1QDTA

2.1 a resolution structure of escherichia coli lytic transglycoyslase slt35 in complex with calcium
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdtA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdtA02
4IJ4A 3A95A 1LHIA 1ZV5L 1V7SA 2HUBA 1HEWA 1GAYA 4HPEA 4OWEA 2NWDX 1WTNA 1JTPL 3P64A 3QNGA 1XEIA 2VB1A 1D6QA 3CSQA 1BB3A 1GF5A 1GB3A 2HEDA 4LYZA 5LVHA 2YBIA 1JEFA 1VDPA 3A94A 3WPKA 1LTMA 4WO9A 2FYDA 1GFAA 3ATOA 1LSDA 2G4PA 4H1PA 4ETAA 5A3ZA 3A67Y 3ATNA 3WYHA 4ZEEA 3VWOA 1BB5A 1RCMA 2D6BA 1BVXA 1HEQA 1V7TA 1B0DA 3J6KA 4CHXA 2CGIA 1IOTA 4WLDA 1IP1A 134LA 1QTEA 4LGKA 4DDBA 1DPWA 1HEMA 4CFOA 1GFGA 193LA 2XTHA 4LT3A 1B7PA 2LYMA 5DN5A 5B05A 4MR1A 1VAUA 7LYZA 3WL2A 5M1YA 3WULA 1LKSA 1LJKA 2MEGA 1B7MA 2HU1A 1GPQC 4IATA 2CJLA 3G3BB 4NWEA 1LZGA 1TBYA 1VDSA 3B0KA 4NY5A 4OWAA 1W6ZA 2ZIJA 4B0DA 5IHGA 4YEMA 1IP6A 1I20A 3P68A 5KKJA 5KY1A 1DQJC 1GBYA 2XJWA 1LSFA 4H9BA 5D5FA 4Z46A 2BQOA 3N9CA 1GFHA 3KAMA 5F81A 2WARA 1B5YA 1NDGC 1KXWA 1LZBA 2GV0A 4Z98A 1B7RA 1GEVA 4I8SA 4MCKA 2YBJA 3FE0A 1UUZC 4TWSA 3WPLA 1FDLY 1UACY 1LPIA 3OK0A 1GF9A 4GCDA 1VATA 4DD0A 5LXWA 2BQKA 1JUGA 1UIGA 1TDYA 3A6BY 1F6RA 4PRQA 1ALCA 1IP5A 2ZYCA 2DQGY 4NGWA 1GE3A 4G4HA 1GFEA 1REYA 1IC5Y 1GB9A 5DLAA 4AXTA 1BHZA 3HBEX 5KXLA 2CWIA 1I56A 1OUGA 1IWXA 1KXYA 1LSZA 1LZDA 1LJ4A 1YKZX 1D0LA 3AZ7A 207LA 1B7OA 1HNLA 1GFUA 2HEAA 4KT3A 5APDA 3AB6A 3WU7A 4C5FA 5LVIA 1H87A 1CKGA 3W3EA 3OJPA 1LMTA 2D4IA 1JIYA 3GXRA 4EMNA 1C10A 1LYYA 4TSBA 1P2CC 2BQJA 3N9AA 4R6CA 4TX7A 4B4IA 1XGPC 1OUDA 3B72A 1OQMA 2DQDY 3RT5X 4ETDA 4WM2A 3WH1A 3WW6A 4C3WA 4M4OA 4CGEA 4ETBA 1WVUA 3HBHA 4WM5A 2IHLA 4QGZA 1ZMYL 4ML7A 3AZ6A 4CFPA 1JWRA 3TXGA 1DKJA 3N9EA 1JPOA 1IX0A 1GDWA 2ZNWY 3AZ4A 3LZTA 1LYOA 1RJCB 4PRUA 4W94A 4WG7A 1DPXA 6LYTA 5JENB 1UA6Y 1JKBA 2C8PA 1XGUC 4HJYA 4R0FA 4ZFPA 1GE4A 1GFKA 2RSCA 4LZTA 1NF5A 1C46A 1SQ2L 1BWIA 1GWDA 1IP4A 3CT0A 1AM7A 1A4VA 4XN6A 4GLAA 2Z12A 3TMWA 3AZ5A 4HP0A 4NGJA 1SLYA 3E3DA 1IR8A 5DM9A 3TXJA 1QDTA 154LA 1OUIA 1DI4A 5HMVA 4XJFA 2I25L 1INUA 4I0CA 3RW8A 3T36A 3TXHA 1QTKA 2HEEA 1OUJA 2MEEA 3LYZA 1QUSA 3WVXA 2ZYPA 4XJHA 4H9FA 5LAFA 2LZ2A 4WOAA 1J1XY 2C8OA 1B5ZA 3CT5A 1O23A 1DI3A 1HFZA 1YKXX 2BLYA 4H8YA 4NGVA 4W96A 4NGKA 4RW1A 1GAZA 3TXBA 1LYZA 1PZYA 5LYTA 1LSMA 1C45A 1I1ZA 4UWVA 3K3TA 4BAFA 4CJ2A 4J1AA 4RLNA 1JISA 1BGIA 2MEBA 4WO6A 1NDMC 5I4YA 1LHLA 2ZNXY 1GD6A 2Z39A 3A90A 1WQNA 1LMAA 1QSWA 4DC4A 1GEZA 1JSFA 1DI5A 4GN4A 1GFRA 1LZSA 2BPUA 1GE0A 3EMSA 1WQPA 1LJGA 4NGOA 4X3BA 3T6UA 5II3A 4TUNA 1YIKA 5F16A 1LSCA 2YDGA 5F9UA 4ET9A 1AT5A 1BVKC 2DQFC 1FLUA 1GBSA 3RNXA 5LVKA 1CKDA 4ETCA 1EL1A 1OUEA 1UICA 2Z37A 5KXNA 4NSHA 1G7HC 5I4WA 1YAQA 3TMXA 4YENA 3W6BA 8LYZA 1QQYA 1IWVA 1UIEA 4WL6A 4G4CA 1KIPC 2BQHA 5KXZA 1OP9B 1HEPA 2X0AA 4XJDA 2DBTA 1LJJA 2FBBA 3WXUA 4YOPA 4B49A 4NGIA 1GXV2 1MELL 1YAPA 5HNLA 1GF3A 4XJBA 3MGWA 1EQ4A 4NWHA 2HTXA 1IWWA 4LYOA 1OUFA 3A3RX 5F9XA 2D91A 1GFVA 5I53A 1G7JC 1NBZC 4H8XA 1IVMA 4U3XB 2Z18A 1B5WA 1YAOA 1XSFA 1IY4A 1JKDA 5APCA 1GBZA 3AW6A 4TSCA 3CSRA 3W6FA 1D0KA 1JTOL 4MSTA 4HSFA 4YM8A 4GCEA 5HLLA 1IP3A 4E3UA 6LYZA 1G7LC 1Z55A 3CB7A 4H9CA 4WM1A 1T3PA 3IWRA 2G4NA 2MEFA 4WM6A 3LN2A 5E4PA 1ZVHL 4OWBA 4TTDA 1LMQA 4LYMA 4GCBA 1LMNA 1B5VA 4HPIA 2DQJY 5KXYA 4EOFA 1RE2A 1UIHA 1LHJA 5C6IA 1QIOA 3WW5A 4PJ2C 4HJVA 4ANRA 1LZNA 3EO5A 5LIOA 1A2YC 1HMKA 4J7VA 1LZ9A 4H90A 1B9OA 1LJEA 1HSXA 1LZTA 1IOQA 2Z2FA 3FI7A 4YF2A 5LA8A 3A6CY 1LZ5A 1LSPA 2D4KA 3D3DA 1QSAA 3A92A 1UBZA 3WPJA 5FEKA 1WQQA 1LMCA 1HFXA 1LHHA 2BQMA 4RDSA 4NGLA 5C6LA 3W6AA 2XBRA 3ZVQA 1NQIA 2YBNA 1AKIA 1UIDA 3TXIA 1OUCA 1PS5A 4L41A 4UWNA 1ZVYB 1DZBX 3WXTA 1IR9A 2AUBA 3TMVA 2Z19A 4OWHA 5I54A 1GFTA 2Q0MX 2BQNA 4LYCA 1GF8A 4DD2A 1H6MA 4H9AA 4Z41A 1GB2A 4XADA 3AGIA 1IO5A 1JITA 1LZCA 1VFBC 1REZA 1XGTC 1LSAA 2A7FA 1GFJA 2IFFY 5I5QA 4H93A 3LHMA 4J0LA 2F2NA 2MECA 1FBIX 5FSTA 4WM4A 5LINA 3HFMY 5LYMA 1BWHA 3CSZA 5KXKA 3CQLA 153LA 1MLCE 1WTMA 1GE1A 2H9JA 1TCYA 3TXKA 4OWCA 5KXPA 3WUAA 2HEFA 5L9JA 1B2KA 1GBXA 4LYTA 2BQGA 1G7IC 4KPMA 3B0OA 2W1MA 3A34A 1UCOA 4NG8A 3P66A 1F0WA 2DKVA 3W6DA 1OUHA 1NMMA 3LYTA 5IDDA 3WU8A 1B5UA 1NHEA 2BQIA 4J1BA 4DD9A 1CNSA 4DYGA 5KXMA 1B7NA 1YILA 4WL7A 4NFVA 3AGGG 5K7OA 1XGRC 4N1CC 3WMKA 1XGQC 1WQRA 5B06A 1LSNA 4HV2A 3HBDA 4N5RA 1IC7Y 5HNCA 1OUBA 4GLVA 4GN3A 1LJHA 1LZ8A 1CKFA 1WQOA 4QDNA 2G4QA 1J1OY 2H5ZA 1LAAA 1IORA 1VDQA 5APEA 3WUNA 3EBAB 2FBDA 1QUTA 3SP3A 2BQFA 5A3EA 4WLTA 4XJGA 1GF0A 3LYOA 4HTQA 2DQHY 4NSIA 2EPEA 1E8LA 2MEIA 2HECA 1CJ6A 2BQBA 4HTKA 1LSGA 3LYMA 1CKCA 3TXDA 1EQEA 1F6SA 1LOZA 1VDTA 2Z38A 5LVGA 2CDSA 1UIFA 1LCNA 4QEQA 3AYQA 4NEBA 4H8ZA 4FJRA 4BADA 3QY4A 4QY9A 4RW2A 1HENA 5LA5A 1FLYA 2ZILA 5J7CA 2N5ZA 4B1AA 1HFYA 1RFPA 1UC0A 1GB0A 1XEJA 4HTNA 4YEOA 3A93A 1EQ5A 1B7QA 1DKKA 4N9RA 5DN4A 1KXXA 5KXSA 4BS7A 3A3QA 2LYZA 1LHMA 1GB8A 5D5CA 1HERA 1LMPA 1LZ4A 5KXOA 1JSEA 2B5ZA 1YANA 1J1PY 1HF4A 1LMOA 2EKSC 1CJ9A 2W1YA 5KXTA 194LA 3BKVA 5B1FA 5B1GA 2BQEA 4O34A 1GF4A 3ZVQB 3WU9A 1IWZA 5LVJA 3TXEA 3LZ2A 5APFA 2EIZC 2ZWBA 4LT2A 1UIAA 3WVYA 4B4EA 5IELA 5B59A 1DXJA 1NBYC 5F14A 1G7MC 5FCPA 4XJIA 5KKIA 1WVVA 2BQDA 4G49A 1LYSA 5HMJA 2H9KA 1NKHA 2PC2A 2YBMA 208LA 1IWYA 5FHWA 4AGAA 4D9ZA 4H92A 3A96A 4OOOA 1GF7A 2ZIKA 4H9EA 1GBOA 1JJ1A 4G9SA 1HC0A 2BLXA 1RI8B 2F30A 5L3HA 4NHTA 5AMYA 4LFPA 3AW7A 1BQLY 1GE2A 4OOTA 3D9AC 9LYZA 1IOSA 4KXIA 4DD3A 135LA 1HSWA 3B6LA 4H9HA 4NGYA 2BQCA 2LZTA 4FDYA 5FDJA 2DQCY 4G4BA 2F4AA 4GCFA 4H94A 1JHLA 5DL9A 1IWUA 1YL1X 2Y8PA 3AJNA 2F4GA 5LYZA 1FLQA 1IY3A 1LJFA 4N0JA 4KL7A 4WG1A 3CT1A 4DWXA 4DT3A 4XYYA 1FLWA 1W08A 2XBSA 4DD1A 1LSYA 1HHLA 2I6ZA 1CJ7A 1LZ1A 3TMUA 1NWGA 1YQVY 4NG1A 2Z2EA 1D9UA 4OW1A 1LJ3A 1B7LA 1YROA 4PPOA 1FKQA 1LZYA 1LZAA 3ULRA 2FYCA 4II8A 3ZEKA 1UIBA 4UWUA 4GCCA 1GXXA 4LFXA 1B5XA 4LT1A 4N1EI 3TXFA 4A7DA 4HJZA 1LJNA 1OUAA 1REMA 1YL0X 2A7DA 1AT6A 2YBLA 1LZEA 2BAAA 4PHIA 3IJVA 4XENA 5ILFA 2LHMA 2BQLA 1IIZA 5LAGA 1JKCA 133LA 1JJ0A 4NHIA 4ETEA 1WQMA 4NHPA 4ET8A 2YSSC 3IJUA 4WLXA 1JKAA 3QE8A 1KIRC 4NHQA 4IASA 4NHSA 2ZQ3A 3M18B 5B07A 1IR7A 2ZQ4A 1IC4Y 1FN5A 3A8ZA 2HU3A 1LSBA 1C7PA 2DQIY 3F6ZA 4Z3MA 2W1XA 1D0MA 1LSEA 1YAMA 4RLMA 3GXKA 4H91A 5KXRA 1JTTL 1CKHA 3RZ4A 4DD7A 5FELA 5T3FA 3A91A 3W6CA 4DDCA 1LZ6A 1BB4A 4LT0A 3P4ZA 4BAPA 3G3AB 5EBHA 2MEAA 2I26L 1TAYA 1T6VL 4NSGA 1GB6A 5KXXA 1IP2A 2EQLA 1IEEA 2W1LA 3RU5A 3M3UA 1IP7A 4NGZA 1CJ8A 1B7SA 1LKRA 1XFPL 2BQAA 2D4JA 1LHKA 1N4FA 1YKYX 1GBWA 1C08C 2YVBA 3BKHA 4H9IA 3W6EA 5I4XA 3EXDA 1BWJA 4WLYA 4B4JA 1IWTA 1LZRA 3J4GA 5C6JA 2MEHA 1REXA 4P2EA 1GB7A 4M6DA 5KXWA 5L3IA 4LYBA 1HMLA 5E9RA 4WMGA 2MEDA 5KJ9A 1F10A 1JJ3A 1XEKA 4NSJA 1BB6A 5HQ1A 1D6PA 1LJIA 4NIJA 4GN5C 1VEDA 1GB5A 1FKVA 3P65A 4N8ZA 1GF6A 4WM3A 1GDXA 2LYOA 3WUMA 1IOCA 4ZIXA 3B0IA 5ILCA 1AZFA 1HELA 1KIQC 2DQAA 2DQEY 4DDAA 1QDRA 3AGHA 132LA 1BB7A 2YBHA 1GHLA 1TEWA 1HEOA 1C43A 2HEBA 4HV1A 4PGJB
chains in the Genus database with same CATH superfamily
1ZV5L 2L7IA 2NWDX 1XXHA 1QT7A 1BB3A 1GF5A 3HGIA 1GB3A 5LVHA 1R2YA 4LCBA 2YBIA 3A94A 1L64A 4WO9A 1IXRC 4OO9A 4ARPA 2G4PA 3ATNA 3WYHA 3NY9A 2RBNA 3C82A 1C6IA 1IBMM 3W0FA 2DZLA 1L57A 4X66M 137LA 2OTYX 3ILKA 1PGYA 2JZ0A 3AOEC 2CJLA 4OWAA 4NY5A 3J7BA 5IHGA 4YEMA 4PJZA 1IP6A 1JTNA 1I20A 1GJSA 3P68A 5KY1A 3PNVA 4H9BA 1OAIA 1UM8A 2BQOA 1GFHA 2I7NA 3GRVA 2J7OA 3U6SA 3DN8A 4K5YA 1Y8GA 1QSBA 4NC6A 2YBJA 1TH2A 5EP4A 3OK0A 3KW6A 1N32M 4DD0A 3SYKA 4F2LA 3NY8A 5LXWA 1N77A 2BQKA 1AIPC 226LA 3GUNA 2O79A 4NGWA 2A5YB 1WHCA 1T8FA 3VKGA 1IC5Y 3J27B 1GB9A 5KXLA 2CWIA 4EKSA 1I56A 1WJ7A 4QNRA 1QT3A 1C6GA 103LA 1GFUA 2HEAA 2CE7A 4KT3A 3SYLA 1JQJC 1CV5A 3AB6A 3F9LA 1JTMA 262LA 219LA 1LMTA 2D4IA 4EMNA 3SATA 2W82A 1LYYA 4TSBA 4L78A 3N9AA 4R6CA 102LA 1KYIA 3T38A 3B72A 4LF7M 1L20A 4ETDA 3OE8A 3K8ZA 3AKZA 242LA 1OQYA 4QGZA 1ZMYL 1SXJC 4CFPA 3TXGA 1GABA 1NHBA 1HT1E 4LJ9A 1DPXA 3M0EA 4B7FA 2B73A 1LGWA 1C6NA 4HJYA 4ZFPA 224LA 4LZTA 1BWIA 2EKFA 225LA 4HP0A 3E3DA 2Z3XA 1IR8A 1QDTA 154LA 5C18A 141LA 3RW8A 3T36A 2YQZA 261LA 2CUZA 2G3QA 1V33A 2R44A 1QUSA 127LA 142LA 4FCTA 4B3MM 1J1XY 3CT5A 1HFZA 1L90A 2KRKA 4W96A 1TH3A 4NGKA 1Z5AA 1IN8A 1LYZA 4I7KA 4NRWA 2R46A 1I1ZA 3U6PA 2LVNC 4CJ2A 4L15A 4RLNA 3THGA 4ARMB 1BGIA 1CU3A 1NDMC 1GD6A 1L72A 1R7RA 1PJIA 1QT4A 2RB1X 1LMAA 3D4SA 2GNOA 1GFRA 1GE0A 3G3VA 1LJGA 2V1UA 5II3A 1L14A 3HJQA 155LA 4M9XA 2KDLA 2UXCM 2DZNB 1FLUA 1GBSA 4ETCA 1EL1A 5I4WA 3TMXA 161LA 1IWVA 4DV5M 2R4EA 1C6QA 1UIEA 4FWHA 3KOZE 1L27A 2BQHA 4G4CA 3A42A 4XJDA 2FBBA 235LA 4CISA 4NGIA 1OYUA 1MELL 3MGWA 118LA 3GRRA 5LMNM 2HTXA 1OUFA 3A3RX 5F9XA 1GFVA 1L89A 236LA 1G7JC 1B5WA 150LA 3U5ZB 3UMMA 1PQKA 1XSFA 3AW6A 4D81A 3W67A 1I6SA 3CSRA 176LA 3HDFA 1D0KA 4DR1M 3NWLA 4DV1M 4D82A 239LA 3LZMA 4KT0F 4H9CA 4CIZA 1L52A 128LA 1T97A 2G4NA 3HUAA 1IXSA 3E46A 2QHOB 169LA 4GCBA 2V6ZM 1YUBA 2DQJY 1C6DA 4IIWA 2X4AA 2EJSA 2KNVA 4DV2M 4G4NA 4MGZE 233LA 171LA 1IOQA 5H37D 2Z2FA 2JZ1A 2YR0A 3A6CY 1QZEA 3KSJA 3I51A 5EJCA 4F1IA 4G4OA 3A92A 1IN5A 1UBZA 3FTEA 1QYRA 1AUAA 2KA6B 3DN3A 1HFXA 1L73A 1LHHA 213LA 237LA 5C6LA 1VEJA 1L19A 3KSXA 2Y0TA 1NQIA 4QHTA 2DVWB 2CRUA 3VK7A 1DZBX 1OIPA 1WR1B 4OWHA 1WGNA 4PCZA 1GFTA 1GF8A 4DD2A 4DJHA 1VFBC 4UN2B 1REZA 1LSAA 2EA0A 2H5XA 3DN2A 2F2NA 2MECA 4WM4A 1BWHA 1MLCE 1K28A 2H9JA 173LA 3TL4X 5KXPA 1GBXA 3EIEA 3DNAA 2WZJA 2B6ZA 160LA 1T6HA 3A34A 1OTRA 1GJTA 3LQRA 2O01F 3HT9A 1HNWM 4P16A 5EXSA 1DYEA 1OUHA 3WU8A 1NHEA 4J1BA 4DD9A 4WL7A 1E9SA 2DAIA 1L1TA 1PRBA 3VDPA 1L93A 1XGRC 3WMKA 4HV2A 3HBDA 3CTWB 1IC7Y 5HNCA 1PQOA 4GN3A 2R0IA 1LJHA 1LZ8A 1CKFA 2F5SA 4GHAA 138LA 1NHWC 1VDQA 165LA 5FTJA 1QUTA 3GLHE 4MGKE 1L62A 2BQFA 4LJ8A 3GQ4A 1GVNA 3LYOA 115LA 4NSIA 2EPEA 1CJ6A 4HTKA 1F6SA 1VDTA 2Z38A 3HT7A 2APLA 4G6ZA 1C1KA 1L35A 2CFOA 2GQFA 1UIFA 3AYQA 4DQ7A 1P3NA 1L81A 2L78A 1L40A 4W58A 1L92A 2N5ZA 4B1AA 1RFPA 1UC0A 5KXSA 4NL4H 3C3EA 2LYZA 2H1RA 3VDUA 1A5TA 3TE6A 1YANA 1KW5A 5EQTA 1EPYA 1CJ9A 3AJIB 2EKSC 5KXTA 3JR6A 1XWIA 3BKVA 2BQEA 4O34A 3ZVQB 3WU9A 3LZ2A 2ZWBA 2VDBB 3WVYA 3U6LA 1DXJA 4JV5M 1NBYC 1C69A 5BPVA 1QUGA 3SB9A 5HMJA 1LYSA 3AFHA 2LVAA 2PC2A 1NKHA 208LA 3C3DA 4AGAA 2XFSA 4H92A 3A96A 2ZIKA 3GLFE 1NVMA 1RI8B 2F30A 2CP8A 3LVVA 2V1CA 3AW7A 1BQLY 1QTHA 2CEAA 258LA 4DD3A 4H9HA 1L34A 2BNKA 4NGYA 1CX7A 5ITXA 4G4BA 1QS5A 2UUBM 1JHLA 4YY3M 2F4GA 181LA 4DR5M 4JI8M 1LJFA 4DQJA 5E26A 1L47A 4KL7A 4WG1A 2Y0QA 1W08A 2XBSA 2RH1A 2I6ZA 1L59A 4WURA 3SB6A 1C6KA 5EP3A 1ZV1A 1QTDA 1YROA 4PPOA 4I7TA 5KPRA 1VQ1A 3ULRA 2FFJA 1G06A 4A7DA 144LA 1B5XA 1OUAA 1YL0X 1LYFA 3IJVA 1L8QA 4NHIA 1JJ0A 3B7ZA 2CV2A 1E94E 2FH0A 3RFWA 1KIRC 5KQDA 3M18B 149LA 3K92A 3NYAA 1N36M 3EMLA 4B3RM 1NJFA 1KY0A 1JTTL 4QOZC 3A91A 4BAPA 4LT0A 1L83A 254LA 2MEAA 2I26L 4NSGA 3ODUA 1CX6A 2W1LA 3RU5A 