3KOYE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (aerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3koyE02
3KP0E 3KOXE 3KOZE 3KP1E 3KOYE 3KOWE
chains in the Genus database with same CATH superfamily
3HWSA 1D0KA 2LHCA 2LVPC 4AG5A 4BLCA 3GLFA 2C5RA 4B7FA 2P5TA 2XSZD 2KNZA 4NXNM 1IN4A 2QENA 1Q02A 4WURA 1N33M 1WIVA 3VKGA 2N35A 3NWLA 3SYKA 3Q8XA 3E21A 4MH0E 2LNHC 2XF3A 4D82A 1Z5CA 2KZUA 1JR3A 1PJSA 4DR3M 5FTMA 1J5EM 4D81A 1T43A 3FD9A 3LVVA 4JV5M 3T1HM 5DYIA 1T3TA 1GJSA 1NSFA 1DO0A 3KXEC 2GQFA 2FNAA 3FRIA 1HT1E 4HLQA 3GLGB 1G59A 5DNYA 3JR5A 4MGHA 4TUWA 3GRYA 1TH4A 2O25A 4LRSA 2V1CA 3HJ8A 4RNAA 3GP1A 2EJSA 3KOWE 4II7A 4B7HA 3SHGB 3SASA 4LZZA 2O5RA 3TL4X 2CHQA 2NQ8C 4F2LA 2DNAA 2V6ZM 2E5LM 3EIEA 2XSZA 3VDUA 4QOSA 1QYRA 1NV8A 1YUBA 4G6ZA 1QAOA 3VK7A 4B3SM 2LHGA 3GLIE 1SXJE 2KA6B 7CATA 1K82A 3R9XB 2Y21A 3KVWA 1WHCA 5KPZA 2DAEA 2L2DA 2ZAMA 1OIZA 2KRUA 3PVSA 1ZV1A 3FYCA 1IY1A 2CV1A 3B74A 2I7NA 3IHPA 4XGIA 3GO8A 3GRVA 1MX0A 2LVOC 5LMNM 2HL7A 2RRUA 3HU1A 3SBJA 2L4FA 1Q3BA 3GQ4A 5FTNA 3T6PA 4P16A 4G4QA 3LMMA 2W82A 4JN6A 4GHLA 2F5OA 3U6LA 2KNAA 2C98A 2DHRA 2HAKA 4LJAA 4OW0A 2DWNA 2VIIA 3TWKA 2XGNA 1OAOC 2WSCF 4LG2A 1X37A 4IJFA 2UUCM 1Y8GA 3B89A 1IN5A 4YHHM 4FCVA 4MGIE 3J7BA 2WZJA 5LMUM 2I7PA 2LTUA 4X64M 4JI2M 3C3EA 3R8FA 3B7ZA 3FTFA 1WGNA 4JYAM 3LQRA 3K92A 1WGLA 3T1YM 5IZ7D 4B7GA 2UXBM 1IN7A 1WJ7A 3AFHA 4PDIA 3KS8A 4L15A 3JR4A 1MJGM 4DR1M 1GO5A 4GIPA 1IN6A 1NJGA 3AKZA 3FYDA 1BVSA 2R44A 2DWMA 1SG9A 4LJ4A 4LFBM 4R71A 2F5NA 4GKJM 3SAUA 4MGKE 4QOZC 5FTLA 4YY3M 2QBYB 3M0EA 1MN3A 3HHYA 2DAIA 5BPVA 1IFYA 4MGZE 3BBZA 5ITTA 4JI0M 1VDDA 1R2YA 2J7NA 2KNVA 4M9ZA 3U6SA 1LV7A 1V92A 4LJ5A 1N34M 2YNMD 3L26A 1TH3A 4UN2B 3AL0C 4GC5A 4NXMM 3DZDA 1TTEA 2XZUA 2CEAA 1J09A 2VF7A 2DVWB 2DZLA 2K47A 4X65M 1IBLM 1R4GA 2MJ5B 2XH9A 3M7GA 1VEGA 2R4EA 2DXIA 4REZA 3U60A 1FNNA 2O01F 2FE8A 4PD2A 1HQYE 3L28A 1NNUC 3GPXA 1JB0F 1JR3D 3DA1A 3GLFE 2F5SA 1QAMA 1N36M 2EUCA 4NL4H 1V33A 2K0BX 2EKFA 2LVQD 4DV5M 3GQ5A 3MMPA 3JAMS 3H4JA 1QUSA 4LJ7A 2XZFA 4LF4M 2R46A 4LF5M 1HNZM 3W67A 1JR3E 3J80S 1VEKA 5EXTA 1OFHA 1DO2A 3ZQJA 2C9OA 1K3WA 3U6CA 1XMOM 3FUXA 2RGHA 3U6EA 3SARA 1LTMA 4LF6M 1HNWM 4FVMA 2KW0A 2LVNC 3V76A 3IECA 3ZH9B 4OX9M 1L1TA 4R3DA 3I04M 2Z4RA 3NBIA 5ITXA 2CHVA 4HL4A 3RFWA 4RF0A 1HJPA 3C9PA 2L7HA 2JXNA 3U5ZA 1D0LA 4A3VB 2JZ0A 2HHHM 5FTJA 3L27A 1IY0A 3CF0A 2EO2A 4K0KM 1C1KA 4Z6YA 3ZCBB 1V34A 4OVZB 2LBCA 1W5TA 2KRKA 3FUUA 1DGGA 3FUTA 4LGYA 2KEBA 3I4VA 4GC9A 2DENA 3E9SA 3J27B 3SYLA 1IN8A 1XXHA 4DR6M 1DGHB 1OFIA 3RGPA 4IBFA 4L16A 2CV0A 4AKHA 3GLHA 2UUAM 1S3SA 3CF2A 3K1JA 1TGUA 4FWDA 4DV4M 1AIPC 2KXEA 4NRWA 3FE3A 3NBXX 2Y20A 3LQQA 1I4WA 3PXGA 4DUZM 3VK8A 4I5SA 3GLIB 2VF8A 1SXJB 1C7YA 3MJ5A 5JI2E 2L6OA 1NNJA 4M0WA 1NHGC 2ZAOA 3CGWA 4DV3M 3D8LA 1E94E 3U6MA 3WHLA 1OAIA 1WR1B 2OOBA 1NY5A 1TDZA 3KS4A 3C58A 1XNQM 4KO8A 2YQZA 1TDHA 3DOAA 4GKKM 1IXSB 1XC8A 1NHWC 1Q3CA 4GEWA 1WXQA 3SMPA 1KFVA 3L25A 3T15A 3L29A 1D2NA 1G4AE 3BOSA 2WSEF 4FW9A 8CATA 5EP4A 2JWSA 2GNOA 2JZ1A 3AOGA 3F92A 4PCZA 2XLJA 1YSYA 3VKHA 2LXEA 3PNVA 3J81S 3GQ3A 3HJSA 5JI3E 4QHTA 1PJJA 2DZOB 4JI4M 4L8RC 2A5YB 4ANRA 2C96A 2D7HA 5ITUA 3SFZA 4LJ9A 4CISA 3T38A 1Z5AA 3PNYA 2BJVA 4FWGA 1L1ZA 2OOAA 1ZMUA 4L78A 1CUKA 5EP2A 3K9OA 2OQ4A 1J7KA 4LY6A 4IBJA 4P17A 1YE9A 2QSFX 3CTWB 5ITYA 2OPFA 5L8RF 2QNJA 1QQWA 2R62A 3WHKA 3KOZE 2R18A 4FCTA 1F4IA 1N77A 4IJEA 2XEPA 1JQJC 1Z6TA 2YFQA 5EP3A 4DR5M 1OJLA 4IBEA 1N32M 2ERCA 3KFUG 3GLGA 5BR8M 4JI3M 2JY7A 3Q8GA 4LF9M 5DFLA 2B3TA 1ZMWA 1VQ1A 