1QDTA

2.1 a resolution structure of escherichia coli lytic transglycoyslase slt35 in complex with calcium
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdtA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdtA02
4L41A 4IJ4A 2H9KA 1UIGA 4FJRA 2IHLA 1IWTA 1J1OY 5LYZA 2DQEY 1LSCA 1B7QA 1F10A 2ZWBA 2XBSA 2F30A 3BKVA 5KXRA 1OUIA 2D4KA 1KIQC 2YBMA 1JTPL 1UIEA 2I6ZA 1GF5A 208LA 1IWYA 5J7CA 3G3AB 1GB3A 5B1FA 3T36A 1DKJA 2D4JA 1BB5A 4RDSA 3RU5A 4J7VA 1QTEA 3AW7A 1GDWA 4MCKA 3W6CA 1LHKA 2LZ2A 1GXXA 1OUAA 4GLAA 4BADA 3N9EA 5F9UA 1B7LA 1LJ4A 5EBHA 2DQHY 2EKSC 2W1MA 1GPQC 3P65A 1BQLY 4IASA 1ALCA 1LKRA 4I0CA 5LAFA 4ZEEA 5LVGA 1KXYA 1LZ5A 4WO6A 5JENB 1D6QA 1DPWA 1LMOA 1IY4A 2RSCA 3OK0A 4NSGA 3TXIA 2FBBA 1IOCA 1SQ2L 5D5CA 2X0AA 3ATOA 1GB6A 3A93A 4NGZA 1DKKA 2A7FA 1J1PY 2FYDA 1IP6A 4NGWA 2YBLA 4WM1A 4DT3A 1GFHA 1B5WA 1NBZC 4YENA 2HU1A 4I8SA 4NWEA 4NGIA 1OP9B 5HNLA 1HMKA 2D91A 3F6ZA 4KT3A 1GB9A 1LMTA 2EQLA 1IC5Y 3LN2A 3LYTA 2Z12A 2G4QA 4XENA 1BVKC 4QGZA 3WH1A 2Z2EA 3WL2A 1WQQA 3QY4A 4H93A 1VDSA 3HFMY 1GFKA 4H8XA 4OOOA 1HEPA 4NGVA 4BAFA 4H94A 1LSYA 1GF8A 1H6MA 5F16A 4GN5C 1IO5A 4KPMA 4X3BA 1D0LA 5F14A 1LHLA 1EQ5A 1FKVA 1GFVA 1BVXA 1UBZA 1HFYA 1FLYA 1IP7A 1GEVA 1HF4A 1LMPA 2G4NA 4NG8A 3WU8A 1CJ7A 1CJ6A 1H87A 1HMLA 2YBNA 3B6LA 2ZIJA 4NGLA 1IP3A 2BQMA 4AXTA 1B9OA 1OUDA 4YEMA 3CB7A 4DDCA 4NIJA 1REYA 1I20A 1WQOA 3TMXA 3B0IA 1IP4A 2BQBA 2EPEA 4B4IA 1GFUA 3P68A 1LJNA 4H90A 1C10A 3M3UA 4RLNA 1JKDA 1XGPC 1YL1X 3AW6A 3TXHA 3IWRA 1AT6A 4UWNA 2XJWA 1NDMC 4OWAA 1KIPC 2DQAA 1FBIX 5LIOA 5LAGA 1B7SA 1GBXA 1VDPA 1WTMA 4G9SA 4LT1A 1LHIA 1IR8A 3HBHA 4TSCA 1QSWA 1BHZA 2YVBA 4NGYA 1IX0A 3TMVA 5APCA 1JKBA 1NQIA 4N9RA 1WQPA 3A91A 1GHLA 4N0JA 2DQGY 3A95A 4NFVA 4WM5A 6LYTA 2ZQ4A 1ZV5L 3LYOA 4GLVA 4HP0A 5L3IA 5L9JA 1BB6A 2ZNWY 1CKFA 1IWVA 3AGGG 1LSDA 4A7DA 4HTNA 4M6DA 1LSMA 1T6VL 2BQIA 1B7OA 4HSFA 3A3QA 1OQMA 1BB4A 2MEDA 1IC4Y 9LYZA 1YKYX 1VEDA 4H9HA 3AB6A 1JKCA 5FSTA 1OUBA 1AM7A 1DQJC 1XGTC 2CDSA 4CGEA 1LMQA 1GBYA 3P4ZA 2DQJY 3W6AA 2ZYCA 1LZBA 1LSAA 5ILCA 1GEZA 1GFJA 3ZVQA 4PJ2C 2WARA 1IVMA 1GE2A 1BB7A 1JKAA 4KXIA 1B5ZA 4DDAA 5C6JA 1FKQA 1CKDA 1JJ0A 1C43A 2MEFA 2F4AA 3B0KA 3EBAB 4N5RA 5LXWA 1B5XA 4GCFA 2DQFC 1JJ1A 1GFRA 7LYZA 5E4PA 4M4OA 5HQ1A 1PZYA 5KKIA 1HSXA 1GFEA 4GCDA 3TXFA 1LAAA 2F2NA 4RLMA 6LYZA 1DI5A 1LJHA 5LYMA 2IFFY 3BKHA 1GF9A 3AZ6A 4GCBA 1C45A 1QDTA 1LHJA 1LYOA 3RW8A 132LA 1WVVA 2I26L 2LHMA 4LYMA 4WLTA 1QUTA 3N9CA 4G49A 3MGWA 1AT5A 3IJVA 1N4FA 4EOFA 2GV0A 1LCNA 2BQEA 4LYCA 1B2KA 3A34A 5B06A 1JSEA 5M1YA 1G7MC 1HC0A 1B7MA 1LYZA 3CT0A 4G4CA 3ZVQB 4B0DA 4P2EA 2B5ZA 1AKIA 1HNLA 1INUA 4Z98A 1OUCA 2N5ZA 1YAQA 3RZ4A 2HEBA 4H8YA 1LJIA 2FYCA 3J4GA 1RE2A 4AGAA 2ZNXY 2DQIY 1CJ9A 2BQDA 4ZIXA 1UCOA 1MLCE 4G4HA 4HV1A 5FDJA 4WL6A 4YF2A 5LINA 4WG1A 3D3DA 3T6UA 4H91A 1QQYA 1LZTA 3J6KA 1J1XY 1GBWA 1LJKA 3ZEKA 3CSQA 3EO5A 1G7LC 5KKJA 4LT2A 2HEDA 4XJFA 1JTTL 5I54A 4RW1A 1VDQA 5KXMA 1C08C 5L3HA 1GBSA 1JEFA 4H9EA 4QDNA 1B5VA 4BS7A 4TX7A 4OWEA 154LA 1LYSA 1JJ3A 1CKGA 4CHXA 1RI8B 1Z55A 1B7PA 1UICA 1DI3A 1LJ3A 2MEEA 1BWIA 1GE4A 5DL9A 1RJCB 3TXGA 1IEEA 1F6RA 2BQFA 5KY1A 1B7NA 2LZTA 2Q0MX 5IDDA 3A6CY 4ZFPA 1GF6A 1ZMYL 4PGJB 4WM6A 3E3DA 3TMWA 1TAYA 1B5YA 3A67Y 1QUSA 4Z46A 1IWZA 1IOTA 4DDBA 4MR1A 4NHTA 2F4GA 1AZFA 5A3EA 1GBZA 1LJJA 4OWHA 1LZEA 3B0OA 5IHGA 1RFPA 4XYYA 1C7PA 4CJ2A 4WMGA 3AZ5A 1LTMA 1TCYA 3WPJA 4DD2A 3VWOA 3ATNA 5KXPA 3WUMA 1YAMA 3P64A 4WG7A 4N1CC 4XJHA 3WPLA 4PRUA 4ET9A 1LJGA 4TSBA 1TEWA 4W94A 2ZQ3A 4RW2A 1OUEA 1V7TA 4ANRA 2HTXA 3A92A 4XJDA 1LZ6A 1LPIA 2DBTA 1LSZA 2HEEA 4R0FA 3GXRA 4BAPA 5LVJA 1UUZC 4GCEA 1DPXA 2FBDA 4DD7A 2BQNA 2BPUA 1D0MA 4HPEA 1XFPL 3TXBA 4Z3MA 4KL7A 4E3UA 1GF0A 4II8A 4NGOA 4ETEA 193LA 3QE8A 3K3TA 5DLAA 5LA8A 1KXWA 4GN3A 1NWGA 5KJ9A 3LHMA 1NBYC 3WXTA 1A2YC 4J0LA 1W08A 4HTQA 4H9IA 3AZ4A 3HBDA 5F81A 5I53A 4DD0A 1C46A 2BQGA 5APEA 3TMUA 2HEFA 1IOSA 1XSFA 2Z2FA 3W6FA 1QIOA 2VB1A 4H9BA 1B0DA 1JPOA 1XGRC 1IY3A 1G7IC 2CGIA 3A94A 4HPIA 2BLXA 4XJGA 4YM8A 1VFBC 1CJ8A 4NSHA 4XADA 3W3EA 3AGIA 2G4PA 1GWDA 1JUGA 1LZYA 1IP2A 1OUJA 4IATA 1JHLA 1EQEA 5AMYA 5HMJA 1NKHA 1D0KA 4NGKA 2I25L 1CKHA 2MEHA 1LZCA 4MSTA 4H9FA 1GFAA 4PRQA 4ET8A 1BGIA 1NF5A 1UIDA 1GXV2 2BQCA 3AYQA 2MEIA 1GE0A 3ULRA 5HNCA 1YIKA 5LYTA 1LYYA 2BQKA 3LZ2A 5KXLA 1VATA 4H1PA 1GB5A 4LT0A 1LKSA 5FELA 4WM3A 4H92A 1FDLY 1I56A 4TWSA 4ETAA 1LZSA 1FLWA 2BQLA 2BQOA 4NEBA 4QY9A 3OJPA 1MELL 134LA 1JITA 2YBIA 4H9CA 4PHIA 4TUNA 3CT1A 1REZA 1HHLA 5C6LA 3TXEA 5II3A 1LZAA 1SLYA 2EIZC 1XEKA 3AGHA 4NSIA 4ETBA 4GCCA 4OWCA 2HUBA 1UIBA 4HJZA 3FE0A 4DYGA 5I4YA 5KXOA 4C5FA 5B07A 1XGQC 4W96A 1HEOA 4WLDA 4WM2A 5C6IA 4YEOA 3W6BA 3WW5A 135LA 5FEKA 1JISA 1JTOL 1B5UA 2HU3A 5F9XA 1ZVHL 1F0WA 2C8PA 4XJBA 5LVHA 2DQCY 1XEIA 5D5FA 2LYOA 2W1YA 3A96A 2BQJA 5FHWA 3WVYA 1W6ZA 1KXXA 1NMMA 2DQDY 1YKZX 1BWHA 1CKCA 4DD9A 3A3RX 4DD3A 1HERA 5APDA 1UA6Y 5KXYA 1XEJA 1JWRA 4XJIA 4D9ZA 1GF4A 1LZ4A 2W1XA 4R6CA 1D6PA 5E9RA 3M18B 4OW1A 1FLQA 4ML7A 5LVKA 1HFZA 3W6EA 1NHEA 1YQVY 4LFPA 3WYHA 1HSWA 3WUAA 5HLLA 1IOQA 4LYOA 5LA5A 2Z19A 3QNGA 4QEQA 3CSRA 4OWBA 4WOAA 1GF7A 4LT3A 3WUNA 4B49A 2HEAA 5HMVA 1G7HC 1OUHA 1YANA 4LGKA 1LMAA 3KAMA 5K7OA 1LSFA 4OOTA 2D6BA 3A6BY 4GN4A 4NG1A 1UIFA 1TBYA 1GB2A 4WM4A 1E8LA 4WLYA 1V7SA 4LYBA 4UWUA 1KIRC 3WVXA 3FI7A 1GDXA 1HEQA 1LJEA 1LJFA 2W1LA 3G3BB 1IORA 1UC0A 4NHSA 2AUBA 5DM9A 2YBJA 1WVUA 2BQAA 3WU9A 3WMKA 1EL1A 2LYMA 1GFTA 4U3XB 4XN6A 1O23A 1DXJA 1WTNA 1GE3A 3EXDA 4B4EA 1EQ4A 1QSAA 2A7DA 1LZNA 1YKXX 3B72A 4NSJA 2Z18A 1GFGA 5A3ZA 3CQLA 4H9AA 4DWXA 1FN5A 2Y8PA 2MEGA 4DD1A 1GAZA 1LSGA 2CJLA 3AZ7A 3P66A 3HBEX 2Z37A 1LMCA 207LA 3TXJA 153LA 1IR7A 2ZYPA 3LZTA 4PPOA 3WULA 1HFXA 4B1AA 1LZ8A 1LZRA 5B59A 1NDGC 5APFA 1LOZA 3GXKA 4NHQA 1OUGA 1IC7Y 194LA 2BLYA 4YOPA 2ZILA 4N8ZA 3N9AA 4G4BA 2BQHA 5T3FA 3IJUA 4LYTA 1OUFA 2DKVA 4WLXA 1YL0X 5I5QA 1REXA 2H9JA 5B05A 2LYZA 5IELA 1P2CC 4EMNA 4J1AA 2D4IA 4LZTA 1T3PA 4HJVA 5ILFA 1LHHA 2MEAA 2YBHA 3AJNA 3RT5X 3TXDA 1LZ9A 1TDYA 1WQRA 1HEMA 1GD6A 2XTHA 4H8ZA 2MEBA 1VAUA 1F6SA 1GF3A 3D9AC 4NHIA 4ETDA 1G7JC 4HTKA 3EMSA 1CNSA 4C3WA 3CT5A 1REMA 3WU7A 4ETCA 3WXUA 1UIHA 4NHPA 3SP3A 1GE1A 1IWWA 4DC4A 3WPKA 1HENA 1WQMA 2C8OA 5KXZA 3CSZA 2Z38A 4CFOA 2YSSC 3RNXA 1LSPA 2NWDX 1IWUA 1LHMA 5KXXA 1YAPA 4WO9A 1QTKA 4Z41A 4LFXA 3A8ZA 1ZVYB 3A90A 1HEWA 5I4XA 1IWXA 5KXWA 1QDRA 1LZ1A 1XGUC 1BWJA 5KXSA 1LMNA 8LYZA 2HECA 1RCMA 5LVIA 1YAOA 1GAYA 1GBOA 2YDGA 5KXNA 1LSEA 1VDTA 1GB0A 1JIYA 1LSNA 3LYMA 5KXKA 4HV2A 1YROA 4UWVA 1WQNA 2BAAA 4LYZA 4CFPA 1DI4A 1LZGA 1DZBX 1IP5A 4J1BA 1D9UA 2Z39A 1UACY 1B7RA 1HELA 5I4WA 4NY5A 1GB8A 3TXKA 2MECA 1JSFA 2CWIA 5DN5A 1LZDA 2PC2A 4NWHA 4N1EI 4TTDA 1I1ZA 2H5ZA 4FDYA 1FLUA 5DN4A 1UIAA 5B1GA 1IR9A 2XBRA 2ZIKA 3WW6A 4NGJA 1IP1A 1YILA 3W6DA 133LA 4O34A 1GB7A 1PS5A 5FCPA 5KXTA 1BB3A 4WL7A 1IIZA 1LSBA 1A4VA 3LYZA 4B4JA 4HJYA
chains in the Genus database with same CATH superfamily
4L41A 4IJ4A 2LH0A 1UIGA 4JI1M 2IHLA 1K28A 1IWTA 4RF0A 3J80S 1B7QA 1QT6A 3BKVA 2LVNC 2D4KA 1BVSA 1P2RA 2EJSA 1IWYA 5J7CA 3U6LA 1C6NA 1DKJA 4J7VA 1QTEA 1C6HA 1L38A 2LZ2A 1GXXA 1OUAA 4GLAA 2RBQA 5LMUM 2EKSC 2W1MA 3P65A 1VEJA 5DYGA 3GO8A 5LAFA 2LTUA 2KDLA 2LHCA 5JENB 1LPYA 3AFHA 1D6QA 1DPWA 1LMOA 2RSCA 4NSGA 205LA 2HHHM 1HJPA 1IOCA 4GRIA 3HTDA 4W52A 172LA 2X0AA 3A93A 1NHGC 1PQJA 147LA 1J1PY 2RBSA 2DZOB 1RU3A 2MJ5B 2WSEF 2YR0A 1L11A 4NGWA 4WM1A 1GFHA 3SB8A 4I8SA 1XJTA 5HNLA 2D91A 225LA 3F6ZA 4KT3A 2EQLA 1R2ZA 3LN2A 3LYTA 3HTGA 191LA 1V34A 3HH3A 3QY4A 1GO5A 2ZBKB 1VDSA 1GFKA 4H8XA 1HEPA 3DN8A 4LRSA 1NJFA 3C3EA 2DWLA 4KPMA 5KPTA 1OAOC 3OE6A 1EQ5A 1P37A 2MGWA 4JV5M 4OVZB 1IP7A 2A4TA 1GEVA 4DV4M 1LMPA 4NG8A 3WU8A 214LA 2YBNA 3B6LA 1PQDA 1L15A 2ZIJA 1IP3A 4AXTA 4IBIA 4NIJA 3GLIB 3KOZE 1GFUA 3H4MA 1LJNA 2B6WA 1C10A 1NJGA 1JQJC 4RLNA 4GC5A 3C3DA 4X65M 1NDMC 3L27A 115LA 2J5YA 2F5QA 1B7SA 1WTMA 1VDPA 2RBRA 1E9RA 1LHIA 3HBHA 3SBAA 3U6MA 4LDEA 1BHZA 2LBCA 2V1CA 1C6DA 1NQIA 4N9RA 3A91A 213LA 4N0JA 1G4AE 6LYTA 2VF8A 2L7IA 4FCTA 1HR0M 3LW5F 2QBYB 3GUIA 2MR9A 4HP0A 5L9JA 1CKFA 3AGGG 4G4QA 145LA 4R71A 4OW0A 1LSMA 4HSFA 3A3QA 1OQMA 3G3VA 3TE6A 1WGLA 1VEDA 4H9HA 1OUBA 1AM7A 1XGTC 3FE3A 4CGEA 1GBYA 1TTEA 3P4ZA 2ZYCA 1LZBA 1IM2A 4I7SA 4L8RC 3VFDA 3U6PA 160LA 2WARA 1QS5A 1BB7A 3AOEC 1B5ZA 3L25A 3HUAA 2MEFA 4LJAA 1L75A 3B0KA 3EBAB 2WSFF 2APLA 1G8PA 1CU2A 2F2NA 6LYZA 1L37A 4GCBA 2M60A 1LYOA 2LHMA 1IY0A 2I26L 3HKPA 1L34A 4G49A 3T15A 4I7TA 130LA 3KS4A 3IJVA 4LF5M 167LA 2GV0A 125LA 3HTFA 3A34A 3KOYE 1HC0A 4G4CA 1Z5AA 4P2EA 1AKIA 1Q39A 1JR3D 1PQKA 4Z98A 2N5ZA 3RZ4A 4H8YA 3J4GA 192LA 3C80A 4NC6A 4FCWA 1UCOA 3FRHA 1KS3A 4LF8M 4H91A 1LZTA 3ZEKA 4DR1M 3CSQA 185LA 3KP0E 1JTTL 5I54A 3PNYA 1G06A 1XB2B 1T3TA 1QTBA 148LE 4I7QA 3HHXA 1CX7A 4FW9A 2JY5A 5ITXA 1KY1A 2LVPC 151LA 2KEBA 2G5GX 1RJCB 1SSYA 102LA 3SB7A 1IEEA 1HT1E 1B7NA 2LZTA 2Q0MX 5IDDA 1L99A 4YXCA 1ZMYL 2X49A 3A67Y 4KHPM 4D82A 4DDBA 1L29A 2DZNB 4NHTA 230LA 4CGYB 175LA 2F4GA 1AZFA 1C6MA 1GBZA 1IBKM 2B6TA 4S12A 3B0OA 1TF0B 248LA 1L36A 4CJ2A 4WMGA 3FUWA 3IECA 1L86A 4GMQA 3ATNA 2FS1A 3WUMA 3PFIA 1L67A 1TEWA 2ZQ3A 1V7TA 2HTXA 1QT5A 252LA 1L12A 1L81A 4EKSA 1L2CA 2Q9DA 5LVJA 1L89A 4LZZA 4DD7A 2FBDA 2NTHA 2BQNA 2BPUA 1XFPL 3TXBA 5EP2A 236LA 4LGMA 4NGOA 4ETEA 193LA 138LA 3QE8A 3VLFB 3K3TA 4DAJA 4GKKM 3I04M 1OWYA 1HNZM 1G0PA 3KOXE 3CDVA 3AZ4A 3HBDA 1JQUA 3LCVB 1SXJD 1L2DA 228LA 4LJ7A 1IOSA 1AIPC 2R6FA 1XSFA 126LA 4JI0M 3VKGA 1G7IC 1L69A 3HH5A 4HPIA 1L8QA 1VFBC 4NSHA 4NRWA 3W3EA 4JI3M 4IATA 1SXJB 176LA 2L7HA 1PQMA 1EQEA 5AMYA 3BXWA 1NKHA 4NGKA 3HH4A 3CDQA 4KLNA 2XZUA 1GFAA 3ZQJA 1QZEA 2OOAA 2DWNA 2F5OA 2IGCA 4B3TM 4NXMM 2BQKA 2B3TA 1VATA 1OV7A 4H1PA 4LT0A 2R4JA 4JI7M 1FDLY 1I56A 4ETAA 3GLHA 1FLWA 4QY9A 4QNMA 1D3FA 2YBIA 1VDLA 1L82A 1VDDA 5ITTA 2RB2X 3TXEA 4M9ZA 2EIZC 1DGFA 2HWJA 1UIBA 1OVHA 4W96A 5B07A 3CF6E 1KYIA 4WM2A 3C8SA 4YEOA 4FCVA 4CISA 135LA 1I94M 5FEKA 2OU8A 1JTOL 1B5UA 3KSJA 4IBBA 3GQ3A 4IBCA 1G0GA 5D5FA 4MGYE 3L26A 2QNJA 2Z4RA 3QWLA 1CV0A 3TPZA 2BQJA 1G0MA 1KXXA 1YKZX 199LA 4DD3A 4L4UA 2JY6B 1XEJA 1L23A 3KFUG 3J2PB 2XQOA 4R6CA 1L63A 5E9RA 3M18B 1DYBA 1L47A 1L87A 4ARQB 1OTRA 3WUAA 2LCBA 4LYOA 4DJHA 5LA5A 2FH0A 1C66A 2UXDM 3QNGA 4QEQA 2KHHA 4LT3A 4YX7C 1HQCA 4LGKA 5K7OA 1L58A 4CHTB 1UIFA 5KQDA 4LYBA 1QAOA 1GDXA 3C82A 3G3BB 1WVUA 1CV4A 2DAMA 4U3XB 195LA 3A98B 5GKNA 2HKJA 3T38A 3ZCBB 1WTNA 3CDOA 2A7DA 259LA 1R7RA 1G59A 1L95A 1YKXX 1GL7A 1S3SA 3VKHA 2LC9A 1QS9A 1T6HA 3CQLA 3SFZA 2DXIA 4F1IA 1L14A 3HBEX 2YFQA 4D80A 190LA 1L50A 153LA 3WULA 3Q8XA 4LFAM 1NV8A 2ZTDA 174LA 1L71A 3UONA 1LOZA 4NHQA 1LYGA 1LYJA 2BLYA 4I7NA 4ARJA 4N8ZA 3N9AA 3RZEA 4G4BA 2HCBA 1IN6A 3GLIE 2DKVA 1YL0X 2O4WA 2CEAA 3HT8A 2A5YB 