2CWBA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin.
pubmed doi rcsb
source organism Streptococcus sp., homo sapiens
molecule tags Protein binding
total genus 12
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2005-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cwbA00
2JP7A 2EKFA 1WHCA 3E21A 2QNJA 1TTEA 2MJ5B 3LCUA 1HT1E 1AIPC 1DO0A 1NV9A 2BWBA 2OOAA 1T6OA 1WJ7A 3K9OA 2DNAA 4Q7JA 2LTUA 1VQ1A 1E94E 5JI2E 2L2DA 1Q02A 2QHOB 3FE3A 1VEKA 2B3TA 2OO9A 1IFYA 2EJSA 1DV0A 1VDLA 2DAKA 1VEJA 3GLHE 2LVOC 2DAGA 4F1IA 2DI0A 2G3QA 1KYIA 1OAIA 3GLIE 3IHPA 2DENA 5DFLA 4WP2A 1IM2A 2DZLA 1OQYA 2LBCA 2JZ0A 2K9DA 3F92A 1WGLA 3IECA 1P3QQ 2L4FA 1Y8GA 2DKLA 3H4JA 4R71A 2DAIA 2RRUA 2HAKA 3MMPA 4DBGB 2CWBA 1XXHE 2BWEA 2L4EA 2DAEA 1VEGA 3E46A 1UFZA 2CP8A 3GLFE 3GLGE 1IXSA 1OTRA 2H5XA 2LVQD 2DAMA 1ZMUA 2O25A 1BVSA 1WGNA 1WIVA 4UN2B 1ZV1A 2KNZA 4F2LA 1PGYA 2KHHA 2R0IA 3FRHA 1V92A 1CUKA 4G3OA 2MR9A 2MGWA 1A5TA 2KNVA 2JY5A 1QZEA 3T6PA 4GEWA 1HT2E 2JY7A 1OKSA 2KNAA 2JY6B 4HEOA 1ZMWA 1T43A 2MROB 3FRIA 1DO2A 1YLAA 2K0BX 1G4AE 1C7YA 2DHYA 1F4IA 3LCVB 2JZ1A 3BBZA 2JNHA 2WZJA 1XB2B 1R4GA 2QSFX 1MN3A 2ZTDA 1JR3E 2LVNC 2JY8A 1HQYE 2LVPC 2JUJA 1GO5A 2EKKA 2OOBA 1SG9A 1G41A 1EFUB 2ZTCA 1G3IA 2HWJA 2LVAA 1NV8A 1VG5A 1HJPA 3K9PA 1TR8A 1WR1B 3B89A 1ZMVA
chains in the Genus database with same CATH superfamily
2JP7A 4B7HA 2XZFA 4DR7M 1WHCA 3KOWE 2KXEA 1TTEA 3DOAA 2WSFF 1NV9A 2BWBA 1NJGA 1V33A 4DR5M 2HKJA 1Z59A 3I51A 1OFIA 3HWSA 4Q7JA 4I4LA 4A3VB 2W82A 1IQPA 3L28A 2L2DA 3PNYA 2J7NA 2UUAM 4PT5A 2GQFA 2K47A 3BXWA 3WHLA 4D82A 1IXSB 4NRWA 3SMPA 4LRTA 1IN4A 3GLHA 5A2QS 3Q8XA 2EJSA 2CHQA 1DV0A 1OIPA 3GLIA 2R45A 2ZBKB 4R3DA 4F1IA 2XLJA 4IBBA 2DI0A 4DV7M 1MX0A 3T1YM 4ANRA 2Y20A 1TGUA 4HLQA 1Z5BA 2G3QA 4FWHA 2KZSA 3PVSA 3TWLA 4X65M 3SARA 1XNRM 4DR4M 3KSJA 8CATA 1FNNA 4KHPM 1IM2A 1V34A 3WHKA 2XEPA 1XXHB 1OQYA 5E26A 3J81S 2VQEM 1GKIA 4NXMM 1WGLA 1YSYA 3VLFB 2JWSA 3GLGB 3JR4A 1AUAA 2FH0A 2L4FA 3UMMA 4D80A 3U61B 3H4JA 4MM3B 3TWKA 2QPAA 2LNHC 2QZ4A 2VF7A 3PFIA 5BPVA 3GPPA 3R8FA 3HJSA 4R71A 1QDTA 4AQYM 2DXIA 2Z4RA 3U6CA 4JI1M 4CHTB 1IXZA 2RRUA 4LRSA 3ZC7B 1D0MA 3SHFA 3HX3A 4BB9A 1N32M 1Z6TA 2R44A 1IBLM 4XGIA 3E46A 3HJ8A 4GH9A 2VF8A 1IXSA 3A45A 1K3WA 4Y28F 1QYRA 3A42A 4R7GA 4JYAM 5DNYA 1BVSA 4LY6A 4CISA 3K8ZA 4UN2B 3HY5A 4NXNM 3B7ZA 1XNQM 1NHWC 5FTNA 2R0IA 4QNRA 3CF6E 5FTJA 1QZEA 1NY6A 4GEWA 1PJSA 3K92A 1OKSA 1QAOA 2KNAA 3ZH9B 3FUWA 1TF0B 4NC6A 5KPTA 3GQ5A 1XXHA 1ZMWA 3A46A 2MROB 1DO2A 3GLGA 2DWLA 4DV1M 4FVMA 3U61A 1G4AE 4G6ZA 1JR3A 2RKOA 3NBXX 3TL4X 1NVMA 2JNHA 2WZJA 4MGZE 3KOYE 2P5TA 2ZTDA 2G5GX 2OPFA 1QQWA 4EIWA 4JI2M 4AG5A 1QAMA 