3UGJA 2VQEM 4IBGA 2FH0A 2D7EA 1G3IA 2X4AA 2JUJA 1T6OA 4I8OA 4NOOB 1I94M 3B7QA 4X62M 2JA2A 4Z8XA 4LFAM 3IG8A 5C18A 5KQ8A 2Y0QA 2DWLA 1XNRM 3HX3A 1MU5A 2J7OA 1L2BA 1IXSA 2JNHA 4KHPM 3HY5A 1IXZA 2R0IA 3SMSA 2F5PA 5IWAM 3HZJA 3FTCA 1ZAEA 2CHGA 2CUZA 3KP1E 4KLNA 4B3RM 1OTRA 2ZTDA 1R6BX 4MM3B 3E4RA 4G4NA 2DAKA 4JI8M 5IT9S 1K3XA 4FWHA 4MB7A 3GRRA 2G5GX 5EQTA 1PM5A 2D7GA 4WP2A 3GLFB 1W5SA 3QAUA 1QDRA 2CRUA 3U61B 4PDGA 2JY8A 3LCVB 4Q7JA 3HGIA 2CV2A 3U6PA 2DWZB 4KT0F 2Z8YM 2WSFF 1HNXM 1EFUB 1DGFA 3TE6A 4X66M 5ITXE 4IBBA 3GPUA 1L2CA 1PJQA 5F3WA 1Z59A 3HKPA 2Z7JA 2LH0A 3A45A 2BNKA 2HCBA 5H37D 1NV9A 2QPAA 4JXJA 4R7GA 4G3OA 2Y0TA 3TWMA 3B7NA 1GLNA 3KSJA 2DKLA 1A5TA 2V1UA 2L4EA 4QNMA 1XHBA 3GPPA 2BWBA 1XXHE 1IY2A 3A42A 4AG6A 1PJTA 4L6V6 3QYBA 4JI6M 2JY6B 3GLHE 4IBIA 4DR2M 2Q2EB 2QP9X 1HT2E 5ITRA 1ZQ9A 2DAGA 4G4RA 5DYGA 1P3QQ 1D0MA 4QNRA 1IXRC 1NY6A 3FRHA 5GKNA 2RGOA 2F5QA 4B08A 1DGBA 1YLAA 4DV7M 3BXWA 2QBYA 1AUAA 3E46A 1HR0M 4LJ8A 1ZMVA 3DFZA 3LW5F 5EXSA 1QUTA 2ZTCA 2MH8A 3HHWA 2UUBM 2F4VM 5KQDA 2R6FA 3HU2A 4I4LA 4KODA 2ZBKB 3U6DA 2UXCM 4QHSA 3GRUA 4LZJA 3L2AA 1G41A 2MR9A 3IG5A 3KW6A 3OTOM 1XWIA 4FCWA 4W5WA 3SAVA 4M9SA 1L2DA 3U61A 2DI0A 3KDSE 3MK6A 2BJWA 4GRIA 1UM8A 2OO9A 4PT5A 3VDPA 1QAQA 2QCUA 4HEOA 4DV0M 4S12A 3SAWA 2UU9M 3KSXA 4RF1A 1VDLA 1QVRA 4DV2M 4B3TM 4G4OA 3K8ZA 4NC6A 3W0LB 5E6JA 2UXDM 4WW0A 3SHFA 5KPTA 4OU7A 1E9SA 3A98B 4JI5M 1R7RA 3HHXA 2FFJA 3HU3A 2M5ZA 2DZNB 1G8PA 3D8BA 1PRBA 3KOXE 2H1RA 4D80A 4DUYM 3AOEA 1XMQM 1TR8A 2JY5A 3AOEC 5EXXA 4LFCM 1UFZA 1KSFX 1H6UA 4MGYE 2X49A 1SXJD 3GLGE 4CGYB 5C1BA 1EE8A 2C9CA 1QDTA 4XK8F 5KPRA 3W0FA 5EP1A 1GABA 2EA0A 3CF6E 3J2PB 1OKSA 2LWXA 2DHYA 1DV0A 3KOYE 4ITQA 3LCUA 1QZEA 2L7IA 1ORYB 2X8AA 2G3QA 2JP7A 1PGYA 2KHHA 4OVZA 4NSRA 2QQ8A 3K9PA 5FSWA 5KO3A 3FUVA 1Q39A 5EXPA 4CIZA 3J7AS 4XBOA 4LRTA 1DGHA 3PFIA 3W68A 1N75A 3AV0A 1IBMM 3U60B 4GHAA 1OQYA 2QHOB 4DV1M 4GITA 3TPZA 3GLIA 1SXJA 4AKGA 2YR0A 1SXJC 3FTDA 4BBAA 3LVWA 4DR7M 1NVMA 4IBCA 4Y28F 1VG5A 1KYIA 2KDLA 3HHZA 3FTEA 4AKIA 3C3DA 1R2ZA 3I01M 4IBDA 4I81A 5FLXS 2Z3XA 3ZC7B 2R45A 3B9PA 1NO1A 2KZSA 3EIHA 4NRVA 3K2LA 4B3MM 1EIJA 4AQYM 1IM2A 2XFSA 5ITQA 3VLFB 4DR4M 1TH2A 4LJ6A 3FUWA 4DV6M 1RU3A 1VEJA 2ZANA 4FD2A 4M0DA 2Z4SA 4AI6A 2FOIC 3FKEA 3UK6A 1XB2B 3U5ZB 4JI7M 2R65A 1R5LA 4LF8M 3QWLA 2VQFM 2DAMA 3I51A 1GL7A 1NJFA 1QZMA 3RE8A 2HWJA 2MROB 3KP0E 2H5XA 2G8LA 4CJ6A 2VDBB 2BWEA 2EKKA 2K9DA 3MHVC 4RKUF 3UZUA 1XXHB 1GVNA 4LGMA 1L8QA 3A46A 5IREB 3ILKA 3GLHB 2C99A 2R4JA 4EIWA 3UMMA 2MGWA 5A2QS 3U6QA 1HQCA 4IBKA 3TWLA 2LVAA 1E9RA 1GKIA 4L4UA 4M9XA 5FTKA 2CFOA 5E26A 1QANA 1OIPA 1N78A 4GMQA 2J5YA 3AJIB 3I4YA 3TQSA 2CP8A 3SC3A 1Z5BA 2CE7A 2RKOA 2XFTA 4LF7M 4NSOB 3M6AA 3HJQA 2M60A 1PJIA 1IBKM 2AHMA 2L09A 4CHTB 2FS1A 3SATA 2APLA 4AZFA 4DBGB 4ZPXA 1G71A 4F1IA 1E32A 4AW4A 3U6OA 4IIWA 1GL6A 3H4MA 1IQPA 4GH9A 3RGSA 1TF0B 3GPYA 2QZ4A 3QYEA 4JI1M 2HKJA 3THGA 5EJCA 1GJTA 4LCBA 1FJGM 2ZM6M 3UJNA 4BB9A 2CWBA 3VFDA 2K6BA
chains in the Genus database with same CATH topology