2LYZA 4EMNA 238LA 2RKOA 4LZTA 3WHKA 4HJVA 216LA 2L4FA 3AJNA 1MU5A 1TR8A 1HEMA 1NY5A 1GD6A 1VAUA 4NHIA 3D9AC 3GUOA 4HTKA 3NY8A 233LA 1QAQA 3IHPA 4ETCA 2CHGA 4I7JA 3WXUA 188LA 2VDBB 4DC4A 4GBRB 5KO3A 3SHGB 2C8OA 1C6PA 2MH8A 1C65A 155LA 1YAPA 4WO9A 3PXGA 3C9PA 4LFXA 3A8ZA 1XGUC 5LVIA 1YAOA 4LZJA 2V1UA 4FWGA 1XC8A 3C58A 2P5TA 1GB0A 5L8RF 4CFPA 4UWVA 6LZMA 1LYHA 1VEGA 4IBFA 3SARA 4J1BA 2UUCM 2Z39A 1UACY 1SX7A 2NQ8C 1B7RA 4QOSA 3FRIA 1P5CA 1D3JA 5DN5A 1LZDA 4ARQA 1VEKA 3AOGA 3LCUA 5DN4A 3K1JA 4NGJA 1TDZA 1GB7A 1L79A 1L97A 4LF4M 1YLAA 4GIPA 2FOIC 2K47A 3AOEA 3LYZA 4HJYA 3HU3A 2JNHA 4FJRA 1L90A 245LA 1C67A 3B7ZA 2C99A 1J1OY 4PD2A 3GLHE 3DN6A 256LA 1L61A 2XBSA 4NXNM 4EKPA 2EO2A 1L46A 1OUIA 1KIQC 2YBMA 129LA 3HDFA 2I6ZA 208LA 2F4VM 2OQ4A 3RU5A 4RDSA 1QTDA 1GDWA 4MCKA 3A42A 249LA 5F9UA 4I7MA 1B7LA 5EBHA 1GJTA 1GABA 1ALCA 1LKRA 5LVGA 4WO6A 4XGIA 1IY4A 1HQYE 1N34M 2BJWA 1L07A 2FBBA 3DFZA 4HL4A 4P16A 1VQ1A 4NGZA 4LZMA 7CATA 1PJQA 2JUJA 1XHBA 2OU9A 108LA 2CUZA 5H37D 4BLCA 4B7GA 4NWEA 4NGIA 1HMKA 1L02A 3CGWA 1GB9A 1LMTA 1BVKC 4QGZA 3WH1A 1IFYA 2Z2EA 3GLFA 3HWLA 198LA 5KPZA 4OOOA 1D3NA 2HL7A 4BAFA 2I7PA 1LSYA 1H6MA 5F16A 1IO5A 1D0LA 189LA 1CU5A 4B3RM 173LA 1IN5A 2Z7JA 4NSOB 4R3DA 1OV5A 1FLYA 1L13A 1HF4A 2CUUA 3C7YA 2YNMD 3TWLA 4YHHM 4JI8M 1H87A 4NGLA 4Z8XA 1X37A 2KXEA 1IQPA 1REYA 3DN0A 1IP4A 2EPEA 1EPYA 1Z59A 1XGPC 1OAIA 3TXHA 1IN4A 2XJWA 1FBIX 1P6YA 1GBXA 1SXJE 1IY1A 2AHMA 3THGA 4LT1A 3GLGA 1IX0A 2DQGY 1J5EM 1L39A 3NY9A 1IY2A 163LA 2ZQ4A 3JR5A 1BB6A 1P46A 2ZNWY 4DR3M 1LSDA 4M6DA 1QUDA 1T6VL 201LA 3JR6A 3HGIA 243LA 1IC4Y 2E5LM 1YKYX 3AB6A 1JKCA 2XSZA 217LA 2F47A 5FSTA 2D7EA 4OO9A 4LF6M 1E94E 4WP2A 1NVMA 5ILCA 1IVMA 3U61A 4DDAA 5C6JA 2K6BA 3SN6R 3K2RA 3L2AA 2UUBM 1L35A 1C6TA 5LXWA 1B5XA 1PRBA 2R45A 1JJ1A 2DQFC 5ITYA 1L30A 7LYZA 5HQ1A 1PZYA 3NBIA 1HSXA 4EKQA 3TXFA 1LAAA 1OFHA 4RLMA 1L70A 2WZJA 1OWZA 3BKHA 1L20A 1LHJA 3HUQA 2LVAA 3CTWB 3RW8A 2HAKA 4LYMA 1QUTA 3GPYA 3FTFA 2OE9X 3MGWA 1WGNA 1R4GA 3DN3A 1LCNA 247LA 2BQEA 1WR1B 3IG5A 4RNAA 3T6PA 1QAMA 4DV7M 5B06A 5M1YA 1UFZA 1G7MC 1L65A 1HNLA 3K9PA 1DYDA 1CUKA 1YAQA 1CV5A 2HEBA 1C6GA 3UZUA 1LJIA 1LV7A 1C6CA 4KODA 1MLCE 4G4HA 4HV1A 4DUYM 4OU7A 4IBKA 1J1XY 1LJKA 1HNXM 4I81A 5KKJA 2HEDA 4AG5A 4Z6YA 4LDOA 2FNAA 2F5SA 5L3HA 1GBSA 4QDNA 1B5VA 4BS7A 4TX7A 4OWEA 3G3XA 154LA 2BNKA 1LYSA 4CHXA 3FTEA 1B7PA 180LA 2F2QA 1GE4A 2XEPA 1LGUA 5DL9A 3TXGA 4K0KM 1F6RA 3WHLA 5KY1A 1L03A 2C9OA 3JAMS 1L53A 3A6CY 1TAYA 4LJ9A 3U6DA 1B5YA 1QUSA 5C18A 2J7OA 1L51A 4BB9A 1LJJA 3GPXA 1LZEA 3SBJA 3VK8A 2QPAA 2JXNA 4QHTA 1L43A 3WPJA 4DD2A 5FLXS 3VWOA 250LA 1YAMA 3P64A 4LRTA 4N1CC 1LJGA 2LWXA 110LA 1OUEA 3A92A 4ANRA 3U6EA 1LPIA 4R0FA 2HEEA 1LYEA 4YXAC 1DYCA 4BAPA 4GCEA 1DPXA 1L59A 1D0MA 4HPEA 4Z3MA 3FTDA 3SMSA 4ARPA 5DLAA 5LA8A 8CATA 1GJSA 3R8FA 2KNZA 260LA 1NBYC 1A2YC 5DFLA 4H9IA 3AL0C 4AW4A 1C46A 1KNIA 5EP1A 3C83A 2HEFA 5APEA 2QARC 131LA 4H9BA 4X66M 2CGIA 3A94A 4XJGA 4AG6A 3LQRA 1ORYB 4XADA 5LMNM 1L80A 1LWKA 2B6ZA 1GWDA 1JUGA 1LZYA 3TWMA 1ZMWA 4DUZM 1D0KA 1L17A 170LA 2I25L 2EKKA 1CKHA 2GQFA 1NF5A 1KSFX 1L93A 1L88A 2BQCA 2MEIA 1GE0A 1YIKA 3FADA 1LYYA 3QYEA 3W68A 3LZ2A 1GB5A 5FELA 3HTBA 4H92A 4JI6M 2DAIA 1T43A 4PJZA 3OJPA 1MELL 134LA 1LI2A 3VW7A 3CT1A 1LI3A 1IBMM 5C6LA 1CV3A 3AGHA 4OWCA 3U6SA 4DYGA 4HJZA 234LA 1XGQC 3DN2A 2OO9A 3W6BA 1C6IA 2HU3A 4II7A 1J7KA 2Y20A 4IBDA 4XJBA 1CU3A 4LFCM 1D2WA 1L68A 2LYOA 2W1YA 3A96A 3ZH9B 4R7GA 3WVYA 5EXTA 184LA 3GLHB 4I4LA 2UXCM 2DKLA 2RRUA 1F4IA 1MN3A 5EP4A 1L18A 5APDA 3SB6A 4XJIA 3KOWE 2CFOA 1IBLM 1LZ4A 1QTHA 4DV5M 3W6EA 231LA 1OQYA 4IJEA 3WYHA 5HLLA 1J09A 2OEAX 2B73A 3CSRA 1XNRM 107LA 4B49A 5FTNA 3I01M 4BBAA 1L91A 1C7YA 1YANA 1TDHA 1LSFA 181LA 4M0WA 1E8LA 1GB2A 4WM4A 1W5TA 2OOBA 4W58A 3WVXA 1KIRC 4PDGA 2O01F 1LJFA 2AUBA 2RGOA 2LYMA 4XN6A 1NHWC 3I4VA 2DVWB 2CHQA 1PQIA 3IG8A 4IBEA 1LZNA 3B72A 4NSJA 2Z18A 3RFWA 1GFGA 2M5ZA 4I7OA 3KVWA 4H9AA 4DWXA 1SWYA 1L49A 1LSGA 4PDIA 2DWMA 1D2YA 2DWZB 2KZUA 2ZYPA 4PPOA 4B1AA 3GXKA 1L19A 1GLNA 1L72A 1IC7Y 4GHAA 194LA 4LYTA 157LA 1LYFA 2R65A 3NBXX 3GRYA 1L57A 2G3QA 1LHHA 2YBHA 3DZDA 1WQRA 4H8ZA 2EUCA 1GF3A 4ETDA 1G7JC 112LA 2ZTCA 5E26A 3WU7A 4L78A 1L60A 4L6V6 3SP3A 4MM3B 1L48A 5EP3A 1HENA 3C8RA 3CSZA 2Z38A 1QTZA 4CFOA 3TL4X 2YSSC 1IWUA 2JY7A 4Z41A 4B3SM 3A90A 3UGJA 1BWJA 8LYZA 3GQ4A 3AJIB 1JIYA 1LSNA 1WQNA 4LYZA 3SAVA 3GPPA 1D9UA 1HELA 1ZYTA 5I4WA 4G6ZA 4NY5A 1TH4A 4NWHA 2KZSA 1G0JA 2B70A 4FDYA 2XBRA 2ZIKA 127LA 1IP1A 1YILA 3W6DA 133LA 5FCPA 5FTJA 1B6IA 224LA 3PDSA 1A4VA 5A3ZA 1P2LA 4B4JA 1CU0A 1DYGA 4AI6A 1DV0A 1CX6A 5LYZA 1L45A 2DQEY 1F10A 2XH9A 3L29A 2F30A 4X64M 2OU0X 1JTPL 229LA 1UIEA 1L0KA 3G3AB 4W54A 1L24A 3T36A 3U6CA 3AW7A 3W6CA 3D4SA 1KFVA 4BADA 1EFUB 1C6JA 164LA 3FUUA 1V33A 140LA 1EIJA 1DYFA 1L42A 2DQHY 2XFTA 1KXYA 3OK0A 3TXIA 2LXEA 3FYCA 1LLHA 2RH1A 3HT9A 1SQ2L 1UM8A 1GB6A 4PCZA 1DKKA 2A7FA 3GUPA 2FYDA 4DV2M 1B5WA 1NBZC 5EJCA 1OVJA 1G1WA 109LA 4GHLA 1ZMVA 5FSWA 2Z12A 5JI2E 1NNUC 2ANXA 3HDEA 5ITXE 137LA 4H93A 119LA 3HFMY 3GRVA 4NGVA 1AUAA 4B7FA 2X4AA 3F8VA 4JXJA 1GF8A 4H94A 3U60A 3F92A 4GN5C 1CVKA 1LGWA 1L05A 261LA 4GC9A 1HFYA 178LA 118LA 2O79A 1V92A 5DYIA 4JYAM 1QYRA 1CJ7A 3FI5A 4LJ4A 1CJ6A 4W59A 4ARMA 1G71A 3CB7A 4DDCA 4MGZE 1I20A 1WQOA 3GLFB 3B0IA 4B4IA 4L15A 218LA 104LA 4H90A 1L09A 3AW6A 2HUMA 4OWAA 2QB0B 1SX2A 1NSFA 5LAGA 5LIOA 4G9SA 3KSXA 3TMVA 5APCA 1JKBA 1XEPA 3L64A 4NFVA 2UU9M 3A95A 3DNAA 7LZMA 5L3IA 3LYOA 2L09A 1I4WA 1IWVA 2Z8YM 4HTNA 2BQIA 1B7OA 1BB4A 4G4NA 2V6ZM 4GKJM 1DQJC 1K3WA 3RUNA 2DQJY 1JB0F 1LSAA 3ZVQA 1I6SA 4PJ2C 3FUTA 2CV1A 3GLGB 1CKDA 1JJ0A 1IN8A 4ARLA 3EMLA 4N5RA 1TLAA 2XSZD 4GCFA 3J27B 4M4OA 2DZLA 3HJ8A 4GCDA 2CHVA 1ZMUA 1LJHA 2QENA 5LZMA 1QDTA 187LA 2DAEA 132LA 1K82A 3SMPA 2R4EA 3N9CA 242LA 240LA 1DGHA 1AT5A 4W51A 1N4FA 1L66A 237LA 1WHCA 4M0DA 142LA 4LYCA 2CP8A 4MB7A 3T1HM 1B7MA 4B0DA 1PJSA 3U61B 2B5ZA 1OUCA 1HT2E 1RE2A 162LA 4AGAA 2DQIY 3T1YM 2J7NA 1QVRA 246LA 3EO5A 2RAYX 3SAUA 1G07A 4XJFA 4RW1A 1VDQA 1R2YA 5KXMA 1C08C 1JEFA 4H9EA 4LF9M 2OE4X 3J7AS 4CIZA 3DN4A 3OE9A 1RI8B 4MGHA 1Z55A 4RF1A 3B7NA 1UICA 1DI3A 1LJ3A 2MEEA 1BWIA 1E9SA 3U6QA 2BQFA 4B3MM 143LA 3I51A 4ZFPA 4WM6A 4W53A 3RGSA 210LA 4EPFA 5A2QS 4Z46A 4LFBM 2QHOB 5A3EA 4GH9A 3KS8A 4OWHA 3HZJA 5IHGA 1L41A 166LA 5IREB 1L96A 1RFPA 2R62A 4I7RA 4XYYA 1C7PA 3V2YA 1C1KA 1TCYA 4WG7A 3U5ZB 3WPLA 2H5XA 1C6QA 4ET9A 4TSBA 4RW2A 5LYMA 3AV0A 168LA 1L2BA 1LZ6A 4DV1M 2DBTA 1LSZA 3OE8A 3GXRA 1WXQA 4AKIA 1XNQM 4PK0A 1N78A 219LA 4KL7A 1GF0A 3H4JA 4II8A 2OTYX 2RB1X 1DGBA 120LA 1KXWA 253LA 1QT7A 4GN3A 3HH6A 2MROB 3LHMA 5KJ9A 3WXTA 2VQEM 5F81A 5I53A 4DD0A 3J81S 5EQTA 3TMUA 5EXXA 3W6FA 2Z2FA 2VB1A 1L08A 1L73A 226LA 1B0DA 1JPOA 4DR2M 1IY3A 1XGRC 2BLXA 5ITRA 4YM8A 1L1TA 1CJ8A 1L25A 3AGIA 4KT0F 1VG5A 3QAKA 1OUJA 1G41A 1T8FA 1JHLA 1WJ7A 1GL6A 5HMJA 3BBZA 3LVVA 3VK7A 2MEHA 1SWZA 4MSTA 1UIDA 2Y0TA 4W55A 3AYQA 3HJQA 1DO2A 1Q3CA 1XMOM 1QT3A 1LKSA 2L78A 1A5TA 1JTMA 2BQOA 1R5LA 4NEBA 4H9CA 3K8ZA 5IT9S 1REZA 1HHLA 5II3A 1LZAA 1XEKA 4ETBA 4GCCA 3FE0A 5I4YA 5KXOA 2DENA 4WLDA 4JI2M 1L54A 3WW5A 2OTZX 4FD2A 1JISA 5F9XA 1ZVHL 1F0WA 2C8PA 1L92A 3I4YA 2DQCY 1XEIA 3LVWA 1D2NA 2R44A 3DN1A 1W6ZA 2B75A 1BWHA 139LA 1QANA 3HWSA 183LA 3FUXA 2O5RA 5KXYA 1G0QA 2OPFA 1GF4A 1C68A 2W1XA 1N33M 156LA 1LYIA 4F2LA 2ZANA 4OW1A 1FLQA 5LVKA 3B74A 3FTCA 1NHEA 161LA 1YQVY 3GRRA 4LFPA 2HUKA 3AKZA 1HSWA 3HT6A 1HNWM 4LDLA 4OWBA 3WUNA 1GF7A 5HMVA 1TH3A 1QT8A 2L6OA 3U5ZA 177LA 4OOTA 4GN4A 1QUOA 1L94A 1QTVA 4WLYA 1LJEA 1IORA 4NHSA 3DMZA 5DM9A 4EXMA 4FVMA 3FD9A 1PJJA 2XZFA 1DXJA 1YSYA 1P3QQ 2N35A 1GE3A 1EQ4A 2G8LA 3SAWA 227LA 5ITUA 1EE8A 1XXHA 2HULA 4LJ6A 1SXJC 1CUQA 2KRKA 182LA 1FN5A 2Y8PA 2D7GA 4DD1A 1GAZA 2CJLA 3AZ7A 3P66A 1P56A 2Z37A 1LMCA 1IXSA 207LA 220LA 2RGHA 2DHRA 1IR7A 3LZTA 3E4RA 1HFXA 1LZ8A 5B59A 1ZV1A 3C8QA 5APFA 1OUGA 3K92A 1IXZA 3GUKA 2Y0QA 3E46A 113LA 2BQHA 5T3FA 1CUPA 1KY0A 3IJUA 3GLFE 4WLXA 5I5QA 4IAPA 1L98A 4I8OA 2WSCF 1T3PA 3FKEA 5IWAM 3RT5X 3TXDA 1LZ9A 1TDYA 2Z3XA 3DOAA 2XTHA 4B7HA 1ZQ9A 1YUBA 1T97A 4DQJA 5FTLA 3EMSA 1CNSA 2K0BX 3TWKA 3CT5A 4C3WA 3FYDA 3GRUA 1L56A 3MMPA 1UIHA 4NHPA 1GE1A 1G3IA 1IWWA 3WPKA 3HU1A 1L62A 3CF0A 5KXZA 5BR8M 2F5PA 1ZWNA 3RNXA 1LSPA 1LHMA 3RE8A 5KXXA 2QP9X 1QTKA 1WIVA 1C6KA 3D8LA 1ZVYB 1HEWA 4AKHA 5KXWA 1LZ1A 1LMNA 1RCMA 1C63A 2KW0A 3GLGE 4I7PA 1GBOA 1D3MA 5E6JA 2YDGA 1VDTA 2KRUA 2NTGA 5KXKA 1L28A 1YROA 2BAAA 223LA 1OKSA 2QCUA 169LA 3QAUA 2C98A 1L1ZA 3MJ5A 1OFIA 4ITQA 4I7LA 1IN7A 152LA 1JSFA 2MECA 2UUAM 2PC2A 2JWSA 1C6EA 4TTDA 4E97A 1I1ZA 2H5ZA 2RAZX 1FLUA 1UIAA 1IR9A 4OX9M 4REZA 4O34A 1PS5A 3FA0A 150LA 1BB3A 4NOOB 209LA 1IIZA 4G3OA 3L2XA 146LA 3L28A 2DAKA 4NL4H 2O25A 4ML7A 3SASA 197LA 2H9KA 111LA 1LSCA 2ZWBA 5KXRA 3HHZA 2C96A 1GF5A 1L00A 3C81A 5B1FA 1GB3A 3M7GA 2D4JA 1BB5A 3PNVA 2QZ4A 1LHKA 1PM5A 3N9EA 1R6BX 1Q02A 1W5SA 2XLJA 1L06A 3E9SA 4FWDA 1LJ4A 3NYAA 1GPQC 200LA 1BQLY 4IASA 4ZEEA 4I0CA 4CJ6A 1QUGA 1LZ5A 1L27A 1C60A 1T6OA 2B6YA 4P17A 251LA 3E21A 4DV6M 3HT7A 4JI4M 3ATOA 5D5CA 1T8GA 2DI0A 1C64A 3C7ZA 3ODUA 1P64A 4OVZA 1IP6A 241LA 2YBLA 1PGYA 4DT3A 2Z4SA 3W67A 4YENA 2HU1A 4DBGB 1LWGA 1OP9B 3HHWA 1IXRC 1L84A 1IC5Y 2B74A 196LA 3HUKA 4Q7JA 1L74A 2G4QA 4XENA 4WURA 3MK6A 3GLIA 3WL2A 1WQQA 3TQSA 3NWLA 1CU6A 1N75A 2QQ8A 2CV0A 1PJTA 4X3BA 5F14A 4LY6A 1LHLA 3B9PA 1G0KA 1FKVA 1GFVA 2H1RA 1BVXA 1UBZA 3GULA 1MJGM 4HEOA 4JI5M 255LA 4AKGA 3CF2A 2G4NA 1T8AA 1DYAA 1MX0A 1L77A 4DQ7A 2QBYA 2KA6B 1XJUA 1H6UA 5F3WA 2F5NA 1HMLA 1XXHE 4NSRA 2BQMA 4YEMA 1B9OA 4QHSA 1OUDA 4IJFA 3TMXA 2BQBA 3P68A 2VIIA 4MGKE 1LYDA 3M3UA 4XBOA 1JKDA 1YL1X 3IWRA 1AT6A 4UWNA 3U60B 1KIPC 2DQAA 2UXBM 1NY6A 1L21A 1NNJA 1IR8A 4TSCA 1QSWA 2YVBA 4NGYA 5KQ8A 3GP1A 1GVNA 1WQPA 1GHLA 3EIHA 4WM5A 4GLVA 1ZV5L 4ZPXA 4GITA 5ITQA 4K5YA 123LA 4A7DA 2K9DA 4QNRA 4ARMB 4AQNA 2MEDA 9LYZA 1FNNA 3SC3A 3SHFA 1LW9A 2CDSA 2BWBA 1LMQA 3W6AA 2I7NA 2JZ0A 1GEZA 1GFJA 2C9CA 2GNOA 3KW6A 4IBJA 2DNAA 1GE2A 2R0IA 1JKAA 4KXIA 1FKQA 1QQWA 1C43A 3RGPA 2X8AA 1P36A 3B89A 2F4AA 2O7AA 4ZPUA 2BJVA 2BWEA 3UK6A 2LVQD 3HHYA 1GFRA 4EJ4A 1N36M 5E4PA 5KKIA 4YY3M 1GFEA 3W0FA 5C1BA 1DI5A 2IFFY 2KNVA 1GF9A 1JR3A 3AZ6A 1C45A 4TUWA 4WLTA 1WVVA 3HU2A 4I7KA 2ERCA 221LA 4EOFA 4WW0A 3U6OA 2B7XA 1B2KA 1C6BA 206LA 1JSEA 3K9OA 1LYZA 3CT0A 3ZVQB 2RBPA 4LJ8A 1INUA 3SB5A 1L83A 1DYEA 2FYCA 3D8BA 1C62A 2ZNXY 1CJ9A 2BQDA 3SB9A 1NO1A 4ZIXA 5LINA 2LHGA 4WL6A 5FDJA 1TGUA 4WG1A 4YF2A 3D3DA 1CV6A 262LA 114LA 2Y21A 1QQYA 1OIZA 3J6KA 1XMQM 186LA 1GBWA 1ZAEA 1L10A 1G7LC 4LT2A 1C69A 171LA 1DGHB 4DV3M 158LA 4S0WA 1L01A 1QZMA 2JP7A 1JJ3A 1CKGA 4M9XA 4G4OA 222LA 2B6XA 3CDTA 3GPUA 3BOSA 149LA 1Z5CA 1GF6A 1OVKA 