1QDTA

2.1 a resolution structure of escherichia coli lytic transglycoyslase slt35 in complex with calcium
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdtA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdtA02
1YROA 5DL9A 1OUGA 4DWXA 1CJ8A 3N9AA 4G4BA 4NSIA 2BQAA 4OWBA 5EBHA 4NGIA 2BAAA 1GFAA 5LYTA 1FN5A 2HEBA 5KXPA 2HEDA 5L3IA 2F4AA 3F6ZA 1GFEA 1JJ1A 1G7HC 1GB3A 4FDYA 5LA5A 4RDSA 4TSBA 1EQEA 4O34A 1AT5A 4NHIA 1QQYA 2BQNA 3A6BY 4LYOA 1HEOA 1HEWA 4XJDA 1GF5A 4UWNA 1GB8A 1LHJA 4YENA 2CGIA 2YDGA 1C08C 5C6JA 2F2NA 5B1GA 1UIFA 1REMA 2AUBA 3HBEX 1GF8A 2HTXA 1GXXA 5E9RA 5I53A 4HPIA 1B5XA 2XJWA 4GCFA 1LSDA 4NSHA 5LIOA 1NDMC 1UIEA 1WQRA 4MCKA 4DD3A 4DT3A 1F6SA 1LMOA 1XGPC 4OWCA 1JKDA 2X0AA 5KXXA 1IWYA 4DD7A 3IJVA 1HEPA 3A92A 2LHMA 1XGUC 3BKHA 3ZVQB 1KXYA 4GN5C 2DQAA 1OUBA 1UIAA 3AGIA 4EMNA 1B9OA 1CKFA 3WH1A 4LFXA 3A3RX 4ET9A 2ZILA 4GN3A 4AGAA 1IWWA 2BQFA 1NDGC 5I4WA 1GBOA 3A93A 2ZIKA 1HEMA 1NWGA 1C7PA 2YBNA 3IJUA 4NSGA 1OUDA 2Z38A 3W6FA 4YF2A 5K7OA 1JSEA 1IR8A 5B05A 3CSZA 2DKVA 2EIZC 3EXDA 1OP9B 1IWZA 1FLQA 1GFKA 4HSFA 1IR7A 1WTNA 1B0DA 5KKIA 1LYSA 1GBSA 1WQQA 4J1AA 1LJKA 4KT3A 1LKSA 1GE4A 4P2EA 1IIZA 2MEIA 4DC4A 1QUTA 1OUEA 4PGJB 3WXTA 1N4FA 3FI7A 2BQDA 3TXBA 1REYA 5HLLA 4J1BA 4UWUA 3LYZA 3A3QA 4H93A 1GFUA 1QSAA 1HSXA 5LA8A 1LZYA 4B4IA 1WVVA 1IWXA 3P65A 5I4XA 1IVMA 1WVUA 3B0OA 4WM1A 1LZRA 1HMKA 2LYMA 1B7QA 1B7PA 1LSGA 2BQLA 5KXTA 1B5VA 1C10A 207LA 4AXTA 4ANRA 1GFRA 2HECA 1LZNA 134LA 3N9CA 3LYOA 4HPEA 4HTKA 5B1FA 3P66A 4TUNA 5F81A 4MR1A 4XJHA 3TXIA 3ZEKA 1FBIX 2BQJA 3W6EA 1MELL 1UA6Y 3B0IA 5LAGA 5IELA 4CFPA 1IR9A 4NGKA 4NY5A 1EL1A 4NG1A 1AZFA 4N0JA 3LHMA 5KXYA 193LA 1UIBA 1IC5Y 5KJ9A 1RI8B 1UIHA 1CKGA 3GXKA 2MEEA 4GLAA 1RCMA 1NBYC 5KKJA 2W1LA 4PRQA 5L9JA 1QDRA 1JKCA 4YEOA 1KIQC 3P64A 4RLMA 1D0KA 1LHIA 4YOPA 5HMVA 1QUSA 4KL7A 1REXA 5HQ1A 3AGGG 2MEBA 2H9KA 4IJ4A 2YBHA 3KAMA 1ALCA 4NSJA 1LSPA 5APEA 1F10A 5LVHA 1YKXX 3J6KA 1LHHA 1H87A 1GE2A 1JKBA 1GFHA 1INUA 1JPOA 4WM4A 4A7DA 1LZ1A 1XEKA 4DDCA 1GF6A 4IASA 4WMGA 132LA 3QE8A 3TXFA 1B7NA 1UC0A 2YBMA 1F6RA 3WU9A 1B7RA 5KXKA 1GBZA 2Z19A 4B1AA 1LZ6A 1EQ4A 1GBXA 3AZ6A 5B07A 4ETCA 1IX0A 2C8OA 1XEJA 5FDJA 5ILFA 4N1EI 1BB3A 1I56A 2XBSA 1AKIA 4FJRA 5DLAA 4RW2A 1LHMA 3AJNA 1VATA 1BB6A 1GF9A 3WW6A 3T6UA 4ETAA 3WYHA 4N8ZA 3B0KA 5LVIA 3WL2A 4LYZA 1LMCA 4B49A 2MEFA 4R0FA 1KXWA 4NIJA 2D4IA 4IATA 1JISA 1LYYA 2H5ZA 1LMPA 4XADA 2G4QA 1HFYA 1BHZA 1LJFA 2A7DA 4GN4A 4WM6A 4NWHA 7LYZA 4H9EA 2F4GA 1VDSA 2Z18A 1DI4A 3G3AB 1FLWA 1IOCA 2VB1A 2LZ2A 1TEWA 2Z12A 5F9XA 2D6BA 1HSWA 1BWJA 5I4YA 153LA 4XJGA 1IP7A 1T3PA 4G9SA 1LKRA 4ZIXA 1LPIA 1LZTA 1LJGA 1JEFA 1YILA 4MSTA 3BKVA 1IP2A 4WL6A 1TBYA 3A6CY 1KXXA 3WPKA 4H8ZA 2HEEA 3HBHA 5LVGA 4DDAA 3AW6A 3AGHA 3AZ4A 3N9EA 1HERA 2BQKA 2PC2A 4LYBA 3ZVQA 4HTNA 4LT3A 5B06A 4HTQA 2Z37A 4H90A 1GFJA 2YBIA 1GHLA 4XYYA 3LZTA 3FE0A 1D0MA 4XJFA 5HNLA 3WUMA 4C3WA 1HEQA 9LYZA 3E3DA 4J7VA 1B5UA 4ET8A 2DBTA 4C5FA 1LMQA 1LMNA 2EKSC 4HJYA 1QSWA 1MLCE 4WG7A 1ZVHL 5AMYA 1E8LA 1YIKA 5LAFA 4LYMA 4WLTA 1LMTA 1G7JC 1LTMA 1OUJA 1RJCB 2YVBA 4GCCA 2C8PA 2BQBA 1OUCA 3WULA 1SQ2L 1PZYA 3TXKA 1NMMA 1JTTL 1LCNA 1H6MA 1FDLY 4GLVA 1IP6A 4OOOA 4TX7A 4XENA 2W1XA 1LSFA 5D5CA 1W6ZA 2ZQ4A 5LVJA 1DZBX 5T3FA 2MEDA 4H9CA 4DD0A 4ZFPA 2BLYA 1JTPL 3A91A 1VDQA 4WLYA 1I20A 5I5QA 1ZVYB 4ETEA 2H9JA 4OWHA 5DM9A 1J1OY 2WARA 1LZEA 2A7FA 1BB5A 1IEEA 3B6LA 3TMUA 3P4ZA 4N5RA 4B0DA 2BQHA 1JSFA 4WO6A 3TXJA 1XEIA 2Y8PA 1V7SA 4LYCA 1GB7A 4ZEEA 4LZTA 5LYMA 1XGRC 1IWVA 1G7LC 1CKHA 3TMWA 3VWOA 1IY4A 1GB9A 1KIPC 2XBRA 1GEZA 2BPUA 3MGWA 1GB2A 1YQVY 2FBDA 5FELA 1HENA 1WQMA 1B2KA 2D4KA 3WU8A 4YM8A 1UICA 1YAQA 1IP1A 4H9HA 4NGVA 1BQLY 4H9AA 1YKYX 1D6PA 1A2YC 6LYZA 1LSZA 4OWEA 5KXLA 3TMVA 1F0WA 1AT6A 1LZCA 2MECA 2NWDX 4H94A 2Q0MX 2XTHA 1LZBA 5I54A 5B59A 3CT1A 5HMJA 2YBLA 3LZ2A 8LYZA 4WM5A 2IHLA 1B5WA 3HFMY 1JWRA 3P68A 4H91A 5DN4A 1CJ9A 1FKQA 1Z55A 5KY1A 1GEVA 5LINA 1BWHA 2MEHA 3EMSA 3A90A 1UUZC 1I1ZA 2B5ZA 3A94A 4ML7A 5APCA 1GFVA 1HHLA 1LSBA 2N5ZA 3ATNA 2EQLA 1LZ4A 1BB7A 3RZ4A 1DPXA 1B5YA 4N9RA 2HEFA 4D9ZA 4NG8A 1C46A 1BVKC 1IC7Y 2Z2FA 4DD2A 2BLXA 3AZ5A 1YANA 1IP5A 4HV2A 4BAPA 1LJJA 1B7MA 1CJ6A 1YL0X 2CWIA 2Z2EA 1BGIA 3A34A 4B4JA 1GB5A 5KXSA 1IORA 154LA 2CJLA 4NGLA 4YEMA 4NGZA 3D3DA 3AZ7A 1P2CC 1NHEA 4DDBA 3WUNA 4WM3A 1LJEA 4LFPA 1T6VL 1XSFA 1HF4A 3D9AC 1XGQC 3QY4A 2DQEY 1YAOA 2DQGY 4Z41A 5F9UA 3IWRA 2ZNXY 2LYOA 3ATOA 1LSMA 1VDTA 2I6ZA 5KXZA 4HJVA 4G49A 1CNSA 1B7SA 5KXOA 1JJ0A 3A96A 4H8YA 4XN6A 1LJ3A 1GF0A 3A67Y 1VDPA 3EBAB 4H9BA 5LVKA 3TXGA 5FSTA 2G4PA 3AB6A 4ETDA 1NBZC 5LXWA 2DQJY 4NHSA 4NHQA 1BWIA 2HU3A 3LN2A 4BAFA 1JHLA 1D9UA 1OQMA 1YL1X 2BQGA 3TXDA 4TTDA 3TXEA 4DD1A 5A3ZA 5J7CA 1CKCA 1GDWA 3CB7A 4X3BA 5ILCA 1NQIA 3WMKA 1IWUA 1GF7A 4XJIA 4NHTA 1UCOA 1D0LA 2ZYPA 4PJ2C 1DXJA 3ULRA 1VEDA 1G7IC 3CSRA 5DN5A 3W3EA 2BQOA 1DI5A 1IOQA 5F14A 2HEAA 4L41A 1LAAA 1LZGA 4HP0A 1TAYA 4WOAA 1HFZA 4NWEA 2IFFY 1LJHA 4NGWA 4J0LA 1GWDA 1AM7A 1IO5A 1VAUA 2HU1A 2DQCY 4R6CA 4WO9A 5FEKA 3SP3A 4NEBA 3W6DA 4HV1A 1LJIA 2MEAA 3J4GA 5C6IA 1WQOA 1JJ3A 1LSNA 1CJ7A 1LMAA 1LSCA 1DKJA 3CSQA 3OK0A 1YAPA 2D4JA 1IP4A 1GD6A 2BQEA 2FBBA 4QGZA 3RNXA 4E3UA 1LSYA 1DPWA 3B72A 1LSEA 4II8A 1GBYA 2EPEA 1WTMA 4OWAA 3A8ZA 5L3HA 5JENB 1GE1A 4QDNA 208LA 2ZIJA 4NGYA 5KXNA 4CJ2A 4CFOA 1LJNA 1LZAA 4PRUA 1LZ5A 3WVXA 3W6AA 1GXV2 1QDTA 1YAMA 4UWVA 4RLNA 4WM2A 5LYZA 4H1PA 3RU5A 4W94A 1GF3A 4WLXA 4W96A 1LZDA 5A3EA 1GBWA 1CKDA 3A95A 2DQIY 1JKAA 1OUAA 1HMLA 1REZA 3LYTA 3RT5X 2I26L 2BQIA 3WPJA 1WQNA 1JUGA 3M18B 1HELA 4I8SA 1IOSA 4KPMA 4NGOA 1IP3A 1LHKA 2DQHY 4TSCA 4Z46A 2BQCA 1LJ4A 1GAZA 2ZWBA 1GFTA 1UACY 1NF5A 3CT0A 5FHWA 5HNCA 3T36A 1B7LA 1LZ8A 1J1PY 5APFA 1IY3A 2HUBA 1G7MC 1PS5A 4XJBA 1O23A 4WG1A 1DKKA 3AW7A 1LYZA 2D91A 1D6QA 1JIYA 5IDDA 3TMXA 4H9FA 4CHXA 5C6LA 2BQMA 3WW5A 1A4VA 1GE3A 3QNGA 1SLYA 1UBZA 4LYTA 1C43A 1LZSA 4N1CC 4QEQA 4B4EA 4DD9A 1BB4A 5II3A 4BADA 4Z3MA 2GV0A 4NGJA 3WVYA 1QIOA 1QTEA 2DQFC 1J1XY 133LA 1XFPL 1ZV5L 4G4CA 1OUHA 4HJZA 4KXIA 4QY9A 1C45A 2MEGA 1WQPA 3CT5A 4CGEA 1RE2A 1GDXA 2I25L 3TXHA 4EOFA 2LZTA 2W1MA 4OW1A 3G3BB 4NFVA 3WXUA 4GCEA 3CQLA 4LT2A 1KIRC 1FLYA 2Z39A 3GXRA 1LOZA 5E4PA 1GAYA 4WLDA 2W1YA 2YBJA 3AYQA 2LYZA 4H8XA 1LHLA 1UIDA 1GB0A 1NKHA 2G4NA 1LZ9A 4U3XB 3WU7A 5KXMA 1GPQC 3HBDA 3WPLA 3WUAA 3LYMA 5FCPA 2CDSA 4BS7A 5IHGA 1DQJC 2F30A 2FYDA 3M3UA 6LYTA 1JITA 4OOTA 4DYGA 2ZYCA 4WL7A 1B5ZA 4G4HA 4ETBA 2ZQ3A 2DQDY 1GF4A 4TWSA 1LSAA 1ZMYL 4PHIA 1IC4Y 1UIGA 1TDYA 1HC0A 4H9IA 5D5FA 4M4OA 1TCYA 1XGTC 1B7OA 2YSSC 1LYOA 1YKZX 1EQ5A 1OUIA 4H92A 5M1YA 3K3TA 194LA 1DI3A 5KXRA 4LT1A 1QTKA 3EO5A 4PPOA 1JTOL 1GE0A 4Z98A 4GCBA 4RW1A 4M6DA 2RSCA 4I0CA 1GFGA 135LA 1IWTA 1HFXA 1RFPA 1VFBC 1FLUA 5APDA 2ZNWY 5F16A 1V7TA 1FKVA 3W6BA 5KXWA 4GCDA 2FYCA 1IOTA 4LT0A 1GB6A 1W08A 1BVXA 4LGKA 1OUFA 3OJPA 4NHPA 3RW8A 1HNLA 3W6CA
chains in the Genus database with same CATH superfamily
1CU2A 3GUJA 1ZAEA 4DWXA 4W5WA 1QUDA 2BQAA 2FH0A 2L7IA 2WSCF 2RBRA 1L98A 4NGIA 2Y21A 3K9OA 2W82A 4DR6M 1C68A 1QS5A 2F4AA 1SXJE 1JJ1A 1G7HC 5LA5A 4O34A 1AT5A 1QQYA 1QS9A 1L10A 1HEWA 1D2WA 4W55A 5KPTA 2YDGA 148LE 2F2NA 3UZUA 4DQ7A 5I53A 2JY5A 1B5XA 201LA 4GCFA 3GPPA 1UIEA 4JV5M 1F6SA 4OWCA 2O01F 3SASA 1N33M 1IWYA 3IJVA 1UM8A 3FTCA 1R2ZA 2KNAA 1UIAA 3AGIA 1B9OA 1CKFA 1L53A 142LA 2Z6BA 2ZILA 4AGAA 4QNRA 3A93A 2ZIKA 3GRVA 1C7PA 3W6FA 5K7OA 2DAMA 5B05A 3CSZA 122LA 3VDPA 1CTWA 1QAMA 1W5SA 1LYSA 1L05A 1GBSA 1LKSA 1GE4A 1N4FA 1D3NA 3TXBA 4J1BA 4UWUA 3LYZA 4F1IA 4H93A 1L30A 1QSAA 1CV6A 4B4IA 1WVVA 1XC8A 3FRHA 3C58A 5ITYA 4I7TA 3JAMS 1DV0A 3CDOA 1B5VA 248LA 4AXTA 1LYHA 4HTKA 1SXJA 7CATA 3UJNA 249LA 4XJHA 3AOGA 2BQJA 3W6EA 3I4YA 1UA6Y 4CGYB 4RF0A 5IELA 4CFPA 2DWMA 4NG1A 1D2NA 1IFYA 3LHMA 5KXYA 3V2WA 1UIBA 1KYIA 3BXWA 1RI8B 2B6YA 3KS4A 4EKQA 5KKJA 5DYGA 4M9SA 5L9JA 1JKCA 4DUYM 1C6KA 1D0KA 5HMVA 4LJ5A 1T97A 227LA 141LA 3SMPA 1QUOA 5HQ1A 4I7JA 3HT7A 3DNAA 2MEBA 4IJ4A 3GUPA 3KAMA 2RH1A 4LFBM 1P6YA 2LH0A 1H87A 5IWAM 3J6KA 4WM4A 2XSZD 1INUA 3C80A 1XEKA 5IZ7D 5DYIA 1QYRA 132LA 4RNAA 3TXFA 226LA 1P2RA 166LA 213LA 5B07A 1IX0A 1XEJA 2NTHA 3NY8A 1KY1A 1L73A 1LHMA 4JN6A 4B3MM 3AJNA 4RW2A 2QP9X 1GF9A 2OE9X 3WW6A 1QZEA 3C82A 4RKUF 4B49A 2LHCA 4NIJA 1JISA 1DGBA 1L16A 3T15A 2QBYB 1LMPA 4YXAC 2KZUA 4LJ4A 3SFZA 1CVKA 2RB2X 6LZMA 3LQQA 3NBIA 3B7ZA 4KHPM 2E5LM 3HHWA 2JNHA 1JTMA 1P7SA 2F4GA 1VDSA 3KSXA 2VB1A 2LZ2A 2Z12A 3CDVA 3HU8A 1BWJA 137LA 153LA 3ZH9B 1T3PA 1LPIA 1YILA 3U6MA 3MK6A 3KP1E 4H8ZA 3SB6A 5LVGA 3N9EA 2BQKA 3ZVQA 4LYBA 1GFJA 234LA 3FE0A 3WUMA 9LYZA 4ET8A 3G3WA 4EKRA 1EE8A 4JI0M 1L22A 1LMQA 2EUCA 2XQOA 4HJYA 247LA 2XFTA 2VDBB 4LRTA 1DYDA 2XSZA 4KO8A 4PJZA 1L28A 173LA 1ZVHL 5AMYA 1ZYTA 3NBXX 5LAFA 4LYMA 1LTMA 2KDLA 4PDGA 2BQBA 2AHMA 3VLFB 2RGOA 1LCNA 1H6MA 1P56A 4TX7A 2C5RA 170LA 4I7OA 3HHYA 1DZBX 3ZC7B 4EXMA 2MEDA 235LA 2OOBA 3RGSA 1L72A 1JTPL 3A91A 2RAZX 4FW9A 1ZVYB 1NHGC 2H9JA 5DM9A 1J1OY 1QUHA 4B0DA 2BQHA 1JSFA 4LDOA 3K2LA 1GB7A 4ARPA 5LYMA 1P2LA 1OFIA 1E32A 4NXNM 1P36A 183LA 1S3SA 1L33A 3MGWA 5FELA 2HHHM 1L29A 1YAQA 1LYJA 3K9PA 3K1JA 4LRSA 3DN0A 1SG9A 182LA 1L77A 1C63A 4PT5A 6LYZA 1L49A 5H37D 1C6BA 2MECA 2NWDX 1VDLA 4W54A 8LYZA 3LZ2A 4FD2A 1PJSA 3QYBA 2VF8A 4X66M 4WM5A 2IHLA 1B5WA 3KW6A 4I81A 4IBGA 5IREB 4AW4A 1PQDA 4ARMB 1YSYA 1CJ9A 1Z55A 1W5TA 1GEVA 1TLAA 1L07A 3ODUA 1ORYB 1PJTA 2F5NA 1LSBA 3U6EA 2MJ5B 4NL4H 1L13A 4W59A 8CATA 1DPXA 144LA 1B5YA 4D9ZA 2EO2A 2JP7A 4S12A 1L66A 1C46A 1IC7Y 2LHGA 4DD2A 2BLXA 1L79A 1L90A 1IP5A 1CV4A 4HV2A 1LJJA 1B7MA 159LA 181LA 2CWIA 3HU1A 4DV6M 2F47A 2X8AA 2UU9M 4NGLA 3JR5A 3HHXA 4II7A 1WXQA 1G07A 1C66A 1LJEA 4L8RC 1NY6A 5FTMA 1HF4A 2RAYX 3RUNA 3KOZE 4Z41A 172LA 230LA 3ILKA 3GLFE 3ATOA 3BOSA 2I6ZA 3C3DA 1JJ0A 2ZTDA 3PVSA 4B7HA 2LVOC 1L50A 3A67Y 5LVKA 1VDPA 2UUCM 3VKHA 5KO3A 2M60A 3C81A 5LXWA 4NHSA 1N77A 1P3QQ 1EIJA 4NHQA 3AJIB 4GEWA 2JY7A 1JHLA 1XEPA 1JB0F 3TXDA 4IIWA 3CB7A 3U6PA 5C1BA 4XJIA 4NHTA 2KNVA 1L15A 224LA 1DXJA 4HEOA 4M0DA 3W3EA 4LF5M 2BQOA 3KOXE 1DI5A 1IOQA 1NY5A 1L76A 1MU5A 1DYAA 3DMZA 1QUGA 2APLA 1TAYA 1HFZA 4NWEA 4J0LA 1GWDA 1AM7A 1IO5A 1C61A 1VAUA 2HU1A 3SP3A 245LA 3E21A 1WQOA 1L47A 168LA 3SAUA 1IP4A 1LSEA 4II8A 3GQ5A 184LA 4OWAA 1LYDA 1L00A 1T43A 3GLFA 3HJ8A 2GQFA 4R3DA 3GQ3A 4NGYA 5KXNA 2OO9A 1LZAA 1L44A 1LZ5A 3JR4A 4JI5M 3U60A 3RU5A 2DVWB 1LZDA 5A3EA 1GBWA 4GMQA 4L15A 167LA 1JKAA 3GULA 4GIPA 5BR8M 2DWLA 4I8SA 4KPMA 1KFVA 3F92A 4Z46A 3HDFA 2Z7JA 185LA 2LTUA 5FHWA 5HNCA 1SWZA 1B7LA 1QTDA 3T36A 1IY3A 1G7MC 3DN1A 4W58A 1C6IA 1DKKA 3M6AA 1D6QA 4H9FA 2DAIA 3C8QA 5KQDA 3B74A 1L39A 4IBKA 1LZSA 1OWZA 4B4EA 2CRUA 2OE4X 4DD9A 2XEPA 2VQEM 4DV4M 4BADA 1SXJB 1L12A 1QTEA 1J1XY 1XFPL 2CE7A 3MMPA 