2OOBA

Crystal structure of the uba domain from cbl-b ubiquitin ligase in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
LENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2oobA00
1P3QQ 2CWBA 1VEJA 1VG5A 2BWEA 1IXSA 2LVOC 3GLHE 2DAKA 1HT2E 1WR1B 1DV0A 1VEGA 1HJPA 3FRIA 3BBZA 2O25A 1BVSA 2L2DA 4WP2A 1UFZA 2QSFX 2QNJA 3FRHA 2HAKA 1WHCA 1WIVA 3K9PA 2RRUA 1KYIA 1DO2A 4F2LA 2KNVA 2JUJA 1NV9A 2JZ1A 1HT1E 1HQYE 1WJ7A 3B89A 1Q02A 2WZJA 2KNAA 5JI2E 3LCUA 2OOAA 2MGWA 2BWBA 3T6PA 1R4GA 2R0IA 4UN2B 1SG9A 2JP7A 4F1IA 2DKLA 1ZMWA 1XXHE 2JY7A 2LVPC 1TTEA 2DAMA 1G3IA 3GLGE 1GO5A 1XB2B 1AIPC 1MN3A 2G3QA 2LVQD 1DO0A 1A5TA 2MR9A 1OQYA 2DAEA 2KHHA 3E21A 1VQ1A 1G4AE 2B3TA 4G3OA 2MJ5B 1T43A 2L4EA 1OTRA 2K0BX 4HEOA 2EJSA 2ZTDA 2DHYA 3IHPA 1JR3E 4R71A 1Y8GA 2LVAA 2K9DA 3E46A 2EKFA 2HWJA 1C7YA 1T6OA 1VDLA 1QZEA 2DAGA 1EFUB 3LCVB 2QHOB 1E94E 2LVNC 2JY5A 1CUKA 3K9OA 2DAIA 4GEWA 3GLFE 1PGYA 2JZ0A 2DNAA 5DFLA 4Q7JA 4DBGB 2CP8A 2DENA 2JNHA 2OO9A 3IECA 3F92A 2JY6B 1G41A 3FE3A 2LBCA 1ZMVA 2MROB 1TR8A 1VEKA 2LTUA 1WGNA 2ZTCA 2KNZA 2H5XA 3MMPA 1IFYA 2EKKA 2JY8A 1OKSA 1NV8A 1F4IA 2DI0A 2OOBA 1V92A 3H4JA 1ZV1A 1WGLA 1ZMUA 2DZLA 2L4FA 1IM2A 3GLIE 1YLAA 1OAIA
chains in the Genus database with same CATH superfamily
3KOWE 1XXHA 1VEJA 4FD2A 2NQ8C 5BPVA 4LJ4A 3SMPA 3U6CA 1XMOM 2H1RA 4D81A 3SMSA 3B7ZA 3PVSA 2ZAOA 3GRVA 4MGZE 3T38A 1VEGA 3U60A 2CUZA 4FWHA 4REZA 2L7IA 2OQ4A 3TL4X 1S3SA 3HU1A 3NWLA 2CFOA 3I01M 4HLQA 5EXTA 2QSFX 4M0WA 2XFTA 3FRHA 1FJGM 2HAKA 4AQYM 1WIVA 3SATA 4II7A 2QENA 4MGHA 5L8RF 2KNVA 2V1UA 2JZ1A 4ZPXA 1Q02A 2XFSA 1IY1A 1LV7A 3HU2A 4AG6A 3GLFB 2WSFF 2X4AA 1R2YA 1QANA 3HJ8A 2RGOA 4IBFA 2BWBA 2R45A 4MH0E 1R4GA 5FTMA 2R0IA 2D7HA 4B7GA 4DV5M 4L16A 2VQEM 4LJ5A 5H37D 4B7FA 3SFZA 2BNKA 4DR6M 4DR1M 2DAMA 1IN4A 4G4OA 1GO5A 4LY6A 1XB2B 4JI5M 4IBCA 2QPAA 3CGWA 4WW0A 4XGIA 4X66M 1A5TA 2VIIA 1N33M 2KHHA 1LTMA 1QVRA 2W82A 1Z5CA 5KPTA 2KA6B 1IBKM 2VF7A 1HNZM 1G4AE 3DOAA 3J2PB 2O01F 4FVMA 3AJIB 4LFAM 2MJ5B 4CHTB 5A2QS 1QYRA 2K0BX 1GL6A 4LZZA 3VLFB 3L28A 2R44A 3LMMA 4LRTA 4PCZA 3J7AS 1IN6A 4B7HA 4RF0A 4IBKA 2YR0A 1TH4A 5IZ7D 3THGA 1SXJE 3M7GA 2KZSA 2HWJA 4DR3M 3PNYA 3V76A 1MU5A 1G71A 2JA2A 1Q3BA 1T6OA 1VDLA 1NO1A 3KS8A 1R7RA 3KOXE 3LCVB 5C18A 1DGHB 3GLIA 2CHGA 2LVNC 3QWLA 3W0FA 2MH8A 5ITXE 1CUKA 3HHYA 4LJAA 3K9OA 3GO8A 1GVNA 4GIPA 1DGGA 1PGYA 3GLHA 3U6EA 4NRVA 1HR0M 1N78A 2DNAA 3EIEA 4Q7JA 4YHHM 2CP8A 2DENA 2DXIA 3WHLA 4RF1A 1PJSA 3F92A 4CJ6A 1G41A 3KP1E 1ZQ9A 1E32A 5FLXS 3T1HM 1NNJA 2ZBKB 1TR8A 1NY5A 4EIWA 4DV4M 4PD2A 1QAOA 2YNMD 1QDRA 2L7HA 3MMPA 3WHKA 2HCBA 3L25A 3I4YA 2Z4RA 4CGYB 4LRSA 4FWGA 3U5ZA 2DI0A 2DWNA 