2H1RA

Crystal structure of a dimethyladenosine transferase from plasmodium falciparum
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
271
Chain Sequence
HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWCTLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Dimethyladenosine transferase, putative
total genus 94
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.480 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2h1rA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h1rA01
3FPGA 2P35A 4BP1A 3LDGA 2BM9A 1YB2A 3C6KA 3HA3A 1X1CA 3F4KA 5E1DA 3BGDA 2B78A 1AF7A 3FUUA 3FZGA 4FZVA 3UJDA 4DQ0A 5CCXA 2OY0A 3VYWA 1VL5A 3V8VA 3CGGA 1MJFA 3PLAE 4PYKA 3ELUA 3GRVA 3IYLW 2JH9A 2OO3A 3MTEA 3UA3A 4CTKA 2ZIFA 3FRIA 4M7RA 5KYGA 5HIJA 3A26A 2OKCA 3KR9A 5ICGA 1L3BA 4EMSA 3FYDA 2VS1A 2ZTHA 3TFWA 1WY7A 3JWHA 4R6WA 2YVLA 3BKWA 3I5UA 3OZTA 3KR1A 4MQ4A 2OYRA 1JQEA 3LBYA 2ZIEA 3T7SA 5KVAA 3PX3A 3FRHA 3HVJA 4IV8A 1Q0SA 3ELWA 3PX2A 4BLWA 2QRVB 5EKUA 3CJRA 3TM4A 4BLUA 3EPPA 4L7VA 4YV0A 4FGZA 4Z2YA 1YF3A 1VP9A 3FPFA 1DUSA 3EVAA 5DM2A 2P8JA 1PRYA 1XDSA 3BWMA 5K0LA 2V7EA 2IIPA 1SQFA 2P1DA 2YX1A 3NW9A 3REOA 4RTNA 5T6BA 4B17A 4LG1A 2NP6A 5BXYA 4E31A 1VLMA 5EEHA 1XTPA 1RI4A 4EQZA 3VSEA 3DMGA 5DM4A 4A6DA 5ICCA 3CCFA 1KPIA 1FPQA 1XCJA 2O05A 4QQKA 2HMYB 3SGLA 4PINA 2FK7A 3CKKA 3EVBA 3O7WA 2C7RA 5K01A 5E1MA 3TMAA 4RX1A 3PT9A 4PYLA 3C3YA 2EJUA 3DMFA 5DT2A 5T64A 4PWYA 2OPBA 3EMDA 3GDHA 3LCCA 5BP7A 10MHA 4QPPA 4PCLA 5EMMA 3KQWA 2ZULA 1BC5A 3OU6A 3NDIA 5BW4A 3PS9A 1M6YA 4CKCA 1QAOA 1DL5A 5DLYA 4HRAA 3BUSA 2ZWVA 3G89A 4F86A 3OFJA 3UJAA 2ZZMA 1I1NA 4C04A 2FRXA 1NBHA 5FULA 2AOUA 2CMHA 3OZSA 4KWCA 1RJDA 5CIYA 2R3SA 2ZZKA 3GWZA 4QQNA 3GIWA 1TW3A 1NV9A 2O07A 2PLWA 3UJ7A 1INLA 2AS0A 3ORHA 2P40A 1M6EX 3ELYA 5E8JA 3KQSA 5EOVA 5LQNA 2GLUA 3FUXA 4HG2A 5FA8A 5EIWA 2C7PA 3P97A 3KPWA 4GUAA 4U7TB 3E05A 3SM3A 1ZHFA 4FP9A 4E2ZA 