4PGJB 3E3DA 3TMWA 4DV0M 1IWZA 1IOTA 4MR1A 3ILKA 4LF7M 3HU8A 2LNHC 4NRVA 2VQFM 3AZ5A 1LTMA 3OTOM 4DR4M 4EPIA 1C6LA 1JTNA 5KXPA 1G0LA 3MHVC 4XJHA 4PRUA 4DQ5A 1L52A 4W94A 1E32A 4XJDA 1D9WA 1KW7A 1TH2A 2EKFA 1L64A 2XF3A 5FTKA 159LA 1UUZC 1SXJA 1C61A 1SSWA 3VDUA 4E3UA 1SG9A 5EXSA 4GRVA 4EIWA 1L44A 1NWGA 4MH0E 3DKEX 4J0LA 4L16A 1OJLA 1LI6A 2ZAOA 1W08A 4HTQA 3EIEA 2BQGA 3DMXA 1FJGM 3LZMA 1QIOA 2W82A 4IIWA 2L4EA 2ANVA 1G1VA 1NV9A 4A3VB 4MGIE 2G4PA 4LJ5A 128LA 1IP2A 1L0JA 2ZM6M 2JA2A 2VF7A 4DR5M 4QOZC 1LZCA 4H9FA 4D81A 4PRQA 4ET8A 1BGIA 2L2DA 1WTHA 1QUHA 3SYKA 1GXV2 4GEWA 3GUJA 3ULRA 5HNCA 5LYTA 3C7WA 3HY5A 4W56A 165LA 3LQQA 2B72A 5KXLA 3JR4A 2FE8A 2C5RA 4WM3A 4HLQA 4TWSA 1LZSA 2BQLA 2RBOA 1K3XA 1JITA 2CV2A 4TUNA 1KW5A 1L32A 4PHIA 141LA 3HX3A 4UN2B 1SLYA 4NSIA 2HUBA 3B7QA 3VDPA 4LCBA 4C5FA 4EKRA 1HEOA 1Z5BA 4JN6A 5C6IA 2EA0A 5I14A 2F32A 1PQOA 5LVHA 3LMMA 1CTWA 3PVSA 5FHWA 2QSFX 1NMMA 4DR6M 254LA 2DQDY 1CKCA 4DD9A 3A3RX 3GQ5A 2R46A 4XK8F 1HERA 1L22A 2FFJA 1UA6Y 122LA 2RBNA 5EXPA 1JWRA 4D9ZA 3K2LA 1C6FA 3GUMA 4AZFA 2D7HA 1D6PA 2DAGA 2OE7X 1L16A 1L26A 1JR3E 1HFZA 4B08A 215LA 1L55A 3V76A 1IOQA 2JZ1A 2Z19A 3SBBC 4WOAA 3R9XB 2ZAMA 232LA 2HEAA 4I5SA 1G7HC 1OUHA 2JY8A 1LMAA 3KAMA 2Q9EA 2D6BA 1L85A 3A6BY 212LA 4NG1A 1TBYA 1LGXA 1V7SA 4UWUA 4DKLA 3FI7A 1HEQA 2W1LA 4X62M 1UC0A 2YBJA 3T6UA 1DO0A 2BQAA 3WMKA 3WU9A 2Q2EB 1EL1A 1CV1A 1QTCA 144LA 1GFTA 1O23A 4LGYA 2CWBA 3UJNA 3EXDA 4B4EA 1QSAA 1P7SA 239LA 1NHBA 3DA1A 5BPVA 2LVOC 4RKUF 2MEGA 2CE7A 3M0EA 2LZMA 1OIPA 1L40A 3KXEC 1Q3BA 3TXJA 3UMMA 3QYBA 2XGNA 1N32M 1LZRA 1NDGC 1L76A 4YOPA 3A45A 3J7BA 2ZILA 1DGGA 4LG2A 4IBGA 1L33A 1OUFA 4KO8A 3GUNA 2DHYA 1REXA 2H9JA 5B05A 1QT4A 1YE9A 5IELA 1Z6TA 3HJSA 1P2CC 4J1AA 103LA 2XFSA 2D4IA 2R18A 3KP1E 1XXHB 5ILFA 3Q8GA 1P3NA 3F9LA 2MEAA 1QSQA 3KDSE 258LA 1OYUA 4Y28F 2MEBA 1Y8GA 3M6AA 4W5WA 4G4RA 1F6SA 3V2WA 4W57A 1IXSB 5KPRA 2CRUA 2YQZA 1N77A 1REMA 3G3WA 1PJIA 2KNAA 1L04A 4PT5A 1WQMA 3A46A 1XWIA 211LA 2NWDX 244LA 3DMVA 5DNYA 5I4XA 1IWXA 1QDRA 5IZ7D 257LA 5KXSA 4AQYM 1ZURA 2HECA 1GAYA 5KXNA 1LSEA 3LYMA 4HV2A 5JI3E 3CDRA 1DI4A 1L31A 1LZGA 1DZBX 4DR7M 1IP5A 3FUVA 3PBLA 5FTMA 1GB8A 1QSBA 3TXKA 4FWHA 2CWIA 4N1EI 3OE0A 5B1GA 2RB0X 3WW6A 1GKIA 2Z6BA 4M9SA 5KXTA 4WL7A 235LA 1LSBA 3SYLA 3HU9A 3SATA 3ZC7B 3W0LB 1C6AA
chains in the Genus database with same CATH topology
4L41A 4IJ4A 1UIGA 2IHLA 1K28A 1IWTA 1B7QA 1QT6A 3BKVA 2D4KA 1P2RA 1IWYA 5J7CA 1C6NA 1DKJA 4J7VA 1QTEA 1C6HA 1L38A 2LZ2A 1GXXA 1OUAA 4GLAA 2RBQA 2EKSC 2W1MA 3P65A 5LAFA 5JENB 1LPYA 1D6QA 1DPWA 1LMOA 2RSCA 4NSGA 205LA 1IOCA 4W52A 3HTDA 172LA 2X0AA 3A93A 1PQJA 147LA 1J1PY 2RBSA 1L11A 4NGWA 4WM1A 1GFHA 3SB8A 4I8SA 1XJTA 5HNLA 2D91A 225LA 3F6ZA 4KT3A 2EQLA 3LN2A 3LYTA 3HTGA 191LA 3HH3A 3QY4A 1VDSA 4H8XA 1GFKA 1HEPA 3DN8A 4KPMA 3OE6A 1EQ5A 1P37A 1IP7A 2A4TA 1GEVA 1LMPA 4NG8A 3WU8A 214LA 2YBNA 3B6LA 1PQDA 1L15A 2ZIJA 1IP3A 4AXTA 4NIJA 1GFUA 1LJNA 2B6WA 1C10A 4RLNA 1NDMC 115LA 1B7SA 1WTMA 1VDPA 2RBRA 1LHIA 3HBHA 3SBAA 4LDEA 1BHZA 1C6DA 1NQIA 4N9RA 3A91A 213LA 4N0JA 6LYTA 3GUIA 4HP0A 5L9JA 1CKFA 3AGGG 145LA 1LSMA 4HSFA 3A3QA 1OQMA 3G3VA 1VEDA 4H9HA 1OUBA 1AM7A 1XGTC 4CGEA 1GBYA 3P4ZA 2ZYCA 1LZBA 4I7SA 160LA 2WARA 1QS5A 1BB7A 1B5ZA 3HUAA 2MEFA 1L75A 3B0KA 3EBAB 1CU2A 2F2NA 6LYZA 1L37A 4GCBA 1LYOA 2LHMA 2I26L 1L34A 4G49A 4I7TA 130LA 3IJVA 167LA 2GV0A 125LA 3HTFA 3A34A 1HC0A 4G4CA 4P2EA 1AKIA 1PQKA 4Z98A 2N5ZA 3RZ4A 4H8YA 3J4GA 192LA 3C80A 1UCOA 1KS3A 4H91A 1LZTA 3ZEKA 3CSQA 185LA 1JTTL 5I54A 1G06A 1QTBA 148LE 4I7QA 1CX7A 1KY1A 151LA 1RJCB 1SSYA 102LA 3SB7A 1IEEA 1B7NA 2LZTA 2Q0MX 5IDDA 1L99A 4YXCA 1ZMYL 3A67Y 4DDBA 1L29A 4NHTA 230LA 175LA 2F4GA 1AZFA 1C6MA 1GBZA 2B6TA 3B0OA 248LA 1L36A 4CJ2A 4WMGA 1L86A 3ATNA 3WUMA 1L67A 1TEWA 2ZQ3A 2HTXA 1V7TA 1QT5A 252LA 1L12A 1L81A 4EKSA 2Q9DA 5LVJA 1L89A 4DD7A 2FBDA 2NTHA 2BQNA 2BPUA 1XFPL 3TXBA 236LA 4NGOA 4ETEA 193LA 138LA 3QE8A 3K3TA 4DAJA 1OWYA 1G0PA 3CDVA 3AZ4A 3HBDA 1JQUA 228LA 1IOSA 1XSFA 126LA 1G7IC 1L69A 3HH5A 4HPIA 1VFBC 4NSHA 3W3EA 4IATA 176LA 1PQMA 1EQEA 5AMYA 1NKHA 4NGKA 3HH4A 3CDQA 1GFAA 2IGCA 2BQKA 1VATA 1OV7A 4H1PA 4LT0A 1FDLY 1I56A 4ETAA 1FLWA 4QY9A 2YBIA 1D3FA 1L82A 2RB2X 3TXEA 2EIZC 1UIBA 1OVHA 4W96A 5B07A 4WM2A 3C8SA 4YEOA 135LA 5FEKA 2OU8A 1JTOL 1B5UA 1G0GA 5D5FA 2BQJA 1CV0A 1G0MA 1KXXA 1YKZX 199LA 4DD3A 1XEJA 1L23A 2XQOA 4R6CA 1L63A 5E9RA 3M18B 1DYBA 1L47A 1L87A 4ARQB 3WUAA 2LCBA 4LYOA 4DJHA 5LA5A 1C66A 3QNGA 4QEQA 4LT3A 4YX7C 4LGKA 5K7OA 1L58A 1UIFA 4LYBA 1GDXA 3C82A 3G3BB 1WVUA 1CV4A 4U3XB 195LA 1WTNA 3CDOA 2A7DA 259LA 1L95A 1YKXX 2LC9A 1QS9A 1T6HA 3CQLA 1L14A 3HBEX 190LA 1L50A 153LA 3WULA 174LA 1L71A 3UONA 1LOZA 4NHQA 1LYGA 1LYJA 2BLYA 4I7NA 4ARJA 4N8ZA 3N9AA 3RZEA 4G4BA 2DKVA 1YL0X 2O4WA 3HT8A 2LYZA 4EMNA 238LA 4LZTA 4HJVA 216LA 3AJNA 1HEMA 1GD6A 1VAUA 4NHIA 3D9AC 3GUOA 4HTKA 3NY8A 233LA 4ETCA 4I7JA 3WXUA 188LA 4DC4A 4GBRB 2C8OA 1C6PA 1C65A 155LA 1YAPA 4WO9A 4LFXA 3A8ZA 1XGUC 5LVIA 1YAOA 1GB0A 4CFPA 4UWVA 6LZMA 1LYHA 4J1BA 2Z39A 1UACY 1SX7A 1B7RA 1P5CA 1D3JA 5DN5A 1LZDA 4ARQA 5DN4A 4NGJA 1GB7A 1L79A 1L97A 3LYZA 4HJYA 4FJRA 1L90A 245LA 1C67A 1J1OY 3DN6A 256LA 1L61A 2XBSA 4EKPA 1L46A 1OUIA 1KIQC 2YBMA 129LA 3HDFA 2I6ZA 208LA 3RU5A 4RDSA 1QTDA 1GDWA 4MCKA 249LA 5F9UA 4I7MA 1B7LA 5EBHA 1ALCA 1LKRA 5LVGA 4WO6A 1IY4A 1L07A 2FBBA 4NGZA 4LZMA 2OU9A 108LA 4NWEA 4NGIA 1HMKA 1L02A 1GB9A 1LMTA 1BVKC 4QGZA 3WH1A 2Z2EA 3HWLA 198LA 4OOOA 1D3NA 4BAFA 1LSYA 1H6MA 5F16A 1IO5A 1D0LA 189LA 1CU5A 173LA 1OV5A 1FLYA 1L13A 1HF4A 2CUUA 3C7YA 1H87A 4NGLA 1REYA 3DN0A 1IP4A 2EPEA 1EPYA 1XGPC 3TXHA 2XJWA 1FBIX 1P6YA 1GBXA 4LT1A 1IX0A 2DQGY 1L39A 3NY9A 2ZQ4A 163LA 1BB6A 1P46A 2ZNWY 1LSDA 4M6DA 1QUDA 1T6VL 201LA 3JR6A 243LA 1IC4Y 1YKYX 3AB6A 1JKCA 217LA 2F47A 5FSTA 4OO9A 5ILCA 1IVMA 4DDAA 5C6JA 3SN6R 3K2RA 1L35A 1C6TA 5LXWA 1B5XA 2DQFC 1JJ1A 7LYZA 1L30A 5HQ1A 1PZYA 1HSXA 4EKQA 3TXFA 1LAAA 4RLMA 1L70A 1OWZA 3BKHA 1L20A 1LHJA 3HUQA 3RW8A 4LYMA 1QUTA 2OE9X 3MGWA 3DN3A 1LCNA 247LA 2BQEA 5B06A 5M1YA 1G7MC 1L65A 1HNLA 1DYDA 1YAQA 1CV5A 2HEBA 1C6GA 1LJIA 1C6CA 1MLCE 4G4HA 4HV1A 1J1XY 1LJKA 5KKJA 2HEDA 4LDOA 5L3HA 1GBSA 4QDNA 1B5VA 4BS7A 4TX7A 4OWEA 3G3XA 154LA 1LYSA 4CHXA 1B7PA 180LA 2F2QA 1GE4A 1LGUA 5DL9A 3TXGA 1F6RA 5KY1A 1L03A 1L53A 3A6CY 1TAYA 1B5YA 1QUSA 1L51A 1LJJA 1LZEA 1L43A 3WPJA 4DD2A 3VWOA 250LA 1YAMA 3P64A 4N1CC 1LJGA 110LA 1OUEA 3A92A 4ANRA 1LPIA 4R0FA 2HEEA 1LYEA 4YXAC 1DYCA 4BAPA 4GCEA 1DPXA 1L59A 1D0MA 4HPEA 4Z3MA 4ARPA 5DLAA 5LA8A 260LA 1NBYC 1A2YC 4H9IA 1C46A 1KNIA 3C83A 5APEA 2HEFA 2QARC 131LA 4H9BA 2CGIA 3A94A 4XJGA 4XADA 1L80A 1LWKA 2B6ZA 1GWDA 1JUGA 1LZYA 1D0KA 1L17A 170LA 2I25L 1CKHA 1NF5A 1L93A 1L88A 2BQCA 2MEIA 1GE0A 1YIKA 3FADA 1LYYA 3LZ2A 1GB5A 5FELA 3HTBA 4H92A 4PJZA 3OJPA 1MELL 134LA 1LI2A 3VW7A 3CT1A 1LI3A 5C6LA 1CV3A 3AGHA 4OWCA 4DYGA 4HJZA 234LA 1XGQC 3DN2A 3W6BA 1C6IA 2HU3A 4XJBA 1CU3A 1D2WA 1L68A 2LYOA 2W1YA 3A96A 3WVYA 184LA 1L18A 5APDA 3SB6A 4XJIA 1LZ4A 1QTHA 3W6EA 231LA 3WYHA 5HLLA 2OEAX 2B73A 3CSRA 4B49A 107LA 1L91A 1YANA 1LSFA 181LA 1E8LA 1GB2A 4WM4A 4W58A 3WVXA 1KIRC 1LJFA 2AUBA 2LYMA 4XN6A 1PQIA 1LZNA 3B72A 4NSJA 2Z18A 1GFGA 4I7OA 4H9AA 4DWXA 1SWYA 1L49A 1LSGA 1D2YA 2ZYPA 4PPOA 4B1AA 3GXKA 1L19A 1L72A 1IC7Y 194LA 4LYTA 157LA 1LYFA 1L57A 1LHHA 2YBHA 1WQRA 4H8ZA 1GF3A 4ETDA 1G7JC 112LA 3WU7A 1L60A 3SP3A 1L48A 1HENA 3C8RA 3CSZA 2Z38A 1QTZA 4CFOA 2YSSC 1IWUA 4Z41A 3A90A 1BWJA 8LYZA 1JIYA 1LSNA 1WQNA 4LYZA 1D9UA 1HELA 1ZYTA 5I4WA 4NY5A 4NWHA 1G0JA 2B70A 4FDYA 2XBRA 2ZIKA 127LA 1IP1A 1YILA 3W6DA 133LA 5FCPA 1B6IA 224LA 3PDSA 1A4VA 5A3ZA 1P2LA 4B4JA 1CU0A 1DYGA 1CX6A 5LYZA 1L45A 2DQEY 1F10A 2F30A 2OU0X 1JTPL 229LA 1UIEA 1L0KA 3G3AB 4W54A 1L24A 3T36A 3AW7A 3W6CA 3D4SA 4BADA 1C6JA 164LA 140LA 1DYFA 1L42A 2DQHY 1KXYA 3OK0A 3TXIA 1LLHA 2RH1A 3HT9A 1SQ2L 1GB6A 1DKKA 2A7FA 3GUPA 2FYDA 1B5WA 1NBZC 1OVJA 1G1WA 109LA 2Z12A 2ANXA 3HDEA 137LA 4H93A 119LA 3HFMY 4NGVA 4H94A 3F8VA 1GF8A 4GN5C 1CVKA 1LGWA 1L05A 261LA 1HFYA 178LA 118LA 2O79A 1CJ7A 3FI5A 1CJ6A 4W59A 4ARMA 3CB7A 4DDCA 1I20A 1WQOA 3B0IA 4B4IA 218LA 104LA 4H90A 1L09A 3AW6A 2HUMA 4OWAA 2QB0B 1SX2A 5LAGA 5LIOA 4G9SA 3TMVA 5APCA 1JKBA 1XEPA 3L64A 4NFVA 3A95A 7LZMA 3DNAA 5L3IA 3LYOA 1IWVA 4HTNA 2BQIA 1B7OA 1BB4A 1DQJC 3RUNA 2DQJY 1LSAA 3ZVQA 1I6SA 4PJ2C 1CKDA 1JJ0A 4ARLA 3EMLA 4N5RA 1TLAA 4GCFA 4M4OA 4GCDA 1LJHA 5LZMA 1QDTA 187LA 132LA 3N9CA 242LA 240LA 1AT5A 4W51A 1N4FA 1L66A 237LA 142LA 4LYCA 1B7MA 4B0DA 2B5ZA 1OUCA 1RE2A 162LA 4AGAA 2DQIY 246LA 3EO5A 2RAYX 4XJFA 1G07A 4RW1A 1VDQA 5KXMA 1C08C 1JEFA 4H9EA 2OE4X 3DN4A 3OE9A 1RI8B 1Z55A 1UICA 1DI3A 1LJ3A 2MEEA 1BWIA 2BQFA 143LA 4ZFPA 4WM6A 4W53A 210LA 4EPFA 4Z46A 5A3EA 4OWHA 5IHGA 1L41A 166LA 1L96A 1RFPA 4XYYA 4I7RA 3V2YA 1C7PA 1TCYA 4WG7A 3WPLA 1C6QA 4ET9A 4TSBA 4RW2A 5LYMA 3OE8A 168LA 1LZ6A 2DBTA 1LSZA 3GXRA 4PK0A 219LA 4KL7A 1GF0A 4II8A 2OTYX 2RB1X 120LA 1KXWA 253LA 1QT7A 4GN3A 3HH6A 5KJ9A 3LHMA 3WXTA 5F81A 5I53A 4DD0A 3TMUA 3W6FA 2Z2FA 2VB1A 1L08A 1L73A 226LA 1B0DA 1JPOA 1XGRC 1IY3A 2BLXA 4YM8A 1CJ8A 1L25A 3AGIA 3QAKA 1OUJA 1T8FA 1JHLA 5HMJA 2MEHA 1SWZA 4MSTA 1UIDA 4W55A 3AYQA 1QT3A 1LKSA 2L78A 1JTMA 2BQOA 4NEBA 4H9CA 1REZA 1HHLA 5II3A 1LZAA 1XEKA 4ETBA 4GCCA 3FE0A 5I4YA 5KXOA 4WLDA 1L54A 3WW5A 2OTZX 1JISA 5F9XA 1ZVHL 1F0WA 2C8PA 1L92A 2DQCY 1XEIA 3DN1A 1W6ZA 2B75A 1BWHA 139LA 183LA 5KXYA 1G0QA 1GF4A 1C68A 2W1XA 156LA 1LYIA 4OW1A 1FLQA 5LVKA 1NHEA 161LA 1YQVY 4LFPA 2HUKA 1HSWA 3HT6A 4LDLA 4OWBA 3WUNA 1GF7A 5HMVA 1QT8A 177LA 4OOTA 4GN4A 1QUOA 1L94A 1QTVA 4WLYA 1LJEA 1IORA 4NHSA 3DMZA 5DM9A 4EXMA 1DXJA 1GE3A 1EQ4A 227LA 2HULA 1CUQA 1FN5A 182LA 2Y8PA 4DD1A 1GAZA 2CJLA 3AZ7A 3P66A 1P56A 2Z37A 1LMCA 207LA 220LA 1IR7A 3LZTA 1HFXA 1LZ8A 5B59A 3C8QA 5APFA 1OUGA 3GUKA 113LA 2BQHA 5T3FA 1CUPA 1KY0A 3IJUA 4WLXA 5I5QA 4IAPA 1L98A 1T3PA 3RT5X 3TXDA 1LZ9A 1TDYA 2XTHA 1T97A 4DQJA 3EMSA 1CNSA 4C3WA 3CT5A 1L56A 1UIHA 4NHPA 1GE1A 1IWWA 3WPKA 5KXZA 1L62A 1ZWNA 3RNXA 1LSPA 1LHMA 5KXXA 1QTKA 1C6KA 1ZVYB 1HEWA 5KXWA 1LZ1A 1LMNA 1RCMA 1C63A 4I7PA 1GBOA 1D3MA 2YDGA 1VDTA 2NTGA 5KXKA 1L28A 1YROA 2BAAA 223LA 169LA 4I7LA 152LA 2MECA 1JSFA 2PC2A 1C6EA 4TTDA 4E97A 1I1ZA 2H5ZA 2RAZX 1FLUA 1UIAA 1IR9A 4O34A 1PS5A 3FA0A 150LA 1BB3A 209LA 1IIZA 3L2XA 146LA 4ML7A 197LA 2H9KA 111LA 1LSCA 2ZWBA 5KXRA 1GF5A 1L00A 3C81A 5B1FA 1GB3A 2D4JA 1BB5A 1LHKA 3N9EA 1L06A 3NYAA 1LJ4A 1GPQC 200LA 1BQLY 4IASA 4ZEEA 4I0CA 1QUGA 1LZ5A 1L27A 1C60A 2B6YA 251LA 5D5CA 3HT7A 3ATOA 1T8GA 1C64A 3C7ZA 3ODUA 1P64A 1IP6A 241LA 2YBLA 4DT3A 4YENA 2HU1A 1LWGA 1OP9B 1L84A 1IC5Y 2B74A 196LA 3HUKA 1L74A 2G4QA 4XENA 3WL2A 1WQQA 