3KOYE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (aerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3koyE02
3KOWE 3KP0E 3KOZE 3KP1E 3KOYE 3KOXE
chains in the Genus database with same CATH superfamily
2Y0TA 1FNNA 2ZAOA 4GHAA 3KOYE 2J5YA 3IHPA 3K9OA 5EP3A 4GKKM 4BLCA 2WSEF 3GQ5A 4B7HA 3MK6A 5JI2E 1JQJC 1XB2B 3HJSA 1XMQM 5IT9S 4I8OA 1LV7A 1L8QA 2CE7A 4AG5A 3U6PA 3E4RA 3J2PB 3I01M 1I94M 4DR6M 1IN4A 2EO2A 4RF0A 2OOBA 4R71A 1WGNA 2OPFA 3MJ5A 3KS8A 2YNMD 3VKGA 1IQPA 1MJGM 4NC6A 2I7PA 1RU3A 1QYRA 1OKSA 3CF0A 5FTKA 4DR5M 2I7NA 2ZTDA 2XSZA 1IN7A 2MROB 4LJ4A 2C9CA 3LCUA 5FSWA 1MX0A 1DO2A 3L25A 2F5OA 2G3QA 4LZJA 2K47A 4QNMA 3ZQJA 5H37D 5JI3E 4G4RA 2ZBKB 3J80S 1AUAA 2C99A 4MB7A 1Z59A 3AOEC 3I51A 3KSJA 3HGIA 2MH8A 3QWLA 4WP2A 3TL4X 4LF6M 3VDPA 3KS4A 3AKZA 4GC9A 4QNRA 1R4GA 3GLFA 3GLGA 1SXJB 2VIIA 1TDZA 4KHPM 1QQWA 2V6ZM 4IJEA 3VDUA 2RGOA 1TDHA 2QBYA 3AJIB 1IN5A 4LF4M 3GPYA 1SXJD 3UGJA 4OVZA 3DA1A 1D0KA 2CFOA 3GQ3A 2D7GA 4LF8M 1DO0A 2QSFX 3LVVA 1Q02A 2FE8A 1TR8A 3CGWA 1WIVA 4MM3B 2JY5A 3Q8GA 2KEBA 4BB9A 1G41A 3H4MA 1HQCA 4B7GA 3GP1A 4D81A 1OFIA 3R9XB 2J7OA 5FTJA 2KW0A 4DR3M 4FCVA 5LMUM 3GRYA 3RGPA 3SHFA 1L2BA 2KRKA 5EXTA 3T15A 1DGBA 1SXJC 4LRTA 1DV0A 5ITUA 3H4JA 1N32M 3UJNA 1E32A 2CEAA 4CJ6A 3SAWA 4IBCA 2E5LM 1IXZA 1NY6A 4D82A 4GHLA 1Q3CA 2DXIA 3QYBA 1DGHB 2JY6B 3GLGE 2R6FA 1OTRA 4JI2M 2R4EA 5EJCA 4KLNA 2DENA 4DR1M 1IY0A 2HKJA 3SYLA 3FE3A 1TH3A 1QZMA 3FUXA 2CV0A 1NHGC 2DWZB 4B08A 3RGSA 3C3DA 4X64M 2CP8A 3CF2A 4RNAA 3R8FA 3T1YM 2GNOA 3VK7A 5ITRA 4WW0A 1OIPA 2WSFF 2D7EA 1N77A 2WSCF 2KXEA 2DWNA 4JI5M 2MJ5B 1Q3BA 1IN6A 2XH9A 2DI0A 1JR3D 3A46A 1K3WA 3FYDA 2B3TA 1IXRC 3NWLA 1D2NA 4JI8M 3OTOM 2Y0QA 3KP1E 1NO1A 4Z6YA 1VDDA 3IG5A 3K9PA 4LJ5A 1I4WA 2MGWA 5DFLA 2L09A 4QOSA 4L6V6 3FTFA 1XMOM 2W82A 5IZ7D 3T1HM 5BPVA 3TQSA 4F2LA 1TGUA 1VG5A 3B7ZA 3HU2A 4IBIA 3RFWA 4NRVA 3D8BA 1E94E 3M7GA 4GMQA 4P17A 4XGIA 1PJTA 1X37A 3A42A 1G4AE 2XF3A 2QQ8A 1TF0B 3PNYA 4G4NA 2UUAM 4IJFA 4IIWA 3T6PA 3GLIE 3ZCBB 5A2QS 4GC5A 1ZAEA 3FUTA 5E6JA 1C7YA 1PRBA 1XXHB 3KDSE 3J7AS 2YR0A 2DAEA 4UN2B 3JR4A 3LQQA 4LF9M 2F5NA 3K2LA 1UM8A 1NY5A 3DOAA 3HWSA 1QZEA 3C3EA 3SYKA 5IREB 3SARA 4M0WA 3CTWB 4QHSA 1NNJA 5DYIA 2QZ4A 3HY5A 3VFDA 3U60A 3TWLA 4ITQA 1A5TA 1QAMA 3U6QA 3DFZA 4XK8F 3FUVA 3M6AA 4MGKE 2DWMA 2LBCA 1XWIA 3GLHE 3HHXA 3L27A 5KO3A 2LH0A 1HQYE 1NJFA 8CATA 3SAVA 4G6ZA 5ITYA 4GH9A 3FRHA 1HNZM 2HWJA 4JI4M 1Z5BA 4XBOA 3AL0C 4DUYM 1F4IA 3HHZA 2C5RA 3W0LB 4GEWA 4LFAM 2XGNA 3A45A 2DHRA 2DAGA 3U6EA 2NQ8C 1D0LA 2UU9M 2QENA 2K6BA 2LHGA 2M60A 3W68A 4LJAA 4DBGB 4LG2A 4KODA 4DV5M 1J09A 1WHCA 2DVWB 4I81A 5ITXE 2R65A 2HCBA 3GRVA 4M0DA 5KPZA 3JR5A 4CHTB 2XZUA 3SBJA 2DZOB 1R2YA 2V1UA 4FWGA 5KPTA 1PJQA 4FCTA 4L16A 3J7BA 1YUBA 1GABA 1N75A 2L7HA 4DV6M 3CF6E 4JN6A 2YQZA 3KXEC 3TE6A 3ILKA 1HR0M 3C9PA 1OAOC 4NXMM 2LVQD 1QUTA 1GL7A 2K0BX 1G3IA 3I4VA 2XSZD 2DNAA 4FWDA 4MGHA 1VEJA 4L15A 2O01F 4B3SM 1T6OA 3M0EA 3TWKA 5IWAM 1GJSA 1D0MA 4B3TM 2BJVA 1ORYB 4Y28F 3LVWA 3GLGB 2ZANA 3GLFB 1K82A 2LVNC 4RF1A 2UUCM 3NBXX 2QBYB 2HAKA 3SMSA 2LWXA 4LGYA 3U6LA 2BWBA 4OVZB 2EKKA 3FTCA 1BVSA 2A5YB 4FVMA 4S12A 1IY1A 1WR1B 2CHQA 4LJ7A 4NXNM 3VLFB 1IXSA 1HNXM 2LXEA 2X4AA 3FYCA 1Q39A 2UXBM 1KYIA 2XFSA 5ITTA 3U6MA 2F4VM 3E46A 1PJIA 1QANA 1QAQA 2LHCA 4GRIA 1IBLM 2JA2A 1E9RA 1HT1E 4DR7M 3BBZA 3GLIA 2R46A 1T43A 2LNHC 2VF7A 1NV9A 1SXJE 1S3SA 1QDTA 1XHBA 4TUWA 5F3WA 3IECA 1DGGA 4IBGA 2Z7JA 3HKPA 4X66M 2LVPC 4L8RC 2R45A 3B9PA 1YSYA 4NRWA 1TTEA 1KFVA 4K0KM 3KOXE 3GLIB 1QUSA 3U6OA 