2H1RA

Crystal structure of a dimethyladenosine transferase from plasmodium falciparum
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
271
Chain Sequence
HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWCTLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 94
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.480 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2h1rA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h1rA01
1KHHA 3OU7A 2FPOA 4FP9A 1INLA 2YX1A 4X41A 5DTQA 3UZUA 3X0DA 4POOA 3LCCA 1ZGAA 5EKUA 1AV6A 1F3LA 3NJRA 5GINE 5CM2Z 3HP7A 2R3SA 5EMMA 7MHTA 2OZVA 2YUIA 3GIWA 5LQJA 3AWIA 3LBYA 3L8DA 2PX4A 2UYCA 3E8SA 2ZFUA 3FPEA 2ZLBA 3FPGA 2H1RA 4PYLA 5FTWA 4PCLA 1EJ6A 4M7RA 5EIFA 3G7UA 3EMBA 2EX4A 3P9NA 2C7OA 3BKWA 2IDJA 3MERA 3THRA 1JTEA 5E9QA 1QAOA 4FGZA 3O4FA 3ELWA 2V7EA 4HH4A 2P3QA 3KQSA 3G2QA 3KPUA 4PCAA 4MTLA 2P8JA 2YXEA 1QZZA 3ME5A 3KPWA 1UIRA 4ER6A 1SQFA 5HFJA 2OPBA 4P7JA 3FRHA 5E1BA 3SR4A 1VP3A 4BLVA 3JWJA 2AOTB 4KRGA 5E1DA 5E9JA 3TKAA 5BXYA 5K0FA 2B25A 5D1HA 5P8WA 5E2AA 1R6AA 3R0QA 5FHRA 5K0JA 3TR6A 4RSRA 2NYUA 2ZZNA 5HIMA 1KYWA 5DWQA 3T7SA 2GH1A 3I64A 1R8YA 3OPNA 4QTUB 3AY0A 5EMJA 4BLWA 2HV9A 3P8ZA 4HGZA 4EKGA 5K0GA 4DKJA 1M0EA 3M33A 3C3PA 3HEMA 2BR5A 2ZBQA 2B78A 3C0KA 4K6MA 4BP3A 4YUZA 3ER9A 3FYCA 1XJ5A 2P7IA 4ER7A 3QV2A 3QOXA 3MQ2A 5DT2A 4RTSA 2UZ4A 4YUYA 1SUSA 1YFLA 1NW7A 3TFWA 1I1NA 2IH5A 2YQZA 2IPXA 3TM5A 5LQNA 4RTNA 2GB4A 3PFHA 3IHTA 4PYIA 5ICCA 2XVMA 3DLIA 1NBIA 2IH4A 2PY6A 4GC9A 5JR3A 3DXYA 5D1NA 2YXLA 3PVCA 2PXXA 5DLYA 2BR4A 4R8RA 4KW7A 4GBED 5ICEA 3UA3A 1ORHA 5DM0A 1QYRA 4MWZA 2Z6QA 3FTCA 2GA9A 3P2EA 3KQQA 3MHTA 2PVCA 4EQZA 3M6UA 2AN4A 1RJFA 3EVBA 5K01A 1X1CA 3UA4A 3G88A 3SM3A 3KHKA 2PXAA 3BXOA 4LECA 4PIPA 1XTPA 4RVHA 4NECA 4PYNA 4RVDA 3FUUA 2PGXA 2ZW9A 3G2PA 5DXJA 4AUKA 4BP1A 5LSAA 3GRUA 4KWCA 1NW8A 4EMSA 4FT4A 4FT2A 4PYKA 4PONA 3THSA 5BW4A 3KQTA 3E05A 3T7RA 2QY6A 3HTXA 5GWXA 2I62A 2OBFA 2OB2A 4PGHA 5K03A 3E7PA 5CUQA 3UWPA 1AF7A 4R6XA 2AOXA 2PKWA 3CVOA 3HCDA 4OA5A 5DRTA 5F2KA 4RWZA 2HNKA 3VC2A 3DOUA 1NV9A 3DXXA 1VBFA 3GRRA 4PNEA 2AOWA 4C06A 2P1DA 3DTNA 3P9CA 3UJBA 2BM9A 4V0QA 1ZG3A 1RI1A 1VL5A 2CMHA 3R6TA 2ZULA 3SSMA 5JUWA 5FCDA 2UYOA 1JG1A 2PV0A 5EZSA 2UYHA 4RTQA 3ELYA 2FK7A 3EMDA 5DRYA 5E9WA 3ERCA 5IH3A 2V74B 2NXNA 2XYRA 2PLWA 2PX5A 4R05A 4YV0A 2VDWA 3AXSA 4PGGA 4IKPA 3LBFA 3IYLW 3B7PA 3UFBA 2NP7A 2B2CA 5CVUA 2G71A 3ELDA 4RTKA 3B89A 5LQUA 1XVAA 3HVIA 3PX2A 3PB3A 1X1DA 1KIAA 3NDJA 4QPNA 2VZ9A 4KDCA 1VIDA 2BM8A 3EVCA 1DUSA 3JWHA 4AZSA 4UOEA 1KPIA 9MHTA 1AQIA 2AVDA 1D2GA 4YV1A 2GAFA 1JSZA 2ZWVA 3WSTA 4F84A 1EAMA 1I4WA 2C7RA 4WVLA 3EVDA 3G8AA 1FJXA 3BUSA 4C07A 1SUIA 1XDSA 1TW3A 4KIGA 2QRVB 2VDUE 3ID6C 3DR5A 2AN3A 2HWKA 4KDRA 2PWYA 3CJQA 5IKMA 4YUWA 2PX8A 3RIEA 5T67A 4LG1A 1WXXA 2GS9A 3ORHA 3C6KA 3GXOA 1D2CA 5GOZA 4OBWA 1QAQA 2PT9A 2ZIEA 3DLCA 4P58A 1KYZA 3EVZA 3UBTA 5DM4A 3LX6A 4HG2A 3UJCA 2G70A 1UFKA 2Y1XA 3DH0A 2ESRA 1L1EA 3PS9A 3PFGA 4C4AA 2CL5A 5EHGA 2ZIGA 2GLUA 4ER3A 5HZMA 3DMGA 2ERCA 4EKIA 10MHA 1VLMA 1DL5A 1TW2A 8MHTA 4M38A 3UJ8A 2P40A 4DZRA 2H00A 1ZQ9A 1IY9A 1Q0SA 1T43A 3P2KA 5BW5A 4RTPA 2AOUB 4HGYA 5K0BA 1SKMA 5C0OE 4IWNA 1UWVA 4PIMA 1ZGJA 1RJGA 2AOVA 1NKVA 3JWGA 3P71T 3BZBA 4GOND 1NW5A 2QM3A 3GNLA 5K05A 3G2MA 3A4TA 3EGEA 2PJDA 3HA7A 3A7EA 3TOSA 2KW5A 3MCZA 4QQNA 1BOOA 3MB5A 2IIPA 3LECA 3HCEA 2AVNA 5E8RA 4ZTBA 3OE5A 4RTJA 2HR1A 3RW9A 3G5LA 1YUBA 1D2HA 3OZSA 3KR2A 5GM1A 2F8LA 1DCTA 2CMGA 1YF3A 5EMLA 2OKCA 3TKYA 4DQ0A 1BC5A 2JHAA 3GGDA 3ELUA 3GJYA 3OZTA 4GOMD 2AN5A 4DM3A 3CBGA 3FPFA 4LWOA 2YTZA 3OE4A 4RVGA 2DULA 1JQ3A 4CKEA 4ER5A 5BP7A 1KPHA 5K0NA 3LDFA 4CKBA 1EQAA 2H11A 3LPMA 1O9GA 4H0NA 4Y2HA 3EEYA 4GC5A 3KQPA 4GQBA 2AS0A 1P39A 4OQDA 1X1BA 3CCFA 4G56A 5EPEA 2OXTA 4V0RA 4DCMA 2Z6UA 5LQRA 2QE6A 5LR6A 5C9ZA 3ANXA 1FBNA 1SVUA 4OQEA 3C6MA 2ZSUA 2YXDA 4E2YA 1XDUA 4HTFA 5E2BA 1L3IA 1MJFA 3TM4A 4CWAA 2ZZKA 3TLJA 3DXZA 5LQCA 4QDKA 3S68A 4RVFA 3BT7A 5FQNA 3KQOA 2EJTA 3KR1A 5DTRA 4DA4A 4P7GA 1XXLA 3DMFA 3KPYA 3NVMB 3BGDA 5CCXA 5FHQA 5EKXA 2IH2A 2IBSA 3BGIA 2P41A 3JWIA 3LCUA 1G55A 5EQJB 4P7KA 1JG3A 5M5BA 3KPJA 2XYQA 2NXCA 3B3JA 1NW3A 1WXWA 2A14A 3HA3A 2ONZA 3MCTA 4RYLA 3GRYA 4X60A 5DSXA 5F2OA 4OBXA 4ER0A 1HMYA 1L3CA 3HNRA 3BKXA 3IEIA 4E2WA 2O57A 5HOQA 5KYGA 4FR0A 1N7IA 3DUWA 3G2OA 2JH9A 3GO4A 3LKZA 2WA2A 3CJTA 3Q87B 4C03A 1FP1D 3OCJA 3P9IA 3NTVA 3HM2A 1V39A 4PYQA 2ZBPA 3LHDA 3M70A 1RI3A 3IV6A 1R00A 2G1PA 1TPYA 5DX0A 2NXEA 3OZRA 3VC1A 4AZTA 3B3GA 4A6EA 3FPJA 2ZWAA 4E32A 4HRAA 1NT2A 5HIJA 5E8JA 3FZGA 4AX8A 2PBFA 4XUDA 4MQ4A 4QPPA 3REOA 5DM1A 2HMYB 5ERGB 1X19A 5KVAA 2N47A 2WK1A 5C1IA 3KKZA 4X63A 1YB2A 4QDJA 2HTEA 2FK8A 1RI2A 2XYVA 5DXAA 4RX1A 4R8SA 3A27A 3B3FA 3QOWA 2LD4A 3A26A 5HEKA 3HVKA 2FCAA 3K0BA 1RI4A 2YR0A 1WG8A 2BR3A 2JHPA 5LQKA 2OY0A 4PYJA 5E1MA 4C04A 3LDGA 3EGIA 2G8NA 1RJDA 1G38A 2FRXA 1PJZA 3GRZA 4BY9E 5EOVA 3M6VA 3P9KA 5FULA 5EHIA 3R9XB 1EG2A 4E31A 3BWCA 3TQSA 1VP9A 4ATNA 4DCGA 2VP3A 4PWYA 3EVGA 5EEGA 3V8VA 4QVGA 1R8XA 3EPPA 3OU2A 5CVJA 3DMHA 3GCZA 5FA8A 1WS6A 1VE3A 