4X64M 2J5YA 5L8RF 4CJ6A 1TDZA 1KSFX 3GRYA 2L6OA 2VIIA 2F5QA 3FUVA 4JN6A 3GRUA 2UXBM 2EKKA 1GO5A 4L78A 2OOBA 3NBIA 3SATA 5EXSA 2C9CA 2C96A 4YHHM 4RF0A 3R9XB 2X4AA 1EFUB 3U6QA 4XBOA 3HU1A 2HWJA 2LHGA 2LVAA 1QUTA 3DZDA 1GJSA 3V76A 4PDIA 3SYLA 1TR8A 4DV0M 1L8QA 3J2PB 3B74A 4QOZC 3CF0A 3RGSA 2EKFA 2CHVA 1DGGA 4G4RA 1K82A 1XMQM 3MK6A 2AHMA 3B7NA 1HT1E 4LGMA 3KFUG 2O5RA 3LVWA 4LFAM 2KW0A 2CFOA 4WW0A 5ITQA 3T15A 1OIZA 4L4UA 1EE8A 4M0DA 2LTUA 4LF9M 3GP1A 5JI2E 1I4WA 2Z7JA 1J7KA 1MU5A 2R62A 2R6FA 3MHVC 4NSRA 2HCBA 4REZA 2L7IA 3FE3A 3HHWA 3U5ZB 3LMMA 2N35A 2X8AA 4B3RM 1W5SA 3FUXA 4FD2A 3EIEA 2CEAA 2G8LA 4AZFA 1L1TA 2UUBM 1XHBA 2DENA 3KOZE 3B7QA 2APLA 5KQ8A 4M9ZA 3FD9A 2QP9X 4HL4A 1PM5A 2XSZA 4IIWA 3IECA 1P3QQ 1Y8GA 2OQ4A 4DUZM 3UJNA 5EJCA 1E9RA 3VDUA 2HHHM 4MGYE 3M6AA 2WSEF 4IBDA 3VK7A 4LF8M 3MMPA 4LJ6A 3SYKA 2CWBA 1I94M 3KVWA 1VEGA 4MH0E 4AW4A 5ITXE 1IY2A 3GLFE 4JI3M 4LCBA 2H5XA 1ORYB 2YNMD 4X66M 3U5ZA 2A5YB 3M0EA 1WIVA 1SXJD 4CGYB 2Z3XA 1ZV1A 4LFCM 4B7GA 4F2LA 2E5LM 4IJEA 3HHYA 3DFZA 4B7FA 2F4VM 2KNVA 2JY5A 4QHTA 3GPUA 2QQ8A 2JY7A 5KQDA 5BR8M 3SAVA 4GHAA 4IBKA 3U6PA 3KSXA 3OTOM 4S12A 4RKUF 3SFZA 3HHZA 1R7RA 4NOOB 4KLNA 1XWIA 1YE9A 4KT0F 2F5OA 4GC9A 4GC5A 1T43A 4FWDA 5H37D 2QBYB 4JI4M 1YLAA 2VDBB 3U60B 4K0KM 5FLXS 2JXNA 2BNKA 1IN7A 2KA6B 3KDSE 4LJ7A 1IBMM 2DVWB 2F5SA 3VDPA 3BBZA 3ILKA 1XB2B 1R4GA 1PJJA 1DGHB 2CE7A 3CGWA 4IBFA 1IN6A 3ZQJA 2DWZB 1NY5A 3AKZA 1IY1A 3T38A 3TQSA 5DYIA 4NL4H 1D0LA 1OJLA 4IBGA 5EP3A 5ITYA 7CATA 1HNWM 3L25A 5EP2A 3K2LA 1TH4A 4Z6YA 1J5EM 1HNXM 1L2BA 3I4VA 3AOEC 4DV6M 1N36M 3Q8GA 2I7PA 3AOGA 2CUZA 5EXXA 2K6BA 3B9PA 5C18A 1L2CA 4PD2A 5EQTA 1N75A 2ZAOA 2C9OA 4B3MM 4M9SA 4BBAA 2DHRA 3I01M 3B89A 1ZMVA 1R6BX 4PDGA 2CRUA 3TPZA 5JI3E 3L26A 1D2NA 3J7BA 5LMUM 4II7A 2QBYA 3E21A 2QNJA 3J80S 2MJ5B 3CTWB 1R5LA 2Q2EB 4LJ4A 3U60A 3D8LA 1DO0A 2EUCA 3KW6A 1WJ7A 2C99A 4G4QA 5FSWA 1GL7A 3ZCBB 4X62M 3GLFB 1HR0M 1DGHA 4GIPA 1E94E 2LH0A 4FCVA 1IN8A 1Q02A 4DR1M 4GMQA 1SXJE 3U6MA 3L29A 4JV5M 2QHOB 5IWAM 4OW0A 3U6DA 2XGNA 1N33M 2B3TA 2OO9A 1IFYA 1IBKM 1SXJC 3C58A 2D7HA 1VDLA 1GLNA 5IREB 3KXEC 3LQQA 2DAGA 3J27B 2KRKA 4ITQA 2FS1A 3U6EA 3AJIB 4GKJM 1KYIA 1OAIA 1GL6A 1PJTA 2CV1A 5DFLA 2ERCA 1JB0F 2FOIC 3FTFA 2DZLA 1K3XA 3AV0A 4LF6M 4GKKM 3SHGB 2FFJA 1HQCA 3F92A 2K9DA 4XK8F 2WSCF 3D8BA 1GABA 4L6V6 2DKLA 4B3TM 2LWXA 3W67A 3LW5F 2UXDM 1UM8A 1MJGM 1QDRA 1QVRA 2C98A 4QOSA 4GHLA 3E9SA 4I8OA 3U6OA 1QZMA 2DAIA 5ITXA 3GLFA 4LF7M 4AKIA 2HAKA 2YQZA 5FTMA 3W0LB 3AL0C 4DBGB 1XXHE 2BWEA 2L4EA 4AG6A 2DAEA 3RGPA 1G71A 1IXRC 3FYCA 3JAMS 1S3SA 2DZOB 1UFZA 2CP8A 4Z8XA 1OAOC 3RFWA 4B08A 3GLGE 4IBCA 2DAMA 1ZMUA 2O25A 4I5SA 4LJ5A 