  3KP1 E;  1YE9 A;  2EA0 A;  3C9P A;  2DVW B;  3SMP A;  3J81 S;  1KSF X;  4AQY M;  4LF6 M;  3B74 A;  4IBI A;  3BBZ A;  1HQY E;  4LFC M;  2X4A A;  1OKS A;  4DV5 M;  1JR3 D;  4JI2 M;  2Y21 A;  1D2N A;  2Y0T A;  3A45 A;  3GLI A;  1EIJ A;  4PDG A;  1IXZ A;  1TGU A;  4LRT A;  1SXJ A;  3DZD A;  1TR8 A;  1XXH E;  1GKI A;  1P3Q Q;  4JI0 M;  4AKI A;  1KFV A;  2HL7 A;  3HJQ A;  2LVA A;  3U61 A;  1OJL A;  5KQ8 A;  4M9S A;  4JI6 M;  1N75 A;  3KP0 E;  3AKZ A;  3WHK A;  5BPV A;  1G59 A;  3GRR A;  1TH4 A;  3LMM A;  3THG A;  4DR6 M;  3SYL A;  4TUW A;  3R9X B;  3FUW A;  3J80 S;  3FUX A;  2KXE A;  4A3V B;  1T43 A;  1IY1 A;  3HU3 A;  1YSY A;  4L6V 6;  4MB7 A;  3HHY A;  2KZU A;  2A5Y B;  2O01 F;  3Q8G A;  2Z7J A;  4GKJ M;  2CHG A;  4NXN M;  2KDL A;  1TTE A;  1VEJ A;  2K0B X;  4KT0 F;  3LW5 F;  2EKF A;  1TDZ A;  1PJT A;  5L8R F;  1XHB A;  2EJS A;  3EIH A;  3HGI A;  2G5G X;  1XMO M;  4PD2 A;  1W5S A;  3PFI A;  3T15 A;  3GLI B;  4LF4 M;  3GLF E;  2BNK A;  2K6B A;  4JI4 M;  1NVM A;  1SXJ B;  3CF6 E;  3GQ5 A;  2DHR A;  4M0W A;  1UFZ A;  4FW9 A;  2DAM A;  1NNJ A;  3LQR A;  3U61 B;  1Z59 A;  3CGW A;  1EE8 A;  1N77 A;  2L4F A;  2UXB M;  4LGM A;  3KW6 A;  1IN4 A;  3LCU A;  4L16 A;  1NHG C;  2JZ1 A;  2R4J A;  4DV7 M;  2QHO B;  3U6S A;  2QNJ A;  2JY6 B;  4LJ7 A;  3GLH A;  3IG5 A;  1IN6 A;  1YLA A;  2K9D A;  4X65 M;  2KNZ A;  3T1Y M;  3IG8 A;  2JZ0 A;  3U6P A;  3HHX A;  3SHF A;  1N36 M;  1L1T A;  1Y8G A;  5FTK A;  4CJ6 A;  2K47 A;  1UM8 A;  2BWE A;  2Z4S A;  3L28 A;  5ITR A;  4I8O A;  5GKN A;  1DGB A;  2KNV A;  4DUZ M;  4LF9 M;  1GL6 A;  1PJJ A;  5FLX S;  3UGJ A;  4NRV A;  4PT5 A;  3RFW A;  1Z6T A;  1ZMV A;  2JY7 A;  1XXH A;  3H4J A;  4I4L A;  3PVS A;  4XGI A;  2VF8 A;  2JNH A;  5FTM A;  4JI8 M;  4RF0 A;  1IQP A;  1TH2 A;  3UMM A;  4OW0 A;  2O25 A;  1N34 M;  3BOS A;  1ZV1 A;  1G41 A;  3FKE A;  2QPA A;  3FRI A;  4QHT A;  2KHH A;  4I81 A;  2E5L M;  2F5O A;  5FSW A;  3SAU A;  4GHL A;  1QQW A;  2DZN B;  3WHL A;  1R4G A;  5KPT A;  1PGY A;  1OFH A;  2L7H A;  4JN6 A;  1S3S A;  1JR3 E;  3DFZ A;  3VFD A;  4NSO B;  1FNN A;  3B9P A;  1IBK M;  3GLH B;  3KS8 A;  4I5S A;  2B3T A;  2Y20 A;  3AL0 C;  4M9Z A;  1PM5 A;  2ZAM A;  2L09 A;  3GPP A;  3I04 M;  4G4Q A;  1IN7 A;  1XWI A;  1WGL A;  3UK6 A;  1T3T A;  4RNA