1NJGA 123LA 2B72A 1IP7A 4NGZA 2BJWA 1B7SA 1XFPL 2VQFM 2OE4X 3SFZA 1YKYX 5IREB 3CF2A 1JB0F 4B4JA 1NNUC 4R3DA 2OOAA 3G3WA 2XSZA 3MJ5A 3NBXX 1C61A 3J4GA 5C6JA 1GB7A 1ZMVA 1L2CA 4M6DA 1C6FA 4LYBA 1HMLA 1SX7A 2MEDA 5KJ9A 1JJ3A 1L85A 1D6PA 4NIJA 4GN5C 4FVMA 147LA 4WM3A 1GDXA 5ILCA 3WUMA 4I7PA 1Q02A 3GRUA 1L2DA 132LA 2YBHA 4HV1A 1TEWA 2HEBA 3HU2A 1H6UA 4IBIA 2FOIC 220LA 2HUBA 4GBRB 241LA 1HEWA 2WSEF 3GLGA 1LYHA 1WTNA 1JTPL 3QNGA 3CSQA 2L7HA 5F3WA 2XEPA 1IQPA 1VDPA 3WPKA 178LA 1IM2A 3OE6A 2EUCA 3ATOA 1L77A 4H1PA 4ETAA 5A3ZA 3KVWA 2F4VM 3A67Y 4W56A 1QTVA 4JI5M 4FW9A 1BB5A 1R6BX 1BVXA 3L27A 1ZWNA 2X8AA 4OW0A 1L67A 2RB0X 134LA 1CUPA 1IY0A 1HEMA 193LA 7LYZA 5DN5A 5M1YA 4MR1A 1VAUA 3WL2A 1L55A 3WULA 1LJKA 5FSTA 1GPQC 1L49A 255LA 1VDSA 3B0KA 2ZIJA 206LA 4B0DA 5KKJA 2C5RA 110LA 1L94A 1DQJC 2XJWA 1LSFA 3FTFA 2WARA 189LA 2GV0A 3K9PA 4I8SA 2JA2A 2Y20A 1FDLY 1XMQM 1LPIA 1UACY 1VATA 1C64A 2DWNA 201LA 1QZMA 1SSYA 3A6BY 2DQGY 1Q3BA 4ARJA 2DKLA 2B6YA 4AXTA 1BHZA 1OUGA 2LWXA 4IBGA 1KXYA 1L43A 1YKZX 3AZ7A 3KOXE 1H87A 3U61B 3SBBC 1P56A 2EKKA 3GXRA 2Q9DA 1HR0M 1L58A 2BQJA 4TX7A 4B4IA 1JR3A 1L17A 1WVUA 3HBHA 4GMQA 4ML7A 3N9EA 3SMPA 3LZTA 1GDWA 5KXOA 4W94A 1LYOA 1RJCB 1L05A 1DGFA 5JENB 4DR6M 1TF0B 170LA 1XGUC 1OFHA 4R0FA 2MGWA 3LCVB 104LA 1LWKA 1SQ2L 3CF6E 1IP4A 1XXHB 1LI3A 109LA 1A4VA 145LA 3GO8A 2RBRA 4LDLA 4NGJA 1SLYA 4W57A 5DFLA 1OUIA 1DO0A 1DI4A 5HMVA 2I25L 2UXDM 3HH5A 3TXHA 3L28A 1OUJA 4BLCA 4LF5M 3M6AA 2MEEA 3UONA 1YSYA 2LZ2A 140LA 1RU3A 3TXBA 1PZYA 3M7GA 1ZMWA 1K3WA 1C45A 3KS4A 4DV6M 1LHLA 2ZNXY 2XFTA 4IBKA 3HU1A 1L46A 1QSWA 1QVRA 4I7LA 3UGJA 3EMSA 1LZSA 2BPUA 1WQPA 3T6UA 1YIKA 5F16A 4I7SA 5F9UA 4S12A 4LF6M 2CHQA 4XBOA 4NSRA 5LVKA 1CKDA 4NOOB 1OUEA 2RBPA 4AG5A 4IBFA 4PDGA 1NHGC 4NRVA 1F4IA 1NY6A 1G7HC 1YAQA 3W6BA 1EE8A 1C6AA 247LA 3DOAA 2N35A 4KLNA 1QQYA 4WL6A 1KIPC 2LNHC 1OP9B 4B49A 1D2YA 1GXV2 1QAOA 3HU8A 5HNLA 4XJBA 3GUMA 4Q7JA 1C67A 2D91A 1L54A 1CVKA 3VFDA 3HHZA 1NBZC 1DGBA 234LA 1IVMA 2Z18A 3DFZA 1JKDA 5APCA 2ZBKB 3L2XA 2B6XA 2ZTCA 2QNJA 4E97A 3W6FA 2KEBA 253LA 3SN6R 4MSTA 4GKJM 4HSFA 1T8GA 4GCEA 4E3UA 1G0KA 6LYZA 3LW5F 1Z55A 1Z59A 2OTZX 182LA 3LN2A 2LVOC 4OWBA 4TTDA 4W55A 1G0QA 3I4VA 2KNZA 1QT5A 3W0LB 5KXYA 3HUQA 5IWAM 1P37A 2RGOA 1LHJA 1DYFA 1QIOA 1IXZA 126LA 4PJ2C 2HL7A 4ANRA 3OTOM 1LZNA 4GH9A 3HU9A 2OE9X 1G0MA 1L42A 2R4JA 1L65A 1WIVA 2F2QA 5LA8A 1LZ5A 2FS1A 3D3DA 4FCVA 3VKHA 3E4RA 4EKPA 3CDOA 3T1YM 4JI3M 4AG6A 2HHHM 3F8VA 5FEKA 3WPJA 3AOEA 1P5CA 1LMCA 2XSZD 2BQMA 4RDSA 3PFIA 4CHTB 3QYEA 1IY1A 238LA 2XBRA 3U6QA 1AKIA 1GL6A 4LJ7A 1NV8A 190LA 1IR9A 3HTFA 4AI6A 5FTKA 3C9PA 5I54A 1G0LA 113LA 4H9AA 3AGIA 1L29A 2A7FA 1L66A 2IFFY 3HUKA 2K6BA 1L03A 1L01A 4J0LA 1N78A 4LDEA 1FBIX 3SASA 1CU6A 3IG8A 5LYMA 5KXKA 3CQLA 4EPFA 1T3TA 1WTMA 1GE1A 1TCYA 4OU7A 3WUAA 5L9JA 1B2KA 2YNMD 1P2RA 4QNMA 2BQGA 1UCOA 4M0WA 4JI2M 1LYJA 4GITA 1L22A 3LYTA 5IDDA 3IECA 4B3SM 1B5UA 2NTHA 1CNSA 3AOGA 3U6DA 1LW9A 1C6CA 5K7OA 4OX9M 1KY1A 1L31A 244LA 5JI2E 3JR4A 2JY7A 1LSNA 5B06A 1SXJA 2OE7X 1CV0A 2O4WA 1C6JA 4QDNA 1WQOA 2G4QA 3SAUA 1J1OY 2H5ZA 3GUKA 3WUNA 3EBAB 1XJUA 3SP3A 2Q9EA 1GF0A 4HTQA 1L38A 1HNXM 2HECA 5A2QS 4PK0A 1C6MA 1IXSB 1CKCA 3TXDA 1LGUA 1EQEA 3HZJA 3IHPA 3DMXA 1J7KA 3CGWA 3UJNA 2CDSA 2RBSA 1L86A 2BWEA 1GKIA 1C6HA 2OU9A 3A46A 3A45A 1ORYB 2DAEA 260LA 4R7GA 1G4AE 2RGHA 2WSCF 1HFYA 3QYBA 4HTNA 1B7QA 4BS7A 5DN4A 2C99A 3A3QA 1ZURA 1GB8A 1HERA 1NO1A 1G3IA 1X37A 1L36A 2W1YA 4I7RA 1S3SA 3J81S 1C60A 4LF8M 1GF4A 1JR3D 5LVJA 1IWZA 3TXEA 2EIZC 1XXHE 4LT2A 1UIAA 2KZSA 198LA 1BVSA 3FRHA 3GLFA 1MX0A 5KKIA 1WVVA 4G49A 2H9KA 1HJPA 1QANA 152LA 1IWYA 5FHWA 1XEPA 1L50A 4G9SA 1JJ1A 1L39A 4LY6A 1HC0A 4P17A 4LJ4A 1TDZA 4LFPA 4OOTA 3D9AC 214LA 1L97A 1G59A 4REZA 1HSWA 3B6LA 3F92A 1CV3A 1L25A 3HH6A 1XNRM 1G1WA 3HWLA 2F4AA 3Q8GA 1YL1X 4GEWA 3U6EA 5EXXA 5LYZA 5I14A 4N0JA 1N34M 1P64A 3CT1A 4L6V6 5DYGA 3FTDA 2B75A 1CJ7A 3TMUA 1NWGA 1NNJA 1YQVY 2Z2EA 1D9UA 4OW1A 4LRSA 1B7LA 4MH0E 1LZYA 3TWLA 2FYCA 3TXFA 1C62A 1GXXA 1L0KA 1N75A 4LFXA 4LT1A 4L16A 3WHLA 1IBKM 4HJZA 1REMA 2A7DA 2YBLA 1AT6A 5ILFA 1LZEA 4XENA 2FNAA 1L70A 1JKCA 4OVZA 1SSWA 3RE8A 1GL7A 1G71A 1L84A 1WQMA 2YSSC 2XF3A 1C7YA 1L56A 4NHQA 4IASA 2JY6B 4S0WA 2O25A 2ZM6M 5B07A 2LC9A 131LA 2LVQD 4WW0A 3F6ZA 1D0MA 1LSEA 4JI6M 4RLMA 2DZOB 3GXKA 2MROB 5T3FA 4I7JA 3C80A 3P4ZA 2BWBA 1D3JA 2F5PA 1TAYA 5GKNA 4YHHM 4GKKM 1G8PA 3BXWA 1L26A 1CJ8A 1LKRA 2BQAA 1LHKA 1N4FA 1GBWA 1DGGA 5I4XA 2XZUA 1BWJA 4WLYA 2QPAA 1OVJA 3LVWA 1L75A 5KXWA 1OJLA 5KPTA 5E9RA 3AL0C 5LZMA 3DMZA 4FD2A 1XEKA 4NSJA 130LA 1LJIA 1VEDA 1GB5A 5LMUM 3P65A 1GF6A 114LA 1OVKA 3B0IA 3A98B 2B6TA 1KIQC 3GLIA 3SHFA 1HT2E 2BJVA 3AGHA 1L09A 1HEOA 2RB2X 3I01M 4IJ4A 3A95A 3HT6A 3B74A 1V7SA 1CU2A 3EIHA 1SWYA 2KZUA 4HPEA 2MR9A 1OIZA 3FYCA 2VB1A 2DAMA 4LYZA 2HEDA 2B7XA 2R6FA 1LTMA 3PDSA 1WTHA 216LA 2RAYX 3VK8A 3GUOA 4ZEEA 3VWOA 2JNHA 1KSFX 2DWZB 1HEQA 1B0DA 4AQNA 4Z6YA 1L23A 4WLDA 3E9SA 2ZAOA 1IP1A 1QTCA 4LGKA 3B9PA 3ZQJA 1GFGA 2XTHA 4AZFA 4LT3A 1B7PA 2LYMA 1QT6A 2OU8A 1XNQM 1P6YA 2MEGA 1B7MA 4IATA 4NWEA 3HT8A 3FKEA 163LA 1TBYA 2JY5A 4QOSA 1W6ZA 231LA 4DKLA 2Z4RA 2JY8A 1W5SA 3K2RA 4Z46A 2QSFX 4IBCA 5IZ7D 3KAMA 4DR3M 1LZBA 1KXWA 1DYAA 3SB8A 1GEVA 248LA 3WPLA 1I4WA 1UUZC 199LA 5KQ8A 139LA 4GCDA 1JUGA 1L2BA 1F6RA 2HKJA 4PRQA 1ALCA 2ZYCA 4LFCM 1N33M 1L16A 1GFEA 166LA 1SXJD 2MH8A 3HBEX 5DLAA 4ARQB 2D7HA 1L24A 1LSZA 129LA 1UFZA 4JN6A 3FUTA 1D9WA 5LVIA 1L18A 1CKGA 3OJPA 3SAVA 3FRIA 2O5RA 5EXPA 2DQDY 1EFUB 4LGYA 3GPPA 3WH1A 3WW6A 4CGEA 4WM5A 4JI0M 2IHLA 4I4LA 3AZ6A 3HJSA 1JWRA 1DKJA 1PJQA 4PRUA 2ZNWY 3AZ4A 245LA 3C7YA 5ITQA 3W68A 1UA6Y 1JQUA 4LZJA 1JKBA 1LYDA 1EIJA 1P3QQ 3E21A 1GE4A 1C46A 2QARC 3GLGB 1GWDA 2Z6BA 120LA 229LA 1T6OA 4GLAA 2D7EA 2Z12A 212LA 1KNIA 4ARQA 1L96A 1QTKA 2K47A 2XLJA 2QB0B 4CGYB 246LA 227LA 3LYZA 3SHGB 4XJHA 3PBLA 1KS3A 3L29A 2C8OA 3HDEA 1O23A 1DI3A 2AHMA 1TR8A 1QUOA 1YKXX 3UZUA 1GAZA 1L11A 4CJ6A 5LYTA 1L00A 4UWVA 1R4GA 1JISA 4WO6A 4HLQA 4RF0A 2Q2EB 2HCBA 4G3OA 1GEZA 1DI5A 4X3BA 2Z4SA 4TUNA 3HHXA 240LA 1QAMA 2KHHA 107LA 4ET9A 4JI4M 1BVKC 1C65A 1OVHA 4W51A 1IN4A 4DV3M 1UICA 2Z37A 3HTDA 4NXMM 4NSHA 1L32A 188LA 1SG9A 3QAKA 8LYZA 2EO2A 4Z8XA 5KXZA 2DI0A 1HEPA 2DBTA 1QUDA 4X62M 1C6BA 4YOPA 1ZMUA 2I7PA 1Q39A 1GF3A 4NWHA 4IBBA 1IWWA 2L4EA 4X65M 1P2LA 4LYOA 3L2AA 3CDQA 4H8XA 3FE3A 3KOYE 4IBEA 1IY4A 1QSQA 4JI7M 1GBZA 1D3FA 2D7GA 1JTOL 2XH9A 2JWSA 5HLLA 1IP3A 1IY2A 3J80S 3GQ5A 4WM1A 2QQ8A 1DYBA 4LGMA 1T3PA 1IN6A 2B74A 2MEFA 5E4PA 5C1BA 1PJJA 1ZVHL 4JXJA 4RKUF 1LMQA 3GULA 4LYMA 1LMNA 1KW7A 2HUMA 1B5VA 4HPIA 4EOFA 1RE2A 5C6IA 3LCUA 4L4UA 3SAWA 4HJVA 3EO5A 5LIOA 1WXQA 2UU9M 1A2YC 1HMKA 177LA 2LBCA 1J09A 1L76A 1HSXA 3QAUA 221LA 3I04M 1ZAEA 187LA 1ZYTA 3FD9A 2D4KA 5KPZA 3FADA 2M60A 2DHYA 2P5TA 2DXIA 251LA 4NGLA 3W6AA 2RKOA 4D80A 1UIDA 3TXIA 3DN6A 1OUCA 1PS5A 3HWSA 3WXTA 4YX7C 3TMVA 2Z19A 3B7QA 1L63A 1LPYA 1GB2A 1YLAA 2B3TA 5BR8M 1IO5A 1JITA 3HTGA 3ZH9B 4H93A 1D2WA 5LINA 2LTUA 2ZTDA 3HFMY 164LA 2FE8A 3CSZA 1G41A 2OOBA 4LJ6A 153LA 1Q3CA 167LA 4AKHA 1OKSA 1TGUA 1I94M 4FWGA 2UUAM 1G7IC 2ANXA 4KPMA 3B0OA 3HH4A 1VDLA 3W6DA 2DKVA 4AKIA 205LA 1L68A 1YE9A 2BQIA 5KXMA 2KW0A 2CWBA 157LA 191LA 230LA 4LJAA 1WQRA 3PXGA 4N5RA 2C98A 3HHWA 3HY5A 3MK6A 4LJ5A 1SX2A 3C83A 1LAAA 1IORA 2LHGA 5APEA 3MMPA 2FBDA 2UXBM 5A3EA 3CDTA 2L09A 4XJGA 3HHYA 1E8LA 2BQBA 1L41A 1LSGA 3LYMA 4EIWA 1LOZA 3FUXA 5LVGA 2CHGA 2A4TA 4LZZA 3R9XB 1LCNA 3HH3A 4QEQA 5DNYA 4H8ZA 4BADA 7LZMA 4QY9A 1OFIA 4RW2A 1FLYA 3FA0A 2ZILA 143LA 3LQQA 5J7CA 3BBZA 1GB0A 1KFVA 4YEOA 2B6WA 4M0DA 2O7AA 1DKKA 4EKRA 4GC5A 1TDHA 1LZ4A 1ZQ9A 1WGLA 4PT5A 2B5ZA 1XHBA 1MJGM 194LA 1R5LA 2KXEA 5B1FA 3GLGE 5APFA 3SMSA 196LA 218LA 2OQ4A 5F14A 4XJIA 2BQDA 3C7WA 2YBMA 4D9ZA 1D3MA 2CV1A 2JXNA 2C9CA 4H9EA 168LA 1C6EA 3H4MA 175LA 2BLXA 4B7GA 2C96A 1L28A 3U60B 5L3HA 3TWMA 2QBYA 1OV5A 4DUYM 1GE2A 5FTNA 4XGIA 1LYEA 1FJGM 4KO8A 9LYZA 1IOSA 3FTCA 3KFUG 4KXIA 2BQCA 4FDYA 5FDJA 125LA 1K82A 3RUNA 3GUJA 4GCFA 4H94A 1IWUA 3AJNA 2Y8PA 1QTBA 1G07A 1CU5A 4EXMA 1IN7A 3TQSA 1L82A 3C8RA 4ZPXA 1HHLA 3GLHB 3GUPA 1SXJB 1LZ1A 4PDIA 4NG1A 8CATA 3GUIA 122LA 2OEAX 2L4FA 1FKQA 1LZAA 2DENA 4B08A 1L1ZA 4TUWA 3K2LA 2C9OA 4YXAC 1LWGA 1UIBA 4UWUA 2Z7JA 3H4JA 3U60A 1LJNA 243LA 2LHMA 5LAGA 1IIZA 4EKQA 3OE9A 133LA 4Y28F 4ETEA 4ET8A 3KOWE 1QUHA 4WLXA 1PQMA 3B89A 4WP2A 186LA 2ZQ3A 4ITQA 2QCUA 1IC4Y 1JR3E 2F5QA 3J2PB 2HU3A 1C7PA 4B7HA 2MJ5B 3DN4A 5KXRA 3RZ4A 4I7MA 5FELA 4DDCA 5EP1A 3DMVA 3G3AB 5EBHA 1L87A 4PD2A 3GLHA 1T6VL 3FUUA 1GB6A 5KXXA 4IAPA 1J5EM 183LA 1L99A 210LA 2D4JA 3DA1A 4MM3B 2YVBA 1C08C 3BKHA 3W6EA 1LGXA 2F5NA 4ARLA 3T6PA 3VLFB 1G1VA 4I7NA 3GLFB 1T43A 3C8QA 1PQIA 1REXA 3HJ8A 3KP1E 5L3IA 3L26A 2OO9A 4WMGA 4DAJA 3SB7A 5HQ1A 3C58A 1BB6A 1L10A 1FNNA 1L53A 4N8ZA 4ZIXA 1L48A 1IOCA 1AZFA 2DQEY 1L12A 2OPFA 2CV0A 1L95A 2VIIA 4PGJB 2DAGA 1XC8A 4LRTA 1LHIA 2KRUA 3RGSA 4OWEA 1GAYA 2DWMA 1DYDA 3P64A 1XEIA 1D6QA 3L64A 1JEFA 2FYDA 1GFAA 1L02A 4LFBM 1LSDA 4IBDA 1RCMA 232LA 2D6BA 1V7TA 3J6KA 4CHXA 2CGIA 1CUKA 1Z5BA 1IOTA 3VW7A 4RNAA 7CATA 4L8RC 1L30A 1QTEA 1L51A 4DDBA 1DPWA 4CFOA 5B05A 2RBOA 1XMOM 1LKSA 4LDOA 2HU1A 4ARMA 197LA 2QZ4A 3G3BB 1LZGA 4DDAA 4GC9A 5KO3A 4OVZB 1GBYA 3SBAA 5D5FA 3N9CA 211LA 4FCWA 5F81A 1B5YA 1NDGC 4Z98A 1B7RA 4MCKA 3FE0A 3TWKA 4TWSA 185LA 1GF9A 195LA 2DHRA 3LMMA 4B3TM 2LXEA 3U6CA 1UIGA 4W52A 1TDYA 2QP9X 2YFQA 4M9ZA 1IP5A 1DGHB 1P36A 5ITRA 1GE3A 4G4HA 2LVPC 1REYA 4LF9M 2R18A 4I7QA 4W59A 1C63A 4M9SA 2R62A 1IWXA 1LZDA 2ERCA 1L37A 1L98A 1LJ4A 1D0LA 3G3XA 4NXNM 1B7OA 1HNLA 207LA 5APDA 4KHPM 4C5FA 3WU7A 3U5ZA 3GPXA 3W3EA 4HL4A 1JIYA 1C10A 1CTWA 3V2YA 3U6OA 1P2CC 3JAMS 1XGPC 3V2WA 1OUDA 1OQMA 3DN1A 3RT5X 2LCBA 3SBJA 4WM2A 4LF4M 1L80A 4C3WA 2VF7A 4M4OA 4IJEA 4ETBA 112LA 2HWJA 2CUUA 2IGCA 3GPYA 1JPOA 2Z8YM 1IX0A 3GLIB 4WG7A 1HQCA 3SB5A 3KDSE 4MGYE 1T8AA 6LYTA 2L6OA 1L91A 2C8PA 1XJTA 1DGHA 3TPZA 3BOSA 2XZFA 1GFKA 1NF5A 3GQ3A 2RSCA 1VG5A 174LA 1CV4A 3CT0A 1AM7A 4XN6A 3TMWA 3AZ5A 3KXEC 172LA 5DM9A 3D8LA 159LA 3TXJA 4MGHA 4DV4M 5JI3E 5FLXS 1INUA 2LH0A 4DR7M 4I0CA 4XJFA 4DV0M 2L2DA 3KP0E 146LA 2HEEA 3WVXA 2ZYPA 1L13A 3AV0A 4H9FA 1SWZA 5LAFA 4WOAA 4X64M 1B5ZA 1VEGA 4NGVA 3U6MA 2BLYA 5FSWA 4H8YA 1K3XA 4RW1A 3OE0A 223LA 180LA 2K9DA 2M5ZA 1LSMA 2ZAMA 3K3TA 4GHLA 4BAFA 4J1AA 2MEBA 259LA 5I4YA 3DKEX 2Z39A 2WSFF 3A90A 1WQNA 4DV7M 4DC4A 1JSFA 4GN4A 3MHVC 4NGOA 1SXJE 3T1HM 1G0PA 222LA 3UK6A 1LSCA 2YDGA 1AT5A 2DQFC 3RNXA 3T15A 1D2NA 1V34A 5DYIA 119LA 1LI2A 5KXNA 1C6TA 4G4QA 3FUVA 228LA 4YENA 158LA 2XQOA 3DN0A 1L60A 3WXUA 3HX3A 2X0AA 3KS8A 1LJJA 1HQYE 2CHVA 4LG2A 1GLNA 1TLAA 1YAPA 2LZMA 4EPIA 1EQ4A 1L33A 4K0KM 1E9RA 4ZPUA 