4LGYA 4D81A 4DV2M 1XMOM 4LZJA 3SAUA 4JXJA 3W0FA 4NRVA 1IN5A 2KNZA 3SAWA 2R4JA 1PGYA 3UK6A 2KHHA 3FRHA 3FTDA 1V92A 3FYDA 2V1UA 1Q3BA 1G59A 1Q3CA 2MGWA 1A5TA 4L16A 4NSOB 3HHXA 2V1CA 3IG8A 3T6PA 1HT2E 5IZ7D 2RGOA 5E6JA 3KOXE 3U6LA 3GQ4A 4LF5M 3VFDA 4HEOA 1PJIA 4IJFA 1YUBA 3UZUA 3M7GA 4DV3M 3FRIA 2M5ZA 1T3TA 4LG2A 2ZANA 2ZAMA 1XC8A 2YR0A 4W5WA 1TDHA 5FTKA 2K0BX 2DHYA 3KP1E 2XF3A 3KS4A 3SBJA 2XZUA 2UXCM 1SXJB 3PNVA 1MN3A 3QYEA 3TE6A 3GPYA 4DUYM 2VQFM 3AOEA 3MJ5A 2LVNC 3FUUA 4OX9M 1KFVA 1Z5CA 1VDDA 4G4OA 4RNAA 1N77A 4G4NA 2YFQA 4DR3M 3GQ3A 2KEBA 4JI7M 4L8RC 1SG9A 4PCZA 2GNOA 2ZTCA 1G3IA 4RF1A 4P17A 3J7AS 5EXTA 4KO8A 1QUSA 4IBJA 1VG5A 5ITRA 4AKHA 2MH8A 4M9XA 3THGA 1NNUC 1C1KA 1IY0A 2LHCA 3RE8A 3UGJA 1N34M 1NSFA 3L2AA 4GITA 3CF2A 3NWLA 2CV0A 2FE8A 2UU9M 3K9PA 4AKGA 5C1BA 2DWMA 1GVNA 2NQ8C 3HJQA 2BJVA 3FTCA 3LCUA 3QYBA 1L1ZA 1AIPC 4JI8M 3EIHA 5F3WA 2OOAA 1T6OA 3HU2A 4MGIE 3K9OA 2XFSA 2DNAA 1J09A 2CV2A 3LVVA 3TWMA 3HKPA 3FKEA 2V6ZM 1SXJA 2EO2A 1VQ1A 2JA2A 3I04M 2UUCM 4LF4M 1NHGC 2O01F 5ITTA 2C5RA 4JI6M 3GRRA 4QHSA 2ZM6M 3AFHA 3PXGA 1JR3D 4FCWA 1H6UA 1DGBA 2KZUA 3SC3A 5FTLA 1VEKA 2L7HA 2DAKA 1VEJA 3GLHE 2LVOC 5KO3A 2Y0QA 1L2DA 5GKNA 4QNMA 2EA0A 4MGHA 3IG5A 3GLIE 3IHPA 4LZZA 2M60A 4I81A 4MGKE 4WP2A 2DWNA 1TH2A 4B3SM 3C9PA 2LBCA 5EXPA 1D0KA 1PRBA 2JZ0A 1R2ZA 5EP1A 3DA1A 4OVZB 4MB7A 3T1HM 3U6SA 4DR6M 2F5NA 1Q39A 5LMNM 4GRIA 2F5PA 3VKHA 2D7GA 2QCUA 3QWLA 2FNAA 3HU3A 5IT9S 1WXQA 3KS8A 1LTMA 1GJTA 2H1RA 3W68A 1EIJA 1QANA 3C3DA 1OTRA 1E9SA 2LVQD 4DV5M 2Z8YM 2KRUA 2Y21A 5KPZA 1WGNA 3JR5A 4KODA 3VKGA 2QENA 1N78A 5KPRA 3GO8A 4BLCA 1CUKA 4G3OA 2MR9A 2HL7A 1QAQA 1NNJA 3SMSA 1NJFA 3QAUA 2KDLA 1RU3A 1OFHA 4M0WA 4P16A 2JY6B 4WURA 2DZNB 4ZPXA 5ITUA 4AI6A 1LV7A 2I7NA 3H4MA 5DYGA 1HNZM 4CIZA 4DR2M 2R46A 4OVZA 3BOSA 3E4RA 4LJ9A 2Z4SA 2R4EA 3A98B 1DGFA 3FUTA 4JI5M 1C7YA 2R65A 1ZQ9A 1F4IA 2R18A 3LCVB 2XFTA 3C3EA 2JZ1A 3VK8A 5EP4A 2QSFX 2BJWA 2Y0TA 2CHGA 3LQRA 1NO1A 3GPXA 1JR3E 2XSZD 1G8PA 4OU7A 4FW9A 4FCTA 4DV4M 3GRVA 4TUWA 4YY3M 2JY8A 1HQYE 2X49A 2XH9A 4LJ8A 4FWGA 2LVPC 2JUJA 1PJQA 3GLHB 1Z5AA 1JQJC 4L15A 1E32A 1R2YA 2D7EA 1X37A 1FJGM 1G41A 3K1JA 3I4YA 1TH3A 4LJAA 3FTEA 3GLIB 4LFBM 2L09A 3KP0E 1NV8A 3HZJA 2RGHA 4JI0M 1HJPA 3HGIA 2J7OA 1WR1B 4IBIA 2LXEA 4IBEA 3L27A 3SASA 1ZAEA 1W5TA
chains in the Genus database with same CATH topology
