2OOBA

Crystal structure of the uba domain from cbl-b ubiquitin ligase in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
LENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2oobA00
2ZTDA 2DKLA 4Q7JA 1HT2E 1WR1B 4R71A 3LCVB 3MMPA 1Q02A 1VEKA 2EJSA 1PGYA 1TTEA 2EKFA 2H5XA 2KHHA 3K9PA 2LBCA 1IXSA 4F1IA 2B3TA 1QZEA 5JI2E 2BWBA 5DFLA 2HAKA 4WP2A 1DV0A 1T6OA 1KYIA 1HQYE 3F92A 2LVAA 1YLAA 1F4IA 4GEWA 1HJPA 4F2LA 1DO2A 2L2DA 1E94E 3LCUA 3GLIE 3T6PA 1XB2B 1OAIA 2LVPC 2O25A 2JZ1A 1TR8A 2JP7A 2OO9A 3FRIA 2OOBA 1OQYA 2CP8A 2R0IA 1VEJA 1T43A 1IM2A 2QSFX 3H4JA 2DAEA 3IHPA 2HWJA 4DBGB 1JR3E 2L4EA 1G41A 1VQ1A 2JY7A 2LVNC 3K9OA 1OTRA 3IECA 2QNJA 1WGNA 4HEOA 1ZMVA 1R4GA 3E21A 1WIVA 2LVOC 2LTUA 2JY8A 1A5TA 1GO5A 1Y8GA 2DAGA 1EFUB 2CWBA 2DI0A 3BBZA 1C7YA 2RRUA 2JNHA 2MGWA 2JUJA 2MJ5B 2WZJA 2JY5A 2KNVA 2JY6B 2MROB 3FE3A 2DAMA 1OKSA 2DENA 4G3OA 3GLGE 1IFYA 1HT1E 2L4FA 2LVQD 1UFZA 3GLFE 1VEGA 1WGLA 1ZMUA 2DAIA 2OOAA 1VDLA 1MN3A 1G4AE 1NV9A 2DAKA 1SG9A 2JZ0A 2KNZA 2MR9A 1ZV1A 2DHYA 1AIPC 1G3IA 3B89A 2ZTCA 1WHCA 1P3QQ 4UN2B 1WJ7A 2BWEA 3GLHE 2DZLA 1VG5A 2K0BX 1V92A 1XXHE 1ZMWA 3E46A 3FRHA 1BVSA 2EKKA 2K9DA 2QHOB 2G3QA 1NV8A 2DNAA 1DO0A 2KNAA 1CUKA
chains in the Genus database with same CATH superfamily
2ZTDA 1FNNA 2WSFF 1GLNA 2DKLA 4JI5M 4FWGA 1IBLM 2I7PA 4JI3M 1HT2E 4NSOB 3OTOM 3FYCA 1SXJB 2RKOA 1WR1B 3SYKA 4LF7M 5KPTA 3GLGB 3EIHA 2CRUA 4QNRA 3GLFB 3VK7A 1Q02A 2EJSA 3BOSA 3VKGA 4FVMA 2C5RA 2KW0A 5JI2E 4DV0M 2XEPA 3KSJA 1QDTA 1J5EM 2HAKA 4WP2A 1DV0A 1HQYE 2GNOA 3A98B 3F92A 4X62M 4X64M 4DV1M 2Z3XA 2G8LA 3GQ4A 4REZA 2DHRA 2L2DA 4M9XA 3SAWA 2UXCM 4AI6A 3B7NA 2XZUA 5LMUM 1IXZA 1V34A 2CHGA 3FYDA 4D81A 3U5ZA 3FTDA 3NBXX 4PDGA 3AFHA 3VDUA 1R6BX 2APLA 2M60A 4MH0E 1GL6A 2CP8A 4JYAM 3HHWA 5DYIA 5IT9S 1AUAA 4CHTB 3HJQA 2DZOB 1OFIA 1VEJA 5FTNA 5ITUA 3HU3A 3SHFA 3W0LB 1R5LA 1IM2A 1YE9A 2YNMD 4FCWA 5EP1A 4I5SA 2CHQA 4QOSA 2DAEA 3SBJA 1IN7A 2YFQA 2R44A 5BPVA 3IHPA 3DOAA 4QHTA 3I51A 3QYBA 1L1ZA 1JR3E 1XHBA 4GITA 4L4UA 2JY7A 3AKZA 1E9SA 3T1HM 1R2YA 4AKHA 2KZSA 3IG8A 2ZAOA 4LGMA 3A45A 3BXWA 2QNJA 1D0MA 4LRSA 3U6EA 4L15A 2QCUA 3EIEA 5ITRA 2Y0QA 3AV0A 3L27A 4IIWA 1V33A 3M7GA 4JV5M 2H1RA 4NXNM 1TDZA 2HL7A 4JN6A 1OIPA 1G71A 3E21A 3SHGB 3VLFB 3GPPA 4DR4M 1N32M 4IBBA 4MB7A 2JY8A 1A5TA 1E9RA 3U6PA 2DVWB 4GC9A 3RGPA 4W5WA 1H6UA 1IY0A 5C1BA 3AJIB 3W0FA 1PRBA 4IBIA 2P5TA 3FTCA 1J09A 2JUJA 2MJ5B 5LMNM 3KXEC 2JY5A 3U6OA 4P16A 2ZANA 2MROB 3FE3A 3UGJA 4XBOA 3C58A 1G59A 4KHPM 3KP1E 4RNAA 3GLGE 1IFYA 2X4AA 2LVQD 4HL4A 4DR3M 2NQ8C 3KOWE 3GLFE 3TWMA 4DR7M 5EXPA 3HHYA 2DAIA 1YSYA 1HNWM 1QAMA 5C18A 4LJ9A 3HZJA 3GP1A 3D8BA 2J7NA 