4EK9A 4O29A 1I9GA 2Q41A 2QM3A 1R74A 5G02A 2XBMA 2VP3A 1L3CA 2BM8A 3QOXA 5LQKA 2PT6A 1RJEA 3T7TA 2PXAA 5B1SA 4RVGA 1O9HA 3NWEA 3RW9A 3T0IA 1NT2A 4IKPA 3G7UA 3GJYA 2NYUA 4LWPA 5FADA 3TR6A 3HTXA 1XJ5A 1XDUA 3NWBA 1KHHA 2FHPA 4KRGA 4AZVA 3R9XB 5DTRA 4CWAA 1D2HA 1I4WA 1RI2A 4E2YA 1FJXA 4P7FA 3MHTA 2PY6A 3GRZA 3SMQA 3TKAA 4HC4A 3MERA 2OXTA 2ZSUA 3C0KA 4PYNA 5E9QA 5HILA 3FUTA 3DXZA 2AOWA 5K8VA 1NE2A 3AJDA 4FS8A 1X1BA 3P2EA 4PYJA 1D2GA 2IBTA 1SG9A 2AOXA 3A7DA 1N2XA 2YXEA 3EVEA 5EQJB 5DRTA 4EKIA 5KS2A 3KU1A 2JHCA 2PX4A 3FPJA 4RTOA 4C08A 1RI1A 2Z6QA 5GIPE 3GXOA 3PTAA 2PT9A 2G72A 4QDJA 1JG4A 4QPNA 3NMUF 1ZGAA 3EEYA 2JHPA 3G88A 3CC8A 3EVGA 3DMHA 4GEKA 5LSAA 2JJQA 1D2CA 1RI5A 2G71A 2H00A 3M70A 2ZWAA 2XYVA 1R6AA 3P9NA 4U7PB 4PCAA 2H1RA 4F84A 3KQYA 3L8DA 3P9IA 5DTQA 2FPOA 2VDUE 3ER8A 2YR0A 3RODA 2B9EA 3D2LA 3I64A 5CUQA 1P1CA 3K6RA 2ZZNA 2KW5A 2Z6UA 1UWVA 4P7GA 2UYCA 5LQJA 1G6Q1 1ORHA 3DULA 3M6WA 5CM2Z 5HEKA 2ZCJA 5GIOE 3SX0A 3I53A 2IFTA 3UFBA 4AUKA 1FP2A 2OB1A 4DZRA 2ZBRA 4MWZA 2E5WA 5JR3A 1KXZA 4BY9E 1B42A 3AXSA 2AN3A 4EVIA 2IDKA 3G2PA 1G8SA 3B5IA 5M5BA 1NW8A 3UBTA 3BT7A 4PYIA 2WA1A 4R05A 3NJRA 1JG1A 4M37A 4XCXA 4GBED 3MQ2A 2BH2A 4DA4A 5HIKA 1FBNA 2PWYA 1G8AA 4GOMD 3B7PA 5GP1A 4PGHA 1O9GA 2PGXA 2IGTA 5DM1A 3GRUA 5CVVA 3CJTA 3FTEA 1QZZA 1WXWA 2VZ9A 5GM1A 1YFJA 2CMGA 2PBFA 1HMYA 2GA9A 3K0BA 2IH4A 2YXDA 3B3FA 5E1BA 4PYMA 3G2MA 1U2ZA 1X19A 1X1AA 4PIPA 3HCBA 4RVDA 5FCDA 1SKMA 4HGYA 3EVCA 5F2KA 2HR1A 5E8RA 2AN5A 1NW5A 4X63A 4C06A 3P71T 3P8ZA 4MIKA 4OQEA 4RTQA 1VIDA 2CKDA 1ZGJA 1NW3A 5EPEA 3UWPA 4CTJA 2UYHA 4V0RA 5DX1A 4RTLA 4E30A 3GCZA 3EGIA 4M38A 4OBWA 4R6XA 4XUEA 3AWIA 1XVAA 1AQIA 3GO4A 1KYZA 4PIMA 3T7RA 2IBSA 1V39A 5DRYA 4DCMA 5CVDA 3SSNA 3UJBA 3B3GA 1WS6A 4K6MA 5EG5A 3NDJA 1G60A 5H02A 4RTJA 2PV0A 5CVJA 4AZWA 3GU3A 5MHTA 4F85A 5FTWA 2AN4A 9MHTA 4M36A 2GAFA 3G5LA 3M6VA 4UOEA 2UZ4A 3ERCA 5CVEA 2ADMA 5DWQA 