3VKHA 2ZAMA 4PCZA 1QVRA 1G71A 3GLHA 2EJSA 4DV2M 2XFTA 4YHHM 2M5ZA 4X62M 5EXPA 5ITQA 4PD2A 3FTDA 1V34A 2KNZA 3GRUA 5KQDA 4FW9A 3SASA 1TH2A 1AIPC 2BNKA 4DV3M 4I4LA 1V92A 1ZV1A 2DZNB 1YE9A 4LRSA 2DZLA 1Y8GA 3WHLA 3SAUA 2X8AA 3SHGB 3JAMS 4X65M 1Z5AA 3U6SA 4CIZA 4HEOA 3HX3A 1JB0F 2QPAA 5EXXA 3B74A 4B7FA 2CV2A 3GLHB 2MR9A 2EA0A 3GPUA 1N78A 4PDIA 2F5QA 5ITXA 3MHVC 3GO8A 2HHHM 1KSFX 3FUWA 1R6BX 4G3OA 1Z6TA 3KVWA 3DZDA 4R7GA 1UFZA 2Z4RA 4LY6A 2BJWA 3ZC7B 4ANRA 1L1ZA 1YLAA 1VEGA 2DKLA 2JY7A 4DV1M 4L4UA 1W5TA 1J5EM 4KO8A 4AZFA 2H1RA 3I04M 2BWEA 2HL7A 5FLXS 4G4QA 4AKGA 2XZFA 3TWMA 4WURA 2WZJA 3IG8A 1JR3E 1QDRA 2O5RA 1OAIA 4JI0M 2R0IA 2ZM6M 4FCWA 2N35A 2Z4SA 4AW4A 1OJLA 1WJ7A 3U5ZA 1PJSA 1EFUB 2OO9A 2VDBB 2FS1A 1IBMM 5KQ8A 4NL4H 2K9DA 3PFIA 1L2DA 2FOIC 1J7KA 2JZ1A 4LF5M 3EIHA 2L4FA 3LW5F 4YY3M 2RRUA 2L6OA 4HL4A 3U60B 1NJGA 1EIJA 4BBAA 1VEKA 4OX9M 4R3DA 4Q7JA 3BOSA 2L7IA 1OIZA 4P16A 1XC8A 3B7QA 1R2ZA 3I4YA 1W5SA 4MGYE 2Z8YM 2Y20A 2R62A 3U5ZB 4NOOB 3B7NA 1GLNA 2V1CA 2LTUA 3KSXA 2JNHA 4AG6A 4LGMA 3U6CA 2LVOC 1R5LA 5FTLA 5BR8M 1XXHE 4M9SA 4OU7A 2VQEM 1XNQM 2JUJA 1WGLA 5EP1A 5EP2A 2AHMA 2D7HA 4LJ6A 5EXSA 4JI3M 1IN8A 2Y21A 3HJ8A 1L1TA 4MH0E 1SXJA 3Q8XA 1NV8A 2OOAA 5C18A 2XLJA 1N36M 4II7A 4CISA 2CRUA 2GQFA 2YFQA 3ZH9B 3HHYA 3PXGA 3C58A 2UUBM 1DGFA 2CWBA 1OQYA 2CUZA 4DR2M 2KRUA 1NNUC 4M9XA 2DHYA 3KOWE 1EE8A 4GIPA 3T38A 2R44A 4LFCM 2JZ0A 5FTNA 3KW6A 3HU3A 1PM5A 3LCVB 2G5GX 2Z3XA 4QHTA 2VQFM 4MGIE 4JI1M 4L78A 4DV0M 4NSRA 4Z8XA 4HLQA 3LMMA 3W0FA 2L2DA 3F92A 2KA6B 2RKOA 3NBIA 4PT5A 5E26A 4JI6M 2DAMA 3L28A 4LF7M 1GJTA 1IM2A 2QCUA 1NHWC 2DWLA 2JP7A 4ZPXA 3U61A 3V76A 3FRIA 2JXNA 2APLA 3HZJA 5L8RF 3GPPA 3GPXA 2FH0A 3UMMA 1L2CA 1MN3A 2RGHA 3D8LA 2KHHA 1FJGM 3FD9A 4IBJA 2DAKA 3WHKA 2JY8A 3L29A 3HU1A 1DGHA 1HJPA 3HJQA 7CATA 4AI6A 2KNAA 3FKEA 3QYEA 1G8PA 4IBDA 3J81S 2F5SA 3QAUA 4IBEA 5C1BA 4KT0F 1TH4A 4LJ9A 2F5PA 2G8LA 2VF8A 3PNVA 3SFZA 1PGYA 3AOGA 4F1IA 1N33M 1IXSB 4RKUF 4DUZM 1PJJA 3U61B 4B3RM 4MGZE 3A98B 4NSOB 2XEPA 1G59A 1GO5A 1WXQA 1CUKA 2EUCA 4GITA 1R7RA 1JR3A 4I5SA 1V33A 3AFHA 2QNJA 3W67A 4A3VB 3VK8A 3KP0E 2J7NA 3HHWA 5DYGA 4OW0A 3GLFE 5FTMA 2CV1A 2FFJA 3EIEA 1XNRM 1Z5CA 1N34M 2Q2EB 5LMNM 2KZUA 3J27B 1VQ1A 2R4JA 1LTMA 2JWSA 3GRRA 1IY2A 2UXDM 3SMPA 1GL6A 2ZTCA 4FWHA 4DV7M 1C1KA 1ZQ9A 2EKFA 4IBKA 3AV0A 5GKNA 1E9SA 2C98A 1OFHA 2R18A 3KOZE 4CGYB 4DV4M 3FTEA 1IFYA 4IBFA 4JYAM 1T3TA 3KFUG 2ERCA 1VDLA 4EIWA 3E9SA 1K3XA 3THGA 3LQRA 1QAOA 4QOZC 2C9OA 1H6UA 1GKIA 1NSFA 1SG9A 3GQ4A 3L2AA 1ZMWA 3BXWA 3RE8A 3UK6A 2LVAA 3FUUA 4W5WA 4AQYM 2QHOB 4JV5M 4LJ8A 2KDLA 3E21A 2KNVA 4JXJA 3K8ZA 4AKIA 4DR4M 2L4EA 1XXHA 3SATA 2CHVA 1NVMA 3B89A 4LCBA 4REZA 5DNYA 3SC3A 2O25A 1ZMVA 4AKHA 1GVNA 3MMPA 2QP9X 5EQTA 4LFBM 4GKJM 4M9ZA 1HT2E 4JI7M 4LZZA 2X49A 4D80A 2UXCM 2OQ4A 1IBKM 1ZMUA 3K1JA 5KPRA 4B3MM 3K92A 3UZUA 1HNWM 3AOEA 4IBBA 4G4OA 4FD2A 3U6DA 3L26A 2C96A 2H5XA 1MU5A 3PVSA 3TPZA 5EP4A 4PDGA 2FNAA 1P3QQ 2KZSA 2CHGA 2P5TA 2DAIA
chains in the Genus database with same CATH topology