1IQPA 3L27A 1V92A 3ZC7B 1ZV1A 4LGYA 3TWKA 1IN8A 1XMQM 2DZLA 4I8OA 4OU7A 1IM2A 1IY0A 3B9PA 2APLA 1R5LA 3TE6A 5DYIA 4R7GA 1HNWM 1JR3D 3R8FA 4B3SM 2UXCM 4YY3M 4JI3M 2BWEA 2KW0A 2CRUA 3HHZA 4G4QA 4MB7A 1IXSA 2F5PA 1W5SA 1V33A 3JAMS 4LF7M 4QHTA 1UM8A 2Z8YM 2D7GA 2DAKA 2V6ZM 3HKPA 2QP9X 1DV0A 4WURA 1HJPA 2AHMA 2G8LA 1OAOC 3FRIA 1SXJB 3T15A 3GPYA 1EIJA 1DGFA 2L2DA 1N75A 3W67A 4P16A 3CF2A 5ITUA 5EXPA 4DR7M 1NHGC 2XH9A 1MJGM 1AUAA 3DFZA 1WHCA 4LGMA 2RRUA 1T3TA 1NV9A 1HT1E 3UJNA 1HQYE 2CV1A 2KNAA 3SYLA 3K2LA 3A42A 4D82A 2HL7A 5DNYA 5GKNA 3T6PA 1N77A 1L2DA 1PJQA 1SXJD 3T1YM 3U6SA 2FNAA 3KS4A 4M9ZA 4X62M 1KSFX 1SG9A 5ITQA 2JWSA 1ZMWA 3HY5A 1HQCA 5JI3E 4IJFA 2LVPC 3JR4A 3MK6A 3MJ5A 3NBIA 4NSOB 3GLGE 3GLFA 3U6PA 4CISA 4JI8M 3TWLA 1AIPC 3U6DA 3J81S 5ITYA 1OQYA 2DAEA 2FS1A 3M6AA 3C58A 4LF5M 2FOIC 4LJ8A 3RGPA 1QUSA 2X49A 2R4EA 1YE9A 4HL4A 4DV3M 2FE8A 2CV2A 3FTDA 4M9SA 4K0KM 4NXMM 1Q39A 2L4EA 4IBGA 4HEOA 2XSZD 4PDIA 1YUBA 4NXNM 1L2CA 1JR3E 1NVMA 4GKKM 2K9DA 1MX0A 1XNQM 3HGIA 2LNHC 3D8BA 2EKFA 1XWIA 4FWDA 3FUUA 2UU9M 5FTLA 1L1TA 4DUYM 4JI4M 3B74A 1K3WA 1XXHB 1OIPA 3J80S 1J5EM 4QNRA 3KFUG 3W68A 1IXZA 2M5ZA 4OX9M 4GC9A 2KRUA 1VDDA 3UGJA 1SXJC 4JN6A 4ITQA 3E4RA 2CE7A 3U60B 2JZ0A 4Z6YA 4L6V6 4KT0F 2KEBA 5EP2A 4LF8M 4DBGB 4NL4H 4QOZC 4GKJM 5FTNA 1H6UA 2JNHA 1R2ZA 3BXWA 3IECA 1OJLA 1G8PA 3U61B 2F5OA 2M60A 3PNVA 3FE3A 2C98A 1PJIA 3FTFA 4MGKE 3ILKA 1ZMVA 2CHQA 2VDBB 3U6QA 3B7NA 1PJJA 3FTCA 4G4NA 4DR5M 1K82A 4I4LA 1K3XA 2KNZA 1XNRM 4LF4M 1QAMA 3VK7A 1IFYA 1PJTA 1OKSA 3GRUA 3VKGA 4LJ6A 2QBYA 1GJTA 3PFIA 4LJ9A 3GLGB 1PM5A 1X37A 2VQFM 5DYGA 3FKEA 4OW0A 5KQDA 4GITA 5EXXA 5IREB 1ZMUA 2I7NA 1YSYA 3AOGA 1V34A 1XHBA 3DA1A 3U6LA 4QOSA 2C96A 2C99A 3VFDA 3LW5F 2K47A 1J7KA 2DWMA 1VG5A 3KP0E 2QZ4A 2LVOC 4B3RM 3SAWA 2CV0A 5EP4A 4R3DA 3B7QA 3QAUA 3GQ5A 2F5QA 1BVSA 1JQJC 4LFBM 1J09A 3JR5A 2BJWA 3CTWB 3Q8GA 4WP2A 3NBXX 1N34M 4LFCM 3J27B 2QNJA 3QYBA 2R4JA 3H4MA 2O5RA 1PRBA 3ZCBB 1C1KA 1NJFA 3K92A 1KYIA 1DO2A 1QDTA 2G5GX 2R46A 2YFQA 3L2AA 4OVZB 4Z8XA 4F2LA 2UUCM 4IBEA 1SXJA 3RFWA 3K8ZA 2HKJA 2WSEF 3TWMA 3LCUA 3KVWA 1Z59A 2OOAA 2MGWA 1NHWC 1OFHA 1OIZA 3RGSA 3UK6A 2R6FA 2QCUA 3U6MA 3SBJA 4I81A 2JP7A 5ITXA 2LXEA 4LF9M 2DKLA 3AL0C 1GLNA 1ORYB 1XXHE 3R9XB 2DZOB 2Y0QA 1TH2A 1L8QA 1TTEA 4AW4A 1G3IA 3HHWA 4LG2A 4QNMA 3HU3A 3IG8A 1MN3A 2G3QA 2LVQD 3CF6E 5IWAM 1DO0A 3A45A 2V1CA 5FSWA 3VKHA 3E21A 1QAQA 1VQ1A 1FNNA 3KSXA 1TF0B 2DWZB 4CIZA 1IBMM 2J7NA 7CATA 2LHGA 3I04M 4LZJA 3W0LB 4BBAA 2Y20A 3DZDA 4AZFA 4B3TM 3IG5A 3A46A 4DV0M 2DHYA 2Y0TA 4Y28F 4AG5A 2C9OA 3IHPA 4IBBA 2XGNA 2LVAA 3E46A 4IBJA 3PXGA 5F3WA 4DV6M 3M0EA 3HX3A 4RNAA 1ZAEA 3FUTA 