3HX3A 1S3SA 3K2LA 3K1JA 3LQRA 1W5SA 4KO8A 5EJCA 3TWLA 1TH3A 1G4AE 2ZM6M 1NV9A 2CEAA 2FH0A 1Z59A 2XFSA 1ZV1A 3R9XB 1AIPC 1G3IA 4OX9M 3SMSA 4DV3M 4G4QA 3CF0A 2KRUA 4UN2B 3U6MA 1HR0M 5KQDA 2BWEA 2K0BX 2ERCA 3J7AS 1V92A 3GPXA 1ZMWA 1SXJD 4II7A 3KP0E 3PNYA 3FRHA 3LVWA 2EKKA 4NRVA 1Z5AA 2F5SA 4DV5M 2CUZA 1VDDA 4QHSA 4ZPXA 2DNAA 3L25A 5EP2A 1WXQA 2Z4SA 3H4JA 3HY5A 4L78A 5KPRA 2CFOA 4FCTA 3FUTA 1NHGC 1NY6A 4Q7JA 3HHZA 3U6DA 4NXMM 4PD2A 4RF1A 4B3RM 3B74A 4R71A 4MGKE 2F5OA 4I81A 3MMPA 1HNZM 5F3WA 4NSRA 3B9PA 2KXEA 2H5XA 3KOZE 5IREB 4OVZB 1I4WA 1G8PA 3U6CA 4D82A 1KYIA 2R46A 2V1UA 4L16A 2R4JA 2C9CA 3AOEC 2OQ4A 1F4IA 2D7EA 4JI6M 1Z5BA 1DO2A 4F2LA 3HWSA 4GHLA 2AHMA 4PCZA 1PJJA 3JR5A 5EXXA 2JZ1A 3SAVA 2OOBA 3UMMA 3Q8GA 5EQTA 3GO8A 5KPZA 3C3EA 3T1YM 2Z4RA 1L1TA 4LJ5A 2J5YA 4S12A 2QSFX 2EO2A 4MM3B 4DUYM 2FNAA 1XXHA 2CE7A 1QDRA 4LFBM 3JR4A 4R3DA 5FTJA 5ITTA 3CF2A 5ITYA 1TGUA 1HQCA 1VQ1A 2LVNC 3D8LA 2UUBM 1D0KA 2EA0A 3KS8A 3MHVC 3QWLA 1MJGM 3UK6A 2KEBA 3M0EA 4IBJA 4B7GA 2OPFA 1N33M 1ZMVA 3U61A 1L2BA 3ZC7B 1XNQM 4B3TM 3L29A 4KLNA 5DYGA 4ANRA 1JR3A 1IY1A 4NRWA 2DAGA 1D2NA 1EFUB 1TF0B 4LJ4A 1Q39A 3BBZA 4NL4H 2JNHA 2KRKA 2MGWA 2DZNB 3PVSA 3TL4X 1L2CA 2HHHM 2KNVA 2XFTA 3CTWB 1GABA 2QZ4A 3GLIA 1EIJA 1OKSA 2KDLA 1R7RA 4G3OA 4YHHM 4LJ6A 1JQJC 3KVWA 3E4RA 1QYRA 4M9ZA 1NJFA 3DFZA 3LW5F 4MGYE 1ZMUA 3KW6A 4PT5A 3I4VA 4DR5M 2J7OA 1GJTA 1IY2A 3K8ZA 1MN3A 3CF6E 5ITXE 1IBMM 3HU1A 2V1CA 1SG9A 1OIZA 1QQWA 2MH8A 4G4RA 1W5TA 3NBIA 4MGHA 3FUXA 4B7FA 1Z6TA 4CGYB 3GQ5A 4FCVA 2ZTCA 1WHCA 1IXRC 2CHVA 2FE8A 3GLGA 1PJTA 3W68A 2WSEF 2CV1A 2XSZA 2L7IA 4KODA 2VQEM 1XMOM 1SXJE 3UJNA 4LFCM 4XK8F 1DGBA 1JB0F 2FFJA 4Y28F 4GH9A 2Y21A 4A3VB 1CUKA 2R0IA 2LHGA 4RF0A 4LZJA 1TH4A 1IN8A 1N75A 4XGIA 4P17A 3PFIA 5FTMA 1D0LA 2G5GX 1IQPA 1T3TA 4NOOB 3T38A 3U6SA 1I94M 1N77A 3J27B 3LCVB 3Q8XA 4LZZA 5FLXS 1VEKA 4X65M 1TTEA 2RGHA 2C99A 2VDBB 4CISA 2LBCA 1IXSA 2QENA 2B3TA 4KT0F 1QANA 1UM8A 3TWKA 3KOXE 4F1IA 2XLJA 1SXJC 2Y20A 5DFLA 3SATA 1T6OA 3AOEA 7CATA 3LQQA 1YLAA 2QBYA 2UU9M 1NVMA 4GEWA 1K3XA 3C9PA 2UUCM 2M5ZA 4G4NA 2I7NA 3T6PA 4LF9M 2O25A 1C1KA 1NSFA 2JP7A 4EIWA 3FRIA 4QOZC 2O5RA 1QAOA 1QUSA 2R18A 3WHKA 4LF5M 3HU2A 4LFAM 1XXHB 2JA2A 4JI4M 2LXEA 1Q3CA 3ZH9B 1Q3BA 1T43A 2QPAA 4GRIA 1XWIA 3GLHA 5EXTA 2W82A 1IBKM 1IN5A 4NC6A 1DGHA 4IJEA 2A5YB 2D7GA 3ILKA 4M0WA 4DBGB 1QUTA 3L2AA 1KSFX 4JI1M 2R6FA 3T15A 3B7ZA 3KSXA 3GRRA 1ZAEA 3U5ZB 1NJGA 3K9OA 4DV6M 1OTRA 3HJ8A 5BR8M 1DGFA 2R45A 1IN4A 2ZBKB 3K92A 4FD2A 2Q2EB 3TQSA 2O01F 3THGA 3U61B 1EE8A 2KA6B 5E6JA 2BJVA 3RFWA 2L7HA 2LHCA 3E9SA 3I04M 4HEOA 4Z6YA 3J81S 4FWDA 5FTKA 2R4EA 1PJSA 2VQFM 2LVOC 2LTUA 4LJAA 