3HWSA 4AG5A 4BLCA 3GLFA 2C5RA 4B7FA 2P5TA 2XSZD 4NXNM 1IN4A 2QENA 4WURA 3VKGA 1N33M 3NWLA 3SYKA 3Q8XA 4D82A 4MH0E 2LNHC 2XF3A 1Z5CA 2KZUA 1JR3A 4DR3M 5FTMA 1J5EM 4D81A 3FD9A 3LVVA 4JV5M 3T1HM 5DYIA 1T3TA 1NSFA 1DO0A 3KXEC 2FNAA 1HT1E 4HLQA 3GLGB 1G59A 5DNYA 3JR5A 4MGHA 4TUWA 3GRYA 1TH4A 4LRSA 2V1CA 3HJ8A 4RNAA 3KOWE 4II7A 4B7HA 3SHGB 3SASA 4LZZA 2O5RA 3TL4X 2CHQA 2NQ8C 2V6ZM 2E5LM 3EIEA 2XSZA 3VDUA 4QOSA 1QYRA 4B3SM 1YUBA 4G6ZA 1QAOA 3VK7A 1SXJE 2KA6B 7CATA 1K82A 3R9XB 2Y21A 3KVWA 5KPZA 2ZAMA 2KRUA 3PVSA 3FYCA 1IY1A 2CV1A 2I7NA 4XGIA 3GO8A 3GRVA 1MX0A 5LMNM 2HL7A 3HU1A 3SBJA 1Q3BA 3GQ4A 5FTNA 4P16A 4G4QA 3LMMA 2W82A 4JN6A 4GHLA 2F5OA 3U6LA 2C98A 2DHRA 4LJAA 4OW0A 2DWNA 2VIIA 3TWKA 2XGNA 4LG2A 1X37A 4IJFA 2UUCM 4YHHM 1IN5A 4FCVA 4MGIE 3J7BA 5LMUM 2I7PA 4X64M 4JI2M 3R8FA 3FTFA 4JYAM 3LQRA 3K92A 3T1YM 5IZ7D 4B7GA 2UXBM 1IN7A 3AFHA 4PDIA 3KS8A 4L15A 3JR4A 4DR1M 4GIPA 1IN6A 1NJGA 3AKZA 3FYDA 4LFBM 2DWMA 4LJ4A 2F5NA 4GKJM 3SAUA 4MGKE 4QOZC 5FTLA 4YY3M 2QBYB 3M0EA 3HHYA 5BPVA 4MGZE 5ITTA 4JI0M 1VDDA 1R2YA 2J7NA 4M9ZA 3U6SA 1LV7A 4LJ5A 1N34M 2YNMD 3L26A 1TH3A 3AL0C 4GC5A 4NXMM 3DZDA 2XZUA 2CEAA 1J09A 2DVWB 2K47A 4X65M 1IBLM 2XH9A 3M7GA 2R4EA 2DXIA 4REZA 3U60A 1FNNA 4PD2A 2FE8A 1HQYE 3L28A 1NNUC 3GPXA 1JR3D 3DA1A 2F5SA 1QAMA 1N36M 2EUCA 4NL4H 4DV5M 3GQ5A 3JAMS 4LJ7A 2XZFA 4LF4M 2R46A 4LF5M 1HNZM 3J80S 5EXTA 1OFHA 1DO2A 2C9OA 1K3WA 3U6CA 1XMOM 3FUXA 2RGHA 3U6EA 3SARA 4LF6M 1HNWM 4FVMA 2KW0A 4OX9M 3ZH9B 1L1TA 4R3DA 2Z4RA 3NBIA 5ITXA 2CHVA 4HL4A 3RFWA 4RF0A 2L7HA 3U5ZA 4A3VB 2HHHM 5FTJA 3L27A 1IY0A 3CF0A 2EO2A 4K0KM 1C1KA 4Z6YA 3ZCBB 4OVZB 1W5TA 2KRKA 3FUUA 1DGGA 3FUTA 4LGYA 2KEBA 3I4VA 4GC9A 3E9SA 3J27B 3SYLA 1IN8A 1XXHA 4DR6M 1DGHB 1OFIA 3RGPA 4IBFA 4L16A 2CV0A 4AKHA 3GLHA 2UUAM 3K1JA 1S3SA 3CF2A 1TGUA 4FWDA 4DV4M 2KXEA 4NRWA 4DUZM 2Y20A 3LQQA 1I4WA 3PXGA 3VK8A 4I5SA 3GLIB 1SXJB 3MJ5A 5JI2E 2L6OA 1NNJA 4M0WA 1NHGC 2ZAOA 4DV3M 3D8LA 1E94E 3U6MA 3WHLA 1NY5A 1TDZA 3KS4A 3C58A 1XNQM 4KO8A 2YQZA 1TDHA 3DOAA 4GKKM 1IXSB 1XC8A 1NHWC 1Q3CA 1WXQA 3SMPA 1KFVA 3L25A 3T15A 3L29A 1D2NA 1G4AE 3BOSA 4FW9A 3GP1A 8CATA 5EP4A 4PCZA 3AOGA 2XLJA 1YSYA 3VKHA 2LXEA 3PNVA 3J81S 3GQ3A 3HJSA 5JI3E 4QHTA 1PJJA 2DZOB 4JI4M 4L8RC 2A5YB 2C96A 2D7HA 5ITUA 3SFZA 4LJ9A 4CISA 3T38A 1Z5AA 3PNYA 2BJVA 4FWGA 1L1ZA 4L78A 5EP2A 2OQ4A 1J7KA 4LY6A 4IBJA 1YE9A 3CTWB 5ITYA 2OPFA 1QQWA 2R62A 3WHKA 3KOZE 2R18A 4FCTA 1N77A 4IJEA 2XEPA 1JQJC 1Z6TA 2YFQA 5EP3A 4DR5M 1OJLA 4IBEA 1N32M 2ERCA 3KFUG 3GLGA 5BR8M 4JI3M 4LF9M 3UGJA 2VQEM 4IBGA 2D7EA 1G3IA 2X4AA 4I8OA 4NOOB 1I94M 4X62M 2JA2A 4Z8XA 4LFAM 3IG8A 5C18A 5KQ8A 2Y0QA 2DWLA 1XNRM 1MU5A 2J7OA 1L2BA 4KHPM 1IXZA 3SMSA 2F5PA 5IWAM 3KP1E 3FTCA 1ZAEA 2CHGA 2CUZA 4KLNA 4B3RM 1R6BX 4MM3B 3E4RA 4G4NA 5IT9S 4JI8M 1K3XA 4FWHA 4MB7A 3GRRA 2G5GX 5EQTA 1PM5A 2D7GA 3GLFB 1W5SA 3QAUA 3U61B 4PDGA 3HGIA 2CV2A 3U6PA 2DWZB 1HNXM 3TE6A 1DGFA 5ITXE 4X66M 1L2CA 4IBBA 3GPUA 5F3WA 1Z59A 3HKPA 2Z7JA 2LH0A 3A45A 2BNKA 2HCBA 5H37D 4JXJA 2QPAA 4R7GA 2Y0TA 3TWMA 1GLNA 3KSJA 2V1UA 4QNMA 1XHBA 3GPPA 4AG6A 1IY2A 3A42A 4JI6M 4IBIA 4DR2M 2Q2EB 2QP9X 1HT2E 5ITRA 1ZQ9A 4G4RA 5DYGA 4QNRA 1IXRC 1NY6A 5GKNA 2RGOA 2F5QA 4B08A 1DGBA 4DV7M 2QBYA 1HR0M 4LJ8A 3DFZA 5EXSA 2F4VM 3HHWA 2UUBM 5KQDA 3HU2A 4I4LA 4KODA 2ZBKB 3U6DA 2UXCM 4QHSA 3GRUA 4LZJA 3L2AA 1G41A 3IG5A 3OTOM 3KW6A 1XWIA 4FCWA 4W5WA 3SAVA 4M9SA 1L2DA 3U61A 3MK6A 3KDSE 2BJWA 4GRIA 1UM8A 4PT5A 3VDPA 1QAQA 2QCUA 4DV0M 4S12A 3SAWA 2UU9M 3KSXA 4RF1A 1QVRA 4DV2M 4B3TM 4G4OA 3K8ZA 3W0LB 5E6JA 2UXDM 4WW0A 3SHFA 5KPTA 4OU7A 1E9SA 3A98B 4JI5M 1R7RA 3HHXA 2FFJA 3HU3A 2M5ZA 2DZNB 1G8PA 3D8BA 3KOXE 2H1RA 4D80A 4DUYM 3AOEA 1XMQM 3AOEC 5EXXA 4LFCM 1KSFX 1H6UA 4MGYE 2X49A 1SXJD 4CGYB 5C1BA 1EE8A 2C9CA 5KPRA 3W0FA 5EP1A 2EA0A 3CF6E 3J2PB 2LWXA 3KOYE 4ITQA 2L7IA 1ORYB 2X8AA 4OVZA 4NSRA 5FSWA 5KO3A 3FUVA 1Q39A 5EXPA 3J7AS 4XBOA 4LRTA 1DGHA 3PFIA 1N75A 3AV0A 1IBMM 3U60B 4GHAA 4DV1M 4GITA 3TPZA 3GLIA 1SXJA 4AKGA 2YR0A 1SXJC 3FTDA 4BBAA 3LVWA 4DR7M 