2Y1XA 4HTFB 5EKXA 3G2OA 2PXXA 5CVUA 3DXXA 3B89A 5EGSA 3HCDA 1JG2A 1RJFA 1TW2A 3HCCA 5HFJA 5C0OE 5C1IA 2XVAA 1IY9A 2PKWA 2JH8A 3ANXA 4FT4A 2Y1WA 3MTIA 5D1HA 1ZQ9A 5EMJA 4EKGA 5K0GA 2YTZA 3MCTA 5GINE 3BKXA 3HVHA 3Q7EA 2ONZA 1R8YA 3KPUA 2BZGA 3BGIA 4G56A 1N7JA 4FSDA 2BR5A 2ZBQA 3OCJA 4KVZA 4KW7A 2ORED 4FSXA 2IPXA 4P58A 2V74B 3RIEA 5LQCA 4GOND 3HM2A 5FWAA 2DPMA 3UA4A 2ZW9A 3OE5A 2EX4A 1JQ3A 2AZTA 4YUYA 3GRRA 3HVIA 5HIIA 3JWJA 5KQRA 1EAMA 2F8LA 4PONA 1BOOA 3DP7A 3JWIA 2LD4A 3UJCA 2XVMA 3NTVA 4FT2A 2JHAA 3LECA 2BR3A 2PX2A 5K0EA 3LDFA 4GOOD 3BXOA 1R8XA 3EGEA 3SVZA 1MHTA 2PWPA 3TLJA 1SUIA 1SQGA 1KP9A 2C7OA 5E2AA 3O4FA 3UJ9A 4WVLA 4YMHA 1QYRA 2GPYA 2OBFA 3KQMA 1P1BA 4ZTBA 2I7CA 3DR5A 3M33A 2PX8A 2OB2A 4XUDA 3PB3A 5EC8A 3TKYA 3E23A 5LQUA 1JTEA 2C7QA 1NBIA 3EVDA 5EHIA 4FR0A 4ER6A 2AR0A 3E7PA 5LQRA 1JG3A 2WA2A 4DKJA 1VBFA 3BWCA 2CL5A 5KQSA 4X41A 5DM0A 4PNEA 3EVZA 1X1DA 3P2IA 4RYLA 7MHTA 2HNKA 2P7IA 2NXNA 4C05A 4JXJA 3ME5A 3THSA 5HOQA 2IH5A 3C3PA 4Y30A 3I9FA 5C9ZA 4HTFA 2ZIGA 2I62A 3UZUA 3LPMA 3BZBA 4V0QA 5E9JA 1EG2A 4GC9A 5JUWA 4GC5A 5IKMA 2P3QA 2P3LA 5E9WA 2VDVE 2QYOA 5FQNA 3VC1A 2G1PA 3CBGA 2NNWB 3AXTA 1NV8A 1UIRA 4HH4A 1Y8CA 1VQ1A 3AY0A 5FHQA 5GWXA 1NW6A 1IM8A 2HTEA 3A4TA 3DUWA 1JTFA 4RTSA 1L3IA 4MHTA 2O57A 4AZTA 3TOSA 3FPEA 3KPVA 4E2WA 1KPHA 3R3HA 4KIFA 4POOA 2XYRA 2B2CA 4HSGA 3EMBA 3IV6A 5DX0A 4CKBA 4OBXA 5K0CA 2YQZA 3BGVA 4LECA 2EFJA 4YUXA 2QRVA 1WG8A 2R6ZA 4PYQA 3IEIA 3TPZA 4BP3A 5DTMA 5DX8A 3DLCA 3TQSA 3MB5A 4GQBA 2NXCA 3FTCA 4KDRA 1HNNA 3NVKI 3JWGA 4RTMA 1WZNA 4GF5A 4ISCA 1QANA 3M4XA 2UYQA 2I9KA 2ONYA 2YXLA 3KPJA 1QAMA 3KQPA 4BLVA 4E33A 1EIZA 3KR2A 1FP1D 3R6TA 4RVFA 4OA8A 3Q87B 5ICEA 2QE6A 5K05A 1QAQA 2H11A 1PJZA 4X61A 3R24A 5U4XA 5CD1A 1VE3A 1WXXA 4E70A 3P9KA 1M0EA 3U81A 1XDZA 1H1DA 5EMKA 4QDKA 3UJ6A 5LR6A 2UYOA 5EHGA 2IH2A 2VDWA 4P7JA 1JQDA 3ID6C 4RTRA 2P3OA 3HEMA 1KR5A 4AX8A 5HZMA 5K0JA 