2JP7A 2EKFA 1WHCA 3E21A 2QNJA 1TTEA 2MJ5B 3LCUA 1HT1E 1AIPC 1DO0A 1NV9A 2BWBA 2OOAA 1T6OA 1WJ7A 3K9OA 2DNAA 4Q7JA 2LTUA 1VQ1A 1E94E 5JI2E 2L2DA 1Q02A 2QHOB 3FE3A 1VEKA 2B3TA 2OO9A 1IFYA 2EJSA 1DV0A 1VDLA 2DAKA 1VEJA 3GLHE 2LVOC 2DAGA 4F1IA 2DI0A 2G3QA 1KYIA 1OAIA 3GLIE 3IHPA 2DENA 5DFLA 4WP2A 1IM2A 2DZLA 1OQYA 2LBCA 2JZ0A 2K9DA 3F92A 1WGLA 3IECA 1P3QQ 2L4FA 1Y8GA 2DKLA 3H4JA 4R71A 2DAIA 2RRUA 2HAKA 3MMPA 4DBGB 2CWBA 1XXHE 2BWEA 2L4EA 2DAEA 1VEGA 3E46A 1UFZA 2CP8A 3GLFE 3GLGE 1IXSA 1OTRA 2H5XA 2LVQD 2DAMA 1ZMUA 2O25A 1BVSA 1WGNA 1WIVA 4UN2B 1ZV1A 2KNZA 4F2LA 1PGYA 2KHHA 2R0IA 3FRHA 1V92A 1CUKA 4G3OA 2MR9A 2MGWA 1A5TA 2KNVA 2JY5A 1QZEA 3T6PA 4GEWA 1HT2E 2JY7A 1OKSA 2KNAA 2JY6B 4HEOA 1ZMWA 1T43A 2MROB 3FRIA 1DO2A 1YLAA 2K0BX 1G4AE 1C7YA 2DHYA 1F4IA 3LCVB 2JZ1A 3BBZA 2JNHA 2WZJA 1XB2B 1R4GA 2QSFX 1MN3A 2ZTDA 1JR3E 2LVNC 2JY8A 1HQYE 2LVPC 2JUJA 1GO5A 2EKKA 2OOBA 1SG9A 1G41A 1EFUB 2ZTCA 1G3IA 2HWJA 2LVAA 1NV8A 1VG5A 1HJPA 3K9PA 1TR8A 1WR1B 3B89A 1ZMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP7 A;  2EKF A;  1WHC A;  3E21 A;  2QNJ A;  1TTE A;  2MJ5 B;  3LCU A;  1HT1 E;  1AIP C;  1DO0 A;  1NV9 A;  2BWB A;  2OOA A;  1T6O A;  1WJ7 A;  3K9O A;  2DNA A;  4Q7J A;  2LTU A;  1VQ1 A;  1E94 E;  5JI2 E;  2L2D A;  1Q02 A;  2QHO B;  3FE3 A;  1VEK A;  2B3T A;  2OO9 A;  1IFY A;  2EJS A;  1DV0 A;  1VDL A;  2DAK A;  1VEJ A;  3GLH E;  2LVO C;  2DAG A;  4F1I A;  2DI0 A;  2G3Q A;  1KYI A;  1OAI A;  3GLI E;  3IHP A;  2DEN A;  5DFL A;  4WP2 A;  1IM2 A;  2DZL A;  1OQY A;  2LBC A;  2JZ0 A;  2K9D A;  3F92 A;  1WGL A;  3IEC A;  1P3Q Q;  2L4F A;  1Y8G A;  2DKL A;  3H4J A;  4R71 A;  2DAI A;  2RRU A;  2HAK A;  3MMP A;  4DBG B;  2CWB A;  1XXH E;  2BWE A;  2L4E A;  2DAE A;  1VEG A;  3E46 A;  1UFZ A;  2CP8 A;  3GLF E;  3GLG E;  1IXS A;  1OTR A;  2H5X A;  2LVQ D;  2DAM A;  1ZMU A;  2O25 A;  1BVS A;  1WGN A;  1WIV A;  4UN2 B;  1ZV1 A;  2KNZ A;  4F2L A;  1PGY A;  2KHH A;  2R0I A;  3FRH A;  1V92 A;  1CUK A;  4G3O A;  2MR9 A;  2MGW A;  1A5T A;  2KNV A;  2JY5 A;  1QZE A;  3T6P A;  4GEW A;  1HT2 E;  2JY7 A;  1OKS A;  2KNA A;  2JY6 B;  4HEO A;  1ZMW A;  1T43 A;  2MRO B;  3FRI A;  1DO2 A;  1YLA A;  2K0B X;  1G4A E;  1C7Y A;  2DHY A;  1F4I A;  3LCV B;  2JZ1 A;  3BBZ A;  2JNH A;  2WZJ A;  1XB2 B;  1R4G A;  2QSF X;  1MN3 A;  2ZTD A;  1JR3 E;  2LVN C;  2JY8 A;  1HQY E;  2LVP C;  2JUJ A;  1GO5 A;  2EKK A;  2OOB A;  1SG9 A;  1G41 A;  1EFU B;  2ZTC A;  1G3I A;  2HWJ A;  2LVA A;  1NV8 A;  1VG5 A;  1HJP A;  3K9P A;  1TR8 A;  1WR1 B;  3B89 A;  1ZMV A; 
#chains in the Genus database with same CATH topology
