4WP2A

Chaetomium mex67 uba domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
60
Chain Sequence
SNAATKAQLIAEVSRRTGMNVEYSQMLTGAANWNLELALQSFEQQKANVPPEAFISQPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Putative mRNA export protein
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 21
structure length 60
sequence length 61
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4wp2A00
4DBGB 2QHOB 2DI0A 2JNHA 3FRIA 1Q02A 1XB2B 1V92A 3FRHA 1WGLA 1EFUB 2K0BX 2OO9A 1DV0A 2LTUA 2KNVA 3BBZA 1WHCA 1GO5A 2QSFX 1UFZA 2CWBA 3FE3A 2MJ5B 2EKKA 1HJPA 3MMPA 1ZMVA 1R4GA 2DZLA 2KHHA 2R0IA 1HT2E 1MN3A 2BWBA 1OKSA 2L4EA 1WR1B 1VDLA 1VEGA 4WP2A 3GLGE 2O25A 2DKLA 2DAGA 3K9OA 2L4FA 2LVNC 1HT1E 2DHYA 2JY6B 2QNJA 4R71A 2HAKA 1G4AE 1IFYA 1P3QQ 4F2LA 3E21A 1ZV1A 1C7YA 1WIVA 1AIPC 1TTEA 3IECA 2OOAA 1TR8A 1IXSA 1YLAA 1KYIA 1VQ1A 1HQYE 1Y8GA 1DO2A 1A5TA 2LVAA 2ZTCA 1VEJA 1DO0A 3GLIE 2DAIA 4UN2B 2JY5A 2JUJA 3K9PA 2EKFA 2JZ0A 1F4IA 1NV8A 3LCVB 2LVQD 3GLFE 1CUKA 1WGNA 1G41A 1OTRA 3F92A 2JY7A 1XXHE 2OOBA 2DAKA 3LCUA 1ZMWA 1WJ7A 2BWEA 3E46A 1JR3E 3B89A 3H4JA 4F1IA 2CP8A 2KNAA 2MROB 1PGYA 1T6OA 2B3TA 1G3IA 4G3OA 2ZTDA 2RRUA 2DAEA 2LBCA 4GEWA 2K9DA 1SG9A 1VEKA 1VG5A 2HWJA 1OAIA 4HEOA 1T43A 2EJSA 2DAMA 3T6PA 2L2DA 5DFLA 1ZMUA 2DNAA 2DENA 2KNZA 1E94E 2G3QA 1IM2A 2JZ1A 1NV9A 3GLHE 2MGWA 2LVOC 2WZJA 1OQYA 2LVPC 2H5XA 3IHPA 2MR9A 1QZEA 4Q7JA 2JY8A 2JP7A 1BVSA 5JI2E
chains in the Genus database with same CATH superfamily
1HNWM 4DBGB 2QHOB 2DI0A 2JNHA 3C3DA 3FRIA 4M9XA 1Q02A 1H6UA 4LJ6A 4B7GA 4JN6A 3FRHA 3JAMS 4LJ4A 1X37A 3HHYA 3KP1E 1J7KA 2LTUA 3GPPA 3BBZA 4PD2A 2X4AA 2QSFX 1UFZA 5E6JA 2FNAA 2MJ5B 2H1RA 5DYGA 4JI1M 2CE7A 1ZMVA 3NBXX 4LJ5A 4LZZA 3RGPA 1OFIA 4RF1A 1HT2E 4MB7A 4LCBA 1OKSA 2Z4RA 3HJ8A 2G8LA 3HZJA 2QBYA 4BB9A 1IBKM 4GC5A 3OTOM 1VEGA 1NHWC 5IZ7D 2DKLA 4YHHM 2DAGA 1G71A 3C9PA 1N34M 4L8RC 2DHYA 2GNOA 3K2LA 3KOXE 3WHKA 2Y21A 3TL4X 5KO3A 3U6LA 2N35A 1TDZA 4IBKA 2UU9M 3QAUA 2QNJA 3W67A 4R71A 3NWLA 4PDGA 4MGZE 3U60B 3J81S 4KT0F 3E21A 3U61B 1C7YA 3BXWA 2P5TA 3L2AA 2F5SA 2UUBM 2OOAA 3T15A 4LF9M 4DR7M 4NC6A 1KYIA 4LRSA 3GP1A 4K0KM 2R6FA 1HQYE 1T3TA 4LF4M 1Y8GA 1PJJA 2LVAA 4JI7M 4CGYB 2FS1A 4DV2M 1VEJA 3GQ5A 4LGMA 1Z59A 4DR3M 4DV3M 2CFOA 3K92A 2JUJA 4EIWA 1QQWA 4DR5M 2NQ8C 1QAOA 4I8OA 1TH3A 3KSJA 3U6PA 3FYDA 3FUTA 8CATA 3HX3A 1D0KA 1IBLM 3LCVB 1L1ZA 1IN4A 1MX0A 2JWSA 5H37D 4LJ8A 3I4YA 5EXTA 4FCVA 2JA2A 3M6AA 3KVWA 2ZBKB 4FD2A 4B08A 3RFWA 2DWLA 3I51A 2XFSA 1GLNA 2QPAA 3B89A 3DFZA 3WHLA 2KRUA 1TF0B 3H4JA 4GIPA 1IN6A 2O01F 2KZSA 3LQQA 4QNMA 3RGSA 2DWZB 1XC8A 1ZQ9A 3E4RA 4NRWA 2KNAA 2MROB 1DGFA 5IWAM 4JV5M 2M5ZA 2B3TA 4LZJA 5FTNA 2HL7A 