2CWBA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin.
pubmed doi rcsb
source organism Streptococcus sp., homo sapiens
total genus 12
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2005-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cwbA00
2DAGA 2KHHA 1HJPA 1SG9A 2JNHA 4HEOA 2B3TA 2OOBA 1VQ1A 3GLHE 1T43A 1OQYA 1IXSA 1T6OA 2EKKA 3GLFE 2DNAA 4F1IA 3B89A 1EFUB 1V92A 3K9PA 2JY6B 1P3QQ 2JZ0A 1R4GA 2ZTDA 1ZMVA 2JZ1A 4G3OA 1VDLA 2EJSA 3K9OA 2QSFX 2MR9A 1NV8A 2DHYA 4Q7JA 2QHOB 1WGNA 2MJ5B 4UN2B 3F92A 2QNJA 1VEJA 2EKFA 2R0IA 2MGWA 2BWEA 2CP8A 2JY5A 1WIVA 2K9DA 4DBGB 2JUJA 2LVQD 1G3IA 2DAMA 1DO0A 2JY8A 3T6PA 1OKSA 2LVNC 2LVPC 1WR1B 3BBZA 1UFZA 1KYIA 5JI2E 2LBCA 2HWJA 2JP7A 2KNZA 1F4IA 1OAIA 1TR8A 2MROB 2WZJA 1HT1E 1MN3A 1HQYE 2CWBA 4WP2A 3E21A 1VEGA 1Y8GA 2DAEA 3MMPA 1XB2B 1VEKA 2K0BX 4GEWA 3LCUA 2KNAA 1AIPC 2DENA 1C7YA 1VG5A 4F2LA 2OOAA 2LVAA 2O25A 3E46A 1WHCA 1WGLA 1ZMUA 1QZEA 3FRHA 3IHPA 3H4JA 1DV0A 2DKLA 2G3QA 1IFYA 2OO9A 2LVOC 1E94E 2RRUA 1GO5A 2ZTCA 1G4AE 3LCVB 2DAIA 1ZV1A 5DFLA 1BVSA 2DZLA 2L4FA 1WJ7A 3GLGE 2L2DA 1IM2A 2KNVA 2H5XA 1G41A 3GLIE 1YLAA 1OTRA 1DO2A 1PGYA 3FE3A 4R71A 1Q02A 3IECA 2DAKA 1JR3E 1ZMWA 2BWBA 2HAKA 1A5TA 3FRIA 2L4EA 2JY7A 2DI0A 1CUKA 2LTUA 1HT2E 1XXHE 1TTEA 1NV9A
chains in the Genus database with same CATH superfamily
3A98B 3HJQA 1NHGC 1UM8A 1N32M 4JI7M 2RGHA 3AOEC 2Y21A 1HJPA 2JNHA 3HJ8A 1PJQA 4IBEA 4MGZE 5LMNM 2XLJA 4B3TM 3DFZA 4AW4A 1IXSA 5ITYA 1Q39A 4M9SA 3GLFE 3B89A 1WXQA 5EJCA 2CFOA 4LGMA 2JY6B 1W5SA 2L6OA 5DYGA 2FS1A 1OAOC 3KOWE 2FE8A 3JR5A 3B7ZA 2ZTDA 3KVWA 4G3OA 2QQ8A 1N75A 4CIZA 3ZH9B 3GLHB 1ORYB 2MR9A 1NV8A 5EP2A 1IBLM 1XWIA 1J5EM 4AQYM 3C3EA 3HGIA 2OPFA 4MH0E 3FUUA 4UN2B 4G4NA 3F92A 4QNRA 4JI2M 2W82A 3NWLA 3U60B 3C3DA 2YFQA 2DWLA 3HWSA 1W5TA 4JN6A 2DHRA 3EIEA 4S12A 2V1UA 3K8ZA 4DBGB 5KO3A 3AKZA 2KZUA 1QDRA 4M9XA 3SATA 4LJ9A 2CV1A 2F4VM 5EP1A 3ILKA 5BR8M 2JY8A 2LVPC 3I04M 5F3WA 1JR3A 1QAOA 1TDZA 2XGNA 3SAWA 2RGOA 1NY6A 3AL0C 2LBCA 4AG6A 1GL7A 5KQ8A 2DZNB 3SYLA 3CTWB 3M6AA 4CISA 4D80A 3DZDA 1IXZA 1KFVA 1C1KA 1NNJA 3HU1A 3MK6A 2L09A 3E9SA 3SBJA 4EIWA 4DV4M 3T1HM 4RKUF 3T38A 1DGBA 1MN3A 1QVRA 3A45A 4LF5M 3MMPA 1NSFA 4GEWA 1OJLA 2QBYB 2VDBB 2XF3A 1XC8A 4OVZA 2DENA 3LQRA 4JI5M 1OFHA 3GLIA 2VF7A 1QZMA 3AJIB 4KT0F 1H6UA 4II7A 2K47A 3SMSA 3K1JA 4A3VB 1L1ZA 3J7AS 1RU3A 4HLQA 3I4YA 3ZC7B 1MX0A 1YE9A 2HKJA 3Q8XA 4LJ5A 2UXDM 1OFIA 4WW0A 3IHPA 2UUBM 3PNVA 2DKLA 1D0MA 2G3QA 4FD2A 3GQ5A 4B3SM 2OO9A 4GHAA 2C99A 2WSCF 3B9PA 3QAUA 1SXJB 3TWMA 1Q3BA 5IZ7D 4KHPM 2CHQA 5ITTA 2R4JA 4DR2M 3TQSA 3LQQA 2CV2A 3GPYA 2OQ4A 2DZLA 3K2LA 4NOOB 4LZZA 2XZUA 2L4FA 2R45A 3FUTA 