4WP2A

Chaetomium mex67 uba domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
60
Chain Sequence
b'SNAATKAQLIAEVSRRTGMNVEYSQMLTGAANWNLELALQSFEQQKANVPPEAFISQPQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative mRNA export protein
molecule tags Transport protein
source organism Chaetomium thermophilum
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
total genus 21
structure length 60
sequence length 61
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4wp2A00
2KNVA 2CWBA 1DO0A 2DKLA 1NV8A 1P3QQ 1Y8GA 3GLIE 1XXHE 2DI0A 2ZTCA 2ZTDA 1PGYA 4F1IA 2QHOB 3E21A 1VEGA 1AIPC 2O25A 1OAIA 2LBCA 2JY5A 3B89A 3LCUA 1HT2E 2CP8A 2JY7A 4HEOA 3FRHA 1OKSA 1OTRA 2JZ1A 1YLAA 4G3OA 1R4GA 1HT1E 1T6OA 1ZMUA 1MN3A 2K9DA 4GEWA 1IM2A 1ZMVA 1WR1B 2DAKA 1XB2B 1F4IA 1VEJA 2DENA 2HWJA 1OQYA 4R71A 5JI2E 3GLHE 1NV9A 1WHCA 3MMPA 3F92A 1ZV1A 3GLGE 1WIVA 1DO2A 2MGWA 2BWBA 1TR8A 1VQ1A 2RRUA 2JY8A 2DNAA 2OOBA 1QZEA 2G3QA 2JP7A 2KNAA 1IFYA 2DAEA 1IXSA 2DAMA 2LVAA 4WP2A 1G3IA 3FE3A 2L4FA 1T43A 3K9PA 3IHPA 1BVSA 4F2LA 4Q7JA 1HQYE 1Q02A 2BWEA 2OOAA 1CUKA 2LVOC 3GLFE 1KYIA 2JUJA 2JZ0A 2WZJA 2HAKA 1E94E 1TTEA 1WGNA 2H5XA 3T6PA 1A5TA 2DAGA 1G41A 1JR3E 2KHHA 2L4EA 4DBGB 1UFZA 1EFUB 1C7YA 3IECA 1SG9A 1ZMWA 1WJ7A 1VEKA 2OO9A 1WGLA 2EKFA 1VDLA 3E46A 2QSFX 2DZLA 1G4AE 2JNHA 1V92A 2L2DA 1HJPA 2DHYA 3FRIA 2QNJA 2R0IA 2LTUA 2LVPC 2EJSA 2B3TA 4UN2B 2KNZA 3H4JA 2MJ5B 5DFLA 2LVNC 2K0BX 2EKKA 3K9OA 1VG5A 2DAIA 2MROB 2LVQD 3BBZA 2MR9A 3LCVB 1DV0A 2JY6B 1GO5A
chains in the Genus database with same CATH superfamily
2KNVA 2O01F 4B3RM 4RF1A 2R6FA 1R5LA 1SXJC 2L6OA 3LW5F 3B9PA 4OVZA 3JR5A 1IBLM 1NV8A 2BNKA 2C98A 3WHLA 1K82A 3VKGA 3WHKA 1OAOC 4G4RA 3K92A 2HHHM 2WSFF 2DI0A 2ZTDA 3FUVA 5IREB 4F1IA 2QHOB 5EXSA 4L16A 3TWLA 4X65M 3E21A 3NWLA 2LBCA 4M9ZA 1OIPA 5ITRA 4FWGA 2C99A 2R4JA 3B89A 3LCUA 5KO3A 2CP8A 2JY7A 4DV1M 4HEOA 2R44A 1Z5CA 3FYDA 4LFCM 5DYIA 2D7GA 1S3SA 4JI5M 1HT1E 1T6OA 1ZMUA 4GEWA 2ZAOA 5ITXA 1YUBA 3D8LA 5C18A 2G5GX 1VEJA 2DENA 3HHZA 3PFIA 4MGIE 4HL4A 3GLGE 1IN5A 1RU3A 1DO2A 2LNHC 2BWBA 4JI6M 2JY8A 1DGFA 2VF7A 2DZOB 2DNAA 2OOBA 2R65A 3J27B 4PD2A 4QOSA 4AQYM 1K3WA 5FTLA 1L8QA 2KNAA 2CV0A 1IN8A 2DAEA 4WP2A 2CHQA 1PRBA 1QANA 4R7GA 1Z5AA 4LRSA 3SMPA 2R4EA 1BVSA 1L1TA 2E5LM 5FTNA 5BR8M 2DWNA 2OOAA 4OW0A 4NRVA 2X8AA 4MH0E 3GRUA 4B7FA 5DNYA 1XWIA 2O5RA 4FD2A 4GMQA 2Y0TA 2QCUA 3UJNA 1GJSA 4QHSA 3T6PA 4L15A 2WSCF 4PT5A 4DR4M 1DGBA 3CF0A 3TPZA 4LF5M 1JR3E 3C9PA 4DV6M 1UFZA 1EFUB 3FUUA 3H4MA 1QZMA 2HKJA 4M9SA 3DOAA 1L2DA 1ZMWA 2KRUA 3GLIA 1NNUC 1JR3D 4DR3M 1PJTA 3OTOM 3U61B 1VEKA 1KSFX 8CATA 5E26A 1WGLA 1VDLA 2EKFA 2RGOA 4XGIA 2QSFX 7CATA 4JI8M 3BOSA 1V92A 3U6EA 