5A2QS 2KZUA 3VKHA 1GO5A 2BNKA 3FUVA 4IJFA 3TE6A 3GLIB 1XNRM 3FTFA 4GHAA 4TUWA 2CWBA 5EXSA 1N78A 2RRUA 2DWLA 4LG2A 5IZ7D 4GKJM 4LRTA 3HHXA 3FD9A 1E32A 3RGSA 4DV7M 1QZMA 2JY6B 4B3SM 3PNVA 3WHLA 3I01M 2DAMA 4G4OA 1KFVA 2RGOA 3FUUA 2ZAMA 5IWAM 3SASA 3GRYA 1MU5A 4X66M 4PDIA 2LWXA 4FWHA 4BBAA 1VEGA 1WGLA 2BJWA 2JWSA 3LMMA 4JI0M 2OOAA 4WURA 1LTMA 2R65A 5KQ8A 4GMQA 2LH0A 4G6ZA 4ITQA 3SC3A 3AL0C 4YY3M 3NWLA 2JZ0A 2KNZA 4CIZA 4GKKM 4GIPA 4IBDA 3PXGA 4DV4M 3SYLA 4BLCA 3B89A 1K3WA 1HNXM 2DXIA 4LF4M 4AG5A 4B3MM 4JI2M 4AG6A 1L8QA 3H4MA 2DZLA 3IG5A 3U60A 3VK8A 4DR6M 4JI8M 2QQ8A 1XXHE 1ORYB 2L09A 4MGIE 4OVZA 5L8RF 3E46A 1J7KA 2QHOB 2F5PA 2G3QA 4L8RC 4DV2M 4K0KM 5ITXA 3ZQJA 3GPUA 4LF8M 1DO0A 1X37A 2C96A 2C9OA 3J80S 4AW4A 4DR2M 1IXSB 1QVRA 4OW0A 1L2DA 2HKJA 3J2PB 2Z7JA 3A42A 4I4LA 3W67A 5DNYA 3DA1A 3QYEA 3A46A 2QBYB 1PGYA 2EKFA 4IBKA 3U6QA 2KHHA 3K9PA 2YR0A 1SXJA 4FW9A 2F5NA 1QZEA 1TH2A 3L26A 4AQYM 1XMQM 2BWBA 3R8FA 2QP9X 4L6V6 4BB9A 3GLFA 3KS4A 2LVAA 3AOGA 4LJ7A 4WW0A 5KO3A 2UUAM 4IBCA 1HJPA 2X8AA 3B7QA 3U6LA 3KOYE 3CGWA 1E94E 3J7BA 1FJGM 3LCUA 3GLIE 1LV7A 3FKEA 4LY6A 1PM5A 1XB2B 1OAIA 2LVPC 3ZCBB 1TR8A 2OO9A 2WSCF 2D7HA 3GLHB 4R7GA 4CJ6A 1OQYA 2HCBA 1Z5CA 1XC8A 1DGHB 3SARA 2N35A 4HLQA 4OU7A 4Z8XA 2XF3A 5ITQA 4GC5A 3QAUA 2LNHC 4M0DA 1GVNA 2Y0TA 2DWNA 2X49A 2DWMA 1GJSA 2K6BA 4JI7M 1JR3D 2HWJA 5EP3A 2K47A 2L4EA 2Z8YM 1NO1A 3VFDA 3UZUA 1G41A 3SAUA 4RKUF 4LJ8A 2VF8A 3IECA 1YUBA 1WGNA 2F4VM 2VF7A 1MX0A 1R4GA 4MGZE 3KDSE 4IBFA 1WIVA 2XH9A 2EUCA 4LF6M 2V6ZM 4IBEA 2UXDM 1Y8GA 3C3DA 4LCBA 2DI0A 1OFHA 1PJIA 4IBGA 2CV2A 1DGGA 1C7YA 3LVVA 3FTEA 1OAOC 3V76A 5FSWA 2WZJA 4DUZM 3GRUA 1GKIA 4DR1M 3SMPA 2DENA 4B08A 3FUWA 3I4YA 1HT1E 2E5LM 1GL7A 2L6OA 2XSZD 3HJSA 5JI3E 1QAQA 2L4FA 4AKGA 5EP4A 3GQ3A 1UFZA 3M6AA 2XZFA 1ZQ9A 4LGYA 2FOIC 3JAMS 1VDLA 4D80A 4QNMA 1PJQA 2CV0A 2DWZB 1OJLA 5E26A 3VDPA 5GKNA 4JXJA 2DAKA 2XGNA 2F5QA 1NNUC 3RE8A 2GQFA 2MR9A 1NNJA 1NHWC 3GPYA 2DHYA 3U60B 2VIIA 1R2ZA 2UXBM 4I8OA 1RU3A 1P3QQ 2C98A 1WJ7A 3HGIA 3MK6A 5H37D 1N36M 3GRVA 3GLHE 1NY5A 2JXNA 3HKPA 1VG5A 3TPZA 4AKIA 3KFUG 3DZDA 1IN6A 1BVSA 3MJ5A 2K9DA 3SFZA 3L28A 1N34M 1K82A 1NV8A 2YQZA 4AZFA 1TDHA 4M9SA 8CATA 5FTLA 2FS1A 2R62A 2KNAA 4B7HA
chains in the Genus database with same CATH topology
