2H1RA

Crystal structure of a dimethyladenosine transferase from plasmodium falciparum
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
271
Chain Sequence
HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWCTLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dimethyladenosine transferase, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 94
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.480 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2h1rA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h1rA01
1VPTA 3FZGA 5DRYA 4A6EA 3B3JA 3HA3A 1EG2A 2PBFA 4FSDA 3HVHA 5FHQA 2JG3A 5FHRA 4PYNA 5LQCA 5E9WA 1IXKA 4CKBA 5DM1A 3IHTA 4QDJA 5BW4A 5JUWA 5FQOA 2ZULA 3IEIA 3KQTA 5K01A 5LSAA 4E2XA 1BHJA 4QQNA 5DLYA 1YFLA 2JJQA 2NXEA 3E8SA 2BZGA 4C4AA 1RI3A 3CVOA 2O07A 1N7IA 3GRZA 4YV1A 5K0GA 3QOWA 1DUSA 2GH1A 2XVAA 4DA4A 1BOOA 3CC8A 1RJDA 5LQAA 3ER8A 3AY0A 3RW9A 5FADA 5EZSA 1QAQA 1XDSA 3ELDA 3DUWA 4V0QA 3C3YA 1L3IA 4PGHA 4FS8A 1JSXA 3H2BA 3EVFA 3UBTA 3CJQA 2AOWA 4U7PB 5LQRA 1D2GA 2IDKA 4E2WA 5K03A 5EQJB 4OX9Y 4E31A 2ZIEA 1NE2A 3JWIA 2YTZA 3EVZA 4OA5A 1NW6A 3CCFA 3DTNA 1QYRA 4PYOA 4RVDA 4PNEA 3LECA 3R24A 2IGTA 3UJ6A 3NWBA 5EG5A 4AZWA 5DTQA 5LQJA 2FPOA 3LKZA 3EEOA 4OBWA 1M6YA 2YR0A 4GOMD 1YFJA 3DLIA 4OQDA 3A27A 4HTFA 2IPXA 3G7UA 2KW5A 4RSRA 3SVZA 4RTOA 2IBSA 1WXXA 5D1HA 3G5LA 5FUBA 4YV2A 3LPMA 2UZ4A 3R9XB 2GS9A 2ADMA 3SM3A 4UOEA 3FPHA 4G56A 2PWYA 3LDGA 3UJ9A 2GPYA 3HCBA 4DCGA 3FRHA 2AN3A 4PYMA 4H0NA 1XTPA 3BWCA 3HEMA 4AZSA 5DX0A 2ZW9A 2QY6A 2B2CA 2JHPA 3E05A 5ICCA 3KR9A 4GUAA 4XUDA 5FCDA 4C06A 4YV0A 2FRXA 2YVLA 5EGSA 5K0CA 1G55A 2P3LA 2HWKA 3FTDA 2DPMA 3BKXA 5DM2A 2WK1A 1EIZA 4KW7A 5G02A 3UA3A 3A25A 2JH8A 2B25A 4X41A 4ZTBA 5C0OE 1G38A 5EMKA 4X60A 2XYVA 3CBGA 1ZGJA 3BZBA 4PYQA 2VP3A 3L8DA 5CVEA 3BGVA 3K0BA 4CWAA 2PX2A 2OB2A 3HCCA 3FUVA 4X61A 2ZLBA 3P9KA 1SG9A 4O29A 1Y8CA 3OZTA 1JTFA 3A4TA 3KKZA 2FCAA 4HTFB 3SR4A 4RTLA 3X0DA 5CCXA 2PSSA 4LWOA 3EGIA 5HILA 2XVMA 3LDFA 4HGZA 4V0RA 4E30A 4E70A 4OBXA 3ER9A 3EEYA 2PT6A 1KPIA 3HCFA 2IIPA 3CKKA 3SSNA 3SSMA 3BWYA 2VDVE 3GGDA 5E8RA 1P1CA 1O9HA 2FK7A 3I9FA 4QQKA 1SQFA 3EMBA 2OO3A 3IYLW 4YMHA 4BP1A 3E23A 3G2OA 4YUZA 1P39A 3DXZA 2IH5A 2O06A 2AOUA 5BP7A 5EMJA 2ZIGA 4BLWA 1RI4A 3B89A 4E2YA 1YB2A 2AN4A 2OB1A 4POOA 3C3PA 5D1NA 2PWPA 3EVDA 2QYOA 2ZTHA 5FQNA 1X1CA 4Y2HA 4P7FA 3MQ2A 3PX3A 2QM3A 2XBMA 3BXOA 5K0EA 1UFKA 2ZFUA 2WA2A 3DULA 5EHGA 5GIPE 4RX1A 2AN5A 1T43A 3MGGA 3V8VA 3FTEA 1TW3A 4R6WA 3ME5A 4RVFA 5EEHA 5F2KA 10MHA 4M7RA 2NXCA 4BY9E 2AS0A 3MTEA 1EJ0A 3OFJA 1Z3CA 5K0NA 2OKCA 3LCUA 5E1MA 3ELUA 3G88A 4QVKA 5HFJA 2P1DA 3OCJA 2XYQA 5DTRA 1SKMA 1AF7A 2ZSUA 3Q87B 2EFJA 3S68A 2R3SA 3O4FA 4ER3A 4RTPA 4F85A 1MHTA 2IH4A 3Q7EA 4CTJA 5K0JA 1DL5A 1PJZA 3HP7A 3LHDA 1VL5A 1R18A 5KQRA 4LG1A 2V74B 3REOA 3MB5A 4QTTB 2AOUB 1JG2A 1R8YA 1VIDA 5K0LA 5DT2A 1QAMA 3PB3A 5DTMA 5ICFA 3V97A 1KP9A 4CKCA 3LSTA 3KPVA 4RTSA 2NXNA 1I9GA 2PXCA 1G60A 2P3OA 2P3QA 2PX5A 3AJDA 3KQSA 3KQOA 4MHTA 2O57A 5HZMA 3DMHA 3UJAA 3K6RA 3NWEA 4OA8A 1XCLA 5K0BA 3UFBA 2P40A 2OBFA 1O54A 5DXAA 4DF3A 1XXLA 1VQ1A 2CMHA 4DQ0A 3KQYA 3MTIA 4E32A 5DWQA 4AZVA 4FP9A 2C7PA 2ZZMA 1AQIA 3GXOA 4BLUA 5GINE 4GF5A 2Y1XA 4E33A 2B3TA 1JQDA 2PVCA 4OQEA 2CWWA 1WG8A 4NECA 5E2AA 3VC2A 5EIWA 1FBNA 5IKMA 5JR3A 3FTFA 2NP7A 4C05A 3FUUA 5FULA 3JWGA 1D2HA 1IM8A 3M6XA 1OR8A 3OZRA 3TM5A 3LX6A 3G2QA 2GA9A 4HGYA 3A26A 2ZWVA 3T7RA 5EC8A 1TW2A 2IBTA 5CCBA 3M70A 3OU6A 5CUQA 2UYCA 5KYGA 1NKVA 1SVUA 4XUEA 2JHAA 3TKAA 1XDUA 3NJRA 3TMAA 4RTMA 2DULA 1NW5A 3HVJA 3BWMA 3FRIA 1JSZA 2PJDA 3UJCA 4B17A 2WA1A 4YUXA 1JG4A 1WXWA 1ZGAA 2ZWAA 4DM3A 3R3HA 3TRKA 2GLUA 3G2MA 3GRVA 3SMQA 9MHTA 3ELYA 2OXTA 2ONZA 2PX4A 3NTVA 3SXJA 2OYRA 2BR3A 4FSXA 5DRTA 5GM1A 4PWYA 3ERCA 1WS6A 3I58A 4YUYA 5EMMA 5LQNA 4HH4A 5EPEA 5F2NA 3DXXA 2YUIA 2OPBA 3PT9A 4R05A 3AXSA 3HTXA 4RV9A 2E5WA 1L1EA 3EVCA 2VS1A 3IV6A 5EVJA 3NVKI 1HNNA 4KWCA 3VSEA 4EVIA 5FA5A 2O05A 5P8WA 3NMUF 3FUTA 1NW7A 3I64A 3LCVB 1TPYA 5DM0A 3RIEA 5E1OA 4FT2A 2PT9A 1NW8A 2EJTA 5DX8A 3FUWA 2I6GA 1MJFA 4M37A 1KR5A 4XUCA 5CM2Z 2I9KA 3P2IA 3TR6A 3A7EA 1WZNA 5FWAA 5FWDA 3NDJA 1JG1A 1KHHA 3F4KA 3GCZA 3M6UA 4ER0A 3P8ZA 4EQZA 1FP1D 2EJUA 3KQWA 1VLMA 1VP3A 3HCEA 1O9GA 4PCLA 2ZVJA 1RJFA 4DKJA 2PXXA 3EMDA 3HA7A 3HCDA 5CVVA 2ERCA 3LBYA 3MCZA 4IV8A 4PYKA 2N47A 2YQZA 4QDKA 5GOZA 3GRRA 4AZTA 1AQJA 4ER5A 4M36A 5CVJA 5DSXA 3TLJA 4F84A 1P1BA 2Z6AA 1RJEA 5K05A 5E1DA 3AXTA 3KQVA 3U81A 3G89A 3GDHA 3LGAA 1INLA 3EVBA 3UJ7A 3OU7A 4EKGA 2BR4A 4PINA 1X1DA 5DX1A 3M33A 4K6MA 3T0IA 4KRGA 4HSGA 3I5UA 4PGGA 2HR1A 5GWXA 5EOVA 4EK9A 1Q0SA 3TFWA 2QRVA 3EGVA 2HV9A 4C07A 3NDIA 5E9JA 2VZ9A 1U2ZA 3R6TA 1R74A 1SUSA 3D2LA 4QVGA 5DPMA 3TOSA 1PRYA 2H11A 5EZQA 3PLAE 3TQSA 5CD1A 1M0EA 4CKEA 4DCMA 1JTEA 4GEKA 3G8AA 3I53A 1FP2A 2Z6QA 2VDWA 5EHIA 5T64A 2CKDA 2P8JA 1G8AA 1RI1A 3G8BA 4AX8A 4RTKA 4C03A 1EJ6A 2IH2A 1JQ3A 3UJ8A 4ER6A 3VYWA 4QTUB 1KYWA 3PFHA 4R6XA 1Q0TA 1JR4A 5FA8A 2PGXA 4R8RA 3P97A 5HOQA 1WY7A 2R6ZA 3B5IA 3DH0A 2GB4A 1YZHA 2LD4A 2AOXA 1B42A 4PYIA 4AUKA 2YXDA 3BUSA 5E9QA 1X19A 2AZTA 