1QDRA 1HJPA 1GKIA 2GQFA 3FRIA 2WSEF 2QZ4A 2QNJA 2LXEA 1QDTA 4OVZB 2R0IA 3UZUA 4LY6A 3TQSA 3U60B 3A42A 3AKZA 1EE8A 3TE6A 3KSXA 2KNZA 3HX3A 3B7NA 1E9SA 1QVRA 2J5YA 2XZUA 2DAIA 4HLQA 4RKUF 1NSFA 2CHVA 4R3DA 1QAMA 3BBZA 2MR9A 1I4WA 2NQ8C 3MK6A 4LGYA 2X4AA 3E4RA 2JY6B 2JWSA 4YHHM 4OU7A 2XH9A 4NL4H 2ZAMA 4IBBA 2CWBA 3U6QA 2CV2A 1L1ZA 1NHGC 2CEAA 2ZBKB 5JI3E 1DO0A 1WXQA 2DKLA 2XGNA 4NOOB 2DWZB 3K2LA 1D0KA 1P3QQ 3LQRA 3QWLA 1YE9A 3HWSA 5F3WA 2YQZA 3GRRA 3GLIE 4L8RC 1XXHE 3T15A 4AZFA 5IZ7D 3FKEA 4Y28F 2Y21A 4DR7M 1VEGA 3HY5A 3KXEC 3VLFB 5FTKA 1IN6A 1IXSB 3FTEA 1IQPA 1PJIA 2XLJA 4NXMM 5LMNM 4FWHA 3FRHA 3R8FA 1H6UA 3KP0E 3LMMA 4BLCA 2K9DA 1IM2A 1WR1B 1NVMA 2Q2EB 1XB2B 3BXWA 4LJ8A 2K6BA 3K1JA 3QYEA 3HKPA 1PJSA 3EIEA 4AG5A 4G6ZA 2XFTA 1NV9A 1IY1A 2ZANA 3F92A 1ZV1A 3PNYA 2D7EA 2UXDM 2EA0A 3KOYE 2UXCM 2MGWA 1D0MA 2CHGA 2VQEM 1OFHA 1IY2A 3KP1E 3KSJA 2FNAA 5H37D 1R7RA 3GQ5A 3J7BA 3MHVC 5EXXA 4GH9A 2QBYA 3SARA 1IXZA 4B3SM 1QZEA 2KDLA 3VFDA 2JP7A 4FCWA 2N35A 2DVWB 4NSOB 5EJCA 2DAMA 3U61A 1IBKM 1NY5A 4JXJA 2L4FA 2I7NA 1T43A 2C9OA 3HHXA 3CF6E 4W5WA 4AI6A 1HNZM 4Z6YA 1Q39A 4YY3M 2F5OA 1R6BX 2KZSA 4B08A 4A3VB 1N77A 3HGIA 1V33A 2Y0QA 1KYIA 1J5EM 2M5ZA 4D81A 3SAVA 2WZJA 3TWKA 1TH4A 4OX9M 4EIWA 2FH0A 2XZFA 4LJ5A 3HU1A 3VK7A 2F5NA 1MX0A 2DAGA 1J7KA 1N75A 4II7A 3GLIB 3GLFB 2RGHA 2QQ8A 1G41A 2KHHA 4LF4M 3R9XB 1C7YA 4LZJA 3JAMS 3KFUG 3KOZE 2LWXA 5ITTA 1GL7A 2CE7A 2DHRA 3HJ8A 1E9RA 4LJ6A 4NXNM 2XFSA 3I04M 1IN4A 4PCZA 1KFVA 4JI4M 1MU5A 1NO1A 3E46A 3SFZA 2F5PA 1OFIA 3SC3A 1ORYB 1K3XA 3SAUA 2L2DA 1JR3A 4FVMA 2RKOA 3SHFA 1SXJD 1MJGM 4DV0M 1TGUA 1XMQM 3Q8XA 4B3TM 2M60A 2EJSA 2R18A 3HHYA 4LZZA 4B3MM 3VDPA 1NJFA 2X49A 3KOXE 4MB7A 3J81S 3A46A 1HR0M 2MJ5B 5DFLA 1LV7A 4IJFA 4JN6A 3K9OA 1IBMM 1HNWM 3FUXA 2UXBM 4DR6M 3GLHA 2MROB 4IBEA 1Q3CA 3AOEC 3FUWA 1N34M 3CTWB 2F5QA 1NJGA 5IT9S 4L78A 4MM3B 2LVQD 3SYLA 3ZC7B 3AOGA 1DV0A 5ITQA 2Z4SA 5A2QS 4L6V6 3UGJA 5ITUA 1XNQM 5LMUM 3SBJA 3I51A 3Q8GA 1GJTA 2EUCA 1R2ZA 2W82A 4RF0A 1Y8GA 4S12A 2VDBB 4M9XA 3ILKA 3DA1A 1SXJA 4LF9M 3KW6A 4X64M 3U6OA 3CGWA 2ZTCA 2UUAM 4LF8M 1PGYA 4GHAA 1ZAEA 4JI7M 1AIPC 1DGGA 3T1HM 2OPFA 2FOIC 4I5SA 2JY5A 3HJQA 2J7NA 2ERCA 4IJEA 4CJ6A 1HT2E 2DWLA 3L25A 1V34A 4KHPM 2K47A 1OKSA 1SXJE 2JZ1A 4G3OA 2VF8A 4MGKE 4NSRA 5EP2A 2QBYB 1MN3A 2L7IA 4XBOA 3KS8A 4PDIA 4JYAM 1L2CA 4DV5M 3V76A 4AW4A 3PNVA 2C9CA 1QUTA 1N78A 4R71A 4LGMA 5JI2E 3TWMA 3GLHE 1WHCA 4JI3M 3MMPA 3GPUA 1PM5A 4X66M 2G8LA 4AG6A 1JQJC 5KPZA 1WIVA 3FTDA 3NBIA 1FNNA 4LF7M 2YFQA 2UU9M 1TR8A 2V1CA 1VQ1A 4GKKM 3NBXX 4GITA 4JI2M 5EP1A 1Z5BA 2L09A 3U6MA 3A45A 1IFYA 1IXSA 2LVAA 4NRWA 4FWDA 1D0LA 1G3IA 2KA6B 3FE3A 3HJSA 3HU3A 4M0WA 4PDGA 3IHPA 3DZDA 