1QQWA 1PQKA 3CT5A 4NC6A 2B74A 1XB2B 5E26A 4GRVA 4CGEA 3MJ5A 5ITTA 256LA 2W1MA 1G0KA 3G3BB 3FA0A 5A2QS 3KS8A 4HL4A 5E4PA 1GAYA 1L94A 1P46A 2R0IA 1MN3A 2LYZA 1LHLA 1GB0A 2G4NA 1LZ9A 5EXTA 244LA 1B5ZA 4G4HA 2ZQ3A 3L26A 1GF4A 152LA 1ZMYL 113LA 3GUIA 1QT7A 2JZ1A 1TDYA 2G8LA 2RBPA 1HC0A 1MJGM 232LA 1TCYA 198LA 4Z6YA 1PJJA 1G0LA 2DNAA 1L70A 4BLCA 4H92A 1CU0A 3EO5A 4PPOA 1G1VA 4GCBA 4M6DA 5I14A 1QT5A 1I4WA 135LA 1VFBC 2ZNWY 1V7TA 1L67A 1E9SA 3KSJA 4GCDA 4LJ8A 1IY0A 2RGHA 3TE6A 1LGXA 1CU5A 1DYCA 3N9AA 4G4BA 4NSIA 4OWBA 2KNZA 3KP0E 238LA 1GFAA 2HEBA 1C6TA 1GFEA 4DV3M 1IN4A 4DR1M 4AZFA 1HEOA 1G0PA 1GF5A 1GB8A 1LHJA 4GHAA 1C08C 5C6JA 1XJTA 1UIFA 4YHHM 1GF8A 3HU2A 1LSDA 120LA 4MCKA 1KY0A 3D8BA 3QAKA 190LA 3J80S 2X0AA 4W51A 2C98A 4FWGA 4MH0E 1HEPA 2LHMA 1XGUC 3BKHA 3ZVQB 4GN5C 2DQAA 3CF2A 2XZUA 3A3RX 3Q8XA 4GN3A 103LA 1IWWA 1LI3A 1R5LA 3J81S 217LA 4YF2A 1JSEA 4QNMA 4AQNA 107LA 2YQZA 2G3QA 1L45A 1L59A 1FLQA 1GFKA 1LGUA 1L99A 2BWBA 4HSFA 1IR7A 4A3VB 5KKIA 4KT3A 2EJSA 1WQQA 1LJKA 4J1AA 1OWYA 3I4VA 1OUEA 4PGJB 5EP4A 2BQDA 3LCUA 156LA 2OOAA 1GFUA 2R18A 1HSXA 5LA8A 3P65A 3FADA 4WM1A 2OU9A 1B7QA 1EFUB 145LA 1LSGA 3L28A 3IHPA 2R4EA 207LA 3HT6A 3P66A 4TUNA 5F81A 1GKIA 4JI1M 4MR1A 3ZEKA 2M5ZA 1JQJC 1MELL 3B0IA 2D7HA 3OE6A 2HL7A 3OE8A 1IR9A 4NGKA 2CUZA 5BPVA 2HUKA 3DMVA 3JR6A 3R9XB 4I4LA 1L11A 2MEEA 4GLAA 1L19A 2W1LA 1TH4A 1WGNA 4W57A 3HT9A 1K3WA 3AV0A 4RLMA 2KZSA 3TL4X 2JUJA 158LA 1QUSA 2OQ4A 3T1YM 3AGGG 1GLNA 4I7QA 5APEA 4B7FA 4DDCA 4IASA 4WMGA 3BBZA 4ARLA 1LYGA 1F6RA 3WU9A 1B7RA 2B72A 3GUOA 5DFLA 2Z19A 4DAJA 3IG5A 1OIPA 3HHZA 2B3TA 1D9WA 1GBXA 2CHVA 2C8OA 5FDJA 1C6GA 2A5YB 1BB3A 2XBSA 1AKIA 4FJRA 1BB6A 2WSFF 1CU6A 2LC9A 1ZQ9A 189LA 5LVIA 1J7KA 3FD9A 1L09A 1LMCA 2MEFA 4LG2A 3A98B 4I7LA 4LF4M 2H5ZA 1HFYA 5FTJA 3DN2A 1C6FA 4IJFA 3M7GA 4GC9A 1OJLA 1C60A 1LGWA 3HX3A 2A7DA 4NWHA 1SXJD 1CX6A 1LV7A 2C9OA 4H9EA 1DI4A 3C83A 3C7WA 4LJ6A 1L23A 5F9XA 1NHBA 3C9PA 2D6BA 1L34A 2F5SA 1A5TA 1JEFA 3BKVA 4WL6A 1R4GA 1TBYA 4OO9A 3WPKA 2CHQA 2QARC 4DDAA 2V1UA 1OVJA 4LT3A 1JR3E 114LA 1CV3A 2YBIA 1GHLA 1N32M 4XYYA 175LA 1D0MA 5HNLA 2CWBA 2YNMD 1B5UA 1IN7A 4GKJM 2KRKA 1LMNA 2EKSC 4JI3M 3FTFA 1G71A 3E9SA 1QSWA 1MLCE 4WG7A 2N35A 1YIKA 2DAGA 4B08A 4WLTA 4W56A 1OUCA 2HWJA 1L03A 3C7ZA 4OVZA 4GH9A 2LXEA 2R62A 5D5CA 1L2BA 1L25A 2ZQ4A 5LVJA 111LA 3GQ4A 2DWNA 3FUTA 4ZFPA 4FCTA 4WLYA 1I20A 2DHRA 2RKOA 4ETEA 1L04A 1L41A 2RB0X 3FRIA 1G0MA 1IEEA 2FE8A 2JA2A 3TPZA 4WO6A 3PXGA 3GLFB 2H5XA 4LZTA 2LWXA 3GLGB 1IN8A 1IY4A 1K3XA 1GB9A 1KIPC 3U60B 3RZEA 1NJGA 1N34M 1HENA 4YM8A 5DNYA 1IXZA 1JR3A 3HH3A 1BQLY 4H9AA 1YKYX 4W52A 2C96A 1TH3A 4OWEA 4EKPA 4LJ7A 1F0WA 3FUVA 3EMLA 2OU0X 1D2YA 2XTHA 5B59A 2HUMA 5HMJA 2YBLA 3SB8A 1NV9A 3VK7A 1F4IA 1IN6A 5EP1A 3U6LA 4H91A 5EXSA 219LA 4WP2A 5LINA 3KOWE 2NQ8C 2MEHA 4G4RA 3EMSA 3A90A 2MROB 1HHLA 1CUQA 2N5ZA 1L20A 3GRUA 174LA 2CV1A 2HEFA 3HUQA 4JI7M 3HKPA 2Z2FA 2Q9DA 1YANA 4BAPA 1XMQM 1LYFA 1L71A 4B4JA 1GJSA 4X65M 3KFUG 2CJLA 2DENA 4NGZA 3D3DA 3AZ7A 3ZCBB 1KSFX 1NHEA 2BJWA 1QTHA 2Q9EA 4LFPA 108LA 1T6VL 1XSFA 2VIIA 4AQYM 1YAOA 2DQGY 1L52A 5F9UA 1PJQA 2OTYX 1QSBA 2LYOA 1UFZA 3GLHE 4G49A 5KXOA 3HJQA 2OPFA 1SXJC 2L7HA 4XN6A 1P5CA 1LJ3A 4H9BA 5FSTA 3EIHA 4PK0A 4EJ4A 2V1CA 2LNHC 2I7NA 2EKKA 3LN2A 3VW7A 3RGPA 4BAFA 1IBLM 1D9UA 1OQMA 1P64A 4WW0A 4TTDA 4YY3M 4DD1A 5A3ZA 2OEAX 3QAUA 1CKCA 220LA 1GDWA 231LA 4X3BA 4OX9M 3DN3A 3LZMA 1P37A 1XNQM 4E97A 1TDZA 1L68A 4LFAM 1L55A 1L01A 3WMKA 1GF7A 251LA 3C3EA 1D0LA 3ULRA 191LA 1CV0A 4DQJA 4R71A 2JWSA 4DUZM 1QAOA 1LAAA 4LJ9A 4WOAA 4LZZA 1LJHA 1OQYA 205LA 5FEKA 4LGYA 3B9PA 3W6DA 4HV1A 1NJFA 5C6IA 5IT9S 1LSNA 1CJ7A 1DGHA 1L31A 4NRWA 1LSCA 2D4JA 4E3UA 4QGZA 1G59A 1DPWA 1LSYA 3B72A 3NWLA 1GBYA 3PNYA 1L43A 1WTMA 3A8ZA 4B3RM 3R8FA 4CJ2A 3GLHA 1LJNA 4PRUA 1MX0A 3W6AA 1GXV2 5ITQA 1YAMA 2D7GA 2ANVA 4DV0M 4AKGA 3CDTA 1GF3A 2HULA 4DQ5A 1HNZM 1Q3BA 1LPYA 2B7XA 1QTBA 2BQIA 2RBNA 1GABA 218LA 4DR3M 1JUGA 1HELA 1QZMA 4TSCA 1LHKA 3KVWA 5JI2E 1LJ4A 3SBAA 1GFTA 2JY6B 1QT3A 4IBJA 1HR0M 2HUBA 1PS5A 4NRVA 3AW7A 2D91A 2KEBA 4CHXA 3B7QA 5C6LA 2RBOA 2BQMA 3EIEA 4L6V6 2B70A 1A4VA 1NNUC 4I7NA 3SHFA 4LDLA 1TTEA 3G3VA 2Y20A 2Y0QA 3M0EA 2GV0A 1QIOA 1ZV5L 4QY9A 210LA 4G4CA 1ZV1A 1RE2A 1GDXA 2I25L 2CV0A 2XZFA 4PD2A 3DA1A 5LMNM 3GXRA 2Z39A 150LA 2ANXA 4H8XA 1D3FA 1L85A 1UIDA 3C8RA 1C62A 4X62M 1SWYA 2CDSA 2FYDA 1JITA 4OOTA 143LA 1L93A 2ZYCA 4WL7A 4DYGA 2OE7X 4PHIA 1CV1A 1HT1E 2KA6B 1L65A 2B6WA 1HNXM 2QENA 3DN8A 5D5FA 2YSSC 3AOEA 1LYEA 1XJUA 4QOSA 1EQ5A 2HCBA 1IY2A 3K3TA 1DI3A 3OTOM 5KXRA 4LT1A 3J7AS 1QTKA 209LA 4Z98A 3T38A 4I0CA 1GFGA 1HFXA 1FLUA 4X64M 2FYCA 4IBDA 1TDHA 4LT0A 4DJHA 1GB6A 1OUFA 3OJPA 1HNLA 3W6CA 1YROA 1IQPA 2L4FA 1OUGA 165LA 2ZAMA 4PDIA 4EPFA 1OKSA 5LYTA 1FN5A 5L3IA 4PCZA 3UK6A 3F6ZA 4DV7M 1GB3A 4I5SA 4FDYA 4IBFA 4TSBA 1EQEA 4NHIA 2BQNA 2EKFA 5LMUM 3W67A 2CGIA 4DR2M 2AUBA 1Y8GA 1REMA 2LBCA 2HTXA 5E9RA 2B73A 4HPIA 2XJWA 4S0WA 4LGMA 4NSHA 1G0QA 4DT3A 5FSWA 4MGYE 1L17A 1WQRA 4DD3A 4W53A 1L40A 1XGPC 1JKDA 5KXXA 2O7AA 3VK8A 1KXYA 1OUBA 4EMNA 180LA 2B6ZA 4KT0F 139LA 3HTDA 4ET9A 3J27B 2BQFA 3LVWA 1GBOA 2ZANA 1NWGA 2YBNA 2K9DA 1L95A 4NSGA 1Z6TA 1XMOM 2DKVA 3EXDA 258LA 2DHYA 1IWZA 3AFHA 1WTNA 1B0DA 3U6QA 3GPUA 1IIZA 5HLLA 200LA 147LA 1REYA 1GL7A 3SAWA 3A3QA 255LA 3KXEC 130LA 1LZYA 1IVMA 1IWXA 2HAKA 3B0OA 1LZRA 2DXIA 1AIPC 1B7PA 2BQLA 5KXTA 1C10A 1L69A 1NO1A 1DGGA 1GFRA 1PQOA 134LA 2HECA 3LYOA 4HPEA 1L81A 3TWLA 5LAGA 4R7GA 260LA 3GPYA 4NY5A 1AZFA 4CISA 193LA 5KJ9A 1IC5Y 1UIHA 1CKGA 3GXKA 4B3TM 1RCMA 1QDRA 3J7BA 1L35A 3L2AA 2QPAA 3DOAA 1LHIA 4YOPA 109LA 2ZBKB 4FVMA 4KL7A 1H6UA 160LA 4K5YA 4IBEA 2DKLA 5EXPA 5L8RF 3DKEX 2XH9A 4AKHA 2H9KA 2JY8A 2YBHA 2QHOB 1ALCA 1T6HA 4NSJA 1F10A 4XK8F 1Z5BA 4DV5M 1YKXX 1LHHA 1GFHA 1L0JA 1JKBA 4ZPXA 4A7DA 123LA 176LA 4NSOB 1V33A 4D82A 1L84A 1OFHA 1UC0A 3RFWA 1L08A 1GBZA 4B1AA 2B6TA 2D7EA 1LZ6A 4BB9A 3AZ6A 4ETCA 5ILFA 125LA 4F2LA 4N1EI 1ZMWA 2RBSA 3K8ZA 2FOIC 1VATA 2R6FA 4N8ZA 3WYHA 5LZMA 229LA 1SSYA 4LYZA 2MGWA 1L21A 1C6HA 4LCBA 233LA 4R0FA 3FTDA 2D4IA 2Z4SA 1LYYA 1BHZA 1C6DA 1LJFA 4JI2M 4GN4A 4WM6A 4KODA 4LF8M 1X37A 2KXEA 1L57A 2DWZB 7LYZA 4IBCA 223LA 2XFSA 3T6PA 3T1HM 3E4RA 2P5TA 261LA 3LW5F 1HSWA 5EP3A 1K82A 3HT8A 3FYDA 1IP7A 1LKRA 2UXDM 3A6CY 146LA 149LA 2RB1X 3I51A 2HEEA 3HBHA 2CV2A 1L51A 3CF6E 3AGHA 3AZ4A 1HERA 4D81A 1PM5A 164LA 2PC2A 1N36M 4HTNA 239LA 5B06A 4FWDA 2L78A 1QTVA 3LZTA 4C3WA 1NNJA 3THGA 2DBTA 3SB9A 3I04M 1DGFA 1L88A 4RF1A 1E8LA 1XXHE 1NVMA 3WHLA 1LMTA 1ZMUA 1G7JC 1R6BX 2ZTCA 2F32A 1OUJA 1RJCB 4GCCA 1CU3A 4IJEA 4P16A 3WULA 1OAOC 1Q39A 1PZYA 1SQ2L 4MB7A 1T6OA 1JTTL 1QTCA 2O5RA 1E94E 3A42A 4XENA 1I94M 1W6ZA 1OVKA 5T3FA 2UUBM 4H9CA 2BLYA 1GL6A 1VDQA 1TH2A 5I5QA 4OWHA 1KW7A 1DGHB 2R44A 2WARA 1LZEA 2A7FA 1BB5A 3TMUA 1C1KA 4REZA 4N5RA 1LWGA 1XEIA 119LA 2O79A 3GLHB 1XGRC 3TWMA 4LY6A 1G7LC 2CUUA 3VWOA 2XBRA 2R45A 2BPUA 2Z3XA 2FBDA 4ZPUA 2D4KA 1B2KA 4H9HA 4NGVA 2GNOA 2CFOA 3FE3A 4AG6A 4IAPA 1C65A 1L2DA 4JI6M 2HKJA 3AL0C 2Q0MX 1LZBA 1G41A 3CT1A 250LA 4LZJA 1XXHA 3HFMY 1JWRA 1DO0A 3P68A 5DN4A 1C64A 4GC5A 1LYIA 2I7PA 1L06A 4I7MA 2LVQD 4NOOB 2DZOB 1I1ZA 3A94A 4ML7A 5APCA 1DYEA 3ATNA 2EQLA 1FJGM 3RZ4A 3GUNA 4N9RA 2Q2EB 2RBQA 4KLNA 4AKIA 1BVKC 241LA 2NTGA 1IBMM 186LA 4B3SM 4LF7M 3HH4A 1GB5A 5KXSA 154LA 3SC3A 2DAEA 4WURA 4YEMA 2F4VM 3C8SA 1Z59A 1P2CC 1NSFA 1L27A 222LA 3QY4A 2QSFX 2A4TA 2R46A 2ZNXY 192LA 2L2DA 1VDTA 2R65A 237LA 4HJVA 1CNSA 1B7SA 4H8YA 151LA 3DMXA 1HQCA 1GF0A 3EBAB 3TXGA 2J7OA 2KHHA 2G4PA 1JR3D 4ETDA 1NBZC 1QANA 4UN2B 253LA 2LVPC 5EJCA 2HU3A 3SB7A 4B7GA 1L42A 1C6EA 3TXEA 4LFCM 1CV5A 3I01M 1C6MA 5ILCA 1NQIA 1UCOA 5KPZA 3A45A 2ZYPA 4PJ2C 4ARJA 1GVNA 3CSRA 1HT2E 3FYCA 5FTKA 2X4AA 1C6QA 1LZGA 2BNKA 3U6DA 1IXSA 4NGWA 3CF0A 4WO9A 2DQCY 4R6CA 3FUWA 1PQJA 2MEAA 1FNNA 3GPXA 1LMAA 3OK0A 1OAIA 1IM2A 1WGLA 2BQEA 3GRYA 3RNXA 118LA 2Y0TA 1PRBA 5L3HA 1GE1A 4LDEA 1WR1B 1LLHA 208LA 3C7YA 4QDNA 3FI5A 4CFOA 3HDEA 1Q3CA 131LA 4K0KM 3WVXA 4UWVA 5FTNA 3K2RA 5LYZA 1Q02A 3LMMA 3FKEA 4CIZA 2XLJA 1T8AA 1QVRA 128LA 3HUKA 3HU3A 1HMLA 1REZA 2G5GX 3FTEA 3RT5X 1OV5A 3UGJA 3WPJA 1SSWA 1WQNA 3UMMA 4NGOA 1IP3A 2BWEA 3U61A 2BQCA 5EP2A 1GAZA 1UACY 2XF3A 3QYEA 1PQIA 2K47A 1LZ8A 1YLAA 5APFA 1NHWC 2FNAA 1LYZA 2O25A 1T8GA 1IXRC 3WW5A 1GE3A 1SLYA 243LA 3OE9A 2R4JA 3V2YA 4N1CC 4QEQA 1VDDA 1BB4A 5II3A 4Z3MA 4NGJA 2DQFC 4KXIA 199LA 1OUHA 4AI6A 188LA 4G6ZA 1Z5CA 4MGHA 3TXHA 1NV8A 4EOFA 4DBGB 3HH6A 4JXJA 4OW1A 4NFVA 4NSRA 3CQLA 1QT6A 2YBJA 1L56A 3AYQA 3L2XA 3WU7A 5KXMA 3WPLA 3CTWB 3LYMA 5FCPA 4BS7A 2F30A 6LYTA 3M3UA 1L74A 1VEKA 5C18A 4JI4M 2FFJA 3L25A 3SYKA 3U5ZA 4M4OA 1VEJA 1XGTC 1B7OA 1LYOA 1YKZX 3HY5A 2KRUA 1OUIA 1V34A 2ERCA 5FLXS 4QOZC 1KNIA 4I7SA 1JTOL 1Z5AA 4CHTB 3HJSA 2Z4RA 1IWTA 5APDA 4L16A 1RFPA 5F16A 3W6BA 3WUNA 1VQ1A 196LA 5KXWA 1QTZA 236LA 1IOTA 3RW8A 1W08A 4NHPA 4GBRB 1G4AE 1TR8A 1L63A 1OV7A 3HH5A 3HGIA 5DL9A 3SARA 4D80A 4LZMA 1CJ8A 3GLIE 1OIZA 4QHTA 2F5QA 195LA 5EBHA 2BAAA 5KXPA 1C6AA 7LZMA 2HEDA 2UXCM 215LA 4RDSA 242LA 4IBIA 3A6BY 4LYOA 4XJDA 1YUBA 1L82A 4UWNA 1L87A 4YENA 1C67A 5B1GA 4M9ZA 4QHSA 1L32A 3HBEX 1GXXA 5LIOA 1NDMC 3LVVA 1TF0B 1LMOA 2QQ8A 4P17A 4YX7C 3A46A 4DD7A 3A92A 3LQRA 3SATA 3SHGB 4OW0A 4DR4M 4MGIE 3WH1A 4L4UA 4LFXA 2CHGA 5GKNA 4OU7A 4G4OA 1C6CA 3G3XA 5I4WA 1NDGC 214LA 4FWHA 1R7RA 1HEMA 3IJUA 1OUDA 2Z38A 3KOYE 1G0GA 1IR8A 2EIZC 1OP9B 127LA 1VG5A 2QNJA 1DYBA 178LA 1L36A 2MEIA 4P2EA 1SX7A 3E46A 1LI6A 4DC4A 3SB5A 3K92A 1QUTA 163LA 4YXCA 3WXTA 3L29A 3FI7A 3PBLA 2JZ0A 1HNWM 3HTFA 5I4XA 3GLIA 1WVUA 1N75A 1HMKA 2LYMA 3VKGA 4ANRA 3N9CA 1LZNA 2OU8A 5B1FA 3TXIA 161LA 1FBIX 2V6ZM 3TQSA 3TWKA 1HJPA 2C99A 1EL1A 4N0JA 4XBOA 3Q8GA 1QSQA 3DN4A 4I8OA 5FTLA 1NBYC 4PRQA 4DV1M 4YEOA 4ARQA 1KIQC 3VDUA 3P64A 3CDRA 1AUAA 1K28A 1L14A 3HTGA 4IBBA 1OTRA 1REXA 2LZMA 3SMSA 2DZNB 1LSPA 5LVHA 4LJAA 1GE2A 1JPOA 211LA 1LZ1A 3KDSE 1GF6A 2RRUA 3GUKA 4Z8XA 3QE8A 1B7NA 2YBMA 3DFZA 1XXHB 5KXKA 2YFQA 2BJVA 1IY1A 1EQ4A 1I56A 5DLAA 1L75A 1LWKA 2L09A 3T6UA 4ETAA 3B0KA 3CGWA 3WL2A 4MGKE 2KW0A 1KXWA 4M9XA 1E9RA 1D3MA 4AG5A 4IATA 3SN6R 4I7KA 3HU9A 4XADA 2G4QA 3HUAA 3H4JA 5ITXE 3VFDA 1L37A 3U6OA 1L0KA 221LA 2OTZX 4LF9M 1L18A 2Z18A 2J5YA 3GLGE 1FLWA 1IOCA 3G3AB 2O4WA 1TEWA 1B6IA 1RU3A 5I4YA 4XJGA 259LA 4G9SA 1CX7A 4ZIXA 1L1ZA 1LZTA 1LJGA 4MSTA 4TUWA 1IP2A 112LA 1KXXA 1GO5A 1CUKA 2C9CA 3AW6A 1G3IA 4G4QA 1JQUA 1OYUA 4I7PA 4HTQA 2Z37A 4H90A 2CP8A 3U6CA 4XJFA 1HEQA 1L92A 3E3DA 4J7VA 1IBKM 4C5FA 1DYGA 1C7YA 1ZURA 4CJ6A 3DZDA 4EKSA 2YVBA 1G8PA 1PJIA 2C8PA 3DN6A 3TXKA 3OE0A 1NMMA 4GLVA 4OOOA 1FDLY 1IP6A 1V92A 1YE9A 2W1XA 2DAKA 1LSFA 3AOEC 1IXSB 2LCBA 3GUMA 2WZJA 1L89A 5ITXA 