2I62A 3TPZA 3NW9A 4PIMA 2CL5A 1F3LA 2ZIFA 4ER7A 2G71A 5K09A 2GAFA 4P7JA 2QRVB 1RI2A 3SGLA 3EVEA 1L3BA 2ZZNA 5KS2A 4RTRA 2XYRA 3B3FA 3T7SA 5DM4A 1F38A 4CXMA 3OPNA 4GOND 7MHTA 1L9KA 5K8VA 1BKYA 5DXJA 3P9NA 1R00A 4PYLA 2CMGA 1NT2A 4ISCA 1KYZA 1KIAA 5T67A 1EQAA 1NW3A 2BM9A 4GBED 1I4WA 2Y1WA 2PV0A 2FHPA 4GOLD 2UYQA 1AV6A 3P2KA 4ATNA 4YUVA 3GO4A 2UYHA 2IFTA 3THRA 4YMGA 1R6AA 3G5TA 3HM2A 3NVMB 4KDCA 4LECA 2JH9A 4P7KA 3TKYA 2I7CA 4F86A 8MHTA 3SX0A 4C08A 2YX1A 1SUIA 3FYCA 2H00A 3BKWA 1H1DA 2PX8A 4PIPA 1FJXA 1D2CA 1RJGA 3KHKA 4Y30A 3CJTA 4MWZA 3BWBA 3MCTA 1SQGA 3GIWA 4BLVA 3EVAA 2IDJA 2FK8A 4HG2A 2BM8A 4P7GA 4PYJA 1JG3A 1G6Q1 5ERGB 1FPQA 1UIRA 2ZCJA 3LL7A 3LDUA 1P91A 5GP1A 5ICGA 4RWZA 4GQBA 5MHTA 3DMGA 5LR6A 3MHTA 3THSA 3UJDA 4HC4A 5IH3A 3C6KA 3UWPA 3FPEA 1VBFA 3AWIA 2NYUA 4YUWA 4MTLA 3UJBA 5EEGA 5KQSA 4FR0A 1X1BA 3HVIA 3LBFA 3OZSA 3FPJA 3HCAA 2EG5A 3OE5A 3MERA 3DXYA 2AVNA 4RTNA 4Z2YA 3JWHA 1ZHFA 1VP9A 3DMFA 3FPFA 3GNLA 4L7VA 2C7QA 4FZVA 1BC5A 1V39A 1XCJA 3M6VA 3HA5A 2P35A 2ZBPA 1NV8A 2P7IA 4FT4A 1I1NA 1ORHA 1XJ5A 3GRYA 2PY6A 4DZRA 5GIOE 2AVDA 4QPNA 3EGEA 2ZZKA 2FYTA 3KQPA 1R8XA 4KVZA 4RTJA 2B9EA 2HTEA 3B3GA 3DR5A 3MAGA 2HNKA 4PCAA 3SSOA 4C04A 1JQEA 3R0QA 5LQKA 2NP6A 1QANA 2ESRA 3HNRA 2AR0A 3QOXA 4FGZA 4KIFA 4BP3A 3EPPA 2B78A 3FTCA 2H1RA 3A7DA 2HMYB 2ORED 4U7TB 5U4XA 3O31A 1QAOA 3GJYA 1IY9A 5BXYA 3EVGA 5HIJA 1EAMA 3O7WA 4IKPA 3KR1A 3VC1A 3RODA 4DMGA 3BGIA 3CGGA 4IWNA 3UA4A 3WSTA 4GC5A 5M5BA 5FTWA 5BW5A 3P9CA 2K4MA 4RVHA 5HIMA 2QE6A 5GM2A 2Q41A 1NV9A 2OZVA 3KPUA 5HIKA 2P41A 5ICEA 5CIYA 1XDZA 2V7EA 3UZUA 3BGDA 4GOOD 3M6WA 2A14A 2G70A 3LKDA 5EMLA 1ZKDA 2AOVA 3KR0A 4QPPA 5HIIA 4KDRA 2BR5A 1G8SA 1HMYA 2EX4A 1ZG3A 5F2OA 2ZBRA 3DLCA 1DCTA 4JXJA 5E8JA 4M38A 4X63A 3KQQA 3TM4A 5EIFA 1YF3A 3JWJA 3PX2A 2ONYA 4R8SA 4WVLA 5LQUA 3GWZA 5B1SA 3OU2A 3FYDA 3PS9A 3OFKA 4RVGA 3FUXA 3KQMA 2AOTA 1XVAA 3LCCA 3KU1A 5EKXA 4A6DA 4EKIA 2UYOA 5CVDA 3G2PA 5E2BA 4EMSA 4XCXA 4CTKA 4E2ZA 1YZ3A 2BH2A 3DOUA 2PXAA 2ZBQA 2YXLA 2YXEA 3GRUA 2G72A 4RTQA 3PTAA 1YUBA 1ZQ9A 3KPYA 1ORIA 5HEKA 1QZZA 5DSTA 2NNWB 3ORHA 4RYLA 3M4XA 5C9ZA 1M6EX 4MQ4A 1KXZA 1KPGA 3ELWA 3B7PA 1L3CA 4PONA 3PVCA 2C7RA 2O0LA 3FPGA 4HRAA 2OY0A 4IV0A 3PFGA 4WXHA 3ANXA 1KPHA 5E1BA 2PLWA 3KR2A 3HVKA 3ID6C 5C1IA 3BT7A 3DP7A 3C0KA 1UWVA 1NBHA 1RI5A 1X1AA 3QV2A 1N2XA 4GC9A 1VE3A 2G8NA 5T6BA 5CVUA 2VDUE 3P9IA 5KVAA 2PKWA 3KPWA 4KIGA 3GU3A 2Z6UA 3C6MA 3P71T 3P2EA 4LWPA 2NXJA 4X1OA 3CJRA 4P58A 5K0FA 4MIKA 5H02A 2JHCA 2AOTB 3T7TA 2P7HA 5EKUA 3OE4A 1NBIA 3E7PA 1N7JA 2C7OA 2F8LA 2G1PA 2IP2A 3KPJA
chains in the Genus database with same CATH superfamily
3RT1A 1BVSA 2XB6A 3IUMA 3N2KB 2OK8A 1UKCA 4ZQEA 3DJFA 3TLGB 4DBZA 2QJTA 1BKSB 5HTOA 4PW0A 1S2NA 1P6UA 5CYOA 1D1TA 1W0KD 4O0LA 4ZARA 5JS2A 1KS2A 5AICA 2EW1A 1I7SB 4HFJA 3PQ5A 4TYYA 1E0JA 4FS8A 2H1SA 3SX2A 1W87A 3EZ6A 4E4TA 3PGJA 2CXOA 3S4YA 4GOMD 4B6RA 2J8ZA 1TVKB 4ZOLB 4R1TA 2ADMA 2GYYA 2JC3A 2BFOA 4EJSC 2DWNA 1XTPA 3FVWA 4PN7A 3FETA 3AESA 3GEDA 1QZUA 3D1JA 1P2VA 4X41A 1UBOS 1ZGJA 4JN6B 5CVEA 3H5RA 4QUGA 4JSTA 4NR0A 2RG1A 2PSSA 4Z7OB 4UNIA 1VMEA 3SSNA 1P1CA 1E2NA 2FPGA 1UIMA 3L01A 2AN4A 3GCWA 4I6JA 3PFFA 1VJRA 4RH0A 3NFRA 3V1LA 4R6WA 3W9YA 3QA3E 2JAUA 1AXEA 2PS9A 2WSBA 2J09A 3SS8A 4IXNA 3UAVA 3D7RA 4DPMA 2K87A 7MDHA 1C4OA 4TTQA 1G8MA 2R6DA 2ENWA 2O2XA 4JJ7A 1DFIA 3OOHA 1LS1A 2EJBA 3I9V1 5FUVA 4JQZA 1C4XA 4MHTA 5AI9A 3F5QA 3UMYA 5HPYB 4LEIA 1CV2A 4CDGA 5B12A 2R68A 2GRAA 1NQUA 1EESA 1TUBA 4GF5A 2H1IA 3IBYA 4D3XA 4OQEA 3ICPA 4J1QA 3M4JA 3HNPA 1IC6A 2A5LA 1FK8A 3RJ5A 3UANA 3K4HA 3WLHA 2G07A 3IELA 4MS4B 2B4AA 1WVIA 4I9NA 2R6FA 3HVJA 4ABTA 1QQ6A 1JPNA 4YUXA 1R10A 3BTUA 5FLEX 1WS6A 3RFUA 4RV9A 2DQKA 1SWVA 2IPMA 5E4JA 4LQ4A 4JYAB 1HBJA 3KC2A 1E4OA 2G80A 1E96A 1FU8A 4IBGA 3UN1A 1TJ3A 5EPOA 1J09A 1ZRHA 2WAAA 1WR8A 1RQLA 3AXTA 4PQGA 2JGEA 2R4JA 4YHBA 4X62M 3LI2A 2A3RA 3LQQA 4MCHA 3CG0A 2D54A 3N0XA 3MWYW 3HQ4O 4BQNA 4MLPA 1E2UA 1DV2A 5JSZA 2Z98A 4DREA 3FHTA 4FGWA 2W8BB 2DZLA 4GM4A 3CZ4A 3A4VA 3N0TA 5ECDA 3T15A 1N5IA 1QVZA 4ZTUB 2GEUA 3IEMA 5LU9A 1BXKA 3A28A 3RK1A 3SX0A 3KSZO 2CLHB 1ZM4A 2O2EA 4L5IA 3ZQUA 1VJ1A 3LDUA 5LBTA 3STHA 1V5WA 1Q3CA 2V6FA 4IDEA 2ZJ2A 1S2GA 2Z3VA 3K32A 4TYQA 1LS6A 1BA2A 3AI3A 4DSNA 3DMFA 1FP7A 3Q5DA 4ITUA 5ALIA 2P7IA 3GPBA 4DN6A 3A1SA 3IP8A 1V6CA 4HEQA 5LLDA 2EP5A 5L3ZA 1ZD1A 3I2KA 4EY3A 3THXB 3K0CC 1KI6A 1EDBA 1NVMB 4E1VA 5IBCA 2K4MA 1ZMUA 3CMMA 2WF7A 1OBHA 4HAOA 2PR2A 4LNHA 3ZS9A 4B3GA 4N18A 3L7JA 2ZB3A 5K8TA 2ZUDA 1NT4A 4ZO4A 2YIVX 4YHHB 1RWBA 2X14A 4ENVA 5CBPB 2E6KA 1UPAA 3W3AH 3WA6A 2PLWA 4P3PA 4S05A 3UVEA 3TIVA 1CR1A 2DT8A 3VK8A 4HDMB 3KHUA 5ESRA 2VH2A 3S70A 1YU6A 2JJYA 3PENA 4OHYA 4NMWA 2J0SA 4Z3OA 3B5JA 3B3JA 1XTSA 3G2KA 3JQ8A 4P22A 1Y6GA 1P29A 1VSQA 1IXZA 1GADO 3R8XA 2QL6A 3ENNA 1RJ9B 3DFIA 2H4JA 3OJOA 3KTDA 1DQNA 2QTBA 4EUSA 5LQRA 3FSRA 4LVCA 1GRQA 4AZWA 5KQPA 4CM6A 5F78A 3PWSA 1JDBB 3G5LA 1Q1ZA 2P6MA 3PRHA 4G5OA 1U6KA 1H6UA 1R6BX 2I2BA 1GNRA 2EKBA 1DIAA 4O4HB 2Y1DA 3N39C 2JH8A 1AN9A 3VX4A 3CVXA 1AUPA 4U2DA 5EIXA 4HAIA 2A5YB 3KX2A 2C2MA 1EGAA 2VBFA 