3KOWE 4F2LA 4ITQA 4LJAA 3U60A 1Q02A 3RE8A 4I4LA 2BWEA 5ITYA 4CHTB 2LVOC 3VK8A 2LH0A 1G71A 2GNOA 5C1BA 2DWMA 4GC5A 1FJGM 3PXGA 3J2PB 3LVVA 5FSWA 2JUJA 4JV5M 3W68A 4IBFA 3AJIB 4ANRA 3GO8A 4DR5M 4L4UA 3AV0A 2HAKA 1TTEA 1WGNA 2H5XA 1TF0B 3RGSA 4DR2M 4Z8XA 4DUYM 1A5TA 5FLXS 1W5TA 2AHMA 3AL0C 2LHCA 4DR1M 5EP4A 5FTMA 3KDSE 1PJJA 1DGHB 2L4EA 4QNRA 2KEBA 2J7OA 3IG5A 3SYKA 3GQ4A 3IG8A 1SG9A 3MJ5A 4DV4M 1W5SA 1WJ7A 2HCBA 3KVWA 3C58A 4LJ4A 2R46A 4MGHA 5KQDA 3T1YM 3U6DA 2V1UA 2JNHA 2DZNB 4REZA 3SASA 1I94M 2DHYA 4GHLA 2C96A 1Z59A 3RGPA 1L2BA 1VDDA 3U5ZA 5L8RF 3AFHA 4MGYE 3L29A 4B7GA 3GP1A 2LTUA 1NNJA 2LVPC 3K8ZA 2JA2A 4CIZA 3UMMA 4JI1M 4IIWA 2B3TA 1TH3A 4GIPA 4UN2B 1GABA 1OIZA 2D7HA 3E9SA 1OJLA 2EKKA 1VG5A 3HZJA 2Z8YM 3J7AS 4B7HA 3B7ZA 2BJWA 2DXIA 4LFBM 3GLGA 1AUAA 1NHWC 1UM8A 3M7GA 1J09A 3W0FA 1TH2A 4DV2M 3LCVB 3EIHA 3ZH9B 1GO5A 1XXHB 2XSZA 3W0LB 5KPRA 3SATA 2CFOA 2Z3XA 4QHTA 4WW0A 4G4OA 1XC8A 4I81A 3GPPA 4CISA 5BPVA 2QENA 3GRYA 1DGHA 2EO2A 5FTJA 4IBKA 1X37A 5ITXE 5E6JA 5EXTA 1GLNA 1T3TA 2Z7JA 3FTFA 4AKHA 2O25A 1OAIA 4KO8A 5KPTA 3U6LA 2OQ4A 4MGZE 4LJ7A 1Z6TA 1XNRM 2F5SA 3ZQJA 3GLFA 1E32A 1OTRA 4WURA 1YLAA 1R4GA 3GLHB 1JB0F 4XK8F 4G4QA 4AKGA 3U5ZB 4LRTA 1ZMVA 3W67A 3GRVA 4G4NA 4LCBA 2DAKA 2YR0A 1XHBA 1ZQ9A 1F4IA 3RFWA 3THGA 2HWJA 1Q3BA 1OQYA 3M6AA 2YNMD 3GPXA 4LFAM 4IBGA 2QP9X 3FUTA 4IBIA 4ZPXA 1NY6A 4GC9A 3QYBA 3GQ3A 3U6PA 2RRUA 4P16A 4TUWA 3HHWA 3GPYA 1QQWA 2Y20A 1C1KA 4P17A 3I4VA 1HQCA 2VIIA 2G3QA 5EXPA 2L7HA 1IXRC 2R62A 4GRIA 4QNMA 4RNAA 1TDHA 1PJQA 4FCTA 4DUZM 3TL4X 2FE8A 3K9PA 3UK6A 1QAOA 4DV3M 2C5RA 2HL7A 2XSZD 4Q7JA 1HQYE 3CF2A 2CV1A 2JXNA 2CRUA 2A5YB 2APLA 1CUKA 2CUZA 2KRKA 3I01M 3PVSA 5DYGA 2KW0A 4KODA 1N33M 1HNXM 2UUBM 3GLFE 4LF6M 2JZ0A 3SHGB 4LJ9A 1G59A 2KXEA 3HU2A 1E94E 1IN7A 4IBDA 4DV7M 1LTMA 3T38A 3FYCA 3U6SA 3DFZA 3C3DA 4FW9A 3J80S 4D82A 2R45A 2V6ZM 1YSYA 3FTCA 5GKNA 3JR4A 2BJVA 2I7PA 2XF3A 2Z4RA 3QAUA 4DBGB 1N36M 4BB9A 4LG2A 4I8OA 3SAWA 3LQQA 3IECA 3L27A 3M0EA 4IBCA 2F4VM 2UUCM 3I4YA 4CGYB 1XXHA 3C3EA 3L28A 4GKJM 3L26A 2OO9A 1D2NA 1SXJB 2DZLA 4AKIA 2ZM6M 1R2YA 1G4AE 1G8PA 3D8BA 3GLGB 4FCVA 1GL6A 2MH8A 4JI0M 2QPAA 3L2AA 4D80A 4IBJA 3U6CA 3KS4A 4M0DA 1QAQA 3B74A 1N32M 5KQ8A 1XMOM 5EQTA 3SMSA 1TDZA 4KT0F 1EIJA 3ZCBB 2H1RA 3H4JA 4X62M 2LVNC 3VDUA 2K0BX 4KLNA 5IWAM 4K0KM 2LHGA 2XEPA 4QOZC 2KZUA 3VKHA 3B7QA 3A98B 1IY0A 2FFJA 2FS1A 2P5TA 4NC6A 1GVNA 1QUSA 2VQFM 3AOEA 3FD9A 1QYRA 5EP3A 3LVWA 4BBAA
chains in the Genus database with same CATH topology