2Y0TA 1FNNA 2ZAOA 4GHAA 3KOYE 4GKKM 5EP3A 4BLCA 3GQ5A 4B7HA 3MK6A 5JI2E 1JQJC 3HJSA 1XMQM 5IT9S 4I8OA 1LV7A 1L8QA 2CE7A 4AG5A 3U6PA 3E4RA 3J2PB 1I94M 4DR6M 1IN4A 2EO2A 4RF0A 2OPFA 3MJ5A 3KS8A 2YNMD 3VKGA 1IQPA 2I7PA 1QYRA 3CF0A 5FTKA 4DR5M 2I7NA 2XSZA 1IN7A 4LJ4A 2C9CA 5FSWA 1MX0A 1DO2A 3L25A 2F5OA 4LZJA 2K47A 4QNMA 5H37D 5JI3E 4G4RA 2ZBKB 3J80S 2C99A 4MB7A 1Z59A 3AOEC 3I51A 3KSJA 3HGIA 3QWLA 3TL4X 4LF6M 3VDPA 3KS4A 3AKZA 4GC9A 4QNRA 3GLFA 3GLGA 1SXJB 2VIIA 1TDZA 4KHPM 1QQWA 2V6ZM 4IJEA 3VDUA 2RGOA 1TDHA 2QBYA 3AJIB 1IN5A 4LF4M 3GPYA 1SXJD 3UGJA 4OVZA 3DA1A 2CFOA 3GQ3A 2D7GA 4LF8M 1DO0A 3LVVA 2FE8A 4MM3B 2KEBA 4BB9A 1G41A 3H4MA 1HQCA 4B7GA 3GP1A 4D81A 1OFIA 3R9XB 2J7OA 5FTJA 2KW0A 4DR3M 4FCVA 5LMUM 3GRYA 3RGPA 3SHFA 1L2BA 2KRKA 5EXTA 3T15A 1DGBA 1SXJC 4LRTA 5ITUA 1N32M 3UJNA 1E32A 2CEAA 3SAWA 4IBCA 2E5LM 1IXZA 1NY6A 4D82A 4GHLA 1Q3CA 2DXIA 1DGHB 4JI2M 2R4EA 5EJCA 4KLNA 4DR1M 1IY0A 2HKJA 3SYLA 1TH3A 1QZMA 3FUXA 2CV0A 1NHGC 2DWZB 4B08A 3RGSA 4X64M 3CF2A 4RNAA 3R8FA 3T1YM 3VK7A 5ITRA 4WW0A 2D7EA 1N77A 2DWNA 2KXEA 4JI5M 1Q3BA 1IN6A 2XH9A 1JR3D 3A46A 1K3WA 3FYDA 3NWLA 1IXRC 1D2NA 4JI8M 3OTOM 2Y0QA 3KP1E 4Z6YA 1VDDA 3IG5A 4LJ5A 1I4WA 2L09A 4QOSA 3FTFA 1XMOM 2W82A 5IZ7D 3T1HM 5BPVA 3TQSA 1TGUA 3HU2A 4IBIA 3RFWA 4NRVA 3D8BA 1E94E 3M7GA 4GMQA 4XGIA 1X37A 3A42A 1G4AE 2XF3A 3PNYA 4G4NA 2UUAM 4IJFA 4IIWA 3ZCBB 5A2QS 4GC5A 1ZAEA 3FUTA 5E6JA 3J7AS 1XXHB 3KDSE 2YR0A 3JR4A 4LF9M 3LQQA 2F5NA 3K2LA 1UM8A 1NY5A 3DOAA 3HWSA 3SYKA 5IREB 3SARA 4M0WA 3CTWB 4QHSA 1NNJA 5DYIA 2QZ4A 3VFDA 3U60A 3TWLA 4ITQA 1QAMA 3U6QA 3DFZA 3FUVA 3M6AA 4MGKE 2DWMA 1XWIA 3L27A 3HHXA 3SAVA 5KO3A 2LH0A 1HQYE 1NJFA 8CATA 4G6ZA 5ITYA 4GH9A 1HNZM 4JI4M 1Z5BA 4XBOA 3AL0C 4DUYM 3HHZA 2C5RA 3W0LB 4LFAM 2XGNA 3A45A 2DHRA 3U6EA 2NQ8C 2UU9M 2QENA 2M60A 4LJAA 4LG2A 4KODA 4DV5M 1J09A 2DVWB 4I81A 5ITXE 2R65A 2HCBA 3GRVA 4M0DA 5KPZA 3JR5A 4CHTB 2XZUA 3SBJA 2DZOB 1R2YA 2V1UA 4FWGA 5KPTA 4FCTA 4L16A 3J7BA 1YUBA 1N75A 2L7HA 4DV6M 3CF6E 4JN6A 2YQZA 3KXEC 3TE6A 3ILKA 1HR0M 4NXMM 1GL7A 1G3IA 3I4VA 2XSZD 4FWDA 4MGHA 4L15A 4B3SM 3M0EA 3TWKA 5IWAM 4B3TM 2BJVA 1ORYB 3LVWA 3GLGB 2ZANA 3GLFB 1K82A 4RF1A 2UUCM 2QBYB 3SMSA 2LWXA 4LGYA 3U6LA 4OVZB 3FTCA 2A5YB 4FVMA 4S12A 1IY1A 4NXNM 2CHQA 4LJ7A 3VLFB 1HNXM 2LXEA 3FYCA 2X4AA 1Q39A 2UXBM 2XFSA 1KYIA 5ITTA 3U6MA 2F4VM 1PJIA 1QANA 1QAQA 4GRIA 1IBLM 2JA2A 1E9RA 1HT1E 4DR7M 3GLIA 2R46A 2LNHC 1SXJE 1S3SA 1XHBA 4TUWA 5F3WA 1DGGA 4IBGA 2Z7JA 3HKPA 4X66M 4L8RC 2R45A 3B9PA 1YSYA 4NRWA 1KFVA 4K0KM 3KOXE 3GLIB 3U6OA 3VKHA 2ZAMA 4PCZA 1QVRA 3GLHA 4DV2M 2XFTA 4YHHM 2M5ZA 4X62M 5EXPA 5ITQA 4PD2A 3FTDA 3GRUA 5KQDA 4FW9A 3SASA 1TH2A 2BNKA 4DV3M 4I4LA 2DZNB 1YE9A 4LRSA 3WHLA 3SAUA 2X8AA 3SHGB 3JAMS 4X65M 1Z5AA 3U6SA 2QPAA 5EXXA 4B7FA 2CV2A 3GLHB 2EA0A 3GPUA 1N78A 4PDIA 2F5QA 5ITXA 3MHVC 3GO8A 2HHHM 1KSFX 3FUWA 1R6BX 1Z6TA 3KVWA 3DZDA 4R7GA 2Z4RA 4LY6A 2BJWA 3ZC7B 1L1ZA 4DV1M 4L4UA 1W5TA 1J5EM 4KO8A 4AZFA 2H1RA 5FLXS 2HL7A 4AKGA 4G4QA 2XZFA 3TWMA 4WURA 3IG8A 2O5RA 4JI0M 2ZM6M 4FCWA 2Z4SA 4AW4A 1OJLA 3U5ZA 1IBMM 5KQ8A 4NL4H 3PFIA 1L2DA 2FOIC 1J7KA 4LF5M 3EIHA 4YY3M 2L6OA 4HL4A 3U60B 1NJGA 4BBAA 4OX9M 4R3DA 3BOSA 2L7IA 4P16A 1XC8A 1R2ZA 3I4YA 1W5SA 4MGYE 2Y20A 2R62A 3U5ZB 4NOOB 1GLNA 2V1CA 3KSXA 4AG6A 4LGMA 3U6CA 5FTLA 5BR8M 4OU7A 4M9SA 2VQEM 1XNQM 5EP1A 5EXSA 5EP2A 2AHMA 2D7HA 4LJ6A 4JI3M 1IN8A 2Y21A 3HJ8A 1L1TA 4MH0E 1SXJA 3Q8XA 1N36M 5C18A 2XLJA 4II7A 4CISA 3ZH9B 2YFQA 3HHYA 3PXGA 3C58A 2UUBM 1DGFA 4DR2M 2CUZA 2KRUA 1NNUC 4M9XA 3KOWE 4GIPA 1EE8A 3T38A 4LFCM 5FTNA 3KW6A 3HU3A 1PM5A 2G5GX 2Z3XA 4QHTA 2VQFM 4MGIE 4JI1M 4L78A 4DV0M 4NSRA 4Z8XA 4HLQA 3LMMA 3W0FA 4PT5A 2KA6B 2RKOA 3NBIA 5E26A 4JI6M 3L28A 4LF7M 1IM2A 2QCUA 1NHWC 2DWLA 4ZPXA 3U61A 3GPPA 3GPXA 3UMMA 1L2CA 2RGHA 3D8LA 1FJGM 3FD9A 4IBJA 3WHKA 3L29A 3HU1A 1DGHA 3HJQA 7CATA 4AI6A 3FKEA 4IBDA 3J81S 1G8PA 2F5SA 3QAUA 4IBEA 5C1BA 1TH4A 4LJ9A 2F5PA 2G8LA 3PNVA 3SFZA 3AOGA 1N33M 1IXSB 4DUZM 1PJJA 3U61B 4B3RM 4MGZE 3A98B 4NSOB 2XEPA 