2ZTDA 2DKLA 4Q7JA 1HT2E 1WR1B 4R71A 3LCVB 3MMPA 1Q02A 1VEKA 2EJSA 1PGYA 1TTEA 2EKFA 2H5XA 2KHHA 3K9PA 2LBCA 1IXSA 4F1IA 2B3TA 1QZEA 5JI2E 2BWBA 5DFLA 2HAKA 4WP2A 1DV0A 1T6OA 1KYIA 1HQYE 3F92A 2LVAA 1YLAA 1F4IA 4GEWA 1HJPA 4F2LA 1DO2A 2L2DA 1E94E 3LCUA 3GLIE 3T6PA 1XB2B 1OAIA 2LVPC 2O25A 2JZ1A 1TR8A 2JP7A 2OO9A 3FRIA 2OOBA 1OQYA 2CP8A 2R0IA 1VEJA 1T43A 1IM2A 2QSFX 3H4JA 2DAEA 3IHPA 2HWJA 4DBGB 1JR3E 2L4EA 1G41A 1VQ1A 2JY7A 2LVNC 3K9OA 1OTRA 3IECA 2QNJA 1WGNA 4HEOA 1ZMVA 1R4GA 3E21A 1WIVA 2LVOC 2LTUA 2JY8A 1A5TA 1GO5A 1Y8GA 2DAGA 1EFUB 2CWBA 2DI0A 3BBZA 1C7YA 2RRUA 2JNHA 2MGWA 2JUJA 2MJ5B 2WZJA 2JY5A 2KNVA 2JY6B 2MROB 3FE3A 2DAMA 1OKSA 2DENA 4G3OA 3GLGE 1IFYA 1HT1E 2L4FA 2LVQD 1UFZA 3GLFE 1VEGA 1WGLA 1ZMUA 2DAIA 2OOAA 1VDLA 1MN3A 1G4AE 1NV9A 2DAKA 1SG9A 2JZ0A 2KNZA 2MR9A 1ZV1A 2DHYA 1AIPC 1G3IA 3B89A 2ZTCA 1WHCA 1P3QQ 4UN2B 1WJ7A 2BWEA 3GLHE 2DZLA 1VG5A 2K0BX 1V92A 1XXHE 1ZMWA 3E46A 3FRHA 1BVSA 2EKKA 2K9DA 2QHOB 2G3QA 1NV8A 2DNAA 1DO0A 2KNAA 1CUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  2DKL A;  4Q7J A;  1HT2 E;  1WR1 B;  4R71 A;  3LCV B;  3MMP A;  1Q02 A;  1VEK A;  2EJS A;  1PGY A;  1TTE A;  2EKF A;  2H5X A;  2KHH A;  3K9P A;  2LBC A;  1IXS A;  4F1I A;  2B3T A;  1QZE A;  5JI2 E;  2BWB A;  5DFL A;  2HAK A;  4WP2 A;  1DV0 A;  1T6O A;  1KYI A;  1HQY E;  3F92 A;  2LVA A;  1YLA A;  1F4I A;  4GEW A;  1HJP A;  4F2L A;  1DO2 A;  2L2D A;  1E94 E;  3LCU A;  3GLI E;  3T6P A;  1XB2 B;  1OAI A;  2LVP C;  2O25 A;  2JZ1 A;  1TR8 A;  2JP7 A;  2OO9 A;  3FRI A;  2OOB A;  1OQY A;  2CP8 A;  2R0I A;  1VEJ A;  1T43 A;  1IM2 A;  2QSF X;  3H4J A;  2DAE A;  3IHP A;  2HWJ A;  4DBG B;  1JR3 E;  2L4E A;  1G41 A;  1VQ1 A;  2JY7 A;  2LVN C;  3K9O A;  1OTR A;  3IEC A;  2QNJ A;  1WGN A;  4HEO A;  1ZMV A;  1R4G A;  3E21 A;  1WIV A;  2LVO C;  2LTU A;  2JY8 A;  1A5T A;  1GO5 A;  1Y8G A;  2DAG A;  1EFU B;  2CWB A;  2DI0 A;  3BBZ A;  1C7Y A;  2RRU A;  2JNH A;  2MGW A;  2JUJ A;  2MJ5 B;  2WZJ A;  2JY5 A;  2KNV A;  2JY6 B;  2MRO B;  3FE3 A;  2DAM A;  1OKS A;  2DEN A;  4G3O A;  3GLG E;  1IFY A;  1HT1 E;  2L4F A;  2LVQ D;  1UFZ A;  3GLF E;  1VEG A;  1WGL A;  1ZMU A;  2DAI A;  2OOA A;  1VDL A;  1MN3 A;  1G4A E;  1NV9 A;  2DAK A;  1SG9 A;  2JZ0 A;  2KNZ A;  2MR9 A;  1ZV1 A;  2DHY A;  1AIP C;  1G3I A;  3B89 A;  2ZTC A;  1WHC A;  1P3Q Q;  4UN2 B;  1WJ7 A;  2BWE A;  3GLH E;  2DZL A;  1VG5 A;  2K0B X;  1V92 A;  1XXH E;  1ZMW A;  3E46 A;  3FRH A;  1BVS A;  2EKK A;  2K9D A;  2QHO B;  2G3Q A;  1NV8 A;  2DNA A;  1DO0 A;  2KNA A;  1CUK A; 
#chains in the Genus database with same CATH topology