2KNVA 2CWBA 1DO0A 2DKLA 1NV8A 1P3QQ 1Y8GA 3GLIE 1XXHE 2DI0A 2ZTCA 2ZTDA 1PGYA 4F1IA 2QHOB 3E21A 1VEGA 1AIPC 2O25A 1OAIA 2LBCA 2JY5A 3B89A 3LCUA 1HT2E 2CP8A 2JY7A 4HEOA 3FRHA 1OKSA 1OTRA 2JZ1A 1YLAA 4G3OA 1R4GA 1HT1E 1T6OA 1ZMUA 1MN3A 2K9DA 4GEWA 1IM2A 1ZMVA 1WR1B 2DAKA 1XB2B 1F4IA 1VEJA 2DENA 2HWJA 1OQYA 4R71A 5JI2E 3GLHE 1NV9A 1WHCA 3MMPA 3F92A 1ZV1A 3GLGE 1WIVA 1DO2A 2MGWA 2BWBA 1TR8A 1VQ1A 2RRUA 2JY8A 2DNAA 2OOBA 1QZEA 2G3QA 2JP7A 2KNAA 1IFYA 2DAEA 1IXSA 2DAMA 2LVAA 4WP2A 1G3IA 3FE3A 2L4FA 1T43A 3K9PA 3IHPA 1BVSA 4F2LA 4Q7JA 1HQYE 1Q02A 2BWEA 2OOAA 1CUKA 2LVOC 3GLFE 1KYIA 2JUJA 2JZ0A 2WZJA 2HAKA 1E94E 1TTEA 1WGNA 2H5XA 3T6PA 1A5TA 2DAGA 1G41A 1JR3E 2KHHA 2L4EA 4DBGB 1UFZA 1EFUB 1C7YA 3IECA 1SG9A 1ZMWA 1WJ7A 1VEKA 2OO9A 1WGLA 2EKFA 1VDLA 3E46A 2QSFX 2DZLA 1G4AE 2JNHA 1V92A 2L2DA 1HJPA 2DHYA 3FRIA 2QNJA 2R0IA 2LTUA 2LVPC 2EJSA 2B3TA 4UN2B 2KNZA 3H4JA 2MJ5B 5DFLA 2LVNC 2K0BX 2EKKA 3K9OA 1VG5A 2DAIA 2MROB 2LVQD 3BBZA 2MR9A 3LCVB 1DV0A 2JY6B 1GO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNV A;  2CWB A;  1DO0 A;  2DKL A;  1NV8 A;  1P3Q Q;  1Y8G A;  3GLI E;  1XXH E;  2DI0 A;  2ZTC A;  2ZTD A;  1PGY A;  4F1I A;  2QHO B;  3E21 A;  1VEG A;  1AIP C;  2O25 A;  1OAI A;  2LBC A;  2JY5 A;  3B89 A;  3LCU A;  1HT2 E;  2CP8 A;  2JY7 A;  4HEO A;  3FRH A;  1OKS A;  1OTR A;  2JZ1 A;  1YLA A;  4G3O A;  1R4G A;  1HT1 E;  1T6O A;  1ZMU A;  1MN3 A;  2K9D A;  4GEW A;  1IM2 A;  1ZMV A;  1WR1 B;  2DAK A;  1XB2 B;  1F4I A;  1VEJ A;  2DEN A;  2HWJ A;  1OQY A;  4R71 A;  5JI2 E;  3GLH E;  1NV9 A;  1WHC A;  3MMP A;  3F92 A;  1ZV1 A;  3GLG E;  1WIV A;  1DO2 A;  2MGW A;  2BWB A;  1TR8 A;  1VQ1 A;  2RRU A;  2JY8 A;  2DNA A;  2OOB A;  1QZE A;  2G3Q A;  2JP7 A;  2KNA A;  1IFY A;  2DAE A;  1IXS A;  2DAM A;  2LVA A;  4WP2 A;  1G3I A;  3FE3 A;  2L4F A;  1T43 A;  3K9P A;  3IHP A;  1BVS A;  4F2L A;  4Q7J A;  1HQY E;  1Q02 A;  2BWE A;  2OOA A;  1CUK A;  2LVO C;  3GLF E;  1KYI A;  2JUJ A;  2JZ0 A;  2WZJ A;  2HAK A;  1E94 E;  1TTE A;  1WGN A;  2H5X A;  3T6P A;  1A5T A;  2DAG A;  1G41 A;  1JR3 E;  2KHH A;  2L4E A;  4DBG B;  1UFZ A;  1EFU B;  1C7Y A;  3IEC A;  1SG9 A;  1ZMW A;  1WJ7 A;  1VEK A;  2OO9 A;  1WGL A;  2EKF A;  1VDL A;  3E46 A;  2QSF X;  2DZL A;  1G4A E;  2JNH A;  1V92 A;  2L2D A;  1HJP A;  2DHY A;  3FRI A;  2QNJ A;  2R0I A;  2LTU A;  2LVP C;  2EJS A;  2B3T A;  4UN2 B;  2KNZ A;  3H4J A;  2MJ5 B;  5DFL A;  2LVN C;  2K0B X;  2EKK A;  3K9O A;  1VG5 A;  2DAI A;  2MRO B;  2LVQ D;  3BBZ A;  2MR9 A;  3LCV B;  1DV0 A;  2JY6 B;  1GO5 A; 
#chains in the Genus database with same CATH topology