2EUCA 3GPPA 4M0DA 1D0MA 5EP3A 1QZEA 2BJVA 2DAGA 3UMMA 1GKIA 4NOOB 4NC6A 5E26A 4XK8F 2C5RA 2L6OA 2QHOB 4DUZM 2DZNB 3SHGB 1IXSB 2Y21A 2ZAMA 2I7PA 1JB0F 3FUVA 4B3MM 4AKIA 1Z5BA 2E5LM 4GC5A 5BR8M 2F5SA 4LJ7A 2CEAA 2D7EA 5DFLA 5E6JA 4PDGA 4X64M 2OO9A 3KXEC 3LVVA 2L09A 2C9CA 2JY6B 3FYDA 3HZJA 3FUXA 3HJQA 3RE8A 2MROB 2Z4SA 1Z5AA 4RKUF 3SARA 1WGNA 3C3DA 2FH0A 3FUWA 4KODA 1G59A 2JY8A 3VDPA 4GHLA 4L8RC 1NV8A 3GRYA 5EXSA 2RGHA 2N35A 3U61A 1D2NA 4NSRA 3SAVA 1IBLM 2R18A 4IJEA 1Q3CA 1RU3A 2F4VM 1N36M 1WGLA 4AKGA 2XF3A 2L4FA 3QYEA 1KFVA 4B08A 4DR2M 3GLIE 3I51A 4MM3B 4G4RA 1GJSA 2RKOA 1OFIA 1P3QQ 2CWBA 4M9XA 2X8AA 4KLNA 4D80A 2XLJA 1DGHA 1E9SA 2YQZA 2F5NA 3GLGA 2JXNA 2Z3XA 3VK8A 1NNUC 1TH3A 3GLHE 1IY2A 2FFJA 3FYCA 3FTEA 2XZUA 4DV1M 3SAUA 3AOEC 4S12A 1HT2E 4BLCA 1WR1B 3BBZA 4GMQA 2OPFA 2O25A 1TDHA 3BOSA 4JI0M 1UFZA 3C3EA 3KOYE 3FD9A 4IBIA 2HHHM 4P17A 3TPZA 1D0LA 2LH0A 3CF0A 3K9PA 4L4UA 1L2BA 4MGIE 4A3VB 1WXQA 2CHVA 1JR3A 2JUJA 1WJ7A 3KW6A 3B89A 2WZJA 2VF8A 1L1ZA 3AFHA 3HJSA 5JI2E 2UXDM 1E9RA 3C9PA 3K1JA 1TDZA 4GRIA 1XC8A 2Z7JA 4UN2B 1NY6A 3UZUA 5ITRA 2EO2A 2A5YB 4OVZA 4XBOA 4F1IA 4X65M 3GQ3A 1N32M 2JY7A 1IN5A 2ZM6M 2LWXA 3L26A 4DV7M 5LMUM 1I94M 5KO3A 1D0KA 2UXBM 4AI6A 3SYKA 2MR9A 3AKZA 2GNOA 3J7BA 4I5SA 2EA0A 4DR4M 5ITTA 3SHFA 5EQTA 1GL7A 2B3TA 4GH9A 3ZQJA 3OTOM 2DVWB 4JI1M 4LCBA 3SASA 4G3OA 4ANRA 2KRKA 5KPZA 1QZMA 4FCTA 5FTKA 1T43A 3HWSA 1OTRA 5KQ8A 3GLIB 2QBYB 2EJSA 3A98B 1DGBA 2ZTDA 3D8LA 4MGYE 1QQWA 2J7OA 4TUWA 4R71A 4NRWA 5EJCA 1Y8GA 1W5TA 4W5WA 3LQQA 3GLHB 4IBDA 1C7YA 4JXJA 3I4VA 3L29A 1EFUB 4PT5A 5KPRA 3AOEA 3U6OA 4BB9A 1E94E 5LMNM 3VDUA 5FTJA 3AV0A 2JY5A 4L15A 4FCVA 4FW9A 2DAIA 4GHAA 4GEWA 5C1BA 3GP1A 2XEPA 3GLFE 2DWLA 2XZFA 1EE8A 2XSZA 5IT9S 3ZH9B 3U5ZB 4JYAM 2LHCA 3E9SA 3GPUA 3MHVC 2GQFA 2Q2EB 3KSJA 1IXRC 2KDLA 1NSFA 2KXEA 2LBCA 3HHXA 2ZANA 2UUAM 1VEKA 2LTUA 4KO8A 8CATA 3KOZE 4AKHA 2P5TA 2ZTCA 1TGUA 3Q8XA 4G6ZA 4IIWA 2H5XA 4JV5M 2R62A 2EKKA 2QQ8A 3TQSA 1I4WA 2WSCF 1F4IA 2DHRA 4DV2M 2ERCA 4JI2M 4L78A 2OOBA 3GQ4A 4JI6M 4QHSA 4FCWA 2KZUA 5EP1A 3LQRA 3H4JA 3KDSE 4KHPM 1IN7A 1QUTA 4JI7M 1NJGA 1GABA 3GPXA 1Z6TA 4LF6M 3GRRA 3LVWA 1R6BX 3EIHA 3SC3A 2J5YA 2UUBM 2R65A 1HNXM 1YLAA 2K6BA 1OAIA
chains in the Genus database with same CATH topology