4DD0A 5JI3E 1L96A 1L26A 1ZMVA 4OVZB 3GLGA 3H4MA 157LA 3W0LB 3B6LA 3CDQA 3P4ZA 129LA 3TXJA 4LF6M 2Y8PA 1V7SA 4LYCA 2VF7A 1GJTA 1OVHA 1DO2A 3UONA 1L97A 4ZEEA 177LA 1L64A 1WHCA 5ITUA 1IWVA 1CKHA 3TMWA 1EPYA 1GEZA 1XNRM 1GB2A 1YQVY 3WU8A 1L02A 1WQMA 1WTHA 1UICA 1G06A 1QT4A 1IP1A 2K0BX 1XHBA 2VQFM 138LA 1LI2A 2IGCA 3B7NA 1ZWNA 1D6PA 1L38A 5F3WA 1A2YC 1LSZA 5KXLA 4Y28F 206LA 3TMVA 1AT6A 1LZCA 4H94A 3U61B 262LA 5I54A 225LA 1R2YA 5KQ8A 5EXXA 3NYAA 3WHKA 1WJ7A 4ITQA 1FKQA 5KY1A 254LA 1BWHA 3U6SA 1UUZC 2B5ZA 3HWSA 1GFVA 2ZM6M 1BVSA 1LW9A 1C6JA 1T8FA 1LZ4A 115LA 1L1TA 1T3TA 1BB7A 1G1WA 2Z8YM 3SAVA 4M0WA 4NG8A 1C6LA 3AZ5A 2QBYA 1CJ6A 3FUXA 1YL0X 3A34A 2Z2EA 1BGIA 1HQYE 1IORA 4XGIA 1L86A 1L58A 3NY9A 1L24A 4DDBA 3HTBA 4WM3A 3V76A 3D9AC 1XGQC 2DQEY 1QT8A 3IWRA 2L4EA 1LSMA 5KXZA 5E6JA 104LA 1XWIA 3A96A 1CUPA 1QAQA 3AB6A 1WIVA 3U5ZB 1L62A 2DQJY 1BWIA 4GKKM 1YL1X 2BQGA 252LA 1PQMA 5J7CA 1DYFA 1L61A 2F5PA 3SYLA 246LA 1IWUA 2FS1A 4DR5M 2F5OA 4DR7M 1G7IC 1VEDA 5DN5A 1N78A 2H1RA 5F14A 2HEAA 4L41A 3L64A 1C6PA 4HP0A 2JXNA 2IFFY 2UUAM 1KW5A 1L91A 1IN5A 4NEBA 3D4SA 3W68A 1LJIA 2B6XA 3J4GA 140LA 3PDSA 1JJ3A 4NXMM 1DKJA 1L46A 3CSQA 1YAPA 1GD6A 2J7NA 2FBBA 4BBAA 2XGNA 2EPEA 3W0FA 1L80A 5JENB 3QWLA 1G0JA 2ZIJA 171LA 1L83A 4EIWA 3ZQJA 1QDTA 5KPRA 4RLNA 3F9LA 4WM2A 4L78A 2WSEF 4H1PA 4W94A 3B89A 4WLXA 4GHLA 4W96A 4MGZE 155LA 1CKDA 3A95A 2DQIY 1OUAA 2DZLA 3HZJA 3HWLA 2LVNC 3LYTA 3GRRA 2I26L 4Q7JA 3IECA 4JYAM 3M18B 1IOSA 1L2CA 2DQHY 2ZAOA 1PGYA 2B75A 197LA 2ZWBA 3PNVA 187LA 1NF5A 4GITA 3RE8A 1C6NA 3CT0A 1J1PY 3SBBC 4XJBA 3MHVC 1O23A 4WG1A 4ARMA 1KS3A 3D8LA 102LA 3AKZA 1JIYA 5IDDA 4FCVA 3TMXA 257LA 1D3JA 1P3NA 3QNGA 3GLIB 1L60A 1UBZA 216LA 4LYTA 4DV2M 1C43A 1L48A 4HLQA 3L27A 1VEGA 3WVYA 212LA 5ITRA 3SBJA 133LA 4HJZA 3GO8A 2UXBM 1C45A 2MEGA 169LA 5EQTA 1WQPA 1L54A 110LA 2YR0A 2F2QA 2LZTA 3WXUA 4GCEA 4MM3B 162LA 4GRIA 4LT2A 3F8VA 1KIRC 1FLYA 3LCVB 1LOZA 4WLDA 2W1YA 1J09A 4ARQB 4U3XB 4FCWA 1NKHA 1GPQC 3HBDA 1C69A 3WUAA 2K6BA 5IHGA 1DQJC 4DKLA 4EPIA 4ETBA 1SX2A 2DQDY 4G3OA 3GP1A 2MH8A 1LSAA 4TWSA 126LA 1I6SA 3PFIA 1IC4Y 2L6OA 3FUUA 1UIGA 4JI8M 4H9IA 240LA 3J2PB 1TGUA 2QZ4A 2QCUA 5M1YA 4I7RA 194LA 2LVAA 1GE0A 4RW1A 2EA0A 1JTNA 2RSCA 2DI0A 4G4NA 2QB0B 3IG8A 1FKVA 1L8QA 2MR9A 1J5EM 2CEAA 4LGKA 1BVXA 2X49A 228LA
chains in the Genus database with same CATH topology
1CU2A 3GUJA 4DWXA 1QUDA 2BQAA 2RBRA 1L98A 4NGIA 1C68A 1QS5A 2F4AA 1JJ1A 1G7HC 5LA5A 4O34A 1AT5A 1QQYA 1QS9A 1L10A 1HEWA 1D2WA 4W55A 2YDGA 148LE 2F2NA 4DQ7A 5I53A 1B5XA 201LA 4GCFA 1UIEA 1F6SA 4OWCA 1IWYA 3IJVA 3AGIA 1UIAA 1B9OA 1CKFA 1L53A 142LA 2Z6BA 2ZILA 4AGAA 3A93A 2ZIKA 1C7PA 3W6FA 5K7OA 5B05A 3CSZA 122LA 1CTWA 1LYSA 1L05A 1GBSA 1LKSA 1GE4A 1N4FA 1D3NA 3TXBA 4J1BA 4UWUA 3LYZA 4H93A 1L30A 1QSAA 1CV6A 4B4IA 1WVVA 4I7TA 3CDOA 1B5VA 248LA 4AXTA 1LYHA 4HTKA 249LA 4XJHA 2BQJA 3W6EA 1UA6Y 5IELA 4CFPA 4NG1A 3LHMA 5KXYA 3V2WA 1UIBA 1RI8B 2B6YA 4EKQA 5KKJA 5L9JA 1JKCA 1C6KA 1D0KA 5HMVA 1T97A 227LA 141LA 1QUOA 5HQ1A 4I7JA 3HT7A 3DNAA 2MEBA 4IJ4A 3GUPA 3KAMA 2RH1A 1P6YA 3J6KA 1H87A 4WM4A 1INUA 3C80A 1XEKA 132LA 3TXFA 226LA 1P2RA 166LA 213LA 5B07A 1IX0A 1XEJA 2NTHA 3NY8A 1KY1A 1L73A 1LHMA 3AJNA 4RW2A 1GF9A 2OE9X 3WW6A 3C82A 4B49A 4NIJA 1JISA 1L16A 1LMPA 4YXAC 1CVKA 2RB2X 6LZMA 1JTMA 1P7SA 2F4GA 1VDSA 2VB1A 3CDVA 2LZ2A 2Z12A 3HU8A 1BWJA 137LA 153LA 1T3PA 1LPIA 1YILA 4H8ZA 3SB6A 5LVGA 3N9EA 2BQKA 3ZVQA 4LYBA 1GFJA 234LA 3FE0A 3WUMA 9LYZA 4ET8A 3G3WA 4EKRA 1LMQA 1L22A 2XQOA 4HJYA 247LA 1DYDA 4PJZA 1L28A 173LA 1ZVHL 5AMYA 1ZYTA 5LAFA 4LYMA 1LTMA 2BQBA 1LCNA 1H6MA 1P56A 4TX7A 170LA 4I7OA 1DZBX 4EXMA 2MEDA 235LA 1L72A 1JTPL 3A91A 2RAZX 1ZVYB 2H9JA 5DM9A 1J1OY 1QUHA 4B0DA 2BQHA 1JSFA 4LDOA 1GB7A 4ARPA 5LYMA 1P2LA 1P36A 183LA 1L33A 3MGWA 5FELA 1L29A 1YAQA 1LYJA 3DN0A 182LA 1L77A 1C63A 6LYZA 1L49A 1C6BA 2MECA 2NWDX 4W54A 8LYZA 3LZ2A 4WM5A 2IHLA 1B5WA 1PQDA 4ARMB 1CJ9A 1Z55A 1GEVA 1TLAA 1L07A 3ODUA 1LSBA 1L13A 4W59A 1DPXA 144LA 1B5YA 4D9ZA 1L66A 1C46A 1IC7Y 4DD2A 2BLXA 1L79A 1L90A 1IP5A 1CV4A 4HV2A 1LJJA 1B7MA 159LA 181LA 2CWIA 2F47A 4NGLA 1G07A 1C66A 1LJEA 1HF4A 2RAYX 3RUNA 4Z41A 172LA 230LA 3ATOA 2I6ZA 1JJ0A 1L50A 3A67Y 5LVKA 1VDPA 3C81A 5LXWA 4NHSA 4NHQA 1JHLA 1XEPA 3TXDA 3CB7A 4XJIA 4NHTA 1L15A 224LA 1DXJA 3W3EA 2BQOA 1DI5A 1IOQA 1L76A 1DYAA 3DMZA 1QUGA 1TAYA 1HFZA 4NWEA 4J0LA 1GWDA 1AM7A 1IO5A 1C61A 1VAUA 2HU1A 3SP3A 1WQOA 1L47A 168LA 1IP4A 1LSEA 4II8A 184LA 4OWAA 1LYDA 1L00A 4NGYA 5KXNA 1LZAA 1L44A 1LZ5A 3RU5A 1LZDA 5A3EA 1GBWA 1JKAA 167LA 3GULA 4I8SA 4KPMA 4Z46A 3HDFA 185LA 5FHWA 5HNCA 1SWZA 1B7LA 1QTDA 3T36A 1IY3A 1G7MC 3DN1A 4W58A 1C6IA 1DKKA 1D6QA 4H9FA 3C8QA 1L39A 1LZSA 1OWZA 4B4EA 4DD9A 2OE4X 4BADA 1L12A 1QTEA 1J1XY 1XFPL 1PQKA 3CT5A 2B74A 4CGEA 4GRVA 256LA 2W1MA 1G0KA 3G3BB 3FA0A 5E4PA 1GAYA 1L94A 1P46A 2LYZA 1LHLA 1GB0A 2G4NA 1LZ9A 244LA 1B5ZA 4G4HA 2ZQ3A 1GF4A 152LA 1ZMYL 113LA 3GUIA 1QT7A 1TDYA 1HC0A 2RBPA 232LA 1TCYA 198LA 1G0LA 1L70A 4H92A 1CU0A 3EO5A 4PPOA 1G1VA 4GCBA 4M6DA 5I14A 1QT5A 135LA 1VFBC 2ZNWY 1V7TA 1L67A 4GCDA 1LGXA 1CU5A 1DYCA 3N9AA 4G4BA 4NSIA 4OWBA 238LA 1GFAA 2HEBA 1C6TA 1GFEA 1HEOA 1G0PA 1GF5A 1GB8A 1LHJA 1C08C 5C6JA 1XJTA 1UIFA 1GF8A 1LSDA 120LA 4MCKA 1KY0A 3QAKA 190LA 2X0AA 4W51A 1HEPA 3BKHA 2LHMA 1XGUC 3ZVQB 4GN5C 2DQAA 3A3RX 4GN3A 103LA 1IWWA 1LI3A 217LA 4YF2A 1JSEA 4AQNA 107LA 1L45A 1L59A 1FLQA 1GFKA 1LGUA 1L99A 4HSFA 1IR7A 5KKIA 4KT3A 1WQQA 4J1AA 1LJKA 1OWYA 1OUEA 4PGJB 2BQDA 156LA 1GFUA 1HSXA 5LA8A 3P65A 3FADA 4WM1A 2OU9A 1B7QA 145LA 1LSGA 207LA 3HT6A 3P66A 4TUNA 5F81A 4MR1A 3ZEKA 1MELL 3B0IA 3OE6A 3OE8A 1IR9A 4NGKA 2HUKA 3DMVA 3JR6A 1L11A 2MEEA 4GLAA 1L19A 2W1LA 4W57A 3HT9A 4RLMA 158LA 1QUSA 3AGGG 4I7QA 5APEA 4DDCA 4IASA 4WMGA 4ARLA 1LYGA 1F6RA 3WU9A 1B7RA 2B72A 3GUOA 2Z19A 4DAJA 1D9WA 1GBXA 2C8OA 5FDJA 1C6GA 1BB3A 2XBSA 1AKIA 4FJRA 1BB6A 1CU6A 2LC9A 189LA 5LVIA 1L09A 1LMCA 2MEFA 4I7LA 2H5ZA 1HFYA 3DN2A 1C6FA 1C60A 1LGWA 2A7DA 4NWHA 1CX6A 4H9EA 3C83A 1DI4A 3C7WA 1L23A 5F9XA 1NHBA 2D6BA 1L34A 1JEFA 3BKVA 4WL6A 1TBYA 4OO9A 3WPKA 2QARC 4DDAA 1OVJA 4LT3A 114LA 1CV3A 2YBIA 1GHLA 4XYYA 175LA 1D0MA 5HNLA 1B5UA 1LMNA 2EKSC 1QSWA 1MLCE 4WG7A 1YIKA 4WLTA 4W56A 1OUCA 1L03A 3C7ZA 5D5CA 1L25A 2ZQ4A 5LVJA 111LA 4ZFPA 4WLYA 1I20A 4ETEA 1L04A 1L41A 2RB0X 1G0MA 1IEEA 4WO6A 4LZTA 1IY4A 1GB9A 1KIPC 3RZEA 1HENA 4YM8A 3HH3A 1BQLY 4H9AA 1YKYX 4W52A 4OWEA 4EKPA 1F0WA 3EMLA 2OU0X 1D2YA 2XTHA 5B59A 2HUMA 5HMJA 2YBLA 3SB8A 4H91A 219LA 5LINA 2MEHA 3EMSA 3A90A 1HHLA 1CUQA 2N5ZA 1L20A 174LA 2HEFA 3HUQA 2Z2FA 2Q9DA 1YANA 4BAPA 1LYFA 1L71A 4B4JA 2CJLA 4NGZA 3D3DA 3AZ7A 1NHEA 1QTHA 2Q9EA 4LFPA 108LA 1T6VL 1XSFA 1YAOA 2DQGY 1L52A 5F9UA 2OTYX 1QSBA 2LYOA 4G49A 5KXOA 4XN6A 1P5CA 1LJ3A 4H9BA 5FSTA 4PK0A 4EJ4A 3LN2A 3VW7A 4BAFA 1D9UA 1OQMA 1P64A 4TTDA 4DD1A 5A3ZA 2OEAX 1CKCA 220LA 1GDWA 231LA 4X3BA 3DN3A 3LZMA 1P37A 4E97A 1L68A 1L55A 1L01A 3WMKA 1GF7A 251LA 1D0LA 3ULRA 191LA 1CV0A 4DQJA 1LAAA 4WOAA 1LJHA 205LA 5FEKA 3W6DA 4HV1A 5C6IA 1LSNA 1CJ7A 1LSCA 1L31A 2D4JA 4E3UA 4QGZA 1LSYA 1DPWA 3B72A 1GBYA 1L43A 1WTMA 3A8ZA 4CJ2A 1LJNA 4PRUA 3W6AA 1GXV2 1YAMA 2ANVA 3CDTA 1GF3A 2HULA 4DQ5A 1LPYA 2B7XA 1QTBA 2BQIA 2RBNA 218LA 1JUGA 1HELA 4TSCA 1LHKA 1LJ4A 3SBAA 1GFTA 1QT3A 2HUBA 1PS5A 3AW7A 2D91A 4CHXA 5C6LA 2RBOA 2BQMA 2B70A 4I7NA 1A4VA 4LDLA 3G3VA 2GV0A 1QIOA 1ZV5L 4QY9A 210LA 4G4CA 1RE2A 1GDXA 2I25L 3GXRA 2Z39A 150LA 2ANXA 4H8XA 1D3FA 1L85A 1UIDA 3C8RA 1C62A 1SWYA 2CDSA 2FYDA 1JITA 4OOTA 143LA 1L93A 2ZYCA 4WL7A 4DYGA 2OE7X 4PHIA 1CV1A 3DN8A 1L65A 2B6WA 5D5FA 2YSSC 1LYEA 1XJUA 1EQ5A 3K3TA 1DI3A 5KXRA 4LT1A 1QTKA 209LA 4Z98A 4I0CA 1GFGA 1HFXA 1FLUA 2FYCA 4LT0A 4DJHA 1GB6A 1OUFA 3OJPA 1HNLA 3W6CA 1YROA 1OUGA 165LA 4EPFA 5LYTA 1FN5A 5L3IA 3F6ZA 1GB3A 4FDYA 4TSBA 1EQEA 4NHIA 2BQNA 2CGIA 2AUBA 1REMA 2HTXA 5E9RA 2B73A 4HPIA 2XJWA 4S0WA 4NSHA 1G0QA 4DT3A 4DD3A 1WQRA 1L17A 4W53A 1L40A 1XGPC 1JKDA 5KXXA 2O7AA 1KXYA 1OUBA 4EMNA 180LA 2B6ZA 139LA 3HTDA 4ET9A 2BQFA 1GBOA 1NWGA 2YBNA 4NSGA 1L95A 2DKVA 3EXDA 258LA 1IWZA 1WTNA 1B0DA 1IIZA 5HLLA 200LA 147LA 1REYA 3A3QA 255LA 130LA 1LZYA 1IVMA 1IWXA 3B0OA 1LZRA 1B7PA 2BQLA 5KXTA 1C10A 1L69A 2HECA 1GFRA 4HPEA 1PQOA 134LA 3LYOA 1L81A 5LAGA 260LA 4NY5A 1AZFA 193LA 5KJ9A 1IC5Y 1UIHA 1CKGA 3GXKA 1RCMA 1QDRA 1L35A 1LHIA 4YOPA 109LA 4KL7A 160LA 4K5YA 3DKEX 2H9KA 2YBHA 1ALCA 1T6HA 4NSJA 1F10A 1YKXX 1LHHA 1GFHA 1L0JA 1JKBA 4A7DA 123LA 176LA 1L84A 1UC0A 1L08A 1GBZA 4B1AA 2B6TA 1LZ6A 4ETCA 3AZ6A 5ILFA 125LA 4N1EI 2RBSA 1VATA 3WYHA 4N8ZA 5LZMA 229LA 1SSYA 4LYZA 1L21A 1C6HA 233LA 4R0FA 2D4IA 1LYYA 1BHZA 1C6DA 1LJFA 4GN4A 4WM6A 1L57A 7LYZA 223LA 261LA 1HSWA 3HT8A 1IP7A 1LKRA 3A6CY 146LA 149LA 2RB1X 2HEEA 3HBHA 1L51A 3AGHA 3AZ4A 1HERA 164LA 2PC2A 4HTNA 239LA 5B06A 2L78A 1QTVA 3LZTA 4C3WA 2DBTA 3SB9A 1L88A 1E8LA 1LMTA 1G7JC 2F32A 1OUJA 1RJCB 4GCCA 1CU3A 3WULA 1SQ2L 1PZYA 1JTTL 1QTCA 4XENA 1W6ZA 1OVKA 5T3FA 4H9CA 2BLYA 1VDQA 5I5QA 4OWHA 1KW7A 2WARA 1LZEA 2A7FA 1BB5A 3TMUA 4N5RA 1LWGA 1XEIA 119LA 2O79A 1XGRC 1G7LC 3VWOA 2CUUA 2XBRA 2BPUA 2FBDA 4ZPUA 2D4KA 1B2KA 4H9HA 4NGVA 4IAPA 1C65A 2Q0MX 1LZBA 3CT1A 250LA 3HFMY 1JWRA 3P68A 5DN4A 1C64A 1LYIA 1L06A 4I7MA 1I1ZA 3A94A 4ML7A 5APCA 1DYEA 3ATNA 2EQLA 3RZ4A 3GUNA 4N9RA 2RBQA 1BVKC 241LA 2NTGA 186LA 3HH4A 1GB5A 5KXSA 154LA 4YEMA 3C8SA 1P2CC 1L27A 222LA 3QY4A 2A4TA 2ZNXY 192LA 1VDTA 237LA 4HJVA 1CNSA 1B7SA 4H8YA 151LA 3DMXA 1GF0A 3EBAB 3TXGA 2G4PA 4ETDA 1NBZC 253LA 2HU3A 3SB7A 1L42A 1C6EA 3TXEA 1CV5A 1C6MA 5ILCA 1NQIA 1UCOA 2ZYPA 4PJ2C 4ARJA 3CSRA 1C6QA 1LZGA 4NGWA 4WO9A 2DQCY 4R6CA 1PQJA 2MEAA 1LMAA 3OK0A 2BQEA 3RNXA 118LA 5L3HA 1GE1A 4LDEA 1LLHA 208LA 4QDNA 3C7YA 3FI5A 4CFOA 3HDEA 131LA 3WVXA 4UWVA 3K2RA 5LYZA 1T8AA 128LA 3HUKA 1HMLA 1REZA 3RT5X 1OV5A 3WPJA 1SSWA 1WQNA 4NGOA 1IP3A 2BQCA 1GAZA 1UACY 1PQIA 1LZ8A 5APFA 1LYZA 1T8GA 3WW5A 1GE3A 1SLYA 243LA 3OE9A 3V2YA 4N1CC 4QEQA 1BB4A 5II3A 4Z3MA 4NGJA 2DQFC 4KXIA 199LA 1OUHA 188LA 3TXHA 4EOFA 3HH6A 4OW1A 4NFVA 3CQLA 1QT6A 2YBJA 1L56A 3AYQA 3L2XA 3WU7A 5KXMA 3WPLA 3LYMA 5FCPA 4BS7A 2F30A 6LYTA 3M3UA 1L74A 4M4OA 1XGTC 1B7OA 1LYOA 1YKZX 1OUIA 1KNIA 4I7SA 1JTOL 5F16A 1IWTA 5APDA 1RFPA 3WUNA 3W6BA 196LA 5KXWA 1QTZA 236LA 1IOTA 3RW8A 1W08A 4NHPA 4GBRB 1OV7A 1L63A 3HH5A 5DL9A 4LZMA 1CJ8A 195LA 5EBHA 2BAAA 5KXPA 1C6AA 7LZMA 2HEDA 215LA 4RDSA 242LA 3A6BY 4LYOA 4XJDA 1L82A 4UWNA 1L87A 4YENA 1C67A 5B1GA 1L32A 3HBEX 1GXXA 5LIOA 1NDMC 1LMOA 4YX7C 4DD7A 3A92A 3WH1A 4LFXA 3G3XA 1C6CA 5I4WA 1NDGC 214LA 1HEMA 3IJUA 1OUDA 2Z38A 1G0GA 1IR8A 2EIZC 1OP9B 127LA 1DYBA 178LA 1L36A 2MEIA 4P2EA 1SX7A 4DC4A 1LI6A 3SB5A 163LA 1QUTA 4YXCA 3WXTA 3FI7A 