 2KNV A;  2O01 F;  4B3R M;  4RF1 A;  2R6F A;  1R5L A;  1SXJ C;  2L6O A;  3LW5 F;  3B9P A;  4OVZ A;  3JR5 A;  1IBL M;  1NV8 A;  2BNK A;  2C98 A;  3WHL A;  1K82 A;  3VKG A;  3WHK A;  1OAO C;  4G4R A;  3K92 A;  2HHH M;  2WSF F;  2DI0 A;  2ZTD A;  3FUV A;  5IRE B;  4F1I A;  2QHO B;  5EXS A;  4L16 A;  3TWL A;  4X65 M;  3E21 A;  3NWL A;  2LBC A;  4M9Z A;  1OIP A;  5ITR A;  4FWG A;  2C99 A;  2R4J A;  3B89 A;  3LCU A;  5KO3 A;  2CP8 A;  2JY7 A;  4DV1 M;  4HEO A;  2R44 A;  1Z5C A;  3FYD A;  4LFC M;  5DYI A;  2D7G A;  1S3S A;  4JI5 M;  1HT1 E;  1T6O A;  1ZMU A;  4GEW A;  2ZAO A;  5ITX A;  1YUB A;  3D8L A;  5C18 A;  2G5G X;  1VEJ A;  2DEN A;  3HHZ A;  3PFI A;  4MGI E;  4HL4 A;  3GLG E;  1IN5 A;  1RU3 A;  1DO2 A;  2LNH C;  2BWB A;  4JI6 M;  2JY8 A;  1DGF A;  2VF7 A;  2DZO B;  2DNA A;  2OOB A;  2R65 A;  3J27 B;  4PD2 A;  4QOS A;  4AQY M;  1K3W A;  5FTL A;  1L8Q A;  2KNA A;  2CV0 A;  1IN8 A;  2DAE A;  4WP2 A;  2CHQ A;  1PRB A;  1QAN A;  4R7G A;  1Z5A A;  4LRS A;  3SMP A;  2R4E A;  1BVS A;  1L1T A;  2E5L M;  5FTN A;  5BR8 M;  2DWN A;  2OOA A;  4OW0 A;  4NRV A;  2X8A A;  4MH0 E;  3GRU A;  4B7F A;  5DNY A;  1XWI A;  2O5R A;  4FD2 A;  4GMQ A;  2Y0T A;  2QCU A;  3UJN A;  1GJS A;  4QHS A;  3T6P A;  4L15 A;  2WSC F;  4PT5 A;  4DR4 M;  1DGB A;  3CF0 A;  3TPZ A;  4LF5 M;  1JR3 E;  3C9P A;  4DV6 M;  1UFZ A;  1EFU B;  3FUU A;  3H4M A;  1QZM A;  2HKJ A;  4M9S A;  3DOA A;  1L2D A;  1ZMW A;  2KRU A;  3GLI A;  1NNU C;  1JR3 D;  4DR3 M;  1PJT A;  3OTO M;  3U61 B;  1VEK A;  1KSF X;  8CAT A;  5E26 A;  1WGL A;  1VDL A;  2EKF A;  2RGO A;  4XGI A;  2QSF X;  7CAT A;  4JI8 M;  3BOS A;  1V92 A;  3U6E A;  1QDR A;  1HJP A;  1GKI A;  2GQF A;  3FRI A;  2WSE F;  2QZ4 A;  2QNJ A;  2LXE A;  1QDT A;  4OVZ B;  2R0I A;  3UZU A;  4LY6 A;  3TQS A;  3U60 B;  3A42 A;  3AKZ A;  1EE8 A;  3TE6 A;  3KSX A;  2KNZ A;  3HX3 A;  3B7N A;  1E9S A;  1QVR A;  2J5Y A;  2XZU A;  2DAI A;  4HLQ A;  4RKU F;  1NSF A;  2CHV A;  4R3D A;  1QAM A;  3BBZ A;  2MR9 A;  1I4W A;  2NQ8 C;  3MK6 A;  4LGY A;  2X4A A;  3E4R A;  2JY6 B;  2JWS A;  4YHH M;  4OU7 A;  2XH9 A;  4NL4 H;  2ZAM A;  4IBB A;  2CWB A;  3U6Q A;  2CV2 A;  1L1Z A;  1NHG C;  2CEA A;  2ZBK B;  5JI3 E;  1DO0 A;  1WXQ A;  2DKL A;  2XGN A;  4NOO B;  2DWZ B;  3K2L A;  1D0K A;  1P3Q Q;  3LQR A;  3QWL A;  1YE9 A;  3HWS A;  5F3W A;  2YQZ A;  3GRR A;  3GLI E;  4L8R C;  1XXH E;  3T15 A;  4AZF A;  5IZ7 D;  3FKE A;  4Y28 F;  2Y21 A;  4DR7 M;  1VEG A;  3HY5 A;  3KXE C;  3VLF B;  5FTK A;  1IN6 A;  1IXS B;  3FTE A;  1IQP A;  1PJI A;  2XLJ A;  4NXM M;  5LMN M;  4FWH A;  3FRH A;  3R8F A;  1H6U A;  3KP0 E;  3LMM A;  4BLC A;  2K9D A;  1IM2 A;  1WR1 B;  1NVM A;  2Q2E B;  1XB2 B;  3BXW A;  4LJ8 A;  2K6B A;  3K1J A;  3QYE A;  3HKP A;  1PJS A;  3EIE A;  4AG5 A;  4G6Z A;  2XFT A;  1NV9 A;  1IY1 A;  2ZAN A;  3F92 A;  1ZV1 A;  3PNY A;  2D7E A;  2UXD M;  2EA0 A;  3KOY E;  2UXC M;  2MGW