2AOTA 2B9EA 2ONYA 3GDHA 3AJDA 3KQWA 5HIIA 4YUVA 4U7PB 1FPQA 3A7DA 4CTKA 2ZIFA 3R3HA 5DX8A 3O31A 1I9GA 4R6WA 3CJRA 3G8BA 3Q7EA 1ORIA 2NXJA 1H1DA 2O0LA 3GWZA 3VSEA 1N7JA 2BH2A 2P3OA 1F38A 2ADMA 3KQYA 4YUXA 1G60A 2JH8A 5KQRA 3OFKA 5T64A 2FHPA 1G8AA 3HA5A 1G8SA 5EEHA 5HIKA 4E2ZA 2JHCA 3E23A 3GRVA 3EVAA 3M4XA 1EIZA 2IGTA 2VS1A 3HVHA 4OA8A 5EMKA 5EGSA 1Z3CA 2PWPA 2AR0A 3FTEA 2OB1A 4E2XA 1EJ0A 2ZTHA 4RTOA 4OX9Y 3CC8A 4E33A 1YZ3A 4GUAA 3PT9A 1JR4A 5B1SA 5EG5A 3SXJA 4A6DA 1Y8CA 3NWEA 3U81A 3D2LA 2JG3A 3F4KA 5GP1A 4E30A 5K0LA 2C7QA 1L9KA 5EC8A 3DP7A 2IBTA 2NP6A 2JJQA 1KXZA 3KU1A 3LGAA 2DPMA 4L7VA 2EFJA 1L3BA 3M6WA 4F85A 1MHTA 2PT6A 5EVJA 5DPMA 1HNNA 3FUTA 2NNWB 4U7TB 4X61A 5GIOE 5CVVA 3C3YA 5CCBA 4RTMA 2ORED 1NE2A 1B42A 4LWPA 2OYRA 4C05A 3I9FA 4FSDA 5LQAA 3M6XA 4CXMA 3G5TA 5CIYA 4XCXA 3VYWA 3NWBA 2OO3A 3B5IA 3TRKA 1PRYA 4HSGA 3SX0A 4RTLA 1ZHFA 2Q41A 3KQVA 4AZVA 5F2NA 3HCBA 1XCJA 3HCAA 3K6RA 3UJAA 3FUVA 5K09A 5FWDA 4BLUA 3V97A 3SSNA 3PX3A 1KPGA 1IXKA 1R18A 3UJ7A 4PYMA 3GU3A 4QVKA 3T0IA 1XCLA 2VDVE 3I53A 3TPZA 5KS2A 5GIPE 5FA5A 5DX1A 2ZZMA 2I6GA 3HVJA 3P2IA 5HILA 5CD1A 4PINA 3CGGA 3FUXA 4IV8A 4DF3A 5K0CA 2ZCJA 1G6Q1 3I58A 2I9KA 2I7CA 5G02A 1SQGA 4EK9A 1M6YA 1O9HA 2PX2A 2E5WA 3NDIA 3BWMA 2P3LA 1YFJA 1NV8A 2QYOA 4YMHA 1Q0TA 3SGLA 1SG9A 4HC4A 2Y1WA 3LKDA 3NW9A 5DM2A 1JG2A 2WA1A 3FTFA 3ER8A 3PTAA 3BGVA 1P1CA 3T7TA 4RTRA 1FP2A 2UYQA 4JXJA 5E1OA 5T6BA 5K8VA 3OU6A 4GEKA 3LL7A 4XUEA 4CTJA 5CVDA 1YZHA 3FPHA 2IFTA 4IV0A 5EIWA 1X1AA 1JG4A 1JQDA 2GPYA 4ISCA 2R6ZA 1NBHA 2PXCA 5FUBA 1JTFA 3H2BA 4M37A 2XVAA 3A25A 5KQSA 4RV9A 2G72A 2O06A 4FS8A 3FRIA 4P7FA 3NVKI 2EJUA 2C7PA 3AXTA 4GF5A 4PYOA 2QRVA 3MAGA 4X1OA 3UJ9A 3LCVB 1JQEA 4AZWA 3KPVA 1XDZA 4QTTB 5DSTA 3P97A 2ZBRA 5U4XA 3BWBA 2P7HA 1IM8A 3KQMA 1RI5A 5GM2A 1R74A 2AZTA 1VPTA 4EVIA 3BWYA 5MHTA 3EVFA 2K4MA 4O29A 5K0EA 1U2ZA 2P35A 3TMAA 1O54A 1OR8A 3FTDA 2EG5A 5FADA 3SVZA 2FYTA 4GOOD 1NW6A 1P1BA 2PSSA 4M36A 5EZQA 3I5UA 4FSXA 2O05A 3G89A 4Y30A 1QANA 4C08A 3UJDA 4YMGA 1P91A 3NMUF 4HTFB 5ICFA 1ZKDA 3FYDA 1WZNA 3EGVA 4KVZA 4MHTA 4CKCA 3EEOA 2Z6AA 3KR9A 2AOUA 3RODA 1QAMA 2IDKA 5ICGA 1AQJA 2ZVJA 3HCCA 3UJ6A 3MTEA 3DULA 3LDUA 4YV2A 4B17A 4F86A 2CWWA 3PLAE 3CKKA 4GOLD 5CVEA 3EVEA 1RJEA 2XBMA 3O7WA 4Z2YA 1JSXA 4QQKA 1KP9A 1BHJA 2CKDA 1BKYA 3MGGA 2B3TA 2O07A 4DMGA 2BZGA 1M6EX 2IP2A 1VQ1A 4MIKA 3MTIA 4KIFA 3LSTA 5FWAA 4FZVA 3HCFA 1WY7A 3FUWA 3OFJA 2YVLA 4E70A 4XUCA 4WXHA 3R24A 5H02A 1N2XA 5DTMA 3SMQA 3KR0A 1KR5A 5FQOA 3SSOA
chains in the Genus database with same CATH superfamily
4MP6A 1R0SA 2D5IA 3N0WA 1TZBA 1D1QA 3GLUA 3NONA 2X0IA 4BNZA 3NIGB 1FDWA 2IX9A 3DGFC 2J5BA 4I66A 1E79D 3KYIB 4X6UA 2EEPA 2B92A 1S2LA 4ZRMA 2XUOA 2EOAA 4PBSA 2OXRA 3GJZA 2F4NA 4KSCA 4FCCA 4E07A 2XQVA 5HX7A 3VR5A 1CVRA 3CR3C 4X65B 2MYPA 3TLKA 2VP4A 4UHBA 2IRWA 4DW8A 1V7CA 3UA3A 4I6EA 4RHUA 4NYMQ 1V3UA 3O73A 3IELA 3Q3EA 4GKKM 2V7XA 4ZEVA 1GARA 1G2QA 3AESA 2I0FA 2BTOA 2G5PA 1AF7A 3IHWA 3SZGA 1XTKA 5H9WA 4B3BA 4BMSA 2AX4A 5T5QA 1S0UA 3RTCA 3DOCA 4FC6A 3RC3A 1SVKA 5BV2P 2N35A 3CNNA 1RWVA 5IJ9B 4DUYM 5I4BA 1YMVA 4YDRA 1WDLA 4CG0A 1X7WB 2EQAA 2CHQA 4O4LF 1K7YA 4UDXX 3N7AA 3UJCA 1WHTA 2CYCA 5DFLA 3R3VA 4FFNA 5IWAB 3UUWA 5KQDA 3WKBA 5CIQA 3IHKA 1W6UA 1YK1A 4HH3C 1GZ4A 5BSEA 2YIVX 5D86A 3OE5A 2HB6A 4CEIA 1IIBA 2H48A 4QBGB 2XDQA 5ALTA 1EA7A 4GC5A 4MGKR 3U4MA 2VTEA 3PNQA 4D6XA 1V16B 4IJWA 1LH0A 2J7NA 1I6WA 2NUAA 2V1XA 1I3NA 4KR2A 3DE7X 4QDKA 3PENA 3ORSA 5B3JC 1E64A 2WWGA 5JBQA 4Y9DA 1GRCA 3TOVA 1DP4A 1GOTA 4HEA6 2C61A 1PJ3A 4XGIA 2OOSA 3HNRA 4G0PA 4MKXA 1H4TA 1T4CB 5CJPA 3B1KA 2R1TB 3W5HA 1MFPA 1HO3A 1R2ZA 4GI7A 3AR3A 5DNYA 4A5OA 4QSHA 1B2LA 4W82A 1VIMA 1GZDA 2KSQA 3JQ6A 2R44A 1GLVA 2D5LA 2HT1A 4X0EA 3GDHA 1AHIA 2WKSA 4V03A 1RQ2A 2EKBA 1FRVA 3R3HA 4AYTA 3ZV6A 4RQBA 1N33B 5AKYA 3DD1A 5KQRA 4OGKA 4F1WA 3ILXA 3CC8A 3PJFA 5CITA 5F5XA 1RLMA 4ZEWA 4HS4A 4DNFA 4NOMA 5IHPA 1G98A 1ULHA 3JCZA 1EDEA 3T7IA 5EVJA 2OO5A 2CCJA 3KNZA 3F7MA 3OAAA 4HRXA 1G8GA 4ZRDA 5IUNC 1OZGA 4QGSA 3PXEA 1ATZA 2BEVB 4EGSA 2IP1A 5HKOA 3BXPA 1LV7A 3CZAA 3TNJA 1PEDA 1GPJA 3SARA 2BFWA 1NV8A 2YWRA 3LHKA 3BGVA 1P1CA 2ODPA 2ZJFA 2QUHA 2PYDA 4UTVA 1ISJA 5K4AA 1IRXA 3RGWS 4BKRA 5EJ4A 2PAFA 3TSZA 3BN3A 2W2TA 3R3XA 1U3WA 3BFJA 3HSKA 3H5RA 1L7DA 5HJEA 3LA6A 2X23A 2ZUBA 1JLLA 2H5JA 3W79A 5A4FS 5KYKA 4ZVMA 3TEMA 2XHEA 2XQKA 2G83A 3RSCA 1JR2A 2VP6A 4S04A 3ZE8A 4WK4B 3M7GA 3U19A 1E7YA 2QPOA 4OI1A 1ZOLA 3GQBB 1J07A 4NBKA 1Z37A 4GXRA 3T7AA 4WOBA 1NUHA 2I80A 5B58T 4DDKA 3QBDA 2WTBA 2CLDX 2J9FB 1IPEA 1QZZA 3PKJA 2JFGA 5BSTA 2ZJBA 1YJXA 3I83A 2FN7A 4XA8A 3OTWA 2B25A 2X4GA 6LDHA 1TUBB 3ZQKA 2WFMA 3JVVA 1CR4A 3LJKA 3RNOA 4IHKA 3O9ZA 2D62A 3DO8A 2R7NA 3QVLA 4ADSG 2Q0XA 3KOYE 4D8XA 2IH5A 1PFWA 1YK0A 3CUSA 4HL6A 4M0DA 3GUYA 4BMCA 2B8NA 4GQAA 5SYMA 3CKYA 2FSSA 2OHVA 1YCHA 3ON5A 2WNHA 3FUUA 4Q5IA 1Q95A 5B55A 4FLFA 4RF2A 4N8SA 4R0VA 3WIBA 2HJVA 1HC7A 1Z4MA 1OTXA 2PKWA 4QL3A 3GLIB 1T36A 1M2EA 2WT8A 1MQSA 1Y37A 1UAGA 1VL5A 1I3LA 1XYGA 5GZ6A 3CF6R 4I46A 4PZYA 1X1DA 2HLHA 4BO4A 4K9PA 1H94A 5TGZA 2UUBB 4GS5A 3K32A 