1CU6A 4X3BA 5F14A 1LHLA 1G0KA 1FKVA 1GFVA 1BVXA 1UBZA 3GULA 255LA 2G4NA 1T8AA 1DYAA 1L77A 4DQ7A 1XJUA 1HMLA 2BQMA 4YEMA 1B9OA 1OUDA 3TMXA 2BQBA 3P68A 1LYDA 3M3UA 1JKDA 1YL1X 3IWRA 1AT6A 4UWNA 1KIPC 2DQAA 1L21A 1IR8A 4TSCA 1QSWA 2YVBA 4NGYA 1WQPA 1GHLA 4WM5A 4GLVA 1ZV5L 4K5YA 123LA 4A7DA 4ARMB 4AQNA 2MEDA 9LYZA 1LW9A 2CDSA 1LMQA 3W6AA 1GEZA 1GFJA 1GE2A 1JKAA 4KXIA 1FKQA 1C43A 4ZPUA 1P36A 2F4AA 2O7AA 1GFRA 4EJ4A 5E4PA 5KKIA 1GFEA 1DI5A 2IFFY 1GF9A 3AZ6A 1C45A 4WLTA 1WVVA 4I7KA 221LA 4EOFA 2B7XA 1B2KA 1C6BA 206LA 1JSEA 1LYZA 3CT0A 3ZVQB 2RBPA 1INUA 3SB5A 1L83A 1DYEA 2FYCA 1C62A 2ZNXY 1CJ9A 2BQDA 3SB9A 4ZIXA 5LINA 5FDJA 4WL6A 4YF2A 4WG1A 3D3DA 1CV6A 262LA 114LA 1QQYA 3T6UA 3J6KA 186LA 1GBWA 1L10A 1G7LC 4LT2A 1C69A 171LA 158LA 4S0WA 1L01A 1JJ3A 1CKGA 222LA 2B6XA 3CDTA 149LA 1GF6A 1OVKA 4PGJB 3E3DA 3TMWA 1IWZA 1IOTA 4MR1A 3HU8A 3AZ5A 1LTMA 4EPIA 1C6LA 1JTNA 5KXPA 1G0LA 4XJHA 4PRUA 4DQ5A 1L52A 4W94A 4XJDA 1D9WA 1KW7A 1L64A 159LA 1UUZC 1C61A 1SSWA 4E3UA 4GRVA 1L44A 1NWGA 3DKEX 4J0LA 1LI6A 1W08A 4HTQA 2BQGA 3DMXA 3LZMA 1QIOA 2ANVA 1G1VA 2G4PA 128LA 1IP2A 1L0JA 1LZCA 4H9FA 4PRQA 4ET8A 1BGIA 1WTHA 1QUHA 1GXV2 3GUJA 3ULRA 5HNCA 5LYTA 3C7WA 4W56A 165LA 2B72A 5KXLA 4WM3A 4TWSA 1LZSA 2BQLA 2RBOA 1JITA 4TUNA 1KW5A 1L32A 4PHIA 141LA 1SLYA 4NSIA 2HUBA 4C5FA 4EKRA 1HEOA 5C6IA 5I14A 2F32A 1PQOA 5LVHA 1CTWA 5FHWA 2DQDY 1NMMA 254LA 1CKCA 4DD9A 3A3RX 1HERA 1L22A 1UA6Y 122LA 2RBNA 1JWRA 4D9ZA 1C6FA 3GUMA 1D6PA 2OE7X 1L16A 1L26A 1HFZA 215LA 1L55A 1IOQA 2Z19A 3SBBC 4WOAA 232LA 2HEAA 1G7HC 1OUHA 1LMAA 3KAMA 2Q9EA 2D6BA 1L85A 3A6BY 212LA 4NG1A 1TBYA 1LGXA 1V7SA 4UWUA 4DKLA 3FI7A 1HEQA 2W1LA 1UC0A 2YBJA 2BQAA 3WU9A 3WMKA 1EL1A 1CV1A 1QTCA 144LA 1GFTA 1O23A 3EXDA 4B4EA 1QSAA 1P7SA 239LA 1NHBA 2MEGA 2LZMA 1L40A 3TXJA 1LZRA 1NDGC 1L76A 4YOPA 2ZILA 1L33A 1OUFA 3GUNA 1REXA 2H9JA 5B05A 1QT4A 5IELA 1P2CC 4J1AA 103LA 2D4IA 5ILFA 1P3NA 3F9LA 2MEAA 1QSQA 258LA 1OYUA 2MEBA 3V2WA 1F6SA 4W57A 3G3WA 1REMA 1L04A 1WQMA 211LA 2NWDX 244LA 3DMVA 5I4XA 1IWXA 1QDRA 257LA 5KXSA 1ZURA 2HECA 1GAYA 5KXNA 1LSEA 3LYMA 4HV2A 3CDRA 1DI4A 1L31A 1LZGA 1DZBX 1IP5A 3PBLA 1GB8A 1QSBA 3TXKA 2CWIA 4N1EI 3OE0A 5B1GA 2RB0X 3WW6A 2Z6BA 5KXTA 4WL7A 235LA 1LSBA 3HU9A 1C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L41 A;  4IJ4 A;  2H9K A;  1UIG A;  4FJR A;  2IHL A;  1IWT A;  1J1O Y;  5LYZ A;  2DQE Y;  1LSC A;  1B7Q A;  1F10 A;  2ZWB A;  2XBS A;  2F30 A;  3BKV A;  5KXR A;  1OUI A;  2D4K A;  1KIQ C;  2YBM A;  1JTP L;  1UIE A;  2I6Z A;  1GF5 A;  208L A;  1IWY A;  5J7C A;  3G3A B;  1GB3 A;  5B1F A;  3T36 A;  1DKJ A;  2D4J A;  1BB5 A;  4RDS A;  3RU5 A;  4J7V A;  1QTE A;  3AW7 A;  1GDW A;  4MCK A;  3W6C A;  1LHK A;  2LZ2 A;  1GXX A;  1OUA A;  4GLA A;  4BAD A;  3N9E A;  5F9U A;  1B7L A;  1LJ4 A;  5EBH A;  2DQH Y;  2EKS C;  2W1M A;  1GPQ C;  3P65 A;  1BQL Y;  4IAS A;  1ALC A;  1LKR A;  4I0C A;  5LAF A;  4ZEE A;  5LVG A;  1KXY A;  1LZ5 A;  4WO6 A;  5JEN B;  1D6Q A;  1DPW A;  1LMO A;  1IY4 A;  2RSC A;  3OK0 A;  4NSG A;  3TXI A;  2FBB A;  1IOC A;  1SQ2 L;  5D5C A;  2X0A A;  3ATO A;  1GB6 A;  3A93 A;  4NGZ A;  1DKK A;  2A7F A;  1J1P Y;  2FYD A;  1IP6 A;  4NGW A;  2YBL A;  4WM1 A;  4DT3 A;  1GFH A;  1B5W A;  1NBZ C;  4YEN A;  2HU1 A;  4I8S A;  4NWE A;  4NGI A;  1OP9 B;  5HNL A;  1HMK A;  2D91 A;  3F6Z A;  4KT3 A;  1GB9 A;  1LMT A;  2EQL A;  1IC5 Y;  3LN2 A;  3LYT A;  2Z12 A;  2G4Q A;  4XEN A;  1BVK C;  4QGZ A;  3WH1 A;  2Z2E A;  3WL2 A;  1WQQ A;  3QY4 A;  4H93 A;  1VDS A;  3HFM Y;  1GFK A;  4H8X A;  4OOO A;  1HEP A;  4NGV A;  4BAF A;  4H94 A;  1LSY A;  1GF8 A;  1H6M A;  5F16 A;  4GN5 C;  1IO5 A;  4KPM A;  4X3B A;  1D0L A;  5F14 A;  1LHL A;  1EQ5 A;  1FKV A;  1GFV A;  1BVX A;  1UBZ A;  1HFY A;  1FLY A;  1IP7 A;  1GEV A;  1HF4 A;  1LMP A;  2G4N A;  4NG8 A;  3WU8 A;  1CJ7 A;  1CJ6 A;  1H87 A;  1HML A;  2YBN A;  3B6L A;  2ZIJ A;  4NGL A;  1IP3 A;  2BQM A;  4AXT A;  1B9O A;  1OUD A;  4YEM A;  3CB7 A;  4DDC A;  4NIJ A;  1REY A;  1I20 A;  1WQO A;  3TMX A;  3B0I A;  1IP4 A;  2BQB A;  2EPE A;  4B4I A;  1GFU A;  3P68 A;  1LJN A;  4H90 A;  1C10 A;  3M3U A;  4RLN A;  1JKD A;  1XGP C;  1YL1 X;  3AW6 A;  3TXH A;  3IWR A;  1AT6 A;  4UWN A;  2XJW A;  1NDM C;  4OWA A;  1KIP C;  2DQA A;  1FBI X;  5LIO A;  5LAG A;  1B7S A;  1GBX A;  1VDP A;  1WTM A;  4G9S A;  4LT1 A;  1LHI A;  1IR8 A;  3HBH A;  4TSC A;  1QSW A;  1BHZ A;  2YVB A;  4NGY A;  1IX0 A;  3TMV A;  5APC A;  1JKB A;  1NQI A;  4N9R A;  1WQP A;  3A91 A;  1GHL A;  4N0J A;  2DQG Y;  3A95 A;  4NFV A;  4WM5 A;  6LYT A;  2ZQ4 A;  1ZV5 L;  3LYO A;  4GLV A;  4HP0 A;  5L3I A;  5L9J A;  1BB6 A;  2ZNW Y;  1CKF A;  1IWV A;  3AGG G;  1LSD A;  4A7D A;  4HTN A;  4M6D A;  1LSM A;  1T6V L;  2BQI A;  1B7O A;  4HSF A;  3A3Q A;  1OQM A;  1BB4 A;  2MED A;  1IC4 Y;  9LYZ A;  1YKY X;  1VED A;  4H9H A;  3AB6 A;  1JKC A;  5FST A;  1OUB A;  1AM7 A;  1DQJ C;  1XGT C;  2CDS A;  4CGE A;  1LMQ A;  1GBY A;  3P4Z A;  2DQJ Y;  3W6A A;  2ZYC A;  1LZB A;  1LSA A;  5ILC A;  1GEZ A;  1GFJ A;  3ZVQ A;  4PJ2 C;  2WAR A;  1IVM A;  1GE2 A;  1BB7 A;  1JKA A;  4KXI A;  1B5Z A;  4DDA A;  5C6J A;  1FKQ A;  1CKD A;  1JJ0 A;  1C43 A;  2MEF A;  2F4A A;  3B0K A;  3EBA B;  4N5R A;  5LXW A;  1B5X A;  4GCF A;  2DQF C;  1JJ1 A;  1GFR A;  7LYZ A;  5E4P A;  4M4O A;  5HQ1 A;  1PZY A;  5KKI A;  1HSX A;  1GFE A;  4GCD A;  3TXF A;  1LAA A;  2F2N A;  4RLM A;  6LYZ A;  1DI5 A;  1LJH A;  5LYM A;  2IFF Y;  3BKH A;  1GF9 A;  3AZ6 A;  4GCB A;  1C45 A;  1QDT A;  1LHJ A;  1LYO A;  3RW8 A;  132L A;  1WVV A;  2I26 L;  2LHM A;  4LYM A;  4WLT A;  1QUT A;  3N9C A;  4G49 A;  3MGW A;  1AT5 A;  3IJV A;  1N4F A;  4EOF A;  2GV0 A;  1LCN A;  2BQE A;  4LYC A;  1B2K A;  3A34 A;  5B06 A;  1JSE A;  5M1Y A;  1G7M C;  1HC0 A;  1B7M A;  1LYZ A;  3CT0 A;  4G4C A;  3ZVQ B;  4B0D A;  4P2E A;  2B5Z A;  1AKI A;  1HNL A;  1INU A;  4Z98 A;  1OUC A;  2N5Z A;  1YAQ A;  3RZ4 A;  2HEB A;  4H8Y A;  1LJI A;  2FYC A;  3J4G A;  1RE2 A;  4AGA A;  2ZNX Y;  2DQI Y;  1CJ9 A;  2BQD A;  4ZIX A;  1UCO A;  1MLC E;  4G4H A;  4HV1 A;  5FDJ A;  4WL6 A;  4YF2 A;  5LIN A;  4WG1 A;  3D3D A;  3T6U A;  4H91 A;  1QQY A;  1LZT A;  3J6K A;  1J1X Y;  1GBW A;  1LJK A;  3ZEK A;  3CSQ A;  3EO5 A;  1G7L C;  5KKJ A;  4LT2 A;  2HED A;  4XJF A;  1JTT L;  5I54 A;  4RW1 A;  1VDQ A;  5KXM A;  1C08 C;  5L3H A;  1GBS A;  1JEF A;  4H9E A;  4QDN A;  1B5V A;  4BS7 A;  4TX7 A;  4OWE A;  154L A;  1LYS A;  1JJ3 A;  1CKG A;  4CHX A;  1RI8 B;  1Z55 A;  1B7P A;  1UIC A;  1DI3 A;  1LJ3 A;  2MEE A;  1BWI A;  1GE4 A;  5DL9 A;  1RJC B;  3TXG A;  1IEE A;  1F6R A;  2BQF A;  5KY1 A;  1B7N A;  2LZT A;  2Q0M X;  5IDD A;  3A6C Y;  4ZFP A;  1GF6 A;  1ZMY L;  4PGJ B;  4WM6 A;  3E3D A;  3TMW A;  1TAY A;  1B5Y A;  3A67 Y;  1QUS A;  4Z46 A;  1IWZ A;  1IOT A;  4DDB A;  4MR1 A;  4NHT A;  2F4G A;  1AZF A;  5A3E A;  1GBZ A;  1LJJ A;  4OWH A;  1LZE A;  3B0O A;  5IHG A;  1RFP A;  4XYY A;  1C7P A;  4CJ2 A;  4WMG A;  3AZ5 A;  1LTM A;  1TCY A;  3WPJ A;  4DD2 A;  3VWO A;  3ATN A;  5KXP A;  3WUM A;  1YAM A;  3P64 A;  4WG7 A;  4N1C C;  4XJH A;  3WPL A;  4PRU A;  4ET9 A;  1LJG A;  4TSB A;  1TEW A;  4W94 A;  2ZQ3 A;  4RW2 A;  1OUE A;  1V7T A;  4ANR A;  2HTX A;  3A92 A;  4XJD A;  1LZ6 A;  1LPI A;  2DBT A;  1LSZ A;  2HEE A;  4R0F A;  3GXR A;  4BAP A;  5LVJ A;  1UUZ C;  4GCE A;  1DPX A;  2FBD A;  4DD7 A;  2BQN A;  2BPU A;  1D0M A;  4HPE A;  1XFP L;  3TXB A;  4Z3M A;  4KL7 A;  4E3U A;  1GF0 A;  4II8 A;  4NGO A;  4ETE A;  193L A;  3QE8 A;  3K3T A;  5DLA A;  5LA8 A;  1KXW A;  4GN3 A;  1NWG A;  5KJ9 A;  3LHM A;  1NBY C;  3WXT A;  1A2Y C;  4J0L A;  1W08 A;  4HTQ A;  4H9I A;  3AZ4 A;  3HBD A;  5F81 A;  5I53 A;  4DD0 A;  1C46 A;  2BQG A;  5APE A;  3TMU A;  2HEF A;  1IOS A;  1XSF A;  2Z2F A;  3W6F A;  1QIO A;  2VB1 A;  4H9B A;  1B0D A;  1JPO A;  1XGR C;  1IY3 A;  1G7I C;  2CGI A;  3A94 A;  4HPI A;  2BLX A;  4XJG A;  4YM8 A;  1VFB C;  1CJ8 A;  4NSH A;  4XAD A;  3W3E A;  3AGI A;  2G4P A;  1GWD A;  1JUG A;  1LZY A;  1IP2 A;  1OUJ A;  4IAT A;  1JHL A;  1EQE A;  5AMY A;  5HMJ A;  1NKH A;  1D0K A;  4NGK A;  2I25 L;  1CKH A;  2MEH A;  1LZC A;  4MST A;  4H9F A;  1GFA A;  4PRQ A;  4ET8 A;  1BGI A;  1NF5 A;  1UID A;  1GXV 2;  2BQC A;  3AYQ A;  2MEI A;  1GE0 A;  3ULR A;  5HNC A;  1YIK A;  5LYT A;  1LYY A;  2BQK A;  3LZ2 A;  5KXL A;  1VAT A;  4H1P A;  1GB5 A;  4LT0 A;  1LKS A;  5FEL A;  4WM3 A;  4H92 A;  1FDL Y;  1I56 A;  4TWS A;  4ETA A;  1LZS A;  1FLW A;  2BQL A;  2BQO A;  4NEB A;  4QY9 A;  3OJP A;  1MEL L;  134L A;  1JIT A;  2YBI A;  4H9C A;  4PHI A;  4TUN A;  3CT1 A;  1REZ A;  1HHL A;  5C6L A;  3TXE A;  5II3 A;  1LZA A;  1SLY A;  2EIZ C;  1XEK A;  3AGH A;  4NSI A;  4ETB A;  4GCC A;  4OWC A;  2HUB A;  1UIB A;  4HJZ A;  3FE0 A;  4DYG A;  5I4Y A;  5KXO A;  4C5F A;  5B07 A;  1XGQ C;  4W96 A;  1HEO A;  4WLD A;  4WM2 A;  5C6I A;  4YEO A;  3W6B A;  3WW5 A;  135L A;  5FEK A;  1JIS A;  1JTO L;  1B5U A;  2HU3 A;  5F9X A;  1ZVH L;  1F0W A;  2C8P A;  4XJB A;  5LVH A;  2DQC Y;  1XEI A;  5D5F A;  2LYO A;  2W1Y A;  3A96 A;  2BQJ A;  5FHW A;  3WVY A;  1W6Z A;  1KXX A;  1NMM A;  2DQD Y;  1YKZ X;  1BWH A;  1CKC A;  4DD9 A;  3A3R X;  4DD3 A;  1HER A;  5APD A;  1UA6 Y;  5KXY A;  1XEJ A;  1JWR A;  4XJI A;  4D9Z A;  1GF4 A;  1LZ4 A;  2W1X A;  4R6C A;  1D6P A;  5E9R A;  3M18 B;  4OW1 A;  1FLQ A;  4ML7 A;  5LVK A;  1HFZ A;  3W6E A;  1NHE A;  1YQV Y;  4LFP A;  3WYH A;  1HSW A;  3WUA A;  5HLL A;  1IOQ A;  4LYO A;  5LA5 A;  2Z19 A;  3QNG A;  4QEQ A;  3CSR A;  4OWB A;  4WOA A;  1GF7 A;  4LT3 A;  3WUN A;  4B49 A;  2HEA A;  5HMV A;  1G7H C;  1OUH A;  1YAN A;  4LGK A;  1LMA A;  3KAM A;  5K7O A;  1LSF A;  4OOT A;  2D6B A;  3A6B Y;  4GN4 A;  4NG1 A;  1UIF A;  1TBY A;  1GB2 A;  4WM4 A;  1E8L A;  4WLY A;  1V7S A;  4LYB A;  4UWU A;  1KIR C;  3WVX A;  3FI7 A;  1GDX A;  1HEQ A;  1LJE A;  1LJF A;  2W1L A;  3G3B B;  1IOR A;  1UC0 A;  4NHS A;  2AUB A;  5DM9 A;  2YBJ A;  1WVU A;  2BQA A;  3WU9 A;  3WMK A;  1EL1 A;  2LYM A;  1GFT A;  4U3X B;  4XN6 A;  1O23 A;  1DXJ A;  1WTN A;  1GE3 A;  3EXD A;  4B4E A;  1EQ4 A;  1QSA A;  2A7D A;  1LZN A;  1YKX X;  3B72 A;  4NSJ A;  2Z18 A;  1GFG A;  5A3Z A;  3CQL A;  4H9A A;  4DWX A;  1FN5 A;  2Y8P A;  2MEG A;  4DD1 A;  1GAZ A;  1LSG A;  2CJL A;  3AZ7 A;  3P66 A;  3HBE X;  2Z37 A;  1LMC A;  207L A;  3TXJ A;  153L A;  1IR7 A;  2ZYP A;  3LZT A;  4PPO A;  3WUL A;  1HFX A;  4B1A A;  1LZ8 A;  1LZR A;  5B59 A;  1NDG C;  5APF A;  1LOZ A;  3GXK A;  4NHQ A;  1OUG A;  1IC7 Y;  194L A;  2BLY A;  4YOP A;  2ZIL A;  4N8Z A;  3N9A A;  4G4B A;  2BQH A;  5T3F A;  3IJU A;  4LYT A;  1OUF A;  2DKV A;  4WLX A;  1YL0 X;  5I5Q A;  1REX A;  2H9J A;  5B05 A;  2LYZ A;  5IEL A;  1P2C C;  4EMN A;  4J1A A;  2D4I A;  4LZT A;  1T3P A;  4HJV A;  5ILF A;  1LHH A;  2MEA A;  2YBH A;  3AJN A;  3RT5 X;  3TXD A;  1LZ9 A;  1TDY A;  1WQR A;  1HEM A;  1GD6 A;  2XTH A;  4H8Z A;  2MEB A;  1VAU A;  1F6S A;  1GF3 A;  3D9A C;  4NHI A;  4ETD A;  1G7J C;  4HTK A;  3EMS A;  1CNS A;  4C3W A;  3CT5 A;  1REM A;  3WU7 A;  4ETC A;  3WXU A;  1UIH A;  4NHP A;  3SP3 A;  1GE1 A;  1IWW A;  4DC4 A;  3WPK A;  1HEN A;  1WQM A;  2C8O A;  5KXZ A;  3CSZ A;  2Z38 A;  4CFO A;  2YSS C;  3RNX A;  1LSP A;  2NWD X;  1IWU A;  1LHM A;  5KXX A;  1YAP A;  4WO9 A;  1QTK A;  4Z41 A;  4LFX A;  3A8Z A;  1ZVY B;  3A90 A;  1HEW A;  5I4X A;  1IWX A;  5KXW A;  1QDR A;  1LZ1 A;  1XGU C;  1BWJ A;  5KXS A;  1LMN A;  8LYZ A;  2HEC A;  1RCM A;  5LVI A;  1YAO A;  1GAY A;  1GBO A;  2YDG A;  5KXN A;  1LSE A;  1VDT A;  1GB0 A;  1JIY A;  1LSN A;  3LYM A;  5KXK A;  4HV2 A;  1YRO A;  4UWV A;  1WQN A;  2BAA A;  4LYZ A;  4CFP A;  1DI4 A;  1LZG A;  1DZB X;  1IP5 A;  4J1B A;  1D9U A;  2Z39 A;  1UAC Y;  1B7R A;  1HEL A;  5I4W A;  4NY5 A;  1GB8 A;  3TXK A;  2MEC A;  1JSF A;  2CWI A;  5DN5 A;  1LZD A;  2PC2 A;  4NWH A;  4N1E I;  4TTD A;  1I1Z A;  2H5Z A;  4FDY A;  1FLU A;  5DN4 A;  1UIA A;  5B1G A;  1IR9 A;  2XBR A;  2ZIK A;  3WW6 A;  4NGJ A;  1IP1 A;  1YIL A;  3W6D A;  133L A;  4O34 A;  1GB7 A;  1PS5 A;  5FCP A;  5KXT A;  1BB3 A;  4WL7 A;  1IIZ A;  1LSB A;  1A4V A;  3LYZ A;  4B4J A;  4HJY A; 