1G59A 1WXQA 2EUCA 4GITA 1R7RA 1JR3A 4I5SA 3AFHA 4A3VB 3VK8A 3KP0E 2J7NA 3HHWA 5DYGA 4OW0A 5FTMA 2CV1A 2FFJA 3EIEA 1XNRM 1Z5CA 1N34M 2Q2EB 5LMNM 2KZUA 3J27B 2R4JA 3GRRA 1IY2A 2UXDM 3SMPA 1GL6A 4DV7M 4FWHA 1C1KA 1ZQ9A 4IBKA 5GKNA 3AV0A 1E9SA 2C98A 1OFHA 2R18A 3KOZE 4CGYB 4DV4M 3FTEA 4IBFA 4JYAM 1T3TA 3KFUG 2ERCA 4EIWA 3E9SA 1K3XA 3THGA 3LQRA 1QAOA 4QOZC 2C9OA 1H6UA 1GKIA 1NSFA 3GQ4A 3L2AA 3UK6A 3RE8A 3FUUA 4W5WA 4AQYM 4JV5M 4LJ8A 4JXJA 3K8ZA 4AKIA 4DR4M 1XXHA 3SATA 2CHVA 1NVMA 4LCBA 4REZA 5DNYA 3SC3A 4AKHA 1GVNA 5EQTA 2QP9X 4LFBM 4GKJM 4M9ZA 1HT2E 4JI7M 4LZZA 2X49A 4D80A 2UXCM 2OQ4A 1IBKM 3K1JA 5KPRA 4B3MM 3K92A 3UZUA 1HNWM 3AOEA 4IBBA 4G4OA 4FD2A 3U6DA 3L26A 2C96A 1MU5A 3PVSA 3TPZA 5EP4A 4PDGA 2FNAA 2KZSA 2CHGA 2P5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOW E;  3KP0 E;  3KOZ E;  3KP1 E;  3KOY E;  3KOX E; 
#chains in the Genus database with same CATH topology
 2Y0T A;  1FNN A;  2ZAO A;  4GHA A;  3KOY E;  2J5Y A;  3IHP A;  3K9O A;  5EP3 A;  4GKK M;  4BLC A;  2WSE F;  3GQ5 A;  4B7H A;  3MK6 A;  5JI2 E;  1JQJ C;  1XB2 B;  3HJS A;  1XMQ M;  5IT9 S;  4I8O A;  1LV7 A;  1L8Q A;  2CE7 A;  4AG5 A;  3U6P A;  3E4R A;  3J2P B;  3I01 M;  1I94 M;  4DR6 M;  1IN4 A;  2EO2 A;  4RF0 A;  2OOB A;  4R71 A;  1WGN A;  2OPF A;  3MJ5 A;  3KS8 A;  2YNM D;  3VKG A;  1IQP A;  1MJG M;  4NC6 A;  2I7P A;  1RU3 A;  1QYR A;  1OKS A;  3CF0 A;  5FTK A;  4DR5 M;  2I7N A;  2ZTD A;  2XSZ A;  1IN7 A;  2MRO B;  4LJ4 A;  2C9C A;  3LCU A;  5FSW A;  1MX0 A;  1DO2 A;  3L25 A;  2F5O A;  2G3Q A;  4LZJ A;  2K47 A;  4QNM A;  3ZQJ A;  5H37 D;  5JI3 E;  4G4R A;  2ZBK B;  3J80 S;  1AUA A;  2C99 A;  4MB7 A;  1Z59 A;  3AOE C;  3I51 A;  3KSJ A;  3HGI A;  2MH8 A;  3QWL A;  4WP2 A;  3TL4 X;  4LF6 M;  3VDP A;  3KS4 A;  3AKZ A;  4GC9 A;  4QNR A;  1R4G A;  3GLF A;  3GLG A;  1SXJ B;  2VII A;  1TDZ A;  4KHP M;  1QQW A;  2V6Z M;  4IJE A;  3VDU A;  2RGO A;  1TDH A;  2QBY A;  3AJI B;  1IN5 A;  4LF4 M;  3GPY A;  1SXJ D;  3UGJ A;  4OVZ A;  3DA1 A;  1D0K A;  2CFO A;  3GQ3 A;  2D7G A;  4LF8 M;  1DO0 A;  2QSF X;  3LVV A;  1Q02 A;  2FE8 A;  1TR8 A;  3CGW A;  1WIV A;  4MM3 B;  2JY5 A;  3Q8G A;  2KEB A;  4BB9 A;  1G41 A;  3H4M A;  1HQC A;  4B7G A;  3GP1 A;  4D81 A;  1OFI A;  3R9X B;  2J7O A;  5FTJ A;  2KW0 A;  4DR3 M;  4FCV A;  5LMU M;  3GRY A;  3RGP A;  3SHF A;  1L2B A;  2KRK A;  5EXT A;  3T15 A;  1DGB A;  1SXJ C;  4LRT A;  1DV0 A;  5ITU A;  3H4J A;  1N32 M;  3UJN A;  1E32 A;  2CEA A;  4CJ6 A;  3SAW A;  4IBC A;  2E5L M;  1IXZ A;  1NY6 A;  4D82 A;  4GHL A;  1Q3C A;  2DXI A;  3QYB A;  1DGH B;  2JY6 B;  3GLG E;  2R6F A;  1OTR A;  4JI2 M;  2R4E A;  5EJC A;  4KLN A;  2DEN A;  4DR1 M;  1IY0 A;  2HKJ A;  3SYL A;  3FE3 A;  1TH3 A;  1QZM A;  3FUX A;  2CV0 A;  1NHG C;  2DWZ B;  4B08 A;  3RGS A;  3C3D A;  4X64 M;  2CP8 A;  3CF2 A;  4RNA A;  3R8F A;  3T1Y M;  2GNO A;  3VK7 A;  5ITR A;  4WW0 A;  1OIP A;  2WSF F;  2D7E A;  1N77 A;  2WSC F;  2KXE A;  2DWN A;  4JI5 M;  2MJ5 B;  1Q3B A;  1IN6 A;  2XH9 A;  2DI0 A;  1JR3 D;  3A46 A;  1K3W A;  3FYD A;  2B3T A;  1IXR C;  3NWL A;  1D2N A;  4JI8 M;  3OTO M;  2Y0Q A;  3KP1 E;  1NO1 A;  4Z6Y A;  1VDD A;  3IG5 A;  3K9P A;  4LJ5 A;  1I4W A;  2MGW A;  5DFL A;  2L09 A;  4QOS A;  4L6V 6;  3FTF A;  1XMO M;  2W82 A;  5IZ7 D;  3T1H M;  5BPV A;  3TQS A;  4F2L A;  1TGU A;  1VG5 A;  3B7Z A;  3HU2 A;  4IBI A;  3RFW A;  4NRV A;  3D8B A;  1E94 E;  3M7G A;  4GMQ A;  4P17 A;  4XGI A;  1PJT A;  1X37 A;  3A42 A;  1G4A E;  2XF3 A;  2QQ8 