3C7AA 3EFEA 2FWRA 4GE3A 3BRCA 4F9TA 3D8BA 4LQLA 3HCPA 3BAZA 1X42A 1Q6ZA 2X76A 3TW6A 5C52B 3HR7A 3F5SA 2ZRJA 1T43A 5K0BA 3X1KA 4GMFA 3AR7A 1YB5A 1TMYA 5GTDA 2IODA 2DJIA 1SCNE 1T4CA 1Y89A 3MT9A 4I8DA 4NSRA 4S1NA 1K6IA 2GLTA 2PNFA 1TB4A 5F3RA 1R0CA 3L4BC 1LTHR 4QYXA 3PPWA 2EGGA 4EZBA 2PWBA 5IM4F 1Y8ZA 1JLSA 3GUZA 4DR3B 4MWGA 4QBKA 5HQJA 1TYAE 4RH3A 2HJ9A 3ZHOA 5ARBA 3UJPA 5FHQA 1PWYE 3BGIA 3A9UA 1NW3A 2J4FA 5EMNA 5AJTA 3WNDA 2HIHA 3M1IA 2H57A 1TDHA 1W1IA 4GP6A 3VC1A 4JN6A 4D3YA 3F97A 4IDDA 4Q66C 1EP1B 3AUFA 3BOSA 3VKVA 2IZ0A 2C4VA 1VJCA 2JI7A 3BXFA 1SCQA 1PE0A 3JRWA 3JQ8A 4TV9F 2RB4A 5FPKA 1A27A 4C3VA 1U8UA 4YYZA 2GHQA 5A9SA 1VLZA 4HWSA 3ZWOA 1OLXA 1XYVA 3U6OA 4HAWA 4OX9Y 1YNSA 3J80A 4FLMA 1O9BA 5A5DA 3TRDA 3TVYA 1ONPA 4C0SA 3RUFA 4AJ2A 5B2ZA 2EP7A 5JNTA 3I2YX 3VNUA 1VEKA 2ZJ7A 3C87A 1W4BA 3HCAA 1YS1X 2QYSA 3M7IA 3RYIA 3R5SA 3BGOS 3VPAA 3AF1A 1UPBA 2QN3A 2YV5A 3UENA 2J3EA 4MV4A 2LCQA 1UPXA 5A3VA 5F7OA 1ML3A 4GMGA 3VPSA 2GHRA 3HFSA 1ZMOA 1EINA 4CM9D 2Q8QA 4YMUA 1A8QA 1GPH1 1S2IA 3GC6A 1WPGA 3K70B 3EODA 3DAYA 1IFXA 4QRDA 4RD4A 3J7BA 2E18A 4DV6B 4G67A 1UBLS 5JFTA 3TZCA 2V9CA 2Z6AA 3WL3A 2XAUA 2WG1A 2EW1A 3H3XA 5A1TA 3Q15C 3WLHA 4XUGB 3WYBA 1QO7A 2OE2A 1SXJC 3GNSA 1F7VA 2J48A 3Q11A 3R24A 4L6AA 1OFUX 1BKSB 2DCMA 3ISVA 4FXPA 1Z7GA 2RKOA 2D2FA 2YZKA 4UQOA 4CIXA 3GCGA 1OU4A 1YRQA 1IK4A 1TM4E 2FUCA 4FGZA 4G01B 4KQGA 4DV0B 1T2AA 3FSJX 4MHSA 3KB2A 4KSYA 4G5HA 2XZFA 3HXQA 1KBOA 1PFUA 4BECA 1RKVA 1UXHA 3D7NA 2WU3A 1CP3A 4LZOA 1Z9BA 3H1GA 1ZD3A 4ER7A 4BUCA 2VQFB 1YFLA 3GP8A 1I1NA 4I99A 1C8BA 3I04M 3TM5A 1UKVY 6ADHA 5D2CA 1KSGA 4EY7A 4QARA 4MO2A 2Q3JA 3HEAA 1DADA 3VVCA 5ITXE 3R9WA 3RFWA 3HO1A 1NVUQ 4L7QA 2AK2A 4GNRA 3SAJA 3KAKA 4DVJA 1ACMA 4BNKA 1YA4A 3OPYB 3MCAA 3IKMB 4WOJA 3RC8A 1W8DA 5AHKA 2C2YA 1E6KA 4OL0A 1RDFA 1H0RA 2AJTA 3ELYA 1KVQA 2FR8A 3V3TA 4WADA 3F5DA 3GLSA 1U4NA 3AU9A 1MO3A 2HTFA 2NV0A 1IHOA 2JJ1A 4QG7A 1QXSA 3ID6C 3KUUA 4KDRA 3CJQA 1U8ZA 3ORFA 3SAUA 3SICE 5FA6A 1UUFA 2LRHA 2V7WA 4Z1OA 3KEOA 3RTAA 3JZAA 4Q24A 3DMGA 4A3SA 3S70A 1BGXT 4ENUA 3EZLA 1PK7A 1S5PA 1H4VB 2J6HA 1B74A 3AEQA 1MJ5A 2WWHA 1OYWA 4IDPA 1ZH6A 1ZAKA 1ZY2A 2A1IA 3GP5A 3OLQA 5IT5A 4EPWA 4H6VA 4H15A 4CM7A 4GBJA 4AIIA 4FQ7A 4W1RA 1UBOS 1Q5PA 4EUHA 3SJUA 1JDTA 3ANXA 2P8SA 4DIKA 1VG0B 3G1TA 5BWBA 3OKAA 1W1UA 4Y6GB 4KV9A 1XTVA 1NOJA 2JXNA 1K66A 4BKUA 3KS4A 4I3GA 2HQRA 3KJEA 1CNMA 3KHSA 2P5TA 3RE8A 2JIZA 1VLJA 5J2UB 3CLKA 1DDGA 4XCQA 1DUVG 4D46A 3MJHA 3ECCA 1SUCA 1ZMRA 5A2QS 3FDJA 2PMFA 3QELA 3JTEA 3W2TA 4FD2A 2CB0A 3UMGA 1FL9A 3L9WA 1YUMA 4CMEA 3KQYA 4TKZA 1FW8A 2WZDA 2PZAA 4ZPXA 1A4RA 2YHAA 2B2NA 2OXEA 1RC8A 1L7VC 2DQ4A 1NP7A 3BJZA 1YS7A 4LJ4A 1SXHA 2ODBA 1CC1S 2ZVDA 2GPJA 3I1YA 2NNWB 1QPBA 1PEKE 3GVIA 4YX9A 1DARA 1G9SA 2QG4A 3L93A 1U0BB 3TRKA 4LHVA 2P4QA 3IUYA 4G84A 1B0AA 4G0XA 3WLTA 4E5NA 3ROPA 4AZ3B 5CT5A 3RI3A 4DF3A 5TF4A 2WNSA 1V6CA 4HDSA 2F8TA 1OJLA 3MA0A 4G4SO 1ZN7A 4MAFA 5DBFA 2WYOA 2PSDA 3VYSB 4P5EA 2LHGA 3E9NA 4PV7A 3D43A 2P2ZA 3LXXA 1A5SB 1UZNA 4WLNA 5I9MA 2LVOC 3H7AA 2GF9A 5BNFA 4IOKA 1C0EA 4LVCA 5LD2B 4BO9A 1QFMA 4II2A 4CIBA 2EZ9A 1YJQA 3T6KA 1Q3HA 4HK4A 2QUZA 3VJLA 1D6NA 2CFSA 3EVEA 2IF0A 3ZWYA 3UQZA 2H9AA 2QY9A 2JAHA 2O4CA 2I66A 4D6YA 4FFBA 1NJSA 4IBEA 3ENKA 3CWQA 4EUNA 5KQMA 1V5GA 4I4IA 2GBPA 4KLCA 2PXHA 1EGMB 4MV9A 6NULA 2BH9A 3ZJUA 5IZ7D 5AHRA 5COQA 1AVTA 1RMTA 4COKA 2XJ9A 1EAYA 5F4BA 4X8MA 2RBGA 2X8JB 3QXHA 1KAMA 2VNIA 4AP6A 3UK0A 3I9MA 1I5EA 3QXSA 3I6ZA 4AJPA 3LUFA 1OU0A 5EE5B 3TLAA 1SQ6A 4PVDA 1BQEA 1BHSA 3IAAA 4C1NA 1A9OA 2QI9F 2JLUA 2FN9A 1MF7A 5U4QA 1F2DA 1MQAA 4HB3A 2XEPA 4J75A 4G86A 3LZ6A 3JPYA 1FUUA 2O2DA 3CY6A 3FJOA 4ILKA 2NU7B 3RYFA 4XGRA 2W8BB 3B2NA 4RCZA 1IHPA 3LUDA 3R8XA 2HSZA 5FB3A 2VDKB 3HYSA 1TDJA 2CLOB 2DETA 2EKZA 4UMEA 3B89A 3ZXYA 5BR4A 1KIAA 4XDHA 1VL0A 4TZ6A 4Y9SA 2KMLA 3BUSA 5BR7A 1CIVA 2ZJ4A 4X64M 5ALGA 4KBYA 4I3HA 2EDCA 4OYLA 5AJHA 2C3UA 2C1ZA 2ZIGA 4G8BA 2ERCA 3QYFA 4B8ZA 4E2FA 1OX5A 3B7QA 4B7CA 4DILA 1NMXA 3IDQA 3ZHZA 2O0JA 2HCFA 3EGWA 4UNRA 1J25A 3K72B 3LQ2A 2O8NA 3L7MA 1Z6TA 1XEFA 5CDUA 1X74A 5JE8A 3RYCA 5H81A 2KM1A 4KN6A 1X1BA 2UZIR 3QBEA 4IGKA 3H5WA 4BEJA 4JGIA 2ATEA 5FQNA 3PFFA 9ABPA 3GT0A 3RO7A 2QTBA 4C3ZA 1YKGA 4MLCA 4P3XA 3DQQA 4YAJA 2FFAA 1O6GA 3B6EA 4YCBA 5HKBA 1DO8A 3WIEA 5IREB 1ZH0A 2FW8A 5JCPA 4MQ4A 1C9DB 1I7DA 1PK8A 3RQSA 4OGFA 2PZFA 4WRRA 1L6RA 1CQJB 5HJ7A 2F55A 5IJXA 2B61A 2BR3A 1N8KA 1W76A 2I3DA 3I6BA 5BORA 3TQSA 5JANA 3O4IA 4WCFA 1Q0UA 5TPZA 1UR5A 5IARA 1PWEA 5EJ9A 4XDZA 1I4DD 2O23A 3OFKA 3C58A 4RFVA 3R75A 1PS8A 4BNIA 5HS6A 2H18A 5JXHA 2PUVA 1YZ3A 2NQTA 1BAPA 4PC1A 2RRUA 3I32A 5B1SA 5JSFA 4KYTA 2M60A 2OGSA 2Y0CA 4XSVA 4JT2A 4E5PA 1R37A 1YJCA 3N1UA 4G5RA 4GMHA 3HJUA 4IXMA 3PICA 5DKFA 4ARBA 5KKCA 1WR1B 4CYMA 4YHHB 1MEJA 1V5EA 1V1MB 4WZZA 4LRTA 3L8YA 4H0CA 1ZNXA 3U6PA 4IBDA 1Q0ZA 4B6OA 5CX1A 3W7VA 1KZGB 3QU4A 4IGAA 3UFXB 3O03A 3P0JA 5L3ZA 4UM9B 3GB9A 1J42A 1NTRA 3DKKA 4D98A 3UOGA 3I2GA 1WNTA 2H2AA 3WWPA 1V41E 1XEWX 2BJWA 2IXEA 2DFDA 3G1UA 1R4GA 2GAJA 3ZE9A 4I9UA 3G79A 1P91A 2BLNA 2Q99A 1JQKA 2Q49A 3LDUA 