 2ZTD A;  1FNN A;  2WSF F;  1GLN A;  2DKL A;  4JI5 M;  4FWG A;  1IBL M;  2I7P A;  4JI3 M;  1HT2 E;  4NSO B;  3OTO M;  3FYC A;  1SXJ B;  2RKO A;  1WR1 B;  3SYK A;  4LF7 M;  5KPT A;  3GLG B;  3EIH A;  2CRU A;  4QNR A;  3GLF B;  3VK7 A;  1Q02 A;  2EJS A;  3BOS A;  3VKG A;  4FVM A;  2C5R A;  2KW0 A;  5JI2 E;  4DV0 M;  2XEP A;  3KSJ A;  1QDT A;  1J5E M;  2HAK A;  4WP2 A;  1DV0 A;  1HQY E;  2GNO A;  3A98 B;  3F92 A;  4X62 M;  4X64 M;  4DV1 M;  2Z3X A;  2G8L A;  3GQ4 A;  4REZ A;  2DHR A;  2L2D A;  4M9X A;  3SAW A;  2UXC M;  4AI6 A;  3B7N A;  2XZU A;  5LMU M;  1IXZ A;  1V34 A;  2CHG A;  3FYD A;  4D81 A;  3U5Z A;  3FTD A;  3NBX X;  4PDG A;  3AFH A;  3VDU A;  1R6B X;  2APL A;  2M60 A;  4MH0 E;  1GL6 A;  2CP8 A;  4JYA M;  3HHW A;  5DYI A;  5IT9 S;  1AUA A;  4CHT B;  3HJQ A;  2DZO B;  1OFI A;  1VEJ A;  5FTN A;  5ITU A;  3HU3 A;  3SHF A;  3W0L B;  1R5L A;  1IM2 A;  1YE9 A;  2YNM D;  4FCW A;  5EP1 A;  4I5S A;  2CHQ A;  4QOS A;  2DAE A;  3SBJ A;  1IN7 A;  2YFQ A;  2R44 A;  5BPV A;  3IHP A;  3DOA A;  4QHT A;  3I51 A;  3QYB A;  1L1Z A;  1JR3 E;  1XHB A;  4GIT A;  4L4U A;  2JY7 A;  3AKZ A;  1E9S A;  3T1H M;  1R2Y A;  4AKH A;  2KZS A;  3IG8 A;  2ZAO A;  4LGM A;  3A45 A;  3BXW A;  2QNJ A;  1D0M A;  4LRS A;  3U6E A;  4L15 A;  2QCU A;  3EIE A;  5ITR A;  2Y0Q A;  3AV0 A;  3L27 A;  4IIW A;  1V33 A;  3M7G A;  4JV5 M;  2H1R A;  4NXN M;  1TDZ A;  2HL7 A;  4JN6 A;  1OIP A;  1G71 A;  3E21 A;  3SHG B;  3VLF B;  3GPP A;  4DR4 M;  1N32 M;  4IBB A;  4MB7 A;  2JY8 A;  1A5T A;  1E9R A;  3U6P A;  2DVW B;  4GC9 A;  3RGP A;  4W5W A;  1H6U A;  1IY0 A;  5C1B A;  3AJI B;  3W0F A;  1PRB A;  4IBI A;  2P5T A;  3FTC A;  1J09 A;  2JUJ A;  2MJ5 B;  5LMN M;  3KXE C;  2JY5 A;  3U6O A;  4P16 A;  2ZAN A;  2MRO B;  3FE3 A;  3UGJ A;  4XBO A;  3C58 A;  1G59 A;  4KHP M;  3KP1 E;  4RNA A;  3GLG E;  1IFY A;  2X4A A;  2LVQ D;  4HL4 A;  4DR3 M;  2NQ8 C;  3KOW E;  3GLF E;  3TWM A;  4DR7 M;  5EXP A;  3HHY A;  2DAI A;  1YSY A;  1HNW M;  1QAM A;  5C18 A;  4LJ9 A;  3HZJ A;  3GP1 A;  3D8B A;  2J7N A;  3HX3 A;  1S3S A;  3K2L A;  3K1J A;  3LQR A;  1W5S A;  4KO8 A;  5EJC A;  3TWL A;  1TH3 A;  1G4A E;  2ZM6 M;  1NV9 A;  2CEA A;  2FH0 A;  1Z59 A;  2XFS A;  1ZV1 A;  3R9X B;  1AIP C;  1G3I A;  4OX9 M;  3SMS A;  4DV3 M;  4G4Q A;  3CF0 A;  2KRU A;  4UN2 B;  3U6M A;  1HR0 M;  5KQD A;  2BWE A;  2K0B X;  2ERC A;  3J7A S;  1V92 A;  3GPX A;  1ZMW A;  1SXJ D;  4II7 A;  3KP0 E;  3PNY A;  3FRH A;  3LVW A;  2EKK A;  4NRV A;  1Z5A A;  2F5S A;  4DV5 M;  2CUZ A;  1VDD A;  4QHS A;  4ZPX A;  2DNA A;  3L25 A;  5EP2 A;  1WXQ A;  2Z4S A;  3H4J A;  3HY5 A;  4L78 A;  5KPR A;  2CFO A;  4FCT A;  3FUT A;  1NHG C;  1NY6 A;  4Q7J A;  3HHZ A;  3U6D A;  4NXM M;  4PD2 A;  4RF1 A;  4B3R M;  3B74 A;  4R71 A;  4MGK E;  2F5O A;  4I81 A;  3MMP A;  1HNZ M;  5F3W A;  4NSR A;  3B9P A;  2KXE A;  2H5X A;  3KOZ E;  5IRE B;  4OVZ B;  1I4W A;  1G8P A;  3U6C A;  4D82 A;  1KYI A;  2R46 A;  2V1U A;  4L16 A;  2R4J A;  2C9C A;  3AOE C;  2OQ4 A;  1F4I A;  2D7E A;  