A;  1TF0 B;  3PNY A;  4G4N A;  2UUA M;  4IJF A;  4IIW A;  3T6P A;  3GLI E;  3ZCB B;  5A2Q S;  4GC5 A;  1ZAE A;  3FUT A;  5E6J A;  1C7Y A;  1PRB A;  1XXH B;  3KDS E;  3J7A S;  2YR0 A;  2DAE A;  4UN2 B;  3JR4 A;  3LQQ A;  4LF9 M;  2F5N A;  3K2L A;  1UM8 A;  1NY5 A;  3DOA A;  3HWS A;  1QZE A;  3C3E A;  3SYK A;  5IRE B;  3SAR A;  4M0W A;  3CTW B;  4QHS A;  1NNJ A;  5DYI A;  2QZ4 A;  3HY5 A;  3VFD A;  3U60 A;  3TWL A;  4ITQ A;  1A5T A;  1QAM A;  3U6Q A;  3DFZ A;  4XK8 F;  3FUV A;  3M6A A;  4MGK E;  2DWM A;  2LBC A;  1XWI A;  3GLH E;  3HHX A;  3L27 A;  5KO3 A;  2LH0 A;  1HQY E;  1NJF A;  8CAT A;  3SAV A;  4G6Z A;  5ITY A;  4GH9 A;  3FRH A;  1HNZ M;  2HWJ A;  4JI4 M;  1Z5B A;  4XBO A;  3AL0 C;  4DUY M;  1F4I A;  3HHZ A;  2C5R A;  3W0L B;  4GEW A;  4LFA M;  2XGN A;  3A45 A;  2DHR A;  2DAG A;  3U6E A;  2NQ8 C;  1D0L A;  2UU9 M;  2QEN A;  2K6B A;  2LHG A;  2M60 A;  3W68 A;  4LJA A;  4DBG B;  4LG2 A;  4KOD A;  4DV5 M;  1J09 A;  1WHC A;  2DVW B;  4I81 A;  5ITX E;  2R65 A;  2HCB A;  3GRV A;  4M0D A;  5KPZ A;  3JR5 A;  4CHT B;  2XZU A;  3SBJ A;  2DZO B;  1R2Y A;  2V1U A;  4FWG A;  5KPT A;  1PJQ A;  4FCT A;  4L16 A;  3J7B A;  1YUB A;  1GAB A;  1N75 A;  2L7H A;  4DV6 M;  3CF6 E;  4JN6 A;  2YQZ A;  3KXE C;  3TE6 A;  3ILK A;  1HR0 M;  3C9P A;  1OAO C;  4NXM M;  2LVQ D;  1QUT A;  1GL7 A;  2K0B X;  1G3I A;  3I4V A;  2XSZ D;  2DNA A;  4FWD A;  4MGH A;  1VEJ A;  4L15 A;  2O01 F;  4B3S M;  1T6O A;  3M0E A;  3TWK A;  5IWA M;  1GJS A;  1D0M A;  4B3T M;  2BJV A;  1ORY B;  4Y28 F;  3LVW A;  3GLG B;  2ZAN A;  3GLF B;  1K82 A;  2LVN C;  4RF1 A;  2UUC M;  3NBX X;  2QBY B;  2HAK A;  3SMS A;  2LWX A;  4LGY A;  3U6L A;  2BWB A;  4OVZ B;  2EKK A;  3FTC A;  1BVS A;  2A5Y B;  4FVM A;  4S12 A;  1IY1 A;  1WR1 B;  2CHQ A;  4LJ7 A;  4NXN M;  3VLF B;  1IXS A;  1HNX M;  2LXE A;  2X4A A;  3FYC A;  1Q39 A;  2UXB M;  1KYI A;  2XFS A;  5ITT A;  3U6M A;  2F4V M;  3E46 A;  1PJI A;  1QAN A;  1QAQ A;  2LHC A;  4GRI A;  1IBL M;  2JA2 A;  1E9R A;  1HT1 E;  4DR7 M;  3BBZ A;  3GLI A;  2R46 A;  1T43 A;  2LNH C;  2VF7 A;  1NV9 A;  1SXJ E;  1S3S A;  1QDT A;  1XHB A;  4TUW A;  5F3W A;  3IEC A;  1DGG A;  4IBG A;  2Z7J A;  3HKP A;  4X66 M;  2LVP C;  4L8R C;  2R45 A;  3B9P A;  1YSY A;  4NRW A;  1TTE A;  1KFV A;  4K0K M;  3KOX E;  3GLI B;  1QUS A;  3U6O A;  3VKH A;  2ZAM A;  4PCZ A;  1QVR A;  1G71 A;  3GLH A;  2EJS A;  4DV2 M;  2XFT A;  4YHH M;  2M5Z A;  4X62 M;  5EXP A;  5ITQ A;  4PD2 A;  3FTD A;  1V34 A;  2KNZ A;  3GRU A;  5KQD A;  4FW9 A;  3SAS A;  1TH2 A;  1AIP C;  2BNK A;  4DV3 M;  4I4L A;  1V92 A;  1ZV1 A;  2DZN B;  1YE9 A;  4LRS A;  2DZL A;  1Y8G A;  3WHL A;  3SAU A;  2X8A A;  3SHG B;  3JAM S;  4X65 M;  1Z5A A;  3U6S A;  4CIZ A;  4HEO A;  3HX3 A;  1JB0 F;  2QPA A;  5EXX A;  3B74 A;  4B7F A;  2CV2 A;  3GLH B;  2MR9 A;  2EA0 A;  3GPU A;  1N78 A;  4PDI A;  2F5Q A;  5ITX A;  3MHV C;  3GO8 A;  2HHH M;  1KSF X;  3FUW A;  1R6B X;  4G3O A;  1Z6T A;  3KVW A;  3DZD A;  4R7G A;  1UFZ A;  2Z4R A;  4LY6 A;  2BJW A;  3ZC7 B;  4ANR A;  1L1Z A;  1YLA A;  1VEG A;  2DKL A;  2JY7 A;  4DV1 M;  4L4U A;  1W5T A;  1J5E M;  4KO8 A;  4AZF A;  2H1R A;  3I04 M;  2BWE A;  2HL7 A;  5FLX S;  4G4Q A;  4AKG A;  2XZF A;  3TWM A;  4WUR A;  2WZJ A;  3IG8 A;  1JR3 E;  1QDR A;  2O5R A;  1OAI A;  4JI0 M;  2R0I A;  2ZM6 M;  4FCW A;  2N35 A;  2Z4S A;  4AW4 A;  1OJL A;  1WJ7 A;  3U5Z A;  1PJS A;  1EFU B;  2OO9 A;  2VDB B;  2FS1 A;  1IBM M;  5KQ8 A;  4NL4 H;  2K9D A;  3PFI A;  1L2D