1G3IA 4DUZM 3LMMA 3GQ3A 4G3OA 2VQEM 2DVWB 3GLHB 1R2ZA 3NBIA 2DAEA 2LBCA 1EIJA 2UUAM 4JI8M 2Z7JA 3B7NA 1K82A 2QP9X 4OW0A 4NXNM 3U6OA 1GJSA 3ZC7B 2C9OA 2LWXA 3Q8XA 4X64M 1DGHA 3AKZA 3SARA 4LF5M 3HU1A 5DFLA 1IXZA 3AJIB 2L7HA 4M9SA 3LQRA 3V76A 3B74A 2KW0A 2DENA 1GVNA 1PJSA 2KNZA 3EIHA 3IG8A 4LFAM 1PRBA 2JZ1A 2RGOA 3T1HM 1NY5A 1XWIA 4AG6A 4Y28F 4FVMA 3HWSA 1NV9A 2CRUA 3HHZA 2J7NA 4QHTA 1SXJC 5EJCA 2WZJA 1XXHA 4NL4H 1XNRM 4AKGA 4JI5M 1NJFA 4L15A 2MR9A 1QZEA 4Q7JA 1V33A 1JR3A 1BVSA 1IBMM 3TE6A 4IBGA 7CATA 1QDRA 3B7QA 2K6BA 5IREB 1NNJA 1V92A 3SYLA 2K0BX 2C5RA 2I7NA 3D8LA 3GLIA 3L27A 4DR4M 1WHCA 1GO5A 5EP2A 4RKUF 1Z5AA 2KRKA 2YFQA 4IIWA 2AHMA 2R45A 1FJGM 1AUAA 4FWHA 4I4LA 3MMPA 5EP4A 4L6V6 1R4GA 2DZLA 1IY2A 2LNHC 4QOSA 2HHHM 2HCBA 1MN3A 3L29A 4AQYM 2BWBA 2K47A 2QZ4A 2XZUA 2R4JA 2J5YA 1OJLA 1VDLA 1QDTA 3FD9A 4WP2A 3GO8A 4QOZC 4G4RA 2O25A 1G59A 2CEAA 1K3WA 1JR3D 2F5PA 2L4FA 2R65A 2LVNC 2J7OA 4L78A 2JXNA 2Y20A 1NO1A 2Y0QA 3FTDA 2ZAMA 4NSOB 1JB0F 3TWLA 3ZH9B 5FTLA 4KODA 2XLJA 3W68A 1FNNA 1QANA 2Z3XA 4IBJA 4F2LA 2CUZA 4AG5A 4LGYA 2C99A 3I4VA 3U6MA 2BJVA 2A5YB 3AOEC 1L2DA 1TTEA 3A42A 1Z5BA 5ITUA 3ZQJA 3FUXA 1DGGA 2QBYB 1TR8A 1YLAA 4L16A 1VQ1A 3FTFA 5E26A 4AKIA 1A5TA 1QYRA 3GLIE 1E32A 1SXJA 3PFIA 4GHLA 1EE8A 2JY5A 3A45A 1JQJC 1VDDA 5ITXA 1PJTA 1MJGM 3K9PA 3U6EA 3RE8A 3CGWA 2EKFA 1D2NA 3DOAA 2V1CA 3U6QA 2XH9A 1Z5CA 5EXSA 1CUKA 4LF7M 1WGNA 1G41A 4FWGA 4MGHA 4CHTB 5A2QS 1OTRA 3EIEA 2DAKA 3FKEA 4OVZB 1WJ7A 3E46A 3U5ZA 3VDUA 3R9XB 2ZAOA 4NSRA 1GL7A 1TH4A 4GC9A 2XEPA 4DUYM 1QUSA 4HL4A 4G4OA 3GPUA 4B3SM 1G8PA 2CP8A 1Q39A 3DZDA 1PGYA 4GKKM 1SXJD 5BPVA 4IBDA 3I04M 1IQPA 3J80S 4DV4M 4PT5A 2K9DA 1SG9A 1TGUA 2HWJA 1VG5A 3SC3A 4YY3M 3SBJA 1OAIA 3GRRA 3SYKA 5ITTA 1QAQA 4G4QA 1E9SA 3VK8A 4GHAA 3L25A 2EJSA 1OIZA 3KW6A 1KSFX 3MK6A 3AV0A 3GPXA 2R18A 4JYAM 1ORYB 1SXJE 4AKHA 4I81A 2DZOB 3GLGA 5ITXE 2UXDM 1N32M 1NVMA 2XFTA 5KQDA 1E94E 3GRUA 3UK6A 1GL6A 3AOEA 2YR0A 2V6ZM 4FWDA 2L09A 4OX9M 3VKHA 3SHGB 4P17A 3FUWA 3J27B 2MGWA 2VDBB 1NSFA 4IBBA 3ILKA 1OQYA 4R7GA 3B9PA 4RF0A 1UM8A 2ZM6M 2ZANA 2JY8A 2VQFM 3CTWB 1GABA 4WW0A 4OU7A 5LMUM 2VIIA 4X65M 2D7GA 4D82A 4II7A 2ERCA 1Q3BA 1WGLA 1EFUB 2HKJA 3PNYA 2V1UA 3QYEA 3FYCA 3A98B 1R5LA 2FH0A 5KQ8A 4M0WA 4Z8XA 1DV0A 2KNVA 4D81A 4DV1M 3HKPA 2FOIC 4LJ7A 4ITQA 5FSWA 2CWBA 5EXXA 5FTJA 3FE3A 3GRVA 1XXHB 2EKKA 4DV7M 1HJPA 1IY1A 3I01M 2OPFA 4WURA 2YNMD 2R0IA 2YQZA 3GLFA 4IBCA 4XGIA 3R8FA 2L4EA 2L7IA 1PJIA 5BR8M 3CF0A 3Q8GA 2MH8A 3LVVA 1WR1B 4G4NA 1K3XA 4LF6M 3GLGE 3AOGA 4L4UA 3GLIB 4JI3M 1HT1E 5GKNA 5FLXS 1S3SA 3TQSA 4B3TM 4GKJM 3TWMA 4TUWA 4QNRA 1J09A 2FFJA 3UGJA 4QHSA 3SASA 2DWNA 1IFYA 4GRIA 3PVSA 3T38A 4PCZA 1ZV1A 