1NVMA 4IBCA 1KYIA 3HHZA 3FTEA 4AKIA 1R2ZA 4IBDA 4I81A 5FLXS 2Z3XA 3ZC7B 2R45A 3B9PA 2KZSA 3EIHA 4NRVA 4B3MM 3K2LA 4AQYM 1IM2A 2XFSA 5ITQA 3VLFB 4DR4M 1TH2A 4LJ6A 3FUWA 4DV6M 4FD2A 2ZANA 4M0DA 2Z4SA 4AI6A 2FOIC 3FKEA 3UK6A 3U5ZB 4JI7M 2R65A 4LF8M 3QWLA 2VQFM 3I51A 1GL7A 1NJFA 1QZMA 3RE8A 3KP0E 2G8LA 3MHVC 3UZUA 1XXHB 1GVNA 4LGMA 1L8QA 3A46A 5IREB 3ILKA 3GLHB 2C99A 2R4JA 4EIWA 3UMMA 5A2QS 3U6QA 1HQCA 4IBKA 3TWLA 1E9RA 1GKIA 4L4UA 4M9XA 5FTKA 2CFOA 5E26A 1QANA 1N78A 4GMQA 3AJIB 3TQSA 3I4YA 4LF7M 3SC3A 1Z5BA 2CE7A 2RKOA 2XFTA 4NSOB 3M6AA 3HJQA 2M60A 1PJIA 1IBKM 2AHMA 2L09A 4CHTB 3SATA 4AZFA 4ZPXA 1E32A 4AW4A 3U6OA 4IIWA 1GL6A 3H4MA 1IQPA 4GH9A 3RGSA 3GPYA 2QZ4A 4JI1M 2HKJA 3THGA 5EJCA 1FJGM 4LCBA 3UJNA 4BB9A 3VFDA 2ZM6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP0 E;  3KOX E;  3KOZ E;  3KP1 E;  3KOY E;  3KOW E; 
#chains in the Genus database with same CATH topology
 3HWS A;  1D0K A;  2LHC A;  2LVP C;  4AG5 A;  4BLC A;  3GLF A;  2C5R A;  4B7F A;  2P5T A;  2XSZ D;  2KNZ A;  4NXN M;  1IN4 A;  2QEN A;  1Q02 A;  4WUR A;  1N33 M;  1WIV A;  3VKG A;  2N35 A;  3NWL A;  3SYK A;  3Q8X A;  3E21 A;  4MH0 E;  2LNH C;  2XF3 A;  4D82 A;  1Z5C A;  2KZU A;  1JR3 A;  1PJS A;  4DR3 M;  5FTM A;  1J5E M;  4D81 A;  1T43 A;  3FD9 A;  3LVV A;  4JV5 M;  3T1H M;  5DYI A;  1T3T A;  1GJS A;  1NSF A;  1DO0 A;  3KXE C;  2GQF A;  2FNA A;  3FRI A;  1HT1 E;  4HLQ A;  3GLG B;  1G59 A;  5DNY A;  3JR5 A;  4MGH A;  4TUW A;  3GRY A;  1TH4 A;  2O25 A;  4LRS A;  2V1C A;  3HJ8 A;  4RNA A;  3GP1 A;  2EJS A;  3KOW E;  4II7 A;  4B7H A;  3SHG B;  3SAS A;  4LZZ A;  2O5R A;  3TL4 X;  2CHQ A;  2NQ8 C;  4F2L A;  2DNA A;  2V6Z M;  2E5L M;  3EIE A;  2XSZ A;  3VDU A;  4QOS A;  1QYR A;  1NV8 A;  1YUB A;  4G6Z A;  1QAO A;  3VK7 A;  4B3S M;  2LHG A;  3GLI E;  1SXJ E;  2KA6 B;  7CAT A;  1K82 A;  3R9X B;  2Y21 A;  3KVW A;  1WHC A;  5KPZ A;  2DAE A;  2L2D A;  2ZAM A;  1OIZ A;  2KRU A;  3PVS A;  1ZV1 A;  3FYC A;  1IY1 A;  2CV1 A;  3B74 A;  2I7N A;  3IHP A;  4XGI A;  3GO8 A;  3GRV A;  1MX0 A;  2LVO C;  5LMN M;  2HL7 A;  2RRU A;  3HU1 A;  3SBJ A;  2L4F A;  1Q3B A;  3GQ4 A;  5FTN A;  3T6P A;  4P16 A;  4G4Q A;  3LMM A;  2W82 A;  4JN6 A;  4GHL A;  2F5O A;  3U6L A;  2KNA A;  2C98 A;  2DHR A;  2HAK A;  4LJA A;  4OW0 A;  2DWN A;  2VII A;  3TWK A;  2XGN A;  1OAO C;  2WSC F;  4LG2 A;  1X37 A;  4IJF A;  2UUC M;  1Y8G A;  3B89 A;  1IN5 A;  4YHH M;  4FCV A;  4MGI E;  3J7B A;  2WZJ A;  5LMU M;  2I7P A;  2LTU A;  4X64 M;  4JI2 M;  3C3E A;  3R8F A;  3B7Z A;  3FTF A;  1WGN A;  4JYA M;  3LQR A;  3K92 A;  1WGL A;  3T1Y M;  5IZ7 D;  4B7G A;  2UXB M;  1IN7 A;  1WJ7 A;  3AFH A;  4PDI A;  3KS8 A;  4L15 A;  3JR4 A;  1MJG M;  4DR1 M;  1GO5 A;  4GIP A;  1IN6 A;  1NJG A;  3AKZ A;  3FYD A;  1BVS A;  2R44 A;  2DWM A;  1SG9 A;  4LJ4 A;  4LFB M;  4R71 A;  2F5N A;  4GKJ M;  3SAU A;  4MGK E;  4QOZ C;  5FTL A;  4YY3 M;  2QBY B;  3M0E A;  1MN3 A;  3HHY A;  2DAI A;  5BPV A;  1IFY A;  4MGZ E;  3BBZ A;  5ITT A;  4JI0 M;  1VDD A;  1R2Y A;  2J7N A;  2KNV A;  4M9Z A;  3U6S A;  1LV7 A;  1V92 A;  4LJ5 A;  1N34 M;  2YNM D;  3L26 A;  1TH3 A;  4UN2 B;  3AL0 C;  4GC5 A;  4NXM M;  3DZD A;  1TTE A;  2XZU A;  2CEA A;  1J09 A;  2VF7 A;  2DVW B;  2DZL A;  2K47 A;  4X65 M;  1IBL M;  1R4G A;  2MJ5 B;  2XH9 A;  3M7G A;  1VEG A;  2R4E A;  2DXI A;  4REZ A;  3U60 A;  1FNN A;  2O01 F;  2FE8 A;  4PD2 A;  1HQY E;  3L28 A;  1NNU C;  3GPX A;  1JB0 F;  1JR3 D;  3DA1 A;  3GLF E;  2F5S A;  1QAM A;  1N36 