4JI6 M;  1Z5B A;  1DO2 A;  4F2L A;  3HWS A;  4GHL A;  2AHM A;  4PCZ A;  1PJJ A;  3JR5 A;  5EXX A;  2JZ1 A;  3SAV A;  2OOB A;  3UMM A;  3Q8G A;  5EQT A;  3GO8 A;  5KPZ A;  3C3E A;  3T1Y M;  2Z4R A;  1L1T A;  4LJ5 A;  2J5Y A;  4S12 A;  2QSF X;  2EO2 A;  4MM3 B;  4DUY M;  2FNA A;  1XXH A;  2CE7 A;  1QDR A;  4LFB M;  3JR4 A;  4R3D A;  5FTJ A;  5ITT A;  3CF2 A;  5ITY A;  1TGU A;  1HQC A;  1VQ1 A;  2LVN C;  3D8L A;  2UUB M;  1D0K A;  2EA0 A;  3KS8 A;  3MHV C;  3QWL A;  1MJG M;  3UK6 A;  2KEB A;  3M0E A;  4IBJ A;  4B7G A;  2OPF A;  1N33 M;  1ZMV A;  3U61 A;  1L2B A;  3ZC7 B;  1XNQ M;  4B3T M;  3L29 A;  4KLN A;  5DYG A;  4ANR A;  1JR3 A;  1IY1 A;  4NRW A;  2DAG A;  1D2N A;  1EFU B;  1TF0 B;  4LJ4 A;  1Q39 A;  3BBZ A;  4NL4 H;  2JNH A;  2KRK A;  2MGW A;  2DZN B;  3PVS A;  3TL4 X;  1L2C A;  2HHH M;  2KNV A;  2XFT A;  3CTW B;  1GAB A;  2QZ4 A;  3GLI A;  1EIJ A;  1OKS A;  2KDL A;  1R7R A;  4G3O A;  4YHH M;  4LJ6 A;  1JQJ C;  3KVW A;  3E4R A;  1QYR A;  4M9Z A;  1NJF A;  3DFZ A;  3LW5 F;  4MGY E;  1ZMU A;  3KW6 A;  4PT5 A;  3I4V A;  4DR5 M;  2J7O A;  1GJT A;  1IY2 A;  3K8Z A;  1MN3 A;  3CF6 E;  5ITX E;  1IBM M;  3HU1 A;  2V1C A;  1SG9 A;  1OIZ A;  1QQW A;  2MH8 A;  4G4R A;  1W5T A;  3NBI A;  4MGH A;  3FUX A;  4B7F A;  1Z6T A;  4CGY B;  3GQ5 A;  4FCV A;  2ZTC A;  1WHC A;  1IXR C;  2CHV A;  2FE8 A;  3GLG A;  1PJT A;  3W68 A;  2WSE F;  2CV1 A;  2XSZ A;  2L7I A;  4KOD A;  2VQE M;  1XMO M;  1SXJ E;  3UJN A;  4LFC M;  4XK8 F;  1DGB A;  1JB0 F;  2FFJ A;  4Y28 F;  4GH9 A;  2Y21 A;  4A3V B;  1CUK A;  2R0I A;  2LHG A;  4RF0 A;  4LZJ A;  1TH4 A;  1IN8 A;  1N75 A;  4XGI A;  4P17 A;  3PFI A;  5FTM A;  1D0L A;  2G5G X;  1IQP A;  1T3T A;  4NOO B;  3T38 A;  3U6S A;  1I94 M;  1N77 A;  3J27 B;  3LCV B;  3Q8X A;  4LZZ A;  5FLX S;  1VEK A;  4X65 M;  1TTE A;  2RGH A;  2C99 A;  2VDB B;  4CIS A;  2LBC A;  1IXS A;  2QEN A;  2B3T A;  4KT0 F;  1QAN A;  1UM8 A;  3TWK A;  3KOX E;  4F1I A;  2XLJ A;  1SXJ C;  2Y20 A;  5DFL A;  3SAT A;  1T6O A;  3AOE A;  7CAT A;  3LQQ A;  1YLA A;  2QBY A;  2UU9 M;  1NVM A;  4GEW A;  1K3X A;  3C9P A;  2UUC M;  2M5Z A;  4G4N A;  2I7N A;  3T6P A;  4LF9 M;  2O25 A;  1C1K A;  1NSF A;  2JP7 A;  4EIW A;  3FRI A;  4QOZ C;  2O5R A;  1QAO A;  1QUS A;  2R18 A;  3WHK A;  4LF5 M;  3HU2 A;  4LFA M;  1XXH B;  2JA2 A;  4JI4 M;  2LXE A;  1Q3C A;  3ZH9 B;  1Q3B A;  1T43 A;  2QPA A;  4GRI A;  1XWI A;  3GLH A;  5EXT A;  2W82 A;  1IBK M;  1IN5 A;  4NC6 A;  1DGH A;  4IJE A;  2A5Y B;  2D7G A;  3ILK A;  4M0W A;  4DBG B;  1QUT A;  3L2A A;  1KSF X;  4JI1 M;  2R6F A;  3T15 A;  3B7Z A;  3KSX A;  3GRR A;  1ZAE A;  3U5Z