A;  4FWG A;  3W0F A;  1C7Y A;  1PJI A;  3HJS A;  3GLF A;  4GHA A;  4QHS A;  1V34 A;  1A5T A;  5KO3 A;  2L6O A;  2KRU A;  1XB2 B;  1MJG M;  4JV5 M;  4LFB M;  3GQ3 A;  1XC8 A;  2NQ8 C;  4JI5 M;  2CP8 A;  3V76 A;  1GJT A;  1VEG A;  1I94 M;  2XEP A;  1L2B A;  3K8Z A;  1MU5 A;  1X37 A;  4KO8 A;  2CHV A;  4IBD A;  5E6J A;  4HL4 A;  1DO2 A;  1G71 A;  1OTR A;  3KS4 A;  2MR9 A;  3VLF B;  5KPZ A;  1D0M A;  3U6E A;  4II7 A;  4OU7 A;  1DO0 A;  5FTJ A;  4B7F A;  1XNR M;  4AG5 A;  2O5R A;  1J5E M;  4M9X A;  2WZJ A;  4AKG A;  3E9S A;  4FCW A;  3TWK A;  1J7K A;  4R3D A;  5DNY A;  3GLF B;  1HNX M;  2L7I A;  4JI3 M;  1L2D A;  3M6A A;  2KRK A;  4RKU F;  2C5R A;  2J7O A;  1Q3B A;  2DKL A;  4HEO A;  3U6O A;  4KHP M;  3GO8 A;  1MN3 A;  4P16 A;  4IBE A;  3SAT A;  1ZQ9 A;  3HHW A;  1NY5 A;  3PXG A;  2OOA A;  3GRY A;  1JR3 A;  3KOX E;  2MRO B;  3QYB A;  3GPU A;  3ZC7 B;  3AOE A;  1VG5 A;  2OO9 A;  2XGN A;  2KA6 B;  1WIV A;  1SXJ C;  1VEK A;  2HWJ A;  5IRE B;  2QBY A;  3M7G A;  3MMP A;  1WGN A;  2OPF A;  1Z5C A;  4AKH A;  1BVS A;  4CIZ A;  2DI0 A;  5EP3 A;  3TWM A;  2YFQ A;  3PNY A;  3HWS A;  4JI7 M;  2LBC A;  1YUB A;  5FTL A;  1D0L A;  5ITX A;  2DWL A;  5DYI A;  2QEN A;  2WSE F;  3U5Z A;  2DWN A;  1QZM A;  1C1K A;  3LQQ A;  1PJQ A;  3E46 A;  4LJ8 A;  5EJC A;  4G6Z A;  2OOB A;  4D80 A;  2XZF A;  4WW0 A;  4NSR A;  4FCV A;  1SG9 A;  2UUB M;  4DR3 M;  1VDD A;  2D7H A;  4RF1 A;  5ITT A;  3CF2 A;  4DR7 M;  4R7G A;  1KYI A;  3TWL A;  4B3R M;  3I51 A;  2CV2 A;  2XF3 A;  3DA1 A;  5BR8 M;  1NNU C;  3FUT A;  2QBY B;  2R46 A;  3KDS E;  3T6P A;  2HAK A;  2M5Z A;  1CUK A;  4IBG A;  5EQT A;  3HKP A;  3OTO M;  3RGS A;  4G4O A;  1G3I A;  4B7H A;  4B3T M;  1Q39 A;  2D7E A;  1RU3 A;  4MM3 B;  4GC9 A;  5IZ7 D;  4DBG B;  4DR5 M;  1IBL M;  1K3X A;  3VKH A;  1IBM M;  2ZM6 M;  4LJ4 A;  3FTD A;  2Z4R A;  3QWL A;  2X8A A;  3AOG A;  2G3Q A;  1E94 E;  3L25 A;  4BBA A;  1ZMU A;  5KPR A;  2BJW A;  3IEC A;  3E4R A;  3LCV B;  3TPZ A;  5EP2 A;  3U5Z B;  3ZH9 B;  2F5N A;  2JWS A;  4JXJ A;  4QOS A;  4FCT A;  1GVN A;  3TQS A;  4LF8 M;  1WHC A;  7CAT A;  1OAO C;  2H5X A;  3VK8 A;  3SAV A;  4Y28 F;  5EXT A;  4R71 A;  2LHC A;  3GRV A;  1HNZ M;  2C98 A;  2BJV A;  4MGZ E;  2X49 A;  3J7A S;  3EIE A;  3U6Q A;  3D8L A;  1NJF A;  