#chains in the Genus database with same CATH topology
 4L41 A;  4IJ4 A;  2LH0 A;  1UIG A;  4JI1 M;  2IHL A;  1K28 A;  1IWT A;  4RF0 A;  3J80 S;  1B7Q A;  1QT6 A;  3BKV A;  2LVN C;  2D4K A;  1BVS A;  1P2R A;  2EJS A;  1IWY A;  5J7C A;  3U6L A;  1C6N A;  1DKJ A;  4J7V A;  1QTE A;  1C6H A;  1L38 A;  2LZ2 A;  1GXX A;  1OUA A;  4GLA A;  2RBQ A;  5LMU M;  2EKS C;  2W1M A;  3P65 A;  1VEJ A;  5DYG A;  3GO8 A;  5LAF A;  2LTU A;  2KDL A;  2LHC A;  5JEN B;  1LPY A;  3AFH A;  1D6Q A;  1DPW A;  1LMO A;  2RSC A;  4NSG A;  205L A;  2HHH M;  1HJP A;  1IOC A;  4GRI A;  3HTD A;  4W52 A;  172L A;  2X0A A;  3A93 A;  1NHG C;  1PQJ A;  147L A;  1J1P Y;  2RBS A;  2DZO B;  1RU3 A;  2MJ5 B;  2WSE F;  2YR0 A;  1L11 A;  4NGW A;  4WM1 A;  1GFH A;  3SB8 A;  4I8S A;  1XJT A;  5HNL A;  2D91 A;  225L A;  3F6Z A;  4KT3 A;  2EQL A;  1R2Z A;  3LN2 A;  3LYT A;  3HTG A;  191L A;  1V34 A;  3HH3 A;  3QY4 A;  1GO5 A;  2ZBK B;  1VDS A;  1GFK A;  4H8X A;  1HEP A;  3DN8 A;  4LRS A;  1NJF A;  3C3E A;  2DWL A;  4KPM A;  5KPT A;  1OAO C;  3OE6 A;  1EQ5 A;  1P37 A;  2MGW A;  4JV5 M;  4OVZ B;  1IP7 A;  2A4T A;  1GEV A;  4DV4 M;  1LMP A;  4NG8 A;  3WU8 A;  214L A;  2YBN A;  3B6L A;  1PQD A;  1L15 A;  2ZIJ A;  1IP3 A;  4AXT A;  4IBI A;  4NIJ A;  3GLI B;  3KOZ E;  1GFU A;  3H4M A;  1LJN A;  2B6W A;  1C10 A;  1NJG A;  1JQJ C;  4RLN A;  4GC5 A;  3C3D A;  4X65 M;  1NDM C;  3L27 A;  115L A;  2J5Y A;  2F5Q A;  1B7S A;  1WTM A;  1VDP A;  2RBR A;  1E9R A;  1LHI A;  3HBH A;  3SBA A;  3U6M A;  4LDE A;  1BHZ A;  2LBC A;  2V1C A;  1C6D A;  1NQI A;  4N9R A;  3A91 A;  213L A;  4N0J A;  1G4A E;  6LYT A;  2VF8 A;  2L7I A;  4FCT A;  1HR0 M;  3LW5 F;  2QBY B;  3GUI A;  2MR9 A;  4HP0 A;  5L9J A;  1CKF A;  3AGG G;  4G4Q A;  145L A;  4R71 A;  4OW0 A;  1LSM A;  4HSF A;  3A3Q A;  1OQM A;  3G3V A;  3TE6 A;  1WGL A;  1VED A;  4H9H A;  1OUB A;  1AM7 A;  1XGT C;  3FE3 A;  4CGE A;  1GBY A;  1TTE A;  3P4Z A;  2ZYC A;  1LZB A;  1IM2 A;  4I7S A;  4L8R C;  3VFD A;  3U6P A;  160L A;  2WAR A;  1QS5 A;  1BB7 A;  3AOE C;  1B5Z A;  3L25 A;  3HUA A;  2MEF A;  4LJA A;  1L75 A;  3B0K A;  3EBA B;  2WSF F;  2APL A;  1G8P A;  1CU2 A;  2F2N A;  6LYZ A;  1L37 A;  4GCB A;  2M60 A;  1LYO A;  2LHM A;  1IY0 A;  2I26 L;  3HKP A;  1L34 A;  4G49 A;  3T15 A;  4I7T A;  130L A;  3KS4 A;  3IJV A;  4LF5 M;  167L A;  2GV0 A;  125L A;  3HTF A;  3A34 A;  3KOY E;  1HC0 A;  4G4C A;  1Z5A A;  4P2E A;  1AKI A;  1Q39 A;  1JR3 D;  1PQK A;  4Z98 A;  2N5Z A;  3RZ4 A;  4H8Y A;  3J4G A;  192L A;  3C80 A;  4NC6 A;  4FCW A;  1UCO A;  3FRH A;  1KS3 A;  4LF8 M;  4H91 A;  1LZT A;  3ZEK A;  4DR1 M;  3CSQ A;  185L A;  3KP0 E;  1JTT L;  5I54 A;  3PNY A;  1G06 A;  1XB2 B;  1T3T A;  1QTB A;  148L E;  4I7Q A;  3HHX A;  1CX7 A;  4FW9 A;  2JY5 A;  5ITX A;  1KY1 A;  2LVP C;  151L A;  2KEB A;  2G5G X;  1RJC B;  1SSY A;  102L A;  3SB7 A;  1IEE A;  1HT1 E;  1B7N A;  2LZT A;  2Q0M X;  5IDD A;  1L99 A;  4YXC A;  1ZMY L;  2X49 A;  3A67 Y;  4KHP M;  4D82 A;  4DDB A;  1L29 A;  2DZN B;  4NHT A;  230L A;  4CGY B;  175L A;  2F4G A;  1AZF A;  1C6M A;  1GBZ A;  1IBK M;  2B6T A;  4S12 A;  3B0O A;  1TF0 B;  248L A;  1L36 A;  4CJ2 A;  4WMG A;  3FUW A;  3IEC A;  1L86 A;  4GMQ A;  3ATN A;  2FS1 A;  3WUM A;  3PFI A;  1L67 A;  1TEW A;  2ZQ3 A;  1V7T A;  2HTX A;  1QT5 A;  252L A;  1L12 A;  1L81 A;  4EKS A;  1L2C A;  2Q9D A;  5LVJ A;  1L89 A;  4LZZ A;  4DD7 A;  2FBD A;  2NTH A;  2BQN A;  2BPU A;  1XFP L;  3TXB A;  5EP2 A;  236L A;  4LGM A;  4NGO A;  4ETE A;  193L A;  138L A;  3QE8 A;  3VLF B;  3K3T A;  4DAJ A;  4GKK M;  3I04 M;  1OWY A;  1HNZ M;  1G0P A;  3KOX E;  3CDV A;  3AZ4 A;  3HBD A;  1JQU A;  3LCV B;  1SXJ D;  1L2D A;  228L A;  4LJ7 A;  1IOS A;  1AIP C;  2R6F A;  1XSF A;  126L A;  4JI0 M;  3VKG A;  1G7I C;  1L69 A;  3HH5 A;  4HPI A;  1L8Q A;  1VFB C;  4NSH A;  4NRW A;  3W3E A;  4JI3 M;  4IAT A;  1SXJ B;  176L A;  2L7H A;  1PQM A;  1EQE A;  5AMY A;  3BXW A;  1NKH A;  4NGK A;  3HH4 A;  3CDQ A;  4KLN A;  2XZU A;  1GFA A;  3ZQJ A;  1QZE A;  2OOA A;  2DWN A;  2F5O A;  2IGC A;  4B3T M;  4NXM M;  2BQK A;  2B3T A;  1VAT A;  1OV7 A;  4H1P A;  4LT0 A;  2R4J A;  4JI7 M;  1FDL Y;  1I56 A;  4ETA A;  3GLH A;  1FLW A;  4QY9 A;  4QNM A;  1D3F A;  2YBI A;  1VDL A;  1L82 A;  1VDD A;  5ITT A;  2RB2 X;  3TXE A;  4M9Z A;  2EIZ C;  1DGF A;  2HWJ A;  1UIB A;  1OVH A;  4W96 A;  5B07 A;  3CF6 E;  1KYI A;  4WM2 A;  3C8S A;  4YEO A;  4FCV A;  4CIS A;  135L A;  1I94 M;  5FEK A;  2OU8 A;  1JTO L;  1B5U A;  3KSJ A;  4IBB A;  3GQ3 A;  4IBC A;  1G0G A;  5D5F A;  4MGY E;  3L26 A;  2QNJ A;  2Z4R A;  3QWL A;  1CV0 A;  3TPZ A;  2BQJ A;  1G0M A;  1KXX A;  1YKZ X;  199L A;  4DD3 A;  4L4U A;  2JY6 B;  1XEJ A;  1L23 A;  3KFU G;  3J2P B;  2XQO A;  4R6C A;  1L63 A;  5E9R A;  3M18 B;  1DYB A;  1L47 A;  1L87 A;  4ARQ B;  1OTR A;  3WUA A;  2LCB A;  4LYO A;  4DJH A;  5LA5 A;  2FH0 A;  1C66 A;  2UXD M;  3QNG A;  4QEQ A;  2KHH A;  4LT3 A;  4YX7 C;  1HQC A;  4LGK A;  5K7O A;  1L58 A;  4CHT B;  1UIF A;  5KQD A;  4LYB A;  1QAO A;  1GDX A;  3C82 A;  3G3B B;  1WVU A;  1CV4 A;  2DAM A;  4U3X B;  195L A;  3A98 B;  5GKN A;  2HKJ A;  3T38 A;  3ZCB B;  1WTN A;  3CDO A;  2A7D A;  259L A;  1R7R A;  1G59 A;  1L95 A;  1YKX X;  1GL7 A;  1S3S A;  3VKH A;  2LC9 A;  1QS9 A;  1T6H A;  3CQL A;  3SFZ A;  2DXI A;  4F1I A;  1L14 A;  3HBE X;  2YFQ A;  4D80 A;  190L A;  1L50 A;  153L A;  3WUL A;  3Q8X A;  4LFA M;  1NV8 A;  2ZTD A;  174L A;  1L71 A;  3UON A;  1LOZ A;  4NHQ A;  1LYG A;  1LYJ A;  2BLY A;  4I7N A;  4ARJ A;  4N8Z A;  3N9A A;  3RZE A;  4G4B A;  2HCB A;  1IN6 A;  3GLI E;  2DKV A;  1YL0 X;  2O4W A;  2CEA A;  3HT8 A;  2A5Y B;  2LYZ A;  4EMN A;  238L A;  2RKO A;  4LZT A;  3WHK A;  4HJV A;  216L A;  2L4F A;  3AJN A;  1MU5 A;  1TR8 A;  1HEM A;  1NY5 A;  1GD6 A;  1VAU A;  4NHI A;  3D9A C;  3GUO A;  4HTK A;  3NY8 A;  233L A;  1QAQ A;  3IHP A;  4ETC A;  2CHG A;  4I7J A;  3WXU A;  188L A;  2VDB B;  4DC4 A;  4GBR B;  5KO3 A;  3SHG B;  2C8O A;  1C6P A;  2MH8 A;  1C65 A;  155L A;  1YAP A;  4WO9 A;  3PXG A;  3C9P A;  4LFX A;  3A8Z A;  1XGU C;  5LVI A;  1YAO A;  4LZJ A;  2V1U A;  4FWG A;  1XC8 A;  3C58 A;  2P5T A;  1GB0 A;  5L8R F;  4CFP A;  4UWV A;  6LZM A;  1LYH A;  1VEG A;  4IBF A;  3SAR A;  4J1B A;  2UUC M;  2Z39 A;  1UAC Y;  1SX7 A;  2NQ8 C;  1B7R A;  4QOS A;  3FRI A;  1P5C A;  1D3J A;  5DN5 A;  1LZD A;  4ARQ A;  1VEK A;  3AOG A;  3LCU A;  5DN4 A;  3K1J A;  4NGJ A;  1TDZ A;  1GB7 A;  1L79 A;  1L97 A;  4LF4 M;  1YLA A;  4GIP A;  2FOI C;  2K47 A;  3AOE A;  3LYZ A;  4HJY A;  3HU3 A;  2JNH A;  4FJR A;  1L90 A;  245L A;  1C67 A;  3B7Z A;  2C99 A;  1J1O Y;  4PD2 A;  3GLH E;  3DN6 A;  256L A;  1L61 A;  2XBS A;  4NXN M;  4EKP A;  2EO2 A;  1L46 A;  1OUI A;  1KIQ C;  2YBM A;  129L A;  3HDF A;  2I6Z A;  208L A;  2F4V M;  2OQ4 A;  3RU5 A;  4RDS A;  1QTD A;  1GDW A;  4MCK A;  3A42 A;  249L A;  5F9U A;  4I7M A;  1B7L A;  5EBH A;  1GJT A;  1GAB A;  1ALC A;  1LKR A;  5LVG A;  4WO6 A;  4XGI A;  1IY4 A;  1HQY E;  1N34 M;  2BJW A;  1L07 A;  2FBB A;  3DFZ A;  4HL4 A;  4P16 A;  1VQ1 A;  4NGZ A;  4LZM A;  7CAT A;  1PJQ A;  2JUJ A;  1XHB A;  2OU9 A;  108L A;  2CUZ A;  5H37 D;  4BLC A;  4B7G A;  4NWE A;  4NGI A;  1HMK A;  1L02 A;  3CGW A;  1GB9 A;  1LMT A;  1BVK C;  4QGZ A;  3WH1 A;  1IFY A;  2Z2E A;  3GLF A;  3HWL A;  198L A;  5KPZ A;  4OOO A;  1D3N A;  2HL7 A;  4BAF A;  2I7P A;  1LSY A;  1H6M A;  5F16 A;  1IO5 A;  1D0L A;  189L A;  1CU5 A;  4B3R M;  173L A;  1IN5 A;  2Z7J A;  4NSO B;  4R3D A;  1OV5 A;  1FLY A;  1L13 A;  1HF4 A;  2CUU A;  3C7Y A;  2YNM D;  3TWL A;  4YHH M;  4JI8 M;  1H87 A;  4NGL A;  4Z8X A;  1X37 A;  2KXE A;  1IQP A;  1REY A;  3DN0 A;  1IP4 A;  2EPE A;  1EPY A;  1Z59 A;  1XGP C;  1OAI A;  3TXH A;  1IN4 A;  2XJW A;  1FBI X;  1P6Y A;  1GBX A;  1SXJ E;  1IY1 A;  2AHM A;  3THG A;  4LT1 A;  3GLG A;  1IX0 A;  2DQG Y;  1J5E M;  1L39 A;  3NY9 A;  1IY2 A;  163L A;  2ZQ4 A;  3JR5 A;  1BB6 A;  1P46 A;  2ZNW Y;  4DR3 M;  1LSD A;  4M6D A;  1QUD A;  1T6V L;  201L A;  3JR6 A;  3HGI A;  243L A;  1IC4 Y;  2E5L M;  1YKY X;  3AB6 A;  1JKC A;  2XSZ A;  217L A;  2F47 A;  5FST A;  2D7E A;  4OO9 A;  4LF6 M;  1E94 E;  4WP2 A;  1NVM A;  5ILC A;  1IVM A;  3U61 A;  4DDA A;  5C6J A;  2K6B A;  3SN6 R;  3K2R A;  3L2A A;  2UUB M;  1L35 A;  1C6T A;  5LXW A;  1B5X A;  1PRB A;  2R45 A;  1JJ1 A;  2DQF C;  5ITY A;  1L30 A;  7LYZ A;  5HQ1 A;  1PZY A;  3NBI A;  1HSX A;  4EKQ A;  3TXF A;  1LAA A;  1OFH A;  4RLM A;  1L70 A;  2WZJ A;  1OWZ A;  3BKH A;  1L20 A;  1LHJ A;  3HUQ A;  2LVA A;  3CTW B;  3RW8 A;  2HAK A;  4LYM A;  1QUT A;  3GPY A;  3FTF A;  2OE9 X;  3MGW A;  1WGN A;  1R4G A;  3DN3 A;  1LCN A;  247L A;  2BQE A;  1WR1 B;  3IG5 A;  4RNA A;  3T6P A;  1QAM A;  4DV7 M;  5B06 A;  5M1Y A;  1UFZ A;  1G7M C;  1L65 A;  1HNL A;  3K9P A;  1DYD A;  1CUK A;  1YAQ A;  1CV5 A;  2HEB A;  1C6G A;  3UZU A;  1LJI A;  1LV7 A;  1C6C A;  4KOD A;  1MLC E;  4G4H A;  4HV1 A;  4DUY M;  4OU7 A;  4IBK A;  1J1X Y;  1LJK A;  1HNX M;  4I81 A;  5KKJ A;  2HED A;  4AG5 A;  