1E4EA 1F6BA 4H1TA 4QQKA 5JAQA 1RAAA 2IXTA 4F5WA 1ISMA 1KJQA 4PRZA 1EM6A 3T4PA 1XNHA 1QIFA 5JQGA 4MVCA 1HNWB 3JYOA 1GQSA 2CC2A 3LBIA 4BEWA 1ZRNA 1L4EA 3LMMA 2A0UA 3BMCB 3OA2A 4Q0MA 1SCKA 3CEHA 4Q4AA 3ZYZA 2FP4B 3WWYA 3V1KA 5C31A 1JDVA 3PPVA 1X0XA 1RZUA 3EXIB 4XVCA 2CUNA 1SXJD 4WAUA 4X8OA 3K9GA 5HUHA 1XTJA 3STWA 2IW3A 2B20A 4CQJA 3BTOA 1MOQA 4KFRA 1BA3A 3HLTA 3UW1A 2P6OA 1Z22A 4DBZA 3V1MA 3KALA 5DF1A 4YCMA 5HK8A 1LDBA 4R7GA 1X86B 5TLSA 1HQCA 5JJBA 4RC9A 3GJ4A 2X9VA 4DIBA 1A71A 1PSWA 1FTQA 1KI9A 2G6BA 3THSA 3EX7C 2ILVA 2HO5A 2GXAA 4U7DA 3VR6H 3SF0A 2UZAA 2HNKA 3PZBA 1UPFA 1WMDA 1U3DA 1UFZA 2V7PA 2VJMB 3WGMA 4FCWA 2POQX 4JBLA 2J7KA 2ZB3A 3HR8A 4TKVB 4CDNA 3I6MA 1TVMA 2VJYA 1TM2A 1ND5A 4P98A 4BLCA 4IF4A 2K7FA 2KA6B 4KIGA 5CEJA 3CMMA 4TLEA 2XMBA 3NBIA 5I4KA 4AQDA 4G4NA 4IOJA 3G2NA 4TV8F 3PEFA 3BB1A 1HT2E 4R5HA 2QXUA 4YWJA 2PTGA 1NOIA 4I5DA 3IAS6 2PGAA 1Y1KE 1NQXA 5B12A 1ODJA 4MCHA 4P5PA 2V97A 1UJCA 3RIXA 3T41A 4F3KA 4BTEA 1Q6YA 3GHYA 2ATIA 3IT3A 5GMOA 5LQRA 1XU7A 2EFYA 1XDUA 2P91A 2PX6A 2ORVA 3M1YA 1QUSA 1U5AA 5EJAA 5DT9A 3IMFA 16PKA 3TQHA 2BFPA 3WRXA 5A3SA 4Q1BA 3HA3A 3IBFA 1JHUA 4KRYA 2PIDA 3U6QA 3BKXA 2JGEA 3QKUA 4IO0A 3LKZA 2XGGA 1Z5BA 3P4XA 2HMAA 3WP1B 2RI1A 4AZTA 4FDUA 1CCWA 1KU0A 1HNZM 5LXTA 4ESOA 3FOCA 2RGNA 1E2MA 5EWMA 2CMDA 1GQRA 4IH1A 1FMTA 4BN5A 1ZMTA 3UB4A 3N59A 5K6RA 1Z4PX 3AG5A 2E4YA 2Z3XA 4YECA 1WUHS 4RJ2A 1F51E 1JKIA 4YLYA 1OIVA 4E0BA 1K88A 3GWZA 1E98A 4S24A 3NRCA 4Q05A 1HH4A 3FZNA 2V6JA 1CVIA 3M4XA 3G23A 1MAWA 4IUYA 4KP7A 2J7PD 4EX7A 3T1OA 1XQYA 2FZEA 4QEZA 3OT1B 2MIIA 4BZZA 1HNNA 2VRBA 2ZQ5A 1NE2A 1ZU5A 3OZVA 1CY1A 3PDCA 4MS4A 5C46F 4F5DA 3GH3A 5C32A 3TMKA 1LPNA 1NC1A 2CXPA 4BVEA 5ALNA 5BURA 2XMCA 4UOZA 4X1KA 3IOMA 2HWXA 3ZDDA 1O5IA 2I9KA 4RSMA 3T8YA 3H4JA 3HB1A 2RJ3A 2ZYVX 3MLEA 2O6HA 4F04A 4NYJR 4JJKA 2OCBA 721PA 4DM4A 4JYAB 2EEZA 3ASZA 2WZBA 3V42A 2WM8A 2D00A 2F1RA 3K2BA 3DOJA 5I4IA 3PUKA 2O06A 3QNWA 3R3WA 3O2QB 1FDIA 1XDZA 3PL5A 1CIJA 3NEPX 1C3XA 1A5TA 3B9QA 2BFEB 4UNSA 1V11B 4U2DA 3B5EA 2IEDA 1CJUC 2WFLB 4L4ZA 4OB8A 2OXFA 1F06A 1DKQA 4XM0A 5C4MA 3Q3GE 3E53A 2EARA 3D31A 2UXBB 3DZCA 3CHYA 2BBSA 4TMZA 8ABPA 1NBEA 3V2GA 1PP4A 2OXCA 4LDAA 1IAVA 1K0UA 4DWVA 4TTJA 2XGSA 3C4JA 3VR5D 3W0FA 1T4DA 4KR7A 1YA8A 4EHKA 3GIWA 5DCWA 3ZHBA 2FR8C 1E66A 2QTMA 2O8DB 1FDVA 5HFJA 3WQHA 4BNXA 2R85A 3PJDA 1XXHA 3QF4B 4HXEB 4DREA 3U3OA 1RYDA 4EF4A 3IILA 3KAJA 3IHLA 4S35A 2PU7A 2FPSA 3VISA 3FMOB 2Q4BA 1MNAA 3AJRA 1M33A 1C3OB 1V0JA 2JLZA 4D44A 1D4AA 1NMYA 1HI9A 2ZRIA 3V7FA 3VI4B 4ZOLA 4X24A 5IT9S 1AGRA 4DV2B 4LNAA 4J7XA 5FV4A 4RGYA 3U4GA 1KZHA 1FRQA 4G89A 4WDRA 2QTVB 3IJEB 3DTNA 1I4EB 1M6HA 2XIJA 1UKYA 2IYUA 2PZBA 4IIWA 3X1DA 5HPYB 2V8OA 4GW3A 1XVAA 2XRMA 2AMVA 5HXAA 1UBFA 4G1MB 1ZAEA 2PLFA 4IHJA 1ZJJA 4DZZA 3V4ZA 3IKTA 3UVEA 3DE6X 4OQ4A 4WH0A 4TYQA 4ALLA 4X7MA 1N78A 5AM4A 3QYJA 5ES3A 1L4YA 4IW3B 4PHFA 4P4UA 4L4XA 1K6EA 1Y7TA 4K26A 4RHCA 4CMEC 5HRCA 1P1IA 1NYLA 1E7QA 1EDOA 2WJZB 1F1BA 2JCGA 3NIBA 4CKBA 4OHFA 5I01A 3VM6A 4OUKX 5JZ9A 4BEVA 4UHJA 1KHTA 2M6KA 5KCZA 4J6FA 5AP9A 3B3AA 3KPYA 5CBKA 5DWDA 1Q2XA 4H4EA 2IELA 5K3CA 4K0KB 5FOVA 3AY6A 3FAZA 4WNIA 1W1WA 4J43A 1VIYA 3T3NA 4AX8A 4OAOA 3D5QA 4FJ1A 5FTJA 5D87A 1BW9B 2B8EA 2YJZA 3ZBTA 4FHCA 3M5CA 1WRBA 4EX6A 4CW7A 2JFOA 4NV1A 2ZJ2A 1GKKA 1NNI1 2HMTA 5FORA 2F48A 2C8LA 1J2UA 1D3AA 1QGDA 3FH0A 3INRA 3RBVA 2ONYA 1A69A 3BMNA 1TKAA 2LWXA 3OAAD 2OM2A 3ASVA 4Z2AA 1H1LA 1HXHA 4OSOA 1WL8A 2DI0A 4JBWA 1V9CA 2A9JA 3QKRB 3BD9A 4KQ6A 4ZJYA 2BKAA 1SZCA 4FNGA 3QRWA 4X92A 3EULA 2IUSA 4TZKA 4XH9B 2XZTA 2JK1A 2AH5A 4J0QA 2VBCA 1T8SA 4P4NA 2ZAGA 2QMYA 5JHHB 4ZYXA 2ORED 5DI3B 2L19A 4HAOA 2JIRA 3EXG1 2I87A 2J85A 3ZDZB 3H86A 4CFZA 1KL7A 5AOAA 2PZLA 3MAJA 1FF9A 3DAHA 4P1ZA 4LBWA 1S9DA 4WINA 2I6GA 3Q3CA 4KACA 3ESRA 2PLNA 5JS1A 1J20A 1KF0A 4HADA 3CUVA 4C7MA 3BFKA 3PVZA 4TQUS 1WVIA 1JJFA 1YL7A 3RTGA 3L84A 4DJFC 4CTJA 4FCTA 1II8A 4WMLA 4PZCA 2A5JA 2QYTA 1G1AA 4NESA 2TMGA 4QTTB 5DSTA 1U8TA 4Z9FA 2X7JA 2W98A 5C1OA 1NQVA 5TEWA 1PQ4A 3KKQA 1NW6A 1T24A 3ZY5A 1SHJA 4LSWA 4KLAA 4J29A 4LZZA 2DFNA 5A5EA 2GZSA 4IS3A 4G1CA 4OSPA 4MW1A 2JAQA 2B3TA 1S3FA 3FY4A 5AWFC 4WXHA 2XCOA 3TIIA 5FQOA 2I7TA 2FPOA 3HI4A 4R8KA 5A3JA 4YRDA 3ONFA 2E6KA 1ECLA 4YONB 1AS3A 3FNHA 2RAVA 3LT5A 4U2EA 5HVNA 2VP5A 1YC5A 4WERA 2PMKA 5KPRA 2XUGA 4Y28F 5CG2A 2D1RA 3B9BA 1H4QA 3SHFA 5ADVA 3SXPA 2D2XA 3V1NA 4PX9A 3JARA 5JD6A 4XWYA 3QE4A 4P3NA 4F46A 4P3OA 2P9HA 2QTZA 1YS4A 1UXGA 2CDCA 2PXXA 3NWOA 1A97A 3UJHA 4MWZA 4EEZA 2X7XA 3KQQA 5JZOA 2TRSB 3UA4A 1R5LA 5J3JA 5CDFA 2WVJA 3IVMA 5I7FA 3ST7A 5TJ9A 5LA6A 3AV0A 4MQ5A 4EJFA 3EXG2 3M6AA 3GRRA 1XJCA 2OORA 4NLLA 2GGSA 2CHUA 3PU6A 4JP1A 2EERA 2WINI 1TK9A 5ALJA 3LK7A 2D54A 3B7PA 3W06A 5HKLA 1L7BA 1GV1A 2G07A 3GDWA 2VZ9A 4ZJZA 1RYHA 4X8LA 3E1KA 1TX4B 2NWQA 2P9TA 4TSFA 4F8JA 1OXMA 4PDIA 1N2EA 1WBDA 5GADl 3ZEAA 2QL6A 3CRZA 2YJ4A 1NF9A 1P5ZB 3LGXA 2EJCA 2C96A 4Q7JA 2GJKA 4UHFA 4YJFB 4TTAA 3DEYX 4PSDA 1Q3BA 3VUFA 2CL0X 3OQVA 1BKDR 3IIJA 4CKCB 4FMCB 4WCFC 4OHOA 1ST3A 5GONA 4GOND 4BMYA 2P1ZA 5KI6A 5EKDA 4NRDA 2EVWX 