M;  2EUC A;  4NL4 H;  1V33 A;  2K0B X;  2EKF A;  2LVQ D;  4DV5 M;  3GQ5 A;  3MMP A;  3JAM S;  3H4J A;  1QUS A;  4LJ7 A;  2XZF A;  4LF4 M;  2R46 A;  4LF5 M;  1HNZ M;  3W67 A;  1JR3 E;  3J80 S;  1VEK A;  5EXT A;  1OFH A;  1DO2 A;  3ZQJ A;  2C9O A;  1K3W A;  3U6C A;  1XMO M;  3FUX A;  2RGH A;  3U6E A;  3SAR A;  1LTM A;  4LF6 M;  1HNW M;  4FVM A;  2KW0 A;  2LVN C;  3V76 A;  3IEC A;  3ZH9 B;  4OX9 M;  1L1T A;  4R3D A;  3I04 M;  2Z4R A;  3NBI A;  5ITX A;  2CHV A;  4HL4 A;  3RFW A;  4RF0 A;  1HJP A;  3C9P A;  2L7H A;  2JXN A;  3U5Z A;  1D0L A;  4A3V B;  2JZ0 A;  2HHH M;  5FTJ A;  3L27 A;  1IY0 A;  3CF0 A;  2EO2 A;  4K0K M;  1C1K A;  4Z6Y A;  3ZCB B;  1V34 A;  4OVZ B;  2LBC A;  1W5T A;  2KRK A;  3FUU A;  1DGG A;  3FUT A;  4LGY A;  2KEB A;  3I4V A;  4GC9 A;  2DEN A;  3E9S A;  3J27 B;  3SYL A;  1IN8 A;  1XXH A;  4DR6 M;  1DGH B;  1OFI A;  3RGP A;  4IBF A;  4L16 A;  2CV0 A;  4AKH A;  3GLH A;  2UUA M;  1S3S A;  3CF2 A;  3K1J A;  1TGU A;  4FWD A;  4DV4 M;  1AIP C;  2KXE A;  4NRW A;  3FE3 A;  3NBX X;  2Y20 A;  3LQQ A;  1I4W A;  3PXG A;  4DUZ M;  3VK8 A;  4I5S A;  3GLI B;  2VF8 A;  1SXJ B;  1C7Y A;  3MJ5 A;  5JI2 E;  2L6O A;  1NNJ A;  4M0W A;  1NHG C;  2ZAO A;  3CGW A;  4DV3 M;  3D8L A;  1E94 E;  3U6M A;  3WHL A;  1OAI A;  1WR1 B;  2OOB A;  1NY5 A;  1TDZ A;  3KS4 A;  3C58 A;  1XNQ M;  4KO8 A;  2YQZ A;  1TDH A;  3DOA A;  4GKK M;  1IXS B;  1XC8 A;  1NHW C;  1Q3C A;  4GEW A;  1WXQ A;  3SMP A;  1KFV A;  3L25 A;  3T15 A;  3L29 A;  1D2N A;  1G4A E;  3BOS A;  2WSE F;  4FW9 A;  8CAT A;  5EP4 A;  2JWS A;  2GNO A;  2JZ1 A;  3AOG A;  3F92 A;  4PCZ A;  2XLJ A;  1YSY A;  3VKH A;  2LXE A;  3PNV A;  3J81 S;  3GQ3 A;  3HJS A;  5JI3 E;  4QHT A;  1PJJ A;  2DZO B;  4JI4 M;  4L8R C;  2A5Y B;  4ANR A;  2C96 A;  2D7H A;  5ITU A;  3SFZ A;  4LJ9 A;  4CIS A;  3T38 A;  1Z5A A;  3PNY A;  2BJV A;  4FWG A;  1L1Z A;  2OOA A;  1ZMU A;  4L78 A;  1CUK A;  5EP2 A;  3K9O A;  2OQ4 A;  1J7K A;  4LY6 A;  4IBJ A;  4P17 A;  1YE9 A;  2QSF X;  3CTW B;  5ITY A;  2OPF A;  5L8R F;  2QNJ A;  1QQW A;  2R62 A;  3WHK A;  3KOZ E;  2R18 A;  4FCT A;  1F4I A;  1N77 A;  4IJE A;  2XEP A;  1JQJ C;  1Z6T A;  2YFQ A;  5EP3 A;  4DR5 M;  1OJL A;  4IBE A;  1N32 M;  2ERC A;  3KFU G;  3GLG A;  5BR8 M;  4JI3 M;  2JY7 A;  3Q8G A;  4LF9 M;  5DFL A;  2B3T A;  1ZMW A;  1VQ1 A;  3UGJ A;  2VQE M;  4IBG A;  2FH0 A;  2D7E A;  1G3I A;  2X4A A;  2JUJ A;  1T6O A;  4I8O A;  4NOO B;  1I94 M;  3B7Q A;  4X62 M;  2JA2 A;  4Z8X A;  4LFA M;  3IG8 A;  5C18 A;  5KQ8 A;  2Y0Q A;  2DWL A;  1XNR M;  3HX3 A;  1MU5 A;  2J7O A;  1L2B A;  1IXS A;  2JNH A;  4KHP M;  3HY5 A;  1IXZ A;  2R0I A;  3SMS A;  2F5P A;  5IWA M;  3HZJ A;  3FTC A;  1ZAE A;  2CHG A;  2CUZ A;  3KP1 E;  4KLN A;  4B3R M;  1OTR A;  2ZTD A;  1R6B X;  4MM3 B;  3E4R A;  4G4N A;  2DAK A;  4JI8 M;  5IT9 S;  1K3X A;  4FWH A;  4MB7 A;  3GRR A;  2G5G X;  5EQT A;  1PM5 A;  2D7G A;  4WP2 A;  3GLF B;  1W5S A;  3QAU A;  1QDR A;  2CRU A;  3U61 B;  4PDG A;  2JY8 A;  3LCV B;  4Q7J A;  3HGI A;  2CV2 A;  3U6P A;  2DWZ B;  4KT0 F;  2Z8Y M;  2WSF F;  1HNX M;  1EFU B;  1DGF A;  3TE6 A;  4X66 M;  5ITX E;  4IBB A;  3GPU A;  1L2C A;  1PJQ A;  5F3W A;  1Z59 A;  3HKP A;  2Z7J A;  2LH0 A;  3A45 A;  2BNK A;  2HCB A;  5H37 D;  1NV9 A;  2QPA A;  4JXJ A;  4R7G A;  4G3O A;  2Y0T A;  3TWM A;  3B7N A;  1GLN A;  3KSJ A;  2DKL A;  1A5T A;  2V1U A;  2L4E A;  4QNM A;  1XHB A;  3GPP A;  2BWB A;  1XXH E;  1IY2 A;  3A42 A;  4AG6 A;  1PJT A;  4L6V 6;  3QYB A;  4JI6 