1IY0A 1WIVA 1AIPC 4IBIA 4JI6M 3L26A 1R7RA 1HR0M 1IXSA 2KEBA 1NY6A 3HHWA 3D8BA 2QCUA 3KOZE 3VK7A 2CHGA 5FTMA 1TH2A 1J5EM 3CF6E 1DO0A 3TWKA 2DAIA 3GRYA 2WSFF 4CJ6A 2APLA 5ITYA 1IN5A 2O5RA 4UN2B 4B7FA 5EP1A 1L2BA 1NJGA 2JZ0A 1F4IA 2F5OA 3SAWA 2DHRA 2KZUA 4DR6M 4P16A 3GLFE 3HU3A 3SMSA 3GQ4A 2LHCA 4IBFA 3F92A 3QWLA 4KO8A 1XXHE 4CIZA 4CISA 4AI6A 2UXCM 1ZMWA 2RGHA 4M0DA 3BOSA 4B3MM 3VFDA 2CHQA 3A46A 3FUUA 3SAVA 1PJQA 2KA6B 2UUCM 4NXMM 1JR3E 1D0LA 4M9ZA 3M0EA 4S12A 1SXJB 4F1IA 4DV5M 1HNZM 2F5QA 3HY5A 4G6ZA 3KSXA 3J7BA 4DV6M 4LY6A 1I4WA 4IJFA 4FW9A 4ZPXA 3J7AS 2ZTDA 2WSCF 3U6CA 2XZFA 1N36M 4W5WA 1QZMA 1D0MA 1VEKA 2XGNA 3QYBA 1T43A 2LH0A 2CV2A 4LG2A 4AW4A 3U5ZB 2DAMA 3T6PA 2L2DA 5IT9S 2Z8YM 1ZMUA 4FCTA 4BBAA 5JI2E 1RU3A 1YSYA 2G3QA 3B7ZA 3KS4A 3W0FA 1R6BX 5C18A 1L2CA 3CF2A 3KDSE 5LMNM 2LXEA 2LHGA 2RKOA 2LVPC 4NRVA 4D80A 3IHPA 1GJTA 2Y0TA 3U6DA 2W82A 4KLNA 2DXIA 1IXRC 1Q3CA 3W0LB 1XB2B 5KPZA 2D7HA 3KS8A 2X8AA 4GITA 4JI0M 4AZFA 2XF3A 3GLGB 2M60A 1OAOC 2OO9A 1N78A 2C9CA 5L8RF 3MHVC 3LW5F 4ANRA 4JI4M 2KXEA 2Q2EB 3HJQA 3TPZA 1OIPA 4JI2M 3KOWE 4IJEA 4Z6YA 2UXBM 3U60A 1N75A 3SMPA 4MH0E 2R46A 2KHHA 5FTKA 4OVZA 1L8QA 5F3WA 3U61A 4LFCM 3SHFA 4LF8M 4NOOB 4LJAA 3PNVA 3T1YM 5EP3A 4BLCA 5KPTA 2F5NA 3HJSA 3MJ5A 2E5LM 3K9OA 1DGHB 2VF7A 3C3EA 3AFHA 4RNAA 1L1TA 2Z4SA 2JY6B 2CV0A 1QUTA 2WSEF 2BNKA 4LRTA 4DR2M 4KHPM 1QAMA 2HAKA 5ITRA 3HU2A 4LJ9A 1G4AE 3J2PB 5ITQA 1P3QQ 1E9RA 1ZAEA 3UZUA 4B7HA 3GLFB 1GKIA 5KPRA 4MGKE 4XK8F 1DGBA 2D7EA 2R4EA 1HQCA 3IECA 3H4MA 1IN8A 5EQTA 3U6SA 1KFVA 2CV1A 1DO2A 4IBEA 1YUBA 2ZTCA 2VF8A 4DR1M 2L6OA 1NHGC 3FTEA 1WXQA 2EA0A 1N77A 3KXEC 2QENA 1N33M 1TDHA 2CHVA 3M7GA 1NV8A 1V34A 3UJNA 2LVQD 1PM5A 3GLHA 1HNXM 1MU5A 4MGIE 1W5SA 3JR5A 3SAUA 2BJWA 4PDIA 3KFUG 1IXSB 2JY7A 1LV7A 2OOBA 3VLFB 3LCUA 4MM3B 4JXJA 2DZNB 3K1JA 2FE8A 2BWEA 2I7PA 2XSZA 4XBOA 3SFZA 2EO2A 2EUCA 2R44A 1OFHA 3THGA 1XMOM 1I94M 2F4VM 2QQ8A 3FTCA 4LFBM 1YE9A 3KOYE 2OQ4A 3IG5A 4GH9A 4HLQA 2X49A 1T6OA 1NNUC 3VDPA 4REZA 4MGYE 3HHXA 4DV0M 4GMQA 4I5SA 1IN7A 3AL0C 3LVWA 3VKGA 2RRUA 1LTMA 2G5GX 4GEWA 5DNYA 2GQFA 5EXPA 1XMQM 3HGIA 5DYIA 4HEOA 1R2YA 4X62M 2C98A 3L28A 3ZCBB 3E9SA 5JI3E 1XHBA 3C58A 2DWMA 1W5TA 2DNAA 4R3DA 2KDLA 2XSZD 4FCWA 3JR4A 1IM2A 4B3RM 3KP0E 3FUVA 1QVRA 2C96A 1Z6TA 2R62A 3PXGA 3SATA 5C1BA 3GLHE 2LVOC 3K8ZA 1XNQM 1C1KA 3GPYA 2H5XA 3DA1A 2JP7A 4A3VB 3UMMA 4X66M
chains in the Genus database with same CATH topology