5K4AA 4V0RA 4YIHA 1U8TA 3NHUA 4MI9A 3OHSX 1SQFA 4HDRB 4MP6A 2G6BA 2JRLA 2RKOA 3TLMA 2HPVA 1Q3KA 1KNXA 5DBFA 1P9NA 2I5PO 1ZIOA 2HK6A 3WAKA 5HKBA 1W19A 2JY7A 2DSTA 1JH9A 5PGMA 3WKBA 2D2EA 2YRXA 2IL1A 3TLYA 3K2IA 1R4NA 1I6LA 1LSUA 3H13A 4GKKB 3TAXA 2H4ZA 4BTLA 4EI2A 3ABSB 4C4ZA 3I8SA 3INGA 1JB0F 1EDZA 2NADA 1X1EA 2P67A 1BDJA 3J7TA 1EHYA 4WBXC 4LXUA 4ZAXA 1PS9A 1R0RE 1Z26A 3MK31 3OP4A 3THYB 4CF6A 1A9ZA 5BOVA 1S8NA 5FI3A 1SA0B 1NSTA 3NH9A 3TRKA 4FILA 3ZS8A 3MPOA 5FI1B 2QQ8A 3DMRA 2AXEA 3ASYA 2I29A 3QTBA 1IAVA 4CTMA 3JD4A 4P7BA 5FOQA 2X40A 2BKVA 4PY2A 4MUHA 4MW2A 1IVSA 4M7PA 3C6ZA 1JG6A 2QRKA 5LZ5A 1MF7A 1YWGO 3W6OA 2XUIA 1VHWA 1QJCA 3SHWA 5CVJA 1FLVA 3B12A 2QD1A 3ZVLA 4NENA 2JGRA 4RULA 5CNIA 1Q0UA 4KVGA 2RGBA 4PZYA 5FWXA 1WIVA 1BCRA 3H9UA 2HPAA 3W05A 5HCNA 1EUDB 1WXHA 3K9GA 1O96B 3QPAA 5D7NA 4MYUA 3SKXA 3UK0A 1CY7A 2DR2A 3GEEA 3ZXYA 3KAJA 2P30A 4JJAA 2ON6A 1PGPA 2XQKA 4C21A 2H1OA 5FOWA 1MTOA 4GBED 4WCFC 1STOA 3GX1A 4FBLA 1HF3A 3ZGVA 3WGOA 1I3MA 4ZALA 3VR6D 2FOXA 3WKCA 2PUCA 4J0KA 3ZDFA 1YASA 2K9DA 1NP3A 2JLWA 2BT4A 2BW0A 5L4LA 4HRXA 2GWHA 3THSA 3GJ8A 1E79D 1MHPA 4O08A 4BO5A 4V0SA 1Z28A 1Q7BA 3IUNA 4YY3M 2PL1A 3N6VA 1SVSA 3RKSA 3D7LA 1Q0RA 1U90A 3FSGA 3ULKA 1IY9A 1VDMA 3EXAA 4IKPA 3MBKA 3SD7A 1G59A 5K3EA 5GTDA 1ZKDA 4DUZM 1ZVQA 3C7CB 5ECWA 4MOWA 4B7ZA 3HKPA 3OOSA 1CFJA 1ZJWA 4R0VA 4M38A 3HXMA 3IMGA 3HXPA 3SFTA 3BQNB 2JI9A 2BCEA 4X00A 5G2OA 2ZJ0A 3UKOA 2NO6A 2VF7A 4ZCIA 4EUFA 4LZPA 1TYAE 4L3VA 1QZZA 3RV3A 4Y2PA 3S2EA 5LXTF 4BNZA 2G8LA 4Z4CA 3IUYA 1Z5OA 1DGGA 5LP1A 3VMMA 1USWA 1ID8A 3F97A 4K0RA 4WY2A 2FLWA 3SEFA 2VQFM 2JLVA 3CEPB 4E5SA 3TL6A 4EPXA 3D4PA 1QIEA 3NOQA 1Z2AA 5LYJF 2I22A 3AY0A 2WT4A 4GYWA 2J31A 5BSFA 3NOOA 2FMFA 2IKQA 4PPFA 1A0OA 5CX1A 1X37A 1K5HA 4V0KA 5DHUA 3SVZA 1HXHA 1QV6A 1WXXA 5FUBA 3ZCSA 1EFPA 3SM3A 1L4EA 5DXFA 2DLNA 2EDCA 1FYDA 4NJMA 1R8QA 2PX0A 1U81A 1GAJA 2PRYA 3FCEA 4FS3A 1XX6A 2XADA 1XCPA 3ZDQA 2FAXA 4JI5B 2NVOA 2VAPA 4OYLA 5F23A 1V48A 3O2NA 1M1NA 5C1OA 5FBWB 1IXYA 3TQCA 1E1QA 3IAM6 5JC8A 1D4OA 2IYRA 3C4QA 4NBLA 2Q6LA 4QVKA 2G0TA 1SC4A 1NYRA 2EQ5A 4G41A 1N33B 5DHPA 2G1AA 2F4VM 3SK0A 3HJCA 4EARA 3K1TA 1DQZA 2HMAA 1A95A 3UFBA 2V0CA 3UT5A 1IPFA 4KRYA 3NXSA 4MVJD 4RZIA 2WTAA 4L5BA 3FTFA 1IJEA 3GFBA 1NBME 3U6MA 4H1HA 3L8FA 3I32A 4DDUA 4JR2A 1RPZA 1YKFA 5JHHB 3LXUX 2F3QA 1PL8A 5H81A 3PDIA 2PD4A 2E6UX 2JA1A 5I45A 4UM8B 3R2JA 4FD2A 1OHHA 3WYFA 1Y48E 1BEUB 4CQLB 2ZAOA 4R9RA 4RU1A 4OFBA 4ZT4A 4FT2A 3IQWA 4KB5A 3TQQA 3AR2A 4XD2A 3T61A 5F7JA 3PIDA 4TTAA 5AKGA 2AXPA 4E5DA 4XSHA 4I55B 4DV0B 4JB8A 2BR4A 3COPA 1C0KA 4L5JA 1NPDA 5CMLA 3U19A 4QICA 3TOSA 2H11A 3TEJA 2XMQA 4TS1A 2EKDA 3GBVA 3I92A 4F9EA 3D7SA 1V45E 2EO2A 1YZHA 3ZQ6A 2DMRA 3FR7A 3QZUA 4FNAA 1NDQA 5IG2A 3JTMA 1YJBA 1SUDA 5K09A 1NG1A 1YB1A 3DS8A 3WLAA 7MHTA 1LF0A 3R3JA 5DISB 5AJYA 4TL6A 4DA0A 2VT7A 3D8RA 2JLQA 3ROZA 2WSYB 1AMUA 8ABPA 5DZSA 1JTVA 1NJ8A 1U2SA 1T10A 1Q57A 3SQXA 4WUVA 3MMXA 1V5FA 1GQRA 2PL9A 4KDFA 5L7YA 4G5YA 3IIMA 2R60A 1M33A 4YXWA 3AFGA 2SBTA 1GTMA 4ZJYA 4R81A 3ZHOA 4XGKA 5CFLA 1EK6A 4DZRA 3M8KA 1CRLA 2ECOA 1CQIB 3UHFA 4JI6B 2LE0A 2NT4A 1G0NA 3EPPA 3KZXA 4D1YA 5IEBA 1WKBA 1TAGA 5H59A 1UM9B 2VTKA 4GC5A 3WYAA 3FE3A 2GCOB 3UICA 5JS1A 2YIJA 1O95C 2Q5FA 2QMOA 5AHOA 1I4LD 5CB4A 2ZBQA 1V3TA 1I33A 2R18A 3X44A 1L3CA 4O3FA 5LFAA 3HJSA 3L0OA 1B0UA 5KTNA 5A0VA 1RYBA 2QR5A 4ITQA 4CYMA 5AVKA 1RKVA 4R9SA 1OKKD 1N7HA 5C1BA 4DLXA 1OU4A 2NTEA 2O5RA 3V1KA 2JCYA 1WEHA 4G5RA 4RESA 2JFQA 4HADA 4C3VA 4PLPA 3SBOA 2DPXA 3CC8A 1REQB 5D86A 2QMEA 4GX1A 1PDWA 3P4XA 1M2FA 1M2GA 4URVR 1OV4A 3THWA 5KYXA 4PNEA 1IU9A 3WR5A 3F78A 1CQWA 1P5RA 3BB3A 4NDNE 3QUTA 2BBSA 1FX0B 1EB9A 2CJPA 5FPQA 2QRQA 3PLRA 1EX1A 5EMKA 1ZN2A 5KMGB 2ZLBA 4OHKA 2XODA 1WPXA 2XVMA 3ESYA 3EEYA 5C7IO 1RC0A 3F6RA 4NYIQ 4IZOA 2FZLA 1LD3A 4EKYA 1JDZA 5DO9A 4GQIA 3Q3HA 5DHFA 1Z5CA 1TAHA 2Z8XA 3EXIB 2I4LA 5LYJA 4C88A 4BE7B 4QXRA 2VK1A 3FVTA 4PBTA 2PRSA 3WWPA 4CMCA 2I6UA 1X92A 2PKCA 5L4NA 4FYHA 1GGJA 1G6HA 5FBVB 3WY9A 1SU6A 1QAMA 4N0QA 3TX2A 3AJDA 2PX5A 3FOWA 1C3LA 1U1IA 4OA8A 4BU1A 3SAUA 4UC0A 2Q0QA 4F5ZA 2ZJBA 1UUFA 3KZOA 5KJEA 1EGHA 3ZV4A 3I45A 2NOAA 4PZDA 3G23A 4J49A 2QG6A 4MGIR 3HJRA 4WI1A 4ZVLA 1LDNA 2E2WA 4XK8F 5HGXA 3R4VA 1T4MA 2V9PA 5AUPB 3ERCA 4J7XA 3ZKWA 1O7JA 3DBLB 2NZXA 4N9QA 2QSFX 1CZLA 1IYZA 2ZJ3A 4R68A 2O2ZA 3INYA 3MSXA 4LV5B 4KRXA 4DR4M 2Z6AA 2H6EA 2JLCA 2WTBA 3TXAA 2JGDB 1QFSA 4H31A 5FP0A 3E15A 4U7GA 5CEJA 2WG2A 4WPGA 2PQMA 1UBLS 5LMZA 1KQFA 2ZWMA 1KYIA 3VSDA 4AJLA 3ZR4B 4WGGA 4ND7A 3H2IA 4B84A 2P78A 2OTCA 4LCEA 2WPDA 4UTNA 4BUJA 4MA0A 1R9MA 1C7ZA 3P0FA 2KZUA 2IZZA 4KREA 1WDKA 2JFHA 4N3GA 4MKHA 3H1EA 1YC2A 1JLRA 3T3EA 3EASA 5LN1A 3AIKA 3ANYB 1I94M 3VC3A 3V1TC 5AESA 3TCNA 3G5TA 2A8YA 1SUIA 1QR2A 5ALKA 5L6MB 5JAQA 4DR2B 2HD4A 4PHGA 4HYYA 4I19A 4OO3A 3UWPA 3VOBA 3TBKA 3E18A 1SHTX 3O8CA 5KSYA 2DG2A 4LF7B 1D2EA 1RHKA 4RTJA 4E5UA 2UXCB 1CUWA 1DX4A 3ZDZB 2QZPA 2VHYA 2Q4RA 4XVHA 2WKRA 1E63A 1WD7A 4OK6A 3N07A 1QRSA 3CEMA 4QPPA 5IWAB 3U7RA 4R8SA 4JSYA 1O03A 1ZJ5A 3D1LA 4YECA 3KQHA 1E59A 3HNOA 4AO6A 1R6UA 5KQMA 5KJFA 