1QDTA

2.1 a resolution structure of escherichia coli lytic transglycoyslase slt35 in complex with calcium
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdtA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdtA02
1GB3A 2D4IA 3B72A 1FLWA 3G3BB 5HNCA 1LJHA 5HNLA 4GN5C 2IHLA 5APDA 207LA 1EQ4A 4NGKA 4WM5A 2HU3A 1HEWA 2EQLA 1IWWA 133LA 2H9KA 2FYCA 4LFXA 3WXTA 2BQJA 4B1AA 3WXUA 1OUCA 2HEFA 3A93A 3W3EA 4B4IA 1F10A 1IWZA 1LJGA 1B7LA 1GFKA 1GDWA 2MECA 4PJ2C 1LJ4A 1HEQA 4OWBA 4NHPA 4E3UA 1OUEA 1IP7A 1B5YA 2HEEA 2W1LA 1DPXA 3P65A 1YANA 4WM4A 2BQAA 4G4BA 5L3IA 1NQIA 5E4PA 1JKAA 1LMOA 1NDMC 5LYTA 2PC2A 4RLNA 1LSBA 3LYMA 1WQNA 4LT0A 4QY9A 1UUZC 4WM3A 1V7SA 5FCPA 3CSRA 2BLXA 1IR8A 5LAGA 4QDNA 1WVUA 2BQEA 4HSFA 1IC5Y 3AZ6A 1JTOL 4D9ZA 4TTDA 3LZ2A 1GFAA 5II3A 3D9AC 2ZNWY 1LZBA 1HC0A 4XJBA 1MELL 1GBSA 1LZSA 3LZTA 1CNSA 1LHJA 4H91A 1IEEA 1J1OY 2CJLA 1JSFA 1GF4A 1LSCA 1HFZA 1T6VL 4OW1A 4NGVA 4MSTA 8LYZA 1GF3A 4LT2A 4II8A 4LT1A 4H9AA 4TWSA 4XADA 1LJKA 1JKBA 4ZFPA 5KKIA 1LZDA 2BQKA 4XENA 5KXMA 3QNGA 2EIZC 3TXIA 4WG1A 1JPOA 1LZTA 4NG8A 1B0DA 1LMQA 4NGZA 4I8SA 4XJIA 2HTXA 2Z2FA 1B9OA 2XBSA 3W6BA 1HF4A 1UA6Y 4WM2A 1UIFA 5ILCA 2C8PA 4HPIA 4R0FA 208LA 1LZ1A 1CKGA 3A92A 1VDSA 2ZILA 3AZ5A 1KIQC 4ETAA 4H8XA 2I26L 1A4VA 1FDLY 1GHLA 1XGQC 1VATA 2Z2EA 3A94A 1NF5A 2Z39A 4H94A 2LHMA 5B07A 1LOZA 1JJ0A 1KIRC 5ILFA 4N5RA 1HMKA 1REMA 4HJVA 1KXXA 4R6CA 5DN4A 4NHIA 4G4HA 4H1PA 1GFEA 2CGIA 2Y8PA 2ZYPA 3EO5A 1B5XA 1F6RA 4HTQA 1JITA 4LFPA 1BB5A 1MLCE 1LMNA 3EBAB 4J1BA 2C8OA 1OUHA 2Q0MX 4EMNA 4UWVA 3A34A 5LIOA 1IX0A 4TUNA 1LYZA 1DPWA 2LZ2A 1B7RA 1BHZA 1IOSA 1RCMA 5F9UA 4IJ4A 3M18B 4DD7A 1D0MA 1OUGA 5IDDA 1AM7A 1GFVA 1LZGA 1GAZA 2G4PA 135LA 1GB7A 4PHIA 4WO9A 3WU9A 3WPKA 1NBZC 2DKVA 4WOAA 5KJ9A 1VDTA 1C08C 2BQHA 1CKFA 1IC7Y 3WUMA 3MGWA 1D0LA 3WPJA 5KXWA 1LJFA 1UC0A 2BAAA 4H8YA 1WQOA 1BB7A 5I4WA 5LXWA 1IY3A 1EL1A 1QDTA 2CDSA 2WARA 2MEBA 1LJIA 3P4ZA 4YF2A 4WG7A 1I56A 4ET8A 3ULRA 4GLAA 2ZIJA 1GB9A 1EQ5A 4Z98A 4OWHA 5LYZA 1NDGC 1F6SA 1LTMA 4GCBA 2XBRA 2YBJA 1D9UA 1GB5A 1FN5A 4OWAA 1N4FA 5B06A 3WVYA 193LA 1LZ4A 2BQMA 1SLYA 1NKHA 2HECA 1AT6A 1GF5A 1GWDA 2HU1A 3W6EA 3WW5A 3EMSA 1WQPA 2DQIY 1D0KA 1QTEA 2YBHA 3P64A 1UIBA 4WL7A 4WM1A 1OUJA 4EOFA 2DBTA 1GF0A 1DQJC 4PGJB 4P2EA 5LA8A 5APFA 4ZIXA 1RFPA 4UWUA 2ZNXY 4J0LA 1QUSA 1CJ7A 3F6ZA 3K3TA 4NSJA 1VFBC 2FYDA 4GCCA 3RNXA 5HQ1A 1I20A 1NHEA 1OP9B 4OWCA 4XYYA 2H5ZA 2DQEY 3CT5A 1XGPC 4GN4A 3WU8A 1HELA 2ZIKA 4YEMA 5KXOA 5LVJA 1GFRA 4OOTA 4TSCA 1G7MC 4H9FA 1RJCB 3TXEA 2YVBA 1GE3A 1GB2A 1GE0A 1INUA 4NGOA 4NGYA 4NWHA 1B5VA 5FDJA 1C43A 4H9BA 3WULA 1IC4Y 4LGKA 1P2CC 1IORA 1GF8A 1REYA 1LHMA 1XSFA 2BPUA 4B0DA 3TXJA 1DZBX 2BQGA 1C46A 4NGJA 2YDGA 4NWEA 1LSFA 1XGUC 4IATA 5LAFA 2MEIA 1LMCA 1LZ9A 1LSYA 1LZYA 1F0WA 1LYSA 1PS5A 1JWRA 4DDBA 5KXPA 1IWXA 1CKHA 4HJZA 1LAAA 2A7DA 4PPOA 4NFVA 1JUGA 2DQFC 3A6BY 1XGTC 1AZFA 1UICA 3ZEKA 2Z37A 4I0CA 2YSSC 3A90A 4WO6A 1FKQA 4PRUA 1ZMYL 4X3BA 5L9JA 5F16A 2F4GA 2YBMA 2LYMA 5IHGA 1LPIA 4N0JA 5M1YA 4WMGA 2Z38A 1OUDA 1IP5A 1T3PA 2A7FA 1QSWA 3QE8A 5KXZA 3TXFA 4WLXA 1AT5A 1C7PA 1WTMA 1DI5A 4H9EA 3A96A 5DM9A 4CFOA 3CSQA 4H92A 5T3FA 1G7HC 1YQVY 4BS7A 5KXXA 4N1EI 1IOQA 1KXYA 3E3DA 4LYTA 4GCDA 2HUBA 1G7LC 3A8ZA 1WQMA 4W94A 4Z41A 1LSZA 1GBWA 1JJ1A 1YILA 1ZV5L 4NGLA 3VWOA 4Z3MA 4XJDA 4KT3A 3CSZA 5KXTA 2LZTA 4LT3A 1CJ9A 4KL7A 4QEQA 1LMAA 4WM6A 4DYGA 1O23A 3GXRA 2BQIA 4LYMA 4L41A 3N9AA 3ATNA 3G3AB 3WVXA 2MEAA 4HTKA 2W1MA 3HFMY 4HTNA 2LYOA 1YAOA 1BQLY 4HJYA 1C45A 5FEKA 4NG1A 3LN2A 1IOCA 3WMKA 1LSMA 1LZRA 4NGIA 1LHIA 3W6CA 1XEIA 1JHLA 3EXDA 5JENB 1LSDA 4ZEEA 3HBDA 3TXBA 3A6CY 4LYCA 4NSGA 1GF7A 4H9IA 1IWTA 3TMVA 1Z55A 4NHSA 4WLYA 1HERA 1B7MA 4GLVA 5F14A 3RZ4A 1LZ6A 4RDSA 2XJWA 4HV1A 1HENA 3P68A 3TXKA 1REXA 1LHHA 1W08A 1YAQA 1LZ5A 1GFTA 3TMXA 5D5FA 1LZNA 3ZVQB 4ETEA 5FELA 1GBXA 1WTNA 1CJ6A 1FLQA 1LHKA 2Z12A 1JTTL 4PRQA 9LYZA 1GFJA 4ETBA 1LKSA 3BKVA 6LYZA 1GBZA 4BAFA 4WL6A 5AMYA 3WU7A 3AW7A 1BWIA 1LJNA 3A91A 5DL9A 3ATOA 1H6MA 1LSAA 5HMVA 1OUAA 3AYQA 2HEBA 1GE4A 4GCFA 2DQCY 2I25L 1FKVA 2YBNA 1UIAA 4CFPA 1GFUA 134LA 3RT5X 2BQBA 1C10A 1JSEA 1YROA 3P66A 4HPEA 1JKDA 4DD0A 2N5ZA 5LYMA 1IR9A 1QIOA 3WPLA 2W1XA 1HEPA 1REZA 3N9CA 3A95A 3SP3A 5K7OA 1JJ3A 1HFXA 2AUBA 3W6FA 1YKZX 4LYZA 3KAMA 1IP6A 1UBZA 4XJFA 5J7CA 4LYBA 4YOPA 1YL0X 4C3WA 2YBIA 4NSHA 3OJPA 1FLUA 1NBYC 4DWXA 3B0OA 4LZTA 1GD6A 1SQ2L 5LA5A 2BQOA 1HEOA 4DD9A 1B7OA 1YAMA 2HEAA 3HBEX 5C6LA 1LJJA 3A67Y 1CJ8A 1V7TA 4OOOA 5APCA 3TXHA 1OQMA 1VAUA 4A7DA 1BB6A 4H8ZA 4FJRA 2ZQ4A 2DQGY 1LSNA 3AB6A 2Z18A 2EKSC 3B0KA 1IP2A 1A2YC 1DKJA 1KXWA 3WW6A 153LA 1BB4A 3A3QA 3T6UA 1TAYA 1AKIA 1GPQC 1RE2A 1UACY 2BQLA 1GDXA 1LZ8A 2MEEA 1YKYX 4G49A 1LSGA 4MR1A 1BWJA 1E8LA 4YEOA 1TEWA 4H90A 5DLAA 1GB8A 1IP1A 5A3ZA 5LVGA 1GBYA 2NWDX 4W96A 4AGAA 3AGGG 1IIZA 1KIPC 3CQLA 1GF9A 4H9HA 3TMWA 4DD1A 4G4CA 4B4EA 1GBOA 1HSWA 4NHQA 4QGZA 1BVXA 1RI8B 1UIHA 1YKXX 4BADA 4ANRA 4DDCA 5A3EA 3QY4A 5HLLA 4H9CA 2G4QA 1DXJA 1BVKC 1GAYA 2MEFA 2X0AA 1GE1A 3LYTA 4KPMA 5B1FA 1EQEA 5KXRA 4N8ZA 1I1ZA 1QDRA 3RU5A 1FLYA 1XEKA 3WUNA 1LYYA 1HEMA 4DD2A 1LZAA 3A3RX 1B7NA 1NWGA 1PZYA 1UIEA 2F30A 3IJUA 5FHWA 1H87A 3B6LA 5LVIA 2D6BA 2D4KA 4KXIA 4RW2A 3BKHA 2DQHY 1HFYA 2ZQ3A 1ZVHL 3FI7A 2BQFA 2ZYCA 1LZEA 2HEDA 4CGEA 1DI3A 2W1YA 1GFGA 4AXTA 1CKDA 2MEGA 2RSCA 1GEZA 1VDQA 132LA 3CT0A 2FBDA 5LVHA 3WUAA 5KXLA 1D6PA 1J1PY 1IOTA 4G9SA 4NIJA 1GB0A 5B1GA 1B5UA 2BQNA 3LYZA 1IWYA 5F9XA 4XJGA 4YM8A 5KXSA 5HMJA 1OUFA 4ML7A 2VB1A 4XN6A 1JIYA 1QTKA 2G4NA 5C6IA 3OK0A 1IO5A 1BGIA 3AW6A 4FDYA 5IELA 1B7PA 154LA 1VEDA 1JTPL 3WL2A 2MEHA 1TBYA 4N9RA 1VDPA 3WH1A 1G7IC 1HNLA 2YBLA 2B5ZA 4N1CC 1BB3A 1LKRA 1LSEA 1QSAA 5I4YA 5DN5A 1WQQA 1IY4A 2BQDA 2MEDA 1XFPL 3GXKA 3IJVA 1W6ZA 1XGRC 2BLYA 1GB6A 3AZ7A 4B49A 2DQDY 2XTHA 2DQJY 4IASA 1DI4A 4J7VA 1YL1X 1IP3A 3AGIA 1TDYA 4OWEA 3B0IA 5FSTA 1LJ3A 1JKCA 3J4GA 1BWHA 4U3XB 1GE2A 4C5FA 3HBHA 1LSPA 4J1AA 4YENA 1TCYA 1G7JC 1UIGA 1YIKA 4H93A 1HHLA 5I5QA 1IP4A 1LHLA 2ZWBA 4NY5A 1JEFA 1B7SA 3T36A 5LINA 3RW8A 4LYOA 4RW1A 1GF6A 4HV2A 4M4OA 3M3UA 5D5CA 5I4XA 1GFHA 2LYZA 3TMUA 5L3HA 2F4AA 3CB7A 4HP0A 3TXGA 1WQRA 1HMLA 2GV0A 4GCEA 5F81A 5KXKA 2D91A 3AGHA 3CT1A 6LYTA 1LMTA 1IVMA 1DKKA 2DQAA 1OUBA 4WLTA 3FE0A 1B7QA 4UWNA 1QUTA 4CHXA 194LA 1IWUA 5KXNA 1FBIX 4ETCA 1GXXA 4O34A 4RLMA 4Z46A 2H9JA 4ET9A 1D6QA 1LMPA 3TXDA 4DDAA 5APEA 1LZCA 2F2NA 2FBBA 5B05A 4M6DA 1HSXA 1ZVYB 2Z19A 3IWRA 4XJHA 5I53A 5KXYA 5LVKA 1IWVA 1JISA 4NHTA 4NGWA 4MCKA 1XEJA 5C6JA 1QQYA 4ETDA 1NMMA 1LJEA 4NSIA 3LHMA 4NEBA 4CJ2A 1ALCA 4TSBA 4DD3A 4TX7A 5KY1A 5KKJA 3N9EA 2IFFY 1B5ZA 2D4JA 1LCNA 3ZVQA 1B2KA 4WLDA 4DC4A 7LYZA 3AJNA 3W6AA 4BAPA 1UCOA 3W6DA 1IR7A 4B4JA 1CKCA 1UIDA 3J6KA 2I6ZA 5E9RA 1GEVA 3D3DA 4GN3A 2BQCA 1J1XY 3WYHA 2EPEA 1B5WA 1YAPA 3LYOA 5EBHA 5I54A 2CWIA 1WVVA 1OUIA 3AZ4A 1GXV2 5B59A 4DT3A 1LYOA
chains in the Genus database with same CATH superfamily
2RRUA 4Z6YA 3HDEA 4AQYM 3B72A 3G3BB 2V1CA 4GIPA 227LA 3RZEA 4GN5C 4YXAC 1R4GA 4WM5A 3GPUA 133LA 2H9KA 2FYCA 4MGIE 2BQJA 1OUCA 5ITUA 4LJ7A 5FTMA 1IWZA 1LJGA 4G4RA 1GDWA 1LJ4A 4IBEA 5IWAM 1L13A 1C65A 1OFHA 4NHPA 4E3UA 4Y28F 167LA 2Y21A 4G4BA 5L3IA 1NQIA 1JKAA 2PC2A 3OE8A 1WQNA 4LT0A 1PJQA 3R8FA 3CSRA 2E5LM 4EPIA 4HSFA 4TTDA 3LZ2A 1DGGA 3D9AC 2ZNWY 5II3A 4I7OA 1XNRM 3GLFA 3LZTA 3FTDA 3L29A 4JI1M 1LHJA 5F3WA 1JSFA 1G0QA 1GF4A 3IG8A 4MSTA 3KP0E 2XFSA 4LT1A 4D80A 4TWSA 4GBRB 5KKIA 5KXMA 1LZDA 1OVKA 2EIZC 1XWIA 2RGHA 4DQ5A 2DAIA 3GUIA 4I8SA 3K1JA 2Z2FA 2LVPC 3THGA 3W6BA 4WM2A 5ILCA 1LZ1A 1CKGA 1G1VA 3E46A 1VDSA 3B7QA 3DN8A 4ETAA 4H8XA 1QS5A 1A4VA 1FDLY 4M0DA 2Z39A 2LHMA 4H94A 4TUWA 1L1TA 1JJ0A 1OV7A 4DV5M 4HJVA 4A3VB 252LA 4G4HA 2R45A 2ZYPA 3J80S 2I7PA 1F6RA 1JITA 1D3FA 1MLCE 3HUAA 2C5RA 4UWVA 2LZ2A 3HJSA 1B7RA 1IOSA 1RCMA 214LA 1DGHB 1LYIA 3A98B 4DD7A 1KW7A 5IDDA 1AM7A 1QTHA 1GFVA 1GAZA 2M60A 4WO9A 1WHCA 1VDTA 1HQYE 1HNXM 1D0LA 4JI0M 1SXJB 4DR3M 3NY9A 4KODA 5FTJA 1IY3A 2CDSA 2WARA 1LJIA 3HUQA 2DHYA 1I56A 3I01M 3PNVA 3ULRA 1L59A 2ZIJA 4B3TM 1GB9A 4Z98A 2RBQA 1V92A 4LRTA 1NDGC 2DAMA 1LTMA 4AQNA 3U6EA 1I6SA 1LZ4A 1AT6A 4G6ZA 1GF5A 4PCZA 5EXSA 1WQPA 3KP1E 2DQIY 1G59A 5C18A 3WHKA 4WL7A 5LA8A 2K6BA 3AOEC 1C6CA 166LA 5APFA 1RFPA 4YY3M 2ZNXY 1QUSA 2ZBKB 199LA 2FYDA 2DWZB 2OOAA 1I20A 1NHEA 2NTHA 1XJTA 1XGPC 1YLAA 211LA 5LVJA 1D3NA 4TSCA 2QP9X 4H9FA 3TXEA 3TWKA 4LF9M 171LA 3HU1A 1IORA 1REYA 1XSFA 2BPUA 1L98A 4AW4A 4I81A 1XGUC 4IATA 2QB0B 5LAFA 2MEIA 1LMCA 4W59A 1L99A 5BR8M 1SXJE 2UXDM 2DHRA 1JUGA 1QTDA 2DQFC 2KNVA 1XGTC 1NVMA 4FWHA 2CEAA 4DKLA 1FKQA 2HAKA 4PRUA 4X3BA 3V2WA 5FLXS 4JI4M 2Z4RA 143LA 2LYMA 3VLFB 2CHGA 3AOGA 4P17A 1XHBA 5KXZA 3QE8A 3RGPA 1CTWA 4OVZA 2HHHM 4WLXA 1C6JA 2IGCA 4H9EA 1LI2A 4CFOA 2D7EA 5T3FA 1L69A 103LA 5KXXA 1WJ7A 4N1EI 1HJPA 2YNMD 4LYTA 1G7LC 1WQMA 3TL4X 1YILA 4FCWA 4NGLA 4XJDA 4LT3A 1CJ9A 3M0EA 3GXRA 3GPYA 2BQIA 3PNYA 5L8RF 2NTGA 3G3AB 4HTKA 2OU0X 2LYOA 1C45A 1I94M 2K9DA 1ZURA 3LN2A 1IN5A 3VKHA 1CUPA 1L54A 3W6CA 1XEIA 5IZ7D 4I8OA 4M9ZA 1L21A 1LSDA 3HDFA 3Q8XA 4JI7M 244LA 1GF7A 3U5ZA 3FE3A 1Z55A 1L37A 1OAOC 1REXA 1YAQA 1LZ5A 183LA 2L7IA 1GBXA 3DOAA 230LA 2K47A 1FLQA 1EIJA 4XGIA 3DN6A 3F9LA 3G3XA 4ETBA 1LKSA 3C80A 1KYIA 4DR7M 5ITXE 3BKVA 6LYZA 1SG9A 1GBZA 3C7YA 2NQ8C 4QNRA 2WSFF 4L4UA 4W51A 5HMVA 1FNNA 3C8SA 2X49A 2I25L 1G41A 4JI3M 4EPFA 4CFPA 1CVKA 3GLHA 134LA 2OE9X 1QQWA 3P66A 4DD0A 5LYMA 1IR9A 1C66A 3WPLA 2W1XA 1PQIA 1HEPA 3SP3A 2OE4X 1C6PA 1HFXA 3MHVC 1L62A 4XJFA 1YL0X 1I4WA 2BWEA 4LJ4A 4LZTA 1GD6A 1SQ2L 198LA 187LA 4L8RC 2BQOA 119LA 1B7OA 1LJJA 4OOOA 4A7DA 4IBBA 1BB6A 144LA 3A42A 1C62A 2LTUA 1L10A 4FJRA 120LA 1LSNA 158LA 1IBMM 3DFZA 2EKSC 1BB4A 1T8FA 4I4LA 3T1YM 3GLGE 2ZTDA 1AKIA 1UACY 1LZ8A 2C9CA 4MR1A 4H90A 3HHZA 5LVGA 1WGLA 2NWDX 256LA 1LYDA 4RKUF 1IIZA 1TGUA 3CQLA 2L4EA 4G4CA 1XXHA 4MGYE 4ARMB 4DDCA 1L80A 4NSRA 1C63A 5HLLA 3NY8A 2L4FA 3HU3A 1BVKC 2MEFA 2X0AA 4KPMA 1SXJC 2KZUA 5ITQA 1I1ZA 1QDRA 2UXBM 1C6GA 1HEMA 4LF6M 3A3RX 1B7NA 2FNAA 4AZFA 258LA 2FE8A 4DV2M 253LA 3GQ4A 1L88A 1LYJA 3BKHA 1PJTA 3FI7A 3C83A 1LZEA 4LF8M 1B6IA 4CGEA 1Z59A 1VEKA 2MEGA 4JN6A 2RSCA 2FBDA 2LHCA 1D6PA 2CE7A 2LHGA 1IY2A 2BQNA 5F9XA 1IWYA 4XJGA 5DFLA 5I14A 2L09A 102LA 149LA 1L64A 4FDYA 1B7PA 1PQKA 4LZMA 1T43A 4N9RA 1N34M 2B5ZA 1VDDA 1C6IA 3J27B 1IXSB 4QOSA 2CV2A 1LKRA 1OVHA 4DR4M 5DN5A 1WQQA 2MEDA 1CU6A 1XGRC 3AZ7A 1GB6A 4B49A 5EP1A 2DQDY 2RB0X 2XTHA 1SSYA 3DN2A 3AGIA 3B0IA 4GC5A 1VQ1A 1LPYA 1PQJA 1G7JC 4H93A 4LZJA 1HHLA 1IP4A 1B7SA 1QVRA 1D2YA 5EXXA 3KOZE 2OEAX 3RW8A 2QCUA 1R7RA 1DYAA 4HV2A 2RB2X 5D5CA 3RUNA 1L49A 2F4AA 4HP0A 1C6TA 5KPTA 1PRBA 1WQRA 3TXGA 2GV0A 5KXKA 2F5NA 1JR3E 4B08A 1LMTA 5ITTA 2XEPA 4FCTA 4WLTA 1QUTA 