A;  2FOI C;  1J7K A;  2JZ1 A;  4LF5 M;  3EIH A;  2L4F A;  3LW5 F;  4YY3 M;  2RRU A;  2L6O A;  4HL4 A;  3U60 B;  1NJG A;  1EIJ A;  4BBA A;  1VEK A;  4OX9 M;  4R3D A;  4Q7J A;  3BOS A;  2L7I A;  1OIZ A;  4P16 A;  1XC8 A;  3B7Q A;  1R2Z A;  3I4Y A;  1W5S A;  4MGY E;  2Z8Y M;  2Y20 A;  2R62 A;  3U5Z B;  4NOO B;  3B7N A;  1GLN A;  2V1C A;  2LTU A;  3KSX A;  2JNH A;  4AG6 A;  4LGM A;  3U6C A;  2LVO C;  1R5L A;  5FTL A;  5BR8 M;  1XXH E;  4M9S A;  4OU7 A;  2VQE M;  1XNQ M;  2JUJ A;  1WGL A;  5EP1 A;  5EP2 A;  2AHM A;  2D7H A;  4LJ6 A;  5EXS A;  4JI3 M;  1IN8 A;  2Y21 A;  3HJ8 A;  1L1T A;  4MH0 E;  1SXJ A;  3Q8X A;  1NV8 A;  2OOA A;  5C18 A;  2XLJ A;  1N36 M;  4II7 A;  4CIS A;  2CRU A;  2GQF A;  2YFQ A;  3ZH9 B;  3HHY A;  3PXG A;  3C58 A;  2UUB M;  1DGF A;  2CWB A;  1OQY A;  2CUZ A;  4DR2 M;  2KRU A;  1NNU C;  4M9X A;  2DHY A;  3KOW E;  1EE8 A;  4GIP A;  3T38 A;  2R44 A;  4LFC M;  2JZ0 A;  5FTN A;  3KW6 A;  3HU3 A;  1PM5 A;  3LCV B;  2G5G X;  2Z3X A;  4QHT A;  2VQF M;  4MGI E;  4JI1 M;  4L78 A;  4DV0 M;  4NSR A;  4Z8X A;  4HLQ A;  3LMM A;  3W0F A;  2L2D A;  3F92 A;  2KA6 B;  2RKO A;  3NBI A;  4PT5 A;  5E26 A;  4JI6 M;  2DAM A;  3L28 A;  4LF7 M;  1GJT A;  1IM2 A;  2QCU A;  1NHW C;  2DWL A;  2JP7 A;  4ZPX A;  3U61 A;  3V76 A;  3FRI A;  2JXN A;  2APL A;  3HZJ A;  5L8R F;  3GPP A;  3GPX A;  2FH0 A;  3UMM A;  1L2C A;  1MN3 A;  2RGH A;  3D8L A;  2KHH A;  1FJG M;  3FD9 A;  4IBJ A;  2DAK A;  3WHK A;  2JY8 A;  3L29 A;  3HU1 A;  1DGH A;  1HJP A;  3HJQ A;  7CAT A;  4AI6 A;  2KNA A;  3FKE A;  3QYE A;  1G8P A;  4IBD A;  3J81 S;  2F5S A;  3QAU A;  4IBE A;  5C1B A;  4KT0 F;  1TH4 A;  4LJ9 A;  2F5P A;  2G8L A;  2VF8 A;  3PNV A;  3SFZ A;  1PGY A;  3AOG A;  4F1I A;  1N33 M;  1IXS B;  4RKU F;  4DUZ M;  1PJJ A;  3U61 B;  4B3R M;  4MGZ E;  3A98 B;  4NSO B;  2XEP A;  1G59 A;  1GO5 A;  1WXQ A;  1CUK A;  2EUC A;  4GIT A;  1R7R A;  1JR3 A;  4I5S A;  1V33 A;  3AFH A;  2QNJ A;  3W67 A;  4A3V B;  3VK8 A;  3KP0 E;  2J7N A;  3HHW A;  5DYG A;  4OW0 A;  3GLF E;  5FTM A;  2CV1 A;  2FFJ A;  3EIE A;  1XNR M;  1Z5C A;  1N34 M;  2Q2E B;  5LMN M;  2KZU A;  3J27 B;  1VQ1 A;  2R4J A;  1LTM A;  2JWS A;  3GRR A;  1IY2 A;  2UXD M;  3SMP A;  1GL6 A;  2ZTC A;  4FWH A;  4DV7 M;  1C1K A;  1ZQ9 A;  2EKF A;  4IBK A;  3AV0 A;  5GKN A;  1E9S A;  2C98 A;  1OFH A;  2R18 A;  3KOZ E;  4CGY B;  4DV4 M;  3FTE A;  1IFY A;  4IBF A;  4JYA M;  1T3T A;  3KFU G;  2ERC A;  1VDL A;  4EIW A;  3E9S A;  1K3X A;  3THG A;  3LQR A;  1QAO A;  4QOZ C;  2C9O A;  1H6U A;  1GKI A;  1NSF A;  1SG9 A;  3GQ4 A;  3L2A A;  1ZMW A;  3BXW A;  3RE8 A;  3UK6 A;  2LVA A;  3FUU A;  4W5W A;  4AQY M;  2QHO B;  4JV5 M;  4LJ8 A;  2KDL A;  3E21 A;  2KNV A;  4JXJ A;  3K8Z A;  4AKI A;  4DR4 M;  2L4E A;  1XXH A;  3SAT A;  2CHV A;  1NVM A;  3B89 A;  4LCB A;  4REZ A;  5DNY A;  3SC3 A;  2O25 A;  1ZMV A;  4AKH A;  1GVN A;  3MMP A;  2QP9 X;  5EQT A;  4LFB M;  4GKJ M;  4M9Z A;  1HT2 E;  4JI7 M;  4LZZ A;  2X49 A;  4D80 A;  2UXC M;  2OQ4 A;  1IBK M;  1ZMU A;  3K1J A;  5KPR A;  4B3M M;  3K92 A;  3UZU A;  1HNW M;  3AOE A;  4IBB A;  4G4O A;  4FD2 A;  3U6D A;  3L26 A;  2C96 A;  2H5X A;  1MU5 A;  3PVS A;  3TPZ A;  5EP4 A;  4PDG A;  2FNA A;  1P3Q Q;  2KZS A;  2CHG A;  2P5T A;  2DAI A; 
#chains in the Genus database with same CATH homology