1G18A 4X93A 1W30A 3T4XA 1WCIA 4AJHA 2ZAMA 3REQA 2ACWA 4CKYA 2IA5A 3UWKA 5F2EA 4KQKA 1ACLA 3HXLA 2RONA 4L8LA 4C7XA 3HCWA 4A8JB 4QJ5A 1C3VA 1E9RA 3K9BA 1Q11A 2M98A 3LYHA 2B8TA 3URKA 1EE9A 4D6XA 4Q7JB 1M6VB 1UMCB 3NZEA 3S7TA 4TWJA 3OIVA 4LF5B 2MINA 4ZU6X 4HWGA 4KN9S 4Y2QA 3I6QA 1ZONA 2YTZA 1HYEA 2XCRB 2QN8A 2XMSA 4KZPA 4OBWA 3V2HA 1ILWA 1KMHA 5A3VA 3DLTA 5K0ZA 4KBFA 2ONKA 3BIOA 5AVUA 1M1YB 5AVJA 2P2CA 1XMOM 1YZUA 3L7CA 4H7JA 3HR4A 2CWDA 1YBHA 1OU0A 4AJKA 4YDRA 3CU5A 3D4IA 1VPLA 3LFUA 4Y2YA 3TJZA 2ZR7A 2QP4A 1JSRA 3GGDA 5EFOA 1R0LA 3TBFA 2FSVC 2EBUA 3ITNA 1A9PA 2IH5A 2DT5A 3WMFA 1E1CA 1QRTA 4JXXA 3D5TA 4P7FA 3DFZA 1Y1RA 1NNI1 5CGZA 1KDRA 3D8BA 1GZSA 5EZYF 4AQDA 3GF4A 1SRQA 1DUVG 2V03A 1ND6A 4GWKA 1PGYA 4QDUA 4WZ6A 1QDEA 3FNQA 4CFSA 2VTBB 1DCMA 3RK0A 4ZHQF 1I13A 5FSWA 1H8HA 2Y68A 4RTSA 1PL0A 2Q2VA 1Q0HA 3DDWA 4QKQA 4TPKA 3RGSA 2P2LA 4UAGA 4YC7A 4HXYA 3GCDA 4NULA 4F04A 2FA9A 3WFIA 2RHRA 3HSKA 3HYSA 3PBKA 1HYHA 3E5NA 4BQIA 3ZW8A 2JFGA 1KJZA 1Z5WA 4L16A 1CUZA 1IG3A 3R40A 3TMAA 4NXMB 1KKMA 5FWYA 3W79A 3PITA 1MH1A 1XP5A 2AL7A 5KOHA 2X8JA 4LJSA 3NKLA 1IJFA 4ZCQA 3WRVA 1M1UA 4WZBA 3EF1A 1FJGB 2WM9B 2VQEM 5DHAA 4IWYA 1IBCA 2P68A 1PW7A 2Q0SA 1GFZA 1VLLA 3ILKA 3AV3A 3F5MA 5C8YF 3V9AA 3WFZA 1L2TA 2XXAA 1F4PA 1PRYA 4AQYM 3N74A 1PJLA 3HKCB 1EJ6A 3I9OA 3VYWA 1JR4A 1EUQA 1SELA 1LSSA 4DLYA 2W37A 2IPNA 2DETA 1XNHA 3ZBUA 1CY6A 4URZR 4ER7A 4DLBA 1HO3A 2R45A 1P2TA 2HHLA 1J8FA 3H8VA 4BE9A 5LD2C 4A10A 2RHWA 1AV6A 2P77A 4XVUA 2EJVA 4BQFA 3HM2A 3WYCA 1Z45A 1T3SA 2ZYHA 1L6RA 1FJXA 3HFRA 2CC2A 3KVVA 2Z1DA 3FN4A 4DA9A 3TUJC 1MJGM 4CE6A 4QD3A 4JJ8A 3LL7A 4YGXB 1RZRA 3UMVA 3ONWA 4ICIA 2X8AA 3TVDA 3EQ9A 1K8YB 3HCAA 4LTMA 3OE5A 4MA4A 4N41A 4FKBA 1E61A 2J45A 3F90A 3SJUA 4HKTA 4QAQA 4PCZA 3COWA 1XJ5A 1SKAA 3G2LA 4OYYA 3KWJA 4KVZA 5LUAA 1ZN7A 4OK5A 4FEAA 4IDCA 1HK7A 3DMPA 2KLHA 4UDNA 1EAMA 2AFHA 4ID3A 2EXXA 1GG2A 4YVFA 4KSYA 3C3WA 1RCFA 4EAQA 1NQWA 4RORA 4NIMA 5CDUA 2QT9A 3PD0A 1BD4A 5G40A 3GD7A 2WZDA 4J7UA 1XVAA 1Y4SA 3G49A 3FR8A 5TPWA 4NS1A 1JWBB 1ORIA 4CV2A 1EWYA 4I50A 4P82A 3JQ9A 4U8GA 2D5LA 1UBUS 1UWVA 1BVRA 1R1DA 1EVZA 4MJ3A 3EZ9A 2QVLA 4ZP1A 1EVLA 3OA2A 2HNAA 3NCHA 3OFSA 2D2IA 4B8WA 5B7QA 2ZI3A 4J0QA 3PHJA 3B2EA 3TJRA 3HUFA 3QH4A 1PV1A 3IUEA 4JX8A 2FH5B 4YV1A 3MWGA 2A9KA 1SUBA 5K8IA 1XDSA 1XRJA 3UGKA 1I3NA 5IAKA 1JHYA 2CF5A 3NTUA 5TT0A 2ES4A 1CIJA 4A0FA 3NV7A 1AUQA 4L4RA 2RH8A 3FVRA 3BL6A 2I3ZA 3ZCBB 4DDMA 1E1NA 3B13B 1HGXA 2C8JA 1E7WA 3K7EA 4L7QA 3JR7A 3U3MA 3E5RA 1PWZA 1OTXA 2OYSA 1LFDB 3HB0A 2DPLA 4XX1A 3VUFA 3RBVA 2JGFA 1Z2EA 3VKHA 3ANLA 4G1UC 3KE8A 4AIIA 2Z83A 6NULA 1P19A 2OBNA 1KZ1A 4FZJA 2KE5A 2GGSA 4D7AA 3HL0A 2ZPUA 5K3OA 2AX3A 1FYEA 2ZI6A 3AH8A 1ZL2A 1PU2A 3GLHA 1BU8A 4NV0A 4F6RB 3SC2B 1CJBA 4CLXA 4YJ3A 3TQHA 4HF7A 1IEQA 3IAUA 2ATEA 4O4LF 2J3EA 1IN6A 4V0NA 3SZ3A 1S3GA 4TL8A 4BGDA 2OE2A 3CZMA 2ZSKA 3EEIA 4PQYA 1UMDA 3HWRA 5EYPB 1CCWA 2IOQA 2O8BA 1C7IA 1R8YA 2OOKA 4O2BF 1ZCBA 2PXCA 3B52X 5HMMA 3GELA 3M5CA 4DXAA 4C2BA 1RWKA 4AI6A 4RJTA 4G0VA 3QY0A 1DC4A 4C7OB 1E9AA 1CJVC 3PZBA 2B5OA 4CM9D 2X8BA 3KYCA 3HEBA 1E3DA 5E2AA 2IP1A 2OFWA 2ZKLA 3Q9UA 4WKBA 3DLAA 3M7GA 4MUEA 5CUQA 1F1JA 2GT1A 3R3ZA 1MX1A 1YJ5A 3UG7A 5IJZA 2APJA 2RAPA 2DKNA 2RH4A 2OXTA 4C7KA 1PD1A 4WLEA 1GUDA 1D09A 2BI7A 2IKSA 4A73A 2YUIA 1XR3A 4WLVA 3H2HA 1DC6A 2ZUWA 4QOIA 4R98A 1ECCA 4DYHA 1KEKA 3BMCA 3C3EA 3AZPA 2R5WA 2R97A 2CZQA 2YNMA 1NULA 4IIVA 4OHOA 3Q6IA 3WGYA 2WTMA 1KMQA 4EG4A 1GPMA 3HJNA 3QEMA 1OYOA 1A2OA 3HVUA 2YJ3A 3QQ5A 1KRXA 5H4GA 1GA1A 1RWVA 3IUPA 2SCUB 4JCOA 1H1TA 1XRQA 4R2XA 1S02A 3QEKA 1ZN9A 1SK8A 4BRUA 4YUVA 1RYDA 3ZWVA 1SB9A 2EKPA 3ZWMA 2J9XB 3IIEA 1RJGA 5ALQA 1ICIA 2PAFA 3DAFA 3HDYA 4PG7A 1M2VB 1XPJA 3U6KA 1EDOA 4GZMA 2W0SA 3WWEA 2BM1A 4TYMA 3B1YA 4EL5A 1GKYA 3LZDA 3PSAA 4BNVA 2GKOA 4UULA 5ISMA 1U6JA 4IGFA 1T3GA 1V8FA 3QNWA 1CP3A 1VG5A 1YR8A 1AD2A 1H1LA 1XFDA 1HNZB 3AF3A 4HQKA 2Y76A 3L82B 1JHVA 2OHXA 3K1AB 3RODA 3RRMA 2O1EA 4W5OA 1KYVA 3LGSA 4GI1A 2BR5A 4IJWA 3KQQA 1Y4AE 1QGED 1E9SA 1ZXBA 1S9HA 1VYVA 5CLJA 2D1YA 5TSDA 3WLKX 3WRYA 2BMDA 4X54A 1V7ZA 5KWIA 4QJBA 8ADHA 2R1VB 3K53A 5AKHA 2L42A 1JKJA 1KJ9A 3O47A 2CDRA 4DLZA 1C14A 1OFGA 3HSYA 3FWZA 4IFBA 2DWQA 2ZJFA 1QF7A 2TMYA 3ZY4A 1HE8B 4XH9B 5K2OA 2HL6A 3EA4A 3UMMA 4Z3DA 1EXDA 2VWQA 2YC2C 1PT7A 2DXIA 1VRWA 1JKXA 1NXPA 4P3KA 2ZU6A 5DM1A 4DRXB 4JI2B 2HCJB 3NG1A 2CK3A 1AHIA 2B7BA 4JBLA 2YQ4A 2GYWA 2WV9A 1CQXA 4O5OA 2HQRA 4PXAA 1I5OA 2E37A 1CJMA 2FGKA 2C07A 4TLBA 3R24A 5EHXA 1ECBA 2DE0X 2YXPX 5FPKA 4YJ2A 2OC9A 3NQ41 5HP4A 4MPPA 5BSWA 4LY3A 2OGSA 3GPUA 4FWHA 2HWKA 1B0PA 5DM2A 1OJLA 4G9BA 4LC9A 1GRNA 1UEJA 1I2MA 4YP6A 2BMWA 2OFPA 1V8BA 3P9KA 4O29A 2NSJA 1UH5A 1LVGA 3SY8A 5E38A 5NLLA 3G2JA 1KOFA 5LUBA 2ZRGA 2WJJA 2FMIA 5JLJA 4KP7A 1QOPB 4BP1A 1TH2A 4KX3A 3OD5A 2IELA 3VC7A 3U61A 2WJ4A 2ZS7A 4XZ3A 1R0BA 5FPPA 4C0QC 4ZQBA 3ZDBA 2XNDD 2I7VA 5EKDA 3HC7A 2OUIA 3BAZA 5T4HA 5HKKD 4UXHA 4GKJM 2EBWA 3WX0A 3Q7EA 3KKOA 1NQTA 3C2QA 4DA7A 4GMKA 1SXPA 4M4SA 3PB3A 1G60A 4RPGA 3WDKA 4O8CA 4XARA 3EDYA 1A4UA 1H8ED 2B3TA 1XLUA 3F8WA 4YALA 3KYDA 5HYVA 2H2DA 