1SKQA 1KMHA 3H1TA 5SZHB 2YY5A 2ZYRA 5CLLA 2R5FA 1T3TA 4OVZB 3MJDA 3UF0A 3L40A 3L1HA 3KFXA 4M49A 3TMYA 4N7MA 2V4UA 3M34A 2NSHA 3KQOA 2PQ2A 2EX1A 3T7DA 3WFZA 4HWPA 4OHCA 1AG9A 3FSGA 2KI5A 1NMSA 4ZVTA 1HGXA 1R64A 1R0XA 1JIJA 2H7CA 2CLSA 3QW2A 3VOAA 4UXHA 4ZC8A 3OD5A 2X3YA 2QP3A 4TLAA 4IQGA 1AKQA 3VMFA 4V2IA 4D4HA 3RFCA 3D64A 2FH5B 4BN0A 4YRCA 2HZ7A 3NBQA 2ZRKA 1EFVB 3BHJA 1PLKA 2GWHA 5EOVA 5J9FA 4DLYA 2IPOA 2NSJA 4ESHA 4L15A 5EMHA 3AJDA 3CE9A 3IE2A 3IECA 1HX7A 3A9RA 4YAOA 1MBZA 4GZMA 2VQEB 2D3TA 1ZK1A 2WG0A 5ALMA 3F5MA 4HMOA 4MGEA 5DHTA 5AXCA 4Z0HO 3V2HA 3CG4A 3BF8A 1ZI6A 4CT4B 1RYFA 2IKSA 1SHLA 4UZSA 1PUJA 1BRMA 3FDXA 3W77A 4WOPA 4BRSA 3H6KA 2VAPA 1RRMA 5IBRA 5F2NA 4JI7M 4XYMA 1C8KA 2CNDA 3A6HA 1URPA 3N8NA 3C45A 3EDYA 2H7VA 3P4UA 4I9GA 1GTVA 2BFBB 4JC5A 3OWXA 3DEJA 1U8FO 1N92A 4BDSA 2JL1A 2QS9A 3ESZA 1HEYA 4LVNA 4LISA 1RHKA 3WGUA 1N6LA 4MUEA 1Y7LA 2X1MA 3MJTA 4IKOA 3D2CA 2DECA 3AHEA 5BPFA 1P4RA 5ALQA 1YKFA 3KTOA 3NOQA 3F2VA 4I6GA 3QEBZ 1ECPA 3QPBA 4Q1VA 1F5SA 2MYTA 3GR6A 4ENQA 1CZOA 1FA9A 3FNEA 2VDQB 1LJ8A 4H18A 3F6SA 2FDCA 2W9XA 1CR0A 2E1PA 1OIXA 4GT1A 3FUWA 4PZ0A 2OMKA 5AK5A 3CMCO 4P36A 5CM2Z 4GZLA 5CM9C 2FE8A 1GQOA 2EC5A 1LBQA 5C34B 2OP1A 4WBNA 3OIVA 3G7UA 2EX4A 1GSOA 1PD0A 3DT8A 4EBBA 3WKCA 4MR7A 1O08A 3W3ZB 3TW8A 2XCQA 2MROB 3D54D 4OIFA 3ROKA 4AC9A 3AL0C 2PBRA 5K6AA 2OQRA 3R7BA 7AT1A 3FLMA 1C0KA 2ZYHA 3NXKA 3RRYA 1QK4A 3QLJA 2HLDA 5HQ3B 2NLOA 5EFOA 3I61A 2ZU6A 2VZ0A 2OYSA 1YS2X 2ZRHA 3ZD8A 1GVNA 2FSHA 1QUTA 3ESAA 3UB2A 3DCIA 4IOLA 1TO1E 3NHYA 3E15A 3NAMA 4YR7A 3AEKB 3LY7A 3NC4A 2JJ1D 3C1TA 5GWXA 4DJAA 2R5NA 3GV0A 3HZHA 3K94A 3QYBA 2YXNA 1O6BA 3PHJA 4OQXA 4TPKA 3RIYA 4YMSA 5EUCA 1KI6A 4PQRA 4F2WA 3EY4A 3WRXC 4ECEA 1O89A 2G88A 3ZWMA 1TECE 3NDPA 2PKQO 1O94A 4RD2A 3U5TA 1V48A 5IDYA 3QUBA 3ZLTA 4BO0A 2RGNC 3TINA 3KXDA 4UD6A 3NWLA 4MR9B 4LTMA 4ZVVA 4L72A 4ND5A 4HVAA 3DH0A 1K2WA 4MW7A 4FVMA 4C21A 2JCBA 3B38A 5I9IA 1DCFA 4KREA 4NAUA 5IPFA 2M9MA 2OSVA 1QX3A 4ZDIA 4P93A 4OQZA 5DGHA 3KB1A 3AM5A 3N2IA 3B78A 5KYUB 1JQ3A 1DKLA 2JIZD 3L92A 2PRKA 4JDPA 3MSCA 3TM4A 4H7JA 2Q2OA 3FW1A 4Q3EA 1AB6A 1N75A 4KMSA 1X1TA 4B3RB 1D2AA 4X60A 5KYYB 3E0QA 1FP1D 3M6LA 5F7XA 4DPKA 2VDMB 4RQAA 2VHTA 4ZVPA 5AOCA 3I37X 1SVWA 3GGOA 2DMRA 3EGOA 3IGFA 5BT9A 2JHPA 2V65A 2GM5A 4PS1A 4IBKA 3VKGA 1RTTA 2BKXA 1AQLA 3HKPA 3U1TA 3FM9A 3PNLA 2ZTDA 1CRWG 5ED4A 4JP2A 3K09A 4D4IA 2WHQA 5LZ7A 4D9JA 2V8BA 1JPUA 5EMKA 3NIFB 2D74A 1NVVQ 1FS4A 4OXKA 1K5HA 4X84A 3BFPA 2VK8A 3EH2A 1GAJA 1THGA 3UHJA 4NRVA 1N1GA 2AFRA 4YPVA 3GVXA 4JLVA 2CFCA 2FFHA 2AJLI 4B7AA 4QTXA 2PRZA 4HFJA 3H3JA 1JLHA 1ZM2A 1MN6A 4PNZA 2D1YA 5C1DA 1A7AA 2W6ZA 4RPIA 2PZJA 2PX2A 4URYR 1Y1LA 1VPDA 1SG9A 1TF2A 1TTTA 2B6NA 3TQFA 1QV9A 4UTZA 4D97A 1Q77A 3K15A 3TE6A 3FCEA 5MFPA 2VL7A 4JI4M 1Q1AA 1V26A 5FUBA 4L8GA 5IJ9A 1TIPA 3MLBA 2ZBRA 3B1XA 3KT3A 4LSZA 2NZYA 3BEDA 1X7WA 4UJ3A 2XWPA 4TOIA 1C3JA 5IDVA 4FSXA 1MP0A 1TFRA 4B46A 3WMGA 5CAEB 1P61B 2NGRA 2OUKA 2JGMA 3TOZA 4N1AA 2QTGA 2VPXA 3ZLBA 3BWXA 4A16A 2WHEA 3FG9A 3KLNA 4B8WA 4ZVKA 4CIAA 4JJIA 1XFAA 5EKUA 1V16A 1DAOA 3LW7A 1YBAA 1C1YA 4LJ6A 1MFZA 1ZH4A 4H08A 5TS3A 2IXAA 4LJ9A 2O7VA 1RM4A 3EXAA 3HFGA 3DL4A 2J32A 4D8YA 5K99A 2R1TA 2POCA 5DWQA 1Q7GA 2F9FA 4MGZR 1D1SA 2ZQYA 1K7FB 2Q4OA 3BDIA 4GEGA 3AMVA 2E0IA 4ES6A 5A4JA 4RS3A 2C5FA 2ZVQX 2XGOA 1KJZA 1M8GA 3H1FA 2P4UA 2BC9A 1MO5A 2C7VA 3UIEA 1RRKA 1WPRA 3B6IA 3N0XA 1ADFA 4UHCA 1PFGA 1KNQA 3F5QA 3GPDG 5FLKA 1N6IA 2Z43A 1T5DX 3G2PA 5SY6A 3WBKA 4QDUA 1K8RA 2X0DA 4WZAB 5C37A 4G4GA 3H5OA 3E7PA 1FU7A 4GOKA 3DO6A 3HR4A 2VF5X 2HL7A 5FV7A 2CP8A 4FSHA 5IDQA 4WCVA 1PZFA 2R6HA 1TTEA 2PJUA 5KQ8A 1S01A 2PO7A 5CNIA 4LX8A 1DS6A 3CF4A 1SU8A 3ZE7A 5CCEA 4CKWB 4QLOA 2BEVA 3HPRA 1X8KA 4AF6A 4JUDX 1P6QA 3MJSA 1OZHA 3U3MA 1OWOA 1QWSA 2AX3A 5KNBH 2IUTA 3LFTA 1FRNA 2Q5LA 3CRMA 4K40A 1YFKA 2YHIB 4K86A 1CBUA 3EZYA 2B8WA 5CDTA 3ZHVA 3BFVA 1RQPA 3RU3A 1UBTS 2ZWOA 4KXUA 1KK0A 1P2FA 3JQ9A 3NUQA 4D0RA 4L4RA 5EJ6A 3UWOA 4M0LA 3SBDA 1Z7WA 3C5VA 4CMGA 4DG8A 1ZI9A 2IVZA 3ANMA 3NPAA 2AC4A 4IVQA 4P3YA 3DMYA 3OECA 5TPZD 2QCUA 1OXXK 3K2LA 4ARZB 3GQBA 3IBTA 3G9UA 3R5TA 1BCSB 3IQXA 3LS2A 1IG0A 1PX0A 4IWYA 1KJ9A 1I1QB 2MSEB 2UUCB 2FW7A 1NQAO 3I1IA 5C35A 1GEGA 3U3XA 5ALXA 1VKRA 4QC2A 2J9FA 4X5OA 1V8FA 4M6WB 4YRJA 1FFBA 1PL0A 1WEKA 2ZJ5A 4YP7A 5AKXA 4YI3A 4DG9A 2QN6A 5H83A 1TUBA 2W4IA 2Q1SA 1Z8HA 1FFDA 3AJEA 3UATA 3STHA 2R2GA 4GL2A 1SA0B 1I7NA 2O2GA 3ZV4A 1PLJA 4KBFA 2X8WA 3ZX5A 5JC8A 3H5AA 5C1BA 5EJIA 2WF8A 3A11A 1XDBA 4KC0A 1IB0A 4V0SA 1IFYA 4CLOB 2X2PA 2PUFA 1QRAA 1BFDA 2XA2A 4YQFA 1SG6A 1UT6A 1Z4QA 1J5EB 2PMDA 3GLIA 1O03A 1YA6A 3ODGA 4D5GA 2A0FA 4NU0A 1H6CA 3ZJTA 5JO9A 2FCRA 2DWPA 4N39A 2O5RA 3A6LA 3PIRA 3PQDA 2CWBA 1ZIYA 2B30A 1NRJB 3QX8A 1G20E 4CF3A 3HJ8A 2JAPA 1WP9A 5IW8A 3RYHB 1T26A 1XKTA 3ZC7B 1RKQA 1US8B 2VHEA 2VHVA 4I8XA 3D5TA 1JB1A 4DV5M 4L2IB 5LM3A 1GGVA 3FLEA 2D3WA 1T6ZA 3OJXA 3UJDA 2PS0A 4GVPA 5JZVA 2B83A 1GUYA 4JB0A 3S8EA 1AHHA 3UJ6A 3DFKA 1ODCA 3H18A 3W5BA 4F86A 4I19A 4F71A 1NPDA 1K6XA 4IIJF 3PXGA 3G82C 3O7WA 2IU0A 1QQAA 1KYVA 4MWCA 2Q2NA 