1P3QQ 2CWBA 1VEJA 1VG5A 2BWEA 1IXSA 2LVOC 3GLHE 2DAKA 1HT2E 1WR1B 1DV0A 1VEGA 1HJPA 3FRIA 3BBZA 2O25A 1BVSA 2L2DA 4WP2A 1UFZA 2QSFX 2QNJA 3FRHA 2HAKA 1WHCA 1WIVA 3K9PA 2RRUA 1KYIA 1DO2A 4F2LA 2KNVA 2JUJA 1NV9A 2JZ1A 1HT1E 1HQYE 1WJ7A 3B89A 1Q02A 2WZJA 2KNAA 5JI2E 3LCUA 2OOAA 2MGWA 2BWBA 3T6PA 1R4GA 2R0IA 4UN2B 1SG9A 2JP7A 4F1IA 2DKLA 1ZMWA 1XXHE 2JY7A 2LVPC 1TTEA 2DAMA 1G3IA 3GLGE 1GO5A 1XB2B 1AIPC 1MN3A 2G3QA 2LVQD 1DO0A 1A5TA 2MR9A 1OQYA 2DAEA 2KHHA 3E21A 1VQ1A 1G4AE 2B3TA 4G3OA 2MJ5B 1T43A 2L4EA 1OTRA 2K0BX 4HEOA 2EJSA 2ZTDA 2DHYA 3IHPA 1JR3E 4R71A 1Y8GA 2LVAA 2K9DA 3E46A 2EKFA 2HWJA 1C7YA 1T6OA 1VDLA 1QZEA 2DAGA 1EFUB 3LCVB 2QHOB 1E94E 2LVNC 2JY5A 1CUKA 3K9OA 2DAIA 4GEWA 3GLFE 1PGYA 2JZ0A 2DNAA 5DFLA 4Q7JA 4DBGB 2CP8A 2DENA 2JNHA 2OO9A 3IECA 3F92A 2JY6B 1G41A 3FE3A 2LBCA 1ZMVA 2MROB 1TR8A 1VEKA 2LTUA 1WGNA 2ZTCA 2KNZA 2H5XA 3MMPA 1IFYA 2EKKA 2JY8A 1OKSA 1NV8A 1F4IA 2DI0A 2OOBA 1V92A 3H4JA 1ZV1A 1WGLA 1ZMUA 2DZLA 2L4FA 1IM2A 3GLIE 1YLAA 1OAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3Q Q;  2CWB A;  1VEJ A;  1VG5 A;  2BWE A;  1IXS A;  2LVO C;  3GLH E;  2DAK A;  1HT2 E;  1WR1 B;  1DV0 A;  1VEG A;  1HJP A;  3FRI A;  3BBZ A;  2O25 A;  1BVS A;  2L2D A;  4WP2 A;  1UFZ A;  2QSF X;  2QNJ A;  3FRH A;  2HAK A;  1WHC A;  1WIV A;  3K9P A;  2RRU A;  1KYI A;  1DO2 A;  4F2L A;  2KNV A;  2JUJ A;  1NV9 A;  2JZ1 A;  1HT1 E;  1HQY E;  1WJ7 A;  3B89 A;  1Q02 A;  2WZJ A;  2KNA A;  5JI2 E;  3LCU A;  2OOA A;  2MGW A;  2BWB A;  3T6P A;  1R4G A;  2R0I A;  4UN2 B;  1SG9 A;  2JP7 A;  4F1I A;  2DKL A;  1ZMW A;  1XXH E;  2JY7 A;  2LVP C;  1TTE A;  2DAM A;  1G3I A;  3GLG E;  1GO5 A;  1XB2 B;  1AIP C;  1MN3 A;  2G3Q A;  2LVQ D;  1DO0 A;  1A5T A;  2MR9 A;  1OQY A;  2DAE A;  2KHH A;  3E21 A;  1VQ1 A;  1G4A E;  2B3T A;  4G3O A;  2MJ5 B;  1T43 A;  2L4E A;  1OTR A;  2K0B X;  4HEO A;  2EJS A;  2ZTD A;  2DHY A;  3IHP A;  1JR3 E;  4R71 A;  1Y8G A;  2LVA A;  2K9D A;  3E46 A;  2EKF A;  2HWJ A;  1C7Y A;  1T6O A;  1VDL A;  1QZE A;  2DAG A;  1EFU B;  3LCV B;  2QHO B;  1E94 E;  2LVN C;  2JY5 A;  1CUK A;  3K9O A;  2DAI A;  4GEW A;  3GLF E;  1PGY A;  2JZ0 A;  2DNA A;  5DFL A;  4Q7J A;  4DBG B;  2CP8 A;  2DEN A;  2JNH A;  2OO9 A;  3IEC A;  3F92 A;  2JY6 B;  1G41 A;  3FE3 A;  2LBC A;  1ZMV A;  2MRO B;  1TR8 A;  1VEK A;  2LTU A;  1WGN A;  2ZTC A;  2KNZ A;  2H5X A;  3MMP A;  1IFY A;  2EKK A;  2JY8 A;  1OKS A;  1NV8 A;  1F4I A;  2DI0 A;  2OOB A;  1V92 A;  3H4J A;  1ZV1 A;  1WGL A;  1ZMU A;  2DZL A;  2L4F A;  1IM2 A;  3GLI E;  1YLA A;  1OAI A; 
#chains in the Genus database with same CATH topology
 3KOW E;  1XXH A;  1VEJ A;  4FD2 A;  2NQ8 C;  5BPV A;  4LJ4 A;  3SMP A;  3U6C A;  1XMO M;  2H1R A;  4D81 A;  3SMS A;  3B7Z A;  3PVS A;  2ZAO A;  3GRV A;  4MGZ E;  3T38 A;  1VEG A;  3U60 A;  2CUZ A;  4FWH A;  4REZ A;  2L7I A;  2OQ4 A;  3TL4 X;  1S3S A;  3HU1 A;  3NWL A;  2CFO A;  3I01 M;  4HLQ A;  5EXT A;  2QSF X;  4M0W A;  2XFT A;  3FRH A;  1FJG M;  2HAK A;  4AQY M;  1WIV A;  