3PBLA 3HTFA 5I4XA 1WVUA 1HMKA 2LYMA 4ANRA 3N9CA 1LZNA 2OU8A 5B1FA 3TXIA 161LA 1FBIX 1EL1A 4N0JA 1QSQA 3DN4A 1NBYC 4PRQA 4YEOA 4ARQA 1KIQC 3P64A 3CDRA 1K28A 1L14A 3HTGA 1REXA 2LZMA 1LSPA 5LVHA 1GE2A 1JPOA 211LA 1LZ1A 1GF6A 3GUKA 3QE8A 1B7NA 2YBMA 5KXKA 1EQ4A 1I56A 5DLAA 1L75A 1LWKA 3T6UA 4ETAA 3B0KA 3WL2A 1KXWA 1D3MA 4IATA 3SN6R 4I7KA 3HU9A 4XADA 2G4QA 3HUAA 1L37A 1L0KA 221LA 2OTZX 1L18A 2Z18A 3G3AB 1FLWA 1IOCA 2O4WA 1TEWA 1B6IA 5I4YA 4XJGA 259LA 4G9SA 1CX7A 4ZIXA 1LZTA 1LJGA 4MSTA 1IP2A 112LA 1KXXA 3AW6A 1JQUA 1OYUA 4I7PA 4HTQA 2Z37A 4H90A 4XJFA 1HEQA 1L92A 3E3DA 4J7VA 4C5FA 1DYGA 1ZURA 4EKSA 2YVBA 2C8PA 3DN6A 3TXKA 3OE0A 1NMMA 4GLVA 4OOOA 1FDLY 1IP6A 2W1XA 1LSFA 2LCBA 3GUMA 1L89A 4DD0A 1L96A 1L26A 157LA 3B6LA 3CDQA 3P4ZA 129LA 3TXJA 2Y8PA 1V7SA 4LYCA 177LA 1OVHA 4ZEEA 3UONA 1L97A 1L64A 1IWVA 1CKHA 3TMWA 1EPYA 1GEZA 1GB2A 1YQVY 3WU8A 1L02A 1WQMA 1WTHA 1UICA 1G06A 1QT4A 1IP1A 138LA 1LI2A 2IGCA 1ZWNA 1D6PA 1L38A 1A2YC 1LSZA 5KXLA 206LA 3TMVA 1AT6A 1LZCA 4H94A 262LA 5I54A 225LA 3NYAA 1FKQA 5KY1A 254LA 1BWHA 1UUZC 2B5ZA 1GFVA 1LW9A 1C6JA 1T8FA 1LZ4A 115LA 1BB7A 1G1WA 4NG8A 1C6LA 3AZ5A 1CJ6A 3A34A 1YL0X 2Z2EA 1BGIA 1IORA 1L86A 1L58A 3NY9A 1L24A 4DDBA 3HTBA 4WM3A 3D9AC 1XGQC 2DQEY 1QT8A 3IWRA 1LSMA 5KXZA 104LA 3A96A 1CUPA 3AB6A 1L62A 2DQJY 1BWIA 1YL1X 2BQGA 252LA 1PQMA 5J7CA 1DYFA 1L61A 246LA 1IWUA 1VEDA 1G7IC 5DN5A 5F14A 2HEAA 4L41A 3L64A 1C6PA 4HP0A 2IFFY 1KW5A 1L91A 4NEBA 3D4SA 1LJIA 2B6XA 3J4GA 140LA 3PDSA 1JJ3A 1DKJA 1L46A 3CSQA 1YAPA 1GD6A 2FBBA 2EPEA 1L80A 5JENB 1G0JA 2ZIJA 171LA 1L83A 1QDTA 4RLNA 4WM2A 3F9LA 4H1PA 4W94A 4WLXA 4W96A 3A95A 155LA 1CKDA 2DQIY 1OUAA 3LYTA 3HWLA 2I26L 3M18B 1IOSA 197LA 2DQHY 2B75A 2ZWBA 187LA 1NF5A 1C6NA 3CT0A 1J1PY 3SBBC 4XJBA 4ARMA 1O23A 4WG1A 1KS3A 102LA 3TMXA 1JIYA 5IDDA 257LA 1D3JA 1P3NA 3QNGA 1L60A 1UBZA 216LA 4LYTA 1C43A 1L48A 3WVYA 212LA 133LA 4HJZA 1C45A 2MEGA 169LA 1WQPA 1L54A 110LA 2F2QA 2LZTA 3WXUA 4GCEA 162LA 4LT2A 3F8VA 1KIRC 1FLYA 1LOZA 4WLDA 2W1YA 4ARQB 4U3XB 1NKHA 1GPQC 3HBDA 1C69A 3WUAA 5IHGA 1DQJC 4DKLA 4EPIA 4ETBA 1SX2A 2DQDY 4TWSA 1LSAA 126LA 1I6SA 1IC4Y 1UIGA 4H9IA 240LA 5M1YA 4I7RA 194LA 1GE0A 4RW1A 1JTNA 2RSCA 2QB0B 1FKVA 4LGKA 1BVXA 245LA 228LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRO A;  5DL9 A;  1OUG A;  4DWX A;  1CJ8 A;  3N9A A;  4G4B A;  4NSI A;  2BQA A;  4OWB A;  5EBH A;  4NGI A;  2BAA A;  1GFA A;  5LYT A;  1FN5 A;  2HEB A;  5KXP A;  2HED A;  5L3I A;  2F4A A;  3F6Z A;  1GFE A;  1JJ1 A;  1G7H C;  1GB3 A;  4FDY A;  5LA5 A;  4RDS A;  4TSB A;  1EQE A;  4O34 A;  1AT5 A;  4NHI A;  1QQY A;  2BQN A;  3A6B Y;  4LYO A;  1HEO A;  1HEW A;  4XJD A;  1GF5 A;  4UWN A;  1GB8 A;  1LHJ A;  4YEN A;  2CGI A;  2YDG A;  1C08 C;  5C6J A;  2F2N A;  5B1G A;  1UIF A;  1REM A;  2AUB A;  3HBE X;  1GF8 A;  2HTX A;  1GXX A;  5E9R A;  5I53 A;  4HPI A;  1B5X A;  2XJW A;  4GCF A;  1LSD A;  4NSH A;  5LIO A;  1NDM C;  1UIE A;  1WQR A;  4MCK A;  4DD3 A;  4DT3 A;  1F6S A;  1LMO A;  1XGP C;  4OWC A;  1JKD A;  2X0A A;  5KXX A;  1IWY A;  4DD7 A;  3IJV A;  1HEP A;  3A92 A;  2LHM A;  1XGU C;  3BKH A;  3ZVQ B;  1KXY A;  4GN5 C;  2DQA A;  1OUB A;  1UIA A;  3AGI A;  4EMN A;  1B9O A;  1CKF A;  3WH1 A;  4LFX A;  3A3R X;  4ET9 A;  2ZIL A;  4GN3 A;  4AGA A;  1IWW A;  2BQF A;  1NDG C;  5I4W A;  1GBO A;  3A93 A;  2ZIK A;  1HEM A;  1NWG A;  1C7P A;  2YBN A;  3IJU A;  4NSG A;  1OUD A;  2Z38 A;  3W6F A;  4YF2 A;  5K7O A;  1JSE A;  1IR8 A;  5B05 A;  3CSZ A;  2DKV A;  2EIZ C;  3EXD A;  1OP9 B;  1IWZ A;  1FLQ A;  1GFK A;  4HSF A;  1IR7 A;  1WTN A;  1B0D A;  5KKI A;  1LYS A;  1GBS A;  1WQQ A;  4J1A A;  1LJK A;  4KT3 A;  1LKS A;  1GE4 A;  4P2E A;  1IIZ A;  2MEI A;  4DC4 A;  1QUT A;  1OUE A;  4PGJ B;  3WXT A;  1N4F A;  3FI7 A;  2BQD A;  3TXB A;  1REY A;  5HLL A;  4J1B A;  4UWU A;  3LYZ A;  3A3Q A;  4H93 A;  1GFU A;  1QSA A;  1HSX A;  5LA8 A;  1LZY A;  4B4I A;  1WVV A;  1IWX A;  3P65 A;  5I4X A;  1IVM A;  1WVU A;  3B0O A;  4WM1 A;  1LZR A;  1HMK A;  2LYM A;  1B7Q A;  1B7P A;  1LSG A;  2BQL A;  5KXT A;  1B5V A;  1C10 A;  207L A;  4AXT A;  4ANR A;  1GFR A;  2HEC A;  1LZN A;  134L A;  3N9C A;  3LYO A;  4HPE A;  4HTK A;  5B1F A;  3P66 A;  4TUN A;  5F81 A;  4MR1 A;  4XJH A;  3TXI A;  3ZEK A;  1FBI X;  2BQJ A;  3W6E A;  1MEL L;  1UA6 Y;  3B0I A;  5LAG A;  5IEL A;  4CFP A;  1IR9 A;  4NGK A;  4NY5 A;  1EL1 A;  4NG1 A;  1AZF A;  4N0J A;  3LHM A;  5KXY A;  193L A;  1UIB A;  1IC5 Y;  5KJ9 A;  1RI8 B;  1UIH A;  1CKG A;  3GXK A;  2MEE A;  4GLA A;  1RCM A;  1NBY C;  5KKJ A;  2W1L A;  4PRQ A;  5L9J A;  1QDR A;  1JKC A;  4YEO A;  1KIQ C;  3P64 A;  4RLM A;  1D0K A;  1LHI A;  4YOP A;  5HMV A;  1QUS A;  4KL7 A;  1REX A;  5HQ1 A;  3AGG G;  2MEB A;  2H9K A;  4IJ4 A;  2YBH A;  3KAM A;  1ALC A;  4NSJ A;  1LSP A;  5APE A;  1F10 A;  5LVH A;  1YKX X;  3J6K A;  1LHH A;  1H87 A;  1GE2 A;  1JKB A;  1GFH A;  1INU A;  1JPO A;  4WM4 A;  4A7D A;  1LZ1 A;  1XEK A;  4DDC A;  1GF6 A;  4IAS A;  4WMG A;  132L A;  3QE8 A;  3TXF A;  1B7N A;  1UC0 A;  2YBM A;  1F6R A;  3WU9 A;  1B7R A;  5KXK A;  1GBZ A;  2Z19 A;  4B1A A;  1LZ6 A;  1EQ4 A;  1GBX A;  3AZ6 A;  5B07 A;  4ETC A;  1IX0 A;  2C8O A;  1XEJ A;  5FDJ A;  5ILF A;  4N1E I;  1BB3 A;  1I56 A;  2XBS A;  1AKI A;  4FJR A;  5DLA A;  4RW2 A;  1LHM A;  3AJN A;  1VAT A;  1BB6 A;  1GF9 A;  3WW6 A;  3T6U A;  4ETA A;  3WYH A;  4N8Z A;  3B0K A;  5LVI A;  3WL2 A;  4LYZ A;  1LMC A;  4B49 A;  2MEF A;  4R0F A;  1KXW A;  4NIJ A;  2D4I A;  4IAT A;  1JIS A;  1LYY A;  2H5Z A;  1LMP A;  4XAD A;  2G4Q A;  1HFY A;  1BHZ A;  1LJF A;  2A7D A;  4GN4 A;  4WM6 A;  4NWH A;  7LYZ A;  4H9E A;  2F4G A;  1VDS A;  2Z18 A;  1DI4 A;  3G3A B;  1FLW A;  1IOC A;  2VB1 A;  2LZ2 A;  1TEW A;  2Z12 A;  5F9X A;  2D6B A;  1HSW A;  1BWJ A;  5I4Y A;  153L A;  4XJG A;  1IP7 A;  1T3P A;  4G9S A;  1LKR A;  4ZIX A;  1LPI A;  1LZT A;  1LJG A;  1JEF A;  1YIL A;  4MST A;  3BKV A;  1IP2 A;  4WL6 A;  1TBY A;  3A6C Y;  1KXX A;  3WPK A;  4H8Z A;  2HEE A;  3HBH A;  5LVG A;  4DDA A;  3AW6 A;  3AGH A;  3AZ4 A;  3N9E A;  1HER A;  2BQK A;  2PC2 A;  4LYB A;  3ZVQ A;  4HTN A;  4LT3 A;  5B06 A;  4HTQ A;  2Z37 A;  4H90 A;  1GFJ A;  2YBI A;  1GHL A;  4XYY A;  3LZT A;  3FE0 A;  1D0M A;  4XJF A;  5HNL A;  3WUM A;  4C3W A;  1HEQ A;  9LYZ A;  3E3D A;  4J7V A;  1B5U A;  4ET8 A;  2DBT A;  4C5F A;  1LMQ A;  1LMN A;  2EKS C;  4HJY A;  1QSW A;  1MLC E;  4WG7 A;  1ZVH L;  5AMY A;  1E8L A;  1YIK A;  5LAF A;  4LYM A;  4WLT A;  1LMT A;  1G7J C;  1LTM A;  1OUJ A;  1RJC B;  2YVB A;  4GCC A;  2C8P A;  2BQB A;  1OUC A;  3WUL A;  1SQ2 L;  1PZY A;  3TXK A;  1NMM A;  1JTT L;  1LCN A;  1H6M A;  1FDL Y;  4GLV A;  1IP6 A;  4OOO A;  4TX7 A;  4XEN A;  2W1X A;  1LSF A;  5D5C A;  1W6Z A;  2ZQ4 A;  5LVJ A;  1DZB X;  5T3F A;  2MED A;  4H9C A;  4DD0 A;  4ZFP A;  2BLY A;  1JTP L;  3A91 A;  1VDQ A;  4WLY A;  1I20 A;  5I5Q A;  1ZVY B;  4ETE A;  2H9J A;  4OWH A;  5DM9 A;  1J1O Y;  2WAR A;  1LZE A;  2A7F A;  1BB5 A;  1IEE A;  3B6L A;  3TMU A;  3P4Z A;  4N5R A;  4B0D A;  2BQH A;  1JSF A;  4WO6 A;  3TXJ A;  1XEI A;  2Y8P A;  1V7S A;  4LYC A;  1GB7 A;  4ZEE A;  4LZT A;  5LYM A;  1XGR C;  1IWV A;  1G7L C;  1CKH A;  3TMW A;  3VWO A;  1IY4 A;  1GB9 A;  1KIP C;  2XBR A;  1GEZ A;  2BPU A;  3MGW A;  1GB2 A;  1YQV Y;  2FBD A;  5FEL A;  1HEN A;  1WQM A;  1B2K A;  2D4K A;  3WU8 A;  4YM8 A;  1UIC A;  1YAQ A;  1IP1 A;  4H9H A;  4NGV A;  1BQL Y;  4H9A A;  1YKY X;  1D6P A;  1A2Y C;  6LYZ A;  1LSZ A;  4OWE A;  5KXL A;  3TMV A;  1F0W A;  1AT6 A;  1LZC A;  2MEC A;  2NWD X;  4H94 A;  2Q0M X;  2XTH A;  1LZB A;  5I54 A;  5B59 A;  3CT1 A;  5HMJ A;  2YBL A;  3LZ2 A;  8LYZ A;  4WM5 A;  2IHL A;  1B5W A;  3HFM Y;  1JWR A;  3P68 A;  4H91 A;  5DN4 A;  1CJ9 A;  1FKQ A;  1Z55 A;  5KY1 A;  1GEV A;  5LIN A;  1BWH A;  2MEH A;  3EMS A;  3A90 A;  1UUZ C;  1I1Z A;  2B5Z A;  3A94 A;  4ML7 A;  5APC A;  1GFV A;  1HHL A;  1LSB A;  2N5Z A;  3ATN A;  2EQL A;  1LZ4 A;  1BB7 A;  3RZ4 A;  1DPX A;  1B5Y A;  4N9R A;  2HEF A;  4D9Z A;  4NG8 A;  1C46 A;  1BVK C;  1IC7 Y;  2Z2F A;  4DD2 A;  2BLX A;  3AZ5 A;  1YAN A;  1IP5 A;  4HV2 A;  4BAP A;  1LJJ A;  1B7M A;  1CJ6 A;  1YL0 X;  2CWI A;  2Z2E A;  1BGI A;  3A34 A;  4B4J A;  1GB5 A;  5KXS A;  1IOR A;  154L A;  2CJL A;  4NGL A;  4YEM A;  4NGZ A;  3D3D A;  3AZ7 A;  1P2C C;  1NHE A;  4DDB A;  3WUN A;  4WM3 A;  1LJE A;  4LFP A;  1T6V L;  1XSF A;  1HF4 A;  3D9A C;  1XGQ C;  3QY4 A;  2DQE Y;  1YAO A;  2DQG Y;  4Z41 A;  5F9U A;  3IWR A;  2ZNX Y;  2LYO A;  3ATO A;  1LSM A;  1VDT A;  2I6Z A;  5KXZ A;  4HJV A;  4G49 A;  1CNS A;  1B7S A;  5KXO A;  1JJ0 A;  3A96 A;  4H8Y A;  4XN6 A;  1LJ3 A;  1GF0 A;  3A67 Y;  1VDP A;  3EBA B;  4H9B A;  5LVK A;  3TXG A;  5FST A;  2G4P A;  3AB6 A;  4ETD A;  1NBZ C;  5LXW A;  2DQJ Y;  4NHS A;  4NHQ A;  1BWI A;  2HU3 A;  3LN2 A;  4BAF A;  1JHL A;  1D9U A;  1OQM A;  1YL1 X;  2BQG A;  3TXD A;  4TTD A;  3TXE A;  4DD1 A;  5A3Z A;  5J7C A;  1CKC A;  1GDW A;  3CB7 A;  4X3B A;  5ILC A;  1NQI A;  3WMK A;  1IWU A;  1GF7 A;  4XJI A;  4NHT A;  1UCO A;  1D0L A;  2ZYP A;  4PJ2 C;  1DXJ A;  3ULR A;  1VED A;  1G7I C;  3CSR A;  5DN5 A;  3W3E A;  2BQO A;  1DI5 A;  1IOQ A;  5F14 A;  2HEA A;  4L41 A;  1LAA A;  1LZG A;  4HP0 A;  1TAY A;  4WOA A;  1HFZ A;  4NWE A;  2IFF Y;  1LJH A;  4NGW A;  4J0L A;  1GWD A;  1AM7 A;  1IO5 A;  1VAU A;  2HU1 A;  2DQC Y;  4R6C A;  4WO9 A;  5FEK A;  3SP3 A;  4NEB A;  3W6D A;  4HV1 A;  1LJI A;  2MEA A;  3J4G A;  5C6I A;  1WQO A;  1JJ3 A;  1LSN A;  1CJ7 A;  1LMA A;  1LSC A;  1DKJ A;  3CSQ A;  3OK0 A;  1YAP A;  2D4J A;  1IP4 A;  1GD6 A;  2BQE A;  2FBB A;  4QGZ A;  3RNX A;  4E3U A;  1LSY A;  1DPW A;  3B72 A;  1LSE A;  4II8 A;  1GBY A;  2EPE A;  1WTM A;  4OWA A;  3A8Z A;  5L3H A;  5JEN B;  1GE1 A;  4QDN A;  208L A;  2ZIJ A;  4NGY A;  5KXN A;  4CJ2 A;  4CFO A;  1LJN A;  1LZA A;  4PRU A;  1LZ5 A;  3WVX A;  3W6A A;  1GXV 2;  1QDT A;  1YAM A;  4UWV A;  4RLN A;  4WM2 A;  5LYZ A;  4H1P A;  3RU5 A;  4W94 A;  1GF3 A;  4WLX A;  4W96 A;  1LZD A;  5A3E A;  1GBW A;  1CKD A;  3A95 A;  2DQI Y;  1JKA A;  1OUA A;  1HML A;  1REZ A;  3LYT A;  3RT5 X;  2I26 L;  2BQI A;  3WPJ A;  1WQN A;  1JUG A;  3M18 B;  1HEL A;  4I8S A;  1IOS A;  4KPM A;  4NGO A;  1IP3 A;  1LHK A;  2DQH Y;  4TSC A;  4Z46 A;  2BQC A;  1LJ4 A;  1GAZ A;  2ZWB A;  1GFT A;  1UAC Y;  1NF5 A;  3CT0 A;  5FHW A;  5HNC A;  3T36 A;  1B7L A;  1LZ8 A;  1J1P Y;  5APF A;  1IY3 A;  2HUB A;  1G7M C;  1PS5 A;  4XJB A;  1O23 A;  4WG1 A;  1DKK A;  3AW7 A;  1LYZ A;  2D91 A;  1D6Q A;  1JIY A;  5IDD A;  3TMX A;  4H9F A;  4CHX A;  5C6L A;  2BQM A;  3WW5 A;  1A4V A;  1GE3 A;  3QNG A;  1SLY A;  1UBZ A;  4LYT A;  1C43 A;  1LZS A;  4N1C C;  4QEQ A;  4B4E A;  4DD9 A;  1BB4 A;  5II3 A;  4BAD A;  4Z3M A;  2GV0 A;  4NGJ A;  3WVY A;  1QIO A;  1QTE A;  2DQF C;  1J1X Y;  133L A;  1XFP L;  1ZV5 L;  4G4C A;  1OUH A;  4HJZ A;  4KXI A;  4QY9 A;  1C45 A;  2MEG A;  1WQP A;  3CT5 A;  4CGE A;  1RE2 A;  1GDX A;  2I25 L;  3TXH A;  4EOF A;  2LZT A;  2W1M A;  4OW1 A;  3G3B B;  4NFV A;  3WXU A;  4GCE A;  3CQL A;  4LT2 A;  1KIR C;  1FLY A;  2Z39 A;  3GXR A;  1LOZ A;  5E4P A;  1GAY A;  4WLD A;  2W1Y A;  2YBJ A;  3AYQ A;  2LYZ A;  4H8X A;  1LHL A;  1UID A;  1GB0 A;  1NKH A;  2G4N A;  1LZ9 A;  4U3X B;  3WU7 A;  5KXM A;  1GPQ C;  3HBD A;  3WPL A;  3WUA A;  3LYM A;  5FCP A;  2CDS A;  4BS7 A;  5IHG A;  1DQJ C;  2F30 A;  2FYD A;  3M3U A;  6LYT A;  1JIT A;  4OOT A;  4DYG A;  2ZYC A;  4WL7 A;  1B5Z A;  4G4H A;  4ETB A;  2ZQ3 A;  2DQD Y;  1GF4 A;  4TWS A;  1LSA A;  1ZMY L;  4PHI A;  1IC4 Y;  1UIG A;  1TDY A;  1HC0 A;  4H9I A;  5D5F A;  4M4O A;  1TCY A;  1XGT C;  1B7O A;  2YSS C;  1LYO A;  1YKZ X;  1EQ5 A;  1OUI A;  4H92 A;  5M1Y A;  3K3T A;  194L A;  1DI3 A;  5KXR A;  4LT1 A;  1QTK A;  3EO5 A;  4PPO A;  1JTO L;  1GE0 A;  4Z98 A;  4GCB A;  4RW1 A;  4M6D A;  2RSC A;  4I0C A;  1GFG A;  135L A;  1IWT A;  1HFX A;  1RFP A;  1VFB C;  1FLU A;  5APD A;  2ZNW Y;  5F16 A;  1V7T A;  1FKV A;  3W6B A;  5KXW A;  4GCD A;  2FYC A;  1IOT A;  4LT0 A;  1GB6 A;  1W08 A;  1BVX A;  4LGK A;  1OUF A;  3OJP A;  4NHP A;  3RW8 A;  1HNL A;  3W6C A; 