4Z6Y A;  4LDO A;  2FNA A;  2F5S A;  5L3H A;  1GBS A;  4QDN A;  1B5V A;  4BS7 A;  4TX7 A;  4OWE A;  3G3X A;  154L A;  2BNK A;  1LYS A;  4CHX A;  3FTE A;  1B7P A;  180L A;  2F2Q A;  1GE4 A;  2XEP A;  1LGU A;  5DL9 A;  3TXG A;  4K0K M;  1F6R A;  3WHL A;  5KY1 A;  1L03 A;  2C9O A;  3JAM S;  1L53 A;  3A6C Y;  1TAY A;  4LJ9 A;  3U6D A;  1B5Y A;  1QUS A;  5C18 A;  2J7O A;  1L51 A;  4BB9 A;  1LJJ A;  3GPX A;  1LZE A;  3SBJ A;  3VK8 A;  2QPA A;  2JXN A;  4QHT A;  1L43 A;  3WPJ A;  4DD2 A;  5FLX S;  3VWO A;  250L A;  1YAM A;  3P64 A;  4LRT A;  4N1C C;  1LJG A;  2LWX A;  110L A;  1OUE A;  3A92 A;  4ANR A;  3U6E A;  1LPI A;  4R0F A;  2HEE A;  1LYE A;  4YXA C;  1DYC A;  4BAP A;  4GCE A;  1DPX A;  1L59 A;  1D0M A;  4HPE A;  4Z3M A;  3FTD A;  3SMS A;  4ARP A;  5DLA A;  5LA8 A;  8CAT A;  1GJS A;  3R8F A;  2KNZ A;  260L A;  1NBY C;  1A2Y C;  5DFL A;  4H9I A;  3AL0 C;  4AW4 A;  1C46 A;  1KNI A;  5EP1 A;  3C83 A;  2HEF A;  5APE A;  2QAR C;  131L A;  4H9B A;  4X66 M;  2CGI A;  3A94 A;  4XJG A;  4AG6 A;  3LQR A;  1ORY B;  4XAD A;  5LMN M;  1L80 A;  1LWK A;  2B6Z A;  1GWD A;  1JUG A;  1LZY A;  3TWM A;  1ZMW A;  4DUZ M;  1D0K A;  1L17 A;  170L A;  2I25 L;  2EKK A;  1CKH A;  2GQF A;  1NF5 A;  1KSF X;  1L93 A;  1L88 A;  2BQC A;  2MEI A;  1GE0 A;  1YIK A;  3FAD A;  1LYY A;  3QYE A;  3W68 A;  3LZ2 A;  1GB5 A;  5FEL A;  3HTB A;  4H92 A;  4JI6 M;  2DAI A;  1T43 A;  4PJZ A;  3OJP A;  1MEL L;  134L A;  1LI2 A;  3VW7 A;  3CT1 A;  1LI3 A;  1IBM M;  5C6L A;  1CV3 A;  3AGH A;  4OWC A;  3U6S A;  4DYG A;  4HJZ A;  234L A;  1XGQ C;  3DN2 A;  2OO9 A;  3W6B A;  1C6I A;  2HU3 A;  4II7 A;  1J7K A;  2Y20 A;  4IBD A;  4XJB A;  1CU3 A;  4LFC M;  1D2W A;  1L68 A;  2LYO A;  2W1Y A;  3A96 A;  3ZH9 B;  4R7G A;  3WVY A;  5EXT A;  184L A;  3GLH B;  4I4L A;  2UXC M;  2DKL A;  2RRU A;  1F4I A;  1MN3 A;  5EP4 A;  1L18 A;  5APD A;  3SB6 A;  4XJI A;  3KOW E;  2CFO A;  1IBL M;  1LZ4 A;  1QTH A;  4DV5 M;  3W6E A;  231L A;  1OQY A;  4IJE A;  3WYH A;  5HLL A;  1J09 A;  2OEA X;  2B73 A;  3CSR A;  1XNR M;  107L A;  4B49 A;  5FTN A;  3I01 M;  4BBA A;  1L91 A;  1C7Y A;  1YAN A;  1TDH A;  1LSF A;  181L A;  4M0W A;  1E8L A;  1GB2 A;  4WM4 A;  1W5T A;  2OOB A;  4W58 A;  3WVX A;  1KIR C;  4PDG A;  2O01 F;  1LJF A;  2AUB A;  2RGO A;  2LYM A;  4XN6 A;  1NHW C;  3I4V A;  2DVW B;  2CHQ A;  1PQI A;  3IG8 A;  4IBE A;  1LZN A;  3B72 A;  4NSJ A;  2Z18 A;  3RFW A;  1GFG A;  2M5Z A;  4I7O A;  3KVW A;  4H9A A;  4DWX A;  1SWY A;  1L49 A;  1LSG A;  4PDI A;  2DWM A;  1D2Y A;  2DWZ B;  2KZU A;  2ZYP A;  4PPO A;  4B1A A;  3GXK A;  1L19 A;  1GLN A;  1L72 A;  1IC7 Y;  4GHA A;  194L A;  4LYT A;  157L A;  1LYF A;  2R65 A;  3NBX X;  3GRY A;  1L57 A;  2G3Q A;  1LHH A;  2YBH A;  3DZD A;  1WQR A;  4H8Z A;  2EUC A;  1GF3 A;  4ETD A;  1G7J C;  112L A;  2ZTC A;  5E26 A;  3WU7 A;  4L78 A;  1L60 A;  4L6V 6;  3SP3 A;  4MM3 B;  1L48 A;  5EP3 A;  1HEN A;  3C8R A;  3CSZ A;  2Z38 A;  1QTZ A;  4CFO A;  3TL4 X;  2YSS C;  1IWU A;  2JY7 A;  4Z41 A;  4B3S M;  3A90 A;  3UGJ A;  1BWJ A;  8LYZ A;  3GQ4 A;  3AJI B;  1JIY A;  1LSN A;  1WQN A;  4LYZ A;  3SAV A;  3GPP A;  1D9U A;  1HEL A;  1ZYT A;  5I4W A;  4G6Z A;  4NY5 A;  1TH4 A;  4NWH A;  2KZS A;  1G0J A;  2B70 A;  4FDY A;  2XBR A;  2ZIK A;  127L A;  1IP1 A;  1YIL A;  3W6D A;  133L A;  5FCP A;  5FTJ A;  1B6I A;  224L A;  3PDS A;  1A4V A;  5A3Z A;  1P2L A;  4B4J A;  1CU0 A;  1DYG A;  4AI6 A;  1DV0 A;  1CX6 A;  5LYZ A;  1L45 A;  2DQE Y;  1F10 A;  2XH9 A;  3L29 A;  2F30 A;  4X64 M;  2OU0 X;  1JTP L;  229L A;  1UIE A;  1L0K A;  3G3A B;  4W54 A;  1L24 A;  3T36 A;  3U6C A;  3AW7 A;  3W6C A;  3D4S A;  1KFV A;  4BAD A;  1EFU B;  1C6J A;  164L A;  3FUU A;  1V33 A;  140L A;  1EIJ A;  1DYF A;  1L42 A;  2DQH Y;  2XFT A;  1KXY A;  3OK0 A;  3TXI A;  2LXE A;  3FYC A;  1LLH A;  2RH1 A;  3HT9 A;  1SQ2 L;  1UM8 A;  1GB6 A;  4PCZ A;  1DKK A;  2A7F A;  3GUP A;  2FYD A;  4DV2 M;  1B5W A;  1NBZ C;  5EJC A;  1OVJ A;  1G1W A;  109L A;  4GHL A;  1ZMV A;  5FSW A;  2Z12 A;  5JI2 E;  1NNU C;  2ANX A;  3HDE A;  5ITX E;  137L A;  4H93 A;  119L A;  3HFM Y;  3GRV A;  4NGV A;  1AUA A;  4B7F A;  2X4A A;  3F8V A;  4JXJ A;  1GF8 A;  4H94 A;  3U60 A;  3F92 A;  4GN5 C;  1CVK A;  1LGW A;  1L05 A;  261L A;  4GC9 A;  1HFY A;  178L A;  118L A;  2O79 A;  1V92 A;  5DYI A;  4JYA M;  1QYR A;  1CJ7 A;  3FI5 A;  4LJ4 A;  1CJ6 A;  4W59 A;  4ARM A;  1G71 A;  3CB7 A;  4DDC A;  4MGZ E;  1I20 A;  1WQO A;  3GLF B;  3B0I A;  4B4I A;  4L15 A;  218L A;  104L A;  4H90 A;  1L09 A;  3AW6 A;  2HUM A;  4OWA A;  2QB0 B;  1SX2 A;  1NSF A;  5LAG A;  5LIO A;  4G9S A;  3KSX A;  3TMV A;  5APC A;  1JKB A;  1XEP A;  3L64 A;  4NFV A;  2UU9 M;  3A95 A;  3DNA A;  7LZM A;  5L3I A;  3LYO A;  2L09 A;  1I4W A;  1IWV A;  2Z8Y M;  4HTN A;  2BQI A;  1B7O A;  1BB4 A;  4G4N A;  2V6Z M;  4GKJ M;  1DQJ C;  1K3W A;  3RUN A;  2DQJ Y;  1JB0 F;  1LSA A;  3ZVQ A;  1I6S A;  4PJ2 C;  3FUT A;  2CV1 A;  3GLG B;  1CKD A;  1JJ0 A;  1IN8 A;  4ARL A;  3EML A;  4N5R A;  1TLA A;  2XSZ D;  4GCF A;  3J27 B;  4M4O A;  2DZL A;  3HJ8 A;  4GCD A;  2CHV A;  1ZMU A;  1LJH A;  2QEN A;  5LZM A;  1QDT A;  187L A;  2DAE A;  132L A;  1K82 A;  3SMP A;  2R4E A;  3N9C A;  242L A;  240L A;  1DGH A;  1AT5 A;  4W51 A;  1N4F A;  1L66 A;  237L A;  1WHC A;  4M0D A;  142L A;  4LYC A;  2CP8 A;  4MB7 A;  3T1H M;  1B7M A;  4B0D A;  1PJS A;  3U61 B;  2B5Z A;  1OUC A;  1HT2 E;  1RE2 A;  162L A;  4AGA A;  2DQI Y;  3T1Y M;  2J7N A;  1QVR A;  246L A;  3EO5 A;  2RAY X;  3SAU A;  1G07 A;  4XJF A;  4RW1 A;  1VDQ A;  1R2Y A;  5KXM A;  1C08 C;  1JEF A;  4H9E A;  4LF9 M;  2OE4 X;  3J7A S;  4CIZ A;  3DN4 A;  3OE9 A;  1RI8 B;  4MGH A;  1Z55 A;  4RF1 A;  3B7N A;  1UIC A;  1DI3 A;  1LJ3 A;  2MEE A;  1BWI A;  1E9S A;  3U6Q A;  2BQF A;  4B3M M;  143L A;  3I51 A;  4ZFP A;  4WM6 A;  4W53 A;  3RGS A;  210L A;  4EPF A;  5A2Q S;  4Z46 A;  4LFB M;  2QHO B;  5A3E A;  4GH9 A;  3KS8 A;  4OWH A;  3HZJ A;  5IHG A;  1L41 A;  166L A;  5IRE B;  1L96 A;  1RFP A;  2R62 A;  4I7R A;  4XYY A;  1C7P A;  3V2Y A;  1C1K A;  1TCY A;  4WG7 A;  3U5Z B;  3WPL A;  2H5X A;  1C6Q A;  4ET9 A;  4TSB A;  4RW2 A;  5LYM A;  3AV0 A;  168L A;  1L2B A;  1LZ6 A;  4DV1 M;  2DBT A;  1LSZ A;  3OE8 A;  3GXR A;  1WXQ A;  4AKI A;  1XNQ M;  4PK0 A;  1N78 A;  219L A;  4KL7 A;  1GF0 A;  3H4J A;  4II8 A;  2OTY X;  2RB1 X;  1DGB A;  120L A;  1KXW A;  253L A;  1QT7 A;  4GN3 A;  3HH6 A;  2MRO B;  3LHM A;  5KJ9 A;  3WXT A;  2VQE M;  5F81 A;  5I53 A;  4DD0 A;  3J81 S;  5EQT A;  3TMU A;  5EXX A;  3W6F A;  2Z2F A;  2VB1 A;  1L08 A;  1L73 A;  226L A;  1B0D A;  1JPO A;  4DR2 M;  1IY3 A;  1XGR C;  2BLX A;  5ITR A;  4YM8 A;  1L1T A;  1CJ8 A;  1L25 A;  3AGI A;  4KT0 F;  1VG5 A;  3QAK A;  1OUJ A;  1G41 A;  1T8F A;  1JHL A;  1WJ7 A;  1GL6 A;  5HMJ A;  3BBZ A;  3LVV A;  3VK7 A;  2MEH A;  1SWZ A;  4MST A;  1UID A;  2Y0T A;  4W55 A;  3AYQ A;  3HJQ A;  1DO2 A;  1Q3C A;  1XMO M;  1QT3 A;  1LKS A;  2L78 A;  1A5T A;  1JTM A;  2BQO A;  1R5L A;  4NEB A;  4H9C A;  3K8Z A;  5IT9 S;  1REZ A;  1HHL A;  5II3 A;  1LZA A;  1XEK A;  4ETB A;  4GCC A;  3FE0 A;  5I4Y A;  5KXO A;  2DEN A;  4WLD A;  4JI2 M;  1L54 A;  3WW5 A;  2OTZ X;  4FD2 A;  1JIS A;  5F9X A;  1ZVH L;  1F0W A;  2C8P A;  1L92 A;  3I4Y A;  2DQC Y;  1XEI A;  3LVW A;  1D2N A;  2R44 A;  3DN1 A;  1W6Z A;  2B75 A;  1BWH A;  139L A;  1QAN A;  3HWS A;  183L A;  3FUX A;  2O5R A;  5KXY A;  1G0Q A;  2OPF A;  1GF4 A;  1C68 A;  2W1X A;  1N33 M;  156L A;  1LYI A;  4F2L A;  2ZAN A;  4OW1 A;  1FLQ A;  5LVK A;  3B74 A;  3FTC A;  1NHE A;  161L A;  1YQV Y;  3GRR A;  4LFP A;  2HUK A;  3AKZ A;  1HSW A;  3HT6 A;  1HNW M;  4LDL A;  4OWB A;  3WUN A;  1GF7 A;  5HMV A;  1TH3 A;  1QT8 A;  2L6O A;  3U5Z A;  177L A;  4OOT A;  4GN4 A;  1QUO A;  1L94 A;  1QTV A;  4WLY A;  1LJE A;  1IOR A;  4NHS A;  3DMZ A;  5DM9 A;  4EXM A;  4FVM A;  3FD9 A;  1PJJ A;  2XZF A;  1DXJ A;  1YSY A;  1P3Q Q;  2N35 A;  1GE3 A;  1EQ4 A;  2G8L A;  3SAW A;  227L A;  5ITU A;  1EE8 A;  1XXH A;  2HUL A;  4LJ6 A;  1SXJ C;  1CUQ A;  2KRK A;  182L A;  1FN5 A;  2Y8P A;  2D7G A;  4DD1 A;  1GAZ A;  2CJL A;  3AZ7 A;  3P66 A;  1P56 A;  2Z37 A;  1LMC A;  1IXS A;  207L A;  220L A;  2RGH A;  2DHR A;  1IR7 A;  3LZT A;  3E4R A;  1HFX A;  1LZ8 A;  5B59 A;  1ZV1 A;  3C8Q A;  5APF A;  1OUG A;  3K92 A;  1IXZ A;  3GUK A;  2Y0Q A;  3E46 A;  113L A;  2BQH A;  5T3F A;  1CUP A;  1KY0 A;  3IJU A;  3GLF E;  4WLX A;  5I5Q A;  4IAP A;  1L98 A;  4I8O A;  2WSC F;  1T3P A;  3FKE A;  5IWA M;  3RT5 X;  3TXD A;  1LZ9 A;  1TDY A;  2Z3X A;  3DOA A;  2XTH A;  4B7H A;  1ZQ9 A;  1YUB A;  1T97 A;  4DQJ A;  5FTL A;  3EMS A;  1CNS A;  2K0B X;  3TWK A;  3CT5 A;  4C3W A;  3FYD A;  3GRU A;  1L56 A;  3MMP A;  1UIH A;  4NHP A;  1GE1 A;  1G3I A;  1IWW A;  3WPK A;  3HU1 A;  1L62 A;  3CF0 A;  5KXZ A;  5BR8 M;  2F5P A;  1ZWN A;  3RNX A;  1LSP A;  1LHM A;  3RE8 A;  5KXX A;  2QP9 X;  1QTK A;  1WIV A;  1C6K A;  3D8L A;  1ZVY B;  1HEW A;  4AKH A;  5KXW A;  1LZ1 A;  1LMN A;  1RCM A;  1C63 A;  2KW0 A;  3GLG E;  4I7P A;  1GBO A;  1D3M A;  5E6J A;  2YDG A;  1VDT A;  2KRU A;  2NTG A;  5KXK A;  1L28 A;  1YRO A;  2BAA A;  223L A;  1OKS A;  2QCU A;  169L A;  3QAU A;  2C98 A;  1L1Z A;  3MJ5 A;  1OFI A;  4ITQ A;  4I7L A;  1IN7 A;  152L A;  1JSF A;  2MEC A;  2UUA M;  2PC2 A;  2JWS A;  1C6E A;  4TTD A;  4E97 A;  1I1Z A;  2H5Z A;  2RAZ X;  1FLU A;  1UIA A;  1IR9 A;  4OX9 M;  4REZ A;  4O34 A;  1PS5 A;  3FA0 A;  150L A;  1BB3 A;  4NOO B;  209L A;  1IIZ A;  4G3O A;  3L2X A;  146L A;  3L28 A;  2DAK A;  4NL4 H;  2O25 A;  4ML7 A;  3SAS A;  197L A;  2H9K A;  111L A;  1LSC A;  2ZWB A;  5KXR A;  3HHZ A;  2C96 A;  1GF5 A;  1L00 A;  3C81 A;  5B1F A;  1GB3 A;  3M7G A;  2D4J A;  1BB5 A;  3PNV A;  2QZ4 A;  1LHK A;  1PM5 A;  3N9E A;  1R6B X;  1Q02 A;  1W5S A;  2XLJ A;  1L06 A;  3E9S A;  4FWD A;  1LJ4 A;  3NYA A;  1GPQ C;  200L A;  1BQL Y;  4IAS A;  4ZEE A;  4I0C A;  4CJ6 A;  1QUG A;  1LZ5 A;  1L27 A;  1C60 A;  1T6O A;  2B6Y A;  4P17 A;  251L A;  3E21 A;  4DV6 M;  3HT7 A;  4JI4 M;  3ATO A;  5D5C A;  1T8G A;  2DI0 A;  1C64 A;  3C7Z A;  3ODU A;  1P64 A;  4OVZ A;  1IP6 A;  241L A;  2YBL A;  1PGY A;  4DT3 A;  2Z4S A;  3W67 A;  4YEN A;  2HU1 A;  4DBG B;  1LWG A;  1OP9 B;  3HHW A;  1IXR C;  1L84 A;  1IC5 Y;  2B74 A;  196L A;  3HUK A;  4Q7J A;  1L74 A;  2G4Q A;  4XEN A;  4WUR A;  3MK6 A;  3GLI A;  3WL2 A;  1WQQ A;  3TQS A;  3NWL A;  1CU6 A;  1N75 A;  2QQ8 A;  2CV0 A;  1PJT A;  4X3B A;  5F14 A;  4LY6 A;  1LHL A;  3B9P A;  1G0K A;  1FKV A;  1GFV A;  2H1R A;  1BVX A;  1UBZ A;  3GUL A;  