5I53A 1V92A 2NTGA 108LA 4U3XB 1L44A 1YAOA 252LA 4TSCA 1NV9A 1LYIA 4GRIA 4W54A 2VQEM 4YM8A 4FWDA 2Y21A 1G7LC 5E6JA 3CB7A 2R65A 4BB9A 3IWRA 1P46A 4WM6A 3CF0A 192LA 4A3VB 1LV7A 2G8LA 1L74A 4EJ4A 151LA 1UIHA 1L71A 3WW5A 4W5WA 1DO2A 1E32A 4DBGB 4J7VA 1LZ9A 4H90A 1PJTA 5IT9S 2JP7A 4MB7A 1B9OA 1LJEA 1LZTA 3J7AS 3GRYA 3FI7A 4YF2A 1LSPA 4I8OA 1CU0A 2KNAA 2F32A 1QSAA 1L88A 1WQQA 1QAQA 4I7OA 3FI5A 4BBAA 1QS9A 2JUJA 3ZVQA 2YBNA 4L41A 4UWNA 1ZVYB 256LA 4DQ5A 2AUBA 1VEKA 4IBJA 3ZC7B 2BQNA 2Q0MX 4LYCA 2RAZX 1H6MA 4Z41A 4XADA 1OV7A 1P7SA 1XGTC 1LZCA 5I5QA 2VF8A 2J5YA 3GPUA 1GFJA 3LHMA 1LYGA 5EXTA 3TXKA 4OWCA 2HEFA 4LZMA 1W5TA 4LYTA 2LHCA 1PJSA 1C68A 1PQDA 2W1MA 4NG8A 3P66A 1QQWA 4KODA 4JYAM 1F0WA 1L21A 1NMMA 1C66A 4DYGA 1B7NA 1YILA 162LA 1L0JA 3ZCBB 4AQYM 1DYCA 4II7A 4NFVA 4JI1M 2DWLA 249LA 3AGGG 3SC3A 3HKPA 4N1CC 1XGQC 1CV1A 1OUBA 2XGNA 4GLVA 1IBLM 1Z6TA 1L06A 1IFYA 3D8BA 1OAOC 4WLTA 3WHKA 3PVSA 3K9OA 215LA 2DQHY 1DYGA 4QHSA 1L04A 2MEIA 217LA 2QENA 3GP1A 2HAKA 2ZANA 3K1JA 3CDVA 4NEBA 1MN3A 2RBQA 4FJRA 3QY4A 5LA5A 1HENA 3PNYA 4IJFA 4DR4M 1GO5A 1PM5A 4HEOA 4R71A 4NSOB 1XEJA 1OWYA 3A93A 1EQ5A 4N9RA 148LE 1KXXA 4XK8F 1LHMA 3GLIE 5D5CA 1LMPA 1JSEA 3CDRA 1J1PY 1HF4A 1LMOA 3C8SA 2J7NA 5B1GA 3FUWA 3RZEA 1L45A 3Q8XA 5IELA 4B4EA 5B59A 2HULA 1G7MC 5FCPA 2F47A 4G4RA 2X49A 1XB2B 4I5SA 1B6IA 1L07A 1QT8A 4OOOA 5ITYA 1GF7A 1NY5A 1GBOA 1R2ZA 4DUZM 250LA 4NHTA 5AMYA 3HU3A 209LA 135LA 4RF1A 2LZTA 6LZMA 1D3NA 1G0JA 2DQCY 200LA 2DAKA 1TH4A 5DL9A 1CV6A 5FTLA 4MGIE 111LA 1FLQA 1IY3A 4DWXA 3C81A 2HUKA 4DT3A 5ITXE 3IG5A 4XYYA 1FLWA 4DD1A 1LSYA 3C7ZA 3HTBA 257LA 1LJ3A 1PQJA 4YXCA 4LFAM 4II8A 3ZEKA 4GCCA 4N1EI 1L08A 4PHIA 2BAAA 1VDDA 5ITTA 5FTMA 2BQLA 3NBIA 3JR5A 5L8RF 4NHPA 3IJUA 1JKAA 3QE8A 4NHSA 3RGPA 3QWLA 1DV0A 1C6PA 3R8FA 1IR7A 2ZQ4A 3A8ZA 1FN5A 1NSFA 4DR2M 1LSBA 2DQIY 4Z3MA 2W1XA 1HNZM 1QTZA 1YAMA 2G5GX 3DZDA 4H91A 1CKHA 3FYDA 4DD7A 3W6CA 1LZ6A 2UUCM 156LA 1BB4A 1L15A 1C6LA 5EP2A 3L25A 4AKGA 2E5LM 3SARA 184LA 1IP2A 2EQLA 1IEEA 5ITUA 3M3UA 2NQ8C 1CUQA 1Z5CA 3V76A 4AW4A 4H9IA 3EXDA 3U61A 4W53A 1IWTA 1LZRA 2MEHA 4P2EA 2OU0X 1MU5A 1L69A 2DNAA 1L61A 3B7NA 4GIPA 1L79A 1F10A 4I81A 2F5OA 4GRVA 1LLHA 1FKVA 2RRUA 1G0GA 2LYOA 1TTEA 1HELA 1OWZA 2DQAA 2K0BX 2ANVA 2QBYB 1QDRA 2B70A 1BB7A 2R45A 3I4YA 1GHLA 1C43A 1LI6A
chains in the Genus database with same CATH topology
1ZV5L 2NWDX 1QT7A 1BB3A 1GF5A 1GB3A 5LVHA 2YBIA 3A94A 1L64A 4WO9A 4OO9A 4ARPA 2G4PA 3ATNA 3WYHA 3NY9A 2RBNA 3C82A 1C6IA 1L57A 137LA 2OTYX 2CJLA 4OWAA 4NY5A 5IHGA 4YEMA 4PJZA 1IP6A 1JTNA 1I20A 3P68A 5KY1A 4H9BA 2BQOA 1GFHA 3DN8A 4K5YA 1QSBA 2YBJA 3OK0A 4DD0A 3NY8A 5LXWA 2BQKA 226LA 3GUNA 2O79A 4NGWA 1T8FA 1IC5Y 1GB9A 5KXLA 2CWIA 4EKSA 1I56A 1QT3A 1C6GA 103LA 1GFUA 2HEAA 4KT3A 1CV5A 3AB6A 3F9LA 1JTMA 262LA 219LA 1LMTA 2D4IA 4EMNA 1LYYA 4TSBA 3N9AA 4R6CA 102LA 3B72A 1L20A 4ETDA 3OE8A 242LA 4QGZA 1ZMYL 4CFPA 3TXGA 1NHBA 1DPXA 2B73A 1LGWA 1C6NA 4HJYA 4ZFPA 224LA 4LZTA 1BWIA 225LA 4HP0A 3E3DA 1IR8A 1QDTA 154LA 141LA 3RW8A 3T36A 261LA 1QUSA 127LA 142LA 1J1XY 3CT5A 1HFZA 1L90A 4W96A 4NGKA 1LYZA 4I7KA 1I1ZA 4CJ2A 4RLNA 4ARMB 1BGIA 1CU3A 1NDMC 1GD6A 1L72A 1QT4A 2RB1X 1LMAA 3D4SA 1GFRA 1GE0A 3G3VA 1LJGA 5II3A 1L14A 155LA 1FLUA 1GBSA 4ETCA 1EL1A 5I4WA 3TMXA 161LA 1IWVA 1UIEA 1C6QA 4G4CA 1L27A 2BQHA 4XJDA 2FBBA 235LA 4NGIA 1OYUA 1MELL 3MGWA 118LA 2HTXA 1OUFA 3A3RX 5F9XA 1GFVA 1L89A 236LA 1G7JC 1B5WA 150LA 1XSFA 1PQKA 3AW6A 1I6SA 3CSRA 176LA 3HDFA 1D0KA 239LA 3LZMA 4H9CA 1L52A 128LA 1T97A 2G4NA 3HUAA 169LA 4GCBA 2DQJY 1C6DA 233LA 171LA 1IOQA 2Z2FA 3A6CY 3A92A 1UBZA 3DN3A 1HFXA 1L73A 1LHHA 213LA 237LA 5C6LA 1L19A 1NQIA 1DZBX 4OWHA 1GFTA 1GF8A 4DD2A 4DJHA 1VFBC 1REZA 1LSAA 3DN2A 2F2NA 2MECA 4WM4A 1BWHA 1MLCE 1K28A 2H9JA 173LA 5KXPA 1GBXA 3DNAA 2B6ZA 160LA 1T6HA 3A34A 3HT9A 1DYEA 1OUHA 3WU8A 1NHEA 4J1BA 4DD9A 4WL7A 1L93A 1XGRC 3WMKA 4HV2A 3HBDA 1IC7Y 5HNCA 1PQOA 4GN3A 1LJHA 1LZ8A 1CKFA 138LA 1VDQA 165LA 1QUTA 1L62A 2BQFA 3LYOA 115LA 4NSIA 2EPEA 1CJ6A 4HTKA 1F6SA 1VDTA 2Z38A 3HT7A 1L35A 1UIFA 3AYQA 4DQ7A 1P3NA 1L81A 2L78A 1L40A 4W58A 1L92A 2N5ZA 4B1AA 1RFPA 1UC0A 5KXSA 2LYZA 1YANA 1KW5A 2EKSC 1EPYA 1CJ9A 5KXTA 3JR6A 3BKVA 2BQEA 4O34A 3ZVQB 3WU9A 3LZ2A 2ZWBA 3WVYA 1DXJA 3SB9A 1NBYC 1C69A 1QUGA 5HMJA 1LYSA 2PC2A 1NKHA 208LA 4AGAA 4H92A 3A96A 2ZIKA 1RI8B 2F30A 3AW7A 1BQLY 1QTHA 258LA 4DD3A 4H9HA 1L34A 4NGYA 1CX7A 4G4BA 1QS5A 1JHLA 2F4GA 181LA 1LJFA 4DQJA 1L47A 4KL7A 4WG1A 1W08A 2XBSA 2RH1A 2I6ZA 1L59A 3SB6A 1C6KA 1QTDA 1YROA 4PPOA 4I7TA 3ULRA 1G06A 4A7DA 144LA 1B5XA 1OUAA 1YL0X 1LYFA 3IJVA 4NHIA 1JJ0A 1KIRC 3M18B 149LA 3NYAA 3EMLA 1KY0A 1JTTL 3A91A 4BAPA 4LT0A 1L83A 254LA 2MEAA 2I26L 4NSGA 3ODUA 1CX6A 2W1LA 3RU5A 2B72A 123LA 1IP7A 4NGZA 1B7SA 1XFPL 2OE4X 1YKYX 4B4JA 3G3WA 3J4GA 5C6JA 1C61A 1GB7A 4M6DA 1C6FA 4LYBA 1HMLA 1SX7A 2MEDA 5KJ9A 1JJ3A 1L85A 1D6PA 4NIJA 4GN5C 147LA 4WM3A 1GDXA 5ILCA 3WUMA 4I7PA 132LA 2YBHA 4HV1A 1TEWA 2HEBA 220LA 2HUBA 4GBRB 241LA 1HEWA 1LYHA 1WTNA 1JTPL 3QNGA 3CSQA 1VDPA 3WPKA 178LA 3OE6A 3ATOA 1L77A 4H1PA 4ETAA 5A3ZA 3A67Y 4W56A 1QTVA 1BB5A 1BVXA 1ZWNA 1L67A 2RB0X 134LA 1CUPA 1HEMA 193LA 7LYZA 5DN5A 5M1YA 4MR1A 1VAUA 3WL2A 1L55A 3WULA 1LJKA 5FSTA 1GPQC 1L49A 255LA 1VDSA 3B0KA 2ZIJA 206LA 4B0DA 5KKJA 110LA 1L94A 1DQJC 2XJWA 1LSFA 2WARA 189LA 2GV0A 4I8SA 1FDLY 1UACY 1LPIA 1VATA 1C64A 201LA 1SSYA 3A6BY 2DQGY 4ARJA 2B6YA 4AXTA 1BHZA 1OUGA 1KXYA 1L43A 1YKZX 3AZ7A 1H87A 3SBBC 1P56A 3GXRA 2Q9DA 1L58A 2BQJA 4TX7A 4B4IA 1L17A 1WVUA 3HBHA 4ML7A 3N9EA 3LZTA 1GDWA 5KXOA 4W94A 1LYOA 1RJCB 1L05A 5JENB 170LA 1XGUC 4R0FA 104LA 1LWKA 1SQ2L 1IP4A 1LI3A 109LA 1A4VA 145LA 2RBRA 4LDLA 4NGJA 1SLYA 4W57A 1OUIA 1DI4A 5HMVA 2I25L 3HH5A 3TXHA 1OUJA 2MEEA 3UONA 2LZ2A 140LA 3TXBA 1PZYA 1C45A 1LHLA 2ZNXY 1L46A 1QSWA 4I7LA 3EMSA 1LZSA 2BPUA 1WQPA 3T6UA 1YIKA 5F16A 4I7SA 5F9UA 5LVKA 1CKDA 1OUEA 2RBPA 1G7HC 1YAQA 3W6BA 1C6AA 247LA 1QQYA 4WL6A 1KIPC 1OP9B 4B49A 1D2YA 1GXV2 3HU8A 5HNLA 4XJBA 3GUMA 1C67A 2D91A 1L54A 1CVKA 234LA 1NBZC 1IVMA 2Z18A 1JKDA 5APCA 3L2XA 2B6XA 4E97A 3W6FA 253LA 3SN6R 4MSTA 4HSFA 1T8GA 4GCEA 4E3UA 1G0KA 6LYZA 1Z55A 2OTZX 182LA 3LN2A 4OWBA 4TTDA 4W55A 1G0QA 1QT5A 5KXYA 3HUQA 1P37A 1LHJA 1DYFA 1QIOA 126LA 4PJ2C 4ANRA 1LZNA 3HU9A 2OE9X 1G0MA 1L42A 1L65A 2F2QA 5LA8A 1LZ5A 3D3DA 4EKPA 3CDOA 3WPJA 3F8VA 5FEKA 1P5CA 1LMCA 2BQMA 4RDSA 238LA 2XBRA 1AKIA 190LA 1IR9A 3HTFA 5I54A 1G0LA 113LA 4H9AA 3AGIA 1L29A 2A7FA 1L66A 2IFFY 3HUKA 1L03A 1L01A 4J0LA 4LDEA 1FBIX 1CU6A 5LYMA 5KXKA 3CQLA 4EPFA 1WTMA 1GE1A 1TCYA 3WUAA 5L9JA 1B2KA 1P2RA 2BQGA 1UCOA 1LYJA 1L22A 3LYTA 5IDDA 2NTHA 1B5UA 1CNSA 1LW9A 1C6CA 5K7OA 1KY1A 244LA 1L31A 5B06A 1LSNA 2OE7X 1CV0A 2O4WA 1C6JA 4QDNA 1WQOA 2G4QA 1J1OY 2H5ZA 3GUKA 3WUNA 3EBAB 1XJUA 3SP3A 2Q9EA 1GF0A 4HTQA 1L38A 2HECA 4PK0A 1C6MA 1CKCA 3TXDA 1LGUA 1EQEA 3DMXA 2RBSA 2CDSA 1L86A 1C6HA 2OU9A 260LA 1HFYA 4HTNA 1B7QA 4BS7A 5DN4A 3A3QA 1ZURA 1GB8A 1HERA 1L36A 2W1YA 4I7RA 1C60A 1GF4A 5LVJA 1IWZA 3TXEA 2EIZC 4LT2A 1UIAA 198LA 5KKIA 1WVVA 4G49A 2H9KA 152LA 1IWYA 5FHWA 1XEPA 1L50A 4G9SA 1JJ1A 1L39A 1HC0A 4LFPA 4OOTA 3D9AC 214LA 1L97A 3B6LA 1HSWA 1CV3A 1L25A 3HH6A 1G1WA 3HWLA 2F4AA 1YL1X 5LYZA 5I14A 4N0JA 1P64A 3CT1A 2B75A 1CJ7A 3TMUA 1NWGA 1YQVY 2Z2EA 1D9UA 4OW1A 1B7LA 1LZYA 2FYCA 3TXFA 1C62A 1GXXA 1L0KA 4LFXA 4LT1A 4HJZA 1REMA 2A7DA 2YBLA 1AT6A 5ILFA 1LZEA 4XENA 1L70A 1JKCA 1SSWA 1WQMA 1L84A 2YSSC 1L56A 4NHQA 4IASA 4S0WA 5B07A 2LC9A 131LA 3F6ZA 1D0MA 1LSEA 4RLMA 3GXKA 5T3FA 4I7JA 3C80A 3P4ZA 1D3JA 1TAYA 1L26A 1CJ8A 1LKRA 2BQAA 1LHKA 1N4FA 1GBWA 5I4XA 1BWJA 4WLYA 1OVJA 1L75A 5KXWA 5E9RA 5LZMA 3DMZA 1XEKA 4NSJA 130LA 1LJIA 3P65A 1VEDA 1GB5A 1GF6A 114LA 1OVKA 3B0IA 2B6TA 1KIQC 3AGHA 1L09A 1HEOA 2RB2X 4IJ4A 3A95A 3HT6A 1V7SA 1CU2A 1SWYA 4HPEA 2VB1A 4LYZA 2HEDA 2B7XA 1LTMA 3PDSA 1WTHA 216LA 2RAYX 3GUOA 4ZEEA 3VWOA 1HEQA 1B0DA 4AQNA 1L23A 4WLDA 1IP1A 1QTCA 4LGKA 1GFGA 2XTHA 4LT3A 1B7PA 2LYMA 1QT6A 2OU8A 1P6YA 2MEGA 1B7MA 4IATA 4NWEA 3HT8A 163LA 1TBYA 231LA 1W6ZA 4DKLA 3K2RA 4Z46A 3KAMA 1LZBA 1KXWA 1DYAA 3SB8A 1GEVA 248LA 3WPLA 1UUZC 199LA 139LA 4GCDA 1JUGA 1F6RA 4PRQA 1ALCA 2ZYCA 1L16A 1GFEA 166LA 5DLAA 3HBEX 4ARQB 1L24A 1LSZA 129LA 1D9WA 5LVIA 1L18A 1CKGA 3OJPA 2DQDY 3WH1A 3WW6A 4CGEA 4WM5A 2IHLA 3AZ6A 1JWRA 1DKJA 4PRUA 2ZNWY 3AZ4A 245LA 3C7YA 1UA6Y 1JQUA 1JKBA 1LYDA 1GE4A 1C46A 2QARC 1GWDA 2Z6BA 120LA 229LA 4GLAA 2Z12A 212LA 1KNIA 4ARQA 1L96A 1QTKA 2QB0B 246LA 227LA 3LYZA 4XJHA 3PBLA 1KS3A 2C8OA 3HDEA 1O23A 1DI3A 1QUOA 1YKXX 1GAZA 1L11A 5LYTA 1L00A 4UWVA 1JISA 4WO6A 1GEZA 1DI5A 4X3BA 4TUNA 240LA 107LA 4ET9A 1BVKC 1C65A 1OVHA 4W51A 1UICA 2Z37A 3HTDA 4NSHA 1L32A 188LA 3QAKA 8LYZA 5KXZA 1HEPA 2DBTA 1QUDA 1C6BA 4YOPA 1GF3A 4NWHA 1IWWA 1P2LA 4LYOA 3CDQA 4H8XA 1IY4A 1QSQA 1GBZA 1D3FA 1JTOL 5HLLA 1IP3A 4WM1A 1DYBA 1T3PA 2MEFA 2B74A 5E4PA 1ZVHL 1LMQA 3GULA 4LYMA 1LMNA 1KW7A 2HUMA 1B5VA 4HPIA 4EOFA 1RE2A 5C6IA 4HJVA 3EO5A 5LIOA 1A2YC 1HMKA 177LA 1L76A 1HSXA 221LA 187LA 1ZYTA 2D4KA 3FADA 251LA 4NGLA 3W6AA 1UIDA 3TXIA 3DN6A 1OUCA 1PS5A 3WXTA 4YX7C 3TMVA 2Z19A 1L63A 1LPYA 1GB2A 3HTGA 1IO5A 1JITA 4H93A 1D2WA 5LINA 3HFMY 164LA 3CSZA 153LA 167LA 1G7IC 2ANXA 4KPMA 3B0OA 3HH4A 3W6DA 2DKVA 205LA 1L68A 2BQIA 5KXMA 157LA 191LA 230LA 1WQRA 4N5RA 1SX2A 3C83A 1LAAA 1IORA 5APEA 2FBDA 5A3EA 3CDTA 4XJGA 1E8LA 2BQBA 1L41A 1LSGA 3LYMA 1LOZA 5LVGA 2A4TA 1LCNA 4QEQA 3HH3A 4H8ZA 4BADA 7LZMA 4QY9A 4RW2A 1FLYA 3FA0A 2ZILA 143LA 5J7CA 1GB0A 4YEOA 2B6WA 2O7AA 1DKKA 4EKRA 1LZ4A 2B5ZA 194LA 5B1FA 5APFA 196LA 218LA 5F14A 4XJIA 2BQDA 3C7WA 2YBMA 4D9ZA 1D3MA 4H9EA 168LA 1C6EA 175LA 2BLXA 1L28A 5L3HA 1OV5A 1GE2A 1LYEA 9LYZA 1IOSA 4KXIA 2BQCA 4FDYA 5FDJA 125LA 3RUNA 3GUJA 4GCFA 4H94A 1IWUA 3AJNA 2Y8PA 1QTBA 1G07A 1CU5A 4EXMA 1L82A 3C8RA 1HHLA 3GUPA 1LZ1A 4NG1A 3GUIA 122LA 2OEAX 1FKQA 1LZAA 4YXAC 1LWGA 1UIBA 4UWUA 1LJNA 243LA 2LHMA 5LAGA 1IIZA 4EKQA 3OE9A 133LA 4ETEA 4ET8A 1QUHA 4WLXA 1PQMA 186LA 2ZQ3A 1IC4Y 2HU3A 1C7PA 3DN4A 5KXRA 3RZ4A 4I7MA 5FELA 4DDCA 3DMVA 3G3AB 5EBHA 1L87A 1T6VL 1GB6A 5KXXA 4IAPA 183LA 1L99A 210LA 2D4JA 2YVBA 3W6EA 1C08C 3BKHA 1LGXA 4ARLA 1G1VA 4I7NA 3C8QA 1PQIA 1REXA 5L3IA 4WMGA 4DAJA 3SB7A 5HQ1A 1BB6A 1L10A 1L53A 4N8ZA 4ZIXA 1L48A 1IOCA 1AZFA 2DQEY 1L12A 1L95A 4PGJB 1LHIA 4OWEA 1GAYA 1DYDA 3P64A 1XEIA 1D6QA 3L64A 1JEFA 2FYDA 1GFAA 1L02A 1LSDA 1RCMA 232LA 2D6BA 1V7TA 3J6KA 4CHXA 2CGIA 1IOTA 3VW7A 1L30A 1QTEA 1L51A 4DDBA 1DPWA 4CFOA 5B05A 2RBOA 1LKSA 4LDOA 2HU1A 4ARMA 197LA 3G3BB 4DDAA 1LZGA 1GBYA 3SBAA 5D5FA 3N9CA 211LA 5F81A 1B5YA 1NDGC 4Z98A 1B7RA 4MCKA 3FE0A 4TWSA 185LA 1GF9A 195LA 1UIGA 4W52A 1TDYA 1IP5A 1P36A 1GE3A 4G4HA 