M;  2JY6 B;  3GLH E;  4IBI A;  4DR2 M;  2Q2E B;  2QP9 X;  1HT2 E;  5ITR A;  1ZQ9 A;  2DAG A;  4G4R A;  5DYG A;  1P3Q Q;  1D0M A;  4QNR A;  1IXR C;  1NY6 A;  3FRH A;  5GKN A;  2RGO A;  2F5Q A;  4B08 A;  1DGB A;  1YLA A;  4DV7 M;  3BXW A;  2QBY A;  1AUA A;  3E46 A;  1HR0 M;  4LJ8 A;  1ZMV A;  3DFZ A;  3LW5 F;  5EXS A;  1QUT A;  2ZTC A;  2MH8 A;  3HHW A;  2UUB M;  2F4V M;  5KQD A;  2R6F A;  3HU2 A;  4I4L A;  4KOD A;  2ZBK B;  3U6D A;  2UXC M;  4QHS A;  3GRU A;  4LZJ A;  3L2A A;  1G41 A;  2MR9 A;  3IG5 A;  3KW6 A;  3OTO M;  1XWI A;  4FCW A;  4W5W A;  3SAV A;  4M9S A;  1L2D A;  3U61 A;  2DI0 A;  3KDS E;  3MK6 A;  2BJW A;  4GRI A;  1UM8 A;  2OO9 A;  4PT5 A;  3VDP A;  1QAQ A;  2QCU A;  4HEO A;  4DV0 M;  4S12 A;  3SAW A;  2UU9 M;  3KSX A;  4RF1 A;  1VDL A;  1QVR A;  4DV2 M;  4B3T M;  4G4O A;  3K8Z A;  4NC6 A;  3W0L B;  5E6J A;  2UXD M;  4WW0 A;  3SHF A;  5KPT A;  4OU7 A;  1E9S A;  3A98 B;  4JI5 M;  1R7R A;  3HHX A;  2FFJ A;  3HU3 A;  2M5Z A;  2DZN B;  1G8P A;  3D8B A;  1PRB A;  3KOX E;  2H1R A;  4D80 A;  4DUY M;  3AOE A;  1XMQ M;  1TR8 A;  2JY5 A;  3AOE C;  5EXX A;  4LFC M;  1UFZ A;  1KSF X;  1H6U A;  4MGY E;  2X49 A;  1SXJ D;  3GLG E;  4CGY B;  5C1B A;  1EE8 A;  2C9C A;  1QDT A;  4XK8 F;  5KPR A;  3W0F A;  5EP1 A;  1GAB A;  2EA0 A;  3CF6 E;  3J2P B;  1OKS A;  2LWX A;  2DHY A;  1DV0 A;  3KOY E;  4ITQ A;  3LCU A;  1QZE A;  2L7I A;  1ORY B;  2X8A A;  2G3Q A;  2JP7 A;  1PGY A;  2KHH A;  4OVZ A;  4NSR A;  2QQ8 A;  3K9P A;  5FSW A;  5KO3 A;  3FUV A;  1Q39 A;  5EXP A;  4CIZ A;  3J7A S;  4XBO A;  4LRT A;  1DGH A;  3PFI A;  3W68 A;  1N75 A;  3AV0 A;  1IBM M;  3U60 B;  4GHA A;  1OQY A;  2QHO B;  4DV1 M;  4GIT A;  3TPZ A;  3GLI A;  1SXJ A;  4AKG A;  2YR0 A;  1SXJ C;  3FTD A;  4BBA A;  3LVW A;  4DR7 M;  1NVM A;  4IBC A;  4Y28 F;  1VG5 A;  1KYI A;  2KDL A;  3HHZ A;  3FTE A;  4AKI A;  3C3D A;  1R2Z A;  3I01 M;  4IBD A;  4I81 A;  5FLX S;  2Z3X A;  3ZC7 B;  2R45 A;  3B9P A;  1NO1 A;  2KZS A;  3EIH A;  4NRV A;  3K2L A;  4B3M M;  1EIJ A;  4AQY M;  1IM2 A;  2XFS A;  5ITQ A;  3VLF B;  4DR4 M;  1TH2 A;  4LJ6 A;  3FUW A;  4DV6 M;  1RU3 A;  1VEJ A;  2ZAN A;  4FD2 A;  4M0D A;  2Z4S A;  4AI6 A;  2FOI C;  3FKE A;  3UK6 A;  1XB2 B;  3U5Z B;  4JI7 M;  2R65 A;  1R5L A;  4LF8 M;  3QWL A;  2VQF M;  2DAM A;  3I51 A;  1GL7 A;  1NJF A;  1QZM A;  3RE8 A;  2HWJ A;  2MRO B;  3KP0 E;  2H5X A;  2G8L A;  4CJ6 A;  2VDB B;  2BWE A;  2EKK A;  2K9D A;  3MHV C;  4RKU F;  3UZU A;  1XXH B;  1GVN A;  4LGM A;  1L8Q A;  3A46 A;  5IRE B;  3ILK A;  3GLH B;  2C99 A;  2R4J A;  4EIW A;  3UMM A;  2MGW A;  5A2Q S;  3U6Q A;  1HQC A;  4IBK A;  3TWL A;  2LVA A;  1E9R A;  1GKI A;  4L4U A;  4M9X A;  5FTK A;  2CFO A;  5E26 A;  1QAN A;  1OIP A;  1N78 A;  4GMQ A;  2J5Y A;  3AJI B;  3I4Y A;  3TQS A;  2CP8 A;  3SC3 A;  1Z5B A;  2CE7 A;  2RKO A;  2XFT A;  4LF7 M;  4NSO B;  3M6A A;  3HJQ A;  2M60 A;  1PJI A;  1IBK M;  2AHM A;  2L09 A;  4CHT B;  2FS1 A;  3SAT A;  2APL A;  4AZF A;  4DBG B;  4ZPX A;  1G71 A;  4F1I A;  1E32 A;  4AW4 A;  3U6O A;  4IIW A;  1GL6 A;  3H4M A;  1IQP A;  4GH9 A;  3RGS A;  1TF0 B;  3GPY A;  2QZ4 A;  3QYE A;  4JI1 M;  2HKJ A;  3THG A;  5EJC A;  1GJT A;  4LCB A;  1FJG M;  2ZM6 M;  3UJN A;  4BB9 A;  2CWB A;  3VFD A;  2K6B A; 
#chains in the Genus database with same CATH homology