3FTFA 2WSEF 4G4QA 3EIHA 1DGHB 2H5XA 3I51A 4D81A 1QUTA 2Y0TA 4LJ4A 1YLAA 4MGHA 1JB0F 4R71A 2XH9A 2KEBA 1E9SA 3U6EA 4AKIA 1NO1A 2RKOA 4L16A 3W67A 3L26A 3HY5A 3SHGB 3KDSE 1ZMWA 4LRTA 4B08A 3VK7A 1V33A 5JI3E 4L15A 3FRIA 1N33M 7CATA 3IG5A 1CUKA 1NJFA 3BOSA 4IIWA 1IXRC 1XXHE 3LVWA 1K3WA 4I4LA 1TTEA 1NV9A 4LCBA 5GKNA 2KHHA 4LJ6A 2Z4RA 5FTKA 3KOYE 4AKHA 1SG9A 3A42A 3JR4A 4HEOA 1SXJA 4M9ZA 2CHVA 3HHWA 1I94M 1OQYA 1T6OA 4XBOA 1DGGA 4MGYE 2KA6B 3ZQJA 2ZANA 3DOAA 4JV5M 3J7BA 4GC5A 2L7IA 4DR1M 5EXXA 5DYIA 2UU9M 3VFDA 4LF7M 1DGHA 3FUXA 3Q8GA 4M0WA 4NRWA 2DWZB 2CV0A 3GLGB 1OIZA 1R2ZA 2ZBKB 1FJGM 1Z59A 3K9OA 4GC9A 2DWMA 3GRRA 3WHLA 2Z7JA 3RFWA 3GRUA 3CF0A 3HZJA 4Q7JA 3FYCA 4IBDA 2MJ5B 2Z4SA 3HU3A 3VK8A 4AKGA 1JQJC 5LMUM 2QNJA 1YUBA 2HCBA 3THGA 4G4RA 2BNKA 2R0IA 3V76A 3U61B 2HL7A 1TH3A 3TL4X 3KS4A 2O01F 4IBBA 1GL6A 5ITRA 3GPXA 4JXJA 1ZAEA 4P16A 1GJTA 4LJAA 4JI1M 4PD2A 2JUJA 2C98A 2NQ8C 1G3IA 2DAMA 3KSJA 2YR0A 3B7QA 3MHVC 5E26A 3OTOM 4DV6M 1DO0A 1GKIA 2LVNC 2R46A 3QWLA 4IJFA 5KPZA 5ITQA 5FLXS 4PDGA 1UFZA 2LH0A 5JI2E 1J09A 5FTLA 2M5ZA 3UGJA 1OAIA 4YHHM 4B7GA 5C18A 1QYRA 3FUWA 5ITXA 4B3RM 4MGIE 2FOIC 2MROB 5DNYA 2UXBM 3VDPA 1IY0A 4OX9M 3TWKA 1HT1E 3DA1A 4CGYB 2KZSA 2CWBA 2K6BA 4Z8XA 2VQEM 2DAEA 3LVVA 1XB2B 1VEKA 2K0BX 4LF4M 3J81S 4LFBM 3GLGA 4R7GA 3C58A 4X62M 2KNAA 1C7YA 1GLNA 1FNNA 4LRSA 4L4UA 2KRUA 3E46A 3FKEA 3FTCA 4LF8M 3D8BA 4TUWA 2KRKA 3KOZE 3H4JA 4Y28F 3T15A 1N77A 2WSFF 1IFYA 3B7NA 1IN7A 2QP9X 1E94E 1EE8A 3U6CA 3SAUA 1G4AE 1PM5A 3U6QA 3U6SA 3U5ZB 4RF0A 1BVSA 5EXTA 1SXJD 2YNMD 3MJ5A 4X66M 2F5PA 2ZAOA 3NBIA 2XFSA 1NNUC 2BJWA 2F5SA 3J80S 1I4WA 2L2DA 3L29A 4DR4M 3LW5F 1L2BA 3GLIE 1NVMA 1SXJC 1XNRM 3CGWA 2N35A 3GLHA 2R6FA 2X4AA 3FE3A 2KDLA 1PJTA 4XK8F 2F5NA 3L25A 2VQFM 3U6MA 2ERCA 1AUAA 4NSRA 4CJ6A 3U60A 2HAKA 2UUCM 5EXPA 3GQ3A 3T1YM 4B7HA 1HNZM 3PVSA 2DXIA 1L8QA 4QOZC 2CRUA 1D0KA 4AI6A 2LTUA 3FYDA 3HU2A 4KLNA 1D2NA 2JA2A 1QAQA 3H4MA 4NRVA 3FUVA 3UMMA 2LHGA 1QQWA 4AG5A 3GPUA 3W0LB 4OW0A 4QOSA 2HHHM 2B3TA 2Q2EB 3GRVA 1T43A 4RNAA 1G8PA 4X64M 2EKKA 3VKHA 2DNAA 4F1IA 1XXHB 2X49A 1L2DA 2J7OA 4BLCA 3J27B 4LFAM 3VLFB 3E4RA 3L27A 5FTMA 4DV1M 4I8OA 4JI6M 1R6BX 2JZ0A 1HQCA 4FCWA 3HHYA 1ZMVA 3M0EA 3M7GA 2QBYA 2JZ1A 3GP1A 1VDLA 2QZ4A 1Z6TA 2EJSA 2VIIA 4MB7A 2V1CA 3GPPA 4REZA 1XMQM 4DR7M 3KFUG 2XEPA 1R2YA 5A2QS 8CATA 1V34A 4FWDA 4IBCA 5EXSA 3KS8A 5KPRA 4GH9A 4LJ8A 2AHMA 1VDDA 1R5LA 1SXJE 1VEJA 2EKFA 1LTMA 2I7NA 3HHXA 3SHFA 4D82A 2C5RA 3TE6A 2BWEA 2JY5A 1WIVA 4FVMA 1JR3D 3L28A 3SFZA 2LVQD 2D7GA 2X8AA 3T6PA 2XSZA 1OIPA 3AFHA 1NY5A 1WR1B 5EQTA 5C1BA 4DV7M 2V6ZM 2DVWB 1Z5BA 3KSXA 5IREB 2HWJA 3KP1E 4DR3M 3UK6A 4B3MM 2KNZA 