B;  1NJG A;  3K9O A;  4DV6 M;  1OTR A;  3HJ8 A;  5BR8 M;  1DGF A;  2R45 A;  1IN4 A;  2ZBK B;  3K92 A;  4FD2 A;  2Q2E B;  3TQS A;  2O01 F;  3THG A;  3U61 B;  1EE8 A;  2KA6 B;  5E6J A;  2BJV A;  3RFW A;  2L7H A;  2LHC A;  3E9S A;  3I04 M;  4HEO A;  4Z6Y A;  3J81 S;  4FWD A;  5FTK A;  2R4E A;  1PJS A;  2VQF M;  2LVO C;  2LTU A;  4LJA A;  5A2Q S;  2KZU A;  3VKH A;  1GO5 A;  2BNK A;  3FUV A;  4IJF A;  3TE6 A;  3GLI B;  1XNR M;  3FTF A;  4GHA A;  4TUW A;  2CWB A;  5EXS A;  1N78 A;  2RRU A;  2DWL A;  4LG2 A;  5IZ7 D;  4GKJ M;  4LRT A;  3HHX A;  3FD9 A;  1E32 A;  3RGS A;  4DV7 M;  1QZM A;  2JY6 B;  4B3S M;  3PNV A;  3WHL A;  3I01 M;  2DAM A;  4G4O A;  1KFV A;  2RGO A;  3FUU A;  2ZAM A;  5IWA M;  3SAS A;  3GRY A;  1MU5 A;  4X66 M;  4PDI A;  2LWX A;  4FWH A;  4BBA A;  1VEG A;  1WGL A;  2BJW A;  2JWS A;  3LMM A;  4JI0 M;  2OOA A;  4WUR A;  1LTM A;  2R65 A;  5KQ8 A;  4GMQ A;  2LH0 A;  4G6Z A;  4ITQ A;  3SC3 A;  3AL0 C;  4YY3 M;  3NWL A;  2JZ0 A;  2KNZ A;  4CIZ A;  4GKK M;  4GIP A;  4IBD A;  3PXG A;  4DV4 M;  3SYL A;  4BLC A;  3B89 A;  1K3W A;  1HNX M;  2DXI A;  4LF4 M;  4AG5 A;  4B3M M;  4JI2 M;  4AG6 A;  1L8Q A;  3H4M A;  2DZL A;  3IG5 A;  3U60 A;  3VK8 A;  4DR6 M;  4JI8 M;  2QQ8 A;  1XXH E;  1ORY B;  2L09 A;  4MGI E;  4OVZ A;  5L8R F;  3E46 A;  1J7K A;  2QHO B;  2F5P A;  2G3Q A;  4L8R C;  4DV2 M;  4K0K M;  5ITX A;  3ZQJ A;  3GPU A;  4LF8 M;  1DO0 A;  1X37 A;  2C96 A;  2C9O A;  3J80 S;  4AW4 A;  4DR2 M;  1IXS B;  1QVR A;  4OW0 A;  1L2D A;  2HKJ A;  3J2P B;  2Z7J A;  3A42 A;  4I4L A;  3W67 A;  5DNY A;  3DA1 A;  3QYE A;  3A46 A;  2QBY B;  1PGY A;  2EKF A;  4IBK A;  3U6Q A;  2KHH A;  3K9P A;  2YR0 A;  1SXJ A;  4FW9 A;  2F5N A;  1QZE A;  1TH2 A;  3L26 A;  4AQY M;  1XMQ M;  2BWB A;  3R8F A;  2QP9 X;  4L6V 6;  4BB9 A;  3GLF A;  3KS4 A;  2LVA A;  3AOG A;  4LJ7 A;  4WW0 A;  5KO3 A;  2UUA M;  4IBC A;  1HJP A;  2X8A A;  3B7Q A;  3U6L A;  3KOY E;  3CGW A;  1E94 E;  3J7B A;  1FJG M;  3LCU A;  3GLI E;  1LV7 A;  3FKE A;  4LY6 A;  1PM5 A;  1XB2 B;  1OAI A;  2LVP C;  3ZCB B;  1TR8 A;  2OO9 A;  2WSC F;  2D7H A;  3GLH B;  4R7G A;  4CJ6 A;  1OQY A;  2HCB A;  1Z5C A;  1XC8 A;  1DGH B;  3SAR A;  2N35 A;  4HLQ A;  4OU7 A;  4Z8X A;  2XF3 A;  5ITQ A;  4GC5 A;  3QAU A;  2LNH C;  4M0D A;  1GVN A;  2Y0T A;  2DWN A;  2X49 A;  2DWM A;  1GJS A;  2K6B A;  4JI7 M;  1JR3 D;  2HWJ A;  5EP3 A;  2K47 A;  2L4E A;  2Z8Y M;  1NO1 A;  3VFD A;  3UZU A;  1G41 A;  3SAU A;  4RKU F;  4LJ8 A;  2VF8 A;  3IEC A;  1YUB A;  1WGN A;  2F4V M;  2VF7 A;  1MX0 A;  1R4G A;  4MGZ E;  3KDS E;  4IBF A;  1WIV A;  2XH9 A;  2EUC A;  4LF6 M;  2V6Z M;  