2K0BX 1IM2A 4GC9A 3HHXA 3SHGB 4CISA 4O34A 1Q39A 3KOYE 2H9JA 5APEA 3BOSA 2OU9A 2FBBA 2DNAA 1NHWC 1SWZA 3C82A 1HSXA 3LMMA 228LA 2Z19A 3J7AS 4DUYM 3WHLA 3GO8A 2L7HA 5EP2A 1HNZM 5LVKA 4NGWA 3KOXE 213LA 1L15A 5C6JA 1L30A 4ETDA 1T8GA 1LJEA 3LHMA 4NEBA 1L24A 217LA 4TSBA 2O79A 1V33A 141LA 3N9EA 2D4JA 4PDGA 4F2LA 1LCNA 1Z5CA 3AJNA 3W6AA 4BAPA 4DQ7A 3W6DA 3IHPA 1UIDA 5E9RA 2OU8A 3G3WA 2BQCA 4IBCA 232LA 2RBOA 4ZPXA 3LYOA 4OO9A 5I54A 2CWIA 3GRYA 2X8AA 3AL0C 5FSWA 1WVVA 259LA 3M6AA 1L28A 1LLHA 2BWBA 175LA 1L48A 1L39A 3SYLA 2D4IA 4R71A 3GLIB 2L2DA 5KPRA 2EQLA 3WXTA 3WXUA 2HEFA 1PQOA 1F10A 2CV0A 1B7LA 1GFKA 2EKFA 2MECA 147LA 1L63A 1OUEA 4FW9A 2HEEA 236LA 1DPXA 3P65A 1YANA 4L6V6 3LW5F 5E4PA 1LMOA 4RLNA 3SARA 1L94A 5FCPA 3AZ6A 2N35A 3GP1A 181LA 1LYEA 1MELL 1DGFA 1CNSA 1MX0A 4LDOA 3UMMA 2A4TA 4IIWA 1HFZA 1T6VL 8LYZA 218LA 4XADA 4II8A 4H9AA 2DI0A 1ZWNA 246LA 2BQKA 4XENA 4WG1A 4NG8A 126LA 2HKJA 3AFHA 2XBSA 3U6LA 1JTMA 3RFWA 5KQ8A 1EPYA 4HPIA 4R0FA 2R44A 3A92A 2DZLA 2ZILA 3C8QA 1L73A 4NRWA 1TLAA 1XGQC 2R46A 1NF5A 3A94A 3TE6A 3HT8A 1REMA 1L8QA 4R6CA 4WP2A 1CV0A 8CATA 3ZC7B 2CGIA 2Y8PA 3EO5A 3VDPA 3W68A 3GLIE 4B7GA 4LFPA 1BB5A 2O5RA 4EMNA 1L71A 5E26A 1DPWA 1L58A 1BHZA 3CF6E 4IJ4A 2CHQA 1SSWA 1OUGA 2UUBM 3L2XA 4ARQA 1LZGA 2G4PA 4XK8F 3FKEA 5KJ9A 1L26A 4PD2A 4E97A 3WUMA 3WPJA 1UC0A 2KNZA 3PVSA 2MH8A 1XMQM 1L57A 107LA 2Z3XA 2MEBA 3L2AA 2O7AA 4ET8A 4QOZC 2XSZA 4AKHA 1EQ5A 188LA 3U6MA 4DV1M 3PBLA 1F4IA 3U6DA 3DN1A 4IBDA 4LY6A 4GCBA 3J2PB 3LVVA 2FFJA 4CGYB 1GB5A 1IBKM 1DYGA 4OWAA 1N4FA 2QBYB 3W6EA 3WW5A 3TPZA 3CF2A 4LGMA 4LFAM 2LCBA 1D0KA 1QTEA 2YBHA 3P64A 172LA 1OUJA 4XJHA 2DBTA 4EOFA 223LA 2R65A 1GF0A 1TH3A 1HR0M 4X62M 4ZIXA 1D3MA 3K3TA 2DAKA 3UGJA 1L17A 3GUOA 3RNXA 4EIWA 4OWCA 4GN4A 3WU8A 3U60B 4YEMA 2P5TA 3V2YA 1OVJA 3FUUA 1G7MC 1MU5A 2DWMA 2ERCA 4NGOA 2H1RA 4NWHA 1C43A 4KHPM 5C1BA 3U6CA 129LA 4B0DA 1L06A 1DZBX 2BJWA 4IBFA 1UM8A 4NGJA 1Y8GA 4NWEA 1LYFA 1LYSA 1PS5A 1CKHA 2JY6B 1QTZA 4HJZA 4UN2B 3DN0A 1UICA 3HWSA 1LYHA 1ZYTA 2JWSA 2YSSC 2WSEF 5H37D 1ZMYL 5L9JA 4DV4M 2F4GA 2QHOB 5IHGA 2HCBA 4WMGA 3RGSA 1OUDA 1T3PA 2EKKA 2MJ5B 2A7FA 4OX9M 1WTMA 2R62A 1TDZA 3C9PA 3HU2A 5DM9A 1G7HC 3ZH9B 3LCUA 248LA 155LA 4GCDA 3A8ZA 1P2LA 4Z41A 1GBWA 4Z3MA 4MM3B 1CU0A 1L96A 3CSZA 4WM6A 5KXTA 112LA 3N9AA 3WVXA 4I5SA 2W1MA 4CIZA 1OIZA 5FEKA 1ZMWA 4NG1A 4B7FA 4I7NA 4DV3M 1E94E 1L47A 3M7GA 2M5ZA 3H4JA 4P16A 3T6PA 1N36M 2A5YB 262LA 1G0JA 4NSGA 4H9IA 3GULA 2YR0A 2DWLA 1C6MA 1H6UA 3RZ4A 2H5XA 2WSCF 1W08A 1QSBA 1OIPA 3GPXA 1OJLA 1GFTA 1NHBA 3TMXA 3ZVQB 3E9SA 5FELA 2Z12A 1LHKA 3HZJA 109LA 1GFJA 1HQCA 240LA 2B3TA 3U6PA 4W52A 3CDTA 4BAFA 4S0WA 3GQ5A 2B6XA 1K82A 3HH4A 4K5YA 1LJNA 5DL9A 138LA 1OUAA 2HEBA 3VDUA 1RU3A 1GFUA 3RT5X 174LA 2BQBA 1C10A 3TQSA 1C6BA 3N9CA 1JJ3A 4L15A 4LYZA 2QNJA 3KAMA 1QAMA 1UBZA 3PFIA 2EA0A 5J7CA 3GLGA 4LYBA 2F5OA 1NNUC 4YOPA 4C3WA 2RB1X 4NSHA 4I7TA 1FLUA 4NL4H 1IQPA 3JR4A 1HEOA 4DD9A 5C6LA 2HEAA 3A67Y 3D8LA 1OV5A 3FI5A 2B7XA 2DQGY 201LA 1L25A 2Z18A 5DYIA 3WW6A 4II7A 2KNAA 153LA 2RAZX 1G07A 3A3QA 3HUKA 1QYRA 2BQLA 3SB8A 3SAWA 3GLFB 1BWJA 4YEOA 5A3ZA 1GB8A 1IP1A 1GBYA 4AGAA 1N32M 3AGGG 4I7PA 1KIPC 1GF9A 4R3DA 1GBOA 4QGZA 1XJUA 2B6ZA 1RI8B 4BADA 1L89A 2CHVA 4H9CA 2EJSA 206LA 3LYTA 3LCVB 3UJNA 4DD2A 1KNIA 1G4AE 1TF0B 1QUDA 170LA 1JQUA 2D6BA 1L35A 3EIEA 4F1IA 1L97A 2G8LA 1D9WA 2ZQ3A 2XQOA 2ZYCA 2OPFA 4B3MM 4IAPA 3HKPA 2F4VM 3HTFA 2KEBA 1QANA 1C61A 178LA 1GEZA 1VDQA 212LA 2V1UA 3CT0A 5LVHA 4MGKE 2DWNA 3WUAA 3SASA 1CV1A 1IOTA 4X66M 1GB0A 1AIPC 4ML7A 3HU9A 1JIYA 1QTKA 177LA 3OK0A 2ZM6M 4PK0A 3FUXA 5IELA 7CATA 3E21A 1JTPL 3TWLA 2KHHA 1QT3A 2R4EA 3WH1A 4MB7A 1G7IC 1GJSA 5LZMA 1L44A 3FTEA 2F5QA 4FCVA 1QSAA 216LA 5I4YA 4NSOB 2B6TA 5GKNA 3GXKA 1PJJA 3SB9A 3IJVA 4ARLA 1W6ZA 1WGNA 3SAUA 1C6LA 1Z6TA 4ITQA 2DQJY 1DI4A 1YL1X 3J81S 1TDYA 4CJ6A 1BWHA 140LA 4U3XB 242LA 4C5FA 2R0IA 4J1AA 4YENA 2CFOA 1TCYA 1UIGA 1YIKA 2CWBA 4LYOA 4RW1A 3VK7A 2FOIC 1GF6A 3HH6A 1NHGC 3M3UA 4EKRA 4BLCA 3TMUA 1W5SA 1IFYA 2D7HA 1CX7A 3CB7A 3GRUA 1D2NA 4GCEA 2HUKA 1PGYA 6LYTA 1IVMA 2O4WA 2DQAA 1OUBA 1CV5A 3U6QA 5KXNA 1GXXA 1C67A 4Z46A 1D6QA 4DDAA 3C81A 2F2NA 5I53A 4OW0A 4NHTA 238LA 3JAMS 3SYKA 4NSIA 2C9OA 1GJTA 2ANXA 2D7GA 5KKJA 1L0JA 1B5ZA 142LA 2LC9A 1L46A 2I6ZA 1R6BX 1GEVA 4EKPA 3D3DA 3CDOA 4ARJA 1J1XY 4RF0A 3HTDA 1YAPA 3K9OA 4IBJA 2HULA 3JR6A 2LVAA 1FJGM 4DT3A 4OVZB 1L11A 3GUMA 1LJHA 1L65A 1L60A 2B72A 1KW5A 5APDA 207LA 4NXNM 4CHTB 4NGKA 2HU3A 1L55A 4LFXA 1IWWA 2RH1A 1ORYB 2QZ4A 1KS3A 1IN4A 5IT9S 3GUKA 5ITYA 3D8BA 1L14A 1B5YA 3MMPA 2BQAA 5ITRA 4PDIA 1NDMC 1LWGA 245LA 4QY9A 1L16A 1UUZC 4JV5M 1V7SA 5LAGA 4QDNA 2ANVA 1J09A 4M9SA 2R4JA 4IBIA 3TWMA 159LA 1IC5Y 3GUJA 4LJ9A 3PXGA 3U5ZB 1HC0A 3HTBA 6LZMA 1N33M 1GBSA 2B75A 4H91A 4S12A 2CJLA 4G4NA 1CUQA 4LGYA 4OW1A 4NGVA 1QUGA 3HGIA 4ZFPA 3UZUA 1LGWA 4KO8A 1C6FA 1NY5A 3BXWA 3GUPA 191LA 1LZTA 1B0DA 237LA 205LA 1TTEA 151LA 3GLIA 2ZANA 3FD9A 4FWDA 4IBKA 1HF4A 1UA6Y 1UIFA 208LA 3HX3A 1BVSA 241LA 4NXMM 3AZ5A 4HL4A 3W67A 2I26L 1GHLA 1G0LA 2Z2EA 5B07A 3HT7A 2JUJA 1XB2B 3DN4A 3GLHB 3GRRA 4LF7M 2RBRA 4JXJA 4NHIA 1GFEA 3IWRA 4GMQA 1B5XA 4M0WA 2LNHC 2F5SA 4HTQA 3ZQJA 3SB7A 1CV3A 1CU5A 2LVQD 2C8OA 5LIOA 1IX0A 2JNHA 4RF1A 4TUNA 3BBZA 4XBOA 5KPZA 2Z6BA 3M18B 1D0MA 4YX7C 3GQ3A 1C1KA 2O01F 2RKOA 135LA 1R2ZA 1GB7A 1PQDA 4PHIA 3WPKA 3WU9A 4LF4M 5IREB 1KY1A 1NV9A 5KXWA 5FTLA 2BAAA 2QPAA 4H8YA 4W56A 2WZJA 1BB7A 5I4WA 5LXWA 4EJ4A 1C6NA 1QDTA 4NC6A 3P4ZA 3FYDA 3GRVA 2J5YA 4GLAA 4DJHA 197LA 4OWHA 5LYZA 1L90A 3KSXA 1K3WA 1L2BA 139LA 2LVNC 3VK8A 1XXHB 4W57A 2YBJA 1P6YA 255LA 2LH0A 1FN5A 1LGXA 1P7SA 3WVYA 2BQMA 1SLYA 2HECA 3HHWA 1GWDA 2HU1A 3EMSA 1L38A 4X65M 4WM1A 1UIBA 3HT9A 1P56A 4L16A 247LA 4I7SA 4M9XA 1DQJC 2XGNA 1L31A 4P2EA 4GH9A 3SFZA 3L28A 3SN6R 2XFTA 1L29A 3CDRA 3F6ZA 3GLHE 5LMUM 5HQ1A 137LA 1OP9B 2QENA 1QZMA 4XYYA 3I51A 2H5ZA 2DQEY 3QWLA 4JI2M 4I7MA 1EFUB 5KXOA 1GFRA 4OOTA 1L08A 3FUVA 1RJCB 3DNAA 2Q2EB 3I4VA 2HUMA 2YVBA 4D81A 1GE0A 1INUA 4NGYA 3MJ5A 4H9BA 3WULA 1IC4Y 1OTRA 4LGKA 2VQFM 2F2QA 195LA 3TXJA 1XC8A 3HWLA 1L20A 3KS8A 2B74A 2YDGA 189LA 1NNJA 2OOBA 229LA 3DMVA 3UONA 2RGOA 4DDBA 2OO9A 5KXPA 1IWXA 1DYBA 1Q02A 2A7DA 4PPOA 4G4QA 4NFVA 1L1ZA 1Q3CA 3FRHA 1YE9A 3A6BY 1AZFA 3HU8A 3SBAA 3ZEKA 2Z37A 4I0CA 1GVNA 4DR6M 3GUNA 3B7ZA 2HL7A 2ZTCA 3U61A 3A90A 1L70A 1CU3A 1WTHA 4QHTA 2YBMA 3J7BA 1LPIA 4N0JA 3SB5A 2Z38A 243LA 1XXHE 127LA 235LA 4LFBM 3TXFA 1QT7A 4FD2A 1AT5A 2KRUA 4DV7M 1JB0F 3HY5A 3LQRA 4H92A 1YQVY 4BS7A 2F47A 1L86A 1IOQA 1C6AA 130LA 3E3DA 2HUBA 4W94A 1LSZA 1L41A 1L05A 3VWOA 1L02A 4YXCA 4KT3A 3G3VA 2APLA 4KL7A 4QEQA 1O23A 1GKIA 3B74A 3KSJA 2LZMA 1C6KA 1D2WA 221LA 2MEAA 3HFMY 215LA 1YAOA 4ARPA 4HJYA 1IOCA 3WMKA 224LA 1LHIA 1G0MA 1JHLA 3AJIB 4LJ6A 1QT8A 4ZEEA 2OE7X 3HBDA 1DYDA 4GEWA 2W82A 111LA 1V34A 1IWTA 110LA 4W5WA 4NHSA 239LA 1OYUA 1NJFA 1LZ6A 2XJWA 4RDSA 3EIHA 3TXKA 3SAVA 4KLNA 5D5FA 1WTNA 1YSYA 1CJ6A 4PRQA 1JTTL 165LA 104LA 1IXRC 3D4SA 1JQJC 3HH5A 3UK6A 1VEJA 4WL6A 5AMYA 3WU7A 1BWIA 1H6MA 1GE4A 2KDLA 4X64M 1L81A 2YBNA 108LA 1JSEA 1YROA 131LA 3KVWA 1JKDA 2N5ZA 2RBNA 3A95A 3W6FA 3SMSA 1YKZX 3Q8GA 2QQ8A 1IP6A 2G3QA 3B89A 2HWJA 1E32A 3MK6A 2YBIA 5EJCA 1QSQA 1DGHA 3OJPA 5EP4A 4D82A 3K2LA 5JI2E 2LBCA 1C68A 1LYOA 1YAMA 3QYBA 3HBEX 1L04A 1CJ8A 1DYCA 5APCA 1OQMA 1VAUA 3HHYA 1C60A 3AB6A 209LA 1KXWA 3B7NA 4GITA 1SXJA 1C7YA 164LA 1GPQC 1CX6A 1RE2A 1OQYA 2MEEA 4JI6M 4G49A 3F92A 4I7JA 4HEOA 1TEWA 5DLAA 4DV6M 169LA 1P2RA 4H9HA 4LG2A 2MROB 4DD1A 4Q7JA 4LRSA 4DBGB 3VKGA 4B4EA 4AKIA 1HSWA 4JI8M 1UIHA 1G0KA 2KA6B 4ANRA 184LA 5A3EA 3QY4A 1T6HA 4ZPUA 1DXJA 1IY0A 5KXRA 1GE1A 5B1FA 1EQEA 3HJQA 4G4OA 2CP8A 3RU5A 3WUNA 249LA 1LZAA 1UIEA 2LVOC 1NWGA 1PZYA 5FHWA 3IJUA 3U6SA 1H87A 3B6LA 5A2QS 5LVIA 2AHMA 1JTNA 222LA 1L32A 4KXIA 2DVWB 1L07A 1OWYA 1SX7A 1LYGA 1HFYA 1L56A 2C99A 4GHLA 2BQFA 260LA 2HEDA 1DI3A 1G06A 1L68A 1OFIA 3EMLA 1CKDA 3JR5A 1DO2A 3T1HM 2J7NA 3QAUA 5KXLA 1J1PY 190LA 4G9SA 4NIJA 1WR1B 3ZCBB 4B3RM 1B5UA 1L12A 4YM8A 4BBAA 1A5TA 3ILKA 4ARQB 2VB1A 3DN3A 4G3OA 1PJIA 3KOWE 4LCBA 4GHAA 3AW6A 225LA 1VEDA 2MEHA 1K3XA 185LA 2EO2A 2Y20A 1VDPA 4N1CC 5ITXA 1ZAEA 1L40A 1Z5AA 1XFPL 4EKSA 4DR5M 2RBPA 2BLYA 173LA 1L85A 4B7HA 2O25A 4IASA 4OWEA 1IP3A 3FUTA 1XEPA 1XMOM 1Q3BA 3FRIA 1LJ3A 5FSTA 2F5PA 2Y0QA 2YFQA 1L72A 3HBHA 1PJSA 3CTWB 1N77A 1L22A 1LI6A 5I5QA 2RAYX 1LHLA 3VW7A 1J7KA 3KS4A 2XLJA 5LINA 5BPVA 5EP3A 3C8RA 4M4OA 5L3HA 150LA 2QSFX 1HMLA 1L2DA 5F81A 2D91A 3AGHA 3C3DA 1DO0A 4I7RA 182LA 3FE0A 1NY6A 4UWNA 4CHXA 194LA 1FBIX 4LJ5A 4ET9A 4QNMA 4BB9A 1LMPA 1IN6A 3KFUG 3SHFA 3ODUA 1QT6A 1ZVYB 115LA 2ZAMA 1HT1E 1GL6A 5FTKA 4MCKA 1NMMA 3RE8A 2UUAM 4CJ2A 5E6JA 3L26A 1P37A 118LA 2IFFY 4L78A 3B9PA 1B2KA 1L36A 4WLDA 1KY0A 4DC4A 1QZEA 1IR7A 1QUHA 3J6KA 1L76A 2JY7A 3AV0A 250LA 2MR9A 4I7QA 1L95A 5B59A 1OUIA 2R6FA 4FWGA 1GB3A 4MH0E 1FLWA 5HNCA 3KXEC 5HNLA 2IHLA 2JY8A 1EQ4A 1HEWA 2ZAOA 4B1AA 2JZ0A 4FVMA 4RNAA 3A93A 4B4IA 3W3EA 4AG6A 1SWYA 1DGBA 4PJ2C 5FTNA 1HEQA 4OWBA 5DNYA 4AI6A 1IP7A 152LA 1CV4A 1L91A 2W1LA 4WM4A 1HT2E 2YQZA 210LA 5LYTA 1L33A 1LSBA 1P36A 3LYMA 3SBJA 2VF8A 2OTYX 4WM3A 1PM5A 2BLXA 1IR8A 1L74A 1WVUA 2BQEA 4D9ZA 1JTOL 3K2RA 1GFAA 180LA 2BJVA 1DYEA 1LZBA 4XJBA 1LZSA 1XNQM 1IEEA 1J1OY 1LSCA 1GF3A 4LT2A 4R7GA 4REZA 1LJKA 1JKBA 2DKLA 3QNGA 3TXIA 1NO1A 1JPOA 4ARMA 4EKQA 1LMQA 4NGZA 4XJIA 2JP7A 2LWXA 1L67A 2HTXA 1B9OA 2C8PA 2CV1A 3GLFE 2DAGA 3KDSE 4K0KM 1KIQC 2Q9DA 3DZDA 1VATA 3OTOM 5JI3E 1LOZA 2DXIA 2XSZD 1L2CA 1KIRC 5ILFA 1CUKA 4N5RA 1HMKA 1YUBA 1L61A 1KXXA 1JR3A 5DN4A 2G5GX 4H1PA 1GL7A 1UFZA 4DR2M 1EE8A 1LMNA 3EBAB 4J1BA 2Q0MX 1OUHA 3A34A 3HT6A 2DENA 2L6OA 3GLGB 1LYZA 1G0PA 5F9UA 1L83A 1ZV1A 3A45A 1NBZC 2DKVA 4WOAA 1T6OA 1P3QQ 1C08C 2BQHA 4HLQA 1CKFA 1IC7Y 3L64A 3MGWA 4LF5M 1LJFA 3QYEA 3K9PA 1WQOA 4W55A 2Z7JA 1EL1A 4IBGA 4MGZE 3K8ZA 1IXSA 1SXJD 4YF2A 148LE 2CUZA 2V6ZM 4WG7A 1LGUA 233LA 1Z5BA 192LA 1F6SA 3NBIA 1C6QA 2XBRA 4DUZM 1L23A 1D9UA 1L53A 5B06A 193LA 1D3JA 1NKHA 2GNOA 1L66A 4W58A 4WURA 1J5EM 4LJAA 5EXPA 2VF7A 4PGJB 1L00A 1QS9A 4UWUA 4J0LA 1CJ7A 3U6OA 2JZ1A 4NSJA 2BNKA 1VFBC 4GCCA 1QUOA 231LA 5EXTA 4MGHA 1MN3A 3CT5A 2VIIA 1HELA 2ZIKA 3SATA 1L87A 1L52A 1K28A 2UXCM 1GE3A 1GB2A 1B5VA 5FDJA 4NRVA 1P2CC 3PDSA 3FTCA 1GF8A 1LHMA 3H4MA 2BQGA 1C46A 3CDVA 1LSFA 3FADA 3NYAA 3V76A 1N78A 2KW0A 1LZ9A 1LSYA 1L09A 1ZMUA 1LZYA 1F0WA 2F32A 2Q9EA 1JWRA 1T97A 1LAAA 200LA 161LA 4LDEA 254LA 4DAJA 4WO6A 1IXZA 3T38A 5F16A 1DYFA 3KW6A 1DV0A 1SX2A 5M1YA 1IP5A 4DQJA 1QSWA 1C7PA 1HNWM 1DI5A 2RBSA 3A96A 2OTZX 2XH9A 3CSQA 2UU9M 2Z4SA 1KXYA 4GRVA 3LQQA 4W54A 1JJ1A 1ZV5L 3LVWA 1VG5A 3SMPA 2VDBB 1LI3A 2LZTA 4DYGA 1LMAA 2B6WA 