4IL5A 5EMHA 1G21B 4YAJA 4K9NA 3TW6A 2JHAA 4BQPA 1Z4IA 3PFWO 5A5DA 1WWKA 1JAIA 1YQGA 1Z08A 1ZBDA 3ZE6A 2VSFA 5JQGB 1WXWA 3M1LA 3QJGA 3BB1A 5J23A 2Q3MA 1LW7A 2HQBA 4OXKA 3VSEA 3V32A 3TVYA 4AC9A 3AIMA 4Q7QA 1IM5A 3CEHA 2EJUA 5TARA 1U9IC 1B0AA 4U0JA 3GA5A 1DKMA 2F8SA 4IG9A 2VOJA 1NUTA 1FFXB 1UPXA 1J20A 4GLFA 1FP2A 3IP1A 1W47A 4KI7A 4QGFA 3AIIA 1JVSA 1QIJA 1WF3A 4DIBA 4MMYB 1PFKA 4H1WA 4KUHA 3DWFA 4E5MA 4QTXA 4JD5A 4P9NA 1G4HA 3V4OA 5IRCD 1ABFA 4RPCA 4EYEA 4AY6A 4ATNA 3A0RB 3DL2A 2NO9A 2H4HA 3C3DA 2C9OA 3TLKA 5FYDA 4LWQA 4TWRA 2HEIA 3KUDA 1PI3A 5E3JA 3H4TA 2HA0A 5U4QA 1XZBA 4J0IA 5EEGA 3PNKA 4G37A 3WISA 1MB0A 3OT4A 1RTTA 5KYUA 1T1GA 1RHJA 2XTNA 1W0CA 5I3ZA 1K8ZB 3VPCA 1V47A 1XTUA 2DR0A 1CUEA 1H5UA 4GYKA 1P17A 3OQVA 4RK1A 1NF3A 4GLJA 4OHVA 2GLTA 3R5HA 4IGAA 3V1MA 1VA4A 5BRAA 1LRKA 2F5PA 4NPCA 4IUDS 3PJEA 3L4JA 4M2LA 4KQHA 4TMTA 2N0SA 1MP0A 4WNYA 1K2WA 2WP0A 5J5VA 3WQHA 3ILSA 1VKHA 1B16A 3VAAA 1EK1A 3B5EA 1XZJA 4LS3A 3L9WA 4WBNF 1XXHA 1W76A 1O1YA 3WL6A 3OC0A 1H3NA 3JSAA 2F5SA 3LFHA 3DJYA 1GNTA 3TTYA 4D9EA 4E07A 1VYTA 2W83A 3ORQA 4M21A 1VPWA 3C74A 5EKUA 1CVIA 2BEUA 3FZGA 2BP7B 2CCKA 1N8TA 3EIXA 5LSAA 2HC9A 4QQNA 1Z34A 2XVAA 3MHVC 2OZLA 4LUCA 5REQB 4CIYA 3AFOA 3B7ZA 3CEAA 1P0PA 2HMWA 4AKEA 4DEXA 2JH3A 1O94A 2ETVA 2O0MA 3I6ZA 4MR9A 3BJIC 1YZFA 1E1MA 2ZE8A 3JYOA 2FR1A 3JQFC 2P91A 1Z16A 3QXGA 3WNQA 2B25A 1MJNA 4E7OA 1BDMA 3WLNA 1ESCA 4FTWA 1T6XA 4X6XA 3OICA 2CLKB 2AR9A 4HB3A 4D41A 4WHMA 1X87A 3JQPA 5KUTA 4TM7A 1ZMVA 2HWWA 2JJ2D 4TZKA 1TCBA 4UUNA 1K3FA 1I80A 4TMXA 1GCIA 2MSKA 3LK7A 4ZI5A 2A1UA 3SAVA 2VEOA 3OA0A 1DCKA 5AVRA 2NQ8C 1JFFA 2XOEA 1JYSA 2GHIA 1KI8A 3SHOA 2PHZA 4U2EA 2FSGA 3GIDA 4GPTA 4TMFA 1DGHB 2XTZA 3JALA 1VIDA 4UDYX 4B3XA 4FJ1A 1QE5A 4G5FA 2IYAA 1OSNA 2ZAYA 2B94A 5AJHA 2OP1A 4GZ5A 3RJTA 1LX6A 1N34B 5HBRA 2E1PA 4BO7A 1T36B 1F7VA 2LW7A 3CLRC 4PC2A 3TM5A 5HE8A 4WOJA 2H5EA 1GU7A 2IEIA 3PC3A 1NKVA 1NWCA 3F2IA 2GOYA 3I9KA 2HNBA 1J25A 1GTRA 2BFMA 1V41E 1Z39A 2OFOA 3NATA 2FFBA 3ETLA 3LW7A 1QOQB 4QUEA 2C0QA 3RVKA 4P0QB 4PTLA 1NHGA 2C3MA 5JHGB 2H54A 1KIMA 1TIKA 1VSVA 4EO9A 1XEXA 2YV1A 2IOFA 2F5NA 1LXCA 2JFOA 5FPYA 1QMGA 5EMNA 4JS0A 2X41A 1XB2A 1CUFA 2GVZC 3OCCA 4Q66C 2I34A 2C58A 1SHZA 2ZJ8A 9ABPA 2AMVA 3OZEA 3GB9A 4RPJA 1KETA 1EFTA 1G7RA 4LMRA 3BILA 1Y0BA 1BSVA 3A06A 1QP0A 4QATA 2ZIFA 5LLTA 1RI2A 2P3SA 2CSXA 3MTJA 3PE3A 3JZAA 2VA8A 1TLLA 3U4IA 2IUYA 4B7GA 3P2KA 1SKBA 1ONBA 2JFYA 3DFFA 1IH8A 4XFKA 4JBHA 1U3DA 5EINA 2BMJA 4GYYA 3ZHXA 3TL3A 1CUCA 2EATA 5F1KA 3QLVC 3AC0A 3L1HA 2QTTA 4KXWA 4F5DA 1L1TA 3IB6A 1DWPA 2A94A 3QF7A 2JCSA 4TVKA 4HN4B 4OJKA 3GEIA 1CF9A 2VDOB 3NWOA 1XA4A 4TN1A 4M8LA 2FYTA 3KQPA 3MWFA 2MHCA 2PZFA 4L3WA 2LDBA 3GR6A 2SKEA 2G9ZA 5IWCA 3WKAA 4CV3A 3TMYA 4XIFA 4OHPA 4Q15A 1CY4A 1E3SA 3RS3A 3FWHA 1KY5A 2VJQA 5HUJA 5FTWA 3HFGA 3Q8WA 2XSZD 3COJA 2QTAA 4UBIA 4U2GA 1PWXA 1WSWA 2CL7X 4ESOA 4C87A 3P9YA 3PX2A 3CF2A 3ZE9A 5EJ8A 3FUXA 3CRZA 2WAXA 3AHCA 3WV5A 5M3BA 4X8MA 1ESZA 3ORHA 1MBZA 4GMGA 3D7KA 1TQ8A 1CU1A 2MT9A 3C6QA 1MG5A 1V1MB 3N1UA 2GILA 4RY9A 1PYOA 4J6FA 5IUKC 4WXRA 3WLJA 3GZ4A 1EK2A 3R7DA 1IWOA 1OLUB 4S1OA 2PZJA 3T7AA 3D9QX 2IS4A 3CE6A 5IFKA 1BZYA 1VIYA 4G1MB 1H6DA 3OEHD 3TNLA 2V7TA 3FFXA 4LI0A 3PPIA 3ER8A 3RH0A 4N40A 4CJ6A 2XLJA 4LJLA 1OI7A 2PKEA 2I71A 5K03A 1MAVA 4UOZA 1ISPA 2MSLA 3RGPA 1GGNA 2Z9CA 4QLBA 5HF9A 1TT5B 3E8MA 1WB6A 4ZOLF 4QXOA 3UT6A 1ZN8A 3KOZA 1N8NA 2E21A 1J5EM 4KDEA 4A3SA 4OHFA 4KPYA 2A9RA 5G02A 1YTUA 4S12A 1X7WA 2OXCA 3KQKA 5D87A 5KKAA 1QOZA 1JQAA 1JHMA 2DFTA 4QQKA 2YV3A 2P5TA 3TR5A 1P39A 3ZW7A 4RNCA 4F2LA 3SS9X 3HYRA 1J8YF 5FQNA 3LBIA 3HJUA 4W6QA 3VR5A 4PZ0A 1UEXC 1YK1A 3IXQA 1WABA 2JIBA 3CSDA 3GPXA 3VR3D 4LTNA 4WT7A 4K1LA 4Q1CA 4OX9B 4IH1A 1GNQA 2IC5A 1J0EA 3DPIA 1CEYA 3TLAA 1HNXB 1OFHA 1Y9EA 1YMQA 3HLYA 1YK0A 2G4VA 1ARZA 1Y1LA 3WRXC 3I5AA 3B3AA 1TYEB 2IXFA 2VT6A 1QHGA 1ZPDA 5EHNA 5JR3A 4NBWA 4GT1A 4P17A 4BO0A 1X94A 2ZRQA 1Q1BA 4PBSA 2WY2D 3DPUA 3L7AA 2EFCB 1K6XA 2FE8A 2C9ZA 5IK2D 4D9NA 4BMYA 4UEJA 1SCIA 4F38A 3SEQA 1JPUA 3N3BC 4UPDA 1Q21A 5B1IA 1YAJA 3E27A 3BRSA 3ZUPA 4RD4A 3GCZA 4QELA 5G4KB 1WZIA 1XLTA 2O3JA 1XTBA 1HKHA 1N9GA 2Q2QA 2QORA 4M36A 3GV0A 2NN3C 5A6SB 2IVFA 2ZPTX 2QAJA 1SOVA 1HDGO 4JGGA 2A9OA 2JCGA 6ABPA 1ODCA 4PV7A 3WMXA 1M0EA 3WLIA 4M8KA 3PFNA 1XMXA 4S1WA 1WCXA 4JC0A 4YRDA 1D0MA 2QN7A 1J00A 5FO0A 3HL4A 4PYIA 2DUUA 3CKYA 4IIDA 1SUAA 4FEGA 4LHZA 3K30A 4US1R 3AR5A 3NHYA 3SZLA 4ZYLA 1GR1A 1QO0D 4OUKX 4ZVNA 4QGHA 4GOND 4IAOA 1P2UA 4BGIA 4QIHA 2VDPB 1AKVA 1GJSA 1KIAA 1QYXA 4EOGA 3OLWA 3EHDA 1BNCA 2PS1A 1WKVA 1MW8X 3JQRA 2F43A 2Q5IA 2TS1A 3MCTA 3AV0A 4R1PA 3QMWA 4WH0A 3DTYA 4UKDA 3GGPA 1GVNA 1Q50A 3SFVA 1VP9A 2PKXA 2ZYRA 5AJTA 3LYAA 1T2EA 3MINB 1DO2A 4JI1M 1OASA 1AO0A 3RSOA 4QPNA 3W0FA 2Z3ZA 1P33A 1N6NA 1HV8A 4MEJA 2NUAA 1R8JA 3IPYA 3ED5A 2R1ZA 1XE3A 3WK7A 1UPFA 2K7ZA 1FFAA 1YKGA 4PBRA 1ONPA 1TRHA 4R1UA 1QBKC 5F2OA 1DCTA 2KNZA 4AJ4A 1T0JB 4NMXB 2YDXA 3O38A 3AHDA 1W49A 2QL7A 5ITZA 4ECAA 1XP8A 4EHIA 2IYUA 2CHVA 2SKCA 3VZDA 4JYAM 2NNWB 1DIRA 4C0HA 1SB8A 4Z51A 4TKUA 1FB5A 3KOWA 1HEYA 4DV5B 2WD7A 3COYA 