3SAT A;  4II7 A;  2QEN A;  4MGH A;  5L8R F;  2KNV A;  2V1U A;  2JZ1 A;  4ZPX A;  1Q02 A;  2XFS A;  1IY1 A;  1LV7 A;  3HU2 A;  4AG6 A;  3GLF B;  2WSF F;  2X4A A;  1R2Y A;  1QAN A;  3HJ8 A;  2RGO A;  4IBF A;  2BWB A;  2R45 A;  4MH0 E;  1R4G A;  5FTM A;  2R0I A;  2D7H A;  4B7G A;  4DV5 M;  4L16 A;  2VQE M;  4LJ5 A;  5H37 D;  4B7F A;  3SFZ A;  2BNK A;  4DR6 M;  4DR1 M;  2DAM A;  1IN4 A;  4G4O A;  1GO5 A;  4LY6 A;  1XB2 B;  4JI5 M;  4IBC A;  2QPA A;  3CGW A;  4WW0 A;  4XGI A;  4X66 M;  1A5T A;  2VII A;  1N33 M;  2KHH A;  1LTM A;  1QVR A;  2W82 A;  1Z5C A;  5KPT A;  2KA6 B;  1IBK M;  2VF7 A;  1HNZ M;  1G4A E;  3DOA A;  3J2P B;  2O01 F;  4FVM A;  3AJI B;  4LFA M;  2MJ5 B;  4CHT B;  5A2Q S;  1QYR A;  2K0B X;  1GL6 A;  4LZZ A;  3VLF B;  3L28 A;  2R44 A;  3LMM A;  4LRT A;  4PCZ A;  3J7A S;  1IN6 A;  4B7H A;  4RF0 A;  4IBK A;  2YR0 A;  1TH4 A;  5IZ7 D;  3THG A;  1SXJ E;  3M7G A;  2KZS A;  2HWJ A;  4DR3 M;  3PNY A;  3V76 A;  1MU5 A;  1G71 A;  2JA2 A;  1Q3B A;  1T6O A;  1VDL A;  1NO1 A;  3KS8 A;  1R7R A;  3KOX E;  3LCV B;  5C18 A;  1DGH B;  3GLI A;  2CHG A;  2LVN C;  3QWL A;  3W0F A;  2MH8 A;  5ITX E;  1CUK A;  3HHY A;  4LJA A;  3K9O A;  3GO8 A;  1GVN A;  4GIP A;  1DGG A;  1PGY A;  3GLH A;  3U6E A;  4NRV A;  1HR0 M;  1N78 A;  2DNA A;  3EIE A;  4Q7J A;  4YHH M;  2CP8 A;  2DEN A;  2DXI A;  3WHL A;  4RF1 A;  1PJS A;  3F92 A;  4CJ6 A;  1G41 A;  3KP1 E;  1ZQ9 A;  1E32 A;  5FLX S;  3T1H M;  1NNJ A;  2ZBK B;  1TR8 A;  1NY5 A;  4EIW A;  4DV4 M;  4PD2 A;  1QAO A;  2YNM D;  1QDR A;  2L7H A;  3MMP A;  3WHK A;  2HCB A;  3L25 A;  3I4Y A;  2Z4R A;  4CGY B;  4LRS A;  4FWG A;  3U5Z A;  2DI0 A;  2DWN A;  1IQP A;  3L27 A;  1V92 A;  3ZC7 B;  1ZV1 A;  4LGY A;  3TWK A;  1IN8 A;  1XMQ M;  2DZL A;  4I8O A;  4OU7 A;  1IM2 A;  1IY0 A;  3B9P A;  2APL A;  1R5L A;  3TE6 A;  5DYI A;  4R7G A;  1HNW M;  1JR3 D;  3R8F A;  4B3S M;  2UXC M;  4YY3 M;  4JI3 M;  2BWE A;  2KW0 A;  2CRU A;  3HHZ A;  4G4Q A;  4MB7 A;  1IXS A;  2F5P A;  1W5S A;  1V33 A;  3JAM S;  4LF7 M;  4QHT A;  1UM8 A;  2Z8Y M;  2D7G A;  2DAK A;  2V6Z M;  3HKP A;  2QP9 X;  1DV0 A;  4WUR A;  1HJP A;  2AHM A;  2G8L A;  1OAO C;  3FRI A;  1SXJ B;  3T15 A;  3GPY A;  1EIJ A;  1DGF A;  2L2D A;  1N75 A;  3W67 A;  4P16 A;  3CF2 A;  5ITU A;  5EXP A;  4DR7 M;  1NHG C;  2XH9 A;  1MJG M;  1AUA A;  3DFZ A;  1WHC A;  4LGM A;  2RRU A;  1T3T A;  1NV9 A;  1HT1 E;  3UJN A;  1HQY E;  2CV1 A;  2KNA A;  3SYL A;  3K2L A;  3A42 A;  4D82 A;  2HL7 A;  5DNY A;  5GKN A;  3T6P A;  1N77 A;  1L2D A;  1PJQ A;  1SXJ D;  3T1Y M;  3U6S A;  2FNA A;  3KS4 A;  4M9Z A;  4X62 M;  1KSF X;  1SG9 A;  5ITQ A;  