234LA 1VEGA 4LYMA 2L78A 4L41A 3ATNA 1CV6A 3C3EA 1QT5A 4HTNA 168LA 1BQLY 1LV7A 3FTFA 4OU7A 1T3TA 1LSMA 1LZRA 5EQTA 4NGIA 2DZNB 1AUAA 1GLNA 3EXDA 5JENB 1L50A 1WXQA 3TXBA 3A6CY 1QAQA 4EXMA 3SB6A 145LA 4LYCA 1T8AA 3TMVA 4WLYA 3T15A 1G3IA 1HERA 1C6EA 1B7MA 1G0GA 4GLVA 5F14A 4HV1A 1HENA 3P68A 1LHHA 4KT0F 113LA 2QARC 1L03A 1LZNA 4ETEA 1TR8A 9LYZA 3C7WA 1L42A 5KO3A 3AOEA 3IECA 3AW7A 1WIVA 3A91A 3ATOA 1LSAA 3AYQA 1QTCA 4GCFA 2DQCY 1MJGM 1FKVA 1UIAA 4JI5M 2GQFA 3FA0A 3A46A 162LA 4HPEA 1L01A 3LZMA 1QIOA 4WW0A 1L45A 1REZA 5K7OA 2AUBA 3FYCA 1NSFA 1L34A 3C7ZA 5KQDA 2B6YA 157LA 3NBXX 4IJEA 1NBYC 4DWXA 3B0OA 125LA 5LA5A 2JXNA 5LMNM 3FUWA 4LDLA 1C69A 1V7TA 3NWLA 3TXHA 4H8ZA 4LZZA 2ZQ4A 1KFVA 1R5LA 4NOOB 3B0KA 1TH4A 1IP2A 1A2YC 1DKJA 4I7LA 3T6UA 1TAYA 2Z8YM 1G8PA 1GDXA 1YKYX 4PJZA 3IG5A 1LSGA 1E8LA 1TDHA 7LZMA 1OKSA 1L92A 2X4AA 4Z8XA 4W96A 1G1WA 128LA 3TMWA 1NV8A 4NHQA 1BVXA 1YKXX 3I04M 2JY5A 3OE6A 2UUCM 2G4QA 1N75A 1GAYA 2QBYA 160LA 163LA 1L0KA 4N8ZA 1G71A 4YHHM 1FLYA 1XEKA 1LYYA 2F30A 5DYGA 3OE9A 2FS1A 186LA 2XF3A 2D4KA 4RW2A 226LA 2DQHY 122LA 3HH3A 1ZVHL 1L77A 3W0FA 2I7NA 2W1YA 1C6DA 2CRUA 1KSFX 1L75A 1GFGA 3U60A 4AXTA 1JR3D 1PQMA 1CU2A 3DMXA 1E9SA 2C98A 132LA 3OE0A 1L18A 2R18A 4IJFA 1LWKA 5B1GA 3LYZA 2VQEM 1L93A 1VDLA 2DAEA 5KXSA 5HMJA 1C64A 1OUFA 3SBBC 2KXEA 4LJ8A 4XN6A 1ZQ9A 2G4NA 5C6IA 1IO5A 2KRKA 4PT5A 1BGIA 1TH2A 2XZFA 2C96A 154LA 2XZUA 3HTGA 1QAOA 261LA 3GPPA 3WL2A 1TBYA 176LA 1GABA 1L19A 4QHSA 3DA1A 1HNLA 1P3NA 3E4RA 220LA 2YBLA 3VFDA 1BB3A 4GKJM 1LSEA 2MGWA 1IY4A 1X37A 3AKZA 1L84A 2BQDA 4I7KA 3DKEX 4JYAM 3K92A 4W53A 146LA 4GKKM 3C58A 4J7VA 1E9RA 3J4GA 1JKCA 251LA 156LA 1GE2A 2J7OA 1S3SA 1LSPA 3DMZA 3HJ8A 1L82A 257LA 2ZWBA 4NY5A 1QTVA 1JEFA 3T36A 4DR1M 2FH0A 1QTBA 3F8VA 4AG5A 3L27A 1IY1A 3QAKA 5I4XA 1GFHA 2LYZA 2B73A 1C6HA 3CT1A 1GO5A 1W5TA 1DKKA 1B7QA 1L27A 1IBLM 4DV0M 1NJGA 3I4YA 1IWUA 4ETCA 4B3SM 4RLMA 1P46A 2EUCA 3TXDA 2OQ4A 1LZCA 5B05A 4M6DA 1R2YA 5KXYA 4AKGA 1P64A 1IWVA 1JISA 196LA 1XEJA 1QQYA 1L79A 3SC3A 4LFCM 2JA2A 1ALCA 4DD3A 1QT4A 1OAIA 2Y0TA 1L51A 219LA 4TX7A 3L25A 5KY1A 1OWZA 3CF0A 1ZMVA 3ZVQA 1L43A 7LYZA 4GRIA 2LXEA 1UCOA 2DZOB 4B4JA 1CKCA 1P5CA 2CUUA 3CGWA 3U61B 1IN8A 123LA 4GN3A 3W0LB 1LW9A 3WYHA 2B70A 1B5WA 2EPEA 5EBHA 3CDQA 3R9XB 2KZSA 3AZ4A 1GXV2 1IN7A 114LA
chains in the Genus database with same CATH topology
3HDEA 3B72A 3G3BB 227LA 3RZEA 4GN5C 4YXAC 4WM5A 133LA 2H9KA 2FYCA 2BQJA 1OUCA 1IWZA 1LJGA 1GDWA 1LJ4A 1L13A 1C65A 4NHPA 4E3UA 167LA 4G4BA 5L3IA 1NQIA 1JKAA 2PC2A 3OE8A 1WQNA 4LT0A 3CSRA 4EPIA 4HSFA 4TTDA 3LZ2A 5II3A 3D9AC 2ZNWY 4I7OA 3LZTA 1LHJA 1JSFA 1G0QA 1GF4A 4MSTA 4LT1A 4TWSA 4GBRB 5KKIA 5KXMA 1LZDA 1OVKA 2EIZC 4DQ5A 3GUIA 4I8SA 2Z2FA 3W6BA 4WM2A 5ILCA 1LZ1A 1CKGA 1G1VA 1VDSA 3DN8A 4ETAA 4H8XA 1QS5A 1A4VA 1FDLY 2Z39A 4H94A 2LHMA 1JJ0A 1OV7A 4HJVA 252LA 4G4HA 2ZYPA 1F6RA 1JITA 1D3FA 1MLCE 3HUAA 4UWVA 2LZ2A 1B7RA 1RCMA 1IOSA 214LA 1LYIA 4DD7A 1KW7A 5IDDA 1AM7A 1QTHA 1GFVA 1GAZA 4WO9A 1VDTA 1D0LA 3NY9A 1IY3A 2CDSA 2WARA 1LJIA 3HUQA 1I56A 3ULRA 1L59A 2ZIJA 1GB9A 4Z98A 2RBQA 1NDGC 1LTMA 4AQNA 1I6SA 1LZ4A 1AT6A 1GF5A 1WQPA 2DQIY 4WL7A 5LA8A 1C6CA 166LA 5APFA 1RFPA 2ZNXY 1QUSA 199LA 2FYDA 1I20A 1NHEA 2NTHA 1XJTA 1XGPC 211LA 5LVJA 1D3NA 4TSCA 4H9FA 3TXEA 171LA 1IORA 1REYA 1XSFA 2BPUA 1L98A 1XGUC 4IATA 2QB0B 5LAFA 2MEIA 1LMCA 4W59A 1L99A 1JUGA 2DQFC 1QTDA 1XGTC 4DKLA 1FKQA 4PRUA 4X3BA 3V2WA 143LA 2LYMA 5KXZA 3QE8A 1CTWA 4WLXA 1C6JA 2IGCA 4H9EA 1LI2A 4CFOA 5T3FA 1L69A 103LA 5KXXA 4N1EI 4LYTA 1G7LC 1WQMA 1YILA 4NGLA 4XJDA 4LT3A 1CJ9A 3GXRA 2BQIA 2NTGA 3G3AB 4HTKA 2OU0X 2LYOA 1C45A 1ZURA 3LN2A 1CUPA 1L54A 3W6CA 1XEIA 1L21A 1LSDA 3HDFA 244LA 1GF7A 1Z55A 1L37A 1REXA 1YAQA 1LZ5A 183LA 1GBXA 230LA 1FLQA 3DN6A 3F9LA 3G3XA 4ETBA 1LKSA 3C80A 3BKVA 6LYZA 1GBZA 3C7YA 4W51A 5HMVA 3C8SA 2I25L 4EPFA 4CFPA 1CVKA 134LA 2OE9X 3P66A 4DD0A 5LYMA 1IR9A 1C66A 3WPLA 2W1XA 1PQIA 1HEPA 3SP3A 2OE4X 1C6PA 1HFXA 1L62A 4XJFA 1YL0X 4LZTA 1GD6A 1SQ2L 198LA 187LA 2BQOA 119LA 1B7OA 1LJJA 4OOOA 4A7DA 1BB6A 144LA 1L10A 1C62A 4FJRA 120LA 1LSNA 158LA 2EKSC 1BB4A 1T8FA 1AKIA 1UACY 1LZ8A 4MR1A 4H90A 5LVGA 2NWDX 256LA 1LYDA 1IIZA 3CQLA 4G4CA 4ARMB 4DDCA 1L80A 1C63A 5HLLA 3NY8A 1BVKC 2X0AA 2MEFA 4KPMA 1I1ZA 1QDRA 1C6GA 1HEMA 3A3RX 1B7NA 258LA 253LA 1L88A 1LYJA 3BKHA 3FI7A 3C83A 1LZEA 1B6IA 4CGEA 2MEGA 2RSCA 2FBDA 1D6PA 2BQNA 5F9XA 1IWYA 4XJGA 5I14A 102LA 149LA 1L64A 4FDYA 1B7PA 1PQKA 4LZMA 4N9RA 2B5ZA 1C6IA 1OVHA 1LKRA 5DN5A 1WQQA 2MEDA 1CU6A 1XGRC 3AZ7A 1GB6A 4B49A 2DQDY 2RB0X 2XTHA 1SSYA 3DN2A 3AGIA 3B0IA 1LPYA 1PQJA 1G7JC 4H93A 1HHLA 1IP4A 1B7SA 1D2YA 3RW8A 2OEAX 1DYAA 4HV2A 2RB2X 5D5CA 3RUNA 1L49A 2F4AA 4HP0A 1C6TA 1WQRA 3TXGA 2GV0A 5KXKA 1LMTA 4WLTA 1QUTA 4O34A 2H9JA 5APEA 2OU9A 2FBBA 1SWZA 3C82A 1HSXA 3IWRA 228LA 2Z19A 4XJHA 5LVKA 4NGWA 213LA 1L15A 5C6JA 1L30A 4ETDA 1T8GA 1LJEA 3LHMA 4NEBA 1L24A 217LA 4TSBA 3N9EA 2O79A 141LA 2D4JA 1LCNA 3AJNA 3W6AA 4BAPA 4DQ7A 3W6DA 1UIDA 5E9RA 2OU8A 3G3WA 2BQCA 232LA 2RBOA 3LYOA 4OO9A 5I54A 2CWIA 1WVVA 259LA 1L28A 1LLHA 175LA 1L48A 1L39A 2D4IA 2EQLA 3WXTA 3WXUA 2HEFA 1PQOA 1F10A 1B7LA 1GFKA 2MECA 147LA 1L63A 1OUEA 2HEEA 236LA 1DPXA 3P65A 1YANA 5E4PA 1LMOA 4RLNA 1L94A 5FCPA 3AZ6A 181LA 1LYEA 1MELL 1CNSA 4LDOA 2A4TA 1HFZA 1T6VL 8LYZA 218LA 4XADA 4II8A 4H9AA 1ZWNA 246LA 2BQKA 4XENA 4WG1A 4NG8A 126LA 2XBSA 1JTMA 1EPYA 4HPIA 4R0FA 3A92A 2ZILA 3C8QA 1L73A 1TLAA 1XGQC 3A94A 1NF5A 3HT8A 1REMA 4R6CA 1CV0A 2CGIA 2Y8PA 3EO5A 4LFPA 1BB5A 4EMNA 1L71A 1DPWA 1L58A 1BHZA 4IJ4A 1SSWA 1OUGA 3L2XA 4ARQA 1LZGA 2G4PA 5KJ9A 1L26A 4E97A 3WUMA 3WPJA 1UC0A 1L57A 107LA 2MEBA 2O7AA 4ET8A 1EQ5A 188LA 3PBLA 3DN1A 4GCBA 1GB5A 1DYGA 4OWAA 1N4FA 3W6EA 3WW5A 2LCBA 1D0KA 1QTEA 2YBHA 3P64A 172LA 1OUJA 4EOFA 2DBTA 223LA 1GF0A 4ZIXA 1D3MA 3K3TA 1L17A 3GUOA 3RNXA 4OWCA 4GN4A 3WU8A 4YEMA 3V2YA 1OVJA 1G7MC 4NGOA 4NWHA 1C43A 129LA 4B0DA 1L06A 1DZBX 4NGJA 4NWEA 1LYFA 1LYSA 1PS5A 1CKHA 1QTZA 4HJZA 3DN0A 1UICA 1LYHA 1ZYTA 2YSSC 1ZMYL 5L9JA 2F4GA 5IHGA 4WMGA 1OUDA 1T3PA 2A7FA 1WTMA 5DM9A 1G7HC 248LA 155LA 4GCDA 3A8ZA 1P2LA 4Z41A 1GBWA 4Z3MA 1CU0A 1L96A 3CSZA 5KXTA 4WM6A 112LA 3N9AA 3WVXA 2W1MA 5FEKA 4NG1A 4I7NA 1L47A 262LA 1G0JA 4NSGA 4H9IA 3GULA 1C6MA 3RZ4A 1W08A 1QSBA 1GFTA 1NHBA 3TMXA 3ZVQB 5FELA 2Z12A 1LHKA 109LA 1GFJA 240LA 4W52A 3CDTA 4BAFA 4S0WA 2B6XA 3HH4A 4K5YA 1LJNA 5DL9A 138LA 1OUAA 2HEBA 1GFUA 3RT5X 174LA 2BQBA 1C10A 1C6BA 3N9CA 1JJ3A 4LYZA 3KAMA 1UBZA 5J7CA 4LYBA 4YOPA 4C3WA 2RB1X 4NSHA 4I7TA 1FLUA 1HEOA 4DD9A 5C6LA 2HEAA 3A67Y 1OV5A 3FI5A 2B7XA 2DQGY 201LA 1L25A 2Z18A 3WW6A 153LA 2RAZX 1G07A 3A3QA 3HUKA 2BQLA 3SB8A 1BWJA 4YEOA 5A3ZA 1GB8A 1IP1A 1GBYA 4AGAA 3AGGG 4I7PA 1KIPC 1GF9A 1GBOA 4QGZA 1XJUA 2B6ZA 1RI8B 4BADA 1L89A 4H9CA 206LA 3LYTA 4DD2A 1KNIA 1QUDA 170LA 1JQUA 2D6BA 1L35A 1L97A 1D9WA 2ZQ3A 2XQOA 2ZYCA 4IAPA 3HTFA 1C61A 178LA 1GEZA 1VDQA 212LA 3CT0A 5LVHA 3WUAA 1CV1A 1IOTA 1GB0A 4ML7A 3HU9A 1JIYA 1QTKA 177LA 3OK0A 4PK0A 5IELA 1JTPL 1QT3A 3WH1A 1G7IC 5LZMA 1L44A 1QSAA 216LA 5I4YA 2B6TA 3GXKA 3SB9A 3IJVA 4ARLA 1W6ZA 1C6LA 2DQJY 1DI4A 1YL1X 1TDYA 1BWHA 140LA 4U3XB 242LA 4C5FA 4J1AA 4YENA 1TCYA 1UIGA 1YIKA 4LYOA 4RW1A 1GF6A 3HH6A 3M3UA 4EKRA 3TMUA 1CX7A 3CB7A 4GCEA 2HUKA 6LYTA 1IVMA 2O4WA 2DQAA 1OUBA 1CV5A 5KXNA 1GXXA 1C67A 4Z46A 1D6QA 4DDAA 3C81A 2F2NA 5I53A 4NHTA 238LA 4NSIA 2ANXA 5KKJA 1L0JA 1B5ZA 142LA 2LC9A 1L46A 2I6ZA 1GEVA 4EKPA 3D3DA 3CDOA 4ARJA 1J1XY 3HTDA 1YAPA 2HULA 3JR6A 4DT3A 1L11A 3GUMA 1LJHA 1L65A 1L60A 2B72A 1KW5A 5APDA 207LA 4NGKA 2HU3A 1L55A 4LFXA 1IWWA 2RH1A 1KS3A 3GUKA 1L14A 1B5YA 2BQAA 1NDMC 1LWGA 245LA 4QY9A 1L16A 1UUZC 1V7SA 5LAGA 4QDNA 2ANVA 159LA 1IC5Y 3GUJA 1HC0A 3HTBA 6LZMA 1GBSA 2B75A 4H91A 2CJLA 1CUQA 4OW1A 4NGVA 1QUGA 4ZFPA 1LGWA 1C6FA 3GUPA 191LA 1LZTA 1B0DA 237LA 205LA 151LA 1HF4A 1UA6Y 1UIFA 208LA 241LA 3AZ5A 2I26L 1GHLA 1G0LA 2Z2EA 5B07A 3HT7A 3DN4A 2RBRA 4NHIA 1GFEA 1B5XA 4HTQA 3SB7A 1CV3A 1CU5A 2C8OA 5LIOA 1IX0A 4TUNA 2Z6BA 3M18B 1D0MA 4YX7C 135LA 1GB7A 1PQDA 4PHIA 3WU9A 3WPKA 1KY1A 5KXWA 2BAAA 4H8YA 4W56A 1BB7A 5I4WA 5LXWA 4EJ4A 1C6NA 1QDTA 3P4ZA 4GLAA 4DJHA 197LA 4OWHA 5LYZA 1L90A 139LA 4W57A 2YBJA 1P6YA 255LA 1FN5A 1LGXA 1P7SA 3WVYA 2BQMA 1SLYA 2HECA 1GWDA 2HU1A 3EMSA 1L38A 4WM1A 1UIBA 3HT9A 1P56A 247LA 4I7SA 1DQJC 1L31A 4P2EA 3SN6R 1L29A 3CDRA 3F6ZA 5HQ1A 137LA 1OP9B 4XYYA 2H5ZA 2DQEY 4I7MA 5KXOA 1GFRA 4OOTA 1L08A 1RJCB 3DNAA 2HUMA 2YVBA 1GE0A 1INUA 4NGYA 4H9BA 3WULA 1IC4Y 4LGKA 2F2QA 195LA 3TXJA 3HWLA 1L20A 2B74A 2YDGA 189LA 229LA 3DMVA 3UONA 4DDBA 5KXPA 1IWXA 1DYBA 2A7DA 4PPOA 4NFVA 3A6BY 1AZFA 3HU8A 3SBAA 3ZEKA 2Z37A 4I0CA 3GUNA 3A90A 1L70A 1CU3A 1WTHA 2YBMA 1LPIA 4N0JA 3SB5A 2Z38A 243LA 127LA 235LA 3TXFA 1QT7A 1AT5A 4H92A 1YQVY 4BS7A 2F47A 1L86A 1IOQA 1C6AA 130LA 3E3DA 2HUBA 4W94A 1LSZA 1L41A 1L05A 3VWOA 1L02A 4YXCA 4KT3A 3G3VA 4KL7A 4QEQA 1O23A 2LZMA 1C6KA 1D2WA 221LA 2MEAA 3HFMY 215LA 1YAOA 4ARPA 4HJYA 1IOCA 3WMKA 224LA 1LHIA 1G0MA 1JHLA 1QT8A 4ZEEA 2OE7X 3HBDA 1DYDA 111LA 1IWTA 110LA 4NHSA 239LA 1OYUA 1LZ6A 4RDSA 2XJWA 3TXKA 5D5FA 1WTNA 1CJ6A 4PRQA 1JTTL 165LA 104LA 3D4SA 3HH5A 4WL6A 5AMYA 3WU7A 1BWIA 1H6MA 1GE4A 1L81A 2YBNA 108LA 1JSEA 1YROA 131LA 1JKDA 2N5ZA 2RBNA 3A95A 3W6FA 1YKZX 1IP6A 2YBIA 1QSQA 3OJPA 1C68A 1YAMA 3HBEX 1L04A 1CJ8A 1DYCA 5APCA 1OQMA 1VAUA 1C60A 3AB6A 209LA 1KXWA 164LA 1GPQC 1CX6A 1RE2A 2MEEA 4G49A 4I7JA 1TEWA 5DLAA 169LA 1P2RA 4H9HA 4DD1A 4B4EA 1HSWA 1UIHA 1G0KA 4ANRA 184LA 5A3EA 3QY4A 1T6HA 4ZPUA 1DXJA 5KXRA 1GE1A 5B1FA 1EQEA 3RU5A 3WUNA 249LA 1LZAA 1UIEA 1NWGA 1PZYA 5FHWA 5LVIA 3IJUA 1H87A 3B6LA 222LA 1JTNA 1L32A 4KXIA 1L07A 1OWYA 1SX7A 1LYGA 1HFYA 1L56A 2BQFA 260LA 2HEDA 1DI3A 1G06A 1L68A 3EMLA 1CKDA 5KXLA 1J1PY 190LA 4G9SA 4NIJA 1L12A 1B5UA 4YM8A 4ARQB 2VB1A 3DN3A 3AW6A 225LA 1VEDA 2MEHA 185LA 1VDPA 4N1CC 1L40A 1XFPL 4EKSA 2RBPA 2BLYA 173LA 1L85A 4IASA 4OWEA 1IP3A 1XEPA 5FSTA 1LJ3A 1L72A 3HBHA 1L22A 1LI6A 5I5QA 2RAYX 1LHLA 3VW7A 5LINA 3C8RA 4M4OA 5L3HA 150LA 1HMLA 5F81A 2D91A 3AGHA 4I7RA 182LA 3FE0A 4UWNA 4CHXA 194LA 1FBIX 4ET9A 1LMPA 3ODUA 1QT6A 1ZVYB 115LA 4MCKA 1NMMA 4CJ2A 1P37A 2IFFY 118LA 1B2KA 1L36A 4WLDA 1KY0A 4DC4A 1IR7A 1QUHA 3J6KA 1L76A 250LA 4I7QA 1L95A 5B59A 1OUIA 1GB3A 1FLWA 5HNCA 5HNLA 2IHLA 1EQ4A 1HEWA 4B1AA 3A93A 4B4IA 3W3EA 1SWYA 4PJ2C 1HEQA 4OWBA 1CV4A 1IP7A 152LA 1L91A 2W1LA 4WM4A 210LA 5LYTA 1L33A 1LSBA 1P36A 3LYMA 2OTYX 4WM3A 2BLXA 1IR8A 1L74A 1WVUA 2BQEA 4D9ZA 1JTOL 3K2RA 1GFAA 180LA 1DYEA 1LZBA 4XJBA 1LZSA 1IEEA 1J1OY 1LSCA 1GF3A 4LT2A 1LJKA 1JKBA 3QNGA 3TXIA 1JPOA 4ARMA 4EKQA 1LMQA 4NGZA 4XJIA 1L67A 2HTXA 1B9OA 2C8PA 1KIQC 2Q9DA 1VATA 1LOZA 1KIRC 