4A6PA 4HN2A 2OD9A 2FUKA 2E5FA 5HW0A 2QJOA 5B3KA 2OORC 3LVFO 4TYYA 2QF7A 4BX3A 2IWRA 2NUBA 2G0AA 4R9NA 1GJTA 1EUCB 4YRMA 1SQFA 3FVQA 4KRGA 5GV8A 3DDCA 1P19A 4HLDA 4MUYA 3VJKA 5HMLA 3B53X 2DGDA 3EZFA 2B78A 2K6GA 4W7SA 4CM1A 4W5OA 2HREA 4BFYA 5JBNA 1Q7TA 2REQB 3UXEA 4LDPA 5EQTA 2O2JA 5LLDA 3GPXA 4GMKA 4I1RA 1GNPA 3TYXA 2J1LA 1Z13A 4DLRA 4XDYA 4IIGA 4FT4A 1YRAA 1NY6A 3A36A 2G77B 4ZZ0A 1OX4B 3Q7RA 5LMNM 2KLBA 4HLUA 3LQQA 1EXWA 2NYAA 1YGPA 2NP7A 4ZT4A 4Z4CA 3LWNA 5D7NA 4IIFA 3FE3A 4Q7EA 1J00A 2PX3A 3OLZA 4NCAA 2W6CX 5DIZA 1QO0A 5KNCA 4JYZA 1PR2A 5DHRA 3T9EA 4Z7QB 3MTAA 4P58A 3C41J 3LX6A 4HG2A 1U7WA 2H5EA 2IYSA 4OK6A 3Q5GA 4GBGA 1EGQA 4YJ3F 3O8LA 2AOVA 1SUDA 2YH2A 1ZMXA 3TOSA 1P4JA 5GJCA 2IUYA 2BHRA 3ZD6A 2IEBA 1MKYA 3WOVA 3GJYA 3F78A 1DBIA 1DRWA 5A4AA 4JGBA 1Y33E 1YVRA 1V71A 2JS7A 4P53A 3UEOA 1WIWA 3ZHYA 4A9AA 2FRDA 5ER9A 2CSXA 3PC2A 2P6RA 4CN9A 2FR0A 5CXQA 2EJTA 1KEVA 5FP0A 1XXLA 4R71A 4WW0A 1OXSC 3ZDFA 2OECA 2ZKLA 2R4JA 1PT5A 1ZITA 3TBHA 4YRRA 1XZEA 1LRJA 1RI3A 3HU3A 3OLCX 2W6OA 1RYZA 2V7QA 2I6SA 1AUAA 2BFMA 4S1TA 4B85A 1H1TA 3QOWA 4TYWA 1DBPA 2FCAA 3K0BA 2YR0A 5I48A 4BVBA 5AVZA 3KXEC 5J4VA 1PJ2A 1GCGA 6AT1A 1EI9A 2Y1GA 5EUMA 3ISTA 4NOLA 2JCXA 2C98A 1JV2B 3T4XA 5DASA 3CKMA 2XVXA 3VPCA 1P7ZA 3I5MA 3NRJA 1M2FA 3AEYA 5LZ5A 1G8KA 1SXJE 4Q3OA 4KWIA 2QZJA 1Y8CA 3G68A 3JQDA 2FPUA 3SWWA 3HJBA 4JUIA 1A8UA 1HLPA 2ONCA 5LQAA 4XXHA 3DWGA 4EHLA 5AM0A 5IAEA 3OPYA 4AZVA 1IY2A 2YINC 2UZ0A 2FXIA 5C5DA 4BFWA 2V3CC 3UOAB 1K86A 5HILA 3II6X 2PV7A 3ESCA 2WJYA 1ZCAA 2EP8A 4MW2A 1FNBA 4JXJA 5T6BA 4QGBA 2RE8A 2EHJA 4EI7A 2VG8A 1TT7A 1P75A 1NBHA 3NOXA 2HA3A 5JFOA 4O5AA 3Q4GA 3DHEA 1B3BA 4DIMA 2AZMA 9LDTA 5K8IA 5H70A 2AZTA 3AVVA 2OFFA 4GHLA 4NC6A 4LJKA 1C9YA 1HE1C 2JJMA 5IWCA 5AKZA 3VGJA 2IQ5A 2YWFA 4UHHA 1F8UA 4AP9A 5AJVB 4B3IA 5EI5A 3AFHA 1A4UA 2XW6A 3HZJA 4FZVA 2NMVA 3RU7A 4ZAVA 4U0JA 5FKJA 3D6VA 3AHIA 1N2XA 4IQFA 1F60A 2GD2A 3VZRA 1PYGA 2XA1A 4O1MA 5GINE 4ZO4A 3WGIA 2B7BA 4G5QA 3JVDA 1QYCA 1PX2A 4HGOA 1O94C 1ZD5A 1CQWA 5CM8B 5A7FA 2JGFA 3DV0B 3VPHA 3CTWB 3IKVA 1SUBA 1DQSA 5J2UA 1GVHA 1QR6A 1Z12A 2HWJA 2VNAA 3EDQA 5DYWA 2GN6A 4PG5A 3A9WA 3HY3A 1ZJWA 1R6TA 2EX0A 2HV8A 4KXXA 4DB2A 2OO5C 2GA9A 3VOTA 5I5GA 1HTBA 4MAMA 2VHCA 1DJNA 3R7WB 4EGFA 3HG7A 3IO3A 1RM5A 5LMCA 2DWCA 1IBKB 3CVWA 3WVNA 4R4JA 3SMVA 1E94E 4MPRA 5AKJA 1HZZA 1SIBE 4EYOA 3ERCA 2Y1CA 3LCMA 1T4GA 4K05A 1E89A 4D9KA 1IY0A 4PY2A 2REBA 2XD9A 5A7HA 1RQGA 3OOJA 1T0JB 2C2OA 4N7RA 3UB3A 1XDSA 2Q1TA 4FWIB 5EFZA 4AZ3A 2ZTCA 1LDYA 4FQ5A 5DM4A 3AUUA 2AN1A 3KQUA 4YROA 5U1PA 4H9GA 4WWHA 3TVTA 4WX2B 4X62B 1QKIA 3HVRA 1V95A 2BYTA 1D2HA 5EJ7A 3K09C 3L8CA 1E63A 1PV1A 4MWOA 4ETWA 5HK9A 1QOZA 3FGZA 1E9VA 4Q00A 1ORVA 1BO6A 4FDLA 2J5RA 2HX1A 1DVRA 2NXCA 5HFNA 4MWTA 1L3CA 5KSZA 2DX7A 4QNRA 3D81A 4JS0A 2ZPTX 1U98A 5B57C 3CPJB 4R1PA 3NV9A 4QJ4A 1FNCA 5EJEA 1YSYA 2CUKA 5KB3A 2AJDA 3QBTA 4EI2A 4R2MA 2XTAA 2C07A 5HEKA 2H1VA 1D0SA 3KD2A 3B2EA 1D2RA 2OY0A 4KX3A 2MSWA 3UKJA 3DZHA 4QVGA 3V8BA 4KUHA 2X8JA 3G0BA 3IR6A 2B1IA 3W1WA 3RAEC 2RHHA 1VRCA 4R3UC 3UHFA 3GLHE 1F9EA 2J59A 2P27A 3SYKA 4QX6A 5BSHA 1IUKA 1WHSB 1PJ4A 1H8EA 4CIZA 2VPQA 2YWEA 3CONA 2ID8A 1PL7A 4C2AA 5KSPA 4XWWA 4RAQA 4YCDA 2ZIXB 4HDOB 3GGJA 3IAM1 4FSDA 2NU7A 3FVRA 2VXOA 4P17A 1YU9A 2W8BA 2Y2VA 5H8WA 2AB0A 3FUVA 2DZDA 3ILSA 1N25A 1XF9A 1FQOA 1J0EA 2PLRA 2Z2JA 3WMWA 2E5WA 4JC4A 5CH8A 2F4VM 4V1CI 3K2QA 1L5WA 2VT3A 1ZGCA 1QUFA 3F3MA 4Q9DA 3T7TA 4NE7A 4RTRA 1OBHA 1A8IA 2MH8A 2ZE8A 4QBIA 1YR1A 1T9HA 2F64A 1V8PA 3C3MA 4JI3B 3D2BA 4QVIA 3U3KA 2QENA 4PE5B 2I54A 2OC9A 3FR8A 1N2IA 2Z5GA 1RI5A 2G9ZA 1YDWA 3IV7A 4WJKB 3WWDA 1FTYA 4U2GA 4BFUA 4QJBA 1RJEA 1G5PA 1OF1A 3QUAA 1JSXA 3EIQA 4AT1A 1JZSA 4EHIA 3BJMA 3VUEA 2HK6A 4OXIA 2IS1A 3UH1A 4QBHA 3LBNA 1JEEA 1QIJA 3KV1A 4J0IA 1Z82A 3EHEA 4IFEA 7MHTA 3BWDD 2HYDA 1KAOA 3GUVA 4E15A 4EJ6A 3W3AD 5CRIA 1G7CA 3Q40A 4I5EA 3NH6A 5CHEA 3O4HA 2ZETA 2H52A 5P8WA 2ZAMA 3VPGA 2J09A 4MGIR 3TTUA 3UTDA 5G1NA 4LMBA 2GRJA 4EHDA 5I3ZA 2NAPA 1CQJA 4JI2B 5AVVA 1SELA 1TRHA 2A0WA 2P6NA 5JYCA 3KJHA 3S2YA 5DLYA 2XLCA 2H9YA 5KVVA 2EAUA 4B4VA 4PN7A 4OEHA 1U0EA 1P2UA 5LP6F 1DC7A 5DDIP 5MN5A 4BQQA 2Q46A 3D5EA 2VDOB 3WJAA 1U2GA 3JQ9C 4BMOB 4TSFD 4R7TA 3ADCA 4OX9B 2H4FA 4ZA2A 1NONA 1J8MF 4FZRA 1EXDA 5JRJA 2VYNA 4O2BB 5K3FB 4Z4EA 1NVWQ 3WJ7A 1IUOA 4HNQA 3ELBA 1HR0B 5IVPA 2UKDA 4ENPA 1P8JA 2B2CA 1VGQA 2X5OA 3FMIA 2CD9A 3QEAZ 3EVCA 4OHRA 4C07A 3NKFA 2QMQA 5KYXB 4WFJA 2AN3A 1YU6A 2A5DA 1V1MA 2Z5VA 2VWGA 5GOZA 2WI8A 1MGOA 2LXEA 4NFSA 4RF0A 3UBTA 4F6RB 1L1EA 1H93A 1UOEA 2C57A 1OHHA 2AD5A 3ORRA 2ZIVB 3QWFA 7GPBA 3WRVA 1RZ3A 1T4MA 2Z9CA 4TMFA 1KZ1A 3UFXA 2IV3A 3EGEA 2JA2A 3FSGD 3GJ3A 4LAFA 3UCFA 2BHSA 3C1AA 1Z8NA 3D4NA 4IICA 2Y6VA 2CMGA 3SX2A 3WBJA 4DM3A 2GJAA 2ILTA 3M8KA 4DR5M 3UV3A 4B3MM 3HO6A 3SLRA 2JLYA 1L1TA 1KK3A 1TM1E 4E2YA 4CWAA 4OO3A 3W68A 4DUPA 4L9RA 3C6ZA 4BNLA 1G0NA 4NZMA 4FC7A 3ZZNA 2KW0A 5JLAA 2C78A 4JJZA 2BDTA 1XDWA 1UBUS 2NXWA 4EM6A 5JDIA 3SIPA 3GFVA 3ZV7A 1F4LA 4W6QA 1XZCA 3U4IA 3FNBA 3BMCA 2CUTA 4UEJA 1ZP6A 1LJLA 2FP4A 3TW0A 4PLWA 3KQWA 1HPLA 