2JWS A;  1ZMW A;  3HY5 A;  1HQC A;  5JI3 E;  4IJF A;  2LVP C;  3JR4 A;  3MK6 A;  3MJ5 A;  3NBI A;  4NSO B;  3GLG E;  3GLF A;  3U6P A;  4CIS A;  4JI8 M;  3TWL A;  1AIP C;  3U6D A;  3J81 S;  5ITY A;  1OQY A;  2DAE A;  2FS1 A;  3M6A A;  3C58 A;  4LF5 M;  2FOI C;  4LJ8 A;  3RGP A;  1QUS A;  2X49 A;  2R4E A;  1YE9 A;  4HL4 A;  4DV3 M;  2FE8 A;  2CV2 A;  3FTD A;  4M9S A;  4K0K M;  4NXM M;  1Q39 A;  2L4E A;  4IBG A;  4HEO A;  2XSZ D;  4PDI A;  1YUB A;  4NXN M;  1L2C A;  1JR3 E;  1NVM A;  4GKK M;  2K9D A;  1MX0 A;  1XNQ M;  3HGI A;  2LNH C;  3D8B A;  2EKF A;  1XWI A;  4FWD A;  3FUU A;  2UU9 M;  5FTL A;  1L1T A;  4DUY M;  4JI4 M;  3B74 A;  1K3W A;  1XXH B;  1OIP A;  3J80 S;  1J5E M;  4QNR A;  3KFU G;  3W68 A;  1IXZ A;  2M5Z A;  4OX9 M;  4GC9 A;  2KRU A;  1VDD A;  3UGJ A;  1SXJ C;  4JN6 A;  4ITQ A;  3E4R A;  2CE7 A;  3U60 B;  2JZ0 A;  4Z6Y A;  4L6V 6;  4KT0 F;  2KEB A;  5EP2 A;  4LF8 M;  4DBG B;  4NL4 H;  4QOZ C;  4GKJ M;  5FTN A;  1H6U A;  2JNH A;  1R2Z A;  3BXW A;  3IEC A;  1OJL A;  1G8P A;  3U61 B;  2F5O A;  2M60 A;  3PNV A;  3FE3 A;  2C98 A;  1PJI A;  3FTF A;  4MGK E;  3ILK A;  1ZMV A;  2CHQ A;  2VDB B;  3U6Q A;  3B7N A;  1PJJ A;  3FTC A;  4G4N A;  4DR5 M;  1K82 A;  4I4L A;  1K3X A;  2KNZ A;  1XNR M;  4LF4 M;  1QAM A;  3VK7 A;  1IFY A;  1PJT A;  1OKS A;  3GRU A;  3VKG A;  4LJ6 A;  2QBY A;  1GJT A;  3PFI A;  4LJ9 A;  3GLG B;  1PM5 A;  1X37 A;  2VQF M;  5DYG A;  3FKE A;  4OW0 A;  5KQD A;  4GIT A;  5EXX A;  5IRE B;  1ZMU A;  2I7N A;  1YSY A;  3AOG A;  1V34 A;  1XHB A;  3DA1 A;  3U6L A;  4QOS A;  2C96 A;  2C99 A;  3VFD A;  3LW5 F;  2K47 A;  1J7K A;  2DWM A;  1VG5 A;  3KP0 E;  2QZ4 A;  2LVO C;  4B3R M;  3SAW A;  2CV0 A;  5EP4 A;  4R3D A;  3B7Q A;  3QAU A;  3GQ5 A;  2F5Q A;  1BVS A;  1JQJ C;  4LFB M;  1J09 A;  3JR5 A;  2BJW A;  3CTW B;  3Q8G A;  4WP2 A;  3NBX X;  1N34 M;  4LFC M;  3J27 B;  2QNJ A;  3QYB A;  2R4J A;  3H4M A;  2O5R A;  1PRB A;  3ZCB B;  1C1K A;  1NJF A;  3K92 A;  1KYI A;  1DO2 A;  1QDT A;  2G5G X;  2R46 A;  2YFQ A;  3L2A A;  4OVZ B;  4Z8X A;  4F2L A;  2UUC M;  4IBE A;  1SXJ A;  3RFW A;  3K8Z A;  2HKJ A;  2WSE F;  3TWM A;  3LCU A;  3KVW A;  1Z59 A;  2OOA A;  2MGW A;  1NHW C;  1OFH A;  1OIZ A;  3RGS A;  3UK6 A;  2R6F A;  2QCU A;  3U6M A;  3SBJ A;  4I81 A;  2JP7 A;  5ITX A;  2LXE A;  4LF9 M;  2DKL A;  3AL0 C;  1GLN A;  1ORY B;  1XXH E;  3R9X B;  2DZO B;  2Y0Q A;  1TH2 A;  1L8Q A;  1TTE A;  4AW4 A;  1G3I A;  3HHW A;  4LG2 A;  4QNM A;  3HU3 A;  3IG8 A;  1MN3 A;  2G3Q A;  2LVQ D;  3CF6 E;  5IWA M;  1DO0 A;  3A45 A;  2V1C A;  5FSW A;  3VKH A;  3E21 A;  1QAQ A;  1VQ1 A;  1FNN A;  3KSX