1MJG M;  4HEO A;  4JI5 M;  255L A;  4AKG A;  3CF2 A;  2G4N A;  1T8A A;  1DYA A;  1MX0 A;  1L77 A;  4DQ7 A;  2QBY A;  2KA6 B;  1XJU A;  1H6U A;  5F3W A;  2F5N A;  1HML A;  1XXH E;  4NSR A;  2BQM A;  4YEM A;  1B9O A;  4QHS A;  1OUD A;  4IJF A;  3TMX A;  2BQB A;  3P68 A;  2VII A;  4MGK E;  1LYD A;  3M3U A;  4XBO A;  1JKD A;  1YL1 X;  3IWR A;  1AT6 A;  4UWN A;  3U60 B;  1KIP C;  2DQA A;  2UXB M;  1NY6 A;  1L21 A;  1NNJ A;  1IR8 A;  4TSC A;  1QSW A;  2YVB A;  4NGY A;  5KQ8 A;  3GP1 A;  1GVN A;  1WQP A;  1GHL A;  3EIH A;  4WM5 A;  4GLV A;  1ZV5 L;  4ZPX A;  4GIT A;  5ITQ A;  4K5Y A;  123L A;  4A7D A;  2K9D A;  4QNR A;  4ARM B;  4AQN A;  2MED A;  9LYZ A;  1FNN A;  3SC3 A;  3SHF A;  1LW9 A;  2CDS A;  2BWB A;  1LMQ A;  3W6A A;  2I7N A;  2JZ0 A;  1GEZ A;  1GFJ A;  2C9C A;  2GNO A;  3KW6 A;  4IBJ A;  2DNA A;  1GE2 A;  2R0I A;  1JKA A;  4KXI A;  1FKQ A;  1QQW A;  1C43 A;  3RGP A;  2X8A A;  1P36 A;  3B89 A;  2F4A A;  2O7A A;  4ZPU A;  2BJV A;  2BWE A;  3UK6 A;  2LVQ D;  3HHY A;  1GFR A;  4EJ4 A;  1N36 M;  5E4P A;  5KKI A;  4YY3 M;  1GFE A;  3W0F A;  5C1B A;  1DI5 A;  2IFF Y;  2KNV A;  1GF9 A;  1JR3 A;  3AZ6 A;  1C45 A;  4TUW A;  4WLT A;  1WVV A;  3HU2 A;  4I7K A;  2ERC A;  221L A;  4EOF A;  4WW0 A;  3U6O A;  2B7X A;  1B2K A;  1C6B A;  206L A;  1JSE A;  3K9O A;  1LYZ A;  3CT0 A;  3ZVQ B;  2RBP A;  4LJ8 A;  1INU A;  3SB5 A;  1L83 A;  1DYE A;  2FYC A;  3D8B A;  1C62 A;  2ZNX Y;  1CJ9 A;  2BQD A;  3SB9 A;  1NO1 A;  4ZIX A;  5LIN A;  2LHG A;  4WL6 A;  5FDJ A;  1TGU A;  4WG1 A;  4YF2 A;  3D3D A;  1CV6 A;  262L A;  114L A;  2Y21 A;  1QQY A;  1OIZ A;  3J6K A;  1XMQ M;  186L A;  1GBW A;  1ZAE A;  1L10 A;  1G7L C;  4LT2 A;  1C69 A;  171L A;  1DGH B;  4DV3 M;  158L A;  4S0W A;  1L01 A;  1QZM A;  2JP7 A;  1JJ3 A;  1CKG A;  4M9X A;  4G4O A;  222L A;  2B6X A;  3CDT A;  3GPU A;  3BOS A;  149L A;  1Z5C A;  1GF6 A;  1OVK A;  4PGJ B;  3E3D A;  3TMW A;  4DV0 M;  1IWZ A;  1IOT A;  4MR1 A;  3ILK A;  4LF7 M;  3HU8 A;  2LNH C;  4NRV A;  2VQF M;  3AZ5 A;  1LTM A;  3OTO M;  4DR4 M;  4EPI A;  1C6L A;  1JTN A;  5KXP A;  1G0L A;  3MHV C;  4XJH A;  4PRU A;  4DQ5 A;  1L52 A;  4W94 A;  1E32 A;  4XJD A;  1D9W A;  1KW7 A;  1TH2 A;  2EKF A;  1L64 A;  2XF3 A;  5FTK A;  159L A;  1UUZ C;  1SXJ A;  1C61 A;  1SSW A;  3VDU A;  4E3U A;  1SG9 A;  5EXS A;  4GRV A;  4EIW A;  1L44 A;  1NWG A;  4MH0 E;  3DKE X;  4J0L A;  4L16 A;  1OJL A;  1LI6 A;  2ZAO A;  1W08 A;  4HTQ A;  3EIE A;  2BQG A;  3DMX A;  1FJG M;  3LZM A;  1QIO A;  2W82 A;  4IIW A;  2L4E A;  2ANV A;  1G1V A;  1NV9 A;  4A3V B;  4MGI E;  2G4P A;  4LJ5 A;  128L A;  1IP2 A;  1L0J A;  2ZM6 M;  2JA2 A;  2VF7 A;  4DR5 M;  4QOZ C;  1LZC A;  4H9F A;  4D81 A;  4PRQ A;  4ET8 A;  1BGI A;  2L2D A;  1WTH A;  1QUH A;  3SYK A;  1GXV 2;  4GEW A;  3GUJ A;  3ULR A;  5HNC A;  5LYT A;  3C7W A;  3HY5 A;  4W56 A;  165L A;  3LQQ A;  2B72 A;  5KXL A;  3JR4 A;  2FE8 A;  2C5R A;  4WM3 A;  4HLQ A;  4TWS A;  1LZS A;  2BQL A;  2RBO A;  1K3X A;  1JIT A;  2CV2 A;  4TUN A;  1KW5 A;  1L32 A;  4PHI A;  141L A;  3HX3 A;  4UN2 B;  1SLY A;  4NSI A;  2HUB A;  3B7Q A;  3VDP A;  4LCB A;  4C5F A;  4EKR A;  1HEO A;  1Z5B A;  4JN6 A;  5C6I A;  2EA0 A;  5I14 A;  2F32 A;  1PQO A;  5LVH A;  3LMM A;  1CTW A;  3PVS A;  5FHW A;  2QSF X;  1NMM A;  4DR6 M;  254L A;  2DQD Y;  1CKC A;  4DD9 A;  3A3R X;  3GQ5 A;  2R46 A;  4XK8 F;  1HER A;  1L22 A;  2FFJ A;  1UA6 Y;  122L A;  2RBN A;  5EXP A;  1JWR A;  4D9Z A;  3K2L A;  1C6F A;  3GUM A;  4AZF A;  2D7H A;  1D6P A;  2DAG A;  2OE7 X;  1L16 A;  1L26 A;  1JR3 E;  1HFZ A;  4B08 A;  215L A;  1L55 A;  3V76 A;  1IOQ A;  2JZ1 A;  2Z19 A;  3SBB C;  4WOA A;  3R9X B;  2ZAM A;  232L A;  2HEA A;  4I5S A;  1G7H C;  1OUH A;  2JY8 A;  1LMA A;  3KAM A;  2Q9E A;  2D6B A;  1L85 A;  3A6B Y;  212L A;  4NG1 A;  1TBY A;  1LGX A;  1V7S A;  4UWU A;  4DKL A;  3FI7 A;  1HEQ A;  2W1L A;  4X62 M;  1UC0 A;  2YBJ A;  3T6U A;  1DO0 A;  2BQA A;  3WMK A;  3WU9 A;  2Q2E B;  1EL1 A;  1CV1 A;  1QTC A;  144L A;  1GFT A;  1O23 A;  4LGY A;  2CWB A;  3UJN A;  3EXD A;  4B4E A;  1QSA A;  1P7S A;  239L A;  1NHB A;  3DA1 A;  5BPV A;  2LVO C;  4RKU F;  2MEG A;  2CE7 A;  3M0E A;  2LZM A;  1OIP A;  1L40 A;  3KXE C;  1Q3B A;  3TXJ A;  3UMM A;  3QYB A;  2XGN A;  1N32 M;  1LZR A;  1NDG C;  1L76 A;  4YOP A;  3A45 A;  3J7B A;  2ZIL A;  1DGG A;  4LG2 A;  4IBG A;  1L33 A;  1OUF A;  4KO8 A;  3GUN A;  2DHY A;  1REX A;  2H9J A;  5B05 A;  1QT4 A;  1YE9 A;  5IEL A;  1Z6T A;  3HJS A;  1P2C C;  4J1A A;  103L A;  2XFS A;  2D4I A;  2R18 A;  3KP1 E;  1XXH B;  5ILF A;  3Q8G A;  1P3N A;  3F9L A;  2MEA A;  1QSQ A;  3KDS E;  258L A;  1OYU A;  4Y28 F;  2MEB A;  1Y8G A;  3M6A A;  4W5W A;  4G4R A;  1F6S A;  3V2W A;  4W57 A;  1IXS B;  5KPR A;  2CRU A;  2YQZ A;  1N77 A;  1REM A;  3G3W A;  1PJI A;  2KNA A;  1L04 A;  4PT5 A;  1WQM A;  3A46 A;  1XWI A;  211L A;  2NWD X;  244L A;  3DMV A;  5DNY A;  5I4X A;  1IWX A;  1QDR A;  5IZ7 D;  257L A;  5KXS A;  4AQY M;  1ZUR A;  2HEC A;  1GAY A;  5KXN A;  1LSE A;  3LYM A;  4HV2 A;  5JI3 E;  3CDR A;  1DI4 A;  1L31 A;  1LZG A;  1DZB X;  4DR7 M;  1IP5 A;  3FUV A;  3PBL A;  5FTM A;  1GB8 A;  1QSB A;  3TXK A;  4FWH A;  2CWI A;  4N1E I;  3OE0 A;  5B1G A;  2RB0 X;  3WW6 A;  1GKI A;  2Z6B A;  4M9S A;  5KXT A;  4WL7 A;  235L A;  1LSB A;  3SYL A;  3HU9 A;  3SAT A;  3ZC7 B;  3W0L B;  1C6A A; 
#chains in the Genus database with same CATH homology
 4L41 A;  4IJ4 A;  1UIG A;  2IHL A;  1K28 A;  1IWT A;  1B7Q A;  1QT6 A;  3BKV A;  2D4K A;  1P2R A;  1IWY A;  5J7C A;  1C6N A;  1DKJ A;  4J7V A;  1QTE A;  1C6H A;  1L38 A;  2LZ2 A;  1GXX A;  1OUA A;  4GLA A;  2RBQ A;  2EKS C;  2W1M A;  3P65 A;  5LAF A;  5JEN B;  1LPY A;  1D6Q A;  1DPW A;  1LMO A;  2RSC A;  4NSG A;  205L A;  1IOC A;  4W52 A;  3HTD A;  172L A;  2X0A A;  3A93 A;  1PQJ A;  147L A;  1J1P Y;  2RBS A;  1L11 A;  4NGW A;  4WM1 A;  1GFH A;  3SB8 A;  4I8S A;  1XJT A;  5HNL A;  2D91 A;  225L A;  3F6Z A;  4KT3 A;  2EQL A;  3LN2 A;  3LYT A;  3HTG A;  191L A;  3HH3 A;  3QY4 A;  1VDS A;  4H8X A;  1GFK A;  1HEP A;  3DN8 A;  4KPM A;  3OE6 A;  1EQ5 A;  1P37 A;  1IP7 A;  2A4T A;  1GEV A;  1LMP A;  4NG8 A;  3WU8 A;  214L A;  2YBN A;  3B6L A;  1PQD A;  1L15 A;  2ZIJ A;  1IP3 A;  4AXT A;  4NIJ A;  1GFU A;  1LJN A;  2B6W A;  1C10 A;  4RLN A;  1NDM C;  115L A;  1B7S A;  1WTM A;  1VDP A;  2RBR A;  1LHI A;  3HBH A;  3SBA A;  4LDE A;  1BHZ A;  1C6D A;  1NQI A;  4N9R A;  3A91 A;  213L A;  4N0J A;  6LYT A;  3GUI A;  4HP0 A;  5L9J A;  1CKF A;  3AGG G;  145L A;  1LSM A;  4HSF A;  3A3Q A;  1OQM A;  3G3V A;  1VED A;  4H9H A;  1OUB A;  1AM7 A;  1XGT C;  4CGE A;  1GBY A;  3P4Z A;  2ZYC A;  1LZB A;  4I7S A;  160L A;  2WAR A;  1QS5 A;  1BB7 A;  1B5Z A;  3HUA A;  2MEF A;  1L75 A;  3B0K A;  3EBA B;  1CU2 A;  2F2N A;  6LYZ A;  1L37 A;  4GCB A;  1LYO A;  2LHM A;  2I26 L;  1L34 A;  4G49 A;  4I7T A;  130L A;  3IJV A;  167L A;  2GV0 A;  125L A;  3HTF A;  3A34 A;  1HC0 A;  4G4C A;  4P2E A;  1AKI A;  1PQK A;  4Z98 A;  2N5Z A;  3RZ4 A;  4H8Y A;  3J4G A;  192L A;  3C80 A;  1UCO A;  1KS3 A;  4H91 A;  1LZT A;  3ZEK A;  3CSQ A;  185L A;  1JTT L;  5I54 A;  1G06 A;  1QTB A;  148L E;  4I7Q A;  1CX7 A;  1KY1 A;  151L A;  1RJC B;  1SSY A;  102L A;  3SB7 A;  1IEE A;  1B7N A;  2LZT A;  2Q0M X;  5IDD A;  1L99 A;  4YXC A;  1ZMY L;  3A67 Y;  4DDB A;  1L29 A;  4NHT A;  230L A;  175L A;  2F4G A;  1AZF A;  1C6M A;  1GBZ A;  2B6T A;  3B0O A;  248L A;  1L36 A;  4CJ2 A;  4WMG A;  1L86 A;  3ATN A;  3WUM A;  1L67 A;  1TEW A;  2ZQ3 A;  2HTX A;  1V7T A;  1QT5 A;  252L A;  1L12 A;  1L81 A;  4EKS A;  2Q9D A;  5LVJ A;  1L89 A;  4DD7 A;  2FBD A;  2NTH A;  2BQN A;  2BPU A;  1XFP L;  3TXB A;  236L A;  4NGO A;  4ETE A;  193L A;  138L A;  3QE8 A;  3K3T A;  4DAJ A;  1OWY A;  1G0P A;  3CDV A;  3AZ4 A;  3HBD A;  1JQU A;  228L A;  1IOS A;  1XSF A;  126L A;  1G7I C;  1L69 A;  3HH5 A;  4HPI A;  1VFB C;  4NSH A;  3W3E A;  4IAT A;  176L A;  1PQM A;  1EQE A;  5AMY A;  1NKH A;  4NGK A;  3HH4 A;  3CDQ A;  1GFA A;  2IGC A;  2BQK A;  1VAT A;  1OV7 A;  4H1P A;  4LT0 A;  1FDL Y;  1I56 A;  4ETA A;  1FLW A;  4QY9 A;  2YBI A;  1D3F A;  1L82 A;  2RB2 X;  3TXE A;  2EIZ C;  1UIB A;  1OVH A;  4W96 A;  5B07 A;  4WM2 A;  3C8S A;  4YEO A;  135L A;  5FEK A;  2OU8 A;  1JTO L;  1B5U A;  1G0G A;  5D5F A;  2BQJ A;  1CV0 A;  1G0M A;  1KXX A;  1YKZ X;  199L A;  4DD3 A;  1XEJ A;  1L23 A;  2XQO A;  4R6C A;  1L63 A;  5E9R A;  3M18 B;  1DYB A;  1L47 A;  1L87 A;  4ARQ B;  3WUA A;  2LCB A;  4LYO A;  4DJH A;  5LA5 A;  1C66 A;  3QNG A;  4QEQ A;  4LT3 A;  4YX7 C;  4LGK A;  5K7O A;  1L58 A;  1UIF A;  4LYB A;  1GDX A;  3C82 A;  3G3B B;  1WVU A;  1CV4 A;  4U3X B;  195L A;  1WTN A;  3CDO A;  2A7D A;  259L A;  1L95 A;  1YKX X;  2LC9 A;  1QS9 A;  1T6H A;  3CQL A;  1L14 A;  3HBE X;  190L A;  1L50 A;  153L A;  3WUL A;  174L A;  1L71 A;  3UON A;  1LOZ A;  4NHQ A;  1LYG A;  1LYJ A;  2BLY A;  4I7N A;  4ARJ A;  4N8Z A;  3N9A A;  3RZE A;  4G4B A;  2DKV A;  1YL0 X;  2O4W A;  3HT8 A;  2LYZ A;  4EMN A;  238L A;  4LZT A;  4HJV A;  216L A;  3AJN A;  1HEM A;  1GD6 A;  1VAU A;  4NHI A;  3D9A C;  3GUO A;  4HTK A;  3NY8 A;  233L A;  4ETC A;  4I7J A;  3WXU A;  188L A;  4DC4 A;  4GBR B;  2C8O A;  1C6P A;  1C65 A;  155L A;  1YAP A;  4WO9 A;  4LFX A;  3A8Z A;  1XGU C;  5LVI A;  1YAO A;  1GB0 A;  4CFP A;  4UWV A;  6LZM A;  1LYH A;  4J1B A;  2Z39 A;  1UAC Y;  1SX7 A;  1B7R A;  1P5C A;  1D3J A;  5DN5 A;  1LZD A;  4ARQ A;  5DN4 A;  4NGJ A;  1GB7 A;  1L79 A;  1L97 A;  3LYZ A;  4HJY A;  4FJR A;  1L90 A;  245L A;  1C67 A;  1J1O Y;  3DN6 A;  256L A;  1L61 A;  2XBS A;  4EKP A;  1L46 A;  1OUI A;  1KIQ C;  2YBM A;  129L A;  3HDF A;  2I6Z A;  208L A;  3RU5 A;  4RDS A;  1QTD A;  1GDW A;  4MCK A;  249L A;  5F9U A;  4I7M A;  1B7L A;  5EBH A;  1ALC A;  1LKR A;  5LVG A;  4WO6 A;  1IY4 A;  1L07 A;  2FBB A;  4NGZ A;  4LZM A;  2OU9 A;  108L A;  4NWE A;  4NGI A;  1HMK A;  1L02 A;  1GB9 A;  1LMT A;  1BVK C;  4QGZ A;  3WH1 A;  2Z2E A;  3HWL A;  198L A;  4OOO A;  1D3N A;  4BAF A;  1LSY A;  1H6M A;  5F16 A;  1IO5 A;  1D0L A;  189L A;  1CU5 A;  173L A;  1OV5 A;  1FLY A;  1L13 A;  1HF4 A;  2CUU A;  3C7Y A;  1H87 A;  4NGL A;  1REY A;  3DN0 A;  1IP4 A;  2EPE A;  1EPY A;  1XGP C;  3TXH A;  2XJW A;  1FBI X;  1P6Y A;  1GBX A;  4LT1 A;  1IX0 A;  2DQG Y;  1L39 A;  3NY9 A;  2ZQ4 A;  163L A;  1BB6 A;  1P46 A;  2ZNW Y;  1LSD A;  4M6D A;  1QUD A;  1T6V L;  201L A;  3JR6 A;  243L A;  1IC4 Y;  1YKY X;  3AB6 A;  1JKC A;  217L A;  2F47 A;  5FST A;  4OO9 A;  5ILC A;  1IVM A;  4DDA A;  5C6J A;  3SN6 R;  3K2R