A;  1D0M A;  2CHG A;  2VQE M;  1OFH A;  1IY2 A;  3KP1 E;  3KSJ A;  2FNA A;  5H37 D;  1R7R A;  3GQ5 A;  3J7B A;  3MHV C;  5EXX A;  4GH9 A;  2QBY A;  3SAR A;  1IXZ A;  4B3S M;  1QZE A;  2KDL A;  3VFD A;  2JP7 A;  4FCW A;  2N35 A;  2DVW B;  4NSO B;  5EJC A;  2DAM A;  3U61 A;  1IBK M;  1NY5 A;  4JXJ A;  2L4F A;  2I7N A;  1T43 A;  2C9O A;  3HHX A;  3CF6 E;  4W5W A;  4AI6 A;  1HNZ M;  4Z6Y A;  1Q39 A;  4YY3 M;  2F5O A;  1R6B X;  2KZS A;  4B08 A;  4A3V B;  1N77 A;  3HGI A;  1V33 A;  2Y0Q A;  1KYI A;  1J5E M;  2M5Z A;  4D81 A;  3SAV A;  2WZJ A;  3TWK A;  1TH4 A;  4OX9 M;  4EIW A;  2FH0 A;  2XZF A;  4LJ5 A;  3HU1 A;  3VK7 A;  2F5N A;  1MX0 A;  2DAG A;  1J7K A;  1N75 A;  4II7 A;  3GLI B;  3GLF B;  2RGH A;  2QQ8 A;  1G41 A;  2KHH A;  4LF4 M;  3R9X B;  1C7Y A;  4LZJ A;  3JAM S;  3KFU G;  3KOZ E;  2LWX A;  5ITT A;  1GL7 A;  2CE7 A;  2DHR A;  3HJ8 A;  1E9R A;  4LJ6 A;  4NXN M;  2XFS A;  3I04 M;  1IN4 A;  4PCZ A;  1KFV A;  4JI4 M;  1MU5 A;  1NO1 A;  3E46 A;  3SFZ A;  2F5P A;  1OFI A;  3SC3 A;  1ORY B;  1K3X A;  3SAU A;  2L2D A;  1JR3 A;  4FVM A;  2RKO A;  3SHF A;  1SXJ D;  1MJG M;  4DV0 M;  1TGU A;  1XMQ M;  3Q8X A;  4B3T M;  2M60 A;  2EJS A;  2R18 A;  3HHY A;  4LZZ A;  4B3M M;  3VDP A;  1NJF A;  2X49 A;  3KOX E;  4MB7 A;  3J81 S;  3A46 A;  1HR0 M;  2MJ5 B;  5DFL A;  1LV7 A;  4IJF A;  4JN6 A;  3K9O A;  1IBM M;  1HNW M;  3FUX A;  2UXB M;  4DR6 M;  3GLH A;  2MRO B;  4IBE A;  1Q3C A;  3AOE C;  3FUW A;  1N34 M;  3CTW B;  2F5Q A;  1NJG A;  5IT9 S;  4L78 A;  4MM3 B;  2LVQ D;  3SYL A;  3ZC7 B;  3AOG A;  1DV0 A;  5ITQ A;  2Z4S A;  5A2Q S;  4L6V 6;  3UGJ A;  5ITU A;  1XNQ M;  5LMU M;  3SBJ A;  3I51 A;  3Q8G A;  1GJT A;  2EUC A;  1R2Z A;  2W82 A;  4RF0 A;  1Y8G A;  4S12 A;  2VDB B;  4M9X A;  3ILK A;  3DA1 A;  1SXJ A;  4LF9 M;  3KW6 A;  4X64 M;  3U6O A;  3CGW A;  2ZTC A;  2UUA M;  4LF8 M;  1PGY A;  4GHA A;  1ZAE A;  4JI7 M;  1AIP C;  1DGG A;  3T1H M;  2OPF A;  2FOI C;  4I5S A;  2JY5 A;  3HJQ A;  2J7N A;  2ERC A;  4IJE A;  4CJ6 A;  1HT2 E;  2DWL A;  3L25 A;  1V34 A;  4KHP M;  2K47 A;  1OKS A;  1SXJ E;  2JZ1 A;  4G3O A;  2VF8 A;  4MGK E;  4NSR A;  5EP2 A;  2QBY B;  1MN3 A;  2L7I A;  4XBO A;  3KS8 A;  4PDI A;  4JYA M;  1L2C A;  4DV5 M;  3V76 A;  4AW4 A;  3PNV A;  2C9C A;  1QUT A;  1N78 A;  4R71 A;  4LGM A;  5JI2 E;  3TWM A;  3GLH E;  1WHC A;  4JI3 M;  3MMP A;  3GPU A;  1PM5 A;  4X66 M;  2G8L A;  4AG6 A;  1JQJ C;  5KPZ A;  1WIV A;  3FTD A;  3NBI A;  1FNN A;  4LF7 M;  2YFQ A;  2UU9 M;  1TR8 A;  2V1C A;  1VQ1 A;  4GKK M;  3NBX X;  4GIT A;  4JI2 M;  5EP1 A;  1Z5B A;  2L09 A;  3U6M A;  3A45 A;  1IFY A;  1IXS A;  2LVA A;  4NRW A;  4FWD A;  1D0L A;  1G3I