1AZTA 4O4LB 3H9EO 3EXIA 4AJIA 2FPRA 2C9OA 5F76A 1FYVA 2JC3A 4DA7A 4RO0A 4NEGA 3PFIA 2PR7A 3EGXB 2P79A 4AY3A 4PHTA 3DQZA 4DLWA 5F77A 4PPYA 3KU1A 3GLKA 2PRSA 2JAXA 4DRYA 1RQRA 1R0ZA 3PG5A 4PRLA 3KOMA 5C5CA 1NI4B 4ZQIA 3HBMA 2GUWA 1XTTA 4FNOA 2W71A 2Y68A 3SC3A 4N18A 2VJMA 2VT6A 4FI3F 1QVWA 4LF6M 1I2ZA 2QP9X 2UYQA 4LF8M 1RE1A 4B8YA 4TKVA 4UE3S 4W8OA 1G3RA 3GPBA 4X65M 3WFJA 1CJMA 3HP4A 4UHDA 2NTEA 5AMXA 1VJGA 4V38A 3S2SA 1PKXA 1NI5A 2ARKA 4Q93A 4JV5B 2JASA 1L7RA 5CB8A 3P5SA 3K1JA 2CJWB 5JAIA 1P0QA 1XD9A 2QXYA 4WY2A 1FZQA 3W5IA 3FHJA 3MT8A 1I2DA 2JGRA 4AIRA 3BS4A 4GR4A 1H05A 3Q98A 3C5HA 1FVXA 1DBSA 3MMSA 3BZUA 3QNUA 3B1YA 3I4LA 4G9EA 4HLUC 3HHZA 2HLDD 3KQKA 2VLBA 5I8PA 1GWNA 4FEEA 3H8JA 2ZLBA 1Y1TA 4D9EA 1JLKA 2XMDA 3K35A 4YRBA 3Q6NA 4G2NA 3M4NA 1GCIA 4FYWA 2C99A 1QTIA 1I7SB 3EMKA 3HSSA 3CLSC 5BOSB 4MUHA 3IUBA 4Z0PA 2FEOA 5K3SA 4RF1A 2Q29A 2AG8A 3OZEA 1VI5A 3D02A 3ABIA 3SDSA 3MPOA 4DT1B 4P08A 2ICAA 3S6JA 1KEUA 1Z5OA 1XK7A 2G09A 3ZDEA 1L7PA 2WVGA 1FU8A 1O94D 2QPTA 1MIOB 1MEEA 1T1IA 1R8JA 1YI8A 1NW8A 1YB7A 3V8MA 3M0EA 1UBRS 2FRDC 4U5QA 1G4AE 4F3TA 3BIFA 3FXAA 1T5BA 3GRPA 4NXNB 2D8AA 2ZM6B 2WV9A 3L18A 3SQOA 2IY8A 3OT1A 2HADA 3S1LA 3LBFA 3U7JA 3H2YA 3HGTA 4C7KA 1XEWY 4C0KA 1GUDA 3HXTA 4DQVA 4C0QC 3WDLA 3WBBA 2YFKA 1C7ZA 1XA0A 4H6WA 1J24A 5IC4A 2QG9A 1R6BX 3FNRA 4MHOA 4RFSB 1NY5A 5HRAA 2MGWA 1B8NA 3I73A 3H9BA 1UWVA 3EQ9A 1OBOA 2OFOA 2PUBA 5F51A 1CRLA 2DKFA 2LP4Y 3IXQA 2P0EA 4XIGS 2OYCA 2H31A 3OE4A 2BFEA 1V11A 2QLTA 4QT0A 4BPBA 2WTNA 5E4FA 2O0MA 5K3AA 2WFLA 1RLTA 3QF7A 4H4DA 4YRSA 5AI6A 3EQZA 1GG5A 4XQGA 1PGPA 3NBXX 4RESA 2XYQA 3ZBPA 4XRGA 2C8VA 2HJHA 4KLNA 1VPWA 3LF1A 2GDJA 1AV7A 4OFZA 1D5WA 3B9RA 1AHNA 4AKSA 1AUOA 1P1HA 3ZZTA 3NC0C 3H9UA 2O8DA 2WWXA 2Z1DA 5ALZA 4CL2A 3GAZA 3GRZA 3LQYA 4M1EA 4ZT2A 3V5NA 4IMPA 2QLBA 1N32B 5JPCA 1ZM4A 1L7MA 2IPLA 3G8BA 3QF4A 1E96A 2V55B 4RF5A 2JBHA 2E87A 3SN6A 3DOOA 4ACAA 2RKWA 2JD2A 2ZTHA 1CT9A 4KCGA 4E33A 3GYGA 4M9RA 2WJJA 4KJZA 1C3OA 3R6WA 5CCBA 1I8TA 4GLLA 1Z0UA 4E22A 3MGBA 6ABPA 2GUGA 2VYCA 1S1MA 4DCTA 3MTBA 5JHGB 2YCLA 4KVAA 2QTVA 3MBOA 1F4IA 2GRUA 4HJXA 3ZQUA 3WS7A 1GNTA 4CM8B 2WQ6A 3IBYA 3BTVA 3W3AA 3JD4A 3RVQA 1NLZA 1ICIA 4N0DA 4P7BA 3CPHA 2RK6A 1T1SA 1X1AA 1JQDA 2UYGA 1LW6E 3O1IC 3MWGA 4IRMA 3ETEA 5EXTA 4IXNA 1SMKA 4Q3CA 3NAZA 5EUQB 3LCVB 1IUNA 4AF8A 3GNQA 1MC5A 3IA7A 5GM2A 1GZ6A 2HIMA 2GBGA 2GBFA 4TV9B 3L25A 2C00A 1O6CA 3ETCA 4OAPA 4MVWA 2VTBB 2PJZA 1IWBB 4G24A 1O95A 3VLFB 3BBLA 4UU0A 2JEOA 3IUPA 3COYA 4AY2A 5A6SB 3M9LA 1M8PA 4Y18A 2J9YB 5L9AA 3RUCA 4JLWA 1NHGA 4JNKA 4QFDA 1B1AA 1UPTA 4G4IA 3DHNA 4KXQA 1H5NA 1BFUA 2UUBM 4JXZA 2WSCF 1L4NA 3M82A 4JI5B 4U0KA 2G0NA 4O2AB 3I09A 1JALA 3DBIA 2AFIE 1LCIA 3ZZMA 5A03A 1LI4A 4KAJA 4HNUA 1BW9A 3C0KA 4EGAA 3T4EA 2ZJOA 3SXUB 3WO1A 4K3VA 3UCXA 3ENVA 4AU1A 3OC0A 1C4KA 1XRQA 5CLGA 1TJNA 4F1IA 2GPSA 3FTCA 4C0WA 3EJ6A 3HGIA 3DBLB 1QS0B 2VEDA 1VPLA 1BRTA 4LK3A 4CV2A 3KKEA 3PUZA 2OILA 1PVOA 4P31A 5LD2C 4FILA 5CUQA 3QKRA 1NV9A 4X44A 4B3TM 1F1JA 1E1QA 3S0JA 4RTQA 4UMDA 3RPEA 1UJMA 4NR0A 3FKSA 2W37A 3O90A 3P52A 1U4OA 3BXHA 5DI3A 4BZPA 2ZR0A 3PE6A 3FA2A 1XMQM 3P9YA 5FO1A 4EHBA 5B2EA 2LVQD 1D2GA 1KKMA 4M1MA 3EVDA 5KVQA 4IRXA 1JDSA 5IKMA 3HFJA 2ES4A 2VZ8A 3K9WA 3V3KA 2ZJ3A 3QKTA 1BE1A 1D7OA 3WX0A 2D13A 2OSBA 4R3WA 1JQAA 1KJNA 1NKVA 3AHHA 3DJYA 3JR5A 3MT7A 2GEBA 3I2KA 3J27B 4QOZC 5JSUA 4DQ0A 3D3QA 4LF7B 2J5YA 5IRCD 4EFMA 5GY7A 4R51A 2B0JA 3N2KB 2OXTA 3SYNA 4C14A 5LR6A 3EFBA 3NASA 2DAPA 3QITA 4IJUA 5I45A 4ZOCA 4UXIA 5EJ5A 3CXRA 2V7TA 2DSNA 5LZ4A 4N6NA 1RKXA 3I52A 2R25B 4I08A 1VRWA 2IHNA 5HKKA 1MG5A 3ESYA 2R79A 3BC1A 2ZSEA 5CA0F 3FPJA 2AG5A 3A4NA 4LOLA 4OP2A 2FE4A 1MAVA 1L1ZA 1VPEA 4BO5A 3ENZA 3RE1A 2Y1EA 3DHYA 3S2GA 1NP6A 3Q8LA 1NOKA 3ZDAA 4Y98A 1GFIA 1RJDA 4QXMA 3EAFA 3AG6A 1IWPB 2P9JA 1M8KA 4UD2A 4CQLB 4ZRNA 3A05A 4I5FA 4TRRA 1Y9ZA 2JWSA 4ZI7F 4B4KA 1AQNA 5IFLA 1DG1G 2CXTA 1PR5A 3NWEA 3L6RA 2OWEA 5E0KB 4KWTA 3C3YA 4DDWA 4UAJA 1C2TA 3ZS9A 1TVKB 3KIPA 3LT0A 1M9NA 2BFCB 3PITA 4L1KA 3E18A 1ZHFA 3PNPA 4EHHA 1DAKA 1LK0A 4DV0M 2G17A 3DBRB 1QHHB 1E9EA 1E1DA 2H54A 5MGBA 2VTBA 2WM3A 3P9ZA 4DR7M 5DM2A 4FHGA 3BRWA 4OJNA 3ES9A 4I9NA 1TA9A 1LQUA 5B1DA 2GBIA 4LYAA 2HCBA 4K6OA 1ZYUA 3BFXA 3I92A 1AZWA 4YJFA 3TLEA 2C5LA 1MAHA 1YTLA 3DV9A 4FE4A 3NMUF 4CKCA 4TN1A 2PTHA 1SBTA 2ECQA 3MOGA 2HF7A 3A1CA 3TCKA 3SHGB 2I1QA 1U2GC 1HDEA 2Q9UA 1QFJA 2OR3A 4DLSA 4KIFA 2C4TA 2R4QA 2IOFA 3V8RA 5ILQA 1TEHA 3AJIB 4OVZA 4ZGWA 1TQHA 2WYWA 3SIWA 4N5MA 2ZUWA 2I3ZA 2VC2B 1P9RA 3FD9A 1FSGA 3Q7SA 4FOPA 2C7OA 4LMRA 4QZVA 1N2CE 2BTQB 1VHLA 1DWOA 3JZFA 4ILEA 1L5ZA 4LHYA 1I2CA 4ZCLA 4WBSA 3V7WA 4JENA 3MD0A 1QTQA 2AXPA 3K3PA 1COWA 1GPMA 2FOLA 1CUDA 3V2IA 3GVCA 4EF5A 4LC0A 2IY9A 1EFVA 5LL6P 4IH9A 4B3SB 2NVWA 4EG3A 5M2QA 1U2SA 2DHYA 2PUDA 4AROA 2FGKA 5ICMA 2FWAA 3S8MA 4NECA 2BGUA 5BW4A 3WNZA 1QO0D 4WY8A 2PUWA 5KNCD 1EDBA 3CLSD 1K97A 1T3ZA 2ZYIA 3SSMA 1EGAA 4Q12A 2Q3MA 1EH5A 2XH9A 1VTKA 4Z49A 1JFFB 4D9HA 1DBWA 3WGTA 2HI0A 3ILKA 1NNSA 3QUCA 4R0MA 2QJFA 2N46A 3K0AB 4F84A 1B0ZA 4WGGA 3H75A 4HPXB 1CEYA 3N7TA 5JDIC 2Y3IA 