 2JP7 A;  4B7H A;  2XZF A;  4DR7 M;  1WHC A;  3KOW E;  2KXE A;  1TTE A;  3DOA A;  2WSF F;  1NV9 A;  2BWB A;  1NJG A;  1V33 A;  4DR5 M;  2HKJ A;  1Z59 A;  3I51 A;  1OFI A;  3HWS A;  4Q7J A;  4I4L A;  4A3V B;  2W82 A;  1IQP A;  3L28 A;  2L2D A;  3PNY A;  2J7N A;  2UUA M;  4PT5 A;  2GQF A;  2K47 A;  3BXW A;  3WHL A;  4D82 A;  1IXS B;  4NRW A;  3SMP A;  4LRT A;  1IN4 A;  3GLH A;  5A2Q S;  3Q8X A;  2EJS A;  2CHQ A;  1DV0 A;  1OIP A;  3GLI A;  2R45 A;  2ZBK B;  4R3D A;  4F1I A;  2XLJ A;  4IBB A;  2DI0 A;  4DV7 M;  1MX0 A;  3T1Y M;  4ANR A;  2Y20 A;  1TGU A;  4HLQ A;  1Z5B A;  2G3Q A;  4FWH A;  2KZS A;  3PVS A;  3TWL A;  4X65 M;  3SAR A;  1XNR M;  4DR4 M;  3KSJ A;  8CAT A;  1FNN A;  4KHP M;  1IM2 A;  1V34 A;  3WHK A;  2XEP A;  1XXH B;  1OQY A;  5E26 A;  3J81 S;  2VQE M;  1GKI A;  4NXM M;  1WGL A;  1YSY A;  3VLF B;  2JWS A;  3GLG B;  3JR4 A;  1AUA A;  2FH0 A;  2L4F A;  3UMM A;  4D80 A;  3U61 B;  3H4J A;  4MM3 B;  3TWK A;  2QPA A;  2LNH C;  2QZ4 A;  2VF7 A;  3PFI A;  5BPV A;  3GPP A;  3R8F A;  3HJS A;  4R71 A;  1QDT A;  4AQY M;  2DXI A;  2Z4R A;  3U6C A;  4JI1 M;  4CHT B;  1IXZ A;  2RRU A;  4LRS A;  3ZC7 B;  1D0M A;  3SHF A;  3HX3 A;  4BB9 A;  1N32 M;  1Z6T A;  2R44 A;  1IBL M;  4XGI A;  3E46 A;  3HJ8 A;  4GH9 A;  2VF8 A;  1IXS A;  3A45 A;  1K3W A;  4Y28 F;  1QYR A;  3A42 A;  4R7G A;  4JYA M;  5DNY A;  1BVS A;  4LY6 A;  4CIS A;  3K8Z A;  4UN2 B;  3HY5 A;  4NXN M;  3B7Z A;  1XNQ M;  1NHW C;  5FTN A;  2R0I A;  4QNR A;  3CF6 E;  5FTJ A;  1QZE A;  1NY6 A;  4GEW A;  1PJS A;  3K92 A;  1OKS A;  1QAO A;  2KNA A;  3ZH9 B;  3FUW A;  1TF0 B;  4NC6 A;  5KPT A;  3GQ5 A;  1XXH A;  1ZMW A;  3A46 A;  2MRO B;  1DO2 A;  3GLG A;  2DWL A;  4DV1 M;  4FVM A;  3U61 A;  1G4A E;  4G6Z A;  1JR3 A;  2RKO A;  3NBX X;  3TL4 X;  1NVM A;  2JNH A;  2WZJ A;  4MGZ E;  3KOY E;  2P5T A;  2ZTD A;  2G5G X;  2OPF A;  1QQW A;  4EIW A;  4JI2 M;  4AG5 A;  1QAM A;  4X64 M;  2J5Y A;  5L8R F;  4CJ6 A;  1TDZ A;  1KSF X;  3GRY A;  2L6O A;  2VII A;  2F5Q A;  3FUV A;  4JN6 A;  3GRU A;  2UXB M;  2EKK A;  1GO5 A;  4L78 A;  2OOB A;  3NBI A;  3SAT A;  5EXS A;  2C9C A;  2C96 A;  4YHH M;  4RF0 A;  3R9X B;  2X4A A;  1EFU B;  3U6Q A;  4XBO A;  3HU1 A;  2HWJ A;  2LHG A;  2LVA A;  1QUT A;  3DZD A;  1GJS A;  3V76 A;  4PDI A;  3SYL A;  1TR8 A;  4DV0 M;  1L8Q A;  3J2P B;  3B74 A;  4QOZ C;  3CF0 A;  3RGS A;  2EKF A;  2CHV A;  1DGG A;  4G4R A;  1K82 A;  1XMQ M;  3MK6 A;  2AHM A;  3B7N A;  1HT1 E;  4LGM A;  3KFU G;  2O5R A;  3LVW A;  4LFA M;  2KW0 A;  2CFO A;  4WW0 A;  5ITQ A;  3T15 A;  1OIZ A;  4L4U A;  1EE8 A;  4M0D A;  2LTU A;  4LF9 M;  3GP1 A;  5JI2 E;  1I4W A;  2Z7J A;  1J7K A;  1MU5 A;  2R62 A;  2R6F A;  3MHV C;  4NSR A;  2HCB A;  4REZ A;  2L7I A;  3FE3 A;  3HHW A;  3U5Z B;  3LMM A;  2N35 A;  2X8A A;  4B3R M;  1W5S A;  3FUX A;  4FD2 A;  3EIE A;  2CEA A;  2G8L A;  4AZF A;  1L1T A;  2UUB M;  1XHB A;  2DEN A;  3KOZ E;  3B7Q A;  2APL A;  5KQ8 A;  4M9Z A;  3FD9 A;  2QP9 X;  4HL4 A;  1PM5 A;  