A;  2KA6 B;  3FE3 A;  3HJS A;  3HU3 A;  4M0W A;  4PDG A;  3IHP A;  3DZD A;  3KOW E;  4F2L A;  4ITQ A;  4LJA A;  3U60 A;  1Q02 A;  3RE8 A;  4I4L A;  2BWE A;  5ITY A;  4CHT B;  2LVO C;  3VK8 A;  2LH0 A;  1G71 A;  2GNO A;  5C1B A;  2DWM A;  4GC5 A;  1FJG M;  3PXG A;  3J2P B;  3LVV A;  5FSW A;  2JUJ A;  4JV5 M;  3W68 A;  4IBF A;  3AJI B;  4ANR A;  3GO8 A;  4DR5 M;  4L4U A;  3AV0 A;  2HAK A;  1TTE A;  1WGN A;  2H5X A;  1TF0 B;  3RGS A;  4DR2 M;  4Z8X A;  4DUY M;  1A5T A;  5FLX S;  1W5T A;  2AHM A;  3AL0 C;  2LHC A;  4DR1 M;  5EP4 A;  5FTM A;  3KDS E;  1PJJ A;  1DGH B;  2L4E A;  4QNR A;  2KEB A;  2J7O A;  3IG5 A;  3SYK A;  3GQ4 A;  3IG8 A;  1SG9 A;  3MJ5 A;  4DV4 M;  1W5S A;  1WJ7 A;  2HCB A;  3KVW A;  3C58 A;  4LJ4 A;  2R46 A;  4MGH A;  5KQD A;  3T1Y M;  3U6D A;  2V1U A;  2JNH A;  2DZN B;  4REZ A;  3SAS A;  1I94 M;  2DHY A;  4GHL A;  2C96 A;  1Z59 A;  3RGP A;  1L2B A;  1VDD A;  3U5Z A;  5L8R F;  3AFH A;  4MGY E;  3L29 A;  4B7G A;  3GP1 A;  2LTU A;  1NNJ A;  2LVP C;  3K8Z A;  2JA2 A;  4CIZ A;  3UMM A;  4JI1 M;  4IIW A;  2B3T A;  1TH3 A;  4GIP A;  4UN2 B;  1GAB A;  1OIZ A;  2D7H A;  3E9S A;  1OJL A;  2EKK A;  1VG5 A;  3HZJ A;  2Z8Y M;  3J7A S;  4B7H A;  3B7Z A;  2BJW A;  2DXI A;  4LFB M;  3GLG A;  1AUA A;  1NHW C;  1UM8 A;  3M7G A;  1J09 A;  3W0F A;  1TH2 A;  4DV2 M;  3LCV B;  3EIH A;  3ZH9 B;  1GO5 A;  1XXH B;  2XSZ A;  3W0L B;  5KPR A;  3SAT A;  2CFO A;  2Z3X A;  4QHT A;  4WW0 A;  4G4O A;  1XC8 A;  4I81 A;  3GPP A;  4CIS A;  5BPV A;  2QEN A;  3GRY A;  1DGH A;  2EO2 A;  5FTJ A;  4IBK A;  1X37 A;  5ITX E;  5E6J A;  5EXT A;  1GLN A;  1T3T A;  2Z7J A;  3FTF A;  4AKH A;  2O25 A;  1OAI A;  4KO8 A;  5KPT A;  3U6L A;  2OQ4 A;  4MGZ E;  4LJ7 A;  1Z6T A;  1XNR M;  2F5S A;  3ZQJ A;  3GLF A;  1E32 A;  1OTR A;  4WUR A;  1YLA A;  1R4G A;  3GLH B;  1JB0 F;  4XK8 F;  4G4Q A;  4AKG A;  3U5Z B;  4LRT A;  1ZMV A;  3W67 A;  3GRV A;  4G4N A;  4LCB A;  2DAK A;  2YR0 A;  1XHB A;  1ZQ9 A;  1F4I A;  3RFW A;  3THG A;  2HWJ A;  1Q3B A;  1OQY A;  3M6A A;  2YNM D;  3GPX A;  4LFA M;  4IBG A;  2QP9 X;  3FUT A;  4IBI A;  4ZPX A;  1NY6 A;  4GC9 A;  3QYB A;  3GQ3 A;  3U6P A;  2RRU A;  4P16 A;  4TUW A;  3HHW A;  3GPY A;  1QQW A;  2Y20 A;  1C1K A;  4P17 A;  3I4V A;  1HQC A;  2VII A;  2G3Q A;  5EXP A;  2L7H A;  1IXR C;  2R62 A;  4GRI A;  4QNM A;  4RNA A;  1TDH A;  1PJQ A;  4FCT A;  4DUZ M;  3TL4 X;  2FE8 A;  3K9P A;  3UK6 A;  1QAO A;  4DV3 M;  2C5R A;  2HL7 A;  2XSZ D;  4Q7J A;  1HQY E;  3CF2 A;  2CV1 A;  2JXN A;  2CRU A;  2A5Y B;  2APL A;  1CUK A;  2CUZ A;  2KRK A;  3I01 M;  3PVS A;  5DYG A;  2KW0 A;  4KOD A;  1N33 M;  1HNX M;  2UUB M;  3GLF E;  4LF6 M;  