1REYA 4I7QA 4W59A 1C63A 1IWXA 3G3XA 1L98A 1L37A 1LJ4A 1LZDA 1D0LA 207LA 1B7OA 1HNLA 5APDA 4C5FA 3WU7A 3W3EA 1JIYA 1C10A 1CTWA 3V2YA 1P2CC 1XGPC 3V2WA 1OUDA 1OQMA 3DN1A 3RT5X 2LCBA 4WM2A 1L80A 4C3WA 4M4OA 4ETBA 112LA 2CUUA 2IGCA 1JPOA 1IX0A 4WG7A 3SB5A 1T8AA 6LYTA 1L91A 2C8PA 1XJTA 1GFKA 2RSCA 1NF5A 174LA 1CV4A 3CT0A 1AM7A 4XN6A 3TMWA 3AZ5A 172LA 5DM9A 159LA 3TXJA 4XJFA 4I0CA 1INUA 146LA 2HEEA 3WVXA 2ZYPA 1L13A 4H9FA 1SWZA 5LAFA 4WOAA 1B5ZA 4NGVA 2BLYA 4H8YA 4RW1A 3OE0A 223LA 180LA 1LSMA 3K3TA 4BAFA 4J1AA 2MEBA 259LA 5I4YA 3DKEX 2Z39A 3A90A 1WQNA 4DC4A 1JSFA 4GN4A 4NGOA 1G0PA 222LA 1LSCA 2YDGA 1AT5A 2DQFC 3RNXA 119LA 5KXNA 1LI2A 1C6TA 228LA 4YENA 158LA 2XQOA 3DN0A 1L60A 3WXUA 2X0AA 1LJJA 1TLAA 2LZMA 4EPIA 1YAPA 1EQ4A 1L33A 4ZPUA 5I53A 2NTGA 108LA 4U3XB 1L44A 1YAOA 252LA 4TSCA 1LYIA 4W54A 4YM8A 1G7LC 3CB7A 3IWRA 1P46A 4WM6A 192LA 1L74A 4EJ4A 151LA 1UIHA 1L71A 3WW5A 4J7VA 1LZ9A 4H90A 1B9OA 1LJEA 1LZTA 3FI7A 4YF2A 1LSPA 1CU0A 2F32A 1QSAA 1L88A 1WQQA 4I7OA 3FI5A 1QS9A 3ZVQA 2YBNA 4L41A 4UWNA 1ZVYB 256LA 4DQ5A 2AUBA 2Q0MX 2BQNA 4LYCA 2RAZX 1H6MA 4Z41A 4XADA 1OV7A 1P7SA 1XGTC 1LZCA 5I5QA 1GFJA 3LHMA 1LYGA 3TXKA 4OWCA 2HEFA 4LZMA 4LYTA 2W1MA 1C68A 1PQDA 4NG8A 3P66A 1F0WA 1L21A 1NMMA 1C66A 4DYGA 1B7NA 1YILA 162LA 1L0JA 1DYCA 4NFVA 249LA 3AGGG 4N1CC 1XGQC 1CV1A 1OUBA 4GLVA 1L06A 4WLTA 215LA 2DQHY 1DYGA 1L04A 2MEIA 217LA 3CDVA 4NEBA 2RBQA 4FJRA 3QY4A 5LA5A 1HENA 1XEJA 1OWYA 3A93A 1EQ5A 4N9RA 148LE 1KXXA 1LHMA 5D5CA 1LMPA 1JSEA 3CDRA 1J1PY 1HF4A 1LMOA 3C8SA 5B1GA 3RZEA 1L45A 5IELA 4B4EA 5B59A 2HULA 1G7MC 5FCPA 2F47A 1B6IA 1L07A 1QT8A 4OOOA 1GF7A 1GBOA 250LA 4NHTA 5AMYA 209LA 135LA 2LZTA 6LZMA 1D3NA 1G0JA 2DQCY 200LA 5DL9A 1CV6A 111LA 1FLQA 1IY3A 4DWXA 3C81A 2HUKA 4DT3A 4XYYA 1FLWA 4DD1A 1LSYA 3C7ZA 3HTBA 257LA 1LJ3A 1PQJA 4YXCA 4II8A 3ZEKA 4GCCA 4N1EI 1L08A 4PHIA 2BAAA 2BQLA 4NHPA 3IJUA 1JKAA 3QE8A 4NHSA 1C6PA 1IR7A 2ZQ4A 3A8ZA 1FN5A 1LSBA 2DQIY 4Z3MA 2W1XA 1QTZA 1YAMA 4H91A 1CKHA 4DD7A 3W6CA 1LZ6A 156LA 1BB4A 1L15A 1C6LA 184LA 1IP2A 2EQLA 1IEEA 3M3UA 1CUQA 4H9IA 3EXDA 4W53A 1IWTA 1LZRA 2MEHA 4P2EA 2OU0X 1L69A 1L61A 1L79A 1F10A 4GRVA 1LLHA 1FKVA 1G0GA 2LYOA 1HELA 1OWZA 2DQAA 2ANVA 1QDRA 2B70A 1BB7A 1GHLA 1C43A 1LI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ4 A;  3A95 A;  1LHI A;  1ZV5 L;  1V7S A;  2HUB A;  1HEW A;  1GAY A;  4HPE A;  4OWE A;  2NWD X;  1WTN A;  1JTP L;  3P64 A;  3QNG A;  1XEI A;  2VB1 A;  1D6Q A;  3CSQ A;  1BB3 A;  1GF5 A;  1GB3 A;  2HED A;  4LYZ A;  5LVH A;  2YBI A;  1JEF A;  1VDP A;  3A94 A;  3WPK A;  1LTM A;  4WO9 A;  2FYD A;  1GFA A;  3ATO A;  1LSD A;  2G4P A;  4H1P A;  4ETA A;  5A3Z A;  3A67 Y;  3ATN A;  3WYH A;  4ZEE A;  3VWO A;  1BB5 A;  1RCM A;  2D6B A;  1BVX A;  1HEQ A;  1V7T A;  1B0D A;  3J6K A;  4CHX A;  2CGI A;  1IOT A;  4WLD A;  1IP1 A;  134L A;  1QTE A;  4LGK A;  4DDB A;  1DPW A;  1HEM A;  4CFO A;  1GFG A;  193L A;  2XTH A;  4LT3 A;  1B7P A;  2LYM A;  5DN5 A;  5B05 A;  4MR1 A;  1VAU A;  7LYZ A;  3WL2 A;  5M1Y A;  3WUL A;  1LKS A;  1LJK A;  2MEG A;  1B7M A;  2HU1 A;  1GPQ C;  4IAT A;  2CJL A;  3G3B B;  4NWE A;  1LZG A;  1TBY A;  1VDS A;  3B0K A;  4NY5 A;  4OWA A;  1W6Z A;  2ZIJ A;  4B0D A;  5IHG A;  4YEM A;  1IP6 A;  1I20 A;  3P68 A;  5KKJ A;  5KY1 A;  1DQJ C;  1GBY A;  2XJW A;  1LSF A;  4H9B A;  5D5F A;  4Z46 A;  2BQO A;  3N9C A;  1GFH A;  3KAM A;  5F81 A;  2WAR A;  1B5Y A;  1NDG C;  1KXW A;  1LZB A;  2GV0 A;  4Z98 A;  1B7R A;  1GEV A;  4I8S A;  4MCK A;  2YBJ A;  3FE0 A;  1UUZ C;  4TWS A;  3WPL A;  1FDL Y;  1UAC Y;  1LPI A;  3OK0 A;  1GF9 A;  4GCD A;  1VAT A;  4DD0 A;  5LXW A;  2BQK A;  1JUG A;  1UIG A;  1TDY A;  3A6B Y;  1F6R A;  4PRQ A;  1ALC A;  1IP5 A;  2ZYC A;  2DQG Y;  4NGW A;  1GE3 A;  4G4H A;  1GFE A;  1REY A;  1IC5 Y;  1GB9 A;  5DLA A;  4AXT A;  1BHZ A;  3HBE X;  5KXL A;  2CWI A;  1I56 A;  1OUG A;  1IWX A;  1KXY A;  1LSZ A;  1LZD A;  1LJ4 A;  1YKZ X;  1D0L A;  3AZ7 A;  207L A;  1B7O A;  1HNL A;  1GFU A;  2HEA A;  4KT3 A;  5APD A;  3AB6 A;  3WU7 A;  4C5F A;  5LVI A;  1H87 A;  1CKG A;  3W3E A;  3OJP A;  1LMT A;  2D4I A;  1JIY A;  3GXR A;  4EMN A;  1C10 A;  1LYY A;  4TSB A;  1P2C C;  2BQJ A;  3N9A A;  4R6C A;  4TX7 A;  4B4I A;  1XGP C;  1OUD A;  3B72 A;  1OQM A;  2DQD Y;  3RT5 X;  4ETD A;  4WM2 A;  3WH1 A;  3WW6 A;  4C3W A;  4M4O A;  4CGE A;  4ETB A;  1WVU A;  3HBH A;  4WM5 A;  2IHL A;  4QGZ A;  1ZMY L;  4ML7 A;  3AZ6 A;  4CFP A;  1JWR A;  3TXG A;  1DKJ A;  3N9E A;  1JPO A;  1IX0 A;  1GDW A;  2ZNW Y;  3AZ4 A;  3LZT A;  1LYO A;  1RJC B;  4PRU A;  4W94 A;  4WG7 A;  1DPX A;  6LYT A;  5JEN B;  1UA6 Y;  1JKB A;  2C8P A;  1XGU C;  4HJY A;  4R0F A;  4ZFP A;  1GE4 A;  1GFK A;  2RSC A;  4LZT A;  1NF5 A;  1C46 A;  1SQ2 L;  1BWI A;  1GWD A;  1IP4 A;  3CT0 A;  1AM7 A;  1A4V A;  4XN6 A;  4GLA A;  2Z12 A;  3TMW A;  3AZ5 A;  4HP0 A;  4NGJ A;  1SLY A;  3E3D A;  1IR8 A;  5DM9 A;  3TXJ A;  1QDT A;  154L A;  1OUI A;  1DI4 A;  5HMV A;  4XJF A;  2I25 L;  1INU A;  4I0C A;  3RW8 A;  3T36 A;  3TXH A;  1QTK A;  2HEE A;  1OUJ A;  2MEE A;  3LYZ A;  1QUS A;  3WVX A;  2ZYP A;  4XJH A;  4H9F A;  5LAF A;  2LZ2 A;  4WOA A;  1J1X Y;  2C8O A;  1B5Z A;  3CT5 A;  1O23 A;  1DI3 A;  1HFZ A;  1YKX X;  2BLY A;  4H8Y A;  4NGV A;  4W96 A;  4NGK A;  4RW1 A;  1GAZ A;  3TXB A;  1LYZ A;  1PZY A;  5LYT A;  1LSM A;  1C45 A;  1I1Z A;  4UWV A;  3K3T A;  4BAF A;  4CJ2 A;  4J1A A;  4RLN A;  1JIS A;  1BGI A;  2MEB A;  4WO6 A;  1NDM C;  5I4Y A;  1LHL A;  2ZNX Y;  1GD6 A;  2Z39 A;  3A90 A;  1WQN A;  1LMA A;  1QSW A;  4DC4 A;  1GEZ A;  1JSF A;  1DI5 A;  4GN4 A;  1GFR A;  1LZS A;  2BPU A;  1GE0 A;  3EMS A;  1WQP A;  1LJG A;  4NGO A;  4X3B A;  3T6U A;  5II3 A;  4TUN A;  1YIK A;  5F16 A;  1LSC A;  2YDG A;  5F9U A;  4ET9 A;  1AT5 A;  1BVK C;  2DQF C;  1FLU A;  1GBS A;  3RNX A;  5LVK A;  1CKD A;  4ETC A;  1EL1 A;  1OUE A;  1UIC A;  2Z37 A;  5KXN A;  4NSH A;  1G7H C;  5I4W A;  1YAQ A;  3TMX A;  4YEN A;  3W6B A;  8LYZ A;  1QQY A;  1IWV A;  1UIE A;  4WL6 A;  4G4C A;  1KIP C;  2BQH A;  5KXZ A;  1OP9 B;  1HEP A;  2X0A A;  4XJD A;  2DBT A;  1LJJ A;  2FBB A;  3WXU A;  4YOP A;  4B49 A;  4NGI A;  1GXV 2;  1MEL L;  1YAP A;  5HNL A;  1GF3 A;  4XJB A;  3MGW A;  1EQ4 A;  4NWH A;  2HTX A;  1IWW A;  4LYO A;  1OUF A;  3A3R X;  5F9X A;  2D91 A;  1GFV A;  5I53 A;  1G7J C;  1NBZ C;  4H8X A;  1IVM A;  4U3X B;  2Z18 A;  1B5W A;  1YAO A;  1XSF A;  1IY4 A;  1JKD A;  5APC A;  1GBZ A;  3AW6 A;  4TSC A;  3CSR A;  3W6F A;  1D0K A;  1JTO L;  4MST A;  4HSF A;  4YM8 A;  4GCE A;  5HLL A;  1IP3 A;  4E3U A;  6LYZ A;  1G7L C;  1Z55 A;  3CB7 A;  4H9C A;  4WM1 A;  1T3P A;  3IWR A;  2G4N A;  2MEF A;  4WM6 A;  3LN2 A;  5E4P A;  1ZVH L;  4OWB A;  4TTD A;  1LMQ A;  4LYM A;  4GCB A;  1LMN A;  1B5V A;  4HPI A;  2DQJ Y;  5KXY A;  4EOF A;  1RE2 A;  1UIH A;  1LHJ A;  5C6I A;  1QIO A;  3WW5 A;  4PJ2 C;  4HJV A;  4ANR A;  1LZN A;  3EO5 A;  5LIO A;  1A2Y C;  1HMK A;  4J7V A;  1LZ9 A;  4H90 A;  1B9O A;  1LJE A;  1HSX A;  1LZT A;  1IOQ A;  2Z2F A;  3FI7 A;  4YF2 A;  5LA8 A;  3A6C Y;  1LZ5 A;  1LSP A;  2D4K A;  3D3D A;  1QSA A;  3A92 A;  1UBZ A;  3WPJ A;  5FEK A;  1WQQ A;  1LMC A;  1HFX A;  1LHH A;  2BQM A;  4RDS A;  4NGL A;  5C6L A;  3W6A A;  2XBR A;  3ZVQ A;  1NQI A;  2YBN A;  1AKI A;  1UID A;  3TXI A;  1OUC A;  1PS5 A;  4L41 A;  4UWN A;  1ZVY B;  1DZB X;  3WXT A;  1IR9 A;  2AUB A;  3TMV A;  2Z19 A;  4OWH A;  5I54 A;  1GFT A;  2Q0M X;  2BQN A;  4LYC A;  1GF8 A;  4DD2 A;  1H6M A;  4H9A A;  4Z41 A;  1GB2 A;  4XAD A;  3AGI A;  1IO5 A;  1JIT A;  1LZC A;  1VFB C;  1REZ A;  1XGT C;  1LSA A;  2A7F A;  1GFJ A;  2IFF Y;  5I5Q A;  4H93 A;  3LHM A;  4J0L A;  2F2N A;  2MEC A;  1FBI X;  5FST A;  4WM4 A;  5LIN A;  3HFM Y;  5LYM A;  1BWH A;  3CSZ A;  5KXK A;  3CQL A;  153L A;  1MLC E;  1WTM A;  1GE1 A;  2H9J A;  1TCY A;  3TXK A;  4OWC A;  5KXP A;  3WUA A;  2HEF A;  5L9J A;  1B2K A;  1GBX A;  4LYT A;  2BQG A;  1G7I C;  4KPM A;  3B0O A;  2W1M A;  3A34 A;  1UCO A;  4NG8 A;  3P66 A;  1F0W A;  2DKV A;  3W6D A;  1OUH A;  1NMM A;  3LYT A;  5IDD A;  3WU8 A;  1B5U A;  1NHE A;  2BQI A;  4J1B A;  4DD9 A;  1CNS A;  4DYG A;  5KXM A;  1B7N A;  1YIL A;  4WL7 A;  4NFV A;  3AGG G;  5K7O A;  1XGR C;  4N1C C;  3WMK A;  1XGQ C;  1WQR A;  5B06 A;  1LSN A;  4HV2 A;  3HBD A;  4N5R A;  1IC7 Y;  5HNC A;  1OUB A;  4GLV A;  4GN3 A;  1LJH A;  1LZ8 A;  1CKF A;  1WQO A;  4QDN A;  2G4Q A;  1J1O Y;  2H5Z A;  1LAA A;  1IOR A;  1VDQ A;  5APE A;  3WUN A;  3EBA B;  2FBD A;  1QUT A;  3SP3 A;  2BQF A;  5A3E A;  4WLT A;  4XJG A;  1GF0 A;  3LYO A;  4HTQ A;  2DQH Y;  4NSI A;  2EPE A;  1E8L A;  2MEI A;  2HEC A;  1CJ6 A;  2BQB A;  4HTK A;  1LSG A;  3LYM A;  1CKC A;  3TXD A;  1EQE A;  1F6S A;  1LOZ A;  1VDT A;  2Z38 A;  5LVG A;  2CDS A;  1UIF A;  1LCN A;  4QEQ A;  3AYQ A;  4NEB A;  4H8Z A;  4FJR A;  4BAD A;  3QY4 A;  4QY9 A;  4RW2 A;  1HEN A;  5LA5 A;  1FLY A;  2ZIL A;  5J7C A;  2N5Z A;  4B1A A;  1HFY A;  1RFP A;  1UC0 A;  1GB0 A;  1XEJ A;  4HTN A;  4YEO A;  3A93 A;  1EQ5 A;  1B7Q A;  1DKK A;  4N9R A;  5DN4 A;  1KXX A;  5KXS A;  4BS7 A;  3A3Q A;  2LYZ A;  1LHM A;  1GB8 A;  5D5C A;  1HER A;  1LMP A;  1LZ4 A;  5KXO A;  1JSE A;  2B5Z A;  1YAN A;  1J1P Y;  1HF4 A;  1LMO A;  2EKS C;  1CJ9 A;  2W1Y A;  5KXT A;  194L A;  3BKV A;  5B1F A;  5B1G A;  2BQE A;  4O34 A;  1GF4 A;  3ZVQ B;  3WU9 A;  1IWZ A;  5LVJ A;  3TXE A;  3LZ2 A;  5APF A;  2EIZ C;  2ZWB A;  4LT2 A;  1UIA A;  3WVY A;  4B4E A;  5IEL A;  5B59 A;  1DXJ A;  1NBY C;  5F14 A;  1G7M C;  5FCP A;  4XJI A;  5KKI A;  1WVV A;  2BQD A;  4G49 A;  1LYS A;  5HMJ A;  2H9K A;  1NKH A;  2PC2 A;  2YBM A;  208L A;  1IWY A;  5FHW A;  4AGA A;  4D9Z A;  4H92 A;  3A96 A;  4OOO A;  1GF7 A;  2ZIK A;  4H9E A;  1GBO A;  1JJ1 A;  4G9S A;  1HC0 A;  2BLX A;  1RI8 B;  2F30 A;  5L3H A;  4NHT A;  5AMY A;  4LFP A;  3AW7 A;  1BQL Y;  1GE2 A;  4OOT A;  3D9A C;  9LYZ A;  1IOS A;  4KXI A;  4DD3 A;  135L A;  1HSW A;  3B6L A;  4H9H A;  4NGY A;  2BQC A;  2LZT A;  4FDY A;  5FDJ A;  2DQC Y;  4G4B A;  2F4A A;  4GCF A;  4H94 A;  1JHL A;  5DL9 A;  1IWU A;  1YL1 X;  2Y8P A;  3AJN A;  2F4G A;  5LYZ A;  1FLQ A;  1IY3 A;  1LJF A;  4N0J A;  4KL7 A;  4WG1 A;  3CT1 A;  4DWX A;  4DT3 A;  4XYY A;  1FLW A;  1W08 A;  2XBS A;  4DD1 A;  1LSY A;  1HHL A;  2I6Z A;  1CJ7 A;  1LZ1 A;  3TMU A;  1NWG A;  1YQV Y;  4NG1 A;  2Z2E A;  1D9U A;  4OW1 A;  1LJ3 A;  1B7L A;  1YRO A;  4PPO A;  1FKQ A;  1LZY A;  1LZA A;  3ULR A;  2FYC A;  4II8 A;  3ZEK A;  1UIB A;  4UWU A;  4GCC A;  1GXX A;  4LFX A;  1B5X A;  4LT1 A;  4N1E I;  3TXF A;  4A7D A;  4HJZ A;  1LJN A;  1OUA A;  1REM A;  1YL0 X;  2A7D A;  1AT6 A;  2YBL A;  1LZE A;  2BAA A;  4PHI A;  3IJV A;  4XEN A;  5ILF A;  2LHM A;  2BQL A;  1IIZ A;  5LAG A;  1JKC A;  133L A;  1JJ0 A;  4NHI A;  4ETE A;  1WQM A;  4NHP A;  4ET8 A;  2YSS C;  3IJU A;  4WLX A;  1JKA A;  3QE8 A;  1KIR C;  4NHQ A;  4IAS A;  4NHS A;  2ZQ3 A;  3M18 B;  5B07 A;  1IR7 A;  2ZQ4 A;  1IC4 Y;  1FN5 A;  3A8Z A;  2HU3 A;  1LSB A;  1C7P A;  2DQI Y;  3F6Z A;  4Z3M A;  2W1X A;  1D0M A;  1LSE A;  1YAM A;  4RLM A;  3GXK A;  4H91 A;  5KXR A;  1JTT L;  1CKH A;  3RZ4 A;  4DD7 A;  5FEL A;  5T3F A;  3A91 A;  3W6C A;  4DDC A;  1LZ6 A;  1BB4 A;  4LT0 A;  3P4Z A;  4BAP A;  3G3A B;  5EBH A;  2MEA A;  2I26 L;  1TAY A;  1T6V L;  4NSG A;  1GB6 A;  5KXX A;  1IP2 A;  2EQL A;  1IEE A;  2W1L A;  3RU5 A;  3M3U A;  1IP7 A;  4NGZ A;  1CJ8 A;  1B7S A;  1LKR A;  1XFP L;  2BQA A;  2D4J A;  1LHK A;  1N4F A;  1YKY X;  1GBW A;  1C08 C;  2YVB A;  3BKH A;  4H9I A;  3W6E A;  5I4X A;  3EXD A;  1BWJ A;  4WLY A;  4B4J A;  1IWT A;  1LZR A;  3J4G A;  5C6J A;  2MEH A;  1REX A;  4P2E A;  1GB7 A;  4M6D A;  5KXW A;  5L3I A;  4LYB A;  1HML A;  5E9R A;  4WMG A;  2MED A;  5KJ9 A;  1F10 A;  1JJ3 A;  1XEK A;  4NSJ A;  1BB6 A;  5HQ1 A;  1D6P A;  1LJI A;  4NIJ A;  4GN5 C;  1VED A;  1GB5 A;  1FKV A;  3P65 A;  4N8Z A;  1GF6 A;  4WM3 A;  1GDX A;  2LYO A;  3WUM A;  1IOC A;  4ZIX A;  3B0I A;  5ILC A;  1AZF A;  1HEL A;  1KIQ C;  2DQA A;  2DQE Y;  4DDA A;  1QDR A;  3AGH A;  132L A;  1BB7 A;  2YBH A;  1GHL A;  1TEW A;  1HEO A;  1C43 A;  2HEB A;  4HV1 A;  4PGJ B; 