4DBGB 2QHOB 2DI0A 2JNHA 3FRIA 1Q02A 1XB2B 1V92A 3FRHA 1WGLA 1EFUB 2K0BX 2OO9A 1DV0A 2LTUA 2KNVA 3BBZA 1WHCA 1GO5A 2QSFX 1UFZA 2CWBA 3FE3A 2MJ5B 2EKKA 1HJPA 3MMPA 1ZMVA 1R4GA 2DZLA 2KHHA 2R0IA 1HT2E 1MN3A 2BWBA 1OKSA 2L4EA 1WR1B 1VDLA 1VEGA 4WP2A 3GLGE 2O25A 2DKLA 2DAGA 3K9OA 2L4FA 2LVNC 1HT1E 2DHYA 2JY6B 2QNJA 4R71A 2HAKA 1G4AE 1IFYA 1P3QQ 4F2LA 3E21A 1ZV1A 1C7YA 1WIVA 1AIPC 1TTEA 3IECA 2OOAA 1TR8A 1IXSA 1YLAA 1KYIA 1VQ1A 1HQYE 1Y8GA 1DO2A 1A5TA 2LVAA 2ZTCA 1VEJA 1DO0A 3GLIE 2DAIA 4UN2B 2JY5A 2JUJA 3K9PA 2EKFA 2JZ0A 1F4IA 1NV8A 3LCVB 2LVQD 3GLFE 1CUKA 1WGNA 1G41A 1OTRA 3F92A 2JY7A 1XXHE 2OOBA 2DAKA 3LCUA 1ZMWA 1WJ7A 2BWEA 3E46A 1JR3E 3B89A 3H4JA 4F1IA 2CP8A 2KNAA 2MROB 1PGYA 1T6OA 2B3TA 1G3IA 4G3OA 2ZTDA 2RRUA 2DAEA 2LBCA 4GEWA 2K9DA 1SG9A 1VEKA 1VG5A 2HWJA 1OAIA 4HEOA 1T43A 2EJSA 2DAMA 3T6PA 2L2DA 5DFLA 1ZMUA 2DNAA 2DENA 2KNZA 1E94E 2G3QA 1IM2A 2JZ1A 1NV9A 3GLHE 2MGWA 2LVOC 2WZJA 1OQYA 2LVPC 2H5XA 3IHPA 2MR9A 1QZEA 4Q7JA 2JY8A 2JP7A 1BVSA 5JI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DBG B;  2QHO B;  2DI0 A;  2JNH A;  3FRI A;  1Q02 A;  1XB2 B;  1V92 A;  3FRH A;  1WGL A;  1EFU B;  2K0B X;  2OO9 A;  1DV0 A;  2LTU A;  2KNV A;  3BBZ A;  1WHC A;  1GO5 A;  2QSF X;  1UFZ A;  2CWB A;  3FE3 A;  2MJ5 B;  2EKK A;  1HJP A;  3MMP A;  1ZMV A;  1R4G A;  2DZL A;  2KHH A;  2R0I A;  1HT2 E;  1MN3 A;  2BWB A;  1OKS A;  2L4E A;  1WR1 B;  1VDL A;  1VEG A;  4WP2 A;  3GLG E;  2O25 A;  2DKL A;  2DAG A;  3K9O A;  2L4F A;  2LVN C;  1HT1 E;  2DHY A;  2JY6 B;  2QNJ A;  4R71 A;  2HAK A;  1G4A E;  1IFY A;  1P3Q Q;  4F2L A;  3E21 A;  1ZV1 A;  1C7Y A;  1WIV A;  1AIP C;  1TTE A;  3IEC A;  2OOA A;  1TR8 A;  1IXS A;  1YLA A;  1KYI A;  1VQ1 A;  1HQY E;  1Y8G A;  1DO2 A;  1A5T A;  2LVA A;  2ZTC A;  1VEJ A;  1DO0 A;  3GLI E;  2DAI A;  4UN2 B;  2JY5 A;  2JUJ A;  3K9P A;  2EKF A;  2JZ0 A;  1F4I A;  1NV8 A;  3LCV B;  2LVQ D;  3GLF E;  1CUK A;  1WGN A;  1G41 A;  1OTR A;  3F92 A;  2JY7 A;  1XXH E;  2OOB A;  2DAK A;  3LCU A;  1ZMW A;  1WJ7 A;  2BWE A;  3E46 A;  1JR3 E;  3B89 A;  3H4J A;  4F1I A;  2CP8 A;  2KNA A;  2MRO B;  1PGY A;  1T6O A;  2B3T A;  1G3I A;  4G3O A;  2ZTD A;  2RRU A;  2DAE A;  2LBC A;  4GEW A;  2K9D A;  1SG9 A;  1VEK A;  1VG5 A;  2HWJ A;  1OAI A;  4HEO A;  1T43 A;  2EJS A;  2DAM A;  3T6P A;  2L2D A;  5DFL A;  1ZMU A;  2DNA A;  2DEN A;  2KNZ A;  1E94 E;  2G3Q A;  1IM2 A;  2JZ1 A;  1NV9 A;  3GLH E;  2MGW A;  2LVO C;  2WZJ A;  1OQY A;  2LVP C;  2H5X A;  3IHP A;  2MR9 A;  1QZE A;  4Q7J A;  2JY8 A;  2JP7 A;  1BVS A;  5JI2 E; 
#chains in the Genus database with same CATH topology