4HLQ A;  5C18 A;  1R2Y A;  4QNM A;  4GIP A;  3GPX A;  3W67 A;  1DV0 A;  1ORY B;  3GRU A;  4DUY M;  3SMS A;  4Z6Y A;  4IBK A;  2HCB A;  3B7Z A;  4OX9 M;  4D82 A;  4LF7 M;  3BXW A;  2EKK A;  3NWL A;  4GC5 A;  4LY6 A;  4OVZ B;  4DR2 M;  2AHM A;  1QAN A;  2FS1 A;  3W0L B;  5E26 A;  4Z8X A;  2C96 A;  4WUR A;  2R0I A;  3PNV A;  2OQ4 A;  2L4E A;  3IHP A;  1LTM A;  3MJ5 A;  1IM2 A;  3A42 A;  1QVR A;  2HHH M;  1N33 M;  4IIW A;  2R6F A;  4FVM A;  4XBO A;  4QOZ C;  3GQ4 A;  2EO2 A;  4GKK M;  1GL7 A;  5JI3 E;  2YR0 A;  3U60 A;  2QCU A;  4AZF A;  3MHV C;  5IWA M;  4X66 M;  1OIP A;  1DGF A;  1TDH A;  2ERC A;  1QDR A;  3ZQJ A;  3U6L A;  3I4V A;  2LWX A;  1D0K A;  4AW4 A;  4UN2 B;  5ITX E;  5EP1 A;  1QAQ A;  3L26 A;  4DV0 M;  2DAE A;  2YNM D;  1GJS A;  2UXD M;  2QSF X;  3KSX A;  1VDL A;  2R45 A;  4GIT A;  1L1Z A;  1L8Q A;  2LXE A;  2Z8Y M;  4LRS A;  4AI6 A;  2Z3X A;  3SYK A;  3FYD A;  5IT9 S;  4DV4 M;  4LJ9 A;  2ZBK B;  2RGO A;  2BWB A;  4LJ5 A;  3J7B A;  4P17 A;  3L27 A;  1XMQ M;  1AUA A;  5JI2 E;  3SHG B;  2UU9 M;  2JA2 A;  4NC6 A;  1HQC A;  1TH3 A;  4MGI E;  3SAS A;  3MK6 A;  4G4R A;  2FH0 A;  1MX0 A;  1QZE A;  2CE7 A;  4NL4 H;  1QDT A;  1ZMW A;  3U60 B;  2L2D A;  2I7P A;  3C3D A;  4G3O A;  3GPY A;  3C3E A;  5ITU A;  1TF0 B;  3ILK A;  1G4A E;  3FUV A;  3FE3 A;  3FYC A;  2XSZ D;  4QNR A;  3B89 A;  2KEB A;  2MJ5 B;  4IBC A;  3RE8 A;  3GP1 A;  2QQ8 A;  2FNA A;  2C9O A;  3KXE C;  4GEW A;  5EP4 A;  2KW0 A;  1IN5 A;  3VDP A;  4LG2 A;  2APL A;  1NV9 A;  2ZAO A;  5EXX A;  1E32 A;  4GH9 A;  2GQF A;  2MH8 A;  4ZPX A;  3SC3 A;  1IFY A;  1R6B X;  3A98 B;  2FE8 A;  2V1C A;  4NOO B;  4AG6 A;  2CV0 A;  1QUS A;  2CFO A;  3B7N A;  3SAW A;  3UJN A;  1R5L A;  5A2Q S;  3HHZ A;  2DAG A;  3FRH A;  4GMQ A;  2R44 A;  3AFH A;  2YQZ A;  4DV3 M;  2CWB A;  3HU2 A;  4LZJ A;  2VII A;  2CV1 A;  3AV0 A;  3NBX X;  1G8P A;  1QAO A;  1OFI A;  5KQD A;  1ZAE A;  3HJ8 A;  2ZTC A;  4M0D A;  1N32 M;  2DNA A;  3I01 M;  2CUZ A;  4L4U A;  2CRU A;  2LVN C;  3M0E A;  4PCZ A;  1V92 A;  4CIS A;  2I7N A;  3CTW B;  2F5P A;  2VQE M;  1HNW M;  3A46 A;  2Y0Q A;  4FWD A;  1XNQ M;  3FTF A;  2D7G A;  1SXJ D;  2WSF F;  3J27 B;  1LV7 A;  3CF0 A;  2DXI A;  4B3M M;  4ITQ A;  1DGG A;  3FUU A;  2XZU A;  2Q2E B;  2FFJ A;  1AIP C;  3KSJ A;  