2NP7A 1OR8A 2O06A 1F3LA 4RV9A 2GS9A 3C6MA 1T43A 1YUBA 3MAGA 1VP3A 3GNLA 2I6GA 2IP2A 3NVMB 3OFKA 4E2XA 4E32A 1ORIA 4MTLA 5DXAA 1O54A 4YUZA 4ER7A 1EJ0A 1Z3CA 3P2KA 2OZVA 2G8NA 3G8AA 5EMLA 2PVCA 3LX6A 1ZG3A 1XXLA 3FPHA 3KPYA 4HGZA 1RI3A 4YUVA 1JSZA 5BW5A 8MHTA 4ATNA 3PFGA 1G38A 4YV2A 3A25A 1KYWA 2QY6A 2BR4A 3PVCA 4DMGA 1JR4A 3HCEA 3KKZA 4PYOA 4CXMA 5FWDA 4NECA 4OX9Y 3V97A 5K0FA 5HIMA 2JG3A 3SSMA 3O31A 4DCGA 3KQQA 4QVGA 5K03A 1YZ3A 4X1OA 1KPGA 3EEOA 4RVHA 4IWNA 5K0NA 1ZKDA 3VC2A 3LCUA 3PFHA 2P7HA 3FYCA 5LQAA 3OU2A 1NKVA 3QV2A 3CJQA 1YZHA 5DXJA 4Y2HA 4P7KA 1R18A 3DLIA 3KQVA 3FTFA 5EVJA 3R0QA 4KDCA 1SUSA 2XYQA 3A7EA 3MCZA 2IDJA 4QTTB 5GOZA 3H2BA 3HP7A 2P41A 3E8SA 4OA5A 3G5TA 5FA5A 5T67A 2B25A 1EJ6A 3ER9A 2ESRA 3HNRA 2YUIA 4H0NA 2DULA 3HCFA 4X60A 2K4MA 4YV1A 2HWKA 3OPNA 5D1NA 1L1EA 3OU7A 5DSXA 1R00A 3A27A 5GM2A 5EEGA 3LKDA 1IXKA 4ER0A 4A6EA 4C4AA 3I58A 3B3JA 4WXHA 1JSXA 3UJ8A 2HV9A 3GRYA 4RSRA 2ZVJA 1N7IA 2NXEA 2ZBPA 3M6XA 5CCBA 1AV6A 2O0LA 1VPTA 3THRA 2GB4A 1F38A 4IV0A 4RTKA 2PXCA 3SR4A 5F2NA 1DCTA 5EZSA 4ER5A 5P8WA 2PSSA 3DXYA 2GH1A 2AOTB 3HCAA 2ZFUA 3FTDA 3DH0A 5EZQA 3TM5A 1BHJA 2PJDA 3G8BA 3KR0A 2ERCA 2CWWA 3LL7A 3G2QA 3BWBA 3P9CA 3M6UA 5E2BA 4R8RA 2EG5A 5ERGB 4KIGA 3S68A 4C03A 2NXJA 4XUCA 3X0DA 1NW7A 3EVFA 5EIFA 1SVUA 5FHRA 3HVKA 3OZRA 4RWZA 5K0BA 5E1OA 2AVNA 3DOUA 2AOUB 3SSOA 3HA5A 5IH3A 1AQJA 2FK8A 4YUWA 4OQDA 5K09A 4QTUB 2ZLBA 4LWOA 1RJGA 3LHDA 2A14A 3KHKA 1EQAA 3EGVA 3ELDA 4PGGA 2EJTA 4GOLD 3SXJA 3TRKA 2PX5A 2FCAA 3LCVB 1TPYA 2G70A 4C07A 1G55A 4CKEA 4ER3A 2Z6AA 3FUVA 5FUBA 4DM3A 1KIAA 2WK1A 3LSTA 2FYTA 3WSTA 3FUWA 3LGAA 5F2OA 4YMGA 5DSTA 1P91A 2N47A 3CVOA 3KQTA 4RTPA 1YFLA 3LDUA 3GGDA 1Q0TA 5FQOA 4AZSA 5ICFA 3DTNA 1UFKA 3IHTA 1BKYA 3BWYA 3LKZA 1P39A 3MGGA 3OE4A 3QOWA 1L9KA 4R8SA 2AOTA 2B3TA 4QVKA 2AVDA 3HA7A 2AOVA 3LBFA 3KQOA 1XCLA 5DPMA 4DF3A
chains in the Genus database with same CATH superfamily