2XSZ A;  4IIW A;  3IEC A;  1P3Q Q;  1Y8G A;  2OQ4 A;  4DUZ M;  3UJN A;  5EJC A;  1E9R A;  3VDU A;  2HHH M;  4MGY E;  3M6A A;  2WSE F;  4IBD A;  3VK7 A;  4LF8 M;  3MMP A;  4LJ6 A;  3SYK A;  2CWB A;  1I94 M;  3KVW A;  1VEG A;  4MH0 E;  4AW4 A;  5ITX E;  1IY2 A;  3GLF E;  4JI3 M;  4LCB A;  2H5X A;  1ORY B;  2YNM D;  4X66 M;  3U5Z A;  2A5Y B;  3M0E A;  1WIV A;  1SXJ D;  4CGY B;  2Z3X A;  1ZV1 A;  4LFC M;  4B7G A;  4F2L A;  2E5L M;  4IJE A;  3HHY A;  3DFZ A;  4B7F A;  2F4V M;  2KNV A;  2JY5 A;  4QHT A;  3GPU A;  2QQ8 A;  2JY7 A;  5KQD A;  5BR8 M;  3SAV A;  4GHA A;  4IBK A;  3U6P A;  3KSX A;  3OTO M;  4S12 A;  4RKU F;  3SFZ A;  3HHZ A;  1R7R A;  4NOO B;  4KLN A;  1XWI A;  1YE9 A;  4KT0 F;  2F5O A;  4GC9 A;  4GC5 A;  1T43 A;  4FWD A;  5H37 D;  2QBY B;  4JI4 M;  1YLA A;  2VDB B;  3U60 B;  4K0K M;  5FLX S;  2JXN A;  2BNK A;  1IN7 A;  2KA6 B;  3KDS E;  4LJ7 A;  1IBM M;  2DVW B;  2F5S A;  3VDP A;  3BBZ A;  3ILK A;  1XB2 B;  1R4G A;  1PJJ A;  1DGH B;  2CE7 A;  3CGW A;  4IBF A;  1IN6 A;  3ZQJ A;  2DWZ B;  1NY5 A;  3AKZ A;  1IY1 A;  3T38 A;  3TQS A;  5DYI A;  4NL4 H;  1D0L A;  1OJL A;  4IBG A;  5EP3 A;  5ITY A;  7CAT A;  1HNW M;  3L25 A;  5EP2 A;  3K2L A;  1TH4 A;  4Z6Y A;  1J5E M;  1HNX M;  1L2B A;  3I4V A;  3AOE C;  4DV6 M;  1N36 M;  3Q8G A;  2I7P A;  3AOG A;  2CUZ A;  5EXX A;  2K6B A;  3B9P A;  5C18 A;  1L2C A;  4PD2 A;  5EQT A;  1N75 A;  2ZAO A;  2C9O A;  4B3M M;  4M9S A;  4BBA A;  2DHR A;  3I01 M;  3B89 A;  1ZMV A;  1R6B X;  4PDG A;  2CRU A;  3TPZ A;  5JI3 E;  3L26 A;  1D2N A;  3J7B A;  5LMU M;  4II7 A;  2QBY A;  3E21 A;  2QNJ A;  3J80 S;  2MJ5 B;  3CTW B;  1R5L A;  2Q2E B;  4LJ4 A;  3U60 A;  3D8L A;  1DO0 A;  2EUC A;  3KW6 A;  1WJ7 A;  2C99 A;  4G4Q A;  5FSW A;  1GL7 A;  3ZCB B;  4X62 M;  3GLF B;  1HR0 M;  1DGH A;  4GIP A;  1E94 E;  2LH0 A;  4FCV A;  1IN8 A;  1Q02 A;  4DR1 M;  4GMQ A;  1SXJ E;  3U6M A;  3L29 A;  4JV5 M;  2QHO B;  5IWA M;  4OW0 A;  3U6D A;  2XGN A;  1N33 M;  2B3T A;  2OO9 A;  1IFY A;  1IBK M;  1SXJ C;  3C58 A;  2D7H A;  1VDL A;  1GLN A;  5IRE B;  3KXE C;  3LQQ A;  2DAG A;  3J27 B;  2KRK A;  4ITQ A;  2FS1 A;  3U6E A;  3AJI B;  4GKJ M;  1KYI A;  1OAI A;  1GL6 A;  1PJT A;  2CV1 A;  5DFL A;  2ERC A;  1JB0 F;  2FOI C;  3FTF A;  2DZL A;  1K3X A;  3AV0 A;  4LF6 M;  4GKK M;  3SHG B;  2FFJ A;  1HQC A;  3F92 A;  2K9D A;  4XK8 F;  2WSC F;  3D8B A;  1GAB A;  4L6V 6;  2DKL A;  4B3T M;  2LWX A;  3W67 A;  3LW5 F;  2UXD M;  1UM8 A;  1MJG M;  1QDR A;  1QVR A;  2C98 A;  4QOS A;  4GHL A;  3E9S A;  4I8O A;  3U6O A;  1QZM A;  2DAI A;  5ITX A;  3GLF A;  4LF7 M;  4AKI A;  2HAK A;  2YQZ A;  5FTM A;  3W0L