 2Y0T A;  1FNN A;  2ZAO A;  4GHA A;  3KOY E;  4GKK M;  5EP3 A;  4BLC A;  3GQ5 A;  4B7H A;  3MK6 A;  5JI2 E;  1JQJ C;  3HJS A;  1XMQ M;  5IT9 S;  4I8O A;  1LV7 A;  1L8Q A;  2CE7 A;  4AG5 A;  3U6P A;  3E4R A;  3J2P B;  1I94 M;  4DR6 M;  1IN4 A;  2EO2 A;  4RF0 A;  2OPF A;  3MJ5 A;  3KS8 A;  2YNM D;  3VKG A;  1IQP A;  2I7P A;  1QYR A;  3CF0 A;  5FTK A;  4DR5 M;  2I7N A;  2XSZ A;  1IN7 A;  4LJ4 A;  2C9C A;  5FSW A;  1MX0 A;  1DO2 A;  3L25 A;  2F5O A;  4LZJ A;  2K47 A;  4QNM A;  5H37 D;  5JI3 E;  4G4R A;  2ZBK B;  3J80 S;  2C99 A;  4MB7 A;  1Z59 A;  3AOE C;  3I51 A;  3KSJ A;  3HGI A;  3QWL A;  3TL4 X;  4LF6 M;  3VDP A;  3KS4 A;  3AKZ A;  4GC9 A;  4QNR A;  3GLF A;  3GLG A;  1SXJ B;  2VII A;  1TDZ A;  4KHP M;  1QQW A;  2V6Z M;  4IJE A;  3VDU A;  2RGO A;  1TDH A;  2QBY A;  3AJI B;  1IN5 A;  4LF4 M;  3GPY A;  1SXJ D;  3UGJ A;  4OVZ A;  3DA1 A;  2CFO A;  3GQ3 A;  2D7G A;  4LF8 M;  1DO0 A;  3LVV A;  2FE8 A;  4MM3 B;  2KEB A;  4BB9 A;  1G41 A;  3H4M A;  1HQC A;  4B7G A;  3GP1 A;  4D81 A;  1OFI A;  3R9X B;  2J7O A;  5FTJ A;  2KW0 A;  4DR3 M;  4FCV A;  5LMU M;  3GRY A;  3RGP A;  3SHF A;  1L2B A;  2KRK A;  5EXT A;  3T15 A;  1DGB A;  1SXJ C;  4LRT A;  5ITU A;  1N32 M;  3UJN A;  1E32 A;  2CEA A;  3SAW A;  4IBC A;  2E5L M;  1IXZ A;  1NY6 A;  4D82 A;  4GHL A;  1Q3C A;  2DXI A;  1DGH B;  4JI2 M;  2R4E A;  5EJC A;  4KLN A;  4DR1 M;  1IY0 A;  2HKJ A;  3SYL A;  1TH3 A;  1QZM A;  3FUX A;  2CV0 A;  1NHG C;  2DWZ B;  4B08 A;  3RGS A;  4X64 M;  3CF2 A;  4RNA A;  3R8F A;  3T1Y M;  3VK7 A;  5ITR A;  4WW0 A;  2D7E A;  1N77 A;  2DWN A;  2KXE A;  4JI5 M;  1Q3B A;  1IN6 A;  2XH9 A;  1JR3 D;  3A46 A;  1K3W A;  3FYD A;  3NWL A;  1IXR C;  1D2N A;  4JI8 M;  3OTO M;  2Y0Q A;  3KP1 E;  4Z6Y A;  1VDD A;  3IG5 A;  4LJ5 A;  1I4W A;  2L09 A;  4QOS A;  3FTF A;  1XMO M;  2W82 A;  5IZ7 D;  3T1H M;  5BPV A;  3TQS A;  1TGU A;  3HU2 A;  4IBI A;  3RFW A;  4NRV A;  3D8B A;  1E94 E;  3M7G A;  4GMQ A;  4XGI A;  1X37 A;  3A42 A;  1G4A E;  2XF3 A;  3PNY A;  4G4N A;  2UUA M;  4IJF A;  4IIW A;  3ZCB B;  5A2Q S;  4GC5 A;  1ZAE A;  3FUT A;  5E6J A;  3J7A S;  1XXH B;  3KDS E;  2YR0 A;  3JR4 A;  4LF9 M;  3LQQ A;  2F5N A;  3K2L A;  1UM8 A;  1NY5 A;  3DOA A;  3HWS A;  3SYK A;  5IRE B;  3SAR A;  4M0W A;  3CTW B;  4QHS A;  1NNJ A;  5DYI A;  2QZ4 A;  3VFD A;  3U60 A;  3TWL A;  4ITQ A;  1QAM A;  3U6Q A;  3DFZ A;  3FUV A;  3M6A A;  4MGK E;  2DWM A;  1XWI A;  3L27 A;  3HHX A;  3SAV A;  5KO3 A;  2LH0 A;  1HQY E;  1NJF A;  8CAT A;  4G6Z A;  5ITY A;  4GH9 A;  1HNZ M;  4JI4 M;  1Z5B A;  4XBO A;  3AL0 C;  4DUY M;  3HHZ A;  2C5R A;  3W0L B;  4LFA M;  2XGN A;  3A45 A;  2DHR A;  3U6E A;  2NQ8 C;  2UU9 M;  2QEN A;  2M60 A;  4LJA A;  4LG2 A;  4KOD A;  4DV5 M;  1J09 A;  2DVW B;  4I81 A;  5ITX E;  2R65 A;  2HCB A;  3GRV A;  4M0D A;  5KPZ A;  3JR5 A;  4CHT B;  2XZU A;  3SBJ A;  2DZO B;  1R2Y A;  2V1U A;  4FWG A;  5KPT A;  4FCT A;  4L16 A;  3J7B A;  1YUB A;  1N75 A;  2L7H A;  4DV6 M;  3CF6 E;  4JN6 A;  2YQZ A;  3KXE C;  3TE6 A;  3ILK A;  1HR0 M;  4NXM M;  1GL7 A;  1G3I A;  3I4V A;  2XSZ D;  4FWD A;  4MGH A;  4L15 A;  4B3S M;  3M0E A;  3TWK A;  5IWA M;  4B3T M;  2BJV A;  1ORY B;  3LVW A;  3GLG B;  2ZAN A;  3GLF B;  1K82 A;  4RF1 A;  2UUC M;  2QBY B;  3SMS A;  2LWX A;  4LGY A;  3U6L A;  4OVZ B;  3FTC A;  2A5Y B;  4FVM A;  4S12 A;  1IY1 A;  4NXN M;  2CHQ A;  4LJ7 A;  3VLF B;  1HNX M;  2LXE A;  3FYC A;  2X4A A;  1Q39 A;  2UXB M;  2XFS A;  1KYI A;  5ITT A;  3U6M A;  2F4V M;  1PJI A;  1QAN A;  1QAQ A;  4GRI A;  1IBL M;  2JA2 A;  1E9R A;  1HT1 E;  4DR7 M;  3GLI A;  2R46 A;  2LNH C;  1SXJ E;  1S3S A;  1XHB A;  4TUW A;  5F3W A;  1DGG A;  