#chains in the Genus database with same CATH topology
 1ZV5 L;  2L7I A;  2NWD X;  1XXH A;  1QT7 A;  1BB3 A;  1GF5 A;  3HGI A;  1GB3 A;  5LVH A;  1R2Y A;  4LCB A;  2YBI A;  3A94 A;  1L64 A;  4WO9 A;  1IXR C;  4OO9 A;  4ARP A;  2G4P A;  3ATN A;  3WYH A;  3NY9 A;  2RBN A;  3C82 A;  1C6I A;  1IBM M;  3W0F A;  2DZL A;  1L57 A;  4X66 M;  137L A;  2OTY X;  3ILK A;  1PGY A;  2JZ0 A;  3AOE C;  2CJL A;  4OWA A;  4NY5 A;  3J7B A;  5IHG A;  4YEM A;  4PJZ A;  1IP6 A;  1JTN A;  1I20 A;  1GJS A;  3P68 A;  5KY1 A;  3PNV A;  4H9B A;  1OAI A;  1UM8 A;  2BQO A;  1GFH A;  2I7N A;  3GRV A;  2J7O A;  3U6S A;  3DN8 A;  4K5Y A;  1Y8G A;  1QSB A;  4NC6 A;  2YBJ A;  1TH2 A;  5EP4 A;  3OK0 A;  3KW6 A;  1N32 M;  4DD0 A;  3SYK A;  4F2L A;  3NY8 A;  5LXW A;  1N77 A;  2BQK A;  1AIP C;  226L A;  3GUN A;  2O79 A;  4NGW A;  2A5Y B;  1WHC A;  1T8F A;  3VKG A;  1IC5 Y;  3J27 B;  1GB9 A;  5KXL A;  2CWI A;  4EKS A;  1I56 A;  1WJ7 A;  4QNR A;  1QT3 A;  1C6G A;  103L A;  1GFU A;  2HEA A;  2CE7 A;  4KT3 A;  3SYL A;  1JQJ C;  1CV5 A;  3AB6 A;  3F9L A;  1JTM A;  262L A;  219L A;  1LMT A;  2D4I A;  4EMN A;  3SAT A;  2W82 A;  1LYY A;  4TSB A;  4L78 A;  3N9A A;  4R6C A;  102L A;  1KYI A;  3T38 A;  3B72 A;  4LF7 M;  1L20 A;  4ETD A;  3OE8 A;  3K8Z A;  3AKZ A;  242L A;  1OQY A;  4QGZ A;  1ZMY L;  1SXJ C;  4CFP A;  3TXG A;  1GAB A;  1NHB A;  1HT1 E;  4LJ9 A;  1DPX A;  3M0E A;  4B7F A;  2B73 A;  1LGW A;  1C6N A;  4HJY A;  4ZFP A;  224L A;  4LZT A;  1BWI A;  2EKF A;  225L A;  4HP0 A;  3E3D A;  2Z3X A;  1IR8 A;  1QDT A;  154L A;  5C18 A;  141L A;  3RW8 A;  3T36 A;  2YQZ A;  261L A;  2CUZ A;  2G3Q A;  1V33 A;  2R44 A;  1QUS A;  127L A;  142L A;  4FCT A;  4B3M M;  1J1X Y;  3CT5 A;  1HFZ A;  1L90 A;  2KRK A;  4W96 A;  1TH3 A;  4NGK A;  1Z5A A;  1IN8 A;  1LYZ A;  4I7K A;  4NRW A;  2R46 A;  1I1Z A;  3U6P A;  2LVN C;  4CJ2 A;  4L15 A;  4RLN A;  3THG A;  4ARM B;  1BGI A;  1CU3 A;  1NDM C;  1GD6 A;  1L72 A;  1R7R A;  1PJI A;  1QT4 A;  2RB1 X;  1LMA A;  3D4S A;  2GNO A;  1GFR A;  1GE0 A;  3G3V A;  1LJG A;  2V1U A;  5II3 A;  1L14 A;  3HJQ A;  155L A;  4M9X A;  2KDL A;  2UXC M;  2DZN B;  1FLU A;  1GBS A;  4ETC A;  1EL1 A;  5I4W A;  3TMX A;  161L A;  1IWV A;  4DV5 M;  2R4E A;  1C6Q A;  1UIE A;  4FWH A;  3KOZ E;  1L27 A;  2BQH A;  4G4C A;  3A42 A;  4XJD A;  2FBB A;  235L A;  4CIS A;  4NGI A;  1OYU A;  1MEL L;  3MGW A;  118L A;  3GRR A;  5LMN M;  2HTX A;  1OUF A;  3A3R X;  5F9X A;  1GFV A;  1L89 A;  236L A;  1G7J C;  1B5W A;  150L A;  3U5Z B;  3UMM A;  1PQK A;  1XSF A;  3AW6 A;  4D81 A;  3W67 A;  1I6S A;  3CSR A;  176L A;  3HDF A;  1D0K A;  4DR1 M;  3NWL A;  4DV1 M;  4D82 A;  239L A;  3LZM A;  4KT0 F;  4H9C A;  4CIZ A;  1L52 A;  128L A;  1T97 A;  2G4N A;  3HUA A;  1IXS A;  3E46 A;  2QHO B;  169L A;  4GCB A;  2V6Z M;  1YUB A;  2DQJ Y;  1C6D A;  4IIW A;  2X4A A;  2EJS A;  2KNV A;  4DV2 M;  4G4N A;  4MGZ E;  233L A;  171L A;  1IOQ A;  5H37 D;  2Z2F A;  2JZ1 A;  2YR0 A;  3A6C Y;  1QZE A;  3KSJ A;  3I51 A;  5EJC A;  4F1I A;  4G4O A;  3A92 A;  1IN5 A;  1UBZ A;  3FTE A;  1QYR A;  1AUA A;  2KA6 B;  3DN3 A;  1HFX A;  1L73 A;  1LHH A;  213L A;  237L A;  5C6L A;  1VEJ A;  1L19 A;  3KSX A;  2Y0T A;  1NQI A;  4QHT A;  2DVW B;  2CRU A;  3VK7 A;  1DZB X;  1OIP A;  1WR1 B;  4OWH A;  1WGN A;  4PCZ A;  1GFT A;  1GF8 A;  4DD2 A;  4DJH A;  1VFB C;  4UN2 B;  1REZ A;  1LSA A;  2EA0 A;  2H5X A;  3DN2 A;  2F2N A;  2MEC A;  4WM4 A;  1BWH A;  1MLC E;  1K28 A;  2H9J A;  173L A;  3TL4 X;  5KXP A;  1GBX A;  3EIE A;  3DNA A;  2WZJ A;  2B6Z A;  160L A;  1T6H A;  3A34 A;  1OTR A;  1GJT A;  3LQR A;  2O01 F;  3HT9 A;  1HNW M;  4P16 A;  5EXS A;  1DYE A;  1OUH A;  3WU8 A;  1NHE A;  4J1B A;  4DD9 A;  4WL7 A;  1E9S A;  2DAI A;  1L1T A;  1PRB A;  3VDP A;  1L93 A;  1XGR C;  3WMK A;  4HV2 A;  3HBD A;  3CTW B;  1IC7 Y;  5HNC A;  1PQO A;  4GN3 A;  2R0I A;  1LJH A;  1LZ8 A;  1CKF A;  2F5S A;  4GHA A;  138L A;  1NHW C;  1VDQ A;  165L A;  5FTJ A;  1QUT A;  3GLH E;  4MGK E;  1L62 A;  2BQF A;  4LJ8 A;  3GQ4 A;  1GVN A;  3LYO A;  115L A;  4NSI A;  2EPE A;  1CJ6 A;  4HTK A;  1F6S A;  1VDT A;  2Z38 A;  3HT7 A;  2APL A;  4G6Z A;  1C1K A;  1L35 A;  2CFO A;  2GQF A;  1UIF A;  3AYQ A;  4DQ7 A;  1P3N A;  1L81 A;  2L78 A;  1L40 A;  4W58 A;  1L92 A;  2N5Z A;  4B1A A;  1RFP A;  1UC0 A;  5KXS A;  4NL4 H;  3C3E A;  2LYZ A;  2H1R A;  3VDU A;  1A5T A;  3TE6 A;  1YAN A;  1KW5 A;  5EQT A;  1EPY A;  1CJ9 A;  3AJI B;  2EKS C;  5KXT A;  3JR6 A;  1XWI A;  3BKV A;  2BQE A;  4O34 A;  3ZVQ B;  3WU9 A;  3LZ2 A;  2ZWB A;  2VDB B;  3WVY A;  3U6L A;  1DXJ A;  4JV5 M;  1NBY C;  1C69 A;  5BPV A;  1QUG A;  3SB9 A;  5HMJ A;  1LYS A;  3AFH A;  2LVA A;  2PC2 A;  1NKH A;  208L A;  3C3D A;  4AGA A;  2XFS A;  4H92 A;  3A96 A;  2ZIK A;  3GLF E;  1NVM A;  1RI8 B;  2F30 A;  2CP8 A;  3LVV A;  2V1C A;  3AW7 A;  1BQL Y;  1QTH A;  2CEA A;  258L A;  4DD3 A;  4H9H A;  1L34 A;  2BNK A;  4NGY A;  1CX7 A;  5ITX A;  4G4B A;  1QS5 A;  2UUB M;  1JHL A;  4YY3 M;  2F4G A;  181L A;  4DR5 M;  4JI8 M;  1LJF A;  4DQJ A;  5E26 A;  1L47 A;  4KL7 A;  4WG1 A;  2Y0Q A;  1W08 A;  2XBS A;  2RH1 A;  2I6Z A;  1L59 A;  4WUR A;  3SB6 A;  1C6K A;  5EP3 A;  1ZV1 A;  1QTD A;  1YRO A;  4PPO A;  4I7T A;  5KPR A;  1VQ1 A;  3ULR A;  2FFJ A;  1G06 A;  4A7D A;  144L A;  1B5X A;  1OUA A;  1YL0 X;  1LYF A;  3IJV A;  1L8Q A;  4NHI A;  1JJ0 A;  3B7Z A;  2CV2 A;  1E94 E;  2FH0 A;  3RFW A;  1KIR C;  5KQD A;  3M18 B;  149L A;  3K92 A;  3NYA A;  1N36 M;  3EML A;  4B3R M;  1NJF A;  1KY0 A;  1JTT L;  4QOZ C;  3A91 A;  4BAP A;  4LT0 A;  1L83 A;  254L A;  2MEA A;  2I26 L;  4NSG A;  3ODU A;  1CX6 A;  2W1L A;  3RU5 A;  1NJG A;  123L A;  2B72 A;  1IP7 A;  4NGZ A;  2BJW A;  1B7S A;  1XFP L;  2VQF M;  2OE4 X;  3SFZ A;  1YKY X;  5IRE B;  3CF2 A;  1JB0 F;  4B4J A;  1NNU C;  4R3D A;  2OOA A;  3G3W A;  2XSZ A;  3MJ5 A;  3NBX X;  1C61 A;  3J4G A;  5C6J A;  1GB7 A;  1ZMV A;  1L2C A;  4M6D A;  1C6F A;  4LYB A;  1HML A;  1SX7 A;  2MED A;  5KJ9 A;  1JJ3 A;  1L85 A;  1D6P A;  4NIJ A;  4GN5 C;  4FVM A;  147L A;  4WM3 A;  1GDX A;  5ILC A;  3WUM A;  4I7P A;  1Q02 A;  3GRU A;  1L2D A;  132L A;  2YBH A;  4HV1 A;  1TEW A;  2HEB A;  3HU2 A;  1H6U A;  4IBI A;  2FOI C;  220L A;  2HUB A;  4GBR B;  241L A;  1HEW A;  2WSE F;  3GLG A;  1LYH A;  1WTN A;  1JTP L;  3QNG A;  3CSQ A;  2L7H A;  5F3W A;  2XEP A;  1IQP A;  1VDP A;  3WPK A;  178L A;  1IM2 A;  3OE6 A;  2EUC A;  3ATO A;  1L77 A;  4H1P A;  4ETA A;  5A3Z A;  3KVW A;  2F4V M;  3A67 Y;  4W56 A;  1QTV A;  4JI5 M;  4FW9 A;  1BB5 A;  1R6B X;  1BVX A;  3L27 A;  1ZWN A;  2X8A A;  4OW0 A;  1L67 A;  2RB0 X;  134L A;  1CUP A;  1IY0 A;  1HEM A;  193L A;  7LYZ A;  5DN5 A;  5M1Y A;  4MR1 A;  1VAU A;  3WL2 A;  1L55 A;  3WUL A;  1LJK A;  5FST A;  1GPQ C;  1L49 A;  255L A;  1VDS A;  3B0K A;  2ZIJ A;  206L A;  4B0D A;  5KKJ A;  2C5R A;  110L A;  1L94 A;  1DQJ C;  2XJW A;  1LSF A;  3FTF A;  2WAR A;  189L A;  2GV0 A;  3K9P A;  4I8S A;  2JA2 A;  2Y20 A;  1FDL Y;  1XMQ M;  1LPI A;  1UAC Y;  1VAT A;  1C64 A;  2DWN A;  201L A;  1QZM A;  1SSY A;  3A6B Y;  2DQG Y;  1Q3B A;  4ARJ A;  2DKL A;  2B6Y A;  4AXT A;  1BHZ A;  1OUG A;  2LWX A;  4IBG A;  1KXY A;  1L43 A;  1YKZ X;  3AZ7 A;  3KOX E;  1H87 A;  3U61 B;  3SBB C;  1P56 A;  2EKK A;  3GXR A;  2Q9D A;  1HR0 M;  1L58 A;  2BQJ A;  4TX7 A;  4B4I A;  1JR3 A;  1L17 A;  1WVU A;  3HBH A;  4GMQ A;  4ML7 A;  3N9E A;  3SMP A;  3LZT A;  1GDW A;  5KXO A;  4W94 A;  1LYO A;  1RJC B;  1L05 A;  1DGF A;  5JEN B;  4DR6 M;  1TF0 B;  170L A;  1XGU C;  1OFH A;  4R0F A;  2MGW A;  3LCV B;  104L A;  1LWK A;  1SQ2 L;  3CF6 E;  1IP4 A;  1XXH B;  1LI3 A;  109L A;  1A4V A;  145L A;  3GO8 A;  2RBR A;  4LDL A;  4NGJ A;  1SLY A;  4W57 A;  5DFL A;  1OUI A;  1DO0 A;  1DI4 A;  5HMV A;  2I25 L;  2UXD M;  3HH5 A;  3TXH A;  3L28 A;  1OUJ A;  4BLC A;  4LF5 M;  3M6A A;  2MEE A;  3UON A;  1YSY A;  2LZ2 A;  140L A;  1RU3 A;  3TXB A;  1PZY A;  3M7G A;  1ZMW A;  1K3W A;  1C45 A;  3KS4 A;  4DV6 M;  1LHL A;  2ZNX Y;  2XFT A;  4IBK A;  3HU1 A;  1L46 A;  1QSW A;  1QVR A;  4I7L A;  3UGJ A;  3EMS A;  1LZS A;  2BPU A;  1WQP A;  3T6U A;  1YIK A;  5F16 A;  4I7S A;  5F9U A;  4S12 A;  4LF6 M;  2CHQ A;  4XBO A;  4NSR A;  5LVK A;  1CKD A;  4NOO B;  1OUE A;  2RBP A;  4AG5 A;  4IBF A;  4PDG A;  1NHG C;  4NRV A;  1F4I A;  1NY6 A;  1G7H C;  1YAQ A;  3W6B A;  1EE8 A;  1C6A A;  247L A;  3DOA A;  2N35 A;  4KLN A;  1QQY A;  4WL6 A;  1KIP C;  2LNH C;  1OP9 B;  4B49 A;  1D2Y A;  1GXV 2;  1QAO A;  3HU8 A;  5HNL A;  4XJB A;  3GUM A;  4Q7J A;  1C67 A;  2D91 A;  1L54 A;  1CVK A;  3VFD A;  3HHZ A;  1NBZ C;  1DGB A;  234L A;  1IVM A;  2Z18 A;  3DFZ A;  1JKD A;  5APC A;  2ZBK B;  3L2X A;  2B6X A;  2ZTC A;  2QNJ A;  4E97 A;  3W6F A;  2KEB A;  253L A;  3SN6 R;  4MST A;  4GKJ M;  4HSF A;  1T8G A;  4GCE A;  4E3U A;  1G0K A;  6LYZ A;  3LW5 F;  1Z55 A;  1Z59 A;  2OTZ X;  182L A;  3LN2 A;  2LVO C;  4OWB A;  4TTD A;  4W55 A;  1G0Q A;  3I4V A;  2KNZ A;  1QT5 A;  3W0L B;  5KXY A;  3HUQ A;  5IWA M;  1P37 A;  2RGO A;  