2R44A 2DZOB 4B7FA 1IXSB 4JYAM 2C96A 4G6ZA 1XXHA 4LJ7A 2WZJA 3K92A 3GLFB 4IBFA 2CEAA 5H37D 4G4OA 1HQYE 3CF6E 4CHTB 3PFIA 3LCUA 1G59A 2J5YA 3I01M 3IG8A 4P17A 2JWSA 1AIPC 2LHCA 1IBKM 2XFTA 4GRIA 3C9PA 3U6DA 2G5GX 1VG5A 3R9XB 2OOAA 2LVAA 1IN5A 2O25A 1E9RA 4MM3B 3A46A 3HKPA 1TDHA 1WGLA 3R8FA 1N34M 4PDIA 2LWXA 4LY6A 4BB9A 1DV0A 1TH2A 1N36M 1IY2A 1NJGA 2LNHC 2RRUA 3QYBA 5ITXE 1KSFX 3PXGA 2ZTCA 1IBMM 3VKGA 2DAIA 3SYKA 1ZV1A 2FFJA 1R7RA 2F5OA 5IT9S 1QUSA 5FTJA 4IBJA 1N78A 2KW0A 3VDUA 1G71A 4Z6YA 3GLGE 2XZFA 3GQ4A 1IM2A 1G41A 2H1RA 5E6JA 2R62A 2UUAM 4JI4M 1D0LA 3ZCBB 4OU7A 4JI3M 1PGYA 3B74A 4IJEA 1K82A 1Q02A 5EP4A 2Z3XA 2DAKA 3GLFA 1JR3E 4DV2M 3U6OA 2R65A 1A5TA 3U61A 1K3XA 2JY7A 4OVZB 2DI0A 2JXNA 4FWGA 3GLIB 1HT2E 4PCZA 4DV3M 3J2PB 3SASA 4NC6A 4X65M 1HNXM 1F4IA 1PJJA 2DAGA 3FTEA 1IN8A 3RE8A 2MH8A 1DGFA 4NXNM 4ITQA 1MU5A 3SMPA 1TGUA 1Z5AA 5EP3A 3SARA 2E5LM 1IQPA 2OOBA 2Z8YM 1VQ1A 3PNYA 4BBAA 2XSZD 3GLHE 2M60A 4PT5A 1L1TA 4NXMM 3RGPA 4IBGA 4QNMA 3W0FA 1EFUB 3KW6A 4W5WA 4QHSA 1V92A 3K9PA 2D7EA 2FNAA 3FD9A 2ZM6M 1P3QQ 1PRBA 1S3SA 3CF2A 3KP0E 4I81A 4R3DA 3UZUA 1R4GA 1IN4A 1GJSA 4IBIA 4RF1A 5L8RF 4LF6M 1HR0M 3GRYA 2QSFX 1PJIA 1Z5CA 2ZAMA 4GIPA 3AV0A 4WURA 1L2CA 1YSYA 2DHYA 2QHOB 1WGNA 3AOEA 4FCTA 3BXWA 2EO2A 2DWNA 4GKJM 4LG2A 4XGIA 2MGWA 4NSOB 2J7NA 2CP8A 1GABA 2K9DA 1IY1A 1PJSA 4QHTA 3U5ZA 3LMMA 4JI8M 1OKSA 4I5SA 4MGKE 1NHWC 3BBZA 4M0DA 4DR6M 1KYIA 2I7PA 4L6V6 5ITUA 3FTDA 2QENA 2JP7A 4DUYM 3WHKA 2C9OA 4FW9A 4DUZM 1LV7A 1TR8A 2EUCA 2R4EA 4IBKA 3SC3A 1HNWM 2Y20A 4DV5M 2A5YB 4WP2A 4ZPXA 3E21A 1VEGA 1Y8GA 2F5QA 1TH4A 5IWAM 5KPTA 4KODA 2GQFA 3U6PA 1J7KA 2LXEA 2QPAA 4GMQA 3TWLA 2KXEA 2YQZA 2CE7A 1QANA 2BJVA 2R18A 4F2LA 3UJNA 1WHCA 3AOGA 3D8LA 3JAMS 2APLA 4L8RC 1ZMUA 1IN6A 1QZEA 3FRHA 1X37A 5KQDA 3HHZA 1T3TA 2VF8A 4LFCM 2LVOC 1GO5A 1E32A 4HL4A 3LCVB 1MJGM 2L7HA 5FSWA 1GVNA 3I4VA 5DFLA 2FH0A 4FWHA 2P5TA 4LZJA 1Q3CA 2O5RA 5FTNA 4DR5M 4LGYA 4K0KM 3U6LA 1XMOM 3RGSA 2G8LA 1WJ7A 3HJSA 2KNVA 4GITA 4DV0M 1EIJA 4AZFA 4JI0M 4ANRA 1XNQM 1OTRA 1QAMA 3KXEC 1ZQ9A 2C9CA 3L2AA 1DO2A 2QCUA 4YY3M 1TF0B 3IECA 4KO8A 3SAVA 4GHLA 3QYEA 4FCVA 3NBXX 2BWBA 2Y0QA 5BPVA 2UXCM 2EA0A 2CUZA 2L4EA 4GKKM 1QDTA 3W68A 2GNOA 3GO8A 3TPZA 2CHGA 4L78A 3HX3A 3KOXE 4LF9M 2D7HA 4NL4H 1XHBA
chains in the Genus database with same CATH topology