#chains in the Genus database with same CATH topology
 1CU2 A;  3GUJ A;  1ZAE A;  4DWX A;  4W5W A;  1QUD A;  2BQA A;  2FH0 A;  2L7I A;  2WSC F;  2RBR A;  1L98 A;  4NGI A;  2Y21 A;  3K9O A;  2W82 A;  4DR6 M;  1C68 A;  1QS5 A;  2F4A A;  1SXJ E;  1JJ1 A;  1G7H C;  5LA5 A;  4O34 A;  1AT5 A;  1QQY A;  1QS9 A;  1L10 A;  1HEW A;  1D2W A;  4W55 A;  5KPT A;  2YDG A;  148L E;  2F2N A;  3UZU A;  4DQ7 A;  5I53 A;  2JY5 A;  1B5X A;  201L A;  4GCF A;  3GPP A;  1UIE A;  4JV5 M;  1F6S A;  4OWC A;  2O01 F;  3SAS A;  1N33 M;  1IWY A;  3IJV A;  1UM8 A;  3FTC A;  1R2Z A;  2KNA A;  1UIA A;  3AGI A;  1B9O A;  1CKF A;  1L53 A;  142L A;  2Z6B A;  2ZIL A;  4AGA A;  4QNR A;  3A93 A;  2ZIK A;  3GRV A;  1C7P A;  3W6F A;  5K7O A;  2DAM A;  5B05 A;  3CSZ A;  122L A;  3VDP A;  1CTW A;  1QAM A;  1W5S A;  1LYS A;  1L05 A;  1GBS A;  1LKS A;  1GE4 A;  1N4F A;  1D3N A;  3TXB A;  4J1B A;  4UWU A;  3LYZ A;  4F1I A;  4H93 A;  1L30 A;  1QSA A;  1CV6 A;  4B4I A;  1WVV A;  1XC8 A;  3FRH A;  3C58 A;  5ITY A;  4I7T A;  3JAM S;  1DV0 A;  3CDO A;  1B5V A;  248L A;  4AXT A;  1LYH A;  4HTK A;  1SXJ A;  7CAT A;  3UJN A;  249L A;  4XJH A;  3AOG A;  2BQJ A;  3W6E A;  3I4Y A;  1UA6 Y;  4CGY B;  4RF0 A;  5IEL A;  4CFP A;  2DWM A;  4NG1 A;  1D2N A;  1IFY A;  3LHM A;  5KXY A;  3V2W A;  1UIB A;  1KYI A;  3BXW A;  1RI8 B;  2B6Y A;  3KS4 A;  4EKQ A;  5KKJ A;  5DYG A;  4M9S A;  5L9J A;  1JKC A;  4DUY M;  1C6K A;  1D0K A;  5HMV A;  4LJ5 A;  1T97 A;  227L A;  141L A;  3SMP A;  1QUO A;  5HQ1 A;  4I7J A;  3HT7 A;  3DNA A;  2MEB A;  4IJ4 A;  3GUP A;  3KAM A;  2RH1 A;  4LFB M;  1P6Y A;  2LH0 A;  1H87 A;  5IWA M;  3J6K A;  4WM4 A;  2XSZ D;  1INU A;  3C80 A;  1XEK A;  5IZ7 D;  5DYI A;  1QYR A;  132L A;  4RNA A;  3TXF A;  226L A;  1P2R A;  166L A;  213L A;  5B07 A;  1IX0 A;  1XEJ A;  2NTH A;  3NY8 A;  1KY1 A;  1L73 A;  1LHM A;  4JN6 A;  4B3M M;  3AJN A;  4RW2 A;  2QP9 X;  1GF9 A;  2OE9 X;  3WW6 A;  1QZE A;  3C82 A;  4RKU F;  4B49 A;  2LHC A;  4NIJ A;  1JIS A;  1DGB A;  1L16 A;  3T15 A;  2QBY B;  1LMP A;  4YXA C;  2KZU A;  4LJ4 A;  3SFZ A;  1CVK A;  2RB2 X;  6LZM A;  3LQQ A;  3NBI A;  3B7Z A;  4KHP M;  2E5L M;  3HHW A;  2JNH A;  1JTM A;  1P7S A;  2F4G A;  1VDS A;  3KSX A;  2VB1 A;  2LZ2 A;  2Z12 A;  3CDV A;  3HU8 A;  1BWJ A;  137L A;  153L A;  3ZH9 B;  1T3P A;  1LPI A;  1YIL A;  3U6M A;  3MK6 A;  3KP1 E;  4H8Z A;  3SB6 A;  5LVG A;  3N9E A;  2BQK A;  3ZVQ A;  4LYB A;  1GFJ A;  234L A;  3FE0 A;  3WUM A;  9LYZ A;  4ET8 A;  3G3W A;  4EKR A;  1EE8 A;  4JI0 M;  1L22 A;  1LMQ A;  2EUC A;  2XQO A;  4HJY A;  247L A;  2XFT A;  2VDB B;  4LRT A;  1DYD A;  2XSZ A;  4KO8 A;  4PJZ A;  1L28 A;  173L A;  1ZVH L;  5AMY A;  1ZYT A;  3NBX X;  5LAF A;  4LYM A;  1LTM A;  2KDL A;  4PDG A;  2BQB A;  2AHM A;  3VLF B;  2RGO A;  1LCN A;  1H6M A;  1P56 A;  4TX7 A;  2C5R A;  170L A;  4I7O A;  3HHY A;  1DZB X;  3ZC7 B;  4EXM A;  2MED A;  235L A;  2OOB A;  3RGS A;  1L72 A;  1JTP L;  3A91 A;  2RAZ X;  4FW9 A;  1ZVY B;  1NHG C;  2H9J A;  5DM9 A;  1J1O Y;  1QUH A;  4B0D A;  2BQH A;  1JSF A;  4LDO A;  3K2L A;  1GB7 A;  4ARP A;  5LYM A;  1P2L A;  1OFI A;  1E32 A;  4NXN M;  1P36 A;  183L A;  1S3S A;  1L33 A;  3MGW A;  5FEL A;  2HHH M;  1L29 A;  1YAQ A;  1LYJ A;  3K9P A;  3K1J A;  4LRS A;  3DN0 A;  1SG9 A;  182L A;  1L77 A;  1C63 A;  4PT5 A;  6LYZ A;  1L49 A;  5H37 D;  1C6B A;  2MEC A;  2NWD X;  1VDL A;  4W54 A;  8LYZ A;  3LZ2 A;  4FD2 A;  1PJS A;  3QYB A;  2VF8 A;  4X66 M;  4WM5 A;  2IHL A;  1B5W A;  3KW6 A;  4I81 A;  4IBG A;  5IRE B;  4AW4 A;  1PQD A;  4ARM B;  1YSY A;  1CJ9 A;  1Z55 A;  1W5T A;  1GEV A;  1TLA A;  1L07 A;  3ODU A;  1ORY B;  1PJT A;  2F5N A;  1LSB A;  3U6E A;  2MJ5 B;  4NL4 H;  1L13 A;  4W59 A;  8CAT A;  1DPX A;  144L A;  1B5Y A;  4D9Z A;  2EO2 A;  2JP7 A;  4S12 A;  1L66 A;  1C46 A;  1IC7 Y;  2LHG A;  4DD2 A;  2BLX A;  1L79 A;  1L90 A;  1IP5 A;  1CV4 A;  4HV2 A;  1LJJ A;  1B7M A;  159L A;  181L A;  2CWI A;  3HU1 A;  4DV6 M;  2F47 A;  2X8A A;  2UU9 M;  4NGL A;  3JR5 A;  3HHX A;  4II7 A;  1WXQ A;  1G07 A;  1C66 A;  1LJE A;  4L8R C;  1NY6 A;  5FTM A;  1HF4 A;  2RAY X;  3RUN A;  3KOZ E;  4Z41 A;  172L A;  230L A;  3ILK A;  3GLF E;  3ATO A;  3BOS A;  2I6Z A;  3C3D A;  1JJ0 A;  2ZTD A;  3PVS A;  4B7H A;  2LVO C;  1L50 A;  3A67 Y;  5LVK A;  1VDP A;  2UUC M;  3VKH A;  5KO3 A;  2M60 A;  3C81 A;  5LXW A;  4NHS A;  1N77 A;  1P3Q Q;  1EIJ A;  4NHQ A;  3AJI B;  4GEW A;  2JY7 A;  1JHL A;  1XEP A;  1JB0 F;  3TXD A;  4IIW A;  3CB7 A;  3U6P A;  5C1B A;  4XJI A;  4NHT A;  2KNV A;  1L15 A;  224L A;  1DXJ A;  4HEO A;  4M0D A;  3W3E A;  4LF5 M;  2BQO A;  3KOX E;  1DI5 A;  1IOQ A;  1NY5 A;  1L76 A;  1MU5 A;  1DYA A;  3DMZ A;  1QUG A;  2APL A;  1TAY A;  1HFZ A;  4NWE A;  4J0L A;  1GWD A;  1AM7 A;  1IO5 A;  1C61 A;  1VAU A;  2HU1 A;  3SP3 A;  245L A;  3E21 A;  1WQO A;  1L47 A;  168L A;  3SAU A;  1IP4 A;  1LSE A;  4II8 A;  3GQ5 A;  184L A;  4OWA A;  1LYD A;  1L00 A;  1T43 A;  3GLF A;  3HJ8 A;  2GQF A;  4R3D A;  3GQ3 A;  4NGY A;  5KXN A;  2OO9 A;  1LZA A;  1L44 A;  1LZ5 A;  3JR4 A;  4JI5 M;  3U60 A;  3RU5 A;  2DVW B;  1LZD A;  5A3E A;  1GBW A;  4GMQ A;  4L15 A;  167L A;  1JKA A;  3GUL A;  4GIP A;  5BR8 M;  2DWL A;  4I8S A;  4KPM A;  1KFV A;  3F92 A;  4Z46 A;  3HDF A;  2Z7J A;  185L A;  2LTU A;  5FHW A;  5HNC A;  1SWZ A;  1B7L A;  1QTD A;  3T36 A;  1IY3 A;  1G7M C;  3DN1 A;  4W58 A;  1C6I A;  1DKK A;  3M6A A;  1D6Q A;  4H9F A;  2DAI A;  3C8Q A;  5KQD A;  3B74 A;  1L39 A;  4IBK A;  1LZS A;  1OWZ A;  4B4E A;  2CRU A;  2OE4 X;  4DD9 A;  2XEP A;  2VQE M;  4DV4 M;  4BAD A;  1SXJ B;  1L12 A;  1QTE A;  1J1X Y;  1XFP L;  2CE7 A;  3MMP A;  1QQW A;  1PQK A;  3CT5 A;  4NC6 A;  2B74 A;  1XB2 B;  5E26 A;  4GRV A;  4CGE A;  3MJ5 A;  5ITT A;  256L A;  2W1M A;  1G0K A;  3G3B B;  3FA0 A;  5A2Q S;  3KS8 A;  4HL4 A;  5E4P A;  1GAY A;  1L94 A;  1P46 A;  2R0I A;  1MN3 A;  2LYZ A;  1LHL A;  1GB0 A;  2G4N A;  1LZ9 A;  5EXT A;  244L A;  1B5Z A;  4G4H A;  2ZQ3 A;  3L26 A;  1GF4 A;  152L A;  1ZMY L;  113L A;  3GUI A;  1QT7 A;  2JZ1 A;  1TDY A;  2G8L A;  2RBP A;  1HC0 A;  1MJG M;  232L A;  1TCY A;  198L A;  4Z6Y A;  1PJJ A;  1G0L A;  2DNA A;  1L70 A;  4BLC A;  4H92 A;  1CU0 A;  3EO5 A;  4PPO A;  1G1V A;  4GCB A;  4M6D A;  5I14 A;  1QT5 A;  1I4W A;  135L A;  1VFB C;  2ZNW Y;  1V7T A;  1L67 A;  1E9S A;  3KSJ A;  4GCD A;  4LJ8 A;  1IY0 A;  2RGH A;  3TE6 A;  1LGX A;  1CU5 A;  1DYC A;  3N9A A;  4G4B A;  4NSI A;  4OWB A;  2KNZ A;  3KP0 E;  238L A;  1GFA A;  2HEB A;  1C6T A;  1GFE A;  4DV3 M;  1IN4 A;  4DR1 M;  4AZF A;  1HEO A;  1G0P A;  1GF5 A;  1GB8 A;  1LHJ A;  4GHA A;  1C08 C;  5C6J A;  1XJT A;  1UIF A;  4YHH M;  1GF8 A;  3HU2 A;  1LSD A;  120L A;  4MCK A;  1KY0 A;  3D8B A;  3QAK A;  190L A;  3J80 S;  2X0A A;  4W51 A;  2C98 A;  4FWG A;  4MH0 E;  1HEP A;  2LHM A;  1XGU C;  3BKH A;  3ZVQ B;  4GN5 C;  2DQA A;  3CF2 A;  2XZU A;  3A3R X;  3Q8X A;  4GN3 A;  103L A;  1IWW A;  1LI3 A;  1R5L A;  3J81 S;  217L A;  4YF2 A;  1JSE A;  4QNM A;  4AQN A;  107L A;  2YQZ A;  2G3Q A;  1L45 A;  1L59 A;  1FLQ A;  1GFK A;  1LGU A;  1L99 A;  2BWB A;  4HSF A;  1IR7 A;  4A3V B;  5KKI A;  4KT3 A;  2EJS A;  1WQQ A;  1LJK A;  4J1A A;  1OWY A;  3I4V A;  1OUE A;  4PGJ B;  5EP4 A;  2BQD A;  3LCU A;  156L A;  2OOA A;  1GFU A;  2R18 A;  1HSX A;  5LA8 A;  3P65 A;  3FAD A;  4WM1 A;  2OU9 A;  1B7Q A;  1EFU B;  145L A;  1LSG A;  3L28 A;  3IHP A;  2R4E A;  207L A;  3HT6 A;  3P66 A;  4TUN A;  5F81 A;  1GKI A;  4JI1 M;  4MR1 A;  3ZEK A;  2M5Z A;  1JQJ C;  1MEL L;  3B0I A;  2D7H A;  3OE6 A;  2HL7 A;  3OE8 A;  1IR9 A;  4NGK A;  2CUZ A;  5BPV A;  2HUK A;  3DMV A;  3JR6 A;  3R9X B;  4I4L A;  1L11 A;  2MEE A;  4GLA A;  1L19 A;  2W1L A;  1TH4 A;  1WGN A;  4W57 A;  3HT9 A;  1K3W A;  3AV0 A;  4RLM A;  2KZS A;  3TL4 X;  2JUJ A;  158L A;  1QUS A;  2OQ4 A;  3T1Y M;  3AGG G;  1GLN A;  4I7Q A;  5APE A;  4B7F A;  4DDC A;  4IAS A;  4WMG A;  3BBZ A;  4ARL A;  1LYG A;  1F6R A;  3WU9 A;  1B7R A;  2B72 A;  3GUO A;  5DFL A;  2Z19 A;  4DAJ A;  3IG5 A;  1OIP A;  3HHZ A;  2B3T A;  1D9W A;  1GBX A;  2CHV A;  2C8O A;  5FDJ A;  1C6G A;  2A5Y B;  1BB3 A;  2XBS A;  1AKI A;  4FJR A;  1BB6 A;  2WSF F;  1CU6 A;  2LC9 A;  1ZQ9 A;  189L A;  5LVI A;  1J7K A;  3FD9 A;  1L09 A;  1LMC A;  2MEF A;  4LG2 A;  3A98 B;  4I7L A;  4LF4 M;  2H5Z A;  1HFY A;  5FTJ A;  3DN2 A;  1C6F A;  4IJF A;  3M7G A;  4GC9 A;  1OJL A;  1C60 A;  1LGW A;  3HX3 A;  2A7D A;  4NWH A;  1SXJ D;  1CX6 A;  1LV7 A;  2C9O A;  4H9E A;  1DI4 A;  3C83 A;  3C7W A;  4LJ6 A;  1L23 A;  5F9X A;  1NHB A;  3C9P A;  2D6B A;  1L34 A;  2F5S A;  1A5T A;  1JEF A;  3BKV A;  4WL6 A;  1R4G A;  1TBY A;  4OO9 A;  3WPK A;  2CHQ A;  2QAR C;  4DDA A;  2V1U A;  1OVJ A;  4LT3 A;  1JR3 E;  114L A;  1CV3 A;  2YBI A;  1GHL A;  1N32 M;  4XYY A;  175L A;  1D0M A;  5HNL A;  2CWB A;  2YNM D;  1B5U A;  1IN7 A;  4GKJ M;  2KRK A;  1LMN A;  2EKS C;  4JI3 M;  3FTF A;  1G71 A;  3E9S A;  1QSW A;  1MLC E;  4WG7 A;  2N35 A;  1YIK A;  2DAG A;  4B08 A;  4WLT A;  4W56 A;  1OUC A;  