5ILFA 4N5RA 1HMKA 1L61A 1KXXA 5DN4A 4H1PA 1LMNA 3EBAB 4J1BA 2Q0MX 1OUHA 3A34A 3HT6A 1LYZA 1G0PA 5F9UA 1L83A 1NBZC 2DKVA 4WOAA 1C08C 2BQHA 1CKFA 1IC7Y 3L64A 3MGWA 1LJFA 1WQOA 4W55A 1EL1A 4YF2A 148LE 4WG7A 1LGUA 233LA 192LA 1F6SA 1C6QA 2XBRA 1L23A 1D9UA 1L53A 5B06A 193LA 1D3JA 1NKHA 1L66A 4W58A 4PGJB 1L00A 1QS9A 4UWUA 4J0LA 1CJ7A 4NSJA 1VFBC 4GCCA 1QUOA 231LA 3CT5A 1HELA 2ZIKA 1L87A 1L52A 1K28A 1GE3A 1GB2A 1B5VA 5FDJA 1P2CC 3PDSA 1GF8A 1LHMA 2BQGA 1C46A 3CDVA 1LSFA 3FADA 3NYAA 1LZ9A 1LSYA 1L09A 1LZYA 1F0WA 2F32A 2Q9EA 1JWRA 1T97A 1LAAA 200LA 161LA 4LDEA 254LA 4DAJA 4WO6A 5F16A 1DYFA 1SX2A 5M1YA 1IP5A 4DQJA 1QSWA 1C7PA 1DI5A 2RBSA 3A96A 2OTZX 3CSQA 1KXYA 4GRVA 4W54A 1JJ1A 1ZV5L 1LI3A 2LZTA 4DYGA 1LMAA 2B6WA 234LA 4LYMA 2L78A 4L41A 3ATNA 1CV6A 1QT5A 4HTNA 168LA 1BQLY 1LSMA 1LZRA 4NGIA 3EXDA 5JENB 1L50A 3TXBA 3A6CY 4EXMA 3SB6A 145LA 4LYCA 1T8AA 3TMVA 4WLYA 1HERA 1C6EA 1B7MA 1G0GA 4GLVA 5F14A 4HV1A 1HENA 3P68A 1LHHA 113LA 2QARC 1L03A 1LZNA 4ETEA 9LYZA 3C7WA 1L42A 3AW7A 3A91A 3ATOA 1LSAA 3AYQA 1QTCA 4GCFA 2DQCY 1FKVA 1UIAA 3FA0A 162LA 4HPEA 1L01A 3LZMA 1QIOA 1L45A 1REZA 5K7OA 2AUBA 1L34A 3C7ZA 2B6YA 157LA 1NBYC 4DWXA 3B0OA 125LA 5LA5A 4LDLA 1C69A 1V7TA 3TXHA 4H8ZA 2ZQ4A 3B0KA 1IP2A 1A2YC 1DKJA 4I7LA 3T6UA 1TAYA 1GDXA 4PJZA 1YKYX 1LSGA 1E8LA 7LZMA 1L92A 4W96A 1G1WA 128LA 3TMWA 4NHQA 1BVXA 1YKXX 3OE6A 2G4QA 1GAYA 160LA 163LA 1L0KA 4N8ZA 1FLYA 1XEKA 1LYYA 2F30A 3OE9A 186LA 2D4KA 4RW2A 226LA 2DQHY 122LA 3HH3A 1ZVHL 1L77A 2W1YA 1C6DA 1L75A 1GFGA 4AXTA 1PQMA 1CU2A 3DMXA 132LA 3OE0A 1L18A 1LWKA 5B1GA 3LYZA 1L93A 5KXSA 5HMJA 1C64A 1OUFA 3SBBC 4XN6A 2G4NA 5C6IA 1IO5A 1BGIA 154LA 3HTGA 261LA 3WL2A 1TBYA 176LA 1L19A 1P3NA 1HNLA 220LA 2YBLA 1BB3A 1LSEA 1IY4A 1L84A 2BQDA 4I7KA 4W53A 3DKEX 146LA 4J7VA 3J4GA 1JKCA 251LA 156LA 1GE2A 1LSPA 3DMZA 1L82A 257LA 2ZWBA 4NY5A 1QTVA 1JEFA 3T36A 1QTBA 3F8VA 3QAKA 5I4XA 1GFHA 2LYZA 2B73A 1C6HA 3CT1A 1DKKA 1B7QA 1L27A 1IWUA 4ETCA 4RLMA 1P46A 3TXDA 1LZCA 5B05A 4M6DA 5KXYA 1P64A 1IWVA 1JISA 196LA 1XEJA 1QQYA 1L79A 1ALCA 4DD3A 1QT4A 219LA 1L51A 4TX7A 5KY1A 1OWZA 3ZVQA 1L43A 7LYZA 1UCOA 4B4JA 1CKCA 1P5CA 2CUUA 4GN3A 123LA 1LW9A 3WYHA 2B70A 1B5WA 2EPEA 5EBHA 3CDQA 3AZ4A 1GXV2 114LA 1LYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GB3 A;  2D4I A;  3B72 A;  1FLW A;  3G3B B;  5HNC A;  1LJH A;  5HNL A;  4GN5 C;  2IHL A;  5APD A;  207L A;  1EQ4 A;  4NGK A;  4WM5 A;  2HU3 A;  1HEW A;  2EQL A;  1IWW A;  133L A;  2H9K A;  2FYC A;  4LFX A;  3WXT A;  2BQJ A;  4B1A A;  3WXU A;  1OUC A;  2HEF A;  3A93 A;  3W3E A;  4B4I A;  1F10 A;  1IWZ A;  1LJG A;  1B7L A;  1GFK A;  1GDW A;  2MEC A;  4PJ2 C;  1LJ4 A;  1HEQ A;  4OWB A;  4NHP A;  4E3U A;  1OUE A;  1IP7 A;  1B5Y A;  2HEE A;  2W1L A;  1DPX A;  3P65 A;  1YAN A;  4WM4 A;  2BQA A;  4G4B A;  5L3I A;  1NQI A;  5E4P A;  1JKA A;  1LMO A;  1NDM C;  5LYT A;  2PC2 A;  4RLN A;  1LSB A;  3LYM A;  1WQN A;  4LT0 A;  4QY9 A;  1UUZ C;  4WM3 A;  1V7S A;  5FCP A;  3CSR A;  2BLX A;  1IR8 A;  5LAG A;  4QDN A;  1WVU A;  2BQE A;  4HSF A;  1IC5 Y;  3AZ6 A;  1JTO L;  4D9Z A;  4TTD A;  3LZ2 A;  1GFA A;  5II3 A;  3D9A C;  2ZNW Y;  1LZB A;  1HC0 A;  4XJB A;  1MEL L;  1GBS A;  1LZS A;  3LZT A;  1CNS A;  1LHJ A;  4H91 A;  1IEE A;  1J1O Y;  2CJL A;  1JSF A;  1GF4 A;  1LSC A;  1HFZ A;  1T6V L;  4OW1 A;  4NGV A;  4MST A;  8LYZ A;  1GF3 A;  4LT2 A;  4II8 A;  4LT1 A;  4H9A A;  4TWS A;  4XAD A;  1LJK A;  1JKB A;  4ZFP A;  5KKI A;  1LZD A;  2BQK A;  4XEN A;  5KXM A;  3QNG A;  2EIZ C;  3TXI A;  4WG1 A;  1JPO A;  1LZT A;  4NG8 A;  1B0D A;  1LMQ A;  4NGZ A;  4I8S A;  4XJI A;  2HTX A;  2Z2F A;  1B9O A;  2XBS A;  3W6B A;  1HF4 A;  1UA6 Y;  4WM2 A;  1UIF A;  5ILC A;  2C8P A;  4HPI A;  4R0F A;  208L A;  1LZ1 A;  1CKG A;  3A92 A;  1VDS A;  2ZIL A;  3AZ5 A;  1KIQ C;  4ETA A;  4H8X A;  2I26 L;  1A4V A;  1FDL Y;  1GHL A;  1XGQ C;  1VAT A;  2Z2E A;  3A94 A;  1NF5 A;  2Z39 A;  4H94 A;  2LHM A;  5B07 A;  1LOZ A;  1JJ0 A;  1KIR C;  5ILF A;  4N5R A;  1HMK A;  1REM A;  4HJV A;  1KXX A;  4R6C A;  5DN4 A;  4NHI A;  4G4H A;  4H1P A;  1GFE A;  2CGI A;  2Y8P A;  2ZYP A;  3EO5 A;  1B5X A;  1F6R A;  4HTQ A;  1JIT A;  4LFP A;  1BB5 A;  1MLC E;  1LMN A;  3EBA B;  4J1B A;  2C8O A;  1OUH A;  2Q0M X;  4EMN A;  4UWV A;  3A34 A;  5LIO A;  1IX0 A;  4TUN A;  1LYZ A;  1DPW A;  2LZ2 A;  1B7R A;  1BHZ A;  1IOS A;  1RCM A;  5F9U A;  4IJ4 A;  3M18 B;  4DD7 A;  1D0M A;  1OUG A;  5IDD A;  1AM7 A;  1GFV A;  1LZG A;  1GAZ A;  2G4P A;  135L A;  1GB7 A;  4PHI A;  4WO9 A;  3WU9 A;  3WPK A;  1NBZ C;  2DKV A;  4WOA A;  5KJ9 A;  1VDT A;  1C08 C;  2BQH A;  1CKF A;  1IC7 Y;  3WUM A;  3MGW A;  1D0L A;  3WPJ A;  5KXW A;  1LJF A;  1UC0 A;  2BAA A;  4H8Y A;  1WQO A;  1BB7 A;  5I4W A;  5LXW A;  1IY3 A;  1EL1 A;  1QDT A;  2CDS A;  2WAR A;  2MEB A;  1LJI A;  3P4Z A;  4YF2 A;  4WG7 A;  1I56 A;  4ET8 A;  3ULR A;  4GLA A;  2ZIJ A;  1GB9 A;  1EQ5 A;  4Z98 A;  4OWH A;  5LYZ A;  1NDG C;  1F6S A;  1LTM A;  4GCB A;  2XBR A;  2YBJ A;  1D9U A;  1GB5 A;  1FN5 A;  4OWA A;  1N4F A;  5B06 A;  3WVY A;  193L A;  1LZ4 A;  2BQM A;  1SLY A;  1NKH A;  2HEC A;  1AT6 A;  1GF5 A;  1GWD A;  2HU1 A;  3W6E A;  3WW5 A;  3EMS A;  1WQP A;  2DQI Y;  1D0K A;  1QTE A;  2YBH A;  3P64 A;  1UIB A;  4WL7 A;  4WM1 A;  1OUJ A;  4EOF A;  2DBT A;  1GF0 A;  1DQJ C;  4PGJ B;  4P2E A;  5LA8 A;  5APF A;  4ZIX A;  1RFP A;  4UWU A;  2ZNX Y;  4J0L A;  1QUS A;  1CJ7 A;  3F6Z A;  3K3T A;  4NSJ A;  1VFB C;  2FYD A;  4GCC A;  3RNX A;  5HQ1 A;  1I20 A;  1NHE A;  1OP9 B;  4OWC A;  4XYY A;  2H5Z A;  2DQE Y;  3CT5 A;  1XGP C;  4GN4 A;  3WU8 A;  1HEL A;  2ZIK A;  4YEM A;  5KXO A;  5LVJ A;  1GFR A;  4OOT A;  4TSC A;  1G7M C;  4H9F A;  1RJC B;  3TXE A;  2YVB A;  1GE3 A;  1GB2 A;  1GE0 A;  1INU A;  4NGO A;  4NGY A;  4NWH A;  1B5V A;  5FDJ A;  1C43 A;  4H9B A;  3WUL A;  1IC4 Y;  4LGK A;  1P2C C;  1IOR A;  1GF8 A;  1REY A;  1LHM A;  1XSF A;  2BPU A;  4B0D A;  3TXJ A;  1DZB X;  2BQG A;  1C46 A;  4NGJ A;  2YDG A;  4NWE A;  1LSF A;  1XGU C;  4IAT A;  5LAF A;  2MEI A;  1LMC A;  1LZ9 A;  1LSY A;  1LZY A;  1F0W A;  1LYS A;  1PS5 A;  1JWR A;  4DDB A;  5KXP A;  1IWX A;  1CKH A;  4HJZ A;  1LAA A;  2A7D A;  4PPO A;  4NFV A;  1JUG A;  2DQF C;  3A6B Y;  1XGT C;  1AZF A;  1UIC A;  3ZEK A;  2Z37 A;  4I0C A;  2YSS C;  3A90 A;  4WO6 A;  1FKQ A;  4PRU A;  1ZMY L;  4X3B A;  5L9J A;  5F16 A;  2F4G A;  2YBM A;  2LYM A;  5IHG A;  1LPI A;  4N0J A;  5M1Y A;  4WMG A;  2Z38 A;  1OUD A;  1IP5 A;  1T3P A;  2A7F A;  1QSW A;  3QE8 A;  5KXZ A;  3TXF A;  4WLX A;  1AT5 A;  1C7P A;  1WTM A;  1DI5 A;  4H9E A;  3A96 A;  5DM9 A;  4CFO A;  3CSQ A;  4H92 A;  5T3F A;  1G7H C;  1YQV Y;  4BS7 A;  5KXX A;  4N1E I;  1IOQ A;  1KXY A;  3E3D A;  4LYT A;  4GCD A;  2HUB A;  1G7L C;  3A8Z A;  1WQM A;  4W94 A;  4Z41 A;  1LSZ A;  1GBW A;  1JJ1 A;  1YIL A;  1ZV5 L;  4NGL A;  3VWO A;  4Z3M A;  4XJD A;  4KT3 A;  3CSZ A;  5KXT A;  2LZT A;  4LT3 A;  1CJ9 A;  4KL7 A;  4QEQ A;  1LMA A;  4WM6 A;  4DYG A;  1O23 A;  3GXR A;  2BQI A;  4LYM A;  4L41 A;  3N9A A;  3ATN A;  3G3A B;  3WVX A;  2MEA A;  4HTK A;  2W1M A;  3HFM Y;  4HTN A;  2LYO A;  1YAO A;  1BQL Y;  4HJY A;  1C45 A;  5FEK A;  4NG1 A;  3LN2 A;  1IOC A;  3WMK A;  1LSM A;  1LZR A;  4NGI A;  1LHI A;  3W6C A;  1XEI A;  1JHL A;  3EXD A;  5JEN B;  1LSD A;  4ZEE A;  3HBD A;  3TXB A;  3A6C Y;  4LYC A;  4NSG A;  1GF7 A;  4H9I A;  1IWT A;  3TMV A;  1Z55 A;  4NHS A;  4WLY A;  1HER A;  1B7M A;  4GLV A;  5F14 A;  3RZ4 A;  1LZ6 A;  4RDS A;  2XJW A;  4HV1 A;  1HEN A;  3P68 A;  3TXK A;  1REX A;  1LHH A;  1W08 A;  1YAQ A;  1LZ5 A;  1GFT A;  3TMX A;  5D5F A;  1LZN A;  3ZVQ B;  4ETE A;  5FEL A;  1GBX A;  1WTN A;  1CJ6 A;  1FLQ A;  1LHK A;  2Z12 A;  1JTT L;  4PRQ A;  9LYZ A;  1GFJ A;  4ETB A;  1LKS A;  3BKV A;  6LYZ A;  1GBZ A;  4BAF A;  4WL6 A;  5AMY A;  3WU7 A;  3AW7 A;  1BWI A;  1LJN A;  3A91 A;  5DL9 A;  3ATO A;  1H6M A;  1LSA A;  5HMV A;  1OUA A;  3AYQ A;  2HEB A;  1GE4 A;  4GCF A;  2DQC Y;  2I25 L;  1FKV A;  2YBN A;  1UIA A;  4CFP A;  1GFU A;  134L A;  3RT5 X;  2BQB A;  1C10 A;  1JSE A;  1YRO A;  3P66 A;  4HPE A;  1JKD A;  4DD0 A;  2N5Z A;  5LYM A;  1IR9 A;  1QIO A;  3WPL A;  2W1X A;  1HEP A;  1REZ A;  3N9C A;  3A95 A;  3SP3 A;  5K7O A;  1JJ3 A;  1HFX A;  2AUB A;  3W6F A;  1YKZ X;  4LYZ A;  3KAM A;  1IP6 A;  1UBZ A;  4XJF A;  5J7C A;  4LYB A;  4YOP A;  1YL0 X;  4C3W A;  2YBI A;  4NSH A;  3OJP A;  1FLU A;  1NBY C;  4DWX A;  3B0O A;  4LZT A;  1GD6 A;  1SQ2 L;  5LA5 A;  2BQO A;  1HEO A;  4DD9 A;  1B7O A;  1YAM A;  2HEA A;  3HBE X;  5C6L A;  1LJJ A;  3A67 Y;  1CJ8 A;  1V7T A;  4OOO A;  5APC A;  3TXH A;  1OQM A;  1VAU A;  4A7D A;  1BB6 A;  4H8Z A;  4FJR A;  2ZQ4 A;  2DQG Y;  1LSN A;  3AB6 A;  2Z18 A;  2EKS C;  3B0K A;  1IP2 A;  1A2Y C;  1DKJ A;  1KXW A;  3WW6 A;  153L A;  1BB4 A;  3A3Q A;  3T6U A;  1TAY A;  1AKI A;  1GPQ C;  1RE2 A;  1UAC Y;  2BQL A;  1GDX A;  1LZ8 A;  2MEE A;  1YKY X;  4G49 A;  1LSG A;  4MR1 A;  1BWJ A;  1E8L A;  4YEO A;  1TEW A;  4H90 A;  5DLA A;  1GB8 A;  1IP1 A;  5A3Z A;  5LVG A;  1GBY A;  2NWD X;  4W96 A;  4AGA A;  3AGG G;  1IIZ A;  1KIP C;  3CQL A;  1GF9 A;  4H9H A;  3TMW A;  4DD1 A;  4G4C A;  4B4E A;  1GBO A;  1HSW A;  4NHQ A;  4QGZ A;  1BVX A;  1RI8 B;  1UIH A;  1YKX X;  4BAD A;  4ANR A;  4DDC A;  5A3E A;  3QY4 A;  5HLL A;  4H9C A;  2G4Q A;  1DXJ A;  1BVK C;  1GAY A;  2MEF A;  2X0A A;  1GE1 A;  3LYT A;  4KPM A;  5B1F A;  1EQE A;  5KXR A;  4N8Z A;  1I1Z A;  1QDR A;  3RU5 A;  1FLY A;  1XEK A;  3WUN A;  1LYY A;  1HEM A;  4DD2 A;  1LZA A;  3A3R X;  1B7N A;  1NWG A;  1PZY A;  1UIE A;  2F30 A;  3IJU A;  5FHW A;  1H87 A;  3B6L A;  5LVI A;  2D6B A;  2D4K A;  4KXI A;  4RW2 A;  3BKH A;  2DQH Y;  1HFY A;  2ZQ3 A;  1ZVH L;  3FI7 A;  2BQF A;  2ZYC A;  1LZE A;  2HED A;  4CGE A;  1DI3 A;  2W1Y A;  1GFG A;  4AXT A;  1CKD A;  2MEG A;  2RSC A;  1GEZ A;  1VDQ A;  132L A;  3CT0 A;  2FBD A;  5LVH A;  3WUA A;  5KXL A;  1D6P A;  1J1P Y;  1IOT A;  4G9S A;  4NIJ A;  1GB0 A;  5B1G A;  1B5U A;  2BQN A;  3LYZ A;  1IWY A;  5F9X A;  4XJG A;  4YM8 A;  5KXS A;  5HMJ A;  1OUF A;  4ML7 A;  2VB1 A;  4XN6 A;  1JIY A;  1QTK A;  2G4N A;  5C6I A;  3OK0 A;  1IO5 A;  1BGI A;  3AW6 A;  4FDY A;  5IEL A;  1B7P A;  154L A;  1VED A;  1JTP L;  3WL2 A;  2MEH A;  1TBY A;  4N9R A;  1VDP A;  3WH1 A;  1G7I C;  1HNL A;  2YBL A;  2B5Z A;  4N1C C;  1BB3 A;  1LKR A;  1LSE A;  1QSA A;  5I4Y A;  5DN5 A;  1WQQ A;  1IY4 A;  2BQD A;  2MED A;  1XFP L;  3GXK A;  3IJV A;  1W6Z A;  1XGR C;  2BLY A;  1GB6 A;  3AZ7 A;  4B49 A;  2DQD Y;  2XTH A;  2DQJ Y;  4IAS A;  1DI4 A;  4J7V A;  1YL1 X;  1IP3 A;  3AGI A;  1TDY A;  4OWE A;  3B0I A;  5FST A;  1LJ3 A;  1JKC A;  3J4G A;  1BWH A;  4U3X B;  1GE2 A;  4C5F A;  3HBH A;  1LSP A;  4J1A A;  4YEN A;  1TCY A;  1G7J C;  1UIG A;  1YIK A;  4H93 A;  1HHL A;  5I5Q A;  1IP4 A;  1LHL A;  2ZWB A;  4NY5 A;  1JEF A;  1B7S A;  3T36 A;  5LIN A;  3RW8 A;  4LYO A;  4RW1 A;  1GF6 A;  4HV2 A;  4M4O A;  3M3U A;  5D5C A;  5I4X A;  1GFH A;  2LYZ A;  3TMU A;  5L3H A;  2F4A A;  3CB7 A;  4HP0 A;  3TXG A;  1WQR A;  1HML A;  2GV0 A;  4GCE A;  5F81 A;  5KXK A;  2D91 A;  3AGH A;  3CT1 A;  6LYT A;  1LMT A;  1IVM A;  1DKK A;  2DQA A;  1OUB A;  4WLT A;  3FE0 A;  1B7Q A;  4UWN A;  1QUT A;  4CHX A;  194L A;  1IWU A;  5KXN A;  1FBI X;  4ETC A;  1GXX A;  4O34 A;  4RLM A;  4Z46 A;  2H9J A;  4ET9 A;  1D6Q A;  1LMP A;  3TXD A;  4DDA A;  5APE A;  1LZC A;  2F2N A;  2FBB A;  5B05 A;  4M6D A;  1HSX A;  1ZVY B;  2Z19 A;  3IWR A;  4XJH A;  5I53 A;  5KXY A;  5LVK A;  1IWV A;  1JIS A;  4NHT A;  4NGW A;  4MCK A;  1XEJ A;  5C6J A;  1QQY A;  4ETD A;  1NMM A;  1LJE A;  4NSI A;  3LHM A;  4NEB A;  4CJ2 A;  1ALC A;  4TSB A;  4DD3 A;  4TX7 A;  5KY1 A;  5KKJ A;  3N9E A;  2IFF Y;  1B5Z A;  2D4J A;  1LCN A;  3ZVQ A;  1B2K A;  4WLD A;  4DC4 A;  7LYZ A;  3AJN A;  3W6A A;  4BAP A;  1UCO A;  3W6D A;  1IR7 A;  4B4J A;  1CKC A;  1UID A;  3J6K A;  2I6Z A;  5E9R A;  1GEV A;  3D3D A;  4GN3 A;  2BQC A;  1J1X Y;  3WYH A;  2EPE A;  1B5W A;  1YAP A;  3LYO A;  5EBH A;  5I54 A;  2CWI A;  1WVV A;  1OUI A;  3AZ4 A;  1GXV 2;  5B59 A;  4DT3 A;  1LYO A; 