 1HNW M;  4DBG B;  2QHO B;  2DI0 A;  2JNH A;  3C3D A;  3FRI A;  4M9X A;  1Q02 A;  1H6U A;  4LJ6 A;  4B7G A;  4JN6 A;  3FRH A;  3JAM S;  4LJ4 A;  1X37 A;  3HHY A;  3KP1 E;  1J7K A;  2LTU A;  3GPP A;  3BBZ A;  4PD2 A;  2X4A A;  2QSF X;  1UFZ A;  5E6J A;  2FNA A;  2MJ5 B;  2H1R A;  5DYG A;  4JI1 M;  2CE7 A;  1ZMV A;  3NBX X;  4LJ5 A;  4LZZ A;  3RGP A;  1OFI A;  4RF1 A;  1HT2 E;  4MB7 A;  4LCB A;  1OKS A;  2Z4R A;  3HJ8 A;  2G8L A;  3HZJ A;  2QBY A;  4BB9 A;  1IBK M;  4GC5 A;  3OTO M;  1VEG A;  1NHW C;  5IZ7 D;  2DKL A;  4YHH M;  2DAG A;  1G71 A;  3C9P A;  1N34 M;  4L8R C;  2DHY A;  2GNO A;  3K2L A;  3KOX E;  3WHK A;  2Y21 A;  3TL4 X;  5KO3 A;  3U6L A;  2N35 A;  1TDZ A;  4IBK A;  2UU9 M;  3QAU A;  2QNJ A;  3W67 A;  4R71 A;  3NWL A;  4PDG A;  4MGZ E;  3U60 B;  3J81 S;  4KT0 F;  3E21 A;  3U61 B;  1C7Y A;  3BXW A;  2P5T A;  3L2A A;  2F5S A;  2UUB M;  2OOA A;  3T15 A;  4LF9 M;  4DR7 M;  4NC6 A;  1KYI A;  4LRS A;  3GP1 A;  4K0K M;  2R6F A;  1HQY E;  1T3T A;  4LF4 M;  1Y8G A;  1PJJ A;  2LVA A;  4JI7 M;  4CGY B;  2FS1 A;  4DV2 M;  1VEJ A;  3GQ5 A;  4LGM A;  1Z59 A;  4DR3 M;  4DV3 M;  2CFO A;  3K92 A;  2JUJ A;  4EIW A;  1QQW A;  4DR5 M;  2NQ8 C;  1QAO A;  4I8O A;  1TH3 A;  3KSJ A;  3U6P A;  3FYD A;  3FUT A;  8CAT A;  3HX3 A;  1D0K A;  1IBL M;  3LCV B;  1L1Z A;  1IN4 A;  1MX0 A;  2JWS A;  5H37 D;  4LJ8 A;  3I4Y A;  5EXT A;  4FCV A;  2JA2 A;  3M6A A;  3KVW A;  2ZBK B;  4FD2 A;  4B08 A;  3RFW A;  2DWL A;  3I51 A;  2XFS A;  1GLN A;  2QPA A;  3B89 A;  3DFZ A;  3WHL A;  2KRU A;  1TF0 B;  3H4J A;  4GIP A;  1IN6 A;  2O01 F;  2KZS A;  3LQQ A;  4QNM A;  3RGS A;  2DWZ B;  1XC8 A;  1ZQ9 A;  3E4R A;  4NRW A;  2KNA A;  2MRO B;  1DGF A;  5IWA M;  4JV5 M;  2M5Z A;  2B3T A;  4LZJ A;  5FTN A;  2HL7 A;  1G3I A;  4DUZ M;  3LMM A;  3GQ3 A;  4G3O A;  2VQE M;  2DVW B;  3GLH B;  1R2Z A;  3NBI A;  2DAE A;  2LBC A;  1EIJ A;  2UUA M;  4JI8 M;  2Z7J A;  3B7N A;  1K82 A;  2QP9 X;  4OW0 A;  4NXN M;  3U6O A;  1GJS A;  3ZC7 B;  2C9O A;  2LWX A;  3Q8X A;  4X64 M;  1DGH A;  3AKZ A;  3SAR A;  4LF5 M;  3HU1 A;  5DFL A;  1IXZ A;  3AJI B;  2L7H A;  4M9S A;  3LQR A;  3V76 A;  3B74 A;  2KW0 A;  2DEN A;  1GVN A;  1PJS A;  2KNZ A;  3EIH A;  3IG8 A;  4LFA M;  1PRB A;  2JZ1 A;  2RGO A;  3T1H M;  1NY5 A;  1XWI A;  4AG6 A;  4Y28 F;  4FVM A;  3HWS A;  1NV9 A;  2CRU A;  3HHZ A;  2J7N A;  4QHT A;  1SXJ C;  5EJC A;  2WZJ A;  1XXH A;  4NL4 H;  1XNR M;  4AKG A;  4JI5 M;  1NJF A;  4L15 A;  2MR9 A;  1QZE A;  4Q7J A;  1V33 A;  1JR3 A;  1BVS A;  1IBM M;  3TE6 A;  4IBG A;  7CAT A;  1QDR A;  3B7Q A;  2K6B A;  5IRE B;  1NNJ A;  1V92 A;  3SYL A;  2K0B X;  2C5R A;  2I7N A;  3D8L A;  3GLI A;  3L27 A;  4DR4 M;  1WHC A;  1GO5 A;  5EP2 A;  4RKU F;  1Z5A A;  2KRK A;  2YFQ A;  4IIW A;  2AHM A;  2R45 A;  1FJG M;  1AUA A;  4FWH A;  4I4L A;  3MMP A;  5EP4 A;  4L6V 6;  1R4G A;  2DZL A;  1IY2 A;  2LNH C;  4QOS A;  2HHH M;  2HCB A;  1MN3 A;  3L29 A;  4AQY M;  