1LHJ A;  1DYF A;  1QIO A;  1IXZ A;  126L A;  4PJ2 C;  2HL7 A;  4ANR A;  3OTO M;  1LZN A;  4GH9 A;  3HU9 A;  2OE9 X;  1G0M A;  1L42 A;  2R4J A;  1L65 A;  1WIV A;  2F2Q A;  5LA8 A;  1LZ5 A;  2FS1 A;  3D3D A;  4FCV A;  3VKH A;  3E4R A;  4EKP A;  3CDO A;  3T1Y M;  4JI3 M;  4AG6 A;  2HHH M;  3F8V A;  5FEK A;  3WPJ A;  3AOE A;  1P5C A;  1LMC A;  2XSZ D;  2BQM A;  4RDS A;  3PFI A;  4CHT B;  3QYE A;  1IY1 A;  238L A;  2XBR A;  3U6Q A;  1AKI A;  1GL6 A;  4LJ7 A;  1NV8 A;  190L A;  1IR9 A;  3HTF A;  4AI6 A;  5FTK A;  3C9P A;  5I54 A;  1G0L A;  113L A;  4H9A A;  3AGI A;  1L29 A;  2A7F A;  1L66 A;  2IFF Y;  3HUK A;  2K6B A;  1L03 A;  1L01 A;  4J0L A;  1N78 A;  4LDE A;  1FBI X;  3SAS A;  1CU6 A;  3IG8 A;  5LYM A;  5KXK A;  3CQL A;  4EPF A;  1T3T A;  1WTM A;  1GE1 A;  1TCY A;  4OU7 A;  3WUA A;  5L9J A;  1B2K A;  2YNM D;  1P2R A;  4QNM A;  2BQG A;  1UCO A;  4M0W A;  4JI2 M;  1LYJ A;  4GIT A;  1L22 A;  3LYT A;  5IDD A;  3IEC A;  4B3S M;  1B5U A;  2NTH A;  1CNS A;  3AOG A;  3U6D A;  1LW9 A;  1C6C A;  5K7O A;  4OX9 M;  1KY1 A;  1L31 A;  244L A;  5JI2 E;  3JR4 A;  2JY7 A;  1LSN A;  5B06 A;  1SXJ A;  2OE7 X;  1CV0 A;  2O4W A;  1C6J A;  4QDN A;  1WQO A;  2G4Q A;  3SAU A;  1J1O Y;  2H5Z A;  3GUK A;  3WUN A;  3EBA B;  1XJU A;  3SP3 A;  2Q9E A;  1GF0 A;  4HTQ A;  1L38 A;  1HNX M;  2HEC A;  5A2Q S;  4PK0 A;  1C6M A;  1IXS B;  1CKC A;  3TXD A;  1LGU A;  1EQE A;  3HZJ A;  3IHP A;  3DMX A;  1J7K A;  3CGW A;  3UJN A;  2CDS A;  2RBS A;  1L86 A;  2BWE A;  1GKI A;  1C6H A;  2OU9 A;  3A46 A;  3A45 A;  1ORY B;  2DAE A;  260L A;  4R7G A;  1G4A E;  2RGH A;  2WSC F;  1HFY A;  3QYB A;  4HTN A;  1B7Q A;  4BS7 A;  5DN4 A;  2C99 A;  3A3Q A;  1ZUR A;  1GB8 A;  1HER A;  1NO1 A;  1G3I A;  1X37 A;  1L36 A;  2W1Y A;  4I7R A;  1S3S A;  3J81 S;  1C60 A;  4LF8 M;  1GF4 A;  1JR3 D;  5LVJ A;  1IWZ A;  3TXE A;  2EIZ C;  1XXH E;  4LT2 A;  1UIA A;  2KZS A;  198L A;  1BVS A;  3FRH A;  3GLF A;  1MX0 A;  5KKI A;  1WVV A;  4G49 A;  2H9K A;  1HJP A;  1QAN A;  152L A;  1IWY A;  5FHW A;  1XEP A;  1L50 A;  4G9S A;  1JJ1 A;  1L39 A;  4LY6 A;  1HC0 A;  4P17 A;  4LJ4 A;  1TDZ A;  4LFP A;  4OOT A;  3D9A C;  214L A;  1L97 A;  1G59 A;  4REZ A;  1HSW A;  3B6L A;  3F92 A;  1CV3 A;  1L25 A;  3HH6 A;  1XNR M;  1G1W A;  3HWL A;  2F4A A;  3Q8G A;  1YL1 X;  4GEW A;  3U6E A;  5EXX A;  5LYZ A;  5I14 A;  4N0J A;  1N34 M;  1P64 A;  3CT1 A;  4L6V 6;  5DYG A;  3FTD A;  2B75 A;  1CJ7 A;  3TMU A;  1NWG A;  1NNJ A;  1YQV Y;  2Z2E A;  1D9U A;  4OW1 A;  4LRS A;  1B7L A;  4MH0 E;  1LZY A;  3TWL A;  2FYC A;  3TXF A;  1C62 A;  1GXX A;  1L0K A;  1N75 A;  4LFX A;  4LT1 A;  4L16 A;  3WHL A;  1IBK M;  4HJZ A;  1REM A;  2A7D A;  2YBL A;  1AT6 A;  5ILF A;  1LZE A;  4XEN A;  2FNA A;  1L70 A;  1JKC A;  4OVZ A;  1SSW A;  3RE8 A;  1GL7 A;  1G71 A;  1L84 A;  1WQM A;  2YSS C;  2XF3 A;  1C7Y A;  1L56 A;  4NHQ A;  4IAS A;  2JY6 B;  4S0W A;  2O25 A;  2ZM6 M;  5B07 A;  2LC9 A;  131L A;  2LVQ D;  4WW0 A;  3F6Z A;  1D0M A;  1LSE A;  4JI6 M;  4RLM A;  2DZO B;  3GXK A;  2MRO B;  5T3F A;  4I7J A;  3C80 A;  3P4Z A;  2BWB A;  1D3J A;  2F5P A;  1TAY A;  5GKN A;  4YHH M;  4GKK M;  1G8P A;  3BXW A;  1L26 A;  1CJ8 A;  1LKR A;  2BQA A;  1LHK A;  1N4F A;  1GBW A;  1DGG A;  5I4X A;  2XZU A;  1BWJ A;  4WLY A;  2QPA A;  1OVJ A;  3LVW A;  1L75 A;  5KXW A;  1OJL A;  5KPT A;  5E9R A;  3AL0 C;  5LZM A;  3DMZ A;  4FD2 A;  1XEK A;  4NSJ A;  130L A;  1LJI A;  1VED A;  1GB5 A;  5LMU M;  3P65 A;  1GF6 A;  114L A;  1OVK A;  3B0I A;  3A98 B;  2B6T A;  1KIQ C;  3GLI A;  3SHF A;  1HT2 E;  2BJV A;  3AGH A;  1L09 A;  1HEO A;  2RB2 X;  3I01 M;  4IJ4 A;  3A95 A;  3HT6 A;  3B74 A;  1V7S A;  1CU2 A;  3EIH A;  1SWY A;  2KZU A;  4HPE A;  2MR9 A;  1OIZ A;  3FYC A;  2VB1 A;  2DAM A;  4LYZ A;  2HED A;  2B7X A;  2R6F A;  1LTM A;  3PDS A;  1WTH A;  216L A;  2RAY X;  3VK8 A;  3GUO A;  4ZEE A;  3VWO A;  2JNH A;  1KSF X;  2DWZ B;  1HEQ A;  1B0D A;  4AQN A;  4Z6Y A;  1L23 A;  4WLD A;  3E9S A;  2ZAO A;  1IP1 A;  1QTC A;  4LGK A;  3B9P A;  3ZQJ A;  1GFG A;  2XTH A;  4AZF A;  4LT3 A;  1B7P A;  2LYM A;  1QT6 A;  2OU8 A;  1XNQ M;  1P6Y A;  2MEG A;  1B7M A;  4IAT A;  4NWE A;  3HT8 A;  3FKE A;  163L A;  1TBY A;  2JY5 A;  4QOS A;  1W6Z A;  231L A;  4DKL A;  2Z4R A;  2JY8 A;  1W5S A;  3K2R A;  4Z46 A;  2QSF X;  4IBC A;  5IZ7 D;  3KAM A;  4DR3 M;  1LZB A;  1KXW A;  1DYA A;  3SB8 A;  1GEV A;  248L A;  3WPL A;  1I4W A;  1UUZ C;  199L A;  5KQ8 A;  139L A;  4GCD A;  1JUG A;  1L2B A;  1F6R A;  2HKJ A;  4PRQ A;  1ALC A;  2ZYC A;  4LFC M;  1N33 M;  1L16 A;  1GFE A;  166L A;  1SXJ D;  2MH8 A;  3HBE X;  5DLA A;  4ARQ B;  2D7H A;  1L24 A;  1LSZ A;  129L A;  1UFZ A;  4JN6 A;  3FUT A;  1D9W A;  5LVI A;  1L18 A;  1CKG A;  3OJP A;  3SAV A;  3FRI A;  2O5R A;  5EXP A;  2DQD Y;  1EFU B;  4LGY A;  3GPP A;  3WH1 A;  3WW6 A;  4CGE A;  4WM5 A;  4JI0 M;  2IHL A;  4I4L A;  3AZ6 A;  3HJS A;  1JWR A;  1DKJ A;  1PJQ A;  4PRU A;  2ZNW Y;  3AZ4 A;  245L A;  3C7Y A;  5ITQ A;  3W68 A;  1UA6 Y;  1JQU A;  4LZJ A;  1JKB A;  1LYD A;  1EIJ A;  1P3Q Q;  3E21 A;  1GE4 A;  1C46 A;  2QAR C;  3GLG B;  1GWD A;  2Z6B A;  120L A;  229L A;  1T6O A;  4GLA A;  2D7E A;  2Z12 A;  212L A;  1KNI A;  4ARQ A;  1L96 A;  1QTK A;  2K47 A;  2XLJ A;  2QB0 B;  4CGY B;  246L A;  227L A;  3LYZ A;  3SHG B;  4XJH A;  3PBL A;  1KS3 A;  3L29 A;  2C8O A;  3HDE A;  1O23 A;  1DI3 A;  2AHM A;  1TR8 A;  1QUO A;  1YKX X;  3UZU A;  1GAZ A;  1L11 A;  4CJ6 A;  5LYT A;  1L00 A;  4UWV A;  1R4G A;  1JIS A;  4WO6 A;  4HLQ A;  4RF0 A;  2Q2E B;  2HCB A;  4G3O A;  1GEZ A;  1DI5 A;  4X3B A;  2Z4S A;  4TUN A;  3HHX A;  240L A;  1QAM A;  2KHH A;  107L A;  4ET9 A;  4JI4 M;  1BVK C;  1C65 A;  1OVH A;  4W51 A;  1IN4 A;  4DV3 M;  1UIC A;  2Z37 A;  3HTD A;  4NXM M;  4NSH A;  1L32 A;  188L A;  1SG9 A;  3QAK A;  8LYZ A;  2EO2 A;  4Z8X A;  5KXZ A;  2DI0 A;  1HEP A;  2DBT A;  1QUD A;  4X62 M;  1C6B A;  4YOP A;  1ZMU A;  2I7P A;  1Q39 A;  1GF3 A;  4NWH A;  4IBB A;  1IWW A;  2L4E A;  4X65 M;  1P2L A;  4LYO A;  3L2A A;  3CDQ A;  4H8X A;  3FE3 A;  3KOY E;  4IBE A;  1IY4 A;  1QSQ A;  4JI7 M;  1GBZ A;  1D3F A;  2D7G A;  1JTO L;  2XH9 A;  2JWS A;  5HLL A;  1IP3 A;  1IY2 A;  3J80 S;  3GQ5 A;  4WM1 A;  2QQ8 A;  1DYB A;  4LGM A;  1T3P A;  1IN6 A;  2B74 A;  2MEF A;  5E4P A;  5C1B A;  1PJJ A;  1ZVH L;  4JXJ A;  4RKU F;  1LMQ A;  3GUL A;  4LYM A;  1LMN A;  1KW7 A;  2HUM A;  1B5V A;  4HPI A;  4EOF A;  1RE2 A;  5C6I A;  3LCU A;  4L4U A;  3SAW A;  4HJV A;  3EO5 A;  5LIO A;  1WXQ A;  2UU9 M;  1A2Y C;  1HMK A;  177L A;  2LBC A;  1J09 A;  1L76 A;  1HSX A;  3QAU A;  221L A;  3I04 M;  1ZAE A;  187L A;  1ZYT A;  3FD9 A;  2D4K A;  5KPZ A;  3FAD A;  2M60 A;  2DHY A;  2P5T A;  2DXI A;  251L A;  4NGL A;  3W6A A;  2RKO A;  4D80 A;  1UID A;  3TXI A;  3DN6 A;  1OUC A;  1PS5 A;  3HWS A;  3WXT A;  4YX7 C;  3TMV A;  2Z19 A;  3B7Q A;  1L63 A;  1LPY A;  1GB2 A;  1YLA A;  2B3T A;  5BR8 M;  1IO5 A;  1JIT A;  3HTG A;  3ZH9 B;  4H93 A;  1D2W A;  5LIN A;  2LTU A;  2ZTD A;  3HFM Y;  164L A;  2FE8 A;  3CSZ A;  1G41 A;  2OOB A;  4LJ6 A;  153L A;  1Q3C A;  167L A;  4AKH A;  1OKS A;  1TGU A;  1I94 M;  4FWG A;  2UUA M;  1G7I C;  2ANX A;  4KPM A;  3B0O A;  3HH4 A;  1VDL A;  3W6D A;  2DKV A;  4AKI A;  205L A;  1L68 A;  1YE9 A;  2BQI A;  5KXM A;  2KW0 A;  2CWB A;  157L A;  191L A;  230L A;  4LJA A;  1WQR A;  3PXG A;  4N5R A;  2C98 A;  3HHW A;  3HY5 A;  3MK6 A;  4LJ5 A;  1SX2 A;  3C83 A;  1LAA A;  1IOR A;  2LHG A;  5APE A;  3MMP A;  2FBD A;  2UXB M;  5A3E A;  3CDT A;  2L09 A;  4XJG A;  3HHY A;  1E8L A;  2BQB A;  1L41 A;  1LSG A;  3LYM A;  4EIW A;  1LOZ A;  3FUX A;  5LVG A;  2CHG A;  2A4T A;  4LZZ A;  3R9X B;  1LCN A;  3HH3 A;  4QEQ A;  5DNY A;  4H8Z A;  4BAD A;  7LZM A;  4QY9 A;  1OFI A;  4RW2 A;  1FLY A;  3FA0 A;  2ZIL A;  143L A;  3LQQ A;  5J7C A;  3BBZ A;  1GB0 A;  1KFV A;  4YEO A;  2B6W A;  4M0D A;  2O7A A;  1DKK A;  4EKR A;  4GC5 A;  1TDH A;  1LZ4 A;  1ZQ9 A;  1WGL A;  4PT5 A;  2B5Z A;  1XHB A;  1MJG M;  194L A;  1R5L A;  2KXE A;  5B1F A;  3GLG E;  5APF A;  3SMS A;  196L A;  218L A;  2OQ4 A;  5F14 A;  4XJI A;  2BQD A;  3C7W A;  2YBM A;  4D9Z A;  1D3M A;  2CV1 A;  2JXN A;  2C9C A;  4H9E A;  168L A;  1C6E A;  3H4M A;  175L A;  2BLX A;  4B7G A;  2C96 A;  1L28 A;  3U60 B;  5L3H A;  3TWM A;  2QBY A;  1OV5 A;  4DUY M;  1GE2 A;  5FTN A;  4XGI A;  1LYE A;  1FJG M;  4KO8 A;  9LYZ A;  1IOS A;  3FTC A;  3KFU G;  4KXI A;  2BQC A;  4FDY A;  5FDJ A;  125L A;  1K82 A;  3RUN A;  3GUJ A;  4GCF A;  4H94 A;  1IWU A;  3AJN A;  2Y8P A;  1QTB A;  1G07 A;  1CU5 A;  4EXM A;  1IN7 A;  3TQS A;  1L82 A;  3C8R A;  4ZPX A;  1HHL A;  3GLH B;  3GUP A;  1SXJ B;  1LZ1 A;  4PDI A;  4NG1 A;  8CAT A;  3GUI A;  122L A;  2OEA X;  2L4F A;  1FKQ A;  1LZA A;  2DEN A;  4B08 A;  1L1Z A;  4TUW A;  3K2L A;  2C9O A;  4YXA C;  1LWG A;  1UIB A;  4UWU A;  2Z7J A;  3H4J A;  3U60 A;  1LJN A;  243L A;  2LHM A;  5LAG A;  1IIZ A;  4EKQ A;  3OE9 A;  133L A;  4Y28 F;  4ETE A;  4ET8 A;  3KOW E;  1QUH A;  4WLX A;  1PQM A;  3B89 A;  4WP2 A;  186L A;  2ZQ3 A;  4ITQ A;  2QCU A;  1IC4 Y;  1JR3 E;  2F5Q A;  3J2P B;  2HU3 A;  1C7P A;  4B7H A;  2MJ5 B;  3DN4 A;  5KXR A;  3RZ4 A;  4I7M A;  5FEL A;  4DDC A;  5EP1 A;  3DMV A;  3G3A B;  5EBH A;  1L87 A;  4PD2 A;  3GLH A;  1T6V L;  3FUU A;  1GB6 A;  5KXX A;  4IAP A;  1J5E M;  183L A;  1L99 A;  210L A;  2D4J A;  3DA1 A;  4MM3 B;  2YVB A;  1C08 C;  3BKH A;  3W6E A;  1LGX A;  2F5N A;  4ARL A;  3T6P A;  3VLF B;  1G1V A;  4I7N A;  3GLF B;  1T43 A;  3C8Q A;  1PQI A;  1REX A;  3HJ8 A;  3KP1 E;  5L3I A;  3L26 A;  2OO9 A;  4WMG A;  4DAJ A;  3SB7 A;  5HQ1 A;  3C58 A;  1BB6 A;  1L10 A;  1FNN A;  1L53 A;  4N8Z A;  4ZIX A;  1L48 A;  1IOC A;  1AZF A;  2DQE Y;  1L12 A;  2OPF A;  2CV0 A;  1L95 A;  2VII A;  4PGJ B;  2DAG A;  1XC8 A;  4LRT A;  1LHI A;  2KRU A;  3RGS A;  4OWE A;  1GAY A;  2DWM A;  1DYD A;  3P64 A;  1XEI A;  1D6Q A;  3L64 A;  1JEF A;  2FYD A;  1GFA A;  1L02 A;  4LFB M;  1LSD A;  4IBD A;  1RCM A;  232L A;  2D6B A;  1V7T A;  3J6K A;  4CHX A;  2CGI A;  1CUK A;  1Z5B A;  1IOT A;  3VW7 A;  4RNA A;  7CAT A;  4L8R C;  1L30 A;  1QTE A;  1L51 A;  4DDB A;  1DPW A;  4CFO A;  5B05 A;  2RBO A;  1XMO M;  1LKS A;  4LDO A;  2HU1 A;  4ARM A;  197L A;  2QZ4 A;  3G3B B;  1LZG A;  4DDA A;  4GC9 A;  5KO3 A;  4OVZ B;  1GBY A;  3SBA A;  5D5F A;  3N9C A;  211L A;  4FCW A;  5F81 A;  1B5Y A;  1NDG C;  4Z98 A;  1B7R A;  4MCK A;  3FE0 A;  3TWK A;  4TWS A;  185L A;  1GF9 A;  195L A;  2DHR A;  3LMM A;  4B3T M;  2LXE A;  3U6C A;  1UIG A;  4W52 A;  1TDY A;  2QP9 X;  2YFQ A;  4M9Z A;  1IP5 A;  1DGH B;  1P36 A;  5ITR A;  1GE3 A;  4G4H A;  2LVP C;  1REY A;  4LF9 M;  2R18 A;  4I7Q A;  4W59 A;  1C63 A;  4M9S A;  2R62 A;  1IWX A;  1LZD A;  2ERC A;  1L37 A;  1L98 A;  1LJ4 A;  1D0L A;  3G3X A;  4NXN M;  1B7O A;  1HNL A;  207L A;  5APD A;  4KHP M;  4C5F A;  3WU7 A;  3U5Z A;  3GPX A;  3W3E A;  4HL4 A;  1JIY A;  1C10 A;  1CTW A;  3V2Y A;  3U6O A;  1P2C C;  3JAM S;  1XGP C;  3V2W A;  1OUD A;  1OQM A;  3DN1 A;  3RT5 X;  2LCB A;  3SBJ A;  4WM2 A;  4LF4 M;  1L80 A;  4C3W A;  2VF7 A;  4M4O A;  4IJE A;  4ETB A;  112L A;  2HWJ A;  2CUU A;  2IGC A;  3GPY A;  1JPO A;  2Z8Y M;  1IX0 A;  3GLI B;  4WG7 A;  1HQC A;  3SB5 A;  3KDS E;  4MGY E;  1T8A A;  6LYT A;  2L6O A;  1L91 A;  2C8P A;  1XJT A;  1DGH A;  3TPZ A;  3BOS A;  2XZF A;  1GFK A;  1NF5 A;  3GQ3 A;  2RSC A;  1VG5 A;  174L A;  1CV4 A;  3CT0 A;  1AM7 A;  4XN6 A;  3TMW A;  3AZ5 A;  3KXE C;  172L A;  5DM9 A;  3D8L A;  159L A;  3TXJ A;  4MGH A;  4DV4 M;  5JI3 E;  5FLX S;  1INU A;  2LH0 A;  4DR7 M;  4I0C A;  4XJF A;  4DV0 M;  2L2D A;  3KP0 E;  146L A;  2HEE A;  3WVX A;  2ZYP A;  1L13 A;  3AV0 A;  4H9F A;  1SWZ A;  5LAF A;  4WOA A;  4X64 M;  1B5Z A;  1VEG A;  4NGV A;  3U6M A;  2BLY A;  5FSW A;  4H8Y A;  1K3X A;  4RW1 A;  3OE0 A;  223L A;  180L A;  2K9D A;  2M5Z A;  1LSM A;  2ZAM A;  3K3T A;  4GHL A;  4BAF A;  4J1A A;  2MEB A;  259L A;  5I4Y A;  3DKE X;  2Z39 A;  2WSF F;  3A90 A;  1WQN A;  4DV7 M;  4DC4 A;  1JSF A;  4GN4 A;  3MHV C;  4NGO A;  1SXJ E;  3T1H M;  1G0P A;  222L A;  3UK6 A;  1LSC A;  2YDG A;  1AT5 A;  2DQF C;  3RNX A;  3T15 A;  1D2N A;  1V34 A;  5DYI A;  119L A;  1LI2 A;  5KXN A;  1C6T A;  4G4Q A;  3FUV A;  228L A;  4YEN A;  158L A;  2XQO A;  3DN0 A;  1L60 A;  3WXU A;  3HX3 A;  2X0A A;  3KS8 A;  1LJJ A;  1HQY E;  2CHV A;  4LG2 A;  1GLN A;  1TLA A;  1YAP A;  2LZM A;  4EPI A;  1EQ4 A;  1L33 A;  4K0K M;  1E9R A;  4ZPU A;  5I53 A;  1V92 A;  2NTG A;  108L A;  4U3X B;  1L44 A;  1YAO A;  252L A;  4TSC A;  1NV9 A;  1LYI A;  4GRI A;  4W54 A;  2VQE M;  4YM8 A;  4FWD A;  2Y21 A;  1G7L C;  5E6J A;  3CB7 A;  2R65 A;  4BB9 A;  3IWR A;  1P46 A;  4WM6 A;  3CF0 A;  192L A;  4A3V B;  1LV7 A;  2G8L A;  1L74 A;  4EJ4 A;  151L A;  1UIH A;  1L71 A;  3WW5 A;  4W5W A;  1DO2 A;  1E32 A;  4DBG B;  4J7V A;  1LZ9 A;  4H90 A;  1PJT A;  5IT9 S;  2JP7 A;  4MB7 A;  1B9O A;  1LJE A;  1LZT A;  3J7A S;  3GRY A;  3FI7 A;  4YF2 A;  1LSP A;  4I8O A;  1CU0 A;  2KNA A;  2F32 A;  1QSA A;  1L88 A;  1WQQ A;  1QAQ A;  4I7O A;  3FI5 A;  4BBA A;  1QS9 A;  2JUJ A;  3ZVQ A;  2YBN A;  4L41 A;  4UWN A;  1ZVY B;  256L A;  4DQ5 A;  2AUB A;  1VEK A;  4IBJ A;  3ZC7 B;  2BQN A;  2Q0M X;  4LYC A;  2RAZ X;  1H6M A;  4Z41 A;  4XAD A;  1OV7 A;  1P7S A;  1XGT C;  1LZC A;  5I5Q A;  2VF8 A;  2J5Y A;  3GPU A;  1GFJ A;  3LHM A;  1LYG A;  5EXT A;  3TXK A;  4OWC A;  2HEF A;  4LZM A;  1W5T A;  4LYT A;  2LHC A;  1PJS A;  1C68 A;  1PQD A;  2W1M A;  4NG8 A;  3P66 A;  1QQW A;  4KOD A;  4JYA M;  1F0W A;  1L21 A;  1NMM A;  1C66 A;  4DYG A;  1B7N A;  1YIL A;  162L A;  1L0J A;  3ZCB B;  4AQY M;  1DYC A;  4II7 A;  4NFV A;  4JI1 M;  2DWL A;  249L A;  3AGG G;  3SC3 A;  3HKP A;  4N1C C;  1XGQ C;  1CV1 A;  1OUB A;  2XGN A;  4GLV A;  1IBL M;  1Z6T A;  1L06 A;  1IFY A;  3D8B A;  1OAO C;  4WLT A;  3WHK A;  3PVS A;  3K9O A;  215L A;  2DQH Y;  1DYG A;  4QHS A;  1L04 A;  2MEI A;  217L A;  2QEN A;  3GP1 A;  2HAK A;  2ZAN A;  3K1J A;  3CDV A;  4NEB A;  1MN3 A;  2RBQ A;  4FJR A;  3QY4 A;  5LA5 A;  1HEN A;  3PNY A;  4IJF A;  4DR4 M;  1GO5 A;  1PM5 A;  4HEO A;  4R71 A;  4NSO B;  1XEJ A;  1OWY A;  3A93 A;  1EQ5 A;  4N9R A;  148L E;  1KXX A;  4XK8 F;  1LHM A;  3GLI E;  5D5C A;  1LMP A;  1JSE A;  3CDR A;  1J1P Y;  1HF4 A;  1LMO A;  3C8S A;  2J7N A;  5B1G A;  3FUW A;  3RZE A;  1L45 A;  3Q8X A;  5IEL A;  4B4E A;  5B59 A;  2HUL A;  1G7M C;  5FCP A;  2F47 A;  4G4R A;  2X49 A;  1XB2 B;  4I5S A;  1B6I A;  1L07 A;  1QT8 A;  4OOO A;  5ITY A;  1GF7 A;  1NY5 A;  1GBO A;  1R2Z A;  4DUZ M;  250L A;  4NHT A;  5AMY A;  3HU3 A;  209L A;  135L A;  4RF1 A;  2LZT A;  6LZM A;  1D3N A;  1G0J A;  2DQC Y;  200L A;  2DAK A;  1TH4 A;  5DL9 A;  1CV6 A;  5FTL A;  4MGI E;  111L A;  1FLQ A;  1IY3 A;  4DWX A;  3C81 A;  2HUK A;  4DT3 A;  5ITX E;  3IG5 A;  4XYY A;  1FLW A;  4DD1 A;  1LSY A;  3C7Z A;  3HTB A;  257L A;  1LJ3 A;  1PQJ A;  4YXC A;  4LFA M;  4II8 A;  3ZEK A;  4GCC A;  4N1E I;  1L08 A;  4PHI A;  2BAA A;  1VDD A;  5ITT A;  5FTM A;  2BQL A;  3NBI A;  3JR5 A;  5L8R F;  4NHP A;  3IJU A;  1JKA A;  3QE8 A;  4NHS A;  3RGP A;  3QWL A;  1DV0 A;  1C6P A;  3R8F A;  1IR7 A;  2ZQ4 A;  3A8Z A;  1FN5 A;  1NSF A;  4DR2 M;  1LSB A;  2DQI Y;  4Z3M A;  2W1X A;  1HNZ M;  1QTZ A;  1YAM A;  2G5G X;  3DZD A;  4H91 A;  1CKH A;  3FYD A;  4DD7 A;  3W6C A;  1LZ6 A;  2UUC M;  156L A;  1BB4 A;  1L15 A;  1C6L A;  5EP2 A;  3L25 A;  4AKG A;  2E5L M;  3SAR A;  184L A;  1IP2 A;  2EQL A;  1IEE A;  5ITU A;  3M3U A;  2NQ8 C;  1CUQ A;  1Z5C A;  3V76 A;  4AW4 A;  4H9I A;  3EXD A;  3U61 A;  4W53 A;  1IWT A;  1LZR A;  2MEH A;  4P2E A;  2OU0 X;  1MU5 A;  1L69 A;  2DNA A;  1L61 A;  3B7N A;  4GIP A;  1L79 A;  1F10 A;  4I81 A;  2F5O A;  4GRV A;  1LLH A;  1FKV A;  2RRU A;  1G0G A;  2LYO A;  1TTE A;  1HEL A;  1OWZ A;  2DQA A;  2K0B X;  2ANV A;  2QBY B;  1QDR A;  2B70 A;  1BB7 A;  2R45 A;  3I4Y A;  1GHL A;  1C43 A;  1LI6 A; 
#chains in the Genus database with same CATH homology
 1ZV5 L;  2NWD X;  1QT7 A;  1BB3 A;  1GF5 A;  1GB3 A;  5LVH A;  2YBI A;  3A94 A;  1L64 A;  4WO9 A;  4OO9 A;  4ARP A;  2G4P A;  3ATN A;  3WYH A;  3NY9 A;  2RBN A;  3C82 A;  1C6I A;  1L57 A;  137L A;  2OTY X;  2CJL A;  4OWA A;  4NY5 A;  5IHG A;  4YEM A;  4PJZ A;  1IP6 A;  1JTN A;  1I20 A;  3P68 A;  5KY1 A;  4H9B A;  2BQO A;  1GFH A;  3DN8 A;  4K5Y A;  1QSB A;  2YBJ A;  3OK0 A;  4DD0 A;  3NY8 A;  5LXW A;  2BQK A;  226L A;  3GUN A;  2O79 A;  4NGW A;  1T8F A;  1IC5 Y;  1GB9 A;  5KXL A;  2CWI A;  4EKS A;  1I56 A;  1QT3 A;  1C6G A;  103L A;  1GFU A;  2HEA A;  4KT3 A;  1CV5 A;  3AB6 A;  3F9L A;  1JTM A;  262L A;  219L A;  1LMT A;  2D4I A;  4EMN A;  1LYY A;  4TSB A;  3N9A A;  4R6C A;  102L A;  3B72 A;  1L20 A;  4ETD A;  3OE8 A;  242L A;  4QGZ A;  1ZMY L;  4CFP A;  3TXG A;  1NHB A;  1DPX A;  2B73 A;  1LGW A;  1C6N A;  4HJY A;  4ZFP A;  224L A;  4LZT A;  1BWI A;  225L A;  4HP0 A;  3E3D A;  1IR8 A;  1QDT A;  154L A;  141L A;  3RW8 A;  3T36 A;  261L A;  1QUS A;  127L A;  142L A;  1J1X Y;  3CT5 A;  1HFZ A;  1L90 A;  4W96 A;  4NGK A;  1LYZ A;  4I7K A;  1I1Z A;  4CJ2 A;  4RLN A;  4ARM B;  1BGI A;  1CU3 A;  1NDM C;  1GD6 A;  1L72 A;  1QT4 A;  2RB1 X;  1LMA A;  3D4S A;  1GFR A;  1GE0 A;  3G3V A;  1LJG A;  5II3 A;  1L14 A;  155L A;  1FLU A;  1GBS A;  4ETC A;  1EL1 A;  5I4W A;  3TMX A;  161L A;  1IWV A;  1UIE A;  1C6Q A;  4G4C A;  1L27 A;  2BQH A;  4XJD A;  2FBB A;  235L A;  4NGI A;  1OYU A;  1MEL L;  3MGW A;  118L A;  2HTX A;  1OUF A;  3A3R X;  5F9X A;  1GFV A;  1L89 A;  236L A;  1G7J C;  1B5W A;  150L A;  1XSF A;  1PQK A;  3AW6 A;  1I6S A;  3CSR A;  176L A;  3HDF A;  1D0K A;  239L A;  3LZM A;  4H9C A;  1L52 A;  128L A;  1T97 A;  2G4N A;  3HUA A;  169L A;  4GCB A;  2DQJ Y;  1C6D A;  233L A;  171L A;  1IOQ A;  2Z2F A;  3A6C Y;  3A92 A;  1UBZ A;  3DN3 A;  1HFX A;  1L73 A;  1LHH A;  213L A;  237L A;  5C6L A;  1L19 A;  1NQI A;  1DZB X;  4OWH A;  1GFT A;  1GF8 A;  4DD2 A;  4DJH A;  1VFB C;  1REZ A;  1LSA A;  3DN2 A;  2F2N A;  2MEC A;  4WM4 A;  1BWH A;  1MLC E;  1K28 A;  2H9J A;  173L A;  5KXP A;  1GBX A;  3DNA A;  2B6Z A;  160L A;  1T6H A;  3A34 A;  3HT9 A;  1DYE A;  1OUH A;  3WU8 A;  1NHE A;  4J1B A;  4DD9 A;  4WL7 A;  1L93 A;  1XGR C;  3WMK A;  4HV2 A;  3HBD A;  1IC7 Y;  5HNC A;  1PQO A;  4GN3 A;  1LJH A;  1LZ8 A;  1CKF A;  138L A;  1VDQ A;  165L A;  1QUT A;  1L62 A;  2BQF A;  3LYO A;  115L A;  4NSI A;  2EPE A;  1CJ6 A;  4HTK A;  1F6S A;  1VDT A;  2Z38 A;  3HT7 A;  1L35 A;  1UIF A;  3AYQ A;  4DQ7 A;  1P3N A;  1L81 A;  2L78 A;  1L40 A;  4W58 A;  1L92 A;  2N5Z A;  4B1A A;  1RFP A;  1UC0 A;  5KXS A;  2LYZ A;  1YAN A;  1KW5 A;  2EKS C;  1EPY A;  1CJ9 A;  5KXT A;  3JR6 A;  3BKV A;  2BQE A;  4O34 A;  3ZVQ B;  3WU9 A;  3LZ2 A;  2ZWB A;  3WVY A;  1DXJ A;  3SB9 A;  1NBY C;  1C69 A;  1QUG A;  5HMJ A;  1LYS A;  2PC2 A;  1NKH A;  208L A;  4AGA A;  4H92 A;  3A96 A;  2ZIK A;  1RI8 B;  2F30 A;  3AW7 A;  1BQL Y;  1QTH A;  258L A;  4DD3 A;  4H9H A;  1L34 A;  4NGY A;  1CX7 A;  4G4B A;  1QS5 A;  1JHL A;  2F4G A;  181L A;  1LJF A;  4DQJ A;  1L47 A;  4KL7 A;  4WG1 A;  1W08 A;  2XBS A;  2RH1 A;  2I6Z A;  1L59 A;  3SB6 A;  1C6K A;  1QTD A;  1YRO A;  4PPO A;  4I7T A;  3ULR A;  1G06 A;  4A7D A;  144L A;  1B5X A;  1OUA A;  1YL0 X;  1LYF A;  3IJV A;  4NHI A;  1JJ0 A;  1KIR C;  3M18 B;  149L A;  3NYA A;  3EML A;  1KY0 A;  1JTT L;  3A91 A;  4BAP A;  4LT0 A;  1L83 A;  254L A;  2MEA A;  2I26 L;  4NSG A;  3ODU A;  1CX6 A;  2W1L A;  3RU5 A;  2B72 A;  123L A;  1IP7 A;  4NGZ A;  1B7S A;  1XFP L;  2OE4 X;  1YKY X;  4B4J A;  3G3W A;  3J4G A;  5C6J A;  1C61 A;  1GB7 A;  4M6D A;  1C6F A;  4LYB A;  1HML A;  1SX7 A;  2MED A;  5KJ9 A;  1JJ3 A;  1L85 A;  1D6P A;  4NIJ A;  4GN5 C;  147L A;  4WM3 A;  1GDX A;  5ILC A;  3WUM A;  4I7P A;  132L A;  2YBH A;  4HV1 A;  1TEW A;  2HEB A;  220L A;  2HUB A;  4GBR B;  241L A;  1HEW A;  1LYH A;  1WTN A;  1JTP L;  3QNG A;  3CSQ A;  1VDP A;  3WPK A;  178L A;  3OE6 A;  3ATO A;  1L77 A;  4H1P A;  4ETA A;  5A3Z A;  3A67 Y;  4W56 A;  1QTV A;  1BB5 A;  1BVX A;  1ZWN A;  1L67 A;  2RB0 X;  134L A;  1CUP A;  1HEM A;  193L A;  7LYZ A;  5DN5 A;  5M1Y A;  4MR1 A;  1VAU A;  3WL2 A;  1L55 A;  3WUL A;  1LJK A;  5FST A;  1GPQ C;  1L49 A;  255L A;  1VDS A;  3B0K A;  2ZIJ A;  206L A;  4B0D A;  5KKJ A;  110L A;  1L94 A;  1DQJ C;  2XJW A;  1LSF A;  2WAR A;  189L A;  2GV0 A;  4I8S A;  1FDL Y;  1UAC Y;  1LPI A;  1VAT A;  1C64 A;  201L A;  1SSY A;  3A6B Y;  2DQG Y;  4ARJ A;  2B6Y A;  4AXT A;  1BHZ A;  1OUG A;  1KXY A;  1L43 A;  1YKZ X;  3AZ7 A;  1H87 A;  3SBB C;  1P56 A;  3GXR A;  2Q9D A;  1L58 A;  2BQJ A;  4TX7 A;  4B4I A;  1L17 A;  1WVU A;  3HBH A;  4ML7 A;  3N9E A;  3LZT A;  1GDW A;  5KXO A;  4W94 A;  1LYO A;  1RJC B;  1L05 A;  5JEN B;  170L A;  1XGU C;  4R0F A;  104L A;  1LWK A;  1SQ2 L;  1IP4 A;  1LI3 A;  109L A;  1A4V A;  145L A;  2RBR A;  4LDL A;  4NGJ A;  1SLY A;  4W57 A;  1OUI A;  1DI4 A;  5HMV A;  2I25 L;  3HH5 A;  3TXH A;  1OUJ A;  2MEE A;  3UON A;  2LZ2 A;  140L A;  3TXB A;  1PZY A;  1C45 A;  1LHL A;  2ZNX Y;  1L46 A;  1QSW A;  4I7L A;  3EMS A;  1LZS A;  2BPU A;  1WQP A;  3T6U