B;  3AL0 C;  4DBG B;  1XXH E;  2BWE A;  2L4E A;  4AG6 A;  2DAE A;  3RGP A;  1G71 A;  1IXR C;  3FYC A;  3JAM S;  1S3S A;  2DZO B;  1UFZ A;  2CP8 A;  4Z8X A;  1OAO C;  3RFW A;  4B08 A;  3GLG E;  4IBC A;  2DAM A;  1ZMU A;  2O25 A;  4I5S A;  4LJ5 A;  4LGY A;  4D81 A;  4DV2 M;  1XMO M;  4LZJ A;  3SAU A;  4JXJ A;  3W0F A;  4NRV A;  1IN5 A;  2KNZ A;  3SAW A;  2R4J A;  1PGY A;  3UK6 A;  2KHH A;  3FRH A;  3FTD A;  1V92 A;  3FYD A;  2V1U A;  1Q3B A;  1G59 A;  1Q3C A;  2MGW A;  1A5T A;  4L16 A;  4NSO B;  3HHX A;  2V1C A;  3IG8 A;  3T6P A;  1HT2 E;  5IZ7 D;  2RGO A;  5E6J A;  3KOX E;  3U6L A;  3GQ4 A;  4LF5 M;  3VFD A;  4HEO A;  1PJI A;  4IJF A;  1YUB A;  3UZU A;  3M7G A;  4DV3 M;  3FRI A;  2M5Z A;  1T3T A;  4LG2 A;  2ZAN A;  2ZAM A;  1XC8 A;  2YR0 A;  4W5W A;  1TDH A;  5FTK A;  2K0B X;  2DHY A;  3KP1 E;  2XF3 A;  3KS4 A;  3SBJ A;  2XZU A;  2UXC M;  1SXJ B;  3PNV A;  1MN3 A;  3QYE A;  3TE6 A;  3GPY A;  4DUY M;  2VQF M;  3AOE A;  3MJ5 A;  2LVN C;  3FUU A;  4OX9 M;  1KFV A;  1Z5C A;  1VDD A;  4G4O A;  4RNA A;  1N77 A;  4G4N A;  2YFQ A;  4DR3 M;  3GQ3 A;  2KEB A;  4JI7 M;  4L8R C;  1SG9 A;  4PCZ A;  2GNO A;  2ZTC A;  1G3I A;  4RF1 A;  4P17 A;  3J7A S;  5EXT A;  4KO8 A;  1QUS A;  4IBJ A;  1VG5 A;  5ITR A;  4AKH A;  2MH8 A;  4M9X A;  3THG A;  1NNU C;  1C1K A;  1IY0 A;  2LHC A;  3RE8 A;  3UGJ A;  1N34 M;  1NSF A;  3L2A A;  4GIT A;  3CF2 A;  3NWL A;  2CV0 A;  2FE8 A;  2UU9 M;  3K9P A;  4AKG A;  5C1B A;  2DWM A;  1GVN A;  2NQ8 C;  3HJQ A;  2BJV A;  3FTC A;  3LCU A;  3QYB A;  1L1Z A;  1AIP C;  4JI8 M;  3EIH A;  5F3W A;  2OOA A;  1T6O A;  3HU2 A;  4MGI E;  3K9O A;  2XFS A;  2DNA A;  1J09 A;  2CV2 A;  3LVV A;  3TWM A;  3HKP A;  3FKE A;  2V6Z M;  1SXJ A;  2EO2 A;  1VQ1 A;  2JA2 A;  3I04 M;  2UUC M;  4LF4 M;  1NHG C;  2O01 F;  5ITT A;  2C5R A;  4JI6 M;  3GRR A;  4QHS A;  2ZM6 M;  3AFH A;  3PXG A;  1JR3 D;  4FCW A;  1H6U A;  1DGB A;  2KZU A;  3SC3 A;  5FTL A;  1VEK A;  2L7H A;  2DAK A;  1VEJ A;  3GLH E;  2LVO C;  5KO3 A;  2Y0Q A;  1L2D A;  5GKN A;  4QNM A;  2EA0 A;  4MGH A;  3IG5 A;  3GLI E;  3IHP A;  4LZZ A;  2M60 A;  4I81 A;  4MGK E;  4WP2 A;  2DWN A;  1TH2 A;  4B3S M;  3C9P A;  2LBC A;  5EXP A;  1D0K A;  1PRB A;  2JZ0 A;  1R2Z A;  5EP1 A;  3DA1 A;  4OVZ B;  4MB7 A;  3T1H M;  3U6S A;  4DR6 M;  2F5N A;  1Q39 A;  5LMN M;  4GRI A;  2F5P A;  3VKH A;  2D7G A;  2QCU A;  3QWL A;  2FNA A;  3HU3 A;  5IT9 S;  1WXQ A;  3KS8 A;  1LTM A;  1GJT A;  2H1R A;  3W68 A;  1EIJ A;  1QAN A;  3C3D A;  1OTR A;  1E9S A;  2LVQ D;  4DV5 M;  2Z8Y M;  2KRU A;  2Y21 A;  5KPZ A;  1WGN A;  3JR5 A;  4KOD A;  3VKG A;  2QEN A;  1N78 A;  5KPR A;  3GO8 