#chains in the Genus database with same CATH topology
 2RRU A;  4Z6Y A;  3HDE A;  4AQY M;  3B72 A;  3G3B B;  2V1C A;  4GIP A;  227L A;  3RZE A;  4GN5 C;  4YXA C;  1R4G A;  4WM5 A;  3GPU A;  133L A;  2H9K A;  2FYC A;  4MGI E;  2BQJ A;  1OUC A;  5ITU A;  4LJ7 A;  5FTM A;  1IWZ A;  1LJG A;  4G4R A;  1GDW A;  1LJ4 A;  4IBE A;  5IWA M;  1L13 A;  1C65 A;  1OFH A;  4NHP A;  4E3U A;  4Y28 F;  167L A;  2Y21 A;  4G4B A;  5L3I A;  1NQI A;  1JKA A;  2PC2 A;  3OE8 A;  1WQN A;  4LT0 A;  1PJQ A;  3R8F A;  3CSR A;  2E5L M;  4EPI A;  4HSF A;  4TTD A;  3LZ2 A;  1DGG A;  3D9A C;  2ZNW Y;  5II3 A;  4I7O A;  1XNR M;  3GLF A;  3LZT A;  3FTD A;  3L29 A;  4JI1 M;  1LHJ A;  5F3W A;  1JSF A;  1G0Q A;  1GF4 A;  3IG8 A;  4MST A;  3KP0 E;  2XFS A;  4LT1 A;  4D80 A;  4TWS A;  4GBR B;  5KKI A;  5KXM A;  1LZD A;  1OVK A;  2EIZ C;  1XWI A;  2RGH A;  4DQ5 A;  2DAI A;  3GUI A;  4I8S A;  3K1J A;  2Z2F A;  2LVP C;  3THG A;  3W6B A;  4WM2 A;  5ILC A;  1LZ1 A;  1CKG A;  1G1V A;  3E46 A;  1VDS A;  3B7Q A;  3DN8 A;  4ETA A;  4H8X A;  1QS5 A;  1A4V A;  1FDL Y;  4M0D A;  2Z39 A;  2LHM A;  4H94 A;  4TUW A;  1L1T A;  1JJ0 A;  1OV7 A;  4DV5 M;  4HJV A;  4A3V B;  252L A;  4G4H A;  2R45 A;  2ZYP A;  3J80 S;  2I7P A;  1F6R A;  1JIT A;  1D3F A;  1MLC E;  3HUA A;  2C5R A;  4UWV A;  2LZ2 A;  3HJS A;  1B7R A;  1IOS A;  1RCM A;  214L A;  1DGH B;  1LYI A;  3A98 B;  4DD7 A;  1KW7 A;  5IDD A;  1AM7 A;  1QTH A;  1GFV A;  1GAZ A;  2M60 A;  4WO9 A;  1WHC A;  1VDT A;  1HQY E;  1HNX M;  1D0L A;  4JI0 M;  1SXJ B;  4DR3 M;  3NY9 A;  4KOD A;  5FTJ A;  1IY3 A;  2CDS A;  2WAR A;  1LJI A;  3HUQ A;  2DHY A;  1I56 A;  3I01 M;  3PNV A;  3ULR A;  1L59 A;  2ZIJ A;  4B3T M;  1GB9 A;  4Z98 A;  2RBQ A;  1V92 A;  4LRT A;  1NDG C;  2DAM A;  1LTM A;  4AQN A;  3U6E A;  1I6S A;  1LZ4 A;  1AT6 A;  4G6Z A;  1GF5 A;  4PCZ A;  5EXS A;  1WQP A;  3KP1 E;  2DQI Y;  1G59 A;  5C18 A;  3WHK A;  4WL7 A;  5LA8 A;  2K6B A;  3AOE C;  1C6C A;  166L A;  5APF A;  1RFP A;  4YY3 M;  2ZNX Y;  1QUS A;  2ZBK B;  199L A;  2FYD A;  2DWZ B;  2OOA A;  1I20 A;  1NHE A;  2NTH A;  1XJT A;  1XGP C;  1YLA A;  211L A;  5LVJ A;  1D3N A;  4TSC A;  2QP9 X;  4H9F A;  3TXE A;  3TWK A;  4LF9 M;  171L A;  3HU1 A;  1IOR A;  1REY A;  1XSF A;  2BPU A;  1L98 A;  4AW4 A;  4I81 A;  1XGU C;  4IAT A;  2QB0 B;  5LAF A;  2MEI A;  1LMC A;  4W59 A;  1L99 A;  5BR8 M;  1SXJ E;  2UXD M;  2DHR A;  1JUG A;  1QTD A;  2DQF C;  2KNV A;  1XGT C;  1NVM A;  4FWH A;  2CEA A;  4DKL A;  1FKQ A;  2HAK A;  4PRU A;  4X3B A;  3V2W A;  5FLX S;  4JI4 M;  2Z4R A;  143L A;  2LYM A;  3VLF B;  2CHG A;  3AOG A;  4P17 A;  1XHB A;  5KXZ A;  3QE8 A;  3RGP A;  1CTW A;  4OVZ A;  2HHH M;  4WLX A;  1C6J A;  2IGC A;  4H9E A;  1LI2 A;  4CFO A;  2D7E A;  5T3F A;  1L69 A;  103L A;  5KXX A;  1WJ7 A;  4N1E I;  1HJP A;  2YNM D;  4LYT A;  1G7L C;  1WQM A;  3TL4 X;  1YIL A;  4FCW A;  4NGL A;  4XJD A;  4LT3 A;  1CJ9 A;  3M0E A;  3GXR A;  3GPY A;  2BQI A;  3PNY A;  5L8R F;  2NTG A;  3G3A B;  4HTK A;  2OU0 X;  2LYO A;  1C45 A;  1I94 M;  2K9D A;  1ZUR A;  3LN2 A;  1IN5 A;  3VKH A;  1CUP A;  1L54 A;  3W6C A;  1XEI A;  5IZ7 D;  4I8O A;  4M9Z A;  1L21 A;  1LSD A;  3HDF A;  3Q8X A;  4JI7 M;  244L A;  1GF7 A;  3U5Z A;  3FE3 A;  1Z55 A;  1L37 A;  1OAO C;  1REX A;  1YAQ A;  1LZ5 A;  183L A;  2L7I A;  1GBX A;  3DOA A;  230L A;  2K47 A;  1FLQ A;  1EIJ A;  4XGI A;  3DN6 A;  3F9L A;  3G3X A;  4ETB A;  1LKS A;  3C80 A;  1KYI A;  4DR7 M;  5ITX E;  3BKV A;  6LYZ A;  1SG9 A;  1GBZ A;  3C7Y A;  2NQ8 C;  4QNR A;  2WSF F;  4L4U A;  4W51 A;  5HMV A;  1FNN A;  3C8S A;  2X49 A;  2I25 L;  1G41 A;  4JI3 M;  4EPF A;  4CFP A;  1CVK A;  3GLH A;  134L A;  2OE9 X;  1QQW A;  3P66 A;  4DD0 A;  5LYM A;  1IR9 A;  1C66 A;  3WPL A;  2W1X A;  1PQI A;  1HEP A;  3SP3 A;  2OE4 X;  1C6P A;  1HFX A;  3MHV C;  1L62 A;  4XJF A;  1YL0 X;  1I4W A;  2BWE A;  4LJ4 A;  4LZT A;  1GD6 A;  1SQ2 L;  198L A;  187L A;  4L8R C;  2BQO A;  119L A;  1B7O A;  1LJJ A;  4OOO A;  4A7D A;  4IBB A;  1BB6 A;  144L A;  3A42 A;  1C62 A;  2LTU A;  1L10 A;  4FJR A;  120L A;  1LSN A;  158L A;  1IBM M;  3DFZ A;  2EKS C;  1BB4 A;  1T8F A;  4I4L A;  3T1Y M;  3GLG E;  2ZTD A;  1AKI A;  1UAC Y;  1LZ8 A;  2C9C A;  4MR1 A;  4H90 A;  3HHZ A;  5LVG A;  1WGL A;  2NWD X;  256L A;  1LYD A;  4RKU F;  1IIZ A;  1TGU A;  3CQL A;  2L4E A;  4G4C A;  1XXH A;  4MGY E;  4ARM B;  4DDC A;  1L80 A;  4NSR A;  1C63 A;  5HLL A;  3NY8 A;  2L4F A;  3HU3 A;  1BVK C;  2MEF A;  2X0A A;  4KPM A;  1SXJ C;  2KZU A;  5ITQ A;  1I1Z A;  1QDR A;  2UXB M;  1C6G A;  1HEM A;  4LF6 M;  3A3R X;  1B7N A;  2FNA A;  4AZF A;  258L A;  2FE8 A;  4DV2 M;  253L A;  3GQ4 A;  1L88 A;  1LYJ A;  3BKH A;  1PJT A;  3FI7 A;  3C83 A;  1LZE A;  4LF8 M;  1B6I A;  4CGE A;  1Z59 A;  1VEK A;  2MEG A;  4JN6 A;  2RSC A;  2FBD A;  2LHC A;  1D6P A;  2CE7 A;  2LHG A;  1IY2 A;  2BQN A;  5F9X A;  1IWY A;  4XJG A;  5DFL A;  5I14 A;  2L09 A;  102L A;  149L A;  1L64 A;  4FDY A;  1B7P A;  1PQK A;  4LZM A;  1T43 A;  4N9R A;  1N34 M;  2B5Z A;  1VDD A;  1C6I A;  3J27 B;  1IXS B;  4QOS A;  2CV2 A;  1LKR A;  1OVH A;  4DR4 M;  5DN5 A;  1WQQ A;  2MED A;  1CU6 A;  1XGR C;  3AZ7 A;  1GB6 A;  4B49 A;  5EP1 A;  2DQD Y;  2RB0 X;  2XTH A;  1SSY A;  3DN2 A;  3AGI A;  3B0I A;  4GC5 A;  1VQ1 A;  1LPY A;  1PQJ A;  1G7J C;  4H93 A;  4LZJ A;  1HHL A;  1IP4 A;  1B7S A;  1QVR A;  1D2Y A;  5EXX A;  3KOZ E;  2OEA X;  3RW8 A;  2QCU A;  1R7R A;  1DYA A;  4HV2 A;  2RB2 X;  5D5C A;  3RUN A;  1L49 A;  2F4A A;  4HP0 A;  1C6T A;  5KPT A;  1PRB A;  1WQR A;  3TXG A;  2GV0 A;  5KXK A;  2F5N A;  1JR3 E;  4B08 A;  1LMT A;  5ITT A;  2XEP A;  4FCT A;  4WLT A;  1QUT A;  2K0B X;  1IM2 A;  4GC9 A;  3HHX A;  3SHG B;  4CIS A;  4O34 A;  1Q39 A;  3KOY E;  2H9J A;  5APE A;  3BOS A;  2OU9 A;  2FBB A;  2DNA A;  1NHW C;  1SWZ A;  3C82 A;  1HSX A;  3LMM A;  228L A;  2Z19 A;  3J7A S;  4DUY M;  3WHL A;  3GO8 A;  2L7H A;  5EP2 A;  1HNZ M;  5LVK A;  4NGW A;  3KOX E;  213L A;  1L15 A;  5C6J A;  1L30 A;  4ETD A;  1T8G A;  1LJE A;  3LHM A;  4NEB A;  1L24 A;  217L A;  4TSB A;  2O79 A;  1V33 A;  141L A;  3N9E A;  2D4J A;  4PDG A;  4F2L A;  1LCN A;  1Z5C A;  3AJN A;  3W6A A;  4BAP A;  4DQ7 A;  3W6D A;  3IHP A;  1UID A;  5E9R A;  2OU8 A;  3G3W A;  2BQC A;  4IBC A;  232L A;  2RBO A;  4ZPX A;  3LYO A;  4OO9 A;  5I54 A;  2CWI A;  3GRY A;  2X8A A;  3AL0 C;  5FSW A;  1WVV A;  259L A;  3M6A A;  1L28 A;  1LLH A;  2BWB A;  175L A;  1L48 A;  1L39 A;  3SYL A;  2D4I A;  4R71 A;  3GLI B;  2L2D A;  5KPR A;  2EQL A;  3WXT A;  3WXU A;  2HEF A;  1PQO A;  1F10 A;  2CV0 A;  1B7L A;  1GFK A;  2EKF A;  2MEC A;  147L A;  1L63 A;  1OUE A;  4FW9 A;  2HEE A;  236L A;  1DPX A;  3P65 A;  1YAN A;  4L6V 6;  3LW5 F;  5E4P A;  1LMO A;  4RLN A;  3SAR A;  1L94 A;  5FCP A;  3AZ6 A;  2N35 A;  3GP1 A;  181L A;  1LYE A;  1MEL L;  1DGF A;  1CNS A;  1MX0 A;  4LDO A;  3UMM A;  2A4T A;  4IIW A;  1HFZ A;  1T6V L;  8LYZ A;  218L A;  4XAD A;  4II8 A;  4H9A A;  2DI0 A;  1ZWN A;  246L A;  2BQK A;  4XEN A;  4WG1 A;  4NG8 A;  126L A;  2HKJ A;  3AFH A;  2XBS A;  3U6L A;  1JTM A;  3RFW A;  5KQ8 A;  1EPY A;  4HPI A;  4R0F A;  2R44 A;  3A92 A;  2DZL A;  2ZIL A;  3C8Q A;  1L73 A;  4NRW A;  1TLA A;  1XGQ C;  2R46 A;  1NF5 A;  3A94 A;  3TE6 A;  3HT8 A;  1REM A;  1L8Q A;  4R6C A;  4WP2 A;  1CV0 A;  8CAT A;  3ZC7 B;  2CGI A;  2Y8P A;  3EO5 A;  3VDP A;  3W68 A;  3GLI E;  4B7G A;  4LFP A;  1BB5 A;  2O5R A;  4EMN A;  1L71 A;  5E26 A;  1DPW A;  1L58 A;  1BHZ A;  3CF6 E;  4IJ4 A;  2CHQ A;  1SSW A;  1OUG A;  2UUB M;  3L2X A;  4ARQ A;  1LZG A;  2G4P A;  4XK8 F;  3FKE A;  5KJ9 A;  1L26 A;  4PD2 A;  4E97 A;  3WUM A;  3WPJ A;  1UC0 A;  2KNZ A;  3PVS A;  2MH8 A;  1XMQ M;  1L57 A;  107L A;  2Z3X A;  2MEB A;  3L2A A;  2O7A A;  4ET8 A;  4QOZ C;  2XSZ A;  4AKH A;  1EQ5 A;  188L A;  3U6M A;  4DV1 M;  3PBL A;  1F4I A;  3U6D A;  3DN1 A;  4IBD A;  4LY6 A;  4GCB A;  3J2P B;  3LVV A;  2FFJ A;  4CGY B;  1GB5 A;  1IBK M;  1DYG A;  4OWA A;  1N4F A;  2QBY B;  3W6E A;  3WW5 A;  3TPZ A;  3CF2 A;  4LGM A;  4LFA M;  2LCB A;  1D0K A;  1QTE A;  2YBH A;  3P64 A;  172L A;  1OUJ A;  4XJH A;  2DBT A;  4EOF A;  223L A;  2R65 A;  1GF0 A;  1TH3 A;  1HR0 M;  4X62 M;  4ZIX A;  1D3M A;  3K3T A;  2DAK A;  3UGJ A;  1L17 A;  3GUO A;  3RNX A;  4EIW A;  4OWC A;  4GN4 A;  3WU8 A;  3U60 B;  4YEM A;  2P5T A;  3V2Y A;  1OVJ A;  3FUU A;  1G7M C;  1MU5 A;  2DWM A;  2ERC A;  4NGO A;  2H1R A;  4NWH A;  1C43 A;  4KHP M;  5C1B A;  3U6C A;  129L A;  4B0D A;  1L06 A;  1DZB X;  2BJW A;  4IBF A;  1UM8 A;  4NGJ A;  1Y8G A;  4NWE A;  1LYF A;  1LYS A;  1PS5 A;  1CKH A;  2JY6 B;  1QTZ A;  4HJZ A;  4UN2 B;  3DN0 A;  1UIC A;  3HWS A;  1LYH A;  1ZYT A;  2JWS A;  2YSS C;  2WSE F;  5H37 D;  1ZMY L;  5L9J A;  4DV4 M;  2F4G A;  2QHO B;  5IHG A;  2HCB A;  4WMG A;  3RGS A;  1OUD A;  1T3P A;  2EKK A;  2MJ5 B;  2A7F A;  4OX9 M;  1WTM A;  2R62 A;  1TDZ A;  3C9P A;  3HU2 A;  5DM9 A;  1G7H C;  3ZH9 B;  3LCU A;  248L A;  155L A;  4GCD A;  3A8Z A;  1P2L A;  4Z41 A;  1GBW A;  4Z3M A;  4MM3 B;  