2BWB A;  2K47 A;  2QZ4 A;  2XZU A;  2R4J A;  2J5Y A;  1OJL A;  1VDL A;  1QDT A;  3FD9 A;  4WP2 A;  3GO8 A;  4QOZ C;  4G4R A;  2O25 A;  1G59 A;  2CEA A;  1K3W A;  1JR3 D;  2F5P A;  2L4F A;  2R65 A;  2LVN C;  2J7O A;  4L78 A;  2JXN A;  2Y20 A;  1NO1 A;  2Y0Q A;  3FTD A;  2ZAM A;  4NSO B;  1JB0 F;  3TWL A;  3ZH9 B;  5FTL A;  4KOD A;  2XLJ A;  3W68 A;  1FNN A;  1QAN A;  2Z3X A;  4IBJ A;  4F2L A;  2CUZ A;  4AG5 A;  4LGY A;  2C99 A;  3I4V A;  3U6M A;  2BJV A;  2A5Y B;  3AOE C;  1L2D A;  1TTE A;  3A42 A;  1Z5B A;  5ITU A;  3ZQJ A;  3FUX A;  1DGG A;  2QBY B;  1TR8 A;  1YLA A;  4L16 A;  1VQ1 A;  3FTF A;  5E26 A;  4AKI A;  1A5T A;  1QYR A;  3GLI E;  1E32 A;  1SXJ A;  3PFI A;  4GHL A;  1EE8 A;  2JY5 A;  3A45 A;  1JQJ C;  1VDD A;  5ITX A;  1PJT A;  1MJG M;  3K9P A;  3U6E A;  3RE8 A;  3CGW A;  2EKF A;  1D2N A;  3DOA A;  2V1C A;  3U6Q A;  2XH9 A;  1Z5C A;  5EXS A;  1CUK A;  4LF7 M;  1WGN A;  1G41 A;  4FWG A;  4MGH A;  4CHT B;  5A2Q S;  1OTR A;  3EIE A;  2DAK A;  3FKE A;  4OVZ B;  1WJ7 A;  3E46 A;  3U5Z A;  3VDU A;  3R9X B;  2ZAO A;  4NSR A;  1GL7 A;  1TH4 A;  4GC9 A;  2XEP A;  4DUY M;  1QUS A;  4HL4 A;  4G4O A;  3GPU A;  4B3S M;  1G8P A;  2CP8 A;  1Q39 A;  3DZD A;  1PGY A;  4GKK M;  1SXJ D;  5BPV A;  4IBD A;  3I04 M;  1IQP A;  3J80 S;  4DV4 M;  4PT5 A;  2K9D A;  1SG9 A;  1TGU A;  2HWJ A;  1VG5 A;  3SC3 A;  4YY3 M;  3SBJ A;  1OAI A;  3GRR A;  3SYK A;  5ITT A;  1QAQ A;  4G4Q A;  1E9S A;  3VK8 A;  4GHA A;  3L25 A;  2EJS A;  1OIZ A;  3KW6 A;  1KSF X;  3MK6 A;  3AV0 A;  3GPX A;  2R18 A;  4JYA M;  1ORY B;  1SXJ E;  4AKH A;  4I81 A;  2DZO B;  3GLG A;  5ITX E;  2UXD M;  1N32 M;  1NVM A;  2XFT A;  5KQD A;  1E94 E;  3GRU A;  3UK6 A;  1GL6 A;  3AOE A;  2YR0 A;  2V6Z M;  4FWD A;  2L09 A;  4OX9 M;  3VKH A;  3SHG B;  4P17 A;  3FUW A;  3J27 B;  2MGW A;  2VDB B;  1NSF A;  4IBB A;  3ILK A;  1OQY A;  4R7G A;  3B9P A;  4RF0 A;  1UM8 A;  2ZM6 M;  2ZAN A;  2JY8 A;  2VQF M;  3CTW B;  1GAB A;  4WW0 A;  4OU7 A;  5LMU M;  2VII A;  4X65 M;  2D7G A;  4D82 A;  4II7 A;  2ERC A;  1Q3B A;  1WGL A;  1EFU B;  2HKJ A;  3PNY A;  2V1U A;  3QYE A;  3FYC A;  3A98 B;  1R5L A;  2FH0 A;  5KQ8 A;  4M0W A;  4Z8X A;  1DV0 A;  2KNV A;  4D81 A;  4DV1 M;  3HKP A;  2FOI C;  4LJ7 A;  4ITQ A;  5FSW A;  2CWB A;  5EXX A;  5FTJ A;  3FE3 A;  3GRV A;  1XXH B;  2EKK A;  4DV7 M;  1HJP A;  1IY1 A;  3I01 M;  2OPF A;  4WUR A;  2YNM D;  2R0I A;  2YQZ A;  3GLF A;  4IBC A;  4XGI A;  3R8F A;  2L4E A;  2L7I A;  1PJI A;  5BR8 M;  3CF0 A;  3Q8G A;  2MH8 A;  3LVV A;  1WR1 B;  4G4N A;  1K3X A;  4LF6 M;  3GLG E;  3AOG A;  4L4U A;  3GLI B;  4JI3 M;  1HT1 E;  5GKN A;  5FLX S;  1S3S A;  3TQS