A;  1TF0 B;  2DWZ B;  4CIZ A;  1IBM M;  2J7N A;  7CAT A;  2LHG A;  3I04 M;  4LZJ A;  3W0L B;  4BBA A;  2Y20 A;  3DZD A;  4AZF A;  4B3T M;  3IG5 A;  3A46 A;  4DV0 M;  2DHY A;  2Y0T A;  4Y28 F;  4AG5 A;  2C9O A;  3IHP A;  4IBB A;  2XGN A;  2LVA A;  3E46 A;  4IBJ A;  3PXG A;  5F3W A;  4DV6 M;  3M0E A;  3HX3 A;  4RNA A;  1ZAE A;  3FUT A;  2EUC A;  3GPP A;  4M0D A;  1D0M A;  5EP3 A;  1QZE A;  2BJV A;  2DAG A;  3UMM A;  1GKI A;  4NOO B;  4NC6 A;  5E26 A;  4XK8 F;  2C5R A;  2L6O A;  2QHO B;  4DUZ M;  2DZN B;  3SHG B;  1IXS B;  2Y21 A;  2ZAM A;  2I7P A;  1JB0 F;  3FUV A;  4B3M M;  4AKI A;  1Z5B A;  2E5L M;  4GC5 A;  5BR8 M;  2F5S A;  4LJ7 A;  2CEA A;  2D7E A;  5DFL A;  5E6J A;  4PDG A;  4X64 M;  2OO9 A;  3KXE C;  3LVV A;  2L09 A;  2C9C A;  2JY6 B;  3FYD A;  3HZJ A;  3FUX A;  3HJQ A;  3RE8 A;  2MRO B;  2Z4S A;  1Z5A A;  4RKU F;  3SAR A;  1WGN A;  3C3D A;  2FH0 A;  3FUW A;  4KOD A;  1G59 A;  2JY8 A;  3VDP A;  4GHL A;  4L8R C;  1NV8 A;  3GRY A;  5EXS A;  2RGH A;  2N35 A;  3U61 A;  1D2N A;  4NSR A;  3SAV A;  1IBL M;  2R18 A;  4IJE A;  1Q3C A;  1RU3 A;  2F4V M;  1N36 M;  1WGL A;  4AKG A;  2XF3 A;  2L4F A;  3QYE A;  1KFV A;  4B08 A;  4DR2 M;  3GLI E;  3I51 A;  4MM3 B;  4G4R A;  1GJS A;  2RKO A;  1OFI A;  1P3Q Q;  2CWB A;  4M9X A;  2X8A A;  4KLN A;  4D80 A;  2XLJ A;  1DGH A;  1E9S A;  2YQZ A;  2F5N A;  3GLG A;  2JXN A;  2Z3X A;  3VK8 A;  1NNU C;  1TH3 A;  3GLH E;  1IY2 A;  2FFJ A;  3FYC A;  3FTE A;  2XZU A;  4DV1 M;  3SAU A;  3AOE C;  4S12 A;  1HT2 E;  4BLC A;  1WR1 B;  3BBZ A;  4GMQ A;  2OPF A;  2O25 A;  1TDH A;  3BOS A;  4JI0 M;  1UFZ A;  3C3E A;  3KOY E;  3FD9 A;  4IBI A;  2HHH M;  4P17 A;  3TPZ A;  1D0L A;  2LH0 A;  3CF0 A;  3K9P A;  4L4U A;  1L2B A;  4MGI E;  4A3V B;  1WXQ A;  2CHV A;  1JR3 A;  2JUJ A;  1WJ7 A;  3KW6 A;  3B89 A;  2WZJ A;  2VF8 A;  1L1Z A;  3AFH A;  3HJS A;  5JI2 E;  2UXD M;  1E9R A;  3C9P A;  3K1J A;  1TDZ A;  4GRI A;  1XC8 A;  2Z7J A;  4UN2 B;  1NY6 A;  3UZU A;  5ITR A;  2EO2 A;  2A5Y B;  4OVZ A;  4XBO A;  4F1I A;  4X65 M;  3GQ3 A;  1N32 M;  2JY7 A;  1IN5 A;  2ZM6 M;  2LWX A;  3L26 A;  4DV7 M;  5LMU M;  1I94 M;  5KO3 A;  1D0K A;  2UXB M;  4AI6 A;  3SYK A;  2MR9 A;  3AKZ A;  2GNO A;  3J7B A;  4I5S A;  2EA0 A;  4DR4 M;  5ITT A;  3SHF A;  5EQT A;  1GL7 A;  2B3T A;  4GH9 A;  3ZQJ A;  3OTO M;  2DVW B;  4JI1 M;  4LCB A;  3SAS A;  4G3O A;  4ANR A;  2KRK A;  5KPZ A;  1QZM A;  4FCT A;  5FTK A;  1T43 A;  3HWS A;  1OTR A;  5KQ8 A;  3GLI B;  2QBY B;  2EJS A;  3A98 B;  1DGB A;  2ZTD A;  3D8L A;  4MGY E;  1QQW A;  2J7O A;  4TUW A;  4R71 A;  4NRW A;  5EJC A;  1Y8G A;  1W5T A;  4W5W A;  