2DAGA 2KHHA 1HJPA 1SG9A 2JNHA 4HEOA 2B3TA 2OOBA 1VQ1A 3GLHE 1T43A 1OQYA 1IXSA 1T6OA 2EKKA 3GLFE 2DNAA 4F1IA 3B89A 1EFUB 1V92A 3K9PA 2JY6B 1P3QQ 2JZ0A 1R4GA 2ZTDA 1ZMVA 2JZ1A 4G3OA 1VDLA 2EJSA 3K9OA 2QSFX 2MR9A 1NV8A 2DHYA 4Q7JA 2QHOB 1WGNA 2MJ5B 4UN2B 3F92A 2QNJA 1VEJA 2EKFA 2R0IA 2MGWA 2BWEA 2CP8A 2JY5A 1WIVA 2K9DA 4DBGB 2JUJA 2LVQD 1G3IA 2DAMA 1DO0A 2JY8A 3T6PA 1OKSA 2LVNC 2LVPC 1WR1B 3BBZA 1UFZA 1KYIA 5JI2E 2LBCA 2HWJA 2JP7A 2KNZA 1F4IA 1OAIA 1TR8A 2MROB 2WZJA 1HT1E 1MN3A 1HQYE 2CWBA 4WP2A 3E21A 1VEGA 1Y8GA 2DAEA 3MMPA 1XB2B 1VEKA 2K0BX 4GEWA 3LCUA 2KNAA 1AIPC 2DENA 1C7YA 1VG5A 4F2LA 2OOAA 2LVAA 2O25A 3E46A 1WHCA 1WGLA 1ZMUA 1QZEA 3FRHA 3IHPA 3H4JA 1DV0A 2DKLA 2G3QA 1IFYA 2OO9A 2LVOC 1E94E 2RRUA 1GO5A 2ZTCA 1G4AE 3LCVB 2DAIA 1ZV1A 5DFLA 1BVSA 2DZLA 2L4FA 1WJ7A 3GLGE 2L2DA 1IM2A 2KNVA 2H5XA 1G41A 3GLIE 1YLAA 1OTRA 1DO2A 1PGYA 3FE3A 4R71A 1Q02A 3IECA 2DAKA 1JR3E 1ZMWA 2BWBA 2HAKA 1A5TA 3FRIA 2L4EA 2JY7A 2DI0A 1CUKA 2LTUA 1HT2E 1XXHE 1TTEA 1NV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAG A;  2KHH A;  1HJP A;  1SG9 A;  2JNH A;  4HEO A;  2B3T A;  2OOB A;  1VQ1 A;  3GLH E;  1T43 A;  1OQY A;  1IXS A;  1T6O A;  2EKK A;  3GLF E;  2DNA A;  4F1I A;  3B89 A;  1EFU B;  1V92 A;  3K9P A;  2JY6 B;  1P3Q Q;  2JZ0 A;  1R4G A;  2ZTD A;  1ZMV A;  2JZ1 A;  4G3O A;  1VDL A;  2EJS A;  3K9O A;  2QSF X;  2MR9 A;  1NV8 A;  2DHY A;  4Q7J A;  2QHO B;  1WGN A;  2MJ5 B;  4UN2 B;  3F92 A;  2QNJ A;  1VEJ A;  2EKF A;  2R0I A;  2MGW A;  2BWE A;  2CP8 A;  2JY5 A;  1WIV A;  2K9D A;  4DBG B;  2JUJ A;  2LVQ D;  1G3I A;  2DAM A;  1DO0 A;  2JY8 A;  3T6P A;  1OKS A;  2LVN C;  2LVP C;  1WR1 B;  3BBZ A;  1UFZ A;  1KYI A;  5JI2 E;  2LBC A;  2HWJ A;  2JP7 A;  2KNZ A;  1F4I A;  1OAI A;  1TR8 A;  2MRO B;  2WZJ A;  1HT1 E;  1MN3 A;  1HQY E;  2CWB A;  4WP2 A;  3E21 A;  1VEG A;  1Y8G A;  2DAE A;  3MMP A;  1XB2 B;  1VEK A;  2K0B X;  4GEW A;  3LCU A;  2KNA A;  1AIP C;  2DEN A;  1C7Y A;  1VG5 A;  4F2L A;  2OOA A;  2LVA A;  2O25 A;  3E46 A;  1WHC A;  1WGL A;  1ZMU A;  1QZE A;  3FRH A;  3IHP A;  3H4J A;  1DV0 A;  2DKL A;  2G3Q A;  1IFY A;  2OO9 A;  2LVO C;  1E94 E;  2RRU A;  1GO5 A;  2ZTC A;  1G4A E;  3LCV B;  2DAI A;  1ZV1 A;  5DFL A;  1BVS A;  2DZL A;  2L4F A;  1WJ7 A;  3GLG E;  2L2D A;  1IM2 A;  2KNV A;  2H5X A;  1G41 A;  3GLI E;  1YLA A;  1OTR A;  1DO2 A;  1PGY A;  3FE3 A;  4R71 A;  1Q02 A;  3IEC A;  2DAK A;  1JR3 E;  1ZMW A;  2BWB A;  2HAK A;  1A5T A;  3FRI A;  2L4E A;  2JY7 A;  2DI0 A;  1CUK A;  2LTU A;  1HT2 E;  1XXH E;  1TTE A;  1NV9 A; 
#chains in the Genus database with same CATH topology
 3A98 B;  3HJQ A;  1NHG C;  1UM8 A;  1N32 M;  4JI7 M;  2RGH A;  3AOE C;  2Y21 A;  1HJP A;  2JNH A;  3HJ8 A;  1PJQ A;  4IBE A;  4MGZ E;  5LMN M;  2XLJ A;  4B3T M;  3DFZ A;  4AW4 A;  1IXS A;  5ITY A;  1Q39 A;  4M9S A;  3GLF E;  3B89 A;  1WXQ A;  5EJC A;  2CFO A;  4LGM A;  2JY6 B;  1W5S A;  2L6O A;  5DYG A;  2FS1 A;  1OAO C;  3KOW E;  2FE8 A;  3JR5 A;  3B7Z A;  2ZTD A;  3KVW A;  4G3O A;  2QQ8 A;  1N75 A;  4CIZ A;  3ZH9 B;  3GLH B;  1ORY B;  2MR9 A;  1NV8 A;  5EP2 A;  1IBL M;  1XWI A;  1J5E M;  4AQY M;  3C3E A;  3HGI A;  2OPF A;  4MH0 E;  3FUU A;  4UN2 B;  4G4N A;  3F92 A;  4QNR A;  4JI2 M;  2W82 A;  3NWL A;  3U60 B;  3C3D A;  2YFQ A;  2DWL A;  3HWS A;  1W5T A;  4JN6 A;  2DHR A;  3EIE A;  4S12 A;  2V1U A;  3K8Z A;  4DBG B;  5KO3 A;  3AKZ A;  2KZU A;  1QDR A;  4M9X A;  3SAT A;  4LJ9 A;  2CV1 A;  2F4V M;  5EP1 A;  3ILK A;  5BR8 M;  2JY8 A;  2LVP C;  3I04 M;  5F3W A;  1JR3 A;  1QAO A;  1TDZ A;  2XGN A;  3SAW A;  2RGO A;  1NY6 A;  3AL0 C;  2LBC A;  4AG6 A;  1GL7 A;  5KQ8 A;  2DZN B;  3SYL A;  3CTW B;  3M6A A;  4CIS A;  4D80 A;  3DZD A;  1IXZ A;  1KFV A;  1C1K A;  1NNJ A;  3HU1 A;  3MK6 A;  2L09 A;  3E9S A;  3SBJ A;  4EIW A;  4DV4 M;  3T1H M;  4RKU F;  3T38 A;  1DGB A;  1MN3 A;  1QVR A;  3A45 A;  4LF5 M;  3MMP A;  1NSF A;  4GEW A;  1OJL A;  2QBY B;  2VDB B;  2XF3 A;  1XC8 A;  4OVZ A;  2DEN A;  3LQR A;  4JI5 M;  1OFH A;  3GLI A;  2VF7 A;  1QZM A;  3AJI B;  4KT0 F;  1H6U A;  4II7 A;  2K47 A;  3SMS A;  3K1J A;  4A3V B;  1L1Z A;  3J7A S;  1RU3 A;  4HLQ A;  3I4Y A;  3ZC7 B;  1MX0 A;  1YE9 A;  2HKJ A;  3Q8X A;  4LJ5 A;  2UXD M;  1OFI A;  4WW0 A;  3IHP A;  2UUB M;  3PNV A;  2DKL A;  1D0M A;  2G3Q A;  4FD2 A;  3GQ5 A;  4B3S M;  2OO9 A;  4GHA A;  2C99 A;  2WSC F;  3B9P A;  3QAU A;  1SXJ B;  3TWM A;  1Q3B A;  5IZ7 D;  4KHP M;  2CHQ A;  5ITT A;  2R4J A;  4DR2 M;  3TQS A;  3LQQ A;  2CV2 A;  3GPY A;  2OQ4 A;  2DZL A;  3K2L A;  4NOO B;  4LZZ A;  2XZU A;  2L4F A;  2R45 A;  3FUT A;  3FTF A;  2WSE F;  4G4Q A;  3EIH A;  1DGH B;  2H5X A;  3I51 A;  4D81 A;  1QUT A;  2Y0T A;  4LJ4 A;  1YLA A;  4MGH A;  1JB0 F;  4R71 A;  2XH9 A;  2KEB A;  1E9S A;  3U6E A;  4AKI A;  1NO1 A;  2RKO A;  4L16 A;  3W67 A;  3L26 A;  3HY5 A;  3SHG B;  3KDS E;  1ZMW A;  4LRT A;  4B08 A;  3VK7 A;  1V33 A;  5JI3 E;  4L15 A;  3FRI A;  1N33 M;  7CAT A;  3IG5 A;  1CUK A;  1NJF A;  3BOS A;  4IIW A;  1IXR C;  1XXH E;  3LVW A;  1K3W A;  4I4L A;  1TTE A;  1NV9 A;  4LCB A;  5GKN A;  2KHH A;  4LJ6 A;  2Z4R A;  5FTK A;  3KOY E;  4AKH A;  1SG9 A;  3A42 A;  3JR4 A;  4HEO A;  1SXJ A;  4M9Z A;  2CHV A;  3HHW A;  1I94 M;  1OQY A;  1T6O A;  4XBO A;  1DGG A;  4MGY E;  2KA6 B;  3ZQJ A;  2ZAN A;  3DOA A;  4JV5 M;  3J7B A;  4GC5 A;  2L7I A;  4DR1 M;  5EXX A;  5DYI A;  2UU9 M;  3VFD A;  4LF7 M;  1DGH A;  3FUX A;  3Q8G A;  4M0W A;  4NRW A;  2DWZ B;  2CV0 A;  3GLG B;  1OIZ A;  1R2Z A;  2ZBK B;  1FJG M;  1Z59 A;  3K9O A;  4GC9 A;  2DWM A;  3GRR A;  3WHL A;  2Z7J A;  3RFW A;  3GRU A;  3CF0 A;  3HZJ A;  4Q7J A;  