A;  4B3T M;  4GKJ M;  3TWM A;  4TUW A;  4QNR A;  1J09 A;  2FFJ A;  3UGJ A;  4QHS A;  3SAS A;  2DWN A;  1IFY A;  4GRI A;  3PVS A;  3T38 A;  4PCZ A;  1ZV1 A;  1IY0 A;  1WIV A;  1AIP C;  4IBI A;  4JI6 M;  3L26 A;  1R7R A;  1HR0 M;  1IXS A;  2KEB A;  1NY6 A;  3HHW A;  3D8B A;  2QCU A;  3KOZ E;  3VK7 A;  2CHG A;  5FTM A;  1TH2 A;  1J5E M;  3CF6 E;  1DO0 A;  3TWK A;  2DAI A;  3GRY A;  2WSF F;  4CJ6 A;  2APL A;  5ITY A;  1IN5 A;  2O5R A;  4UN2 B;  4B7F A;  5EP1 A;  1L2B A;  1NJG A;  2JZ0 A;  1F4I A;  2F5O A;  3SAW A;  2DHR A;  2KZU A;  4DR6 M;  4P16 A;  3GLF E;  3HU3 A;  3SMS A;  3GQ4 A;  2LHC A;  4IBF A;  3F92 A;  3QWL A;  4KO8 A;  1XXH E;  4CIZ A;  4CIS A;  4AI6 A;  2UXC M;  1ZMW A;  2RGH A;  4M0D A;  3BOS A;  4B3M M;  3VFD A;  2CHQ A;  3A46 A;  3FUU A;  3SAV A;  1PJQ A;  2KA6 B;  2UUC M;  4NXM M;  1JR3 E;  1D0L A;  4M9Z A;  3M0E A;  4S12 A;  1SXJ B;  4F1I A;  4DV5 M;  1HNZ M;  2F5Q A;  3HY5 A;  4G6Z A;  3KSX A;  3J7B A;  4DV6 M;  4LY6 A;  1I4W A;  4IJF A;  4FW9 A;  4ZPX A;  3J7A S;  2ZTD A;  2WSC F;  3U6C A;  2XZF A;  1N36 M;  4W5W A;  1QZM A;  1D0M A;  1VEK A;  2XGN A;  3QYB A;  1T43 A;  2LH0 A;  2CV2 A;  4LG2 A;  4AW4 A;  3U5Z B;  2DAM A;  3T6P A;  2L2D A;  5IT9 S;  2Z8Y M;  1ZMU A;  4FCT A;  4BBA A;  5JI2 E;  1RU3 A;  1YSY A;  2G3Q A;  3B7Z A;  3KS4 A;  3W0F A;  1R6B X;  5C18 A;  1L2C A;  3CF2 A;  3KDS E;  5LMN M;  2LXE A;  2LHG A;  2RKO A;  2LVP C;  4NRV A;  4D80 A;  3IHP A;  1GJT A;  2Y0T A;  3U6D A;  2W82 A;  4KLN A;  2DXI A;  1IXR C;  1Q3C A;  3W0L B;  1XB2 B;  5KPZ A;  2D7H A;  3KS8 A;  2X8A A;  4GIT A;  4JI0 M;  4AZF A;  2XF3 A;  3GLG B;  2M60 A;  1OAO C;  2OO9 A;  1N78 A;  2C9C A;  5L8R F;  3MHV C;  3LW5 F;  4ANR A;  4JI4 M;  2KXE A;  2Q2E B;  3HJQ A;  3TPZ A;  1OIP A;  4JI2 M;  3KOW E;  4IJE A;  4Z6Y A;  2UXB M;  3U60 A;  1N75 A;  3SMP A;  4MH0 E;  2R46 A;  2KHH A;  5FTK A;  4OVZ A;  1L8Q A;  5F3W A;  3U61 A;  4LFC M;  3SHF A;  4LF8 M;  4NOO B;  4LJA A;  3PNV A;  3T1Y M;  5EP3 A;  4BLC A;  5KPT A;  2F5N A;  3HJS A;  3MJ5 A;  2E5L M;  3K9O A;  1DGH B;  2VF7 A;  3C3E A;  3AFH A;  4RNA A;  1L1T A;  2Z4S A;  2JY6 B;  2CV0 A;  1QUT A;  2WSE F;  2BNK A;  4LRT A;  4DR2 M;  4KHP M;  1QAM A;  2HAK A;  5ITR A;  3HU2 A;  4LJ9 A;  1G4A E;  3J2P B;  5ITQ A;  1P3Q Q;  1E9R A;  1ZAE A;  3UZU A;  4B7H A;  3GLF B;  1GKI A;  5KPR A;  4MGK E;  4XK8 F;  1DGB A;  2D7E A;  2R4E A;  1HQC A;  3IEC A;  3H4M A;  1IN8 A;  5EQT A;  3U6S A;  1KFV A;  2CV1 A;  1DO2 A;  4IBE A;  1YUB A;  2ZTC A;  2VF8 A;  4DR1 M;  2L6O A;  1NHG C;  3FTE A;  1WXQ A;  2EA0 A;  1N77 A;  3KXE C;  2QEN A;  1N33 M;  1TDH A;  2CHV A;  3M7G A;  1NV8 A;  