2DAI A;  2R18 A;  4WP2 A;  2XFT A;  2JY8 A;  2VDB B;  4IBJ A;  4S12 A;  2H1R A;  3Q8X A;  1FJG M;  4CGY B;  1Z5B A;  2XH9 A;  4IJF A;  5LMN M;  1JQJ C;  2CEA A;  2WSC F;  8CAT A;  2J7N A;  1OAI A;  2EUC A;  3K9P A;  3K92 A;  4OVZ A;  5DFL A;  1EFU B;  3C58 A;  3T38 A;  2RRU A;  1QYR A;  2R65 A;  4KOD A;  1E9R A;  2G8L A;  2M60 A;  4LGY A;  2CHQ A;  3HZJ A;  3L2A A;  4LJA A;  4X64 M;  1JB0 F;  3U6C A;  2UUA M;  4LF5 M;  2DZL A;  4KLN A;  3W68 A;  3T1H M;  1IN8 A;  3KFU G;  4DV2 M;  2V1U A;  5EXP A;  4DV1 M;  5DYG A;  3GLG E;  5EXS A;  1L2C A;  4XK8 F;  1GO5 A;  1OQY A;  1QAM A;  2FOI C;  1HJP A;  3HU1 A;  4F2L A;  3KOY E;  4LJ6 A;  3FTE A;  1NY6 A; 
#chains in the Genus database with same CATH homology
 1T43 A;  2DAE A;  2LVP C;  2QSF X;  2DKL A;  1VDL A;  1WR1 B;  1HT2 E;  4HEO A;  1Q02 A;  1MN3 A;  1TTE A;  1VEJ A;  2K0B X;  1NV8 A;  2JUJ A;  2OOA A;  2EKF A;  2MRO B;  3F92 A;  1VG5 A;  2EJS A;  2DEN A;  2OO9 A;  1WIV A;  1VEK A;  2BWB A;  2HWJ A;  4F1I A;  3GLF E;  3MMP A;  1WGN A;  5JI2 E;  1BVS A;  1T6O A;  1QZE A;  1UFZ A;  2DAM A;  1ZMW A;  2DI0 A;  2JY5 A;  2L2D A;  2MGW A;  1HT1 E;  4G3O A;  2L4F A;  1G4A E;  2LBC A;  3FE3 A;  3LCU A;  1IXS A;  2JZ1 A;  3B89 A;  2MJ5 B;  2QHO B;  2QNJ A;  2JY6 B;  3E46 A;  4GEW A;  1YLA A;  2K9D A;  2ZTD A;  2KNZ A;  1NV9 A;  2OOB A;  2JZ0 A;  3GLI E;  2DHY A;  1SG9 A;  1WJ7 A;  1Y8G A;  1IFY A;  2BWE A;  1KYI A;  2KNV A;  3T6P A;  2HAK A;  1CUK A;  2DAG A;  3FRH A;  1ZMV A;  2JY7 A;  3H4J A;  1G3I A;  2JNH A;  4DBG B;  2CWB A;  1F4I A;  2DAK A;  4Q7J A;  2O25 A;  3FRI A;  1ZV1 A;  1G41 A;  2G3Q A;  1E94 E;  2KHH A;  2LVO C;  1ZMU A;  2ZTC A;  3E21 A;  2DNA A;  1R4G A;  1PGY A;  3IEC A;  3LCV B;  1JR3 E;  2LVN C;  1WHC A;  2B3T A;  1V92 A;  2H5X A;  1VQ1 A;  4R71 A;  1WGL A;  3K9O A;  1C7Y A;  2LTU A;  1AIP C;  2JP7 A;  2DAI A;  4WP2 A;  2KNA A;  2JY8 A;  2LVQ D;  1A5T A;  1DV0 A;  1XB2 B;  3GLH E;  1OAI A;  2CP8 A;  3K9P A;  2EKK A;  1VEG A;  5DFL A;  1EFU B;  3BBZ A;  1HQY E;  2RRU A;  1OKS A;  2R0I A;  1DO2 A;  2L4E A;  1OTR A;  3IHP A;  1IM2 A;  2MR9 A;  2DZL A;  1DO0 A;  1TR8 A;  1XXH E;  1P3Q Q;  2LVA A;  2WZJ A;  3GLG E;  1OQY A;  4F2L A;  1HJP A;  4UN2 B;  1GO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...