3FYC A;  4IBD A;  2MJ5 B;  2Z4S A;  3HU3 A;  3VK8 A;  4AKG A;  1JQJ C;  5LMU M;  2QNJ A;  1YUB A;  2HCB A;  3THG A;  4G4R A;  2BNK A;  2R0I A;  3V76 A;  3U61 B;  2HL7 A;  1TH3 A;  3TL4 X;  3KS4 A;  2O01 F;  4IBB A;  1GL6 A;  5ITR A;  3GPX A;  4JXJ A;  1ZAE A;  4P16 A;  1GJT A;  4LJA A;  4JI1 M;  4PD2 A;  2JUJ A;  2C98 A;  2NQ8 C;  1G3I A;  2DAM A;  3KSJ A;  2YR0 A;  3B7Q A;  3MHV C;  5E26 A;  3OTO M;  4DV6 M;  1DO0 A;  1GKI A;  2LVN C;  2R46 A;  3QWL A;  4IJF A;  5KPZ A;  5ITQ A;  5FLX S;  4PDG A;  1UFZ A;  2LH0 A;  5JI2 E;  1J09 A;  5FTL A;  2M5Z A;  3UGJ A;  1OAI A;  4YHH M;  4B7G A;  5C18 A;  1QYR A;  3FUW A;  5ITX A;  4B3R M;  4MGI E;  2FOI C;  2MRO B;  5DNY A;  2UXB M;  3VDP A;  1IY0 A;  4OX9 M;  3TWK A;  1HT1 E;  3DA1 A;  4CGY B;  2KZS A;  2CWB A;  2K6B A;  4Z8X A;  2VQE M;  2DAE A;  3LVV A;  1XB2 B;  1VEK A;  2K0B X;  4LF4 M;  3J81 S;  4LFB M;  3GLG A;  4R7G A;  3C58 A;  4X62 M;  2KNA A;  1C7Y A;  1GLN A;  1FNN A;  4LRS A;  4L4U A;  2KRU A;  3E46 A;  3FKE A;  3FTC A;  4LF8 M;  3D8B A;  4TUW A;  2KRK A;  3KOZ E;  3H4J A;  4Y28 F;  3T15 A;  1N77 A;  2WSF F;  1IFY A;  3B7N A;  1IN7 A;  2QP9 X;  1E94 E;  1EE8 A;  3U6C A;  3SAU A;  1G4A E;  1PM5 A;  3U6Q A;  3U6S A;  3U5Z B;  4RF0 A;  1BVS A;  5EXT A;  1SXJ D;  2YNM D;  3MJ5 A;  4X66 M;  2F5P A;  2ZAO A;  3NBI A;  2XFS A;  1NNU C;  2BJW A;  2F5S A;  3J80 S;  1I4W A;  2L2D A;  3L29 A;  4DR4 M;  3LW5 F;  1L2B A;  3GLI E;  1NVM A;  1SXJ C;  1XNR M;  3CGW A;  2N35 A;  3GLH A;  2R6F A;  2X4A A;  3FE3 A;  2KDL A;  1PJT A;  4XK8 F;  2F5N A;  3L25 A;  2VQF M;  3U6M A;  2ERC A;  1AUA A;  4NSR A;  4CJ6 A;  3U60 A;  2HAK A;  2UUC M;  5EXP A;  3GQ3 A;  3T1Y M;  4B7H A;  1HNZ M;  3PVS A;  2DXI A;  1L8Q A;  4QOZ C;  2CRU A;  1D0K A;  4AI6 A;  2LTU A;  3FYD A;  3HU2 A;  4KLN A;  1D2N A;  2JA2 A;  1QAQ A;  3H4M A;  4NRV A;  3FUV A;  3UMM A;  2LHG A;  1QQW A;  4AG5 A;  3GPU A;  3W0L B;  4OW0 A;  4QOS A;  2HHH M;  2B3T A;  2Q2E B;  3GRV A;  1T43 A;  4RNA A;  1G8P A;  4X64 M;  2EKK A;  3VKH A;  2DNA A;  4F1I A;  1XXH B;  2X49 A;  1L2D A;  2J7O A;  4BLC A;  3J27 B;  4LFA M;  3VLF B;  3E4R A;  3L27 A;  5FTM A;  4DV1 M;  4I8O A;  4JI6 M;  1R6B X;  2JZ0 A;  1HQC A;  4FCW A;  3HHY A;  1ZMV A;  3M0E A;  3M7G A;  2QBY A;  2JZ1 A;  3GP1 A;  1VDL A;  2QZ4 A;  1Z6T A;  2EJS A;  2VII A;  4MB7 A;  2V1C A;  3GPP A;  4REZ A;  1XMQ M;  4DR7 M;  3KFU G;  2XEP A;  1R2Y A;  5A2Q S;  8CAT A;  1V34 A;  4FWD A;  4IBC A;  5EXS A;  3KS8 A;  5KPR A;  4GH9 A;  4LJ8 A;  2AHM A;  1VDD A;  1R5L A;  1SXJ E;  1VEJ A;  2EKF A;  1LTM A;  2I7N A;  3HHX A;  3SHF A;  4D82 A;  2C5R A;  3TE6 