1CU0 A;  1L96 A;  3CSZ A;  4WM6 A;  5KXT A;  112L A;  3N9A A;  3WVX A;  4I5S A;  2W1M A;  4CIZ A;  1OIZ A;  5FEK A;  1ZMW A;  4NG1 A;  4B7F A;  4I7N A;  4DV3 M;  1E94 E;  1L47 A;  3M7G A;  2M5Z A;  3H4J A;  4P16 A;  3T6P A;  1N36 M;  2A5Y B;  262L A;  1G0J A;  4NSG A;  4H9I A;  3GUL A;  2YR0 A;  2DWL A;  1C6M A;  1H6U A;  3RZ4 A;  2H5X A;  2WSC F;  1W08 A;  1QSB A;  1OIP A;  3GPX A;  1OJL A;  1GFT A;  1NHB A;  3TMX A;  3ZVQ B;  3E9S A;  5FEL A;  2Z12 A;  1LHK A;  3HZJ A;  109L A;  1GFJ A;  1HQC A;  240L A;  2B3T A;  3U6P A;  4W52 A;  3CDT A;  4BAF A;  4S0W A;  3GQ5 A;  2B6X A;  1K82 A;  3HH4 A;  4K5Y A;  1LJN A;  5DL9 A;  138L A;  1OUA A;  2HEB A;  3VDU A;  1RU3 A;  1GFU A;  3RT5 X;  174L A;  2BQB A;  1C10 A;  3TQS A;  1C6B A;  3N9C A;  1JJ3 A;  4L15 A;  4LYZ A;  2QNJ A;  3KAM A;  1QAM A;  1UBZ A;  3PFI A;  2EA0 A;  5J7C A;  3GLG A;  4LYB A;  2F5O A;  1NNU C;  4YOP A;  4C3W A;  2RB1 X;  4NSH A;  4I7T A;  1FLU A;  4NL4 H;  1IQP A;  3JR4 A;  1HEO A;  4DD9 A;  5C6L A;  2HEA A;  3A67 Y;  3D8L A;  1OV5 A;  3FI5 A;  2B7X A;  2DQG Y;  201L A;  1L25 A;  2Z18 A;  5DYI A;  3WW6 A;  4II7 A;  2KNA A;  153L A;  2RAZ X;  1G07 A;  3A3Q A;  3HUK A;  1QYR A;  2BQL A;  3SB8 A;  3SAW A;  3GLF B;  1BWJ A;  4YEO A;  5A3Z A;  1GB8 A;  1IP1 A;  1GBY A;  4AGA A;  1N32 M;  3AGG G;  4I7P A;  1KIP C;  1GF9 A;  4R3D A;  1GBO A;  4QGZ A;  1XJU A;  2B6Z A;  1RI8 B;  4BAD A;  1L89 A;  2CHV A;  4H9C A;  2EJS A;  206L A;  3LYT A;  3LCV B;  3UJN A;  4DD2 A;  1KNI A;  1G4A E;  1TF0 B;  1QUD A;  170L A;  1JQU A;  2D6B A;  1L35 A;  3EIE A;  4F1I A;  1L97 A;  2G8L A;  1D9W A;  2ZQ3 A;  2XQO A;  2ZYC A;  2OPF A;  4B3M M;  4IAP A;  3HKP A;  2F4V M;  3HTF A;  2KEB A;  1QAN A;  1C61 A;  178L A;  1GEZ A;  1VDQ A;  212L A;  2V1U A;  3CT0 A;  5LVH A;  4MGK E;  2DWN A;  3WUA A;  3SAS A;  1CV1 A;  1IOT A;  4X66 M;  1GB0 A;  1AIP C;  4ML7 A;  3HU9 A;  1JIY A;  1QTK A;  177L A;  3OK0 A;  2ZM6 M;  4PK0 A;  3FUX A;  5IEL A;  7CAT A;  3E21 A;  1JTP L;  3TWL A;  2KHH A;  1QT3 A;  2R4E A;  3WH1 A;  4MB7 A;  1G7I C;  1GJS A;  5LZM A;  1L44 A;  3FTE A;  2F5Q A;  4FCV A;  1QSA A;  216L A;  5I4Y A;  4NSO B;  2B6T A;  5GKN A;  3GXK A;  1PJJ A;  3SB9 A;  3IJV A;  4ARL A;  1W6Z A;  1WGN A;  3SAU A;  1C6L A;  1Z6T A;  4ITQ A;  2DQJ Y;  1DI4 A;  1YL1 X;  3J81 S;  1TDY A;  4CJ6 A;  1BWH A;  140L A;  4U3X B;  242L A;  4C5F A;  2R0I A;  4J1A A;  4YEN A;  2CFO A;  1TCY A;  1UIG A;  1YIK A;  2CWB A;  4LYO A;  4RW1 A;  3VK7 A;  2FOI C;  1GF6 A;  3HH6 A;  1NHG C;  3M3U A;  4EKR A;  4BLC A;  3TMU A;  1W5S A;  1IFY A;  2D7H A;  1CX7 A;  3CB7 A;  3GRU A;  1D2N A;  4GCE A;  2HUK A;  1PGY A;  6LYT A;  1IVM A;  2O4W A;  2DQA A;  1OUB A;  1CV5 A;  3U6Q A;  5KXN A;  1GXX A;  1C67 A;  4Z46 A;  1D6Q A;  4DDA A;  3C81 A;  2F2N A;  5I53 A;  4OW0 A;  4NHT A;  238L A;  3JAM S;  3SYK A;  4NSI A;  2C9O A;  1GJT A;  2ANX A;  2D7G A;  5KKJ A;  1L0J A;  1B5Z A;  142L A;  2LC9 A;  1L46 A;  2I6Z A;  1R6B X;  1GEV A;  4EKP A;  3D3D A;  3CDO A;  4ARJ A;  1J1X Y;  4RF0 A;  3HTD A;  1YAP A;  3K9O A;  4IBJ A;  2HUL A;  3JR6 A;  2LVA A;  1FJG M;  4DT3 A;  4OVZ B;  1L11 A;  3GUM A;  1LJH A;  1L65 A;  1L60 A;  2B72 A;  1KW5 A;  5APD A;  207L A;  4NXN M;  4CHT B;  4NGK A;  2HU3 A;  1L55 A;  4LFX A;  1IWW A;  2RH1 A;  1ORY B;  2QZ4 A;  1KS3 A;  1IN4 A;  5IT9 S;  3GUK A;  5ITY A;  3D8B A;  1L14 A;  1B5Y A;  3MMP A;  2BQA A;  5ITR A;  4PDI A;  1NDM C;  1LWG A;  245L A;  4QY9 A;  1L16 A;  1UUZ C;  4JV5 M;  1V7S A;  5LAG A;  4QDN A;  2ANV A;  1J09 A;  4M9S A;  2R4J A;  4IBI A;  3TWM A;  159L A;  1IC5 Y;  3GUJ A;  4LJ9 A;  3PXG A;  3U5Z B;  1HC0 A;  3HTB A;  6LZM A;  1N33 M;  1GBS A;  2B75 A;  4H91 A;  4S12 A;  2CJL A;  4G4N A;  1CUQ A;  4LGY A;  4OW1 A;  4NGV A;  1QUG A;  3HGI A;  4ZFP A;  3UZU A;  1LGW A;  4KO8 A;  1C6F A;  1NY5 A;  3BXW A;  3GUP A;  191L A;  1LZT A;  1B0D A;  237L A;  205L A;  1TTE A;  151L A;  3GLI A;  2ZAN A;  3FD9 A;  4FWD A;  4IBK A;  1HF4 A;  1UA6 Y;  1UIF A;  208L A;  3HX3 A;  1BVS A;  241L A;  4NXM M;  3AZ5 A;  4HL4 A;  3W67 A;  2I26 L;  1GHL A;  1G0L A;  2Z2E A;  5B07 A;  3HT7 A;  2JUJ A;  1XB2 B;  3DN4 A;  3GLH B;  3GRR A;  4LF7 M;  2RBR A;  4JXJ A;  4NHI A;  1GFE A;  3IWR A;  4GMQ A;  1B5X A;  4M0W A;  2LNH C;  2F5S A;  4HTQ A;  3ZQJ A;  3SB7 A;  1CV3 A;  1CU5 A;  2LVQ D;  2C8O A;  5LIO A;  1IX0 A;  2JNH A;  4RF1 A;  4TUN A;  3BBZ A;  4XBO A;  5KPZ A;  2Z6B A;  3M18 B;  1D0M A;  4YX7 C;  3GQ3 A;  1C1K A;  2O01 F;  2RKO A;  135L A;  1R2Z A;  1GB7 A;  1PQD A;  4PHI A;  3WPK A;  3WU9 A;  4LF4 M;  5IRE B;  1KY1 A;  1NV9 A;  5KXW A;  5FTL A;  2BAA A;  2QPA A;  4H8Y A;  4W56 A;  2WZJ A;  1BB7 A;  5I4W A;  5LXW A;  4EJ4 A;  1C6N A;  1QDT A;  4NC6 A;  3P4Z A;  3FYD A;  3GRV A;  2J5Y A;  4GLA A;  4DJH A;  197L A;  4OWH A;  5LYZ A;  1L90 A;  3KSX A;  1K3W A;  1L2B A;  139L A;  2LVN C;  3VK8 A;  1XXH B;  4W57 A;  2YBJ A;  1P6Y A;  255L A;  2LH0 A;  1FN5 A;  1LGX A;  1P7S A;  3WVY A;  2BQM A;  1SLY A;  2HEC A;  3HHW A;  1GWD A;  2HU1 A;  3EMS A;  1L38 A;  4X65 M;  4WM1 A;  1UIB A;  3HT9 A;  1P56 A;  4L16 A;  247L A;  4I7S A;  4M9X A;  1DQJ C;  2XGN A;  1L31 A;  4P2E A;  4GH9 A;  3SFZ A;  3L28 A;  3SN6 R;  2XFT A;  1L29 A;  3CDR A;  3F6Z A;  3GLH E;  5LMU M;  5HQ1 A;  137L A;  1OP9 B;  2QEN A;  1QZM A;  4XYY A;  3I51 A;  2H5Z A;  2DQE Y;  3QWL A;  4JI2 M;  4I7M A;  1EFU B;  5KXO A;  1GFR A;  4OOT A;  1L08 A;  3FUV A;  1RJC B;  3DNA A;  2Q2E B;  3I4V A;  2HUM A;  2YVB A;  4D81 A;  1GE0 A;  1INU A;  4NGY A;  3MJ5 A;  4H9B A;  3WUL A;  1IC4 Y;  1OTR A;  4LGK A;  2VQF M;  2F2Q A;  195L A;  3TXJ A;  1XC8 A;  3HWL A;  1L20 A;  3KS8 A;  2B74 A;  2YDG A;  189L A;  1NNJ A;  2OOB A;  229L A;  3DMV A;  3UON A;  2RGO A;  4DDB A;  2OO9 A;  5KXP A;  1IWX A;  1DYB A;  1Q02 A;  2A7D A;  4PPO A;  4G4Q A;  4NFV A;  1L1Z A;  1Q3C A;  3FRH A;  1YE9 A;  3A6B Y;  1AZF A;  3HU8 A;  3SBA A;  3ZEK A;  2Z37 A;  4I0C A;  1GVN A;  4DR6 M;  3GUN A;  3B7Z A;  2HL7 A;  2ZTC A;  3U61 A;  3A90 A;  1L70 A;  1CU3 A;  1WTH A;  4QHT A;  2YBM A;  3J7B A;  1LPI A;  4N0J A;  3SB5 A;  2Z38 A;  243L A;  1XXH E;  127L A;  235L A;  4LFB M;  3TXF A;  1QT7 A;  4FD2 A;  1AT5 A;  2KRU A;  4DV7 M;  1JB0 F;  3HY5 A;  3LQR A;  4H92 A;  1YQV Y;  4BS7 A;  2F47 A;  1L86 A;  1IOQ A;  1C6A A;  130L A;  3E3D A;  2HUB A;  4W94 A;  1LSZ A;  1L41 A;  1L05 A;  3VWO A;  1L02 A;  4YXC A;  4KT3 A;  3G3V A;  2APL A;  4KL7 A;  4QEQ A;  1O23 A;  1GKI A;  3B74 A;  3KSJ A;  2LZM A;  1C6K A;  1D2W A;  221L A;  2MEA A;  3HFM Y;  215L A;  1YAO A;  4ARP A;  4HJY A;  1IOC A;  3WMK A;  224L A;  1LHI A;  1G0M A;  1JHL A;  3AJI B;  4LJ6 A;  1QT8 A;  4ZEE A;  2OE7 X;  3HBD A;  1DYD A;  4GEW A;  2W82 A;  111L A;  1V34 A;  1IWT A;  110L A;  4W5W A;  4NHS A;  239L A;  1OYU A;  1NJF A;  1LZ6 A;  2XJW A;  4RDS A;  3EIH A;  3TXK A;  3SAV A;  4KLN A;  5D5F A;  1WTN A;  1YSY A;  1CJ6 A;  4PRQ A;  1JTT L;  165L A;  104L A;  1IXR C;  3D4S A;  1JQJ C;  3HH5 A;  3UK6 A;  1VEJ A;  4WL6 A;  5AMY A;  3WU7 A;  1BWI A;  1H6M A;  1GE4 A;  2KDL A;  4X64 M;  1L81 A;  2YBN A;  108L A;  1JSE A;  1YRO A;  131L A;  3KVW A;  1JKD A;  2N5Z A;  2RBN A;  3A95 A;  3W6F A;  3SMS A;  1YKZ X;  3Q8G A;  2QQ8 A;  1IP6 A;  2G3Q A;  3B89 A;  2HWJ A;  1E32 A;  3MK6 A;  2YBI A;  5EJC A;  1QSQ A;  1DGH A;  3OJP A;  5EP4 A;  4D82 A;  3K2L A;  5JI2 E;  2LBC A;  1C68 A;  1LYO A;  1YAM A;  3QYB A;  3HBE X;  1L04 A;  1CJ8 A;  1DYC A;  5APC A;  1OQM A;  1VAU A;  3HHY A;  1C60 A;  3AB6 A;  209L A;  1KXW A;  3B7N A;  4GIT A;  1SXJ A;  1C7Y A;  164L A;  1GPQ C;  1CX6 A;  1RE2 A;  1OQY A;  2MEE A;  4JI6 M;  4G49 A;  3F92 A;  4I7J A;  4HEO A;  1TEW A;  5DLA A;  4DV6 M;  169L A;  1P2R A;  4H9H A;  4LG2 A;  2MRO B;  4DD1 A;  4Q7J A;  4LRS A;  4DBG B;  3VKG A;  4B4E A;  4AKI A;  1HSW A;  4JI8 M;  1UIH A;  1G0K A;  2KA6 B;  4ANR A;  184L A;  5A3E A;  3QY4 A;  1T6H A;  4ZPU A;  1DXJ A;  1IY0 A;  5KXR A;  1GE1 A;  5B1F A;  1EQE A;  3HJQ A;  4G4O A;  2CP8 A;  3RU5 A;  3WUN A;  249L A;  1LZA A;  1UIE A;  2LVO C;  1NWG A;  1PZY A;  5FHW A;  3IJU A;  3U6S A;  1H87 A;  3B6L A;  5A2Q S;  5LVI A;  2AHM A;  1JTN A;  222L A;  1L32 A;  4KXI A;  2DVW B;  1L07 A;  1OWY A;  1SX7 A;  1LYG A;  1HFY A;  1L56 A;  2C99 A;  4GHL A;  2BQF A;  260L A;  2HED A;  1DI3 A;  1G06 A;  1L68 A;  1OFI A;  3EML A;  1CKD A;  3JR5 A;  1DO2 A;  3T1H M;  2J7N A;  3QAU A;  5KXL A;  1J1P Y;  190L A;  4G9S A;  4NIJ A;  1WR1 B;  3ZCB B;  4B3R M;  1B5U A;  1L12 A;  4YM8 A;  4BBA A;  1A5T A;  3ILK A;  4ARQ B;  2VB1 A;  3DN3 A;  4G3O A;  1PJI A;  3KOW E;  4LCB A;  4GHA A;  3AW6 A;  225L A;  1VED A;  2MEH A;  1K3X A;  185L A;  2EO2 A;  2Y20 A;  1VDP A;  4N1C C;  5ITX A;  1ZAE A;  1L40 A;  1Z5A A;  1XFP L;  4EKS A;  4DR5 M;  2RBP A;  2BLY A;  173L A;  1L85 A;  4B7H A;  2O25 A;  4IAS A;  4OWE A;  1IP3 A;  3FUT A;  1XEP A;  1XMO M;  1Q3B A;  3FRI A;  1LJ3 A;  5FST A;  2F5P A;  2Y0Q A;  2YFQ A;  1L72 A;  3HBH A;  1PJS A;  3CTW B;  1N77 A;  1L22 A;  1LI6 A;  5I5Q A;  2RAY X;  1LHL A;  3VW7 A;  1J7K A;  3KS4 A;  2XLJ A;  5LIN A;  5BPV A;  5EP3 A;  3C8R A;  4M4O A;  5L3H A;  150L A;  2QSF X;  1HML A;  1L2D A;  5F81 A;  2D91 A;  3AGH A;  3C3D A;  1DO0 A;  4I7R A;  182L A;  3FE0 A;  1NY6 A;  4UWN A;  4CHX A;  194L A;  1FBI X;  4LJ5 A;  4ET9 A;  4QNM A;  4BB9 A;  1LMP A;  1IN6 A;  3KFU G;  3SHF A;  3ODU A;  1QT6 A;  1ZVY B;  115L A;  2ZAM A;  1HT1 E;  1GL6 A;  5FTK A;  4MCK A;  1NMM A;  3RE8 A;  2UUA M;  4CJ2 A;  5E6J A;  3L26 A;  1P37 A;  118L A;  2IFF Y;  4L78 A;  3B9P A;  1B2K A;  1L36 A;  4WLD A;  1KY0 A;  4DC4 A;  1QZE A;  1IR7 A;  1QUH A;  3J6K A;  1L76 A;  2JY7 A;  3AV0 A;  250L A;  2MR9 A;  4I7Q A;  1L95 A;  5B59 A;  1OUI A;  2R6F A;  4FWG A;  1GB3 A;  4MH0 E;  1FLW A;  5HNC A;  3KXE C;  5HNL A;  2IHL A;  2JY8 A;  1EQ4 A;  1HEW A;  2ZAO A;  4B1A A;  2JZ0 A;  4FVM A;  4RNA A;  3A93 A;  4B4I A;  3W3E A;  4AG6 A;  1SWY A;  1DGB A;  4PJ2 C;  5FTN A;  1HEQ A;  4OWB A;  5DNY A;  4AI6 A;  1IP7 A;  152L A;  1CV4 A;  1L91 A;  2W1L A;  4WM4 A;  1HT2 E;  2YQZ A;  210L A;  5LYT A;  1L33 A;  1LSB A;  1P36 A;  3LYM A;  3SBJ A;  2VF8 A;  2OTY X;  4WM3 A;  1PM5 A;  2BLX A;  1IR8 A;  1L74 A;  1WVU A;  2BQE A;  4D9Z A;  1JTO L;  3K2R A;  1GFA A;  180L A;  2BJV A;  1DYE A;  1LZB A;  4XJB A;  1LZS A;  1XNQ M;  1IEE A;  1J1O Y;  1LSC A;  1GF3 A;  4LT2 A;  4R7G A;  4REZ A;  1LJK A;  1JKB A;  2DKL A;  3QNG A;  3TXI A;  1NO1 A;  1JPO A;  4ARM A;  4EKQ A;  1LMQ A;  4NGZ A;  4XJI A;  2JP7 A;  2LWX A;  1L67 A;  2HTX