1V34 A;  3UJN A;  2LVQ D;  1PM5 A;  3GLH A;  1HNX M;  1MU5 A;  4MGI E;  1W5S A;  3JR5 A;  3SAU A;  2BJW A;  4PDI A;  3KFU G;  1IXS B;  2JY7 A;  1LV7 A;  2OOB A;  3VLF B;  3LCU A;  4MM3 B;  4JXJ A;  2DZN B;  3K1J A;  2FE8 A;  2BWE A;  2I7P A;  2XSZ A;  4XBO A;  3SFZ A;  2EO2 A;  2EUC A;  2R44 A;  1OFH A;  3THG A;  1XMO M;  1I94 M;  2F4V M;  2QQ8 A;  3FTC A;  4LFB M;  1YE9 A;  3KOY E;  2OQ4 A;  3IG5 A;  4GH9 A;  4HLQ A;  2X49 A;  1T6O A;  1NNU C;  3VDP A;  4REZ A;  4MGY E;  3HHX A;  4DV0 M;  4GMQ A;  4I5S A;  1IN7 A;  3AL0 C;  3LVW A;  3VKG A;  2RRU A;  1LTM A;  2G5G X;  4GEW A;  5DNY A;  2GQF A;  5EXP A;  1XMQ M;  3HGI A;  5DYI A;  4HEO A;  1R2Y A;  4X62 M;  2C98 A;  3L28 A;  3ZCB B;  3E9S A;  5JI3 E;  1XHB A;  3C58 A;  2DWM A;  1W5T A;  2DNA A;  4R3D A;  2KDL A;  2XSZ D;  4FCW A;  3JR4 A;  1IM2 A;  4B3R M;  3KP0 E;  3FUV A;  1QVR A;  2C96 A;  1Z6T A;  2R62 A;  3PXG A;  3SAT A;  5C1B A;  3GLH E;  2LVO C;  3K8Z A;  1XNQ M;  1C1K A;  3GPY A;  2H5X A;  3DA1 A;  2JP7 A;  4A3V B;  3UMM A;  4X66 M; 
#chains in the Genus database with same CATH homology
 4DBG B;  2QHO B;  2DI0 A;  2JNH A;  3FRI A;  1Q02 A;  1XB2 B;  1V92 A;  3FRH A;  1WGL A;  1EFU B;  2K0B X;  2OO9 A;  1DV0 A;  2LTU A;  2KNV A;  3BBZ A;  1WHC A;  1GO5 A;  2QSF X;  1UFZ A;  2CWB A;  3FE3 A;  2MJ5 B;  2EKK A;  1HJP A;  3MMP A;  1ZMV A;  1R4G A;  2DZL A;  2KHH A;  2R0I A;  1HT2 E;  1MN3 A;  2BWB A;  1OKS A;  2L4E A;  1WR1 B;  1VDL A;  1VEG A;  4WP2 A;  3GLG E;  2O25 A;  2DKL A;  2DAG A;  3K9O A;  2L4F A;  2LVN C;  1HT1 E;  2DHY A;  2JY6 B;  2QNJ A;  4R71 A;  2HAK A;  1G4A E;  1IFY A;  1P3Q Q;  4F2L A;  3E21 A;  1ZV1 A;  1C7Y A;  1WIV A;  1AIP C;  1TTE A;  3IEC A;  2OOA A;  1TR8 A;  1IXS A;  1YLA A;  1KYI A;  1VQ1 A;  1HQY E;  1Y8G A;  1DO2 A;  1A5T A;  2LVA A;  2ZTC A;  1VEJ A;  1DO0 A;  3GLI E;  2DAI A;  4UN2 B;  2JY5 A;  2JUJ A;  3K9P A;  2EKF A;  2JZ0 A;  1F4I A;  1NV8 A;  3LCV B;  2LVQ D;  3GLF E;  1CUK A;  1WGN A;  1G41 A;  1OTR A;  3F92 A;  2JY7 A;  1XXH E;  2OOB A;  2DAK A;  3LCU A;  1ZMW A;  1WJ7 A;  2BWE A;  3E46 A;  1JR3 E;  3B89 A;  3H4J A;  4F1I A;  2CP8 A;  2KNA A;  2MRO B;  1PGY A;  1T6O A;  2B3T A;  1G3I A;  4G3O A;  2ZTD A;  2RRU A;  2DAE A;  2LBC A;  4GEW A;  2K9D A;  1SG9 A;  1VEK A;  1VG5 A;  2HWJ A;  1OAI A;  4HEO A;  1T43 A;  2EJS A;  2DAM A;  3T6P A;  2L2D A;  5DFL A;  1ZMU A;  2DNA A;  2DEN A;  2KNZ A;  1E94 E;  2G3Q A;  1IM2 A;  2JZ1 A;  1NV9 A;  3GLH E;  2MGW A;  2LVO C;  2WZJ A;  1OQY A;  2LVP C;  2H5X A;  3IHP A;  2MR9 A;  1QZE A;  4Q7J A;  2JY8 A;  2JP7 A;  1BVS A;  5JI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...