A;  2BWE A;  2JY5 A;  1WIV A;  4FVM A;  1JR3 D;  3L28 A;  3SFZ A;  2LVQ D;  2D7G A;  2X8A A;  3T6P A;  2XSZ A;  1OIP A;  3AFH A;  1NY5 A;  1WR1 B;  5EQT A;  5C1B A;  4DV7 M;  2V6Z M;  2DVW B;  1Z5B A;  3KSX A;  5IRE B;  2HWJ A;  3KP1 E;  4DR3 M;  3UK6 A;  4B3M M;  2KNZ A;  2R44 A;  2DZO B;  4B7F A;  1IXS B;  4JYA M;  2C96 A;  4G6Z A;  1XXH A;  4LJ7 A;  2WZJ A;  3K92 A;  3GLF B;  4IBF A;  2CEA A;  5H37 D;  4G4O A;  1HQY E;  3CF6 E;  4CHT B;  3PFI A;  3LCU A;  1G59 A;  2J5Y A;  3I01 M;  3IG8 A;  4P17 A;  2JWS A;  1AIP C;  2LHC A;  1IBK M;  2XFT A;  4GRI A;  3C9P A;  3U6D A;  2G5G X;  1VG5 A;  3R9X B;  2OOA A;  2LVA A;  1IN5 A;  2O25 A;  1E9R A;  4MM3 B;  3A46 A;  3HKP A;  1TDH A;  1WGL A;  3R8F A;  1N34 M;  4PDI A;  2LWX A;  4LY6 A;  4BB9 A;  1DV0 A;  1TH2 A;  1N36 M;  1IY2 A;  1NJG A;  2LNH C;  2RRU A;  3QYB A;  5ITX E;  1KSF X;  3PXG A;  2ZTC A;  1IBM M;  3VKG A;  2DAI A;  3SYK A;  1ZV1 A;  2FFJ A;  1R7R A;  2F5O A;  5IT9 S;  1QUS A;  5FTJ A;  4IBJ A;  1N78 A;  2KW0 A;  3VDU A;  1G71 A;  4Z6Y A;  3GLG E;  2XZF A;  3GQ4 A;  1IM2 A;  1G41 A;  2H1R A;  5E6J A;  2R62 A;  2UUA M;  4JI4 M;  1D0L A;  3ZCB B;  4OU7 A;  4JI3 M;  1PGY A;  3B74 A;  4IJE A;  1K82 A;  1Q02 A;  5EP4 A;  2Z3X A;  2DAK A;  3GLF A;  1JR3 E;  4DV2 M;  3U6O A;  2R65 A;  1A5T A;  3U61 A;  1K3X A;  2JY7 A;  4OVZ B;  2DI0 A;  2JXN A;  4FWG A;  3GLI B;  1HT2 E;  4PCZ A;  4DV3 M;  3J2P B;  3SAS A;  4NC6 A;  4X65 M;  1HNX M;  1F4I A;  1PJJ A;  2DAG A;  3FTE A;  1IN8 A;  3RE8 A;  2MH8 A;  1DGF A;  4NXN M;  4ITQ A;  1MU5 A;  3SMP A;  1TGU A;  1Z5A A;  5EP3 A;  3SAR A;  2E5L M;  1IQP A;  2OOB A;  2Z8Y M;  1VQ1 A;  3PNY A;  4BBA A;  2XSZ D;  3GLH E;  2M60 A;  4PT5 A;  1L1T A;  4NXM M;  3RGP A;  4IBG A;  4QNM A;  3W0F A;  1EFU B;  3KW6 A;  4W5W A;  4QHS A;  1V92 A;  3K9P A;  2D7E A;  2FNA A;  3FD9 A;  2ZM6 M;  1P3Q Q;  1PRB A;  1S3S A;  3CF2 A;  3KP0 E;  4I81 A;  4R3D A;  3UZU A;  1R4G A;  1IN4 A;  1GJS A;  4IBI A;  4RF1 A;  5L8R F;  4LF6 M;  1HR0 M;  3GRY A;  2QSF X;  1PJI A;  1Z5C A;  2ZAM A;  4GIP A;  3AV0 A;  4WUR A;  1L2C A;  1YSY A;  2DHY A;  2QHO B;  1WGN A;  3AOE A;  4FCT A;  3BXW A;  2EO2 A;  2DWN A;  4GKJ M;  4LG2 A;  4XGI A;  2MGW A;  4NSO B;  2J7N A;  2CP8 A;  1GAB A;  2K9D A;  1IY1 A;  1PJS A;  4QHT A;  3U5Z A;  3LMM A;  4JI8 M;  1OKS A;  4I5S A;  4MGK E;  1NHW C;  3BBZ A;  4M0D A;  4DR6 M;  1KYI A;  2I7P A;  4L6V 6;  5ITU A;  3FTD A;  2QEN A;  2JP7 A;  4DUY M;  3WHK A;  2C9O A;  4FW9 A;  4DUZ M;  1LV7 A;  1TR8 A;  2EUC A;  2R4E A;  4IBK A;  3SC3 A;  1HNW M;  2Y20 A;  4DV5 M;  2A5Y B;  4WP2 A;  4ZPX A;  3E21 A;  1VEG A;  1Y8G A;  2F5Q A;  1TH4 A;  5IWA M;  5KPT A;  4KOD A;  2GQF A;  3U6P A;  1J7K A;  2LXE A;  2QPA A;  4GMQ A;  3TWL A;  2KXE A;  2YQZ A;  2CE7 A;  1QAN A;  2BJV A;  2R18 A;  4F2L A;  3UJN A;  1WHC A;  3AOG A;  3D8L A;  3JAM S;  2APL A;  4L8R C;  1ZMU A;  1IN6 A;  1QZE A;  3FRH A;  1X37 A;  5KQD A;  3HHZ A;  1T3T A;  2VF8 A;  4LFC M;  2LVO C;  1GO5 A;  1E32 A;  4HL4 A;  3LCV B;  1MJG M;  2L7H A;  5FSW A;  1GVN A;  3I4V A;  5DFL A;  2FH0 A;  4FWH A;  2P5T A;  4LZJ A;  1Q3C A;  2O5R A;  5FTN A;  4DR5 M;  4LGY A;  4K0K M;  3U6L A;  1XMO M;  3RGS A;  2G8L A;  1WJ7 A;  3HJS A;  2KNV A;  4GIT A;  4DV0 M;  1EIJ A;  4AZF A;  4JI0 M;  4ANR A;  1XNQ M;  1OTR A;  1QAM A;  3KXE C;  1ZQ9 A;  2C9C A;  3L2A A;  1DO2 A;  2QCU A;  4YY3 M;  1TF0 B;  3IEC A;  4KO8 A;  3SAV A;  4GHL A;  3QYE A;  4FCV A;  3NBX X;  2BWB A;  2Y0Q A;  5BPV A;  2UXC M;  2EA0 A;  2CUZ A;  2L4E A;  4GKK M;  1QDT A;  3W68 A;  2GNO A;  3GO8 A;  3TPZ A;  2CHG A;  4L78 A;  3HX3 A;  3KOX E;  4LF9 M;  2D7H A;  4NL4 H;  1XHB A; 
#chains in the Genus database with same CATH homology
 2DAG A;  2KHH A;  1HJP A;  1SG9 A;  2JNH A;  4HEO A;  2B3T A;  2OOB A;  1VQ1 A;  3GLH E;  1T43 A;  1OQY A;  1IXS A;  1T6O A;  2EKK A;  3GLF E;  2DNA A;  4F1I A;  3B89 A;  1EFU B;  1V92 A;  3K9P A;  2JY6 B;  1P3Q Q;  2JZ0 A;  1R4G A;  2ZTD A;  1ZMV A;  2JZ1 A;  4G3O A;  1VDL A;  2EJS A;  3K9O A;  2QSF X;  2MR9 A;  1NV8 A;  2DHY A;  4Q7J A;  2QHO B;  1WGN A;  2MJ5 B;  4UN2 B;  3F92 A;  2QNJ A;  1VEJ A;  2EKF A;  2R0I A;  2MGW A;  2BWE A;  2CP8 A;  2JY5 A;  1WIV A;  2K9D A;  4DBG B;  2JUJ A;  2LVQ D;  1G3I A;  2DAM A;  1DO0 A;  2JY8 A;  3T6P A;  1OKS A;  2LVN C;  2LVP C;  1WR1 B;  3BBZ A;  1UFZ A;  1KYI A;  5JI2 E;  2LBC A;  2HWJ A;  2JP7 A;  2KNZ A;  1F4I A;  1OAI A;  1TR8 A;  2MRO B;  2WZJ A;  1HT1 E;  1MN3 A;  1HQY E;  2CWB A;  4WP2 A;  3E21 A;  1VEG A;  1Y8G A;  2DAE A;  3MMP A;  1XB2 B;  1VEK A;  2K0B X;  4GEW A;  3LCU A;  2KNA A;  1AIP C;  2DEN A;  1C7Y A;  1VG5 A;  4F2L A;  2OOA A;  2LVA A;  2O25 A;  3E46 A;  1WHC A;  1WGL A;  1ZMU A;  1QZE A;  3FRH A;  3IHP A;  3H4J A;  1DV0 A;  2DKL A;  2G3Q A;  1IFY A;  2OO9 A;  2LVO C;  1E94 E;  2RRU A;  1GO5 A;  2ZTC A;  1G4A E;  3LCV B;  2DAI A;  1ZV1 A;  5DFL A;  1BVS A;  2DZL A;  2L4F A;  1WJ7 A;  3GLG E;  2L2D A;  1IM2 A;  2KNV A;  2H5X A;  1G41 A;  3GLI E;  1YLA A;  1OTR A;  1DO2 A;  1PGY A;  3FE3 A;  4R71 A;  1Q02 A;  3IEC A;  2DAK A;  1JR3 E;  1ZMW A;  2BWB A;  2HAK A;  1A5T A;  3FRI A;  2L4E A;  2JY7 A;  2DI0 A;  1CUK A;  2LTU A;  1HT2 E;  1XXH E;  1TTE A;  1NV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...