2HWJ A;  1L03 A;  3C7Z A;  4OVZ A;  4GH9 A;  2LXE A;  2R62 A;  5D5C A;  1L2B A;  1L25 A;  2ZQ4 A;  5LVJ A;  111L A;  3GQ4 A;  2DWN A;  3FUT A;  4ZFP A;  4FCT A;  4WLY A;  1I20 A;  2DHR A;  2RKO A;  4ETE A;  1L04 A;  1L41 A;  2RB0 X;  3FRI A;  1G0M A;  1IEE A;  2FE8 A;  2JA2 A;  3TPZ A;  4WO6 A;  3PXG A;  3GLF B;  2H5X A;  4LZT A;  2LWX A;  3GLG B;  1IN8 A;  1IY4 A;  1K3X A;  1GB9 A;  1KIP C;  3U60 B;  3RZE A;  1NJG A;  1N34 M;  1HEN A;  4YM8 A;  5DNY A;  1IXZ A;  1JR3 A;  3HH3 A;  1BQL Y;  4H9A A;  1YKY X;  4W52 A;  2C96 A;  1TH3 A;  4OWE A;  4EKP A;  4LJ7 A;  1F0W A;  3FUV A;  3EML A;  2OU0 X;  1D2Y A;  2XTH A;  5B59 A;  2HUM A;  5HMJ A;  2YBL A;  3SB8 A;  1NV9 A;  3VK7 A;  1F4I A;  1IN6 A;  5EP1 A;  3U6L A;  4H91 A;  5EXS A;  219L A;  4WP2 A;  5LIN A;  3KOW E;  2NQ8 C;  2MEH A;  4G4R A;  3EMS A;  3A90 A;  2MRO B;  1HHL A;  1CUQ A;  2N5Z A;  1L20 A;  3GRU A;  174L A;  2CV1 A;  2HEF A;  3HUQ A;  4JI7 M;  3HKP A;  2Z2F A;  2Q9D A;  1YAN A;  4BAP A;  1XMQ M;  1LYF A;  1L71 A;  4B4J A;  1GJS A;  4X65 M;  3KFU G;  2CJL A;  2DEN A;  4NGZ A;  3D3D A;  3AZ7 A;  3ZCB B;  1KSF X;  1NHE A;  2BJW A;  1QTH A;  2Q9E A;  4LFP A;  108L A;  1T6V L;  1XSF A;  2VII A;  4AQY M;  1YAO A;  2DQG Y;  1L52 A;  5F9U A;  1PJQ A;  2OTY X;  1QSB A;  2LYO A;  1UFZ A;  3GLH E;  4G49 A;  5KXO A;  3HJQ A;  2OPF A;  1SXJ C;  2L7H A;  4XN6 A;  1P5C A;  1LJ3 A;  4H9B A;  5FST A;  3EIH A;  4PK0 A;  4EJ4 A;  2V1C A;  2LNH C;  2I7N A;  2EKK A;  3LN2 A;  3VW7 A;  3RGP A;  4BAF A;  1IBL M;  1D9U A;  1OQM A;  1P64 A;  4WW0 A;  4TTD A;  4YY3 M;  4DD1 A;  5A3Z A;  2OEA X;  3QAU A;  1CKC A;  220L A;  1GDW A;  231L A;  4X3B A;  4OX9 M;  3DN3 A;  3LZM A;  1P37 A;  1XNQ M;  4E97 A;  1TDZ A;  1L68 A;  4LFA M;  1L55 A;  1L01 A;  3WMK A;  1GF7 A;  251L A;  3C3E A;  1D0L A;  3ULR A;  191L A;  1CV0 A;  4DQJ A;  4R71 A;  2JWS A;  4DUZ M;  1QAO A;  1LAA A;  4LJ9 A;  4WOA A;  4LZZ A;  1LJH A;  1OQY A;  205L A;  5FEK A;  4LGY A;  3B9P A;  3W6D A;  4HV1 A;  1NJF A;  5C6I A;  5IT9 S;  1LSN A;  1CJ7 A;  1DGH A;  1L31 A;  4NRW A;  1LSC A;  2D4J A;  4E3U A;  4QGZ A;  1G59 A;  1DPW A;  1LSY A;  3B72 A;  3NWL A;  1GBY A;  3PNY A;  1L43 A;  1WTM A;  3A8Z A;  4B3R M;  3R8F A;  4CJ2 A;  3GLH A;  1LJN A;  4PRU A;  1MX0 A;  3W6A A;  1GXV 2;  5ITQ A;  1YAM A;  2D7G A;  2ANV A;  4DV0 M;  4AKG A;  3CDT A;  1GF3 A;  2HUL A;  4DQ5 A;  1HNZ M;  1Q3B A;  1LPY A;  2B7X A;  1QTB A;  2BQI A;  2RBN A;  1GAB A;  218L A;  4DR3 M;  1JUG A;  1HEL A;  1QZM A;  4TSC A;  1LHK A;  3KVW A;  5JI2 E;  1LJ4 A;  3SBA A;  1GFT A;  2JY6 B;  1QT3 A;  4IBJ A;  1HR0 M;  2HUB A;  1PS5 A;  4NRV A;  3AW7 A;  2D91 A;  2KEB A;  4CHX A;  3B7Q A;  5C6L A;  2RBO A;  2BQM A;  3EIE A;  4L6V 6;  2B70 A;  1A4V A;  1NNU C;  4I7N A;  3SHF A;  4LDL A;  1TTE A;  3G3V A;  2Y20 A;  2Y0Q A;  3M0E A;  2GV0 A;  1QIO A;  1ZV5 L;  4QY9 A;  210L A;  4G4C A;  1ZV1 A;  1RE2 A;  1GDX A;  2I25 L;  2CV0 A;  2XZF A;  4PD2 A;  3DA1 A;  5LMN M;  3GXR A;  2Z39 A;  150L A;  2ANX A;  4H8X A;  1D3F A;  1L85 A;  1UID A;  3C8R A;  1C62 A;  4X62 M;  1SWY A;  2CDS A;  2FYD A;  1JIT A;  4OOT A;  143L A;  1L93 A;  2ZYC A;  4WL7 A;  4DYG A;  2OE7 X;  4PHI A;  1CV1 A;  1HT1 E;  2KA6 B;  1L65 A;  2B6W A;  1HNX M;  2QEN A;  3DN8 A;  5D5F A;  2YSS C;  3AOE A;  1LYE A;  1XJU A;  4QOS A;  1EQ5 A;  2HCB A;  1IY2 A;  3K3T A;  1DI3 A;  3OTO M;  5KXR A;  4LT1 A;  3J7A S;  1QTK A;  209L A;  4Z98 A;  3T38 A;  4I0C A;  1GFG A;  1HFX A;  1FLU A;  4X64 M;  2FYC A;  4IBD A;  1TDH A;  4LT0 A;  4DJH A;  1GB6 A;  1OUF A;  3OJP A;  1HNL A;  3W6C A;  1YRO A;  1IQP A;  2L4F A;  1OUG A;  165L A;  2ZAM A;  4PDI A;  4EPF A;  1OKS A;  5LYT A;  1FN5 A;  5L3I A;  4PCZ A;  3UK6 A;  3F6Z A;  4DV7 M;  1GB3 A;  4I5S A;  4FDY A;  4IBF A;  4TSB A;  1EQE A;  4NHI A;  2BQN A;  2EKF A;  5LMU M;  3W67 A;  2CGI A;  4DR2 M;  2AUB A;  1Y8G A;  1REM A;  2LBC A;  2HTX A;  5E9R A;  2B73 A;  4HPI A;  2XJW A;  4S0W A;  4LGM A;  4NSH A;  1G0Q A;  4DT3 A;  5FSW A;  4MGY E;  1L17 A;  1WQR A;  4DD3 A;  4W53 A;  1L40 A;  1XGP C;  1JKD A;  5KXX A;  2O7A A;  3VK8 A;  1KXY A;  1OUB A;  4EMN A;  180L A;  2B6Z A;  4KT0 F;  139L A;  3HTD A;  4ET9 A;  3J27 B;  2BQF A;  3LVW A;  1GBO A;  2ZAN A;  1NWG A;  2YBN A;  2K9D A;  1L95 A;  4NSG A;  1Z6T A;  1XMO M;  2DKV A;  3EXD A;  258L A;  2DHY A;  1IWZ A;  3AFH A;  1WTN A;  1B0D A;  3U6Q A;  3GPU A;  1IIZ A;  5HLL A;  200L A;  147L A;  1REY A;  1GL7 A;  3SAW A;  3A3Q A;  255L A;  3KXE C;  130L A;  1LZY A;  1IVM A;  1IWX A;  2HAK A;  3B0O A;  1LZR A;  2DXI A;  1AIP C;  1B7P A;  2BQL A;  5KXT A;  1C10 A;  1L69 A;  1NO1 A;  1DGG A;  1GFR A;  1PQO A;  134L A;  2HEC A;  3LYO A;  4HPE A;  1L81 A;  3TWL A;  5LAG A;  4R7G A;  260L A;  3GPY A;  4NY5 A;  1AZF A;  4CIS A;  193L A;  5KJ9 A;  1IC5 Y;  1UIH A;  1CKG A;  3GXK A;  4B3T M;  1RCM A;  1QDR A;  3J7B A;  1L35 A;  3L2A A;  2QPA A;  3DOA A;  1LHI A;  4YOP A;  109L A;  2ZBK B;  4FVM A;  4KL7 A;  1H6U A;  160L A;  4K5Y A;  4IBE A;  2DKL A;  5EXP A;  5L8R F;  3DKE X;  2XH9 A;  4AKH A;  2H9K A;  2JY8 A;  2YBH A;  2QHO B;  1ALC A;  1T6H A;  4NSJ A;  1F10 A;  4XK8 F;  1Z5B A;  4DV5 M;  1YKX X;  1LHH A;  1GFH A;  1L0J A;  1JKB A;  4ZPX A;  4A7D A;  123L A;  176L A;  4NSO B;  1V33 A;  4D82 A;  1L84 A;  1OFH A;  1UC0 A;  3RFW A;  1L08 A;  1GBZ A;  4B1A A;  2B6T A;  2D7E A;  1LZ6 A;  4BB9 A;  3AZ6 A;  4ETC A;  5ILF A;  125L A;  4F2L A;  4N1E I;  1ZMW A;  2RBS A;  3K8Z A;  2FOI C;  1VAT A;  2R6F A;  4N8Z A;  3WYH A;  5LZM A;  229L A;  1SSY A;  4LYZ A;  2MGW A;  1L21 A;  1C6H A;  4LCB A;  233L A;  4R0F A;  3FTD A;  2D4I A;  2Z4S A;  1LYY A;  1BHZ A;  1C6D A;  1LJF A;  4JI2 M;  4GN4 A;  4WM6 A;  4KOD A;  4LF8 M;  1X37 A;  2KXE A;  1L57 A;  2DWZ B;  7LYZ A;  4IBC A;  223L A;  2XFS A;  3T6P A;  3T1H M;  3E4R A;  2P5T A;  261L A;  3LW5 F;  1HSW A;  5EP3 A;  1K82 A;  3HT8 A;  3FYD A;  1IP7 A;  1LKR A;  2UXD M;  3A6C Y;  146L A;  149L A;  2RB1 X;  3I51 A;  2HEE A;  3HBH A;  2CV2 A;  1L51 A;  3CF6 E;  3AGH A;  3AZ4 A;  1HER A;  4D81 A;  1PM5 A;  164L A;  2PC2 A;  1N36 M;  4HTN A;  239L A;  5B06 A;  4FWD A;  2L78 A;  1QTV A;  3LZT A;  4C3W A;  1NNJ A;  3THG A;  2DBT A;  3SB9 A;  3I04 M;  1DGF A;  1L88 A;  4RF1 A;  1E8L A;  1XXH E;  1NVM A;  3WHL A;  1LMT A;  1ZMU A;  1G7J C;  1R6B X;  2ZTC A;  2F32 A;  1OUJ A;  1RJC B;  4GCC A;  1CU3 A;  4IJE A;  4P16 A;  3WUL A;  1OAO C;  1Q39 A;  1PZY A;  1SQ2 L;  4MB7 A;  1T6O A;  1JTT L;  1QTC A;  2O5R A;  1E94 E;  3A42 A;  4XEN A;  1I94 M;  1W6Z A;  1OVK A;  5T3F A;  2UUB M;  4H9C A;  2BLY A;  1GL6 A;  1VDQ A;  1TH2 A;  5I5Q A;  4OWH A;  1KW7 A;  1DGH B;  2R44 A;  2WAR A;  1LZE A;  2A7F A;  1BB5 A;  3TMU A;  1C1K A;  4REZ A;  4N5R A;  1LWG A;  1XEI A;  119L A;  2O79 A;  3GLH B;  1XGR C;  3TWM A;  4LY6 A;  1G7L C;  2CUU A;  3VWO A;  2XBR A;  2R45 A;  2BPU A;  2Z3X A;  2FBD A;  4ZPU A;  2D4K A;  1B2K A;  4H9H A;  4NGV A;  2GNO A;  2CFO A;  3FE3 A;  4AG6 A;  4IAP A;  1C65 A;  1L2D A;  4JI6 M;  2HKJ A;  3AL0 C;  2Q0M X;  1LZB A;  1G41 A;  3CT1 A;  250L A;  4LZJ A;  1XXH A;  3HFM Y;  1JWR A;  1DO0 A;  3P68 A;  5DN4 A;  1C64 A;  4GC5 A;  1LYI A;  2I7P A;  1L06 A;  4I7M A;  2LVQ D;  4NOO B;  2DZO B;  1I1Z A;  3A94 A;  4ML7 A;  5APC A;  1DYE A;  3ATN A;  2EQL A;  1FJG M;  3RZ4 A;  3GUN A;  4N9R A;  2Q2E B;  2RBQ A;  4KLN A;  4AKI A;  1BVK C;  241L A;  2NTG A;  1IBM M;  186L A;  4B3S M;  4LF7 M;  3HH4 A;  1GB5 A;  5KXS A;  154L A;  3SC3 A;  2DAE A;  4WUR A;  4YEM A;  2F4V M;  3C8S A;  1Z59 A;  1P2C C;  1NSF A;  1L27 A;  222L A;  3QY4 A;  2QSF X;  2A4T A;  2R46 A;  2ZNX Y;  192L A;  2L2D A;  1VDT A;  2R65 A;  237L A;  4HJV A;  1CNS A;  1B7S A;  4H8Y A;  151L A;  3DMX A;  1HQC A;  1GF0 A;  3EBA B;  3TXG A;  2J7O A;  2KHH A;  2G4P A;  1JR3 D;  4ETD A;  1NBZ C;  1QAN A;  4UN2 B;  253L A;  2LVP C;  5EJC A;  2HU3 A;  3SB7 A;  4B7G A;  1L42 A;  1C6E A;  3TXE A;  4LFC M;  1CV5 A;  3I01 M;  1C6M A;  5ILC A;  1NQI A;  1UCO A;  5KPZ A;  3A45 A;  2ZYP A;  4PJ2 C;  4ARJ A;  1GVN A;  3CSR A;  1HT2 E;  3FYC A;  5FTK A;  2X4A A;  1C6Q A;  1LZG A;  2BNK A;  3U6D A;  1IXS A;  4NGW A;  3CF0 A;  4WO9 A;  2DQC Y;  4R6C A;  3FUW A;  1PQJ A;  2MEA A;  1FNN A;  3GPX A;  1LMA A;  3OK0 A;  1OAI A;  1IM2 A;  1WGL A;  2BQE A;  3GRY A;  3RNX A;  118L A;  2Y0T A;  1PRB A;  5L3H A;  1GE1 A;  4LDE A;  1WR1 B;  1LLH A;  208L A;  3C7Y A;  4QDN A;  3FI5 A;  4CFO A;  3HDE A;  1Q3C A;  131L A;  4K0K M;  3WVX A;  4UWV A;  5FTN A;  3K2R A;  5LYZ A;  1Q02 A;  3LMM A;  3FKE A;  4CIZ A;  2XLJ A;  1T8A A;  1QVR A;  128L A;  3HUK A;  3HU3 A;  1HML A;  1REZ A;  2G5G X;  3FTE A;  3RT5 X;  1OV5 A;  3UGJ A;  3WPJ A;  1SSW A;  1WQN A;  3UMM A;  4NGO A;  1IP3 A;  2BWE A;  3U61 A;  2BQC A;  5EP2 A;  1GAZ A;  1UAC Y;  2XF3 A;  3QYE A;  1PQI A;  2K47 A;  1LZ8 A;  1YLA A;  5APF A;  1NHW C;  2FNA A;  1LYZ A;  2O25 A;  1T8G A;  1IXR C;  3WW5 A;  1GE3 A;  1SLY A;  243L A;  3OE9 A;  2R4J A;  3V2Y A;  4N1C C;  4QEQ A;  1VDD A;  1BB4 A;  5II3 A;  4Z3M A;  4NGJ A;  2DQF C;  4KXI A;  199L A;  1OUH A;  4AI6 A;  188L A;  4G6Z A;  1Z5C A;  4MGH A;  3TXH A;  1NV8 A;  4EOF A;  4DBG B;  3HH6 A;  4JXJ A;  4OW1 A;  4NFV A;  4NSR A;  3CQL A;  1QT6 A;  2YBJ A;  1L56 A;  3AYQ A;  3L2X A;  3WU7 A;  5KXM A;  3WPL A;  3CTW B;  3LYM A;  5FCP A;  4BS7 A;  2F30 A;  6LYT A;  3M3U A;  1L74 A;  1VEK A;  5C18 A;  4JI4 M;  2FFJ A;  3L25 A;  3SYK A;  3U5Z A;  4M4O A;  1VEJ A;  1XGT C;  1B7O A;  1LYO A;  1YKZ X;  3HY5 A;  2KRU A;  1OUI A;  1V34 A;  2ERC A;  5FLX S;  4QOZ C;  1KNI A;  4I7S A;  1JTO L;  1Z5A A;  4CHT B;  3HJS A;  2Z4R A;  1IWT A;  5APD A;  4L16 A;  1RFP A;  5F16 A;  3W6B A;  3WUN A;  1VQ1 A;  196L A;  5KXW A;  1QTZ A;  236L A;  1IOT A;  3RW8 A;  1W08 A;  4NHP A;  4GBR B;  1G4A E;  1TR8 A;  1L63 A;  1OV7 A;  3HH5 A;  3HGI A;  5DL9 A;  3SAR A;  4D80 A;  4LZM A;  1CJ8 A;  3GLI E;  1OIZ A;  4QHT A;  2F5Q A;  195L A;  5EBH A;  2BAA A;  5KXP A;  1C6A A;  7LZM A;  2HED A;  2UXC M;  215L A;  4RDS A;  242L A;  4IBI A;  3A6B Y;  4LYO A;  4XJD A;  1YUB A;  1L82 A;  4UWN A;  1L87 A;  4YEN A;  1C67 A;  5B1G A;  4M9Z A;  4QHS A;  1L32 A;  3HBE X;  1GXX A;  5LIO A;  1NDM C;  3LVV A;  1TF0 B;  1LMO A;  2QQ8 A;  4P17 A;  4YX7 C;  3A46 A;  4DD7 A;  3A92 A;  3LQR A;  3SAT A;  3SHG B;  4OW0 A;  4DR4 M;  4MGI E;  3WH1 A;  4L4U A;  4LFX A;  2CHG A;  5GKN A;  4OU7 A;  4G4O A;  1C6C A;  3G3X A;  5I4W A;  1NDG C;  214L A;  4FWH A;  1R7R A;  1HEM A;  3IJU A;  1OUD A;  2Z38 A;  3KOY E;  1G0G A;  1IR8 A;  2EIZ C;  1OP9 