1Z0ZA 5TRTA 1EG2A 1YR1A 4J6EA 3IV7A 2ECFA 4NU0A 3ECSA 5HZKA 4TTJA 1G7TA 1SVWA 3ENVA 3U60A 1E1DA 4KLNA 3NP7A 4X85A 5C34B 1N0WA 3Q9NA 5JO0A 2HLHA 2I3DA 1QDRA 2FPMA 3MRVA 2HU2A 1J7KA 4GQAA 4GSKA 2OCAA 5AW9A 5EQJB 1BFDA 5K0SA 4XYLA 421PA 1K3UB 2LNDA 3A27A 3EGCA 4KXFB 4RTOA 2X5NA 1FRFS 2VLIA 4HDNA 1XJCA 3IMEA 4YDHB 4ZOCA 3MXOA 2VATA 3VX3A 2F8MA 4XX0A 1EX6A 2XUAA 4XPIA 5DW3A 1NONA 1U3WA 2ZSJA 1RWPA 2VP3A 1MDBA 3BG5A 4ND8B 3DVQX 3OZTA 2Q5LA 3ASUA 3UWOA 3WZ2A 1GZ6A 1UK6A 1I3LA 1MGPA 1MA0A 5IKOA 2HAEA 4JGBA 4BX9A 1H93A 4GLLA 2HIHA 2CMDA 1DBSA 1T8SA 4MI3A 4S2EA 4YX9A 3QLUA 5JI3E 2RK4A 3ZZNA 3O95A 3W5AA 1DFHA 4H17A 1I36A 1YS9A 2M2IA 1U3VA 5HRUA 3WWYA 4C4SA 2ZQ5A 1VCHA 1SUFA 1T9KA 4C0SA 2ZP1A 2D62A 4EFNA 4ZYWA 2QRHA 4EUNA 2CE2X 5D3KA 4V03A 4YHHM 1QH9A 4JQCA 4PG6A 4BNUA 3NHJA 3GDGA 1YULA 4QDZA 2B21A 3E0XA 3H9GA 4UTRA 4NH4A 2M60A 4C4YA 4MKFA 4I9GA 4FFRA 4W9MC 3C1OA 4TLAA 3VZCA 4NE7A 1G17A 2H8GA 2PJDA 2GZHA 3TIIA 2CGEA 1WXIA 3KKMA 5F2NA 4Y1RA 1AIPA 2UUCB 1ZEJA 4EA7A 3EVCA 5AI4A 1HY3A 1SM4A 3ZHTA 4XVCA 5BNZA 2RC6A 2VSQA 3MOIA 4DWWA 1QSGA 4RD1A 1R0WA 3TGPA 2X23A 4NBSA 2ZVJA 4NBVA 2ZR9A 1ZINA 1Z9BA 2YV4A 2DR3A 4RZXA 3U13A 1Z2PX 1U7PA 3P9ZA 2XBUA 4LIPD 4RY0A 3VBCA 4U6SA 3OIUA 5JWOA 2CKDA 2BI4A 1Z6QA 4F3NA 2G9QA 4JCCA 1NMXA 1B2LA 2UXDB 1UC9A 4UHDA 1O8CA 3W8NA 1HI9A 3UK6A 2JAPA 4BPBA 3ACDA 5A0TA 2F00A 4PYLA 2P4SA 4ZWNA 4GWLA 1E2GA 1JKMA 2L2QA 2VDQB 2XRZA 1DCFA 5GGYA 4C08A 1LKZA 1UT5A 4Y2SA 4Q1EA 3GIWA 4J7CA 3EFHA 3HHWA 4GOXA 3TO5A 1CF4A 3AM5A 4WXPA 3LC0A 2JFXA 4GKKM 5KQSA 1OGIA 5FKJA 2V3WA 3OZCA 5CEFA 4Z2YA 1XN1A 4GPIB 4AVYA 1CDDA 2PUAA 2CXQA 2QNRA 1ZOLA 3GRYA 1OBVA 3BRCA 3R75A 4CLOA 3EGEA 3NX4A 1P31A 2RHDA 4YR7A 1XTVA 3JYLA 1A76A 5CP8A 1NMQA 1H5QA 4X66B 1JEYB 3N0WA 5LXTA 4B4KA 2QE6A 2CVHA 4R71A 3PWZA 2IZ0A 4DMHA 3LKDA 4X1IB 1V1RA 3SZGA 1UXIA 2EX4A 5JSFA 3M6LA 1K0FA 3F96A 3GFQA 1Y8RA 1APBA 2R8OA 2W6ID 1CYDA 3M6MD 2VRWA 1LPOA 1RM4A 2CNBA 2GLXA 4IFTA 3RAEC 1M7HA 2NU6A 2JFVA 5A9RA 2YWDA 3O2QB 4BFUA 3FLAA 4RQBA 4MP3A 4Q3NA 4ARZB 3TRDA 1GP2A 5F4ZA 4B7XA 2O0LA 5FLXA 4C4OA 3A6FA 3BMQA 2NGRA 3EMKA 5EUCA 1A9SA 3IILA 1PQ4A 1QCZA 3QMPA 1PKEA 3OTGA 1RYFA 3RD5A 3LY7A 4RVNA 2WG1A 1USIA 4IHJB 4P92A 5K0GA 4ECEA 4TVBA 4XB2A 1PG5A 4AY4A 5J40A 1B6RA 4BB0A 1L8QA 4TTRA 3H5WA 5TF4A 2JAHA 2D1FA 4BQEA 5TIIA 3H11B 4MJ7A 5DBHX 3B1KA 2V6IA 2I2FA 4PLVA 3PA8A 4A91A 4Q3KA 4GZ3A 2GZ3A 3HCBA 2VFAA 1IUPA 2I6SA 5T3YA 1XNRB 2OGUA 2WU0A 1Z5PA 1VGRA 1Y9DA 1A4IA 1I3OA 4H0CA 5IT4A 3U7GA 1E32A 4QJ3A 2I2CA 2XKAA 4Z3KA 1UKVY 5AM3A 4MZDA 3HDQA 3D5QA 5E7QA 2REQA 1XZPA 1W5BA 1K98A 2FK7A 3E23A 3H3XA 4EJ2A 2VBGA 4YBZA 1GPJA 3GLQA 4FHCA 4XM0A 1TCUA 4RJ2A 4CHTA 1B6GA 3IMKA 2R87A 3V8VA 1ZAYA 5AFSA 4B44A 5HFJA 2VP5A 4IMIB 3SVTA 1QYWA 1EWRA 4GP9A 3NC0C 5KJ6A 4E7PA 5H80A 1GKKA 5CG1A 4N8DA 4RXTA 4RE6A 1KY2A 1V7PC 4C6TA 4NOJA 3LF1A 1P4HA 2IYFA 3TQTA 1XZFA 2NZJA 4ESEA 2XB9A 3L0YA 4NECA 1FFDA 4Y2UA 2D4HA 4ZO7A 2HF9A 2DHCA 3U6BA 3K2QA 4N3BA 4X1YA 3WHPA 4IBEA 1PGOA 1QZ3A 2A7XA 4JBYA 3N8KA 3H5IA 5ALSA 1GSHA 4B17A 2GBLA 4Q03A 4MQEA 5CYPA 3W9SA 2VNAA 1Z4LA 1RKBA 4WDRA 4AL4A 4I8OA 3MUNA 3QKSA 3IV6A 4RF4A 3FTQA 1UBMS 2OWEA 4L95C 2MMCA 5CM2Z 1XJ0A 3MT7A 4ZCPA 3ROKA 2J7KA 1T5OA 4LRXA 2F1KA 3F3MA 3HFJA 4PYKA 2SICE 3NEAA 5FOUA 1C7QA 3LGAA 4ZXPA 2Q62A 1P6XA 4I55F 3TMKA 4JLKA 4YJHB 4BATA 1SUSA 1FUKA 4F60A 2ZI9A 1DKRA 4ZVOA 2PJUA 2P9QA 2YXDA 2QLBA 3UIEA 1VBKA 2F3PA 1HTTA 3KVNA 4JI5M 3DE6X 2VPPA 1Y6QA 1JR6A 2ZETA 2XMCA 1JMKC 2Q4OA 3EWIA 5HS4A 4QOSA 2IZOA 1DT5A 3OAAD 5C1DA 2A0KA 1LPMA 2OGZA 3TPCA 3KHKA 1OIPA 1ZNWA 4MDHA 3TQOA 2FFRA 4CW7A 5ERGB 1Q0ZA 1PW5A 3JYQA 1N33M 4P3YA 3D6VA 1WMSA 1PHPA 2VYNA 1V8ZA 4IEIA 3I0ZA 3CLSC 2FEPA 4TWZA 1TZKA 3BD9A 3SE0A 4NCNA 4BNDB 2CLMB 1MXFA 3D8TA 2QLLA 2CV1A 2BF7A 3IJRA 4WUTA 2F8TA 2VHQA 4OHXA 4BV3A 4L27A 4LTDA 3HB7A 1XTZA 4JT4A 1T9BA 1U0HC 3SBDA 2JCXA 1ISMA 1M6HA 1JDNA 1NV9A 4C5AA 1NDHA 1CUBA 2RGAA 2R96A 1G8PA 1J49A 5AT1A 4MDEA 3GGGA 2QVXX 2X76A 2HTFA 4DXDA 2XQGA 2VQ3A 2YXEA 3T1VA 2UU9B 1C29B 3OMWA 3OCZA 3K92A 1RAEA 5FBQB 5E1BA 1ZUNB 3F49S 1ORVA 2VRCA 4INOA 4I2VA 1WCYA 1PR0A 1M5UA 5LKRA 4DV0M 1YDMA 3EXFA 4Q4JB 3OF2A 4TROA 1XZGA 4JZYA 3V76A 1RAAA 3UUFA 5FHQA 1JNXX 5E9WA 4GKVA 4RKQA 3BWDD 4PR3A 5KCZA 2QT1A 4EG8A 2WTNA 2MDTA 2RHBA 4WERA 1U8XX 1JFVA 3ZY6A 3WIOA 4YPOA 2CT8A 3DC7A 1G8HA 4P2GA 5B1DA 1T2FA 1U94A 3PXGA 1T9HA 2IHZA 4C3OB 4IIJB 1XPUA 1E6CA 3OX4A 3OSZA 1IM2A 4M6WA 5TQJA 3AVPA 2GKGA 3VNSA 1LTMA 1EEXB 1XL1A 2ORWA 3EW9A 1BS9A 2B7LA 2XXBA 5IUNC 2DWUA 4IJVA 2W58A 2O06A 4UNNA 3DWEX 1MAAA 3PUVA 1EFRD 4OKNA 1VL2A 4JI6M 2W2MA 4PZZA 1MOSA 3TAHA 4NNJA 5GIPE 1T43A 3CVJA 3A9UA 2JFZA 5E1MA 2Q5EA 1WU7A 5CNJA 2QMYA 2Q45A 4M8NE 5BWMA 4CKWB 1DEXA 1GTSA 1PDVA 2Q7DA 4BGUA 4B6GA 2AOUB 1K6EA 2WWTA 4OQPA 2IGBA 1Z83A 1Z2OX 2WNHA 1E3WA 1ENOA 2QX8A 3WK5A 2GN6A 1MB2A 1P61B 2E89A 4KXQA 3DE2X 4EVQA 1MV5A 1EA7A 5P21A 2L4EA 4C14A 1X8KA 2WYIA 4LGCA 2AE2A 1RPTA 5GJVC 2QN1A 1W35A 4WKOA 1JYFA 1TZCA 2WYUA 4EHDA 3WHIA 3DV0B 4YQYA 2Q7OE 3AGPA 1H3EA 2H9AA 1QV9A 3AXSA 1SIWA 4HMPA 1ISGA 3QXSA 3L6OO 1Z25A 1CTQA 3Q7RA 2NZ2A 