A;  1B9O A;  2C8P A;  2CV1 A;  3GLF E;  2DAG A;  3KDS E;  4K0K M;  1KIQ C;  2Q9D A;  3DZD A;  1VAT A;  3OTO M;  5JI3 E;  1LOZ A;  2DXI A;  2XSZ D;  1L2C A;  1KIR C;  5ILF A;  1CUK A;  4N5R A;  1HMK A;  1YUB A;  1L61 A;  1KXX A;  1JR3 A;  5DN4 A;  2G5G X;  4H1P A;  1GL7 A;  1UFZ A;  4DR2 M;  1EE8 A;  1LMN A;  3EBA B;  4J1B A;  2Q0M X;  1OUH A;  3A34 A;  3HT6 A;  2DEN A;  2L6O A;  3GLG B;  1LYZ A;  1G0P A;  5F9U A;  1L83 A;  1ZV1 A;  3A45 A;  1NBZ C;  2DKV A;  4WOA A;  1T6O A;  1P3Q Q;  1C08 C;  2BQH A;  4HLQ A;  1CKF A;  1IC7 Y;  3L64 A;  3MGW A;  4LF5 M;  1LJF A;  3QYE A;  3K9P A;  1WQO A;  4W55 A;  2Z7J A;  1EL1 A;  4IBG A;  4MGZ E;  3K8Z A;  1IXS A;  1SXJ D;  4YF2 A;  148L E;  2CUZ A;  2V6Z M;  4WG7 A;  1LGU A;  233L A;  1Z5B A;  192L A;  1F6S A;  3NBI A;  1C6Q A;  2XBR A;  4DUZ M;  1L23 A;  1D9U A;  1L53 A;  5B06 A;  193L A;  1D3J A;  1NKH A;  2GNO A;  1L66 A;  4W58 A;  4WUR A;  1J5E M;  4LJA A;  5EXP A;  2VF7 A;  4PGJ B;  1L00 A;  1QS9 A;  4UWU A;  4J0L A;  1CJ7 A;  3U6O A;  2JZ1 A;  4NSJ A;  2BNK A;  1VFB C;  4GCC A;  1QUO A;  231L A;  5EXT A;  4MGH A;  1MN3 A;  3CT5 A;  2VII A;  1HEL A;  2ZIK A;  3SAT A;  1L87 A;  1L52 A;  1K28 A;  2UXC M;  1GE3 A;  1GB2 A;  1B5V A;  5FDJ A;  4NRV A;  1P2C C;  3PDS A;  3FTC A;  1GF8 A;  1LHM A;  3H4M A;  2BQG A;  1C46 A;  3CDV A;  1LSF A;  3FAD A;  3NYA A;  3V76 A;  1N78 A;  2KW0 A;  1LZ9 A;  1LSY A;  1L09 A;  1ZMU A;  1LZY A;  1F0W A;  2F32 A;  2Q9E A;  1JWR A;  1T97 A;  1LAA A;  200L A;  161L A;  4LDE A;  254L A;  4DAJ A;  4WO6 A;  1IXZ A;  3T38 A;  5F16 A;  1DYF A;  3KW6 A;  1DV0 A;  1SX2 A;  5M1Y A;  1IP5 A;  4DQJ A;  1QSW A;  1C7P A;  1HNW M;  1DI5 A;  2RBS A;  3A96 A;  2OTZ X;  2XH9 A;  3CSQ A;  2UU9 M;  2Z4S A;  1KXY A;  4GRV A;  3LQQ A;  4W54 A;  1JJ1 A;  1ZV5 L;  3LVW A;  1VG5 A;  3SMP A;  2VDB B;  1LI3 A;  2LZT A;  4DYG A;  1LMA A;  2B6W A;  234L A;  1VEG A;  4LYM A;  2L78 A;  4L41 A;  3ATN A;  1CV6 A;  3C3E A;  1QT5 A;  4HTN A;  168L A;  1BQL Y;  1LV7 A;  3FTF A;  4OU7 A;  1T3T A;  1LSM A;  1LZR A;  5EQT A;  4NGI A;  2DZN B;  1AUA A;  1GLN A;  3EXD A;  5JEN B;  1L50 A;  1WXQ A;  3TXB A;  3A6C Y;  1QAQ A;  4EXM A;  3SB6 A;  145L A;  4LYC A;  1T8A A;  3TMV A;  4WLY A;  3T15 A;  1G3I A;  1HER A;  1C6E A;  1B7M A;  1G0G A;  4GLV A;  5F14 A;  4HV1 A;  1HEN A;  3P68 A;  1LHH A;  4KT0 F;  113L A;  2QAR C;  1L03 A;  1LZN A;  4ETE A;  1TR8 A;  9LYZ A;  3C7W A;  1L42 A;  5KO3 A;  3AOE A;  3IEC A;  3AW7 A;  1WIV A;  3A91 A;  3ATO A;  1LSA A;  3AYQ A;  1QTC A;  4GCF A;  2DQC Y;  1MJG M;  1FKV A;  1UIA A;  4JI5 M;  2GQF A;  3FA0 A;  3A46 A;  162L A;  4HPE A;  1L01 A;  3LZM A;  1QIO A;  4WW0 A;  1L45 A;  1REZ A;  5K7O A;  2AUB A;  3FYC A;  1NSF A;  1L34 A;  3C7Z A;  5KQD A;  2B6Y A;  157L A;  3NBX X;  4IJE A;  1NBY C;  4DWX A;  3B0O A;  125L A;  5LA5 A;  2JXN A;  5LMN M;  3FUW A;  4LDL A;  1C69 A;  1V7T A;  3NWL A;  3TXH A;  4H8Z A;  4LZZ A;  2ZQ4 A;  1KFV A;  1R5L A;  4NOO B;  3B0K A;  1TH4 A;  1IP2 A;  1A2Y C;  1DKJ A;  4I7L A;  3T6U A;  1TAY A;  2Z8Y M;  1G8P A;  1GDX A;  1YKY X;  4PJZ A;  3IG5 A;  1LSG A;  1E8L A;  1TDH A;  7LZM A;  1OKS A;  1L92 A;  2X4A A;  4Z8X A;  4W96 A;  1G1W A;  128L A;  3TMW A;  1NV8 A;  4NHQ A;  1BVX A;  1YKX X;  3I04 M;  2JY5 A;  3OE6 A;  2UUC M;  2G4Q A;  1N75 A;  1GAY A;  2QBY A;  160L A;  163L A;  1L0K A;  4N8Z A;  1G71 A;  4YHH M;  1FLY A;  1XEK A;  1LYY A;  2F30 A;  5DYG A;  3OE9 A;  2FS1 A;  186L A;  2XF3 A;  2D4K A;  4RW2 A;  226L A;  2DQH Y;  122L A;  3HH3 A;  1ZVH L;  1L77 A;  3W0F A;  2I7N A;  2W1Y A;  1C6D A;  2CRU A;  1KSF X;  1L75 A;  1GFG A;  3U60 A;  4AXT A;  1JR3 D;  1PQM A;  1CU2 A;  3DMX A;  1E9S A;  2C98 A;  132L A;  3OE0 A;  1L18 A;  2R18 A;  4IJF A;  1LWK A;  5B1G A;  3LYZ A;  2VQE M;  1L93 A;  1VDL A;  2DAE A;  5KXS A;  5HMJ A;  1C64 A;  1OUF A;  3SBB C;  2KXE A;  4LJ8 A;  4XN6 A;  1ZQ9 A;  2G4N A;  5C6I A;  1IO5 A;  2KRK A;  4PT5 A;  1BGI A;  1TH2 A;  2XZF A;  2C96 A;  154L A;  2XZU A;  3HTG A;  1QAO A;  261L A;  3GPP A;  3WL2 A;  1TBY A;  176L A;  1GAB A;  1L19 A;  4QHS A;  3DA1 A;  1HNL A;  1P3N A;  3E4R A;  220L A;  2YBL A;  3VFD A;  1BB3 A;  4GKJ M;  1LSE A;  2MGW A;  1IY4 A;  1X37 A;  3AKZ A;  1L84 A;  2BQD A;  4I7K A;  3DKE X;  4JYA M;  3K92 A;  4W53 A;  146L A;  4GKK M;  3C58 A;  4J7V A;  1E9R A;  3J4G A;  1JKC A;  251L A;  156L A;  1GE2 A;  2J7O A;  1S3S A;  1LSP A;  3DMZ A;  3HJ8 A;  1L82 A;  257L A;  2ZWB A;  4NY5 A;  1QTV A;  1JEF A;  3T36 A;  4DR1 M;  2FH0 A;  1QTB A;  3F8V A;  4AG5 A;  3L27 A;  1IY1 A;  3QAK A;  5I4X A;  1GFH A;  2LYZ A;  2B73 A;  1C6H A;  3CT1 A;  1GO5 A;  1W5T A;  1DKK A;  1B7Q A;  1L27 A;  1IBL M;  4DV0 M;  1NJG A;  3I4Y A;  1IWU A;  4ETC A;  4B3S M;  4RLM A;  1P46 A;  2EUC A;  3TXD A;  2OQ4 A;  1LZC A;  5B05 A;  4M6D A;  1R2Y A;  5KXY A;  4AKG A;  1P64 A;  1IWV A;  1JIS A;  196L A;  1XEJ A;  1QQY A;  1L79 A;  3SC3 A;  4LFC M;  2JA2 A;  1ALC A;  4DD3 A;  1QT4 A;  1OAI A;  2Y0T A;  1L51 A;  219L A;  4TX7 A;  3L25 A;  5KY1 A;  1OWZ A;  3CF0 A;  1ZMV A;  3ZVQ A;  1L43 A;  7LYZ A;  4GRI A;  2LXE A;  1UCO A;  2DZO B;  4B4J A;  1CKC A;  1P5C A;  2CUU A;  3CGW A;  3U61 B;  1IN8 A;  123L A;  4GN3 A;  3W0L B;  1LW9 A;  3WYH A;  2B70 A;  1B5W A;  2EPE A;  5EBH A;  3CDQ A;  3R9X B;  2KZS A;  3AZ4 A;  1GXV 2;  1IN7 A;  114L A; 
#chains in the Genus database with same CATH homology
 3HDE A;  3B72 A;  3G3B B;  227L A;  3RZE A;  4GN5 C;  4YXA C;  4WM5 A;  133L A;  2H9K A;  2FYC A;  2BQJ A;  1OUC A;  1IWZ A;  1LJG A;  1GDW A;  1LJ4 A;  1L13 A;  1C65 A;  4NHP A;  4E3U A;  167L A;  4G4B A;  5L3I A;  1NQI A;  1JKA A;  2PC2 A;  3OE8 A;  1WQN A;  4LT0 A;  3CSR A;  4EPI A;  4HSF A;  4TTD A;  3LZ2 A;  5II3 A;  3D9A C;  2ZNW Y;  4I7O A;  3LZT A;  1LHJ A;  1JSF A;  1G0Q A;  1GF4 A;  4MST A;  4LT1 A;  4TWS A;  4GBR B;  5KKI A;  5KXM A;  1LZD A;  1OVK A;  2EIZ C;  4DQ5 A;  3GUI A;  4I8S A;  2Z2F A;  3W6B A;  4WM2 A;  5ILC A;  1LZ1 A;  1CKG A;  1G1V A;  1VDS A;  3DN8 A;  4ETA A;  4H8X A;  1QS5 A;  1A4V A;  1FDL Y;  2Z39 A;  4H94 A;  2LHM A;  1JJ0 A;  1OV7 A;  4HJV A;  252L A;  4G4H A;  2ZYP A;  1F6R A;  1JIT A;  1D3F A;  1MLC E;  3HUA A;  4UWV A;  2LZ2 A;  1B7R A;  1RCM A;  1IOS A;  214L A;  1LYI A;  4DD7 A;  1KW7 A;  5IDD A;  1AM7 A;  1QTH A;  1GFV A;  1GAZ A;  4WO9 A;  1VDT A;  1D0L A;  3NY9 A;  1IY3 A;  2CDS A;  2WAR A;  1LJI A;  3HUQ A;  1I56 A;  3ULR A;  1L59 A;  2ZIJ A;  1GB9 A;  4Z98 A;  2RBQ A;  1NDG C;  1LTM A;  4AQN A;  1I6S A;  1LZ4 A;  1AT6 A;  1GF5 A;  1WQP A;  2DQI Y;  4WL7 A;  5LA8 A;  1C6C A;  166L A;  5APF A;  1RFP A;  2ZNX Y;  1QUS A;  199L A;  2FYD A;  1I20 A;  1NHE A;  2NTH A;  1XJT A;  1XGP C;  211L A;  5LVJ A;  1D3N A;  4TSC A;  4H9F A;  3TXE A;  171L A;  1IOR A;  1REY A;  1XSF A;  2BPU A;  1L98 A;  1XGU C;  4IAT A;  2QB0 B;  5LAF A;  2MEI A;  1LMC A;  4W59 A;  1L99 A;  1JUG A;  2DQF C;  1QTD A;  1XGT C;  4DKL A;  1FKQ A;  4PRU A;  4X3B A;  3V2W A;  143L A;  2LYM A;  5KXZ A;  3QE8 A;  1CTW A;  4WLX A;  1C6J A;  2IGC A;  4H9E A;  1LI2 A;  4CFO A;  5T3F A;  1L69 A;  103L A;  5KXX A;  4N1E I;  4LYT A;  1G7L C;  1WQM A;  1YIL A;  4NGL A;  4XJD A;  4LT3 A;  1CJ9 A;  3GXR A;  2BQI A;  2NTG A;  3G3A B;  4HTK A;  2OU0 X;  2LYO A;  1C45 A;  1ZUR A;  3LN2 A;  1CUP A;  1L54 A;  3W6C A;  1XEI A;  1L21 A;  1LSD A;  3HDF A;  244L A;  1GF7 A;  1Z55 A;  1L37 A;  1REX A;  1YAQ A;  1LZ5 A;  183L A;  1GBX A;  230L A;  1FLQ A;  3DN6 A;  3F9L A;  3G3X A;  4ETB A;  1LKS A;  3C80 A;  3BKV A;  6LYZ A;  1GBZ A;  3C7Y A;  4W51 A;  5HMV A;  3C8S A;  2I25 L;  4EPF A;  4CFP A;  1CVK A;  134L A;  2OE9 X;  3P66 A;  4DD0 A;  5LYM A;  1IR9 A;  1C66 A;  3WPL A;  2W1X A;  1PQI A;  1HEP A;  3SP3 A;  2OE4 X;  1C6P A;  1HFX A;  1L62 A;  4XJF A;  1YL0 X;  4LZT A;  1GD6 A;  1SQ2 L;  198L A;  187L A;  2BQO A;  119L A;  1B7O A;  1LJJ A;  4OOO A;  4A7D A;  1BB6 A;  144L A;  1L10 A;  1C62 A;  4FJR A;  120L A;  1LSN A;  158L A;  2EKS C;  1BB4 A;  1T8F A;  1AKI A;  1UAC Y;  1LZ8 A;  4MR1 A;  4H90 A;  5LVG A;  2NWD X;  256L A;  1LYD A;  1IIZ A;  3CQL A;  4G4C A;  4ARM B;  4DDC A;  1L80 A;  1C63 A;  5HLL A;  3NY8 A;  1BVK C;  2X0A A;  2MEF A;  4KPM A;  1I1Z A;  1QDR A;  1C6G A;  1HEM A;  3A3R X;  1B7N A;  258L A;  253L A;  1L88 A;  1LYJ A;  3BKH A;  3FI7 A;  3C83 A;  1LZE A;  1B6I A;  4CGE A;  2MEG A;  2RSC A;  2FBD A;  1D6P A;  2BQN A;  5F9X A;  1IWY A;  4XJG A;  5I14 A;  102L A;  149L A;  1L64 A;  4FDY A;  1B7P A;  1PQK A;  4LZM A;  4N9R A;  2B5Z A;  1C6I A;  1OVH A;  1LKR A;  5DN5 A;  1WQQ A;  2MED A;  1CU6 A;  1XGR C;  3AZ7 A;  1GB6 A;  4B49 A;  2DQD Y;  2RB0 X;  2XTH A;  1SSY A;  3DN2 A;  3AGI A;  3B0I A;  1LPY A;  1PQJ A;  1G7J C;  4H93 A;  1HHL A;  1IP4 A;  1B7S A;  1D2Y A;  3RW8 A;  2OEA X;  1DYA A;  4HV2 A;  2RB2 X;  5D5C A;  3RUN A;  1L49 A;  2F4A A;  4HP0 A;  1C6T A;  1WQR A;  3TXG A;  2GV0 A;  5KXK A;  1LMT A;  4WLT A;  1QUT A;  4O34 A;  2H9J A;  5APE A;  2OU9 A;  2FBB A;  1SWZ A;  3C82 A;  1HSX A;  3IWR A;  228L A;  2Z19 A;  4XJH A;  5LVK A;  4NGW A;  213L A;  1L15 A;  5C6J A;  1L30 A;  4ETD A;  1T8G A;  1LJE A;  3LHM A;  4NEB A;  1L24 A;  217L A;  4TSB A;  3N9E A;  2O79 A;  141L A;  2D4J A;  1LCN A;  3AJN A;  3W6A A;  4BAP A;  4DQ7 A;  3W6D A;  1UID A;  5E9R A;  2OU8 A;  3G3W A;  2BQC A;  232L A;  2RBO A;  3LYO A;  4OO9 A;  5I54 A;  2CWI A;  1WVV A;  259L A;  1L28 A;  1LLH A;  175L A;  1L48 A;  1L39 A;  2D4I A;  2EQL A;  3WXT A;  3WXU A;  2HEF A;  1PQO A;  1F10 A;  1B7L A;  1GFK A;  2MEC A;  147L A;  1L63 A;  1OUE A;  2HEE A;  236L A;  1DPX A;  3P65 A;  1YAN A;  5E4P A;  1LMO A;  4RLN A;  1L94 A;  5FCP A;  3AZ6 A;  181L A;  1LYE A;  1MEL L;  1CNS A;  4LDO A;  2A4T A;  1HFZ A;  1T6V L;  8LYZ A;  218L A;  4XAD A;  4II8 A;  4H9A A;  1ZWN A;  246L A;  2BQK A;  4XEN A;  4WG1 A;  4NG8 A;  126L A;  2XBS A;  1JTM A;  1EPY A;  4HPI A;  4R0F A;  3A92 A;  2ZIL A;  3C8Q A;  1L73 A;  1TLA A;  1XGQ C;  3A94 A;  1NF5 A;  3HT8 A;  1REM A;  4R6C A;  1CV0 A;  2CGI A;  2Y8P A;  3EO5 A;  4LFP A;  1BB5 A;  4EMN A;  1L71 A;  1DPW A;  1L58 A;  1BHZ A;  4IJ4 A;  1SSW A;  1OUG A;  3L2X A;  4ARQ A;  1LZG A;  2G4P A;  5KJ9 A;  1L26 A;  4E97 A;  3WUM A;  3WPJ A;  1UC0 A;  1L57 A;  107L A;  2MEB A;  2O7A A;  4ET8 A;  1EQ5 A;  188L A;  3PBL A;  3DN1 A;  4GCB A;  1GB5 A;  1DYG A;  4OWA A;  1N4F A;  3W6E A;  3WW5 A;  2LCB A;  1D0K A;  1QTE A;  2YBH A;  3P64 A;  172L A;  1OUJ A;  4EOF A;  2DBT A;  223L A;  1GF0 A;  4ZIX A;  1D3M A;  3K3T A;  1L17 A;  3GUO A;  3RNX A;  4OWC