A;  1YIK A;  5F16 A;  4I7S A;  5F9U A;  5LVK A;  1CKD A;  1OUE A;  2RBP A;  1G7H C;  1YAQ A;  3W6B A;  1C6A A;  247L A;  1QQY A;  4WL6 A;  1KIP C;  1OP9 B;  4B49 A;  1D2Y A;  1GXV 2;  3HU8 A;  5HNL A;  4XJB A;  3GUM A;  1C67 A;  2D91 A;  1L54 A;  1CVK A;  234L A;  1NBZ C;  1IVM A;  2Z18 A;  1JKD A;  5APC A;  3L2X A;  2B6X A;  4E97 A;  3W6F A;  253L A;  3SN6 R;  4MST A;  4HSF A;  1T8G A;  4GCE A;  4E3U A;  1G0K A;  6LYZ A;  1Z55 A;  2OTZ X;  182L A;  3LN2 A;  4OWB A;  4TTD A;  4W55 A;  1G0Q A;  1QT5 A;  5KXY A;  3HUQ A;  1P37 A;  1LHJ A;  1DYF A;  1QIO A;  126L A;  4PJ2 C;  4ANR A;  1LZN A;  3HU9 A;  2OE9 X;  1G0M A;  1L42 A;  1L65 A;  2F2Q A;  5LA8 A;  1LZ5 A;  3D3D A;  4EKP A;  3CDO A;  3WPJ A;  3F8V A;  5FEK A;  1P5C A;  1LMC A;  2BQM A;  4RDS A;  238L A;  2XBR A;  1AKI A;  190L A;  1IR9 A;  3HTF A;  5I54 A;  1G0L A;  113L A;  4H9A A;  3AGI A;  1L29 A;  2A7F A;  1L66 A;  2IFF Y;  3HUK A;  1L03 A;  1L01 A;  4J0L A;  4LDE A;  1FBI X;  1CU6 A;  5LYM A;  5KXK A;  3CQL A;  4EPF A;  1WTM A;  1GE1 A;  1TCY A;  3WUA A;  5L9J A;  1B2K A;  1P2R A;  2BQG A;  1UCO A;  1LYJ A;  1L22 A;  3LYT A;  5IDD A;  2NTH A;  1B5U A;  1CNS A;  1LW9 A;  1C6C A;  5K7O A;  1KY1 A;  244L A;  1L31 A;  5B06 A;  1LSN A;  2OE7 X;  1CV0 A;  2O4W A;  1C6J A;  4QDN A;  1WQO A;  2G4Q A;  1J1O Y;  2H5Z A;  3GUK A;  3WUN A;  3EBA B;  1XJU A;  3SP3 A;  2Q9E A;  1GF0 A;  4HTQ A;  1L38 A;  2HEC A;  4PK0 A;  1C6M A;  1CKC A;  3TXD A;  1LGU A;  1EQE A;  3DMX A;  2RBS A;  2CDS A;  1L86 A;  1C6H A;  2OU9 A;  260L A;  1HFY A;  4HTN A;  1B7Q A;  4BS7 A;  5DN4 A;  3A3Q A;  1ZUR A;  1GB8 A;  1HER A;  1L36 A;  2W1Y A;  4I7R A;  1C60 A;  1GF4 A;  5LVJ A;  1IWZ A;  3TXE A;  2EIZ C;  4LT2 A;  1UIA A;  198L A;  5KKI A;  1WVV A;  4G49 A;  2H9K A;  152L A;  1IWY A;  5FHW A;  1XEP A;  1L50 A;  4G9S A;  1JJ1 A;  1L39 A;  1HC0 A;  4LFP A;  4OOT A;  3D9A C;  214L A;  1L97 A;  3B6L A;  1HSW A;  1CV3 A;  1L25 A;  3HH6 A;  1G1W A;  3HWL A;  2F4A A;  1YL1 X;  5LYZ A;  5I14 A;  4N0J A;  1P64 A;  3CT1 A;  2B75 A;  1CJ7 A;  3TMU A;  1NWG A;  1YQV Y;  2Z2E A;  1D9U A;  4OW1 A;  1B7L A;  1LZY A;  2FYC A;  3TXF A;  1C62 A;  1GXX A;  1L0K A;  4LFX A;  4LT1 A;  4HJZ A;  1REM A;  2A7D A;  2YBL A;  1AT6 A;  5ILF A;  1LZE A;  4XEN A;  1L70 A;  1JKC A;  1SSW A;  1WQM A;  1L84 A;  2YSS C;  1L56 A;  4NHQ A;  4IAS A;  4S0W A;  5B07 A;  2LC9 A;  131L A;  3F6Z A;  1D0M A;  1LSE A;  4RLM A;  3GXK A;  5T3F A;  4I7J A;  3C80 A;  3P4Z A;  1D3J A;  1TAY A;  1L26 A;  1CJ8 A;  1LKR A;  2BQA A;  1LHK A;  1N4F A;  1GBW A;  5I4X A;  1BWJ A;  4WLY A;  1OVJ A;  1L75 A;  5KXW A;  5E9R A;  5LZM A;  3DMZ A;  1XEK A;  4NSJ A;  130L A;  1LJI A;  3P65 A;  1VED A;  1GB5 A;  1GF6 A;  114L A;  1OVK A;  3B0I A;  2B6T A;  1KIQ C;  3AGH A;  1L09 A;  1HEO A;  2RB2 X;  4IJ4 A;  3A95 A;  3HT6 A;  1V7S A;  1CU2 A;  1SWY A;  4HPE A;  2VB1 A;  4LYZ A;  2HED A;  2B7X A;  1LTM A;  3PDS A;  1WTH A;  216L A;  2RAY X;  3GUO A;  4ZEE A;  3VWO A;  1HEQ A;  1B0D A;  4AQN A;  1L23 A;  4WLD A;  1IP1 A;  1QTC A;  4LGK A;  1GFG A;  2XTH A;  4LT3 A;  1B7P A;  2LYM A;  1QT6 A;  2OU8 A;  1P6Y A;  2MEG A;  1B7M A;  4IAT A;  4NWE A;  3HT8 A;  163L A;  1TBY A;  231L A;  1W6Z A;  4DKL A;  3K2R A;  4Z46 A;  3KAM A;  1LZB A;  1KXW A;  1DYA A;  3SB8 A;  1GEV A;  248L A;  3WPL A;  1UUZ C;  199L A;  139L A;  4GCD A;  1JUG A;  1F6R A;  4PRQ A;  1ALC A;  2ZYC A;  1L16 A;  1GFE A;  166L A;  5DLA A;  3HBE X;  4ARQ B;  1L24 A;  1LSZ A;  129L A;  1D9W A;  5LVI A;  1L18 A;  1CKG A;  3OJP A;  2DQD Y;  3WH1 A;  3WW6 A;  4CGE A;  4WM5 A;  2IHL A;  3AZ6 A;  1JWR A;  1DKJ A;  4PRU A;  2ZNW Y;  3AZ4 A;  245L A;  3C7Y A;  1UA6 Y;  1JQU A;  1JKB A;  1LYD A;  1GE4 A;  1C46 A;  2QAR C;  1GWD A;  2Z6B A;  120L A;  229L A;  4GLA A;  2Z12 A;  212L A;  1KNI A;  4ARQ A;  1L96 A;  1QTK A;  2QB0 B;  246L A;  227L A;  3LYZ A;  4XJH A;  3PBL A;  1KS3 A;  2C8O A;  3HDE A;  1O23 A;  1DI3 A;  1QUO A;  1YKX X;  1GAZ A;  1L11 A;  5LYT A;  1L00 A;  4UWV A;  1JIS A;  4WO6 A;  1GEZ A;  1DI5 A;  4X3B A;  4TUN A;  240L A;  107L A;  4ET9 A;  1BVK C;  1C65 A;  1OVH A;  4W51 A;  1UIC A;  2Z37 A;  3HTD A;  4NSH A;  1L32 A;  188L A;  3QAK A;  8LYZ A;  5KXZ A;  1HEP A;  2DBT A;  1QUD A;  1C6B A;  4YOP A;  1GF3 A;  4NWH A;  1IWW A;  1P2L A;  4LYO A;  3CDQ A;  4H8X A;  1IY4 A;  1QSQ A;  1GBZ A;  1D3F A;  1JTO L;  5HLL A;  1IP3 A;  4WM1 A;  1DYB A;  1T3P A;  2MEF A;  2B74 A;  5E4P A;  1ZVH L;  1LMQ A;  3GUL A;  4LYM A;  1LMN A;  1KW7 A;  2HUM A;  1B5V A;  4HPI A;  4EOF A;  1RE2 A;  5C6I A;  4HJV A;  3EO5 A;  5LIO A;  1A2Y C;  1HMK A;  177L A;  1L76 A;  1HSX A;  221L A;  187L A;  1ZYT A;  2D4K A;  3FAD A;  251L A;  4NGL A;  3W6A A;  1UID A;  3TXI A;  3DN6 A;  1OUC A;  1PS5 A;  3WXT A;  4YX7 C;  3TMV A;  2Z19 A;  1L63 A;  1LPY A;  1GB2 A;  3HTG A;  1IO5 A;  1JIT A;  4H93 A;  1D2W A;  5LIN A;  3HFM Y;  164L A;  3CSZ A;  153L A;  167L A;  1G7I C;  2ANX A;  4KPM A;  3B0O A;  3HH4 A;  3W6D A;  2DKV A;  205L A;  1L68 A;  2BQI A;  5KXM A;  157L A;  191L A;  230L A;  1WQR A;  4N5R A;  1SX2 A;  3C83 A;  1LAA A;  1IOR A;  5APE A;  2FBD A;  5A3E A;  3CDT A;  4XJG A;  1E8L A;  2BQB A;  1L41 A;  1LSG A;  3LYM A;  1LOZ A;  5LVG A;  2A4T A;  1LCN A;  4QEQ A;  3HH3 A;  4H8Z A;  4BAD A;  7LZM A;  4QY9 A;  4RW2 A;  1FLY A;  3FA0 A;  2ZIL A;  143L A;  5J7C A;  1GB0 A;  4YEO A;  2B6W A;  2O7A A;  1DKK A;  4EKR A;  1LZ4 A;  2B5Z A;  194L A;  5B1F A;  5APF A;  196L A;  218L A;  5F14 A;  4XJI A;  2BQD A;  3C7W A;  2YBM A;  4D9Z A;  1D3M A;  4H9E A;  168L A;  1C6E A;  175L A;  2BLX A;  1L28 A;  5L3H A;  1OV5 A;  1GE2 A;  1LYE A;  9LYZ A;  1IOS A;  4KXI A;  2BQC A;  4FDY A;  5FDJ A;  125L A;  3RUN A;  3GUJ A;  4GCF A;  4H94 A;  1IWU A;  3AJN A;  2Y8P A;  1QTB A;  1G07 A;  1CU5 A;  4EXM A;  1L82 A;  3C8R A;  1HHL A;  3GUP A;  1LZ1 A;  4NG1 A;  3GUI A;  122L A;  2OEA X;  1FKQ A;  1LZA A;  4YXA C;  1LWG A;  1UIB A;  4UWU A;  1LJN A;  243L A;  2LHM A;  5LAG A;  1IIZ A;  4EKQ A;  3OE9 A;  133L A;  4ETE A;  4ET8 A;  1QUH A;  4WLX A;  1PQM A;  186L A;  2ZQ3 A;  1IC4 Y;  2HU3 A;  1C7P A;  3DN4 A;  5KXR A;  3RZ4 A;  4I7M A;  5FEL A;  4DDC A;  3DMV A;  3G3A B;  5EBH A;  1L87 A;  1T6V L;  1GB6 A;  5KXX A;  4IAP A;  183L A;  1L99 A;  210L A;  2D4J A;  2YVB A;  3W6E A;  1C08 C;  3BKH A;  1LGX A;  4ARL A;  1G1V A;  4I7N A;  3C8Q A;  1PQI A;  1REX A;  5L3I A;  4WMG A;  4DAJ A;  3SB7 A;  5HQ1 A;  1BB6 A;  1L10 A;  1L53 A;  4N8Z A;  4ZIX A;  1L48 A;  1IOC A;  1AZF A;  2DQE Y;  1L12 A;  1L95 A;  4PGJ B;  1LHI A;  4OWE A;  1GAY A;  1DYD A;  3P64 A;  1XEI A;  1D6Q A;  3L64 A;  1JEF A;  2FYD A;  1GFA A;  1L02 A;  1LSD A;  1RCM A;  232L A;  2D6B A;  1V7T A;  3J6K A;  4CHX A;  2CGI A;  1IOT A;  3VW7 A;  1L30 A;  1QTE A;  1L51 A;  4DDB A;  1DPW A;  4CFO A;  5B05 A;  2RBO A;  1LKS A;  4LDO A;  2HU1 A;  4ARM A;  197L A;  3G3B B;  4DDA A;  1LZG A;  1GBY A;  3SBA A;  5D5F A;  3N9C A;  211L A;  5F81 A;  1B5Y A;  1NDG C;  4Z98 A;  1B7R A;  4MCK A;  3FE0 A;  4TWS A;  185L A;  1GF9 A;  195L A;  1UIG A;  4W52 A;  1TDY A;  1IP5 A;  1P36 A;  1GE3 A;  4G4H A;  1REY A;  4I7Q A;  4W59 A;  1C63 A;  1IWX A;  3G3X A;  1L98 A;  1L37 A;  1LJ4 A;  1LZD A;  1D0L A;  207L A;  1B7O A;  1HNL A;  5APD A;  4C5F A;  3WU7 A;  3W3E A;  1JIY A;  1C10 A;  1CTW A;  3V2Y A;  1P2C C;  1XGP C;  3V2W A;  1OUD A;  1OQM A;  3DN1 A;  3RT5 X;  2LCB A;  4WM2 A;  1L80 A;  4C3W A;  4M4O A;  4ETB A;  112L A;  2CUU A;  2IGC A;  1JPO A;  1IX0 A;  4WG7 A;  3SB5 A;  1T8A A;  6LYT A;  1L91 A;  2C8P A;  1XJT A;  1GFK A;  2RSC A;  1NF5 A;  174L A;  1CV4 A;  3CT0 A;  1AM7 A;  4XN6 A;  3TMW A;  3AZ5 A;  172L A;  5DM9 A;  159L A;  3TXJ A;  4XJF A;  4I0C A;  1INU A;  146L A;  2HEE A;  3WVX A;  2ZYP A;  1L13 A;  4H9F A;  1SWZ A;  5LAF A;  4WOA A;  1B5Z A;  4NGV A;  2BLY A;  4H8Y A;  4RW1 A;  3OE0 A;  223L A;  180L A;  1LSM A;  3K3T A;  4BAF A;  4J1A A;  2MEB A;  259L A;  5I4Y A;  3DKE X;  2Z39 A;  3A90 A;  1WQN A;  4DC4 A;  1JSF A;  4GN4 A;  4NGO A;  1G0P A;  222L A;  1LSC A;  2YDG A;  1AT5 A;  2DQF C;  3RNX A;  119L A;  5KXN A;  1LI2 A;  1C6T A;  228L A;  4YEN A;  158L A;  2XQO A;  3DN0 A;  1L60 A;  3WXU A;  2X0A A;  1LJJ A;  1TLA A;  2LZM A;  4EPI A;  1YAP A;  1EQ4 A;  1L33 A;  4ZPU A;  5I53 A;  2NTG A;  108L A;  4U3X B;  1L44 A;  1YAO A;  252L A;  4TSC A;  1LYI A;  4W54 A;  4YM8 A;  1G7L C;  3CB7 A;  3IWR A;  1P46 A;  4WM6 A;  192L A;  1L74 A;  4EJ4 A;  151L A;  1UIH A;  1L71 A;  3WW5 A;  4J7V A;  1LZ9 A;  4H90 A;  1B9O A;  1LJE A;  1LZT A;  3FI7 A;  4YF2 A;  1LSP A;  1CU0 A;  2F32 A;  1QSA A;  1L88 A;  1WQQ A;  4I7O A;  3FI5 A;  1QS9 A;  3ZVQ A;  2YBN A;  4L41 A;  4UWN A;  1ZVY B;  256L A;  4DQ5 A;  2AUB A;  2Q0M X;  2BQN A;  4LYC A;  2RAZ X;  1H6M A;  4Z41 A;  4XAD A;  1OV7 A;  1P7S A;  1XGT C;  1LZC A;  5I5Q A;  1GFJ A;  3LHM A;  1LYG A;  3TXK A;  4OWC A;  2HEF A;  4LZM A;  4LYT A;  2W1M A;  1C68 A;  1PQD A;  4NG8 A;  3P66 A;  1F0W A;  1L21 A;  1NMM A;  1C66 A;  4DYG A;  1B7N A;  1YIL A;  162L A;  1L0J A;  1DYC A;  4NFV A;  249L A;  3AGG G;  4N1C C;  1XGQ C;  1CV1 A;  1OUB A;  4GLV A;  1L06 A;  4WLT A;  215L A;  2DQH Y;  1DYG A;  1L04 A;  2MEI A;  217L A;  3CDV A;  4NEB A;  2RBQ A;  4FJR A;  3QY4 A;  5LA5 A;  1HEN A;  1XEJ A;  1OWY A;  3A93 A;  1EQ5 A;  4N9R A;  148L E;  1KXX A;  1LHM A;  5D5C A;  1LMP A;  1JSE A;  3CDR A;  1J1P Y;  1HF4 A;  1LMO A;  3C8S A;  5B1G A;  3RZE A;  1L45 A;  5IEL A;  4B4E A;  5B59 A;  2HUL A;  1G7M C;  5FCP A;  2F47 A;  1B6I A;  1L07 A;  1QT8 A;  4OOO A;  1GF7 A;  1GBO A;  250L A;  4NHT A;  5AMY A;  209L A;  135L A;  2LZT A;  6LZM A;  1D3N A;  1G0J A;  2DQC Y;  200L A;  5DL9 A;  1CV6 A;  111L A;  1FLQ A;  1IY3 A;  4DWX A;  3C81 A;  2HUK A;  4DT3 A;  4XYY A;  1FLW A;  4DD1 A;  1LSY A;  3C7Z A;  3HTB A;  257L A;  1LJ3 A;  1PQJ A;  4YXC A;  4II8 A;  3ZEK A;  4GCC A;  4N1E I;  1L08 A;  4PHI A;  2BAA A;  2BQL A;  4NHP A;  3IJU A;  1JKA A;  3QE8 A;  4NHS A;  1C6P A;  1IR7 A;  2ZQ4 A;  3A8Z A;  1FN5 A;  1LSB A;  2DQI Y;  4Z3M A;  2W1X A;  1QTZ A;  1YAM A;  4H91 A;  1CKH A;  4DD7 A;  3W6C A;  1LZ6 A;  156L A;  1BB4 A;  1L15 A;  1C6L A;  184L A;  1IP2 A;  2EQL A;  1IEE A;  3M3U A;  1CUQ A;  4H9I A;  3EXD A;  4W53 A;  1IWT A;  1LZR A;  2MEH A;  4P2E A;  2OU0 X;  1L69 A;  1L61 A;  1L79 A;  1F10 A;  4GRV A;  1LLH A;  1FKV A;  1G0G A;  2LYO A;  1HEL A;  1OWZ A;  2DQA A;  2ANV A;  1QDR A;  2B70 A;  1BB7 A;  1GHL A;  1C43 A;  1LI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...