A;  4BLC A;  1CUK A;  4G3O A;  2MR9 A;  2HL7 A;  1QAQ A;  1NNJ A;  3SMS A;  1NJF A;  3QAU A;  2KDL A;  1RU3 A;  1OFH A;  4M0W A;  4P16 A;  2JY6 B;  4WUR A;  2DZN B;  4ZPX A;  5ITU A;  4AI6 A;  1LV7 A;  2I7N A;  3H4M A;  5DYG A;  1HNZ M;  4CIZ A;  4DR2 M;  2R46 A;  4OVZ A;  3BOS A;  3E4R A;  4LJ9 A;  2Z4S A;  2R4E A;  3A98 B;  1DGF A;  3FUT A;  4JI5 M;  1C7Y A;  2R65 A;  1ZQ9 A;  1F4I A;  2R18 A;  3LCV B;  2XFT A;  3C3E A;  2JZ1 A;  3VK8 A;  5EP4 A;  2QSF X;  2BJW A;  2Y0T A;  2CHG A;  3LQR A;  1NO1 A;  3GPX A;  1JR3 E;  2XSZ D;  1G8P A;  4OU7 A;  4FW9 A;  4FCT A;  4DV4 M;  3GRV A;  4TUW A;  4YY3 M;  2JY8 A;  1HQY E;  2X49 A;  2XH9 A;  4LJ8 A;  4FWG A;  2LVP C;  2JUJ A;  1PJQ A;  3GLH B;  1Z5A A;  1JQJ C;  4L15 A;  1E32 A;  1R2Y A;  2D7E A;  1X37 A;  1FJG M;  1G41 A;  3K1J A;  3I4Y A;  1TH3 A;  4LJA A;  3FTE A;  3GLI B;  4LFB M;  2L09 A;  3KP0 E;  1NV8 A;  3HZJ A;  2RGH A;  4JI0 M;  1HJP A;  3HGI A;  2J7O A;  1WR1 B;  4IBI A;  2LXE A;  4IBE A;  3L27 A;  3SAS A;  1ZAE A;  1W5T A; 
#chains in the Genus database with same CATH homology
 2JP7 A;  2EKF A;  1WHC A;  3E21 A;  2QNJ A;  1TTE A;  2MJ5 B;  3LCU A;  1HT1 E;  1AIP C;  1DO0 A;  1NV9 A;  2BWB A;  2OOA A;  1T6O A;  1WJ7 A;  3K9O A;  2DNA A;  4Q7J A;  2LTU A;  1VQ1 A;  1E94 E;  5JI2 E;  2L2D A;  1Q02 A;  2QHO B;  3FE3 A;  1VEK A;  2B3T A;  2OO9 A;  1IFY A;  2EJS A;  1DV0 A;  1VDL A;  2DAK A;  1VEJ A;  3GLH E;  2LVO C;  2DAG A;  4F1I A;  2DI0 A;  2G3Q A;  1KYI A;  1OAI A;  3GLI E;  3IHP A;  2DEN A;  5DFL A;  4WP2 A;  1IM2 A;  2DZL A;  1OQY A;  2LBC A;  2JZ0 A;  2K9D A;  3F92 A;  1WGL A;  3IEC A;  1P3Q Q;  2L4F A;  1Y8G A;  2DKL A;  3H4J A;  4R71 A;  2DAI A;  2RRU A;  2HAK A;  3MMP A;  4DBG B;  2CWB A;  1XXH E;  2BWE A;  2L4E A;  2DAE A;  1VEG A;  3E46 A;  1UFZ A;  2CP8 A;  3GLF E;  3GLG E;  1IXS A;  1OTR A;  2H5X A;  2LVQ D;  2DAM A;  1ZMU A;  2O25 A;  1BVS A;  1WGN A;  1WIV A;  4UN2 B;  1ZV1 A;  2KNZ A;  4F2L A;  1PGY A;  2KHH A;  2R0I A;  3FRH A;  1V92 A;  1CUK A;  4G3O A;  2MR9 A;  2MGW A;  1A5T A;  2KNV A;  2JY5 A;  1QZE A;  3T6P A;  4GEW A;  1HT2 E;  2JY7 A;  1OKS A;  2KNA A;  2JY6 B;  4HEO A;  1ZMW A;  1T43 A;  2MRO B;  3FRI A;  1DO2 A;  1YLA A;  2K0B X;  1G4A E;  1C7Y A;  2DHY A;  1F4I A;  3LCV B;  2JZ1 A;  3BBZ A;  2JNH A;  2WZJ A;  1XB2 B;  1R4G A;  2QSF X;  1MN3 A;  2ZTD A;  1JR3 E;  2LVN C;  2JY8 A;  1HQY E;  2LVP C;  2JUJ A;  1GO5 A;  2EKK A;  2OOB A;  1SG9 A;  1G41 A;  1EFU B;  2ZTC A;  1G3I A;  2HWJ A;  2LVA A;  1NV8 A;  1VG5 A;  1HJP A;  3K9P A;  1TR8 A;  1WR1 B;  3B89 A;  1ZMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...