4IBE A;  2UXD M;  1Y8G A;  3C3D A;  4LCB A;  2DI0 A;  1OFH A;  1PJI A;  4IBG A;  2CV2 A;  1DGG A;  1C7Y A;  3LVV A;  3FTE A;  1OAO C;  3V76 A;  5FSW A;  2WZJ A;  4DUZ M;  3GRU A;  1GKI A;  4DR1 M;  3SMP A;  2DEN A;  4B08 A;  3FUW A;  3I4Y A;  1HT1 E;  2E5L M;  1GL7 A;  2L6O A;  2XSZ D;  3HJS A;  5JI3 E;  1QAQ A;  2L4F A;  4AKG A;  5EP4 A;  3GQ3 A;  1UFZ A;  3M6A A;  2XZF A;  1ZQ9 A;  4LGY A;  2FOI C;  3JAM S;  1VDL A;  4D80 A;  4QNM A;  1PJQ A;  2CV0 A;  2DWZ B;  1OJL A;  5E26 A;  3VDP A;  5GKN A;  4JXJ A;  2DAK A;  2XGN A;  2F5Q A;  1NNU C;  3RE8 A;  2GQF A;  2MR9 A;  1NNJ A;  1NHW C;  3GPY A;  2DHY A;  3U60 B;  2VII A;  1R2Z A;  2UXB M;  4I8O A;  1RU3 A;  1P3Q Q;  2C98 A;  1WJ7 A;  3HGI A;  3MK6 A;  5H37 D;  1N36 M;  3GRV A;  3GLH E;  1NY5 A;  2JXN A;  3HKP A;  1VG5 A;  3TPZ A;  4AKI A;  3KFU G;  3DZD A;  1IN6 A;  1BVS A;  3MJ5 A;  2K9D A;  3SFZ A;  3L28 A;  1N34 M;  1K82 A;  1NV8 A;  2YQZ A;  4AZF A;  1TDH A;  4M9S A;  8CAT A;  5FTL A;  2FS1 A;  2R62 A;  2KNA A;  4B7H A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  2DKL A;  4Q7J A;  1HT2 E;  1WR1 B;  4R71 A;  3LCV B;  3MMP A;  1Q02 A;  1VEK A;  2EJS A;  1PGY A;  1TTE A;  2EKF A;  2H5X A;  2KHH A;  3K9P A;  2LBC A;  1IXS A;  4F1I A;  2B3T A;  1QZE A;  5JI2 E;  2BWB A;  5DFL A;  2HAK A;  4WP2 A;  1DV0 A;  1T6O A;  1KYI A;  1HQY E;  3F92 A;  2LVA A;  1YLA A;  1F4I A;  4GEW A;  1HJP A;  4F2L A;  1DO2 A;  2L2D A;  1E94 E;  3LCU A;  3GLI E;  3T6P A;  1XB2 B;  1OAI A;  2LVP C;  2O25 A;  2JZ1 A;  1TR8 A;  2JP7 A;  2OO9 A;  3FRI A;  2OOB A;  1OQY A;  2CP8 A;  2R0I A;  1VEJ A;  1T43 A;  1IM2 A;  2QSF X;  3H4J A;  2DAE A;  3IHP A;  2HWJ A;  4DBG B;  1JR3 E;  2L4E A;  1G41 A;  1VQ1 A;  2JY7 A;  2LVN C;  3K9O A;  1OTR A;  3IEC A;  2QNJ A;  1WGN A;  4HEO A;  1ZMV A;  1R4G A;  3E21 A;  1WIV A;  2LVO C;  2LTU A;  2JY8 A;  1A5T A;  1GO5 A;  1Y8G A;  2DAG A;  1EFU B;  2CWB A;  2DI0 A;  3BBZ A;  1C7Y A;  2RRU A;  2JNH A;  2MGW A;  2JUJ A;  2MJ5 B;  2WZJ A;  2JY5 A;  2KNV A;  2JY6 B;  2MRO B;  3FE3 A;  2DAM A;  1OKS A;  2DEN A;  4G3O A;  3GLG E;  1IFY A;  1HT1 E;  2L4F A;  2LVQ D;  1UFZ A;  3GLF E;  1VEG A;  1WGL A;  1ZMU A;  2DAI A;  2OOA A;  1VDL A;  1MN3 A;  1G4A E;  1NV9 A;  2DAK A;  1SG9 A;  2JZ0 A;  2KNZ A;  2MR9 A;  1ZV1 A;  2DHY A;  1AIP C;  1G3I A;  3B89 A;  2ZTC A;  1WHC A;  1P3Q Q;  4UN2 B;  1WJ7 A;  2BWE A;  3GLH E;  2DZL A;  1VG5 A;  2K0B X;  1V92 A;  1XXH E;  1ZMW A;  3E46 A;  3FRH A;  1BVS A;  2EKK A;  2K9D A;  2QHO B;  2G3Q A;  1NV8 A;  2DNA A;  1DO0 A;  2KNA A;  1CUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...