2JZ0 A;  3SHG B;  4LJ9 A;  1G59 A;  2KXE A;  3HU2 A;  1E94 E;  1IN7 A;  4IBD A;  4DV7 M;  1LTM A;  3T38 A;  3FYC A;  3U6S A;  3DFZ A;  3C3D A;  4FW9 A;  3J80 S;  4D82 A;  2R45 A;  2V6Z M;  1YSY A;  3FTC A;  5GKN A;  3JR4 A;  2BJV A;  2I7P A;  2XF3 A;  2Z4R A;  3QAU A;  4DBG B;  1N36 M;  4BB9 A;  4LG2 A;  4I8O A;  3SAW A;  3LQQ A;  3IEC A;  3L27 A;  3M0E A;  4IBC A;  2F4V M;  2UUC M;  3I4Y A;  4CGY B;  1XXH A;  3C3E A;  3L28 A;  4GKJ M;  3L26 A;  2OO9 A;  1D2N A;  1SXJ B;  2DZL A;  4AKI A;  2ZM6 M;  1R2Y A;  1G4A E;  1G8P A;  3D8B A;  3GLG B;  4FCV A;  1GL6 A;  2MH8 A;  4JI0 M;  2QPA A;  3L2A A;  4D80 A;  4IBJ A;  3U6C A;  3KS4 A;  4M0D A;  1QAQ A;  3B74 A;  1N32 M;  5KQ8 A;  1XMO M;  5EQT A;  3SMS A;  1TDZ A;  4KT0 F;  1EIJ A;  3ZCB B;  2H1R A;  3H4J A;  4X62 M;  2LVN C;  3VDU A;  2K0B X;  4KLN A;  5IWA M;  4K0K M;  2LHG A;  2XEP A;  4QOZ C;  2KZU A;  3VKH A;  3B7Q A;  3A98 B;  1IY0 A;  2FFJ A;  2FS1 A;  2P5T A;  4NC6 A;  1GVN A;  1QUS A;  2VQF M;  3AOE A;  3FD9 A;  1QYR A;  5EP3 A;  3LVW A;  4BBA A; 
#chains in the Genus database with same CATH homology
 2KNV A;  2CWB A;  1DO0 A;  2DKL A;  1NV8 A;  1P3Q Q;  1Y8G A;  3GLI E;  1XXH E;  2DI0 A;  2ZTC A;  2ZTD A;  1PGY A;  4F1I A;  2QHO B;  3E21 A;  1VEG A;  1AIP C;  2O25 A;  1OAI A;  2LBC A;  2JY5 A;  3B89 A;  3LCU A;  1HT2 E;  2CP8 A;  2JY7 A;  4HEO A;  3FRH A;  1OKS A;  1OTR A;  2JZ1 A;  1YLA A;  4G3O A;  1R4G A;  1HT1 E;  1T6O A;  1ZMU A;  1MN3 A;  2K9D A;  4GEW A;  1IM2 A;  1ZMV A;  1WR1 B;  2DAK A;  1XB2 B;  1F4I A;  1VEJ A;  2DEN A;  2HWJ A;  1OQY A;  4R71 A;  5JI2 E;  3GLH E;  1NV9 A;  1WHC A;  3MMP A;  3F92 A;  1ZV1 A;  3GLG E;  1WIV A;  1DO2 A;  2MGW A;  2BWB A;  1TR8 A;  1VQ1 A;  2RRU A;  2JY8 A;  2DNA A;  2OOB A;  1QZE A;  2G3Q A;  2JP7 A;  2KNA A;  1IFY A;  2DAE A;  1IXS A;  2DAM A;  2LVA A;  4WP2 A;  1G3I A;  3FE3 A;  2L4F A;  1T43 A;  3K9P A;  3IHP A;  1BVS A;  4F2L A;  4Q7J A;  1HQY E;  1Q02 A;  2BWE A;  2OOA A;  1CUK A;  2LVO C;  3GLF E;  1KYI A;  2JUJ A;  2JZ0 A;  2WZJ A;  2HAK A;  1E94 E;  1TTE A;  1WGN A;  2H5X A;  3T6P A;  1A5T A;  2DAG A;  1G41 A;  1JR3 E;  2KHH A;  2L4E A;  4DBG B;  1UFZ A;  1EFU B;  1C7Y A;  3IEC A;  1SG9 A;  1ZMW A;  1WJ7 A;  1VEK A;  2OO9 A;  1WGL A;  2EKF A;  1VDL A;  3E46 A;  2QSF X;  2DZL A;  1G4A E;  2JNH A;  1V92 A;  2L2D A;  1HJP A;  2DHY A;  3FRI A;  2QNJ A;  2R0I A;  2LTU A;  2LVP C;  2EJS A;  2B3T A;  4UN2 B;  2KNZ A;  3H4J A;  2MJ5 B;  5DFL A;  2LVN C;  2K0B X;  2EKK A;  3K9O A;  1VG5 A;  2DAI A;  2MRO B;  2LVQ D;  3BBZ A;  2MR9 A;  3LCV B;  1DV0 A;  2JY6 B;  1GO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...