1UBJS 2I80A 4IIGA 4IV8A 3ZDDA 1KQGA 1OZGA 3G1TA 1Z59A 1FW8A 3OESA 4FGLA 1YR9A 2C97A 2Z6QA 2H52A 4M46A 4DR3B 1COWA 3UPTA 3QWFA 1Z0JA 5FA8A 4XOIA 2OA0A 3ENZA 3FVVA 4L9AA 3ABZA 4EMUA 1JEEA 1PQUA 2EFDB 3EF3A 3C6BA 2ID7A 3KZVA 3GEMA 2VLBA 1ORRA 1NYQA 4JKIA 1OAOC 1DDOA 4WWHA 2X58A 2HK9A 1JSCA 2DQSA 4RL6A 2EA0A 1YQXA 1KC3A 2H59A 1GZ5A 1QTNA 3P9NA 1T1RA 5T67A 4XD7D 4MK4A 3ADKA 2ZVDA 2X4LA 2JH9A 2XCUA 3FOCA 3FOAA 4UUOA 2VPIA 3WZLA 3MWEA 3K9QO 2WP8J 1TO2E 4D9HA 4RWZA 3Q98A 3F8SA 5C3MA 2VXBA 3UUEA 1RPNA 4ND6A 1TMKA 3FPEA 5AIAA 2BKLA 3RRNA 4XRGA 2W6CX 3K6SA 3B78A 5BR7A 5T7BA 2VHCA 4UUPA 3WS7A 4QPCA 2IEDA 4K40A 5B1HA 4PXYA 2IODA 1HR0B 2ZSDA 1V4BA 4TV9B 4F11A 1UC5B 2D2FA 4B4OA 1D8AA 2A0UA 1T6YA 1M3SA 3N2IA 3KR1A 4QHSA 4B8ZA 3ZN2A 4OV6B 3LBNA 2A14A 2KHZA 1ZAEA 2XB4A 4URWR 1Q95A 4PFQA 3RDPA 4WVLA 5KC8A 2VKQA 1M2KA 1K66A 1FTGA 3KTAB 4CTKA 1RMTA 2HSJA 3IRVA 4FWDA 1Z8NA 5CPFA 3L06A 1RQNA 2GJ9A 3GI1A 4MUXA 4JNKA 3UW3A 4G86A 1VE5A 1QCCA 5EQDA 2Y1CA 1TYBE 3S28A 2EGUA 1RLJA 4DADA 1LUAA 1LY1A 2KNAA 3T3PB 4D26A 4NF2A 3A2MA 3PRKE 4E5PA 2KHHA 1Y34E 2PGIA 3FSEA 2H16A 4J0JA 3K0SA 4GMQA 2HF7A 2HM7A 5BYKA 1W36B 2QSZA 1GTL1 3NWPA 3AVUA 3O5AA 4HQFA 3FI0A 3W8RA 3NJ8A 1JLLB 4K87A 1PE0A 3KELA 2IGTA 4Q3CA 1UBHS 1E2PA 4JB0A 3D0KA 4KO2S 4L72A 3PYXA 2JATA 4FZ3A 4EUKA 1SBIA 1E5LA 3DSRA 4B7AA 2FG7C 2F2TA 2V7QA 3ZHCA 4BO3A 2YHUA 4C6SA 1FYFA 1JXMA 4DR2M 1GAQA 5EZYA 5F7XA 3LU1A 2VDRB 4FPXA 4XDZA 3PRJA 3A6ZA 2EKFA 1U3FA 4KI0A 5EA2A 1MJGA 3ZK9A 1VL8A 4ZHQA 4LF7M 3I1JA 3QELB 5D5HA 1YZNA 2IEBA 2E4VA 3FYSA 1XTTA 3LA6A 4NONA 3U0VA 4LDRA 3DBIA 4S0ZA 4ZEMA 1KE2A 1JXAA 3ILVA 1NAHA 4KMRA 4W1RA 4HH3C 4QC2A 5AVSA 3OZXA 1S7CA 4LG1A 5IWAM 5CT8A 5BSKA 4F0JA 4AMYA 2J46A 2P2YA 2ZDGA 2WB2A 1QCDA 1Z35A 3HBNA 4NY1A 4EKEA 4RPLA 5IZ7D 3LJKA 3AM4A 4NX2A 4R9UC 4C6RA 2H63A 4AU1A 4FGJA 4HBZA 4MGZR 3K9OA 3LX6A 4RYDA 1QHHB 3OKCA 3S27A 5C53B 3L6EA 3GVCA 4RKRA 1XAGA 2UYCA 1Y1KE 4EYSA 3O8OB 1YR6A 3T95A 2C2KA 4NE9A 1HM5A 1N6PA 2BIFA 3WMEA 5C8YA 4MKIA 1SXJE 1GAEO 1KTVA 3PKJA 1GQQA 1ZIYA 2AK2A 1ZH6A 1ZGBA 3L2OB 3IV9A 3L0ZA 4LF5M 4MCAA 1IZYA 4IBKA 2C1EA 3FTNA 2UVQA 4L8GA 1I2AA 3M6UA 3RLIA 1FFHA 4F12A 3T7IA 3R3YA 3D59A 2GF9A 3SC3A 1SXJB 5CM8B 1L4KA 3Q7SA 1ZM9A 2V1UA 3E8XA 2ZTMA 4QM7A 4UN2B 1O95D 1ZUIA 3ZE2B 4F2GA 4X8OA 2FMKA 4G8JA 1L5NA 2ECPA 3PX7A 5KSPA 3TRJA 4L28A 5CXXA 1XZKA 5B2EA 3OH8A 4YCLA 1K0UA 5CFOA 3K0EA 2WFMA 3AP1A 4N8EA 1T6OA 1ZR4A 2XYGA 4Q3LA 4Z2AA 3Q3GE 1Y6FA 3DZBA 1E1RD 3HPRA 4C4RA 1OLOA 2G3QA 2PT5A 1YZYA 1XYVA 2W00A 3FD8A 2I1QA 1XNGA 3GFRA 4EPVA 1TZMA 2HA4A 2MSEB 4JOSA 1J9EA 4FFWA 4PD2A 1GYQA 1T9DA 2PO5A 3EPRA 2OHGA 2FF7A 2CJFA 5FFMA 1TR8A 2DRIA 4L4ZA 3AHIA 5IBRA 1RP7A 3L28A 1RTKA 3L6DA 2P5SA 4NZMA 2HDNB 2EF1A 1DZ3A 3E7FA 4K9LA 1L7OA 1KERA 4B6SA 4Q9LA 4NXMM 1J1ZA 4UMVA 4PXSA 5FBHA 5B58T 2X3YA 3OMLA 4IDGA 4L07A 4EAAA 1PLKA 2QD2A 1I10A 1A7UA 3IUSA 4JR0A 4DZZA 4MVCA 3K1YA 3NC1C 3KPYA 1C3XA 3DZKA 4LNUA 1U3CA 4ZKEA 1FJGM 3FKEA 5HQTA 2HDWA 5T6BA 5EWLA 2H1HA 3IRUA 3EDRA 4B3TB 5E6RA 5K1ZA 1I3KA 1KSJA 3OE4A 1N7JA 2C7OA 5JEDA 4B2LA 2CNWA 1XQ1A 4QX6A 1MEJA 1S2LA 1W0JD 3BHIA 4M7OA 2VJYA 4Z8XA 4FBMA 1YU9A 2JCVA 3U3RA 2BZGA 3CVOA 1VI2A 3BE8A 4IXDA 1BIFA 1S2OA 5D00A 1B93A 4Q19A 4LJYA 2C0CA 3VU3A 1Z7EA 1QYRA 4RCVA 3TTTA 4ND5A 1CDOA 3HJTA 3EZ2A 2A0XA 2E4WA 4GZLA 5JCOC 1TKCA 1I0LA 1L5OA 5DX0A 3KTOA 1G55A 4LDNA 4D9MA 3ESQA 4ZAVA 4L0MA 1J0DA 4LJ8A 4MITA 2IIBA 4O4LA 3P45A 1NFFA 4BKRA 3JAMA 4D82A 4X7MA 2AX4A 4Q7LA 3C8MA 3R1IA 3VR5H 4N3CA 3ZWYA 3MPUA 4J29A 4O4IB 4O2BA 2M9MA 3EIFA 1FSGA 4Q16A 2FPKA 2JASA 4QNRA 2ZG6A 3FXAA 5I9BA 1CEEA 3DEYX 1NYLA 3M89A 3MM4A 4CN8A 3BGSA 1CERA 3OIWA 4NCKA 5AKZA 2ZI7A 4MLDA 3TUZC 5GZ3A 3GRAA 1K1EA 1B1AA 1AHHA 1R2YA 3CRMA 2YS7A 1GL3A 4UD2A 5I4CA 4AWXA 2EFYA 2IDZA 2V59A 3KEOA 2CXUA 1N57A 3FYUA 1UJCA 4LW8A 1TGYA 2X0FA 5I6DA 3T7RA 4R7GA 1NRXA 1PJ2A 5ANRB 5E4TA 2AJ8A 1SHUX 4A0GA 5JECA 3L4BA 1DX9A 4TTVA 1TH4A 5JH7B 4WRRA 1QZMA 3QVJA 3SQLA 4AO8A 3VR4D 4DCOA 1FU4A 2FKNA 3II6X 3ZVKA 3C5EA 3FCSB 2J5YA 1B3BA 3H87A 2R5FA 4MUGA 1C9EA 3VNRA 1X7XB 4PZ9A 2EYQA 3VDUA 4IJ5A 2FOLA 3ROGA 3B2QA 5AUOB 3KAPA 4TLMB 4MAFA 4KR2A 4A0HA 4COKA 4YUAA 4FW9A 3S1AA 1JHAA 4HATA 1E66A 1HDRA 1OBOA 3AVOA 1D1QA 2AN1A 2FVYA 3I4CA 4BLQA 1NZFA 4DLSA 1FNDA 1JLSA 1KFVA 1AK9A 2FHPA 1DKLA 3U6SA 2FRDC 3HWWA 3TI9A 5IJ0B 5F35A 4YCNA 1Z5BA 1JIKA 4PPYA 1CVRA 2XMRA 2H00A 5AHXA 2C7VA 4CCWA 3W8EA 3MFQA 3ETHA 4BKOA 3ZV3A 1JR3D 3UKJA 4G26A 4NBRA 3OZSA 3ZCTA 1E2FA 1UMKA 3WL8A 3O8DA 4J16A 1L7RA 2CDBA 2R8ZA 4ZOAA 1R27A 3HU5A 2VPTA 3LW5F 3KSAC 1GZDA 2YVUA 2XUQA 4DCJA 3OOYA 1DBQA 4NNPA 4I4CA 1U31A 4CL2A 2QR3A 2H7YA 2PQ0A 3P9XA 4MV1A 3B6IA 1CUUA 2FGJA 3RR2A 4ZICA 4FONA 1RMYA 1KL7A 2H57A 4DB2A 3H05A 2JVKA 5EFZA 4B3MB 4OGWA 1V11B 3CW2A 3PNQA 2QLMA 4JYMA 1W4BA 3R5TA 1PN3A 4HCJA 1DELA 4H7EA 2OXRA 3IKMB 4CM5A 2OY0A 1QVWA 3EIQA 2O19A 1YCHA 3EY4A 2X0EA 5KVAA 1DWOA 3D6FA 1PWHA 4PE5B 5AK3A 4KQWA 3WI7A 4OCZA 3PUKA 4E0BA 2VTVA 1R3DA 1PAUA 3SYMA 3FCXA 3G0DA 4BQRA 3STUA 1YE3A 2AG8A 2HJVA 4QGAA 1PGJA 3ESBA 1X2EA 5JO9A 1UCFA 4ZRDA 1AZLA 2H4YA 5J2UB 4PYOA 4RSMA 