4QQFA 4P2BA 3N74A 3K70D 1OKSA 1VLQA 2ZGVA 1OYVA 3M4YA 3EVZA 2ZSKA 2BFBA 4ZT3A 1TZMA 1PI3A 1LXCA 3EEQA 3LSYA 5I7AA 1CJBA 4FKMA 2WJ4A 2KW5A 1WGLA 4HN4B 5ESXA 3RS0A 4K9NA 2QVGA 4FHZA 3GPPA 3NYWA 4E6PA 2IWHA 2GFHA 4H0NA 4MYUA 2OM6A 1WGNA 4MGHA 1XK6A 1T9ZA 4OQDA 3VYTB 2V7QD 4LK2A 1JJIA 3U4HA 2VJNA 1GQ2A 2C2HA 1Z0FA 1ZW1A 3FYHA 2M1XA 5AKEA 3KRTA 1QORA 3A6JA 4YAEA 1N7HA 1T91A 4OKIA 4RY2A 2XNJA 3U6EA 2GYWA 3O47A 3PQ2A 1RPAA 1SC4A 4G0UA 4EAAA 1GPBA 1ZJYA 4LV8B 3HB7A 2N47A 3T9BA 1E2LA 1JQLB 4H31A 1TVKA 3WB1A 1CRPA 4Y2JA 4GKJB 3U61B 1C50A 1IVNA 2EP5A 1M0WA 3KV3O 3VX4A 2XITA 4YS6A 4LN1A 1FYDA 3W7AA 2HA4A 3AL3A 4GICA 1X77A 2O2XA 4E2ZA 4DA8A 3H0CA 4KXMA 5HQ3A 3NBYC 5IUKC 1OYYA 4O4IF 1QG2A 3S55A 3GGCA 4ZHQB 2F90A 1MB4A 2NP6A 3UTCA 6GPBA 1C3VA 1QGOA 4TKMA 1V6SA 4LJ5A 1P4SA 3AEKA 1G3IA 2NU9B 2PFSA 4ZEMA 5CGQB 2DXIA 4DYVA 3WZMA 4P0QB 4AYWA 4GRIA 1E2NA 3KOUA 2R8BA 3C8MA 4HC4A 5IAAA 1L5MA 2QUIA 3B6ZA 5CT4A 2PH3A 2VNSA 1E1LA 4JP3A 5FEUA 3NVKI 3E21A 3G9XA 1ULZA 3LLVA 1LPOA 2N0SA 2WRZA 4MR9A 3HUTA 1PNRA 1TO6A 3U6MA 1O0BA 3GN2A 2PS3A 2AQIA 3KR9A 4C01A 4QOFA 4O3MA 2ZYTX 5FUMA 4LRWA 1YBMA 2HU7A 3DFFA 4YDSA 3PFCA 2RH9B 1M54A 2XYGA 5C1PA 3NHLA 1QGUB 4CG2A 3PIDA 1PKEA 1X87A 4A8TA 1AIPA 4RDXA 3PKIA 4ZYTA 5KYUA 1V8OA 2YY6A 5LYJF 1TUIA 2FEMA 3M49A 2HLNA 1E6CA 4IGIA 1AJEA 3V8NA 4NABA 2O1EA 2ZAYA 2P2YA 2K9DA 5T7BA 4NH4A 5KYYA 2AV6A 1TQ4A 4HFRA 4MUKA 2FSPA 4MMXB 1TL7C 1X3SA 4KZPA 1PJSA 3C3PA 1WBJB 3C1UA 4LFAB 4FE7A 2Z4RA 1QCYA 4KE6A 3RABA 5KWSA 1JT9A 4KO1S 4MWEA 2RSLA 2KRKA 4JYBA 2XA9A 3W05A 5JNLA 3H4MA 2JCVA 1P4AA 2AWNA 3T9FA 3AVUA 2IZZA 4M9ZA 1VHTA 3A42A 3VAAA 1P17A 3BX1A 1ZL0A 3AUXA 2CXQA 4MPTA 4DADA 4OSEA 3RWBA 4EG4A 3FYSA 4IMIB 4MLZA 5DGDA 4UKDA 2AQKA 1OPRA 4U2KA 1Q91A 4XGQA 4GMDA 2AC2A 1E3JA 4EB6B 1VI6A 4QYIB 1KEKA 2FPIB 2VYVA 2QMHA 3FVTA 3A6FA 5TC4A 4FWBA 2VDJA 1G5RA 4NZYA 3HBLA 4LQCA 2GO1A 2DNAA 3G49A 1P1KA 3GCXA 4Y0NA 2D1FA 3S44A 1E0JA 1G5IA 4B08A 4OTZA 3WQBA 4M8NE 1M5TA 4JEMA 2JFWA 3PF9A 1ADGA 4ER3A 1VLMA 1KZ4A 2OQVA 2B82A 3DTVB 3W34A 2PZ8A 5H4GA 1MPTA 2LTUA 3CR8A 3AUJB 2FWJA 1NRIA 2OO9A 2I34A 4DMRA 3KBOA 4PG6A 5IT0A 3UXHA 4J03A 4G56A 3WWZA 5E2BA 1L3IA 3E84A 5CAEA 1EUZA 2W5UA 3Q2IA 1WXFA 5JEEA 1MT3A 3RASA 4S1VA 5FNZA 3NJ4A 4DJJA 4QGAA 1MENA 2BT4A 2JVIA 5E3HA 3IUMA 4L0DA 3TX6A 3GFBA 4D2IA 4BJ5A 3PQ6A 1NW9B 2EFCB 2C2ZA 1XXHE 4NV0A 3GFGA 1KYTA 1RZVA 3JYQA 1T2NA 4AUEA 1C4OA 2R48A 3RC1A 1H8ED 1ZXBA 3AHCA 2YW9A 2FSIA 3AC0A 3TLCA 4XWOA 4QTZA 2NU9A 2X58A 1GCUA 4J1SA 3OG9A 4O4HF 4EATA 3RV4A 2M1ZA 4B7HA 1YHNA 2XDYA 3A1VA 1MO4A 3P7MA 4PFSA 1YQQA 3R74A 3U81A 5TGTA 3LFUA 5H5JA 8OHMA 1S1CA 1HNWM 3AI3A 1O95C 3T61A 4QFMA 1D5CA 1PO7A 4ZQCB 3A1WA 1W94A 1FFSA 4ARIA 4N8EA 3IVCA 4WZAA 2EKFA 4TT8A 1HMPA 3P96A 3DHVA 4ND6A 3L0CA 4HOYA 3GLVA 3KAQA 3NU1A 4KE8A 4XYBA 2Y1WA 3C14C 2QRUA 4ZK2A 2H0AA 4V3CA 2GNAA 4O25A 4CKWA 1VG8A 1HKUA 2GN9A 1LQ2A 2ANBA 5BN5B 3FWYA 1T0PA 1BVRA 3HGMA 1V7QA 4GWGA 3K73O 5MHTA 4QOEA 4DB4A 2WU8A 2FPWA 4BNDB 2PH5A 1XZLA 1NVTA 3B85A 4OGWA 2HQBA 1ZKDA 2YHIA 2DHDA 1QAMA 1F2VA 1E0DA 4MVJA 2D2IA 3DULA 2C95A 4DV7B 1LEHA 3MWFA 1JL3A 4F3NA 3A1DA 2Q50A 2OWDA 4MKIA 5GJBA 3LZCA 2HSGA 2FZCA 5FWAA 2HL6A 4OU4A 3PUHA 5JI3E 3KR0A 2HC9A 3X0DA 1CSEE 4POOA 2Y05A 5CIWA 1ZIOA 4O63O 4M8KA 3E61A 2YUIA 1ZGZA 3JD1A 4DQLA 4N0QA 4KOEC 3IUQA 1KI7A 3THRA 5K4GA 5FPYA 5NLLA 3JR3A 3IKJA 5C5IA 1JEDA 2HT6A 2GARA 2ID9A 4Y8VA 4YAIA 4ARZA 1QFYA 1BCSA 1YC2A 3B8EA 3N2ZB 4QTUB 2BR5A 3UMJA 4K6MA 2WILA 4C1BA 1PTJA 2VYND 1B6RA 5TF0A 1PD1A 3F6CA 4EQ6B 5KHOC 1Y6FA 3U7EB 4M6WA 1QHIA 2ZS7A 2XD4A 1NI3A 3AFGA 5IAOA 1RSZA 4URFA 4ERNA 1CZHA 2APLA 3CINA 5LSAA 1IUPA 4LUCA 3KQTA 4Y3UA 3DE1X 3FIJA 4OD0A 3E0XA 4W9NA 2A1TR 3CFYA 4WCDA 4UMVA 1SA0A 3N6RA 3NGLA 4ABYA 4Q7KA 1FDSA 3K0EA 2QNJA 1OHHD 3DOIA 1EMDA 1MW8X 4A0FA 1PR6A 2RHDA 1I5RA 4RTKA 3K2EA 1ZAYA 4MH0E 1SKYE 3F1KA 4DY6A 1IXRC 3PGLA 4CLOA 2J87A 4UM9D 9LDBA 3M9XA 3BSFA 1K5PA 3O94A 1YQEA 2I33A 1PG5A 4DDUA 3Q3VA 1PWZA 1QMPA 1EXVA 1AUQA 1YDGA 3GI1A 4UAUA 4KAXA 5E3IA 1D9ZA 1N1DA 3B1WA 3O38A 2A9VA 3G2MA 2RMKA 3MCZA 4OJTA 5AVQA 5HF5A 2ZAIA 3RYHA 8AT1A 1DKOA 2Q1WA 3NATA 1XE3A 5AVUA 1US8A 3RBAA 1WUTA 1N57A 5CFLA 5J2TB 4L2IA 4BAUA 1JB0F 3L04A 3CVXA 1UEXC 1R9MA 4BNGA 1PGNA 2PU5A 2GVNA 4A4DA 1VKNA 1EVIA 5KINB 1DGGA 3MUNA 5HCNA 1X8LA 4ZO8A 4TUYF 1GTJ1 5K6AC 4C6RA 4Q03A 1LWNA 2F7SA 4DOMA 4OHYA 1YTUA 4N12A 4UNPA 4IHAA 2WAXA 5H7XA 4PANA 1PUXA 3L8MA 4J3NA 4UVHA 4JT8A 3TDMA 5IXSA 3P9KA 1EUCA 3AF6A 2J0UB 4JX8A 3D0OA 3OOSA 1B76A 4EOGA 3TGPA 3T4UA 2FUEA 3T9CA 4ZKEA 1NT4A 1M66A 1JKXA 3O8OB 1BEUB 1NXTA 4RNAA 3I5YA 4FNAA 2UXBM 3N86A 1XNJA 2PWPA 2OB1A 4E2XA 4AMBA 2CXXA 5E95A 1VJTA 4ZDJA 4C76A 4R1SA 3DLHA 5CDFE 1G8JA 4D8VA 1HFWA 2REQA 2EW8A 2O59A 1EB8A 3CWCA 2VUTA 1RAHA 1SWWA 1GCOA 1PNQA 2HNAA 1R2QA 3USCS 3EBOA 2FN3A 5CJJA 3WB0A 1OX4A 1T0BA 1X2EA 3T0IA 3QXXA 5FH9A 4B1FA 3JWPA 2GKGA 1KAGA 3G9QA 3GVHA 4L51A 3ZUGA 2MSNA 3DCNA 2SKDA 4EYGA 4TTPA 3TO5A 1TADA 3AW9A 1NJ5A 2PMBA 3B51X 3DFIA 1QK5A 2BEUB 4OHUA 4DSOA 1V96A 4Y2GA 4O29A 2X4IA 4XGKA 4DV2M 4ZVUA 1P62B 3C98A 2JFXA 3LYUA