A;  4GN4 A;  3WU8 A;  4YEM A;  3V2Y A;  1OVJ A;  1G7M C;  4NGO A;  4NWH A;  1C43 A;  129L A;  4B0D A;  1L06 A;  1DZB X;  4NGJ A;  4NWE A;  1LYF A;  1LYS A;  1PS5 A;  1CKH A;  1QTZ A;  4HJZ A;  3DN0 A;  1UIC A;  1LYH A;  1ZYT A;  2YSS C;  1ZMY L;  5L9J A;  2F4G A;  5IHG A;  4WMG A;  1OUD A;  1T3P A;  2A7F A;  1WTM A;  5DM9 A;  1G7H C;  248L A;  155L A;  4GCD A;  3A8Z A;  1P2L A;  4Z41 A;  1GBW A;  4Z3M A;  1CU0 A;  1L96 A;  3CSZ A;  5KXT A;  4WM6 A;  112L A;  3N9A A;  3WVX A;  2W1M A;  5FEK A;  4NG1 A;  4I7N A;  1L47 A;  262L A;  1G0J A;  4NSG A;  4H9I A;  3GUL A;  1C6M A;  3RZ4 A;  1W08 A;  1QSB A;  1GFT A;  1NHB A;  3TMX A;  3ZVQ B;  5FEL A;  2Z12 A;  1LHK A;  109L A;  1GFJ A;  240L A;  4W52 A;  3CDT A;  4BAF A;  4S0W A;  2B6X A;  3HH4 A;  4K5Y A;  1LJN A;  5DL9 A;  138L A;  1OUA A;  2HEB A;  1GFU A;  3RT5 X;  174L A;  2BQB A;  1C10 A;  1C6B A;  3N9C A;  1JJ3 A;  4LYZ A;  3KAM A;  1UBZ A;  5J7C A;  4LYB A;  4YOP A;  4C3W A;  2RB1 X;  4NSH A;  4I7T A;  1FLU A;  1HEO A;  4DD9 A;  5C6L A;  2HEA A;  3A67 Y;  1OV5 A;  3FI5 A;  2B7X A;  2DQG Y;  201L A;  1L25 A;  2Z18 A;  3WW6 A;  153L A;  2RAZ X;  1G07 A;  3A3Q A;  3HUK A;  2BQL A;  3SB8 A;  1BWJ A;  4YEO A;  5A3Z A;  1GB8 A;  1IP1 A;  1GBY A;  4AGA A;  3AGG G;  4I7P A;  1KIP C;  1GF9 A;  1GBO A;  4QGZ A;  1XJU A;  2B6Z A;  1RI8 B;  4BAD A;  1L89 A;  4H9C A;  206L A;  3LYT A;  4DD2 A;  1KNI A;  1QUD A;  170L A;  1JQU A;  2D6B A;  1L35 A;  1L97 A;  1D9W A;  2ZQ3 A;  2XQO A;  2ZYC A;  4IAP A;  3HTF A;  1C61 A;  178L A;  1GEZ A;  1VDQ A;  212L A;  3CT0 A;  5LVH A;  3WUA A;  1CV1 A;  1IOT A;  1GB0 A;  4ML7 A;  3HU9 A;  1JIY A;  1QTK A;  177L A;  3OK0 A;  4PK0 A;  5IEL A;  1JTP L;  1QT3 A;  3WH1 A;  1G7I C;  5LZM A;  1L44 A;  1QSA A;  216L A;  5I4Y A;  2B6T A;  3GXK A;  3SB9 A;  3IJV A;  4ARL A;  1W6Z A;  1C6L A;  2DQJ Y;  1DI4 A;  1YL1 X;  1TDY A;  1BWH A;  140L A;  4U3X B;  242L A;  4C5F A;  4J1A A;  4YEN A;  1TCY A;  1UIG A;  1YIK A;  4LYO A;  4RW1 A;  1GF6 A;  3HH6 A;  3M3U A;  4EKR A;  3TMU A;  1CX7 A;  3CB7 A;  4GCE A;  2HUK A;  6LYT A;  1IVM A;  2O4W A;  2DQA A;  1OUB A;  1CV5 A;  5KXN A;  1GXX A;  1C67 A;  4Z46 A;  1D6Q A;  4DDA A;  3C81 A;  2F2N A;  5I53 A;  4NHT A;  238L A;  4NSI A;  2ANX A;  5KKJ A;  1L0J A;  1B5Z A;  142L A;  2LC9 A;  1L46 A;  2I6Z A;  1GEV A;  4EKP A;  3D3D A;  3CDO A;  4ARJ A;  1J1X Y;  3HTD A;  1YAP A;  2HUL A;  3JR6 A;  4DT3 A;  1L11 A;  3GUM A;  1LJH A;  1L65 A;  1L60 A;  2B72 A;  1KW5 A;  5APD A;  207L A;  4NGK A;  2HU3 A;  1L55 A;  4LFX A;  1IWW A;  2RH1 A;  1KS3 A;  3GUK A;  1L14 A;  1B5Y A;  2BQA A;  1NDM C;  1LWG A;  245L A;  4QY9 A;  1L16 A;  1UUZ C;  1V7S A;  5LAG A;  4QDN A;  2ANV A;  159L A;  1IC5 Y;  3GUJ A;  1HC0 A;  3HTB A;  6LZM A;  1GBS A;  2B75 A;  4H91 A;  2CJL A;  1CUQ A;  4OW1 A;  4NGV A;  1QUG A;  4ZFP A;  1LGW A;  1C6F A;  3GUP A;  191L A;  1LZT A;  1B0D A;  237L A;  205L A;  151L A;  1HF4 A;  1UA6 Y;  1UIF A;  208L A;  241L A;  3AZ5 A;  2I26 L;  1GHL A;  1G0L A;  2Z2E A;  5B07 A;  3HT7 A;  3DN4 A;  2RBR A;  4NHI A;  1GFE A;  1B5X A;  4HTQ A;  3SB7 A;  1CV3 A;  1CU5 A;  2C8O A;  5LIO A;  1IX0 A;  4TUN A;  2Z6B A;  3M18 B;  1D0M A;  4YX7 C;  135L A;  1GB7 A;  1PQD A;  4PHI A;  3WU9 A;  3WPK A;  1KY1 A;  5KXW A;  2BAA A;  4H8Y A;  4W56 A;  1BB7 A;  5I4W A;  5LXW A;  4EJ4 A;  1C6N A;  1QDT A;  3P4Z A;  4GLA A;  4DJH A;  197L A;  4OWH A;  5LYZ A;  1L90 A;  139L A;  4W57 A;  2YBJ A;  1P6Y A;  255L A;  1FN5 A;  1LGX A;  1P7S A;  3WVY A;  2BQM A;  1SLY A;  2HEC A;  1GWD A;  2HU1 A;  3EMS A;  1L38 A;  4WM1 A;  1UIB A;  3HT9 A;  1P56 A;  247L A;  4I7S A;  1DQJ C;  1L31 A;  4P2E A;  3SN6 R;  1L29 A;  3CDR A;  3F6Z A;  5HQ1 A;  137L A;  1OP9 B;  4XYY A;  2H5Z A;  2DQE Y;  4I7M A;  5KXO A;  1GFR A;  4OOT A;  1L08 A;  1RJC B;  3DNA A;  2HUM A;  2YVB A;  1GE0 A;  1INU A;  4NGY A;  4H9B A;  3WUL A;  1IC4 Y;  4LGK A;  2F2Q A;  195L A;  3TXJ A;  3HWL A;  1L20 A;  2B74 A;  2YDG A;  189L A;  229L A;  3DMV A;  3UON A;  4DDB A;  5KXP A;  1IWX A;  1DYB A;  2A7D A;  4PPO A;  4NFV A;  3A6B Y;  1AZF A;  3HU8 A;  3SBA A;  3ZEK A;  2Z37 A;  4I0C A;  3GUN A;  3A90 A;  1L70 A;  1CU3 A;  1WTH A;  2YBM A;  1LPI A;  4N0J A;  3SB5 A;  2Z38 A;  243L A;  127L A;  235L A;  3TXF A;  1QT7 A;  1AT5 A;  4H92 A;  1YQV Y;  4BS7 A;  2F47 A;  1L86 A;  1IOQ A;  1C6A A;  130L A;  3E3D A;  2HUB A;  4W94 A;  1LSZ A;  1L41 A;  1L05 A;  3VWO A;  1L02 A;  4YXC A;  4KT3 A;  3G3V A;  4KL7 A;  4QEQ A;  1O23 A;  2LZM A;  1C6K A;  1D2W A;  221L A;  2MEA A;  3HFM Y;  215L A;  1YAO A;  4ARP A;  4HJY A;  1IOC A;  3WMK A;  224L A;  1LHI A;  1G0M A;  1JHL A;  1QT8 A;  4ZEE A;  2OE7 X;  3HBD A;  1DYD A;  111L A;  1IWT A;  110L A;  4NHS A;  239L A;  1OYU A;  1LZ6 A;  4RDS A;  2XJW A;  3TXK A;  5D5F A;  1WTN A;  1CJ6 A;  4PRQ A;  1JTT L;  165L A;  104L A;  3D4S A;  3HH5 A;  4WL6 A;  5AMY A;  3WU7 A;  1BWI A;  1H6M A;  1GE4 A;  1L81 A;  2YBN A;  108L A;  1JSE A;  1YRO A;  131L A;  1JKD A;  2N5Z A;  2RBN A;  3A95 A;  3W6F A;  1YKZ X;  1IP6 A;  2YBI A;  1QSQ A;  3OJP A;  1C68 A;  1YAM A;  3HBE X;  1L04 A;  1CJ8 A;  1DYC A;  5APC A;  1OQM A;  1VAU A;  1C60 A;  3AB6 A;  209L A;  1KXW A;  164L A;  1GPQ C;  1CX6 A;  1RE2 A;  2MEE A;  4G49 A;  4I7J A;  1TEW A;  5DLA A;  169L A;  1P2R A;  4H9H A;  4DD1 A;  4B4E A;  1HSW A;  1UIH A;  1G0K A;  4ANR A;  184L A;  5A3E A;  3QY4 A;  1T6H A;  4ZPU A;  1DXJ A;  5KXR A;  1GE1 A;  5B1F A;  1EQE A;  3RU5 A;  3WUN A;  249L A;  1LZA A;  1UIE A;  1NWG A;  1PZY A;  5FHW A;  5LVI A;  3IJU A;  1H87 A;  3B6L A;  222L A;  1JTN A;  1L32 A;  4KXI A;  1L07 A;  1OWY A;  1SX7 A;  1LYG A;  1HFY A;  1L56 A;  2BQF A;  260L A;  2HED A;  1DI3 A;  1G06 A;  1L68 A;  3EML A;  1CKD A;  5KXL A;  1J1P Y;  190L A;  4G9S A;  4NIJ A;  1L12 A;  1B5U A;  4YM8 A;  4ARQ B;  2VB1 A;  3DN3 A;  3AW6 A;  225L A;  1VED A;  2MEH A;  185L A;  1VDP A;  4N1C C;  1L40 A;  1XFP L;  4EKS A;  2RBP A;  2BLY A;  173L A;  1L85 A;  4IAS A;  4OWE A;  1IP3 A;  1XEP A;  5FST A;  1LJ3 A;  1L72 A;  3HBH A;  1L22 A;  1LI6 A;  5I5Q A;  2RAY X;  1LHL A;  3VW7 A;  5LIN A;  3C8R A;  4M4O A;  5L3H A;  150L A;  1HML A;  5F81 A;  2D91 A;  3AGH A;  4I7R A;  182L A;  3FE0 A;  4UWN A;  4CHX A;  194L A;  1FBI X;  4ET9 A;  1LMP A;  3ODU A;  1QT6 A;  1ZVY B;  115L A;  4MCK A;  1NMM A;  4CJ2 A;  1P37 A;  2IFF Y;  118L A;  1B2K A;  1L36 A;  4WLD A;  1KY0 A;  4DC4 A;  1IR7 A;  1QUH A;  3J6K A;  1L76 A;  250L A;  4I7Q A;  1L95 A;  5B59 A;  1OUI A;  1GB3 A;  1FLW A;  5HNC A;  5HNL A;  2IHL A;  1EQ4 A;  1HEW A;  4B1A A;  3A93 A;  4B4I A;  3W3E A;  1SWY A;  4PJ2 C;  1HEQ A;  4OWB A;  1CV4 A;  1IP7 A;  152L A;  1L91 A;  2W1L A;  4WM4 A;  210L A;  5LYT A;  1L33 A;  1LSB A;  1P36 A;  3LYM A;  2OTY X;  4WM3 A;  2BLX A;  1IR8 A;  1L74 A;  1WVU A;  2BQE A;  4D9Z A;  1JTO L;  3K2R A;  1GFA A;  180L A;  1DYE A;  1LZB A;  4XJB A;  1LZS A;  1IEE A;  1J1O Y;  1LSC A;  1GF3 A;  4LT2 A;  1LJK A;  1JKB A;  3QNG A;  3TXI A;  1JPO A;  4ARM A;  4EKQ A;  1LMQ A;  4NGZ A;  4XJI A;  1L67 A;  2HTX A;  1B9O A;  2C8P A;  1KIQ C;  2Q9D A;  1VAT A;  1LOZ A;  1KIR C;  5ILF A;  4N5R A;  1HMK A;  1L61 A;  1KXX A;  5DN4 A;  4H1P A;  1LMN A;  3EBA B;  4J1B A;  2Q0M X;  1OUH A;  3A34 A;  3HT6 A;  1LYZ A;  1G0P A;  5F9U A;  1L83 A;  1NBZ C;  2DKV A;  4WOA A;  1C08 C;  2BQH A;  1CKF A;  1IC7 Y;  3L64 A;  3MGW A;  1LJF A;  1WQO A;  4W55 A;  1EL1 A;  4YF2 A;  148L E;  4WG7 A;  1LGU A;  233L A;  192L A;  1F6S A;  1C6Q A;  2XBR A;  1L23 A;  1D9U A;  1L53 A;  5B06 A;  193L A;  1D3J A;  1NKH A;  1L66 A;  4W58 A;  4PGJ B;  1L00 A;  1QS9 A;  4UWU A;  4J0L A;  1CJ7 A;  4NSJ A;  1VFB C;  4GCC A;  1QUO A;  231L A;  3CT5 A;  1HEL A;  2ZIK A;  1L87 A;  1L52 A;  1K28 A;  1GE3 A;  1GB2 A;  1B5V A;  5FDJ A;  1P2C C;  3PDS A;  1GF8 A;  1LHM A;  2BQG A;  1C46 A;  3CDV A;  1LSF A;  3FAD A;  3NYA A;  1LZ9 A;  1LSY A;  1L09 A;  1LZY A;  1F0W A;  2F32 A;  2Q9E A;  1JWR A;  1T97 A;  1LAA A;  200L A;  161L A;  4LDE A;  254L A;  4DAJ A;  4WO6 A;  5F16 A;  1DYF A;  1SX2 A;  5M1Y A;  1IP5 A;  4DQJ A;  1QSW A;  1C7P A;  1DI5 A;  2RBS A;  3A96 A;  2OTZ X;  3CSQ A;  1KXY A;  4GRV A;  4W54 A;  1JJ1 A;  1ZV5 L;  1LI3 A;  2LZT A;  4DYG A;  1LMA A;  2B6W A;  234L A;  4LYM A;  2L78 A;  4L41 A;  3ATN A;  1CV6 A;  1QT5 A;  4HTN A;  168L A;  1BQL Y;  1LSM A;  1LZR A;  4NGI A;  3EXD A;  5JEN B;  1L50 A;  3TXB A;  3A6C Y;  4EXM A;  3SB6 A;  145L A;  4LYC A;  1T8A A;  3TMV A;  4WLY A;  1HER A;  1C6E A;  1B7M A;  1G0G A;  4GLV A;  5F14 A;  4HV1 A;  1HEN A;  3P68 A;  1LHH A;  113L A;  2QAR C;  1L03 A;  1LZN A;  4ETE A;  9LYZ A;  3C7W A;  1L42 A;  3AW7 A;  3A91 A;  3ATO A;  1LSA A;  3AYQ A;  1QTC A;  4GCF A;  2DQC Y;  1FKV A;  1UIA A;  3FA0 A;  162L A;  4HPE A;  1L01 A;  3LZM A;  1QIO A;  1L45 A;  1REZ A;  5K7O A;  2AUB A;  1L34 A;  3C7Z A;  2B6Y A;  157L A;  1NBY C;  4DWX A;  3B0O A;  125L A;  5LA5 A;  4LDL A;  1C69 A;  1V7T A;  3TXH A;  4H8Z A;  2ZQ4 A;  3B0K A;  1IP2 A;  1A2Y C;  1DKJ A;  4I7L A;  3T6U A;  1TAY A;  1GDX A;  4PJZ A;  1YKY X;  1LSG A;  1E8L A;  7LZM A;  1L92 A;  4W96 A;  1G1W A;  128L A;  3TMW A;  4NHQ A;  1BVX A;  1YKX X;  3OE6 A;  2G4Q A;  1GAY A;  160L A;  163L A;  1L0K A;  4N8Z A;  1FLY A;  1XEK A;  1LYY A;  2F30 A;  3OE9 A;  186L A;  2D4K A;  4RW2 A;  226L A;  2DQH Y;  122L A;  3HH3 A;  1ZVH L;  1L77 A;  2W1Y A;  1C6D A;  1L75 A;  1GFG A;  4AXT A;  1PQM A;  1CU2 A;  3DMX A;  132L A;  3OE0 A;  1L18 A;  1LWK A;  5B1G A;  3LYZ A;  1L93 A;  5KXS A;  5HMJ A;  1C64 A;  1OUF A;  3SBB C;  4XN6 A;  2G4N A;  5C6I A;  1IO5 A;  1BGI A;  154L A;  3HTG A;  261L A;  3WL2 A;  1TBY A;  176L A;  1L19 A;  1P3N A;  1HNL A;  220L A;  2YBL A;  1BB3 A;  1LSE A;  1IY4 A;  1L84 A;  2BQD A;  4I7K A;  4W53 A;  3DKE X;  146L A;  4J7V A;  3J4G A;  1JKC A;  251L A;  156L A;  1GE2 A;  1LSP A;  3DMZ A;  1L82 A;  257L A;  2ZWB A;  4NY5 A;  1QTV A;  1JEF A;  3T36 A;  1QTB A;  3F8V A;  3QAK A;  5I4X A;  1GFH A;  2LYZ A;  2B73 A;  1C6H A;  3CT1 A;  1DKK A;  1B7Q A;  1L27 A;  1IWU A;  4ETC A;  4RLM A;  1P46 A;  3TXD A;  1LZC A;  5B05 A;  4M6D A;  5KXY A;  1P64 A;  1IWV A;  1JIS A;  196L A;  1XEJ A;  1QQY A;  1L79 A;  1ALC A;  4DD3 A;  1QT4 A;  219L A;  1L51 A;  4TX7 A;  5KY1 A;  1OWZ A;  3ZVQ A;  1L43 A;  7LYZ A;  1UCO A;  4B4J A;  1CKC A;  1P5C A;  2CUU A;  4GN3 A;  123L A;  1LW9 A;  3WYH A;  2B70 A;  1B5W A;  2EPE A;  5EBH A;  3CDQ A;  3AZ4 A;  1GXV 2;  114L A;  1LYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...