4IBG A;  2Z7J A;  3HKP A;  4X66 M;  4L8R C;  2R45 A;  3B9P A;  1YSY A;  4NRW A;  1KFV A;  4K0K M;  3KOX E;  3GLI B;  3U6O A;  3VKH A;  2ZAM A;  4PCZ A;  1QVR A;  3GLH A;  4DV2 M;  2XFT A;  4YHH M;  2M5Z A;  4X62 M;  5EXP A;  5ITQ A;  4PD2 A;  3FTD A;  3GRU A;  5KQD A;  4FW9 A;  3SAS A;  1TH2 A;  2BNK A;  4DV3 M;  4I4L A;  2DZN B;  1YE9 A;  4LRS A;  3WHL A;  3SAU A;  2X8A A;  3SHG B;  3JAM S;  4X65 M;  1Z5A A;  3U6S A;  2QPA A;  5EXX A;  4B7F A;  2CV2 A;  3GLH B;  2EA0 A;  3GPU A;  1N78 A;  4PDI A;  2F5Q A;  5ITX A;  3MHV C;  3GO8 A;  2HHH M;  1KSF X;  3FUW A;  1R6B X;  1Z6T A;  3KVW A;  3DZD A;  4R7G A;  2Z4R A;  4LY6 A;  2BJW A;  3ZC7 B;  1L1Z A;  4DV1 M;  4L4U A;  1W5T A;  1J5E M;  4KO8 A;  4AZF A;  2H1R A;  5FLX S;  2HL7 A;  4AKG A;  4G4Q A;  2XZF A;  3TWM A;  4WUR A;  3IG8 A;  2O5R A;  4JI0 M;  2ZM6 M;  4FCW A;  2Z4S A;  4AW4 A;  1OJL A;  3U5Z A;  1IBM M;  5KQ8 A;  4NL4 H;  3PFI A;  1L2D A;  2FOI C;  1J7K A;  4LF5 M;  3EIH A;  4YY3 M;  2L6O A;  4HL4 A;  3U60 B;  1NJG A;  4BBA A;  4OX9 M;  4R3D A;  3BOS A;  2L7I A;  4P16 A;  1XC8 A;  1R2Z A;  3I4Y A;  1W5S A;  4MGY E;  2Y20 A;  2R62 A;  3U5Z B;  4NOO B;  1GLN A;  2V1C A;  3KSX A;  4AG6 A;  4LGM A;  3U6C A;  5FTL A;  5BR8 M;  4OU7 A;  4M9S A;  2VQE M;  1XNQ M;  5EP1 A;  5EXS A;  5EP2 A;  2AHM A;  2D7H A;  4LJ6 A;  4JI3 M;  1IN8 A;  2Y21 A;  3HJ8 A;  1L1T A;  4MH0 E;  1SXJ A;  3Q8X A;  1N36 M;  5C18 A;  2XLJ A;  4II7 A;  4CIS A;  3ZH9 B;  2YFQ A;  3HHY A;  3PXG A;  3C58 A;  2UUB M;  1DGF A;  4DR2 M;  2CUZ A;  2KRU A;  1NNU C;  4M9X A;  3KOW E;  4GIP A;  1EE8 A;  3T38 A;  4LFC M;  5FTN A;  3KW6 A;  3HU3 A;  1PM5 A;  2G5G X;  2Z3X A;  4QHT A;  2VQF M;  4MGI E;  4JI1 M;  4L78 A;  4DV0 M;  4NSR A;  4Z8X A;  4HLQ A;  3LMM A;  3W0F A;  4PT5 A;  2KA6 B;  2RKO A;  3NBI A;  5E26 A;  4JI6 M;  3L28 A;  4LF7 M;  1IM2 A;  2QCU A;  1NHW C;  2DWL A;  4ZPX A;  3U61 A;  3GPP A;  3GPX A;  3UMM A;  1L2C A;  2RGH A;  3D8L A;  1FJG M;  3FD9 A;  4IBJ A;  3WHK A;  3L29 A;  3HU1 A;  1DGH A;  3HJQ A;  7CAT A;  4AI6 A;  3FKE A;  4IBD A;  3J81 S;  1G8P A;  2F5S A;  3QAU A;  4IBE A;  5C1B A;  1TH4 A;  4LJ9 A;  2F5P A;  2G8L A;  3PNV A;  3SFZ A;  3AOG A;  1N33 M;  1IXS B;  4DUZ M;  1PJJ A;  3U61 B;  4B3R M;  4MGZ E;  3A98 B;  4NSO B;  2XEP A;  1G59 A;  1WXQ A;  2EUC A;  4GIT A;  1R7R A;  1JR3 A;  4I5S A;  3AFH A;  4A3V B;  3VK8 A;  3KP0 E;  2J7N A;  3HHW A;  5DYG A;  4OW0 A;  5FTM A;  2CV1 A;  2FFJ A;  3EIE A;  1XNR M;  1Z5C A;  1N34 M;  2Q2E B;  5LMN M;  2KZU A;  3J27 B;  2R4J A;  3GRR A;  1IY2 A;  2UXD M;  3SMP A;  1GL6 A;  4DV7 M;  4FWH A;  1C1K A;  1ZQ9 A;  4IBK A;  5GKN A;  3AV0 A;  1E9S A;  2C98 A;  1OFH A;  2R18 A;  3KOZ E;  4CGY B;  4DV4 M;  3FTE A;  4IBF A;  4JYA M;  1T3T A;  3KFU G;  2ERC A;  4EIW A;  3E9S A;  1K3X A;  3THG A;  3LQR A;  1QAO A;  4QOZ C;  2C9O A;  1H6U A;  1GKI A;  1NSF A;  3GQ4 A;  3L2A A;  3UK6 A;  3RE8 A;  3FUU A;  4W5W A;  4AQY M;  4JV5 M;  4LJ8 A;  4JXJ A;  3K8Z A;  4AKI A;  4DR4 M;  1XXH A;  3SAT A;  2CHV A;  1NVM A;  4LCB A;  4REZ A;  5DNY A;  3SC3 A;  4AKH A;  1GVN A;  5EQT A;  2QP9 X;  4LFB M;  4GKJ M;  4M9Z A;  1HT2 E;  4JI7 M;  4LZZ A;  2X49 A;  4D80 A;  2UXC M;  2OQ4 A;  1IBK M;  3K1J A;  5KPR A;  4B3M M;  3K92 A;  3UZU A;  1HNW M;  3AOE A;  4IBB A;  4G4O A;  4FD2 A;  3U6D A;  3L26 A;  2C96 A;  1MU5 A;  3PVS A;  3TPZ A;  5EP4 A;  4PDG A;  2FNA A;  2KZS A;  2CHG A;  2P5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...