B;  127L A;  1VG5 A;  2QNJ A;  1DYB A;  178L A;  1L36 A;  2MEI A;  4P2E A;  1SX7 A;  3E46 A;  1LI6 A;  4DC4 A;  3SB5 A;  3K92 A;  1QUT A;  163L A;  4YXC A;  3WXT A;  3L29 A;  3FI7 A;  3PBL A;  2JZ0 A;  1HNW M;  3HTF A;  5I4X A;  3GLI A;  1WVU A;  1N75 A;  1HMK A;  2LYM A;  3VKG A;  4ANR A;  3N9C A;  1LZN A;  2OU8 A;  5B1F A;  3TXI A;  161L A;  1FBI X;  2V6Z M;  3TQS A;  3TWK A;  1HJP A;  2C99 A;  1EL1 A;  4N0J A;  4XBO A;  3Q8G A;  1QSQ A;  3DN4 A;  4I8O A;  5FTL A;  1NBY C;  4PRQ A;  4DV1 M;  4YEO A;  4ARQ A;  1KIQ C;  3VDU A;  3P64 A;  3CDR A;  1AUA A;  1K28 A;  1L14 A;  3HTG A;  4IBB A;  1OTR A;  1REX A;  2LZM A;  3SMS A;  2DZN B;  1LSP A;  5LVH A;  4LJA A;  1GE2 A;  1JPO A;  211L A;  1LZ1 A;  3KDS E;  1GF6 A;  2RRU A;  3GUK A;  4Z8X A;  3QE8 A;  1B7N A;  2YBM A;  3DFZ A;  1XXH B;  5KXK A;  2YFQ A;  2BJV A;  1IY1 A;  1EQ4 A;  1I56 A;  5DLA A;  1L75 A;  1LWK A;  2L09 A;  3T6U A;  4ETA A;  3B0K A;  3CGW A;  3WL2 A;  4MGK E;  2KW0 A;  1KXW A;  4M9X A;  1E9R A;  1D3M A;  4AG5 A;  4IAT A;  3SN6 R;  4I7K A;  3HU9 A;  4XAD A;  2G4Q A;  3HUA A;  3H4J A;  5ITX E;  3VFD A;  1L37 A;  3U6O A;  1L0K A;  221L A;  2OTZ X;  4LF9 M;  1L18 A;  2Z18 A;  2J5Y A;  3GLG E;  1FLW A;  1IOC A;  3G3A B;  2O4W A;  1TEW A;  1B6I A;  1RU3 A;  5I4Y A;  4XJG A;  259L A;  4G9S A;  1CX7 A;  4ZIX A;  1L1Z A;  1LZT A;  1LJG A;  4MST A;  4TUW A;  1IP2 A;  112L A;  1KXX A;  1GO5 A;  1CUK A;  2C9C A;  3AW6 A;  1G3I A;  4G4Q A;  1JQU A;  1OYU A;  4I7P A;  4HTQ A;  2Z37 A;  4H90 A;  2CP8 A;  3U6C A;  4XJF A;  1HEQ A;  1L92 A;  3E3D A;  4J7V A;  1IBK M;  4C5F A;  1DYG A;  1C7Y A;  1ZUR A;  4CJ6 A;  3DZD A;  4EKS A;  2YVB A;  1G8P A;  1PJI A;  2C8P A;  3DN6 A;  3TXK A;  3OE0 A;  1NMM A;  4GLV A;  4OOO A;  1FDL Y;  1IP6 A;  1V92 A;  1YE9 A;  2W1X A;  2DAK A;  1LSF A;  3AOE C;  1IXS B;  2LCB A;  3GUM A;  2WZJ A;  1L89 A;  5ITX A;  4DD0 A;  5JI3 E;  1L96 A;  1L26 A;  1ZMV A;  4OVZ B;  3GLG A;  3H4M A;  157L A;  3W0L B;  3B6L A;  3CDQ A;  3P4Z A;  129L A;  3TXJ A;  4LF6 M;  2Y8P A;  1V7S A;  4LYC A;  2VF7 A;  1GJT A;  1OVH A;  1DO2 A;  3UON A;  1L97 A;  4ZEE A;  177L A;  1L64 A;  1WHC A;  5ITU A;  1IWV A;  1CKH A;  3TMW A;  1EPY A;  1GEZ A;  1XNR M;  1GB2 A;  1YQV Y;  3WU8 A;  1L02 A;  1WQM A;  1WTH A;  1UIC A;  1G06 A;  1QT4 A;  1IP1 A;  2K0B X;  1XHB A;  2VQF M;  138L A;  1LI2 A;  2IGC A;  3B7N A;  1ZWN A;  1D6P A;  1L38 A;  5F3W A;  1A2Y C;  1LSZ A;  5KXL A;  4Y28 F;  206L A;  3TMV A;  1AT6 A;  1LZC A;  4H94 A;  3U61 B;  262L A;  5I54 A;  225L A;  1R2Y A;  5KQ8 A;  5EXX A;  3NYA A;  3WHK A;  1WJ7 A;  4ITQ A;  1FKQ A;  5KY1 A;  254L A;  1BWH A;  3U6S A;  1UUZ C;  2B5Z A;  3HWS A;  1GFV A;  2ZM6 M;  1BVS A;  1LW9 A;  1C6J A;  1T8F A;  1LZ4 A;  115L A;  1L1T A;  1T3T A;  1BB7 A;  1G1W A;  2Z8Y M;  3SAV A;  4M0W A;  4NG8 A;  1C6L A;  3AZ5 A;  2QBY A;  1CJ6 A;  3FUX A;  1YL0 X;  3A34 A;  2Z2E A;  1BGI A;  1HQY E;  1IOR A;  4XGI A;  1L86 A;  1L58 A;  3NY9 A;  1L24 A;  4DDB A;  3HTB A;  4WM3 A;  3V76 A;  3D9A C;  1XGQ C;  2DQE Y;  1QT8 A;  3IWR A;  2L4E A;  1LSM A;  5KXZ A;  5E6J A;  104L A;  1XWI A;  3A96 A;  1CUP A;  1QAQ A;  3AB6 A;  1WIV A;  3U5Z B;  1L62 A;  2DQJ Y;  1BWI A;  4GKK M;  1YL1 X;  2BQG A;  252L A;  1PQM A;  5J7C A;  1DYF A;  1L61 A;  2F5P A;  3SYL A;  246L A;  1IWU A;  2FS1 A;  4DR5 M;  2F5O A;  4DR7 M;  1G7I C;  1VED A;  5DN5 A;  1N78 A;  2H1R A;  5F14 A;  2HEA A;  4L41 A;  3L64 A;  1C6P A;  4HP0 A;  2JXN A;  2IFF Y;  2UUA M;  1KW5 A;  1L91 A;  1IN5 A;  4NEB A;  3D4S A;  3W68 A;  1LJI A;  2B6X A;  3J4G A;  140L A;  3PDS A;  1JJ3 A;  4NXM M;  1DKJ A;  1L46 A;  3CSQ A;  1YAP A;  1GD6 A;  2J7N A;  2FBB A;  4BBA A;  2XGN A;  2EPE A;  3W0F A;  1L80 A;  5JEN B;  3QWL A;  1G0J A;  2ZIJ A;  171L A;  1L83 A;  4EIW A;  3ZQJ A;  1QDT A;  5KPR A;  4RLN A;  3F9L A;  4WM2 A;  4L78 A;  2WSE F;  4H1P A;  4W94 A;  3B89 A;  4WLX A;  4GHL A;  4W96 A;  4MGZ E;  155L A;  1CKD A;  3A95 A;  2DQI Y;  1OUA A;  2DZL A;  3HZJ A;  3HWL A;  2LVN C;  3LYT A;  3GRR A;  2I26 L;  4Q7J A;  3IEC A;  4JYA M;  3M18 B;  1IOS A;  1L2C A;  2DQH Y;  2ZAO A;  1PGY A;  2B75 A;  197L A;  2ZWB A;  3PNV A;  187L A;  1NF5 A;  4GIT A;  3RE8 A;  1C6N A;  3CT0 A;  1J1P Y;  3SBB C;  4XJB A;  3MHV C;  1O23 A;  4WG1 A;  4ARM A;  1KS3 A;  3D8L A;  102L A;  3AKZ A;  1JIY A;  5IDD A;  4FCV A;  3TMX A;  257L A;  1D3J A;  1P3N A;  3QNG A;  3GLI B;  1L60 A;  1UBZ A;  216L A;  4LYT A;  4DV2 M;  1C43 A;  1L48 A;  4HLQ A;  3L27 A;  1VEG A;  3WVY A;  212L A;  5ITR A;  3SBJ A;  133L A;  4HJZ A;  3GO8 A;  2UXB M;  1C45 A;  2MEG A;  169L A;  5EQT A;  1WQP A;  1L54 A;  110L A;  2YR0 A;  2F2Q A;  2LZT A;  3WXU A;  4GCE A;  4MM3 B;  162L A;  4GRI A;  4LT2 A;  3F8V A;  1KIR C;  1FLY A;  3LCV B;  1LOZ A;  4WLD A;  2W1Y A;  1J09 A;  4ARQ B;  4U3X B;  4FCW A;  1NKH A;  1GPQ C;  3HBD A;  1C69 A;  3WUA A;  2K6B A;  5IHG A;  1DQJ C;  4DKL A;  4EPI A;  4ETB A;  1SX2 A;  2DQD Y;  4G3O A;  3GP1 A;  2MH8 A;  1LSA A;  4TWS A;  126L A;  1I6S A;  3PFI A;  1IC4 Y;  2L6O A;  3FUU A;  1UIG A;  4JI8 M;  4H9I A;  240L A;  3J2P B;  1TGU A;  2QZ4 A;  2QCU A;  5M1Y A;  4I7R A;  194L A;  2LVA A;  1GE0 A;  4RW1 A;  2EA0 A;  1JTN A;  2RSC A;  2DI0 A;  4G4N A;  2QB0 B;  3IG8 A;  1FKV A;  1L8Q A;  2MR9 A;  1J5E M;  2CEA A;  4LGK A;  1BVX A;  2X49 A;  228L A; 
#chains in the Genus database with same CATH homology
 1CU2 A;  3GUJ A;  4DWX A;  1QUD A;  2BQA A;  2RBR A;  1L98 A;  4NGI A;  1C68 A;  1QS5 A;  2F4A A;  1JJ1 A;  1G7H C;  5LA5 A;  4O34 A;  1AT5 A;  1QQY A;  1QS9 A;  1L10 A;  1HEW A;  1D2W A;  4W55 A;  2YDG A;  148L E;  2F2N A;  4DQ7 A;  5I53 A;  1B5X A;  201L A;  4GCF A;  1UIE A;  1F6S A;  4OWC A;  1IWY A;  3IJV A;  3AGI A;  1UIA A;  1B9O A;  1CKF A;  1L53 A;  142L A;  2Z6B A;  2ZIL A;  4AGA A;  3A93 A;  2ZIK A;  1C7P A;  3W6F A;  5K7O A;  5B05 A;  3CSZ A;  122L A;  1CTW A;  1LYS A;  1L05 A;  1GBS A;  1LKS A;  1GE4 A;  1N4F A;  1D3N A;  3TXB A;  4J1B A;  4UWU A;  3LYZ A;  4H93 A;  1L30 A;  1QSA A;  1CV6 A;  4B4I A;  1WVV A;  4I7T A;  3CDO A;  1B5V A;  248L A;  4AXT A;  1LYH A;  4HTK A;  249L A;  4XJH A;  2BQJ A;  3W6E A;  1UA6 Y;  5IEL A;  4CFP A;  4NG1 A;  3LHM A;  5KXY A;  3V2W A;  1UIB A;  1RI8 B;  2B6Y A;  4EKQ A;  5KKJ A;  5L9J A;  1JKC A;  1C6K A;  1D0K A;  5HMV A;  1T97 A;  227L A;  141L A;  1QUO A;  5HQ1 A;  4I7J A;  3HT7 A;  3DNA A;  2MEB A;  4IJ4 A;  3GUP A;  3KAM A;  2RH1 A;  1P6Y A;  3J6K A;  1H87 A;  4WM4 A;  1INU A;  3C80 A;  1XEK A;  132L A;  3TXF A;  226L A;  1P2R A;  166L A;  213L A;  5B07 A;  1IX0 A;  1XEJ A;  2NTH A;  3NY8 A;  1KY1 A;  1L73 A;  1LHM A;  3AJN A;  4RW2 A;  1GF9 A;  2OE9 X;  3WW6 A;  3C82 A;  4B49 A;  4NIJ A;  1JIS A;  1L16 A;  1LMP A;  4YXA C;  1CVK A;  2RB2 X;  6LZM A;  1JTM A;  1P7S A;  2F4G A;  1VDS A;  2VB1 A;  3CDV A;  2LZ2 A;  2Z12 A;  3HU8 A;  1BWJ A;  137L A;  153L A;  1T3P A;  1LPI A;  1YIL A;  4H8Z A;  3SB6 A;  5LVG A;  3N9E A;  2BQK A;  3ZVQ A;  4LYB A;  1GFJ A;  234L A;  3FE0 A;  3WUM A;  9LYZ A;  4ET8 A;  3G3W A;  4EKR A;  1LMQ A;  1L22 A;  2XQO A;  4HJY A;  247L A;  1DYD A;  4PJZ A;  1L28 A;  173L A;  1ZVH L;  5AMY A;  1ZYT A;  5LAF A;  4LYM A;  1LTM A;  2BQB A;  1LCN A;  1H6M A;  1P56 A;  4TX7 A;  170L A;  4I7O A;  1DZB X;  4EXM A;  2MED A;  235L A;  1L72 A;  1JTP L;  3A91 A;  2RAZ X;  1ZVY B;  2H9J A;  5DM9 A;  1J1O Y;  1QUH A;  4B0D A;  2BQH A;  1JSF A;  4LDO A;  1GB7 A;  4ARP A;  5LYM A;  1P2L A;  1P36 A;  183L A;  1L33 A;  3MGW A;  5FEL A;  1L29 A;  1YAQ A;  1LYJ A;  3DN0 A;  182L A;  1L77 A;  1C63 A;  6LYZ A;  1L49 A;  1C6B A;  2MEC A;  2NWD X;  4W54 A;  8LYZ A;  3LZ2 A;  4WM5 A;  2IHL A;  1B5W A;  1PQD A;  4ARM B;  1CJ9 A;  1Z55 A;  1GEV A;  1TLA A;  1L07 A;  3ODU A;  1LSB A;  1L13 A;  4W59 A;  1DPX A;  144L A;  1B5Y A;  4D9Z A;  1L66 A;  1C46 A;  1IC7 Y;  4DD2 A;  2BLX A;  1L79 A;  1L90 A;  1IP5 A;  1CV4 A;  4HV2 A;  1LJJ A;  1B7M A;  159L A;  181L A;  2CWI A;  2F47 A;  4NGL A;  1G07 A;  1C66 A;  1LJE A;  1HF4 A;  2RAY X;  3RUN A;  4Z41 A;  172L A;  230L A;  3ATO A;  2I6Z A;  1JJ0 A;  1L50 A;  3A67 Y;  5LVK A;  1VDP A;  3C81 A;  5LXW A;  4NHS A;  4NHQ A;  1JHL A;  1XEP A;  3TXD A;  3CB7 A;  4XJI A;  4NHT A;  1L15 A;  224L A;  1DXJ A;  3W3E A;  2BQO A;  1DI5 A;  1IOQ A;  1L76 A;  1DYA A;  3DMZ A;  1QUG A;  1TAY A;  1HFZ A;  4NWE A;  4J0L A;  1GWD A;  1AM7 A;  1IO5 A;  1C61 A;  1VAU A;  2HU1 A;  3SP3 A;  1WQO A;  1L47 A;  168L A;  1IP4 A;  1LSE A;  4II8 A;  184L A;  4OWA A;  1LYD A;  1L00 A;  4NGY A;  5KXN A;  1LZA A;  1L44 A;  1LZ5 A;  3RU5 A;  1LZD A;  5A3E A;  1GBW A;  1JKA A;  167L A;  3GUL A;  4I8S A;  4KPM A;  4Z46 A;  3HDF A;  185L A;  5FHW A;  5HNC A;  1SWZ A;  1B7L A;  1QTD A;  3T36 A;  1IY3 A;  1G7M C;  3DN1 A;  4W58 A;  1C6I A;  1DKK A;  1D6Q A;  4H9F A;  3C8Q A;  1L39 A;  1LZS A;  1OWZ A;  4B4E A;  4DD9 A;  2OE4 X;  4BAD A;  1L12 A;  1QTE A;  1J1X Y;  1XFP L;  1PQK A;  3CT5 A;  2B74 A;  4CGE A;  4GRV A;  256L A;  2W1M A;  1G0K A;  3G3B B;  3FA0 A;  5E4P A;  1GAY A;  1L94 A;  1P46 A;  2LYZ A;  1LHL A;  1GB0 A;  2G4N A;  1LZ9 A;  244L A;  1B5Z A;  4G4H A;  2ZQ3 A;  1GF4 A;  152L A;  1ZMY L;  113L A;  3GUI A;  1QT7 A;  1TDY A;  1HC0 A;  2RBP A;  232L A;  1TCY A;  198L A;  1G0L A;  1L70 A;  4H92 A;  1CU0 A;  3EO5 A;  4PPO A;  1G1V A;  4GCB A;  4M6D A;  5I14 A;  1QT5 A;  135L A;  1VFB C;  2ZNW Y;  1V7T A;  1L67 A;  4GCD A;  1LGX A;  1CU5 A;  1DYC A;  3N9A A;  4G4B A;  4NSI A;  4OWB A;  238L A;  1GFA A;  2HEB A;  1C6T A;  1GFE A;  1HEO A;  1G0P A;  1GF5 A;  1GB8 A;  1LHJ A;  1C08 C;  5C6J A;  1XJT A;  1UIF A;  1GF8 A;  1LSD A;  120L A;  4MCK A;  1KY0 A;  3QAK A;  190L A;  2X0A A;  4W51 A;  1HEP A;  3BKH A;  2LHM A;  1XGU C;  3ZVQ B;  4GN5 C;  2DQA A;  3A3R X;  4GN3 A;  103L A;  1IWW A;  1LI3 A;  217L A;  4YF2 A;  1JSE A;  4AQN A;  107L A;  1L45 A;  1L59 A;  1FLQ A;  1GFK A;  1LGU A;  1L99 A;  4HSF A;  1IR7 A;  5KKI A;  4KT3 A;  1WQQ A;  4J1A A;  1LJK A;  1OWY A;  1OUE A;  4PGJ B;  2BQD A;  156L A;  1GFU A;  1HSX A;  5LA8 A;  3P65 A;  3FAD A;  4WM1 A;  2OU9 A;  1B7Q A;  145L A;  1LSG A;  207L A;  3HT6 A;  3P66 A;  4TUN A;  5F81 A;  4MR1 A;  3ZEK A;  1MEL L;  3B0I A;  3OE6 A;  3OE8 A;  1IR9 A;  4NGK A;  2HUK A;  3DMV A;  3JR6 A;  1L11 A;  2MEE A;  4GLA A;  1L19 A;  2W1L A;  4W57 A;  3HT9 A;  4RLM A;  158L A;  1QUS A;  3AGG G;  4I7Q A;  5APE A;  4DDC A;  4IAS A;  4WMG A;  4ARL A;  1LYG A;  1F6R A;  3WU9 A;  1B7R A;  2B72 A;  3GUO A;  2Z19 A;  4DAJ A;  1D9W A;  1GBX A;  2C8O A;  5FDJ A;  1C6G A;  1BB3 A;  2XBS A;  1AKI A;  4FJR A;  1BB6 A;  1CU6 A;  2LC9 A;  189L A;  5LVI A;  1L09 A;  1LMC A;  2MEF A;  4I7L A;  2H5Z A;  1HFY A;  3DN2 A;  1C6F A;  1C60 A;  1LGW A;  2A7D A;  4NWH A;  1CX6 A;  4H9E A;  3C83 A;  1DI4 A;  3C7W A;  1L23 A;  5F9X A;  1NHB A;  2D6B A;  1L34 A;  1JEF A;  3BKV A;  4WL6 A;  1TBY A;  4OO9 A;  3WPK A;  2QAR C;  4DDA A;  1OVJ A;  4LT3 A;  114L A;  1CV3 A;  2YBI A;  1GHL A;  4XYY A;  175L A;  1D0M A;  5HNL A;  1B5U A;  1LMN A;  2EKS C;  1QSW A;  1MLC E;  4WG7 A;  1YIK A;  4WLT A;  4W56 A;  1OUC A;  1L03 A;  3C7Z A;  5D5C A;  1L25 A;  2ZQ4 A;  5LVJ A;  111L A;  4ZFP A;  4WLY A;  1I20 A;  4ETE A;  1L04 A;  1L41 A;  2RB0 X;  1G0M A;  1IEE A;  4WO6 A;  4LZT A;  1IY4 A;  1GB9 A;  1KIP C;  3RZE A;  1HEN A;  4YM8 A;  3HH3 A;  1BQL Y;  4H9A A;  1YKY X;  4W52 A;  4OWE A;  4EKP A;  1F0W A;  3EML A;  2OU0 X;  1D2Y A;  2XTH A;  5B59 A;  2HUM A;  5HMJ A;  2YBL A;  3SB8 A;  4H91 A;  219L A;  5LIN A;  2MEH A;  3EMS A;  3A90 A;  1HHL A;  1CUQ A;  2N5Z A;  1L20 A;  174L A;  2HEF A;  3HUQ A;  2Z2F A;  2Q9D A;  1YAN A;  4BAP A;  1LYF A;  1L71 A;  4B4J A;  2CJL A;  4NGZ A;  3D3D A;  3AZ7 A;  1NHE A;  1QTH A;  2Q9E A;  4LFP A;  108L A;  1T6V L;  1XSF A;  1YAO A;  2DQG Y;  1L52 A;  5F9U A;  2OTY X;  1QSB A;  2LYO A;  4G49 A;  5KXO A;  4XN6 A;  1P5C A;  1LJ3 A;  4H9B A;  5FST A;  4PK0 A;  4EJ4 A;  3LN2 A;  3VW7 A;  4BAF A;  1D9U A;  1OQM A;  1P64 A;  4TTD A;  4DD1 A;  5A3Z A;  2OEA X;  1CKC A;  220L A;  1GDW A;  231L A;  4X3B A;  3DN3 A;  3LZM A;  1P37 A;  4E97 A;  1L68 A;  1L55 A;  1L01 A;  3WMK A;  1GF7 A;  251L A;  1D0L A;  3ULR A;  191L A;  1CV0 A;  4DQJ A;  1LAA A;  4WOA A;  1LJH A;  205L A;  5FEK A;  3W6D A;  4HV1 A;  5C6I A;  1LSN A;  1CJ7 A;  1LSC A;  1L31 A;  2D4J A;  4E3U A;  4QGZ A;  1LSY A;  1DPW A;  3B72 A;  1GBY A;  1L43 A;  1WTM A;  3A8Z A;  4CJ2 A;  1LJN A;  4PRU A;  3W6A A;  1GXV 2;  1YAM A;  2ANV A;  3CDT A;  1GF3 A;  2HUL A;  4DQ5 A;  1LPY A;  2B7X A;  1QTB A;  2BQI A;  2RBN A;  218L A;  1JUG A;  1HEL A;  4TSC A;  1LHK A;  1LJ4 A;  3SBA A;  1GFT A;  1QT3 A;  2HUB A;  1PS5 A;  3AW7 A;  2D91 A;  4CHX A;  5C6L A;  2RBO A;  2BQM A;  2B70 A;  4I7N A;  1A4V A;  4LDL A;  3G3V A;  2GV0 A;  1QIO A;  1ZV5 L;  4QY9 A;  210L A;  4G4C A;  1RE2 A;  1GDX A;  2I25 L;  3GXR A;  2Z39 A;  150L A;  2ANX A;  4H8X A;  1D3F A;  1L85 A;  1UID A;  3C8R A;  1C62 A;  1SWY A;  2CDS A;  2FYD A;  1JIT A;  4OOT A;  143L A;  1L93 A;  2ZYC A;  4WL7 A;  4DYG A;  2OE7 X;  4PHI A;  1CV1 A;  3DN8 A;  1L65 A;  2B6W A;  5D5F A;  2YSS C;  1LYE A;  1XJU A;  1EQ5 A;  3K3T A;  1DI3 A;  5KXR A;  4LT1 A;  1QTK A;  209L A;  4Z98 A;  4I0C A;  1GFG A;  1HFX A;  1FLU A;  2FYC A;  4LT0 A;  4DJH A;  1GB6 A;  1OUF A;  3OJP A;  1HNL A;  3W6C A;  1YRO A;  1OUG A;  165L A;  4EPF A;  5LYT A;  1FN5 A;  5L3I A;  3F6Z A;  1GB3 A;  4FDY A;  4TSB A;  1EQE A;  4NHI A;  2BQN A;  2CGI A;  2AUB A;  1REM A;  2HTX A;  5E9R A;  2B73 A;  4HPI A;  2XJW A;  4S0W A;  4NSH A;  1G0Q A;  4DT3 A;  4DD3 A;  1WQR A;  1L17 A;  4W53 A;  1L40 A;  1XGP C;  1JKD A;  5KXX A;  2O7A A;  1KXY A;  1OUB A;  4EMN A;  180L A;  2B6Z A;  139L A;  3HTD A;  4ET9 A;  2BQF A;  1GBO A;  1NWG A;  2YBN A;  4NSG A;  1L95 A;  2DKV A;  3EXD A;  258L A;  1IWZ A;  1WTN A;  1B0D A;  1IIZ A;  5HLL A;  200L A;  147L A;  1REY A;  3A3Q A;  255L A;  130L A;  1LZY A;  1IVM A;  1IWX A;  3B0O A;  1LZR A;  1B7P A;  2BQL A;  5KXT A;  1C10 A;  1L69 A;  2HEC A;  1GFR A;  4HPE A;  1PQO A;  134L A;  3LYO A;  1L81 A;  5LAG A;  260L A;  4NY5 A;  1AZF A;  193L A;  5KJ9 A;  1IC5 Y;  1UIH A;  1CKG A;  3GXK A;  1RCM A;  1QDR A;  1L35 A;  1LHI A;  4YOP A;  109L A;  4KL7 A;  160L A;  4K5Y A;  3DKE X;  2H9K A;  2YBH A;  1ALC A;  1T6H A;  4NSJ A;  1F10 A;  1YKX X;  1LHH A;  1GFH A;  1L0J A;  1JKB A;  4A7D A;  123L A;  176L A;  1L84 A;  1UC0 A;  1L08 A;  1GBZ A;  4B1A A;  2B6T A;  1LZ6 A;  4ETC A;  3AZ6 A;  5ILF A;  125L A;  4N1E I;  2RBS A;  1VAT A;  3WYH A;  4N8Z A;  5LZM A;  229L A;  1SSY A;  4LYZ A;  1L21 A;  1C6H A;  233L A;  4R0F A;  2D4I A;  1LYY A;  1BHZ A;  1C6D A;  1LJF A;  4GN4 A;  4WM6 A;  1L57 A;  7LYZ A;  223L A;  261L A;  1HSW A;  3HT8 A;  1IP7 A;  1LKR A;  3A6C Y;  146L A;  149L A;  2RB1 X;  2HEE A;  3HBH A;  1L51 A;  3AGH A;  3AZ4 A;  1HER A;  164L A;  2PC2 A;  4HTN A;  239L A;  5B06 A;  2L78 A;  1QTV A;  3LZT A;  4C3W A;  2DBT A;  3SB9 A;  1L88 A;  1E8L A;  1LMT A;  1G7J C;  2F32 A;  1OUJ A;  1RJC B;  4GCC A;  1CU3 A;  3WUL A;  1SQ2 L;  1PZY A;  1JTT L;  1QTC A;  4XEN A;  1W6Z A;  1OVK A;  5T3F A;  4H9C A;  2BLY A;  1VDQ A;  5I5Q A;  4OWH A;  1KW7 A;  2WAR A;  1LZE A;  2A7F A;  1BB5 A;  3TMU A;  4N5R A;  1LWG A;  1XEI A;  119L A;  2O79 A;  1XGR C;  1G7L C;  3VWO A;  2CUU A;  2XBR A;  2BPU A;  2FBD A;  4ZPU A;  2D4K A;  1B2K A;  4H9H A;  4NGV A;  4IAP A;  1C65 A;  2Q0M X;  1LZB A;  3CT1 A;  250L A;  3HFM Y;  1JWR A;  3P68 A;  5DN4 A;  1C64 A;  1LYI A;  1L06 A;  4I7M A;  1I1Z A;  3A94 A;  4ML7 A;  5APC A;  1DYE A;  3ATN A;  2EQL A;  3RZ4 A;  3GUN A;  4N9R A;  2RBQ A;  1BVK C;  241L A;  2NTG A;  186L A;  3HH4 A;  1GB5 A;  5KXS A;  154L A;  4YEM A;  3C8S A;  1P2C C;  1L27 A;  222L A;  3QY4 A;  2A4T A;  2ZNX Y;  192L A;  1VDT A;  237L A;  4HJV A;  1CNS A;  1B7S A;  4H8Y A;  151L A;  3DMX A;  1GF0 A;  3EBA B;  3TXG A;  2G4P A;  4ETD A;  1NBZ C;  253L A;  2HU3 A;  3SB7 A;  1L42 A;  1C6E A;  3TXE A;  1CV5 A;  1C6M A;  5ILC A;  1NQI A;  1UCO A;  2ZYP A;  4PJ2 C;  4ARJ A;  3CSR A;  1C6Q A;  1LZG A;  4NGW A;  4WO9 A;  2DQC Y;  4R6C A;  1PQJ A;  2MEA A;  1LMA A;  3OK0 A;  2BQE A;  3RNX A;  118L A;  5L3H A;  1GE1 A;  4LDE A;  1LLH A;  208L A;  4QDN A;  3C7Y A;  3FI5 A;  4CFO A;  3HDE A;  131L A;  3WVX A;  4UWV A;  3K2R A;  5LYZ A;  1T8A A;  128L A;  3HUK A;  1HML A;  1REZ A;  3RT5 X;  1OV5 A;  3WPJ A;  1SSW A;  1WQN A;  4NGO A;  1IP3 A;  2BQC A;  1GAZ A;  1UAC Y;  1PQI A;  1LZ8 A;  5APF A;  1LYZ A;  1T8G A;  3WW5 A;  1GE3 A;  1SLY A;  243L A;  3OE9 A;  3V2Y A;  4N1C C;  4QEQ A;  1BB4 A;  5II3 A;  4Z3M A;  4NGJ A;  2DQF C;  4KXI A;  199L A;  1OUH A;  188L A;  3TXH A;  4EOF A;  3HH6 A;  4OW1 A;  4NFV A;  3CQL A;  1QT6 A;  2YBJ A;  1L56 A;  3AYQ A;  3L2X A;  3WU7 A;  5KXM A;  3WPL A;  3LYM A;  5FCP A;  4BS7 A;  2F30 A;  6LYT A;  3M3U A;  1L74 A;  4M4O A;  1XGT C;  1B7O A;  1LYO A;  1YKZ X;  1OUI A;  1KNI A;  4I7S A;  1JTO L;  5F16 A;  1IWT A;  5APD A;  1RFP A;  3WUN A;  3W6B A;  196L A;  5KXW A;  1QTZ A;  236L A;  1IOT A;  3RW8 A;  1W08 A;  4NHP A;  4GBR B;  1OV7 A;  1L63 A;  3HH5 A;  5DL9 A;  4LZM A;  1CJ8 A;  195L A;  5EBH A;  2BAA A;  5KXP A;  1C6A A;  7LZM A;  2HED A;  215L A;  4RDS A;  242L A;  3A6B Y;  4LYO A;  4XJD A;  1L82 A;  4UWN A;  1L87 A;  4YEN A;  1C67 A;  5B1G A;  1L32 A;  3HBE X;  1GXX A;  5LIO A;  1NDM C;  1LMO A;  4YX7 C;  4DD7 A;  3A92 A;  3WH1 A;  4LFX A;  3G3X A;  1C6C A;  5I4W A;  1NDG C;  214L A;  1HEM A;  3IJU A;  1OUD A;  2Z38 A;  1G0G A;  1IR8 A;  2EIZ C;  1OP9 B;  127L A;  1DYB A;  178L A;  1L36 A;  2MEI A;  4P2E A;  1SX7 A;  4DC4 A;  1LI6 A;  3SB5 A;  163L A;  1QUT A;  4YXC A;  3WXT A;  3FI7 A;  3PBL A;  3HTF A;  5I4X A;  1WVU A;  1HMK A;  2LYM A;  4ANR A;  3N9C A;  1LZN A;  2OU8 A;  5B1F A;  3TXI A;  161L A;  1FBI X;  1EL1 A;  4N0J A;  1QSQ A;  3DN4 A;  1NBY C;  4PRQ A;  4YEO A;  4ARQ A;  1KIQ C;  3P64 A;  3CDR A;  1K28 A;  1L14 A;  3HTG A;  1REX A;  2LZM A;  1LSP A;  5LVH A;  1GE2 A;  1JPO A;  211L A;  1LZ1 A;  1GF6 A;  3GUK A;  3QE8 A;  1B7N A;  2YBM A;  5KXK A;  1EQ4 A;  1I56 A;  5DLA A;  1L75 A;  1LWK A;  3T6U A;  4ETA A;  3B0K A;  3WL2 A;  1KXW A;  1D3M A;  4IAT A;  3SN6 R;  4I7K A;  3HU9 A;  4XAD A;  2G4Q A;  3HUA A;  1L37 A;  1L0K A;  221L A;  2OTZ X;  1L18 A;  2Z18 A;  3G3A B;  1FLW A;  1IOC A;  2O4W A;  1TEW A;  1B6I A;  5I4Y A;  4XJG A;  259L A;  4G9S A;  1CX7 A;  4ZIX A;  1LZT A;  1LJG A;  4MST A;  1IP2 A;  112L A;  1KXX A;  3AW6 A;  1JQU A;  1OYU A;  4I7P A;  4HTQ A;  2Z37 A;  4H90 A;  4XJF A;  1HEQ A;  1L92 A;  3E3D A;  4J7V A;  4C5F A;  1DYG A;  1ZUR A;  4EKS A;  2YVB A;  2C8P A;  3DN6 A;  3TXK A;  3OE0 A;  1NMM A;  4GLV A;  4OOO A;  1FDL Y;  1IP6 A;  2W1X A;  1LSF A;  2LCB A;  3GUM A;  1L89 A;  4DD0 A;  1L96 A;  1L26 A;  157L A;  3B6L A;  3CDQ A;  3P4Z A;  129L A;  3TXJ A;  2Y8P A;  1V7S A;  4LYC A;  177L A;  1OVH A;  4ZEE A;  3UON A;  1L97 A;  1L64 A;  1IWV A;  1CKH A;  3TMW A;  1EPY A;  1GEZ A;  1GB2 A;  1YQV Y;  3WU8 A;  1L02 A;  1WQM A;  1WTH A;  1UIC A;  1G06 A;  1QT4 A;  1IP1 A;  138L A;  1LI2 A;  2IGC A;  1ZWN A;  1D6P A;  1L38 A;  1A2Y C;  1LSZ A;  5KXL A;  206L A;  3TMV A;  1AT6 A;  1LZC A;  4H94 A;  262L A;  5I54 A;  225L A;  3NYA A;  1FKQ A;  5KY1 A;  254L A;  1BWH A;  1UUZ C;  2B5Z A;  1GFV A;  1LW9 A;  1C6J A;  1T8F A;  1LZ4 A;  115L A;  1BB7 A;  1G1W A;  4NG8 A;  1C6L A;  3AZ5 A;  1CJ6 A;  3A34 A;  1YL0 X;  2Z2E A;  1BGI A;  1IOR A;  1L86 A;  1L58 A;  3NY9 A;  1L24 A;  4DDB A;  3HTB A;  4WM3 A;  3D9A C;  1XGQ C;  2DQE Y;  1QT8 A;  3IWR A;  1LSM A;  5KXZ A;  104L A;  3A96 A;  1CUP A;  3AB6 A;  1L62 A;  2DQJ Y;  1BWI A;  1YL1 X;  2BQG A;  252L A;  1PQM A;  5J7C A;  1DYF A;  1L61 A;  246L A;  1IWU A;  1VED A;  1G7I C;  5DN5 A;  5F14 A;  2HEA A;  4L41 A;  3L64 A;  1C6P A;  4HP0 A;  2IFF Y;  1KW5 A;  1L91 A;  4NEB A;  3D4S A;  1LJI A;  2B6X A;  3J4G A;  140L A;  3PDS A;  1JJ3 A;  1DKJ A;  1L46 A;  3CSQ A;  1YAP A;  1GD6 A;  2FBB A;  2EPE A;  1L80 A;  5JEN B;  1G0J A;  2ZIJ A;  171L A;  1L83 A;  1QDT A;  4RLN A;  4WM2 A;  3F9L A;  4H1P A;  4W94 A;  4WLX A;  4W96 A;  3A95 A;  155L A;  1CKD A;  2DQI Y;  1OUA A;  3LYT A;  3HWL A;  2I26 L;  3M18 B;  1IOS A;  197L A;  2DQH Y;  2B75 A;  2ZWB A;  187L A;  1NF5 A;  1C6N A;  3CT0 A;  1J1P Y;  3SBB C;  4XJB A;  4ARM A;  1O23 A;  4WG1 A;  1KS3 A;  102L A;  3TMX A;  1JIY A;  5IDD A;  257L A;  1D3J A;  1P3N A;  3QNG A;  1L60 A;  1UBZ A;  216L A;  4LYT A;  1C43 A;  1L48 A;  3WVY A;  212L A;  133L A;  4HJZ A;  1C45 A;  2MEG A;  169L A;  1WQP A;  1L54 A;  110L A;  2F2Q A;  2LZT A;  3WXU A;  4GCE A;  162L A;  4LT2 A;  3F8V A;  1KIR C;  1FLY A;  1LOZ A;  4WLD A;  2W1Y A;  4ARQ B;  4U3X B;  1NKH A;  1GPQ C;  3HBD A;  1C69 A;  3WUA A;  5IHG A;  1DQJ C;  4DKL A;  4EPI A;  4ETB A;  1SX2 A;  2DQD Y;  4TWS A;  1LSA A;  126L A;  1I6S A;  1IC4 Y;  1UIG A;  4H9I A;  240L A;  5M1Y A;  4I7R A;  194L A;  1GE0 A;  4RW1 A;  1JTN A;  2RSC A;  2QB0 B;  1FKV A;  4LGK A;  1BVX A;  245L A;  228L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...