A;  1L35 A;  1C6T A;  5LXW A;  1B5X A;  2DQF C;  1JJ1 A;  7LYZ A;  1L30 A;  5HQ1 A;  1PZY A;  1HSX A;  4EKQ A;  3TXF A;  1LAA A;  4RLM A;  1L70 A;  1OWZ A;  3BKH A;  1L20 A;  1LHJ A;  3HUQ A;  3RW8 A;  4LYM A;  1QUT A;  2OE9 X;  3MGW A;  3DN3 A;  1LCN A;  247L A;  2BQE A;  5B06 A;  5M1Y A;  1G7M C;  1L65 A;  1HNL A;  1DYD A;  1YAQ A;  1CV5 A;  2HEB A;  1C6G A;  1LJI A;  1C6C A;  1MLC E;  4G4H A;  4HV1 A;  1J1X Y;  1LJK A;  5KKJ A;  2HED A;  4LDO A;  5L3H A;  1GBS A;  4QDN A;  1B5V A;  4BS7 A;  4TX7 A;  4OWE A;  3G3X A;  154L A;  1LYS A;  4CHX A;  1B7P A;  180L A;  2F2Q A;  1GE4 A;  1LGU A;  5DL9 A;  3TXG A;  1F6R A;  5KY1 A;  1L03 A;  1L53 A;  3A6C Y;  1TAY A;  1B5Y A;  1QUS A;  1L51 A;  1LJJ A;  1LZE A;  1L43 A;  3WPJ A;  4DD2 A;  3VWO A;  250L A;  1YAM A;  3P64 A;  4N1C C;  1LJG A;  110L A;  1OUE A;  3A92 A;  4ANR A;  1LPI A;  4R0F A;  2HEE A;  1LYE A;  4YXA C;  1DYC A;  4BAP A;  4GCE A;  1DPX A;  1L59 A;  1D0M A;  4HPE A;  4Z3M A;  4ARP A;  5DLA A;  5LA8 A;  260L A;  1NBY C;  1A2Y C;  4H9I A;  1C46 A;  1KNI A;  3C83 A;  5APE A;  2HEF A;  2QAR C;  131L A;  4H9B A;  2CGI A;  3A94 A;  4XJG A;  4XAD A;  1L80 A;  1LWK A;  2B6Z A;  1GWD A;  1JUG A;  1LZY A;  1D0K A;  1L17 A;  170L A;  2I25 L;  1CKH A;  1NF5 A;  1L93 A;  1L88 A;  2BQC A;  2MEI A;  1GE0 A;  1YIK A;  3FAD A;  1LYY A;  3LZ2 A;  1GB5 A;  5FEL A;  3HTB A;  4H92 A;  4PJZ A;  3OJP A;  1MEL L;  134L A;  1LI2 A;  3VW7 A;  3CT1 A;  1LI3 A;  5C6L A;  1CV3 A;  3AGH A;  4OWC A;  4DYG A;  4HJZ A;  234L A;  1XGQ C;  3DN2 A;  3W6B A;  1C6I A;  2HU3 A;  4XJB A;  1CU3 A;  1D2W A;  1L68 A;  2LYO A;  2W1Y A;  3A96 A;  3WVY A;  184L A;  1L18 A;  5APD A;  3SB6 A;  4XJI A;  1LZ4 A;  1QTH A;  3W6E A;  231L A;  3WYH A;  5HLL A;  2OEA X;  2B73 A;  3CSR A;  4B49 A;  107L A;  1L91 A;  1YAN A;  1LSF A;  181L A;  1E8L A;  1GB2 A;  4WM4 A;  4W58 A;  3WVX A;  1KIR C;  1LJF A;  2AUB A;  2LYM A;  4XN6 A;  1PQI A;  1LZN A;  3B72 A;  4NSJ A;  2Z18 A;  1GFG A;  4I7O A;  4H9A A;  4DWX A;  1SWY A;  1L49 A;  1LSG A;  1D2Y A;  2ZYP A;  4PPO A;  4B1A A;  3GXK A;  1L19 A;  1L72 A;  1IC7 Y;  194L A;  4LYT A;  157L A;  1LYF A;  1L57 A;  1LHH A;  2YBH A;  1WQR A;  4H8Z A;  1GF3 A;  4ETD A;  1G7J C;  112L A;  3WU7 A;  1L60 A;  3SP3 A;  1L48 A;  1HEN A;  3C8R A;  3CSZ A;  2Z38 A;  1QTZ A;  4CFO A;  2YSS C;  1IWU A;  4Z41 A;  3A90 A;  1BWJ A;  8LYZ A;  1JIY A;  1LSN A;  1WQN A;  4LYZ A;  1D9U A;  1HEL A;  1ZYT A;  5I4W A;  4NY5 A;  4NWH A;  1G0J A;  2B70 A;  4FDY A;  2XBR A;  2ZIK A;  127L A;  1IP1 A;  1YIL A;  3W6D A;  133L A;  5FCP A;  1B6I A;  224L A;  3PDS A;  1A4V A;  5A3Z A;  1P2L A;  4B4J A;  1CU0 A;  1DYG A;  1CX6 A;  5LYZ A;  1L45 A;  2DQE Y;  1F10 A;  2F30 A;  2OU0 X;  1JTP L;  229L A;  1UIE A;  1L0K A;  3G3A B;  4W54 A;  1L24 A;  3T36 A;  3AW7 A;  3W6C A;  3D4S A;  4BAD A;  1C6J A;  164L A;  140L A;  1DYF A;  1L42 A;  2DQH Y;  1KXY A;  3OK0 A;  3TXI A;  1LLH A;  2RH1 A;  3HT9 A;  1SQ2 L;  1GB6 A;  1DKK A;  2A7F A;  3GUP A;  2FYD A;  1B5W A;  1NBZ C;  1OVJ A;  1G1W A;  109L A;  2Z12 A;  2ANX A;  3HDE A;  137L A;  4H93 A;  119L A;  3HFM Y;  4NGV A;  4H94 A;  3F8V A;  1GF8 A;  4GN5 C;  1CVK A;  1LGW A;  1L05 A;  261L A;  1HFY A;  178L A;  118L A;  2O79 A;  1CJ7 A;  3FI5 A;  1CJ6 A;  4W59 A;  4ARM A;  3CB7 A;  4DDC A;  1I20 A;  1WQO A;  3B0I A;  4B4I A;  218L A;  104L A;  4H90 A;  1L09 A;  3AW6 A;  2HUM A;  4OWA A;  2QB0 B;  1SX2 A;  5LAG A;  5LIO A;  4G9S A;  3TMV A;  5APC A;  1JKB A;  1XEP A;  3L64 A;  4NFV A;  3A95 A;  7LZM A;  3DNA A;  5L3I A;  3LYO A;  1IWV A;  4HTN A;  2BQI A;  1B7O A;  1BB4 A;  1DQJ C;  3RUN A;  2DQJ Y;  1LSA A;  3ZVQ A;  1I6S A;  4PJ2 C;  1CKD A;  1JJ0 A;  4ARL A;  3EML A;  4N5R A;  1TLA A;  4GCF A;  4M4O A;  4GCD A;  1LJH A;  5LZM A;  1QDT A;  187L A;  132L A;  3N9C A;  242L A;  240L A;  1AT5 A;  4W51 A;  1N4F A;  1L66 A;  237L A;  142L A;  4LYC A;  1B7M A;  4B0D A;  2B5Z A;  1OUC A;  1RE2 A;  162L A;  4AGA A;  2DQI Y;  246L A;  3EO5 A;  2RAY X;  4XJF A;  1G07 A;  4RW1 A;  1VDQ A;  5KXM A;  1C08 C;  1JEF A;  4H9E A;  2OE4 X;  3DN4 A;  3OE9 A;  1RI8 B;  1Z55 A;  1UIC A;  1DI3 A;  1LJ3 A;  2MEE A;  1BWI A;  2BQF A;  143L A;  4ZFP A;  4WM6 A;  4W53 A;  210L A;  4EPF A;  4Z46 A;  5A3E A;  4OWH A;  5IHG A;  1L41 A;  166L A;  1L96 A;  1RFP A;  4XYY A;  4I7R A;  3V2Y A;  1C7P A;  1TCY A;  4WG7 A;  3WPL A;  1C6Q A;  4ET9 A;  4TSB A;  4RW2 A;  5LYM A;  3OE8 A;  168L A;  1LZ6 A;  2DBT A;  1LSZ A;  3GXR A;  4PK0 A;  219L A;  4KL7 A;  1GF0 A;  4II8 A;  2OTY X;  2RB1 X;  120L A;  1KXW A;  253L A;  1QT7 A;  4GN3 A;  3HH6 A;  5KJ9 A;  3LHM A;  3WXT A;  5F81 A;  5I53 A;  4DD0 A;  3TMU A;  3W6F A;  2Z2F A;  2VB1 A;  1L08 A;  1L73 A;  226L A;  1B0D A;  1JPO A;  1XGR C;  1IY3 A;  2BLX A;  4YM8 A;  1CJ8 A;  1L25 A;  3AGI A;  3QAK A;  1OUJ A;  1T8F A;  1JHL A;  5HMJ A;  2MEH A;  1SWZ A;  4MST A;  1UID A;  4W55 A;  3AYQ A;  1QT3 A;  1LKS A;  2L78 A;  1JTM A;  2BQO A;  4NEB A;  4H9C A;  1REZ A;  1HHL A;  5II3 A;  1LZA A;  1XEK A;  4ETB A;  4GCC A;  3FE0 A;  5I4Y A;  5KXO A;  4WLD A;  1L54 A;  3WW5 A;  2OTZ X;  1JIS A;  5F9X A;  1ZVH L;  1F0W A;  2C8P A;  1L92 A;  2DQC Y;  1XEI A;  3DN1 A;  1W6Z A;  2B75 A;  1BWH A;  139L A;  183L A;  5KXY A;  1G0Q A;  1GF4 A;  1C68 A;  2W1X A;  156L A;  1LYI A;  4OW1 A;  1FLQ A;  5LVK A;  1NHE A;  161L A;  1YQV Y;  4LFP A;  2HUK A;  1HSW A;  3HT6 A;  4LDL A;  4OWB A;  3WUN A;  1GF7 A;  5HMV A;  1QT8 A;  177L A;  4OOT A;  4GN4 A;  1QUO A;  1L94 A;  1QTV A;  4WLY A;  1LJE A;  1IOR A;  4NHS A;  3DMZ A;  5DM9 A;  4EXM A;  1DXJ A;  1GE3 A;  1EQ4 A;  227L A;  2HUL A;  1CUQ A;  1FN5 A;  182L A;  2Y8P A;  4DD1 A;  1GAZ A;  2CJL A;  3AZ7 A;  3P66 A;  1P56 A;  2Z37 A;  1LMC A;  207L A;  220L A;  1IR7 A;  3LZT A;  1HFX A;  1LZ8 A;  5B59 A;  3C8Q A;  5APF A;  1OUG A;  3GUK A;  113L A;  2BQH A;  5T3F A;  1CUP A;  1KY0 A;  3IJU A;  4WLX A;  5I5Q A;  4IAP A;  1L98 A;  1T3P A;  3RT5 X;  3TXD A;  1LZ9 A;  1TDY A;  2XTH A;  1T97 A;  4DQJ A;  3EMS A;  1CNS A;  4C3W A;  3CT5 A;  1L56 A;  1UIH A;  4NHP A;  1GE1 A;  1IWW A;  3WPK A;  5KXZ A;  1L62 A;  1ZWN A;  3RNX A;  1LSP A;  1LHM A;  5KXX A;  1QTK A;  1C6K A;  1ZVY B;  1HEW A;  5KXW A;  1LZ1 A;  1LMN A;  1RCM A;  1C63 A;  4I7P A;  1GBO A;  1D3M A;  2YDG A;  1VDT A;  2NTG A;  5KXK A;  1L28 A;  1YRO A;  2BAA A;  223L A;  169L A;  4I7L A;  152L A;  2MEC A;  1JSF A;  2PC2 A;  1C6E A;  4TTD A;  4E97 A;  1I1Z A;  2H5Z A;  2RAZ X;  1FLU A;  1UIA A;  1IR9 A;  4O34 A;  1PS5 A;  3FA0 A;  150L A;  1BB3 A;  209L A;  1IIZ A;  3L2X A;  146L A;  4ML7 A;  197L A;  2H9K A;  111L A;  1LSC A;  2ZWB A;  5KXR A;  1GF5 A;  1L00 A;  3C81 A;  5B1F A;  1GB3 A;  2D4J A;  1BB5 A;  1LHK A;  3N9E A;  1L06 A;  3NYA A;  1LJ4 A;  1GPQ C;  200L A;  1BQL Y;  4IAS A;  4ZEE A;  4I0C A;  1QUG A;  1LZ5 A;  1L27 A;  1C60 A;  2B6Y A;  251L A;  5D5C A;  3HT7 A;  3ATO A;  1T8G A;  1C64 A;  3C7Z A;  3ODU A;  1P64 A;  1IP6 A;  241L A;  2YBL A;  4DT3 A;  4YEN A;  2HU1 A;  1LWG A;  1OP9 B;  1L84 A;  1IC5 Y;  2B74 A;  196L A;  3HUK A;  1L74 A;  2G4Q A;  4XEN A;  3WL2 A;  1WQQ A;  1CU6 A;  4X3B A;  5F14 A;  1LHL A;  1G0K A;  1FKV A;  1GFV A;  1BVX A;  1UBZ A;  3GUL A;  255L A;  2G4N A;  1T8A A;  1DYA A;  1L77 A;  4DQ7 A;  1XJU A;  1HML A;  2BQM A;  4YEM A;  1B9O A;  1OUD A;  3TMX A;  2BQB A;  3P68 A;  1LYD A;  3M3U A;  1JKD A;  1YL1 X;  3IWR A;  1AT6 A;  4UWN A;  1KIP C;  2DQA A;  1L21 A;  1IR8 A;  4TSC A;  1QSW A;  2YVB A;  4NGY A;  1WQP A;  1GHL A;  4WM5 A;  4GLV A;  1ZV5 L;  4K5Y A;  123L A;  4A7D A;  4ARM B;  4AQN A;  2MED A;  9LYZ A;  1LW9 A;  2CDS A;  1LMQ A;  3W6A A;  1GEZ A;  1GFJ A;  1GE2 A;  1JKA A;  4KXI A;  1FKQ A;  1C43 A;  4ZPU A;  1P36 A;  2F4A A;  2O7A A;  1GFR A;  4EJ4 A;  5E4P A;  5KKI A;  1GFE A;  1DI5 A;  2IFF Y;  1GF9 A;  3AZ6 A;  1C45 A;  4WLT A;  1WVV A;  4I7K A;  221L A;  4EOF A;  2B7X A;  1B2K A;  1C6B A;  206L A;  1JSE A;  1LYZ A;  3CT0 A;  3ZVQ B;  2RBP A;  1INU A;  3SB5 A;  1L83 A;  1DYE A;  2FYC A;  1C62 A;  2ZNX Y;  1CJ9 A;  2BQD A;  3SB9 A;  4ZIX A;  5LIN A;  5FDJ A;  4WL6 A;  4YF2 A;  4WG1 A;  3D3D A;  1CV6 A;  262L A;  114L A;  1QQY A;  3T6U A;  3J6K A;  186L A;  1GBW A;  1L10 A;  1G7L C;  4LT2 A;  1C69 A;  171L A;  158L A;  4S0W A;  1L01 A;  1JJ3 A;  1CKG A;  222L A;  2B6X A;  3CDT A;  149L A;  1GF6 A;  1OVK A;  4PGJ B;  3E3D A;  3TMW A;  1IWZ A;  1IOT A;  4MR1 A;  3HU8 A;  3AZ5 A;  1LTM A;  4EPI A;  1C6L A;  1JTN A;  5KXP A;  1G0L A;  4XJH A;  4PRU A;  4DQ5 A;  1L52 A;  4W94 A;  4XJD A;  1D9W A;  1KW7 A;  1L64 A;  159L A;  1UUZ C;  1C61 A;  1SSW A;  4E3U A;  4GRV A;  1L44 A;  1NWG A;  3DKE X;  4J0L A;  1LI6 A;  1W08 A;  4HTQ A;  2BQG A;  3DMX A;  3LZM A;  1QIO A;  2ANV A;  1G1V A;  2G4P A;  128L A;  1IP2 A;  1L0J A;  1LZC A;  4H9F A;  4PRQ A;  4ET8 A;  1BGI A;  1WTH A;  1QUH A;  1GXV 2;  3GUJ A;  3ULR A;  5HNC A;  5LYT A;  3C7W A;  4W56 A;  165L A;  2B72 A;  5KXL A;  4WM3 A;  4TWS A;  1LZS A;  2BQL A;  2RBO A;  1JIT A;  4TUN A;  1KW5 A;  1L32 A;  4PHI A;  141L A;  1SLY A;  4NSI A;  2HUB A;  4C5F A;  4EKR A;  1HEO A;  5C6I A;  5I14 A;  2F32 A;  1PQO A;  5LVH A;  1CTW A;  5FHW A;  2DQD Y;  1NMM A;  254L A;  1CKC A;  4DD9 A;  3A3R X;  1HER A;  1L22 A;  1UA6 Y;  122L A;  2RBN A;  1JWR A;  4D9Z A;  1C6F A;  3GUM A;  1D6P A;  2OE7 X;  1L16 A;  1L26 A;  1HFZ A;  215L A;  1L55 A;  1IOQ A;  2Z19 A;  3SBB C;  4WOA A;  232L A;  2HEA A;  1G7H C;  1OUH A;  1LMA A;  3KAM A;  2Q9E A;  2D6B A;  1L85 A;  3A6B Y;  212L A;  4NG1 A;  1TBY A;  1LGX A;  1V7S A;  4UWU A;  4DKL A;  3FI7 A;  1HEQ A;  2W1L A;  1UC0 A;  2YBJ A;  2BQA A;  3WU9 A;  3WMK A;  1EL1 A;  1CV1 A;  1QTC A;  144L A;  1GFT A;  1O23 A;  3EXD A;  4B4E A;  1QSA A;  1P7S A;  239L A;  1NHB A;  2MEG A;  2LZM A;  1L40 A;  3TXJ A;  1LZR A;  1NDG C;  1L76 A;  4YOP A;  2ZIL A;  1L33 A;  1OUF A;  3GUN A;  1REX A;  2H9J A;  5B05 A;  1QT4 A;  5IEL A;  1P2C C;  4J1A A;  103L A;  2D4I A;  5ILF A;  1P3N A;  3F9L A;  2MEA A;  1QSQ A;  258L A;  1OYU A;  2MEB A;  3V2W A;  1F6S A;  4W57 A;  3G3W A;  1REM A;  1L04 A;  1WQM A;  211L A;  2NWD X;  244L A;  3DMV A;  5I4X A;  1IWX A;  1QDR A;  257L A;  5KXS A;  1ZUR A;  2HEC A;  1GAY A;  5KXN A;  1LSE A;  3LYM A;  4HV2 A;  3CDR A;  1DI4 A;  1L31 A;  1LZG A;  1DZB X;  1IP5 A;  3PBL A;  1GB8 A;  1QSB A;  3TXK A;  2CWI A;  4N1E I;  3OE0 A;  5B1G A;  2RB0 X;  3WW6 A;  2Z6B A;  5KXT A;  4WL7 A;  235L A;  1LSB A;  3HU9 A;  1C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...