 3HWS A;  4AG5 A;  4BLC A;  3GLF A;  2C5R A;  4B7F A;  2P5T A;  2XSZ D;  4NXN M;  1IN4 A;  2QEN A;  4WUR A;  3VKG A;  1N33 M;  3NWL A;  3SYK A;  3Q8X A;  4D82 A;  4MH0 E;  2LNH C;  2XF3 A;  1Z5C A;  2KZU A;  1JR3 A;  4DR3 M;  5FTM A;  1J5E M;  4D81 A;  3FD9 A;  3LVV A;  4JV5 M;  3T1H M;  5DYI A;  1T3T A;  1NSF A;  1DO0 A;  3KXE C;  2FNA A;  1HT1 E;  4HLQ A;  3GLG B;  1G59 A;  5DNY A;  3JR5 A;  4MGH A;  4TUW A;  3GRY A;  1TH4 A;  4LRS A;  2V1C A;  3HJ8 A;  4RNA A;  3KOW E;  4II7 A;  4B7H A;  3SHG B;  3SAS A;  4LZZ A;  2O5R A;  3TL4 X;  2CHQ A;  2NQ8 C;  2V6Z M;  2E5L M;  3EIE A;  2XSZ A;  3VDU A;  4QOS A;  1QYR A;  4B3S M;  1YUB A;  4G6Z A;  1QAO A;  3VK7 A;  1SXJ E;  2KA6 B;  7CAT A;  1K82 A;  3R9X B;  2Y21 A;  3KVW A;  5KPZ A;  2ZAM A;  2KRU A;  3PVS A;  3FYC A;  1IY1 A;  2CV1 A;  2I7N A;  4XGI A;  3GO8 A;  3GRV A;  1MX0 A;  5LMN M;  2HL7 A;  3HU1 A;  3SBJ A;  1Q3B A;  3GQ4 A;  5FTN A;  4P16 A;  4G4Q A;  3LMM A;  2W82 A;  4JN6 A;  4GHL A;  2F5O A;  3U6L A;  2C98 A;  2DHR A;  4LJA A;  4OW0 A;  2DWN A;  2VII A;  3TWK A;  2XGN A;  4LG2 A;  1X37 A;  4IJF A;  2UUC M;  4YHH M;  1IN5 A;  4FCV A;  4MGI E;  3J7B A;  5LMU M;  2I7P A;  4X64 M;  4JI2 M;  3R8F A;  3FTF A;  4JYA M;  3LQR A;  3K92 A;  3T1Y M;  5IZ7 D;  4B7G A;  2UXB M;  1IN7 A;  3AFH A;  4PDI A;  3KS8 A;  4L15 A;  3JR4 A;  4DR1 M;  4GIP A;  1IN6 A;  1NJG A;  3AKZ A;  3FYD A;  4LFB M;  2DWM A;  4LJ4 A;  2F5N A;  4GKJ M;  3SAU A;  4MGK E;  4QOZ C;  5FTL A;  4YY3 M;  2QBY B;  3M0E A;  3HHY A;  5BPV A;  4MGZ E;  5ITT A;  4JI0 M;  1VDD A;  1R2Y A;  2J7N A;  4M9Z A;  3U6S A;  1LV7 A;  4LJ5 A;  1N34 M;  2YNM D;  3L26 A;  1TH3 A;  3AL0 C;  4GC5 A;  4NXM M;  3DZD A;  2XZU A;  2CEA A;  1J09 A;  2DVW B;  2K47 A;  4X65 M;  1IBL M;  2XH9 A;  3M7G A;  2R4E A;  2DXI A;  4REZ A;  3U60 A;  1FNN A;  4PD2 A;  2FE8 A;  1HQY E;  3L28 A;  1NNU C;  3GPX A;  1JR3 D;  3DA1 A;  2F5S A;  1QAM A;  1N36 M;  2EUC A;  4NL4 H;  4DV5 M;  3GQ5 A;  3JAM S;  4LJ7 A;  2XZF A;  4LF4 M;  2R46 A;  4LF5 M;  1HNZ M;  3J80 S;  5EXT A;  1OFH A;  1DO2 A;  2C9O A;  1K3W A;  3U6C A;  1XMO M;  3FUX A;  2RGH A;  3U6E A;  3SAR A;  4LF6 M;  1HNW M;  4FVM A;  2KW0 A;  4OX9 M;  3ZH9 B;  1L1T A;  4R3D A;  2Z4R A;  3NBI A;  5ITX A;  2CHV A;  4HL4 A;  3RFW A;  4RF0 A;  2L7H A;  3U5Z A;  4A3V B;  2HHH M;  5FTJ A;  3L27 A;  1IY0 A;  3CF0 A;  2EO2 A;  4K0K M;  1C1K A;  4Z6Y A;  3ZCB B;  4OVZ B;  1W5T A;  2KRK A;  3FUU A;  1DGG A;  3FUT A;  4LGY A;  2KEB A;  3I4V A;  4GC9 A;  3E9S A;  3J27 B;  3SYL A;  1IN8 A;  1XXH A;  4DR6 M;  1DGH B;  1OFI A;  3RGP A;  4IBF A;  4L16 A;  2CV0 A;  4AKH A;  3GLH A;  2UUA M;  3K1J A;  1S3S A;  3CF2 A;  1TGU A;  4FWD A;  4DV4 M;  2KXE A;  4NRW A;  4DUZ M;  2Y20 A;  3LQQ A;  1I4W A;  3PXG A;  3VK8 A;  4I5S A;  3GLI B;  1SXJ B;  3MJ5 A;  5JI2 E;  2L6O A;  1NNJ A;  4M0W A;  1NHG C;  2ZAO A;  4DV3 M;  3D8L A;  1E94 E;  3U6M A;  3WHL A;  1NY5 A;  1TDZ A;  3KS4 A;  3C58 A;  1XNQ M;  4KO8 A;  2YQZ A;  1TDH A;  3DOA A;  4GKK M;  1IXS B;  1XC8 A;  1NHW C;  1Q3C A;  1WXQ A;  3SMP A;  1KFV A;  3L25 A;  3T15 A;  3L29 A;  1D2N A;  1G4A E;  3BOS A;  4FW9 A;  3GP1 A;  8CAT A;  5EP4 A;  4PCZ A;  3AOG A;  2XLJ A;  1YSY A;  3VKH A;  2LXE A;  3PNV A;  3J81 S;  3GQ3 A;  3HJS A;  5JI3 E;  4QHT A;  1PJJ A;  2DZO B;  4JI4 M;  4L8R C;  2A5Y B;  2C96 A;  2D7H A;  5ITU A;  3SFZ A;  4LJ9 A;  4CIS A;  3T38 A;  1Z5A A;  3PNY A;  2BJV A;  4FWG A;  1L1Z A;  4L78 A;  5EP2 A;  2OQ4 A;  1J7K A;  4LY6 A;  4IBJ A;  1YE9 A;  3CTW B;  5ITY A;  2OPF A;  1QQW A;  2R62 A;  3WHK A;  3KOZ E;  2R18 A;  4FCT A;  1N77 A;  4IJE A;  2XEP A;  1JQJ C;  1Z6T A;  2YFQ A;  