2PR7A 1Y89A 4RMNA 4L8RC 4PSKA 4HTFA 3RKRA 4IJEA 2G3YA 2CBXA 3ANMA 3PC8C 4JU8A 4R9VA 3F9RA 4EQ6A 1Y3FE 1YA4A 1RQRA 3RQSA 4YP5A 4CGYB 1OROA 3QVMA 1QYDA 1A5BB 1IB6A 3NONA 1WZ2A 3EMVA 4YJKA 2P5UA 3LP6A 4B83A 1JZSA 5JWRA 4AMZA 2D7HA 3VU0A 1YH3A 3I9FA 2L4FA 2RGGA 3AZQA 3DXZA 1UBCA 1RQPA 5J2TB 3P1JA 2X9VA 4Y9TA 3ORRA 1HNZM 5AKEA 4OAQA 2XJ4A 4S1VA 3IECA 1VSUA 3Q0IA 3ZOKA 4BLSA 2ZRFA 2EERA 2QV0A 4OKSA 3N2GA 4MLCA 4C4TA 3O4FA 4BE4A 1GABA 1J8VA 4LE1A 5LJLA 1ATIA 1YNOA 16PKA 1E0KA 1SOUA 1JX6A 2QD3A 3TINA 3QX9A 5DIZA 4PFJA 4F4CA 3IMCA 2O57A 1Y5IA 2QX4A 1BRTA 3NT5A 3W5IA 1PGQA 3MSCA 5BN3B 1RIIA 5JSHA 1UDAA 4YRCA 4DDTA 5JXIA 1WBDA 5G3YA 1NUHA 4MVJP 1TU4A 3FMGA 3WB0A 1D3AA 1U0TA 2ZRDA 3N2EA 2ZAGA 1IWBB 1VTKA 3BH0A 4YMVA 1U5BB 3ZVRA 2IUUA 2RAVA 2H1LA 3CNQS 1OAAA 1G20A 5JQGF 1U1FA 2OYRA 4E4RA 3UYKA 4N39A 4JI2M 3IR7A 4UNRA 1CUKA 2CSUA 3C3KA 3LCVB 4MNTA 3P2IA 1ECGA 2I3AA 2LRHA 1NU8A 3R41A 1QIMA 5D2CA 1U0RA 1UINA 1M74A 1CRZA 2CHQA 2AG1A 2EOAA 3DDCA 1BKDR 4D3ZA 2HR1A 4NZZA 1YA6A 2GN2A 2JLBA 5DI9A 4AS1A 3QHQA 4CKEA 1SFRA 2MWMA 1J5PA 1CQJB 3EQ7A 2X9NA 2R6ZA 4BNYA 3PWKA 2VHXA 1QLWA 3F92A 4B48A 4K9QA 5K0TA 1DO8A 4MUJA 1NOKA 2ZIAA 1ODKA 3KKKA 1L8LA 2X1LA 2WIBA 2GAFA 3QUQA 5L7WA 1YIOA 1CR2A 2QN3A 3EVEA 1GHTA 1RIFA 3KZMA 2VAMA 3WGUA 5BVHB 3VU1A 3D3WA 3J81A 5IPFA 5JLAA 1W94A 1VL6A 2QHXA 5JD4A 3RYHB 1W1IA 2GDJA 4H6XA 1Z0AA 3TTVA 3CUSA 3RVNA 5KVSA 3BFKA 1QQTA 5E6SA 2V7GA 3LYUA 5EP3A 4M99A 2VJBA 3RQIA 1JIUA 2UZ1A 2QYHA 1YJ8A 1NDUA 4XFJA 1LLDA 2ZZKA 1KY3A 4PCAA 1QYVA 2OD9A 3VTZA 4WBNA 2H1RA 5U4XA 5JZMA 2AF4C 1S3IA 5C8VA 1A4RA 1FSZA 3CTMA 4RVHA 3VR1A 2XUKA 4BNWA 1YE9A 1RZ3A 1V16B 3EK2A 2G4LA 3NUQA 5EIFA 2QW8A 1L7DA 5B1SA 3N58A 5DW0A 4ZI2A 2FSIA 5K2MA 1P7ZA 3JZMA 3E9NA 1NOJA 1LPAB 1VKZA 3UATA 3U44A 2VJKA 4D3SA 4Z4EA 4EMTA 1HE3A 2O8CA 3C0KA 3QUBA 4MO2A 3P94A 5EXEA 1F20A 4QT4A 4A4DA 2DUNA 3I1FA 2GEBA 3BWVA 5NULA 2OCGA 2LV8A 3FLBA 2KDLA 2GQFA 1JNYA 3KJGA 4CVNA 3RS0A 4EY8A 3MMZA 1EFDN 1B8VA 5E3IA 4Z4GA 5LP6C 4DM7A 3HVRA 4IYRA 4MVXA 3OJFA 5IZ4A 5KTMA 4BMXA 4U8HA 2IZ1A 4ZRMA 2LHGA 4CLHA 3CN9A 1EIWA 4NYIR 1MAWA 3C3YA 4D9KA 3HN7A 2A88A 1CR4A 4PHTA 4TS9A 3QK7A 2BFDB 5AK6A 1GR0A 1J0CA 3HN6A 4BECA 3ITDA 1G3MA 4XRRA 1KF0A 1ZOSA 5AVZA 1QE0A 2OBYA 3I0MA 2WVHA 2DHYA 4UU7A 5F5LA 2XOKA 3WK9A 3PUIA 5L51A 1RKQA 2EU8A 3QM1A 3U3XA 4UOQA 5TGTA 2QLJA 1DBWA 4BXOB 4RCYA 1Z7BA 2QZ4A 5ITXE 3K5HA 2FPPB 1IAQA 1XA3A 2QR2A 3HCFA 1NM5C 2OWDA 2O59A 2CNDA 7REQB 2HJWA 1OC4A 4EDHA 4NZYA 3A4MA 1IHDA 1MX3A 5KOYA 4H3HB 4LOAA 1XQYA 5IXYA 4Q4CA 4IO1A 2IHBA 4CKXA 1DTSA 1TM3E 3LAWA 3PQDA 2IIQA 1F4IA 1OLXB 2BWJA 3PHIA 2IS2A 1FSPA 3KL4A 1KQ3A 3G6KA 1T35A 4OJQA 4N01A 3BXZA 4ZDKA 2PUFA 4M9RA 4PRKA 2AXQA 1P1IA 3ROMA 2XIQA 3QU5A 1PJTA 5KIAA 1L5YA 3ND7A 4YTEA 1IM8A 1Z5NA 4DG5A 4CETA 2FXVA 4TKVB 2PG3A 5HA5A 2AV6A 4CJXA 1E5VA 1Q2UA 1RRMA 1UANA 1HLPA 3BD6A 4XBOA 1L4GA 5AJUA 5K8LA 5DB4A 1N5KA 4MQMA 4H35A 3RC2A 3WLQA 2X0DA 4L8FA 2DAMA 3ORSA 4AQ7A 3Q8KA 3ZK7A 4MS1B 1CB7A 3VO9A 2QRGA 3AQIA 5IN4A 5BXQC 2X0IA 4MXDA 4GE0A 2B1RA 2J9RA 3TJMA 3ZWQA 2C4NA 4GP7A 2W2OA 1UPTA 1KO8A 4KMMA 3MS4A 3FNBA 5JAMA 3H65A 3UXYA 1A1SA 3ASVA 1LZLA 4DRYA 5DDIP 3WOHA 1U7XA 2IU0A 4FLFA 3DEHA 3I6BA 1NXXA 1WETA 2PUTA 4C03A 4ETNA 2QVGA 4EG7A 3B20A 2PGXA 1WY7A 1ZRNA 5B3AA 4GXTA 1ULAA 5ALJA 4NFHA 1Q5PA 4WNAB 2GFIA 2HI0A 4YRSA 3G0GA 1K7EB 1SVKA 1FYWA 2ZIXA 3FUCA 1HDOA 4DGSA 4MV5A 4F2PA 1NVXQ 2GBPA 4G0MA 2FW0A 1JIVA 3RJZA 4BTVA 1E9BA 3DVRX 1H2XA 2ZEJA 3JR4A 4F91B 1R6DA 4JVLA 2DHQA 4Y2JA 3ZCRA 3QEJA 3C41J 2LVAA 2O8EA 4LOLA 1L7BA 1OQYA 2C0PA 2Y93A 4YT2A 3LBFA 1PX2A 3MERA 3I62A 1IPHA 1SBYA 1AY0A 1JJIA 2WAOA 1X7DA 3RROA 3HJ8A 1CZRA 1N34M 1N5OX 3A32A 4ZMSA 3SARA 4AG5A 1JH8A 1RD4A 1ONOA 4GHWA 4KIFA 4PN3A 5DGDA 3S40A 5BSUA 5KAMA 1WXDA 4O4HF 5B37A 2E85A 5FUMA 5BR8B 2NZYA 4MB2A 2JZNA 4EUEA 4MGKR 2XKKA 3V5NA 1KEZA 1M6WA 1BQEA 2CFOA 5DU2A 1TQDA 3N2KA 4NE2A 2C94A 2X9GA 4MRRA 1OQAA 3TLGA 4JL5A 4F8EA 1Y42X 3LIPA 1E9FA 3EJWA 5EIAA 2HJ9A 1KYQA 4MR7B 5K0FA 4YAFA 4MQUA 2RHMA 5LB2A 1H4SA 1IK6A 4MV9A 4KQ2A 3LRXA 3BL5A 2NZVG 1TVKA 4ZOLA 2Q4TA 2FWMX 4BVFA 1DIGA 3S5JA 4C5CA 1BOOA 1AO3A 3CMCO 1B26A 2QXUA 3VTKA 4P1ZA 4ENRA 3H1BA 3MEQA 1MEOA 4G4JA 3VYVA 4CEJB 5CLLA 1OFVA 4JN6A 3V7FA 2X5JO 3DLIA 5CFQA 2VDKB 4CU5A 2CXRA 4JQOA 3UH1A 3FROA 1N75A 1GCOA 5LB4A 1QF6A 1NX9A 2A84A 1I4TD 3QWAA 4WJLA 4DIKA 4Z54A 4RK0A 4W82A 2CWBA 3SAWA 2X3UA 2B5WA 3KKZA 3F71A 4ZYVA 4A7PA 3FYTA 4XCQA 1Y1QA 4WACA 2IIPA 1ZV1A 1Z15A 2ZB4A 5BPHA 3R3UA 3ADCA 4QREA 4RHYA 3ETNA 1Y3CE 3CZRA 3USCS 3ABQB 2W2KB 2LPMA 1UKBA 3AI7A 4JVMA 2PWAA 5KYKA 2M6LA 2E0IA 1UOQA 3DOAA 4BC1A 5ALXA 1ZD5A 3KIPA 4BVKA 4MS4A 3LRPA 5CT6A 1H6CA 4BCDA 3W2EA 4QHYA 3LOPA 3TDMA 4ASUA 2C9DA 3IAFA 1HRKA 4FE3A 4J94A 3M6XA 1ZICA 3KAQA 4LHSA 3ZU4A 3CINA 4J1TA 4GNKA 4KLAA 1MAHA 1P77A 2GK4A 3TDNA 4LF6B 1O2DA 3CVWA 1P7WA 3EGDB 1Z2CA 3R8FA 3CSSA 2IXBA 1JHQA 4ALKA 2NUBA 1XDGA 3IVGA 2PT9A 3EPJA 2X4IA 4K26A 2XB8A 4ND3A 4LFBB 4D92A 4Q9KA 4MQ5A 5I7OA 2J3JA 3VR0A 2QQGA 4CQMD 1XALA 5FI0B 2W8BA 3QPBA 3KSUA 3WE7A 2WSSD 1U28C 3QKRB 3D8UA 2WB4A 5ED4A 4OB8A 1YZLA<