3LQQ A;  3GLH B;  4IBD A;  1C7Y A;  4JXJ A;  3I4V A;  3L29 A;  1EFU B;  4PT5 A;  5KPR A;  3AOE A;  3U6O A;  4BB9 A;  1E94 E;  5LMN M;  3VDU A;  5FTJ A;  3AV0 A;  2JY5 A;  4L15 A;  4FCV A;  4FW9 A;  2DAI A;  4GHA A;  4GEW A;  5C1B A;  3GP1 A;  2XEP A;  3GLF E;  2DWL A;  2XZF A;  1EE8 A;  2XSZ A;  5IT9 S;  3ZH9 B;  3U5Z B;  4JYA M;  2LHC A;  3E9S A;  3GPU A;  3MHV C;  2GQF A;  2Q2E B;  3KSJ A;  1IXR C;  2KDL A;  1NSF A;  2KXE A;  2LBC A;  3HHX A;  2ZAN A;  2UUA M;  1VEK A;  2LTU A;  4KO8 A;  8CAT A;  3KOZ E;  4AKH A;  2P5T A;  2ZTC A;  1TGU A;  3Q8X A;  4G6Z A;  4IIW A;  2H5X A;  4JV5 M;  2R62 A;  2EKK A;  2QQ8 A;  3TQS A;  1I4W A;  2WSC F;  1F4I A;  2DHR A;  4DV2 M;  2ERC A;  4JI2 M;  4L78 A;  2OOB A;  3GQ4 A;  4JI6 M;  4QHS A;  4FCW A;  2KZU A;  5EP1 A;  3LQR A;  3H4J A;  3KDS E;  4KHP M;  1IN7 A;  1QUT A;  4JI7 M;  1NJG A;  1GAB A;  3GPX A;  1Z6T A;  4LF6 M;  3GRR A;  3LVW A;  1R6B X;  3EIH A;  3SC3 A;  2J5Y A;  2UUB M;  2R65 A;  1HNX M;  1YLA A;  2K6B A;  1OAI A; 
#chains in the Genus database with same CATH homology
 1P3Q Q;  2CWB A;  1VEJ A;  1VG5 A;  2BWE A;  1IXS A;  2LVO C;  3GLH E;  2DAK A;  1HT2 E;  1WR1 B;  1DV0 A;  1VEG A;  1HJP A;  3FRI A;  3BBZ A;  2O25 A;  1BVS A;  2L2D A;  4WP2 A;  1UFZ A;  2QSF X;  2QNJ A;  3FRH A;  2HAK A;  1WHC A;  1WIV A;  3K9P A;  2RRU A;  1KYI A;  1DO2 A;  4F2L A;  2KNV A;  2JUJ A;  1NV9 A;  2JZ1 A;  1HT1 E;  1HQY E;  1WJ7 A;  3B89 A;  1Q02 A;  2WZJ A;  2KNA A;  5JI2 E;  3LCU A;  2OOA A;  2MGW A;  2BWB A;  3T6P A;  1R4G A;  2R0I A;  4UN2 B;  1SG9 A;  2JP7 A;  4F1I A;  2DKL A;  1ZMW A;  1XXH E;  2JY7 A;  2LVP C;  1TTE A;  2DAM A;  1G3I A;  3GLG E;  1GO5 A;  1XB2 B;  1AIP C;  1MN3 A;  2G3Q A;  2LVQ D;  1DO0 A;  1A5T A;  2MR9 A;  1OQY A;  2DAE A;  2KHH A;  3E21 A;  1VQ1 A;  1G4A E;  2B3T A;  4G3O A;  2MJ5 B;  1T43 A;  2L4E A;  1OTR A;  2K0B X;  4HEO A;  2EJS A;  2ZTD A;  2DHY A;  3IHP A;  1JR3 E;  4R71 A;  1Y8G A;  2LVA A;  2K9D A;  3E46 A;  2EKF A;  2HWJ A;  1C7Y A;  1T6O A;  1VDL A;  1QZE A;  2DAG A;  1EFU B;  3LCV B;  2QHO B;  1E94 E;  2LVN C;  2JY5 A;  1CUK A;  3K9O A;  2DAI A;  4GEW A;  3GLF E;  1PGY A;  2JZ0 A;  2DNA A;  5DFL A;  4Q7J A;  4DBG B;  2CP8 A;  2DEN A;  2JNH A;  2OO9 A;  3IEC A;  3F92 A;  2JY6 B;  1G41 A;  3FE3 A;  2LBC A;  1ZMV A;  2MRO B;  1TR8 A;  1VEK A;  2LTU A;  1WGN A;  2ZTC A;  2KNZ A;  2H5X A;  3MMP A;  1IFY A;  2EKK A;  2JY8 A;  1OKS A;  1NV8 A;  1F4I A;  2DI0 A;  2OOB A;  1V92 A;  3H4J A;  1ZV1 A;  1WGL A;  1ZMU A;  2DZL A;  2L4F A;  1IM2 A;  3GLI E;  1YLA A;  1OAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...