5EP3 A;  4DR5 M;  1OJL A;  4IBE A;  1N32 M;  2ERC A;  3KFU G;  3GLG A;  5BR8 M;  4JI3 M;  4LF9 M;  3UGJ A;  2VQE M;  4IBG A;  2D7E A;  1G3I A;  2X4A A;  4I8O A;  4NOO B;  1I94 M;  4X62 M;  2JA2 A;  4Z8X A;  4LFA M;  3IG8 A;  5C18 A;  5KQ8 A;  2Y0Q A;  2DWL A;  1XNR M;  1MU5 A;  2J7O A;  1L2B A;  4KHP M;  1IXZ A;  3SMS A;  2F5P A;  5IWA M;  3KP1 E;  3FTC A;  1ZAE A;  2CHG A;  2CUZ A;  4KLN A;  4B3R M;  1R6B X;  4MM3 B;  3E4R A;  4G4N A;  5IT9 S;  4JI8 M;  1K3X A;  4FWH A;  4MB7 A;  3GRR A;  2G5G X;  5EQT A;  1PM5 A;  2D7G A;  3GLF B;  1W5S A;  3QAU A;  3U61 B;  4PDG A;  3HGI A;  2CV2 A;  3U6P A;  2DWZ B;  1HNX M;  3TE6 A;  1DGF A;  5ITX E;  4X66 M;  1L2C A;  4IBB A;  3GPU A;  5F3W A;  1Z59 A;  3HKP A;  2Z7J A;  2LH0 A;  3A45 A;  2BNK A;  2HCB A;  5H37 D;  4JXJ A;  2QPA A;  4R7G A;  2Y0T A;  3TWM A;  1GLN A;  3KSJ A;  2V1U A;  4QNM A;  1XHB A;  3GPP A;  4AG6 A;  1IY2 A;  3A42 A;  4JI6 M;  4IBI A;  4DR2 M;  2Q2E B;  2QP9 X;  1HT2 E;  5ITR A;  1ZQ9 A;  4G4R A;  5DYG A;  4QNR A;  1IXR C;  1NY6 A;  5GKN A;  2RGO A;  2F5Q A;  4B08 A;  1DGB A;  4DV7 M;  2QBY A;  1HR0 M;  4LJ8 A;  3DFZ A;  5EXS A;  2F4V M;  3HHW A;  2UUB M;  5KQD A;  3HU2 A;  4I4L A;  4KOD A;  2ZBK B;  3U6D A;  2UXC M;  4QHS A;  3GRU A;  4LZJ A;  3L2A A;  1G41 A;  3IG5 A;  3OTO M;  3KW6 A;  1XWI A;  4FCW A;  4W5W A;  3SAV A;  4M9S A;  1L2D A;  3U61 A;  3MK6 A;  3KDS E;  2BJW A;  4GRI A;  1UM8 A;  4PT5 A;  3VDP A;  1QAQ A;  2QCU A;  4DV0 M;  4S12 A;  3SAW A;  2UU9 M;  3KSX A;  4RF1 A;  1QVR A;  4DV2 M;  4B3T M;  4G4O A;  3K8Z A;  3W0L B;  5E6J A;  2UXD M;  4WW0 A;  3SHF A;  5KPT A;  4OU7 A;  1E9S A;  3A98 B;  4JI5 M;  1R7R A;  3HHX A;  2FFJ A;  3HU3 A;  2M5Z A;  2DZN B;  1G8P A;  3D8B A;  3KOX E;  2H1R A;  4D80 A;  4DUY M;  3AOE A;  1XMQ M;  3AOE C;  5EXX A;  4LFC M;  1KSF X;  1H6U A;  4MGY E;  2X49 A;  1SXJ D;  4CGY B;  5C1B A;  1EE8 A;  2C9C A;  5KPR A;  3W0F A;  5EP1 A;  2EA0 A;  3CF6 E;  3J2P B;  2LWX A;  3KOY E;  4ITQ A;  2L7I A;  1ORY B;  2X8A A;  4OVZ A;  4NSR A;  5FSW A;  5KO3 A;  3FUV A;  1Q39 A;  5EXP A;  3J7A S;  4XBO A;  4LRT A;  1DGH A;  3PFI A;  1N75 A;  3AV0 A;  1IBM M;  3U60 B;  4GHA A;  4DV1 M;  4GIT A;  3TPZ A;  3GLI A;  1SXJ A;  4AKG A;  2YR0 A;  1SXJ C;  3FTD A;  4BBA A;  3LVW A;  4DR7 M;  1NVM A;  4IBC A;  1KYI A;  3HHZ A;  3FTE A;  4AKI A;  1R2Z A;  4IBD A;  4I81 A;  5FLX S;  2Z3X A;  3ZC7 B;  2R45 A;  3B9P A;  2KZS A;  3EIH A;  4NRV A;  4B3M M;  3K2L A;  4AQY M;  1IM2 A;  2XFS A;  5ITQ A;  3VLF B;  4DR4 M;  1TH2 A;  4LJ6 A;  3FUW A;  4DV6 M;  4FD2 A;  2ZAN A;  4M0D A;  2Z4S A;  4AI6 A;  2FOI C;  3FKE A;  3UK6 A;  3U5Z B;  4JI7 M;  2R65 A;  4LF8 M;  3QWL A;  2VQF M;  3I51 A;  1GL7 A;  1NJF A;  1QZM A;  3RE8 A;  3KP0 E;  2G8L A;  3MHV C;  3UZU A;  1XXH B;  1GVN A;  4LGM A;  1L8Q A;  3A46 A;  5IRE B;  3ILK A;  3GLH B;  2C99 A;  2R4J A;  4EIW A;  3UMM A;  5A2Q S;  3U6Q A;  1HQC A;  4IBK A;  3TWL A;  1E9R A;  1GKI A;  4L4U A;  4M9X A;  5FTK A;  2CFO A;  5E26 A;  1QAN A;  1N78 A;  4GMQ A;  3AJI B;  3TQS A;  3I4Y A;  4LF7 M;  3SC3 A;  1Z5B A;  2CE7 A;  2RKO A;  2XFT A;  4NSO B;  3M6A A;  3HJQ A;  2M60 A;  1PJI A;  1IBK M;  2AHM A;  2L09 A;  4CHT B;  3SAT A;  4AZF A;  4ZPX A;  1E32 A;  4AW4 A;  3U6O A;  4IIW A;  1GL6 A;  3H4M A;  1IQP A;  4GH9 A;  3RGS A;  3GPY A;  2QZ4 A;  4JI1 M;  2HKJ A;  3THG A;  5EJC A;  1FJG M;  4LCB A;  3UJN A;  4BB9 A;  3VFD A;  2ZM6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...