4HVCA 6GPBA 4AJ9A 2ZT6A 1XNGA 1ZGCA 1W73A 3GPBA 1Q84A 5LMNM 7CATA 3NOOA 3C6KA 4EHNA 2GCGA 3DHWC 1ETUA 1VB3A 4FZVA 4EG5A 2AD1A 3HX3A 1NFQA 5IX8A 1O3YA 3RG2A 1KDTA 1VL5A 2IHNA 4FX5A 4QFCA 1H0HA 3EG5A 4ZQEA 2FMHA 3HU5A 3PD7A 3U4QB 1AZTA 1NNJA 1L7BA 1V8PA 2WJHA 2XUPA 1XCBA 4NRVA 2PKYX 2QSYA 3TNYA 4WXRA 3T38A 3D8LA 2VWPA 4RSHA 1PSZA 2ZSDA 2FG6C 2LH0A 1CEXA 3JWHA 4F1JA 1UBGA 3ZWDA 4BVJA 1T4DA 2WG1A 3EIOA 2CFCA 3ND9A 5KPDA 4MQ4A 2G7MC 1JQEA 3D59A 1RYFA 3GNSA 3FRHA 1FU8A 1QBGA 1FYVA 3HVJA 3N8HA 4UM5A 5LBUA 3TNJA 3TTXA 2YVQA 2CFRA 4XFKA 2ZE8A 2ECPA 2XI4A 1JVBA 3BIOA 3CJRA 3UWMA 2IP1A 4HX2A 1PGPA 4HR7A 1P29A 4NFSA 3T4UA 3IQHX 1YF3A 2ZJ4A 3F7NA 2J08A 4WXMA 2AFIE 3WRXA 5HX7A 4DY4A 3R3YA 1ZVJA 2RHGB 1PE0A 5CVTA 1FK8A 1MC5A 5JD4A 1MTZA 1Z4OA 5DWVA 4O4LB 4B17A 2FEPA 2DKLA 4CQMB 1LD3A 4OFXA 4GKVA 4IS3A 4ZKEA 4RM2A 3SLRA 3O8BA 4E31A 2V7GA 3ZE8A 4LNHA 3K2BA 1NBMD 2DKOA 3DMDA 4MCHA 5BSWA 1HG1A 3CF4A 1XCJA 1ZXLA 3ADDA 2IZ6A 3G1WA 4G26A 1KI9A 2OV1A 2VQSA 2XCIA 1SZPA 3FJOA 4KQ2A 3ZUGA 2HWYA 1A9ZA 5F77A 1W2GA 4RX1A 3VPDA 4ZYVA 1CQPA 3CNQS 1JJ7A 1ZNYA 2HJVA 3AGPA 1MQ8B 3MFYA 4Q1CA 4WT7A 4BO7A 5C37A 5CEEA 4G5SA 4V0OA 4RACA 3MJSA 1U4SA 2EKKA 1VHTA 4WH0A 3UK6A 1A4XA 1R5JA 1X7DA 3L4EA 2GQ0A 2ZULA 3IKTA 2HCFA 3GJ6A 4LHYA 2ZRGA 3AFOA 2JGNA 2PGOA 3H5NA 1LTHR 2WIGA 1Y34E 1E3IA 2CF6A 4LUCA 4MKZA 4PAGA 5LXTA 2GYUA 1WXEA 3HKDB 2VHYA 2QOEA 3FBGA 3OCWA 1L0BA 1IVNA 2Z3VA 2DHYA 4PT5A 5B1YA 5DISB 2FRXA 2VT3A 4B47A 2XTAA 4BMSA 1ECPA 2CMHA 2J6HA 1F17A 3B12A 3IE0A 4MIOA 2MR6A 1SWVA 5HKBA 4L4YA 3WV4A 4JC8A 2YNMC 1NTRA 3UCEA 2B69A 1W9HA 3B1FA 2Y77A 2P40A 3QENA 4M22A 4R5HA 1VE1A 4W5HA 4ZC8A 4GNRA 1NW4A 3EDYA 2FE8A 3I72A 1WJGA 4TMKA 5TQ0A 3ZDQA 4F9TA 2YCLA 3H0CA 1PEKE 1YZKA 1ZBQA 3G2JA 3R7DA 4ZICA 1IZ8A 2V6ZM 4A8JB 1QX4A 3CLTC 3CA8A 5ALZA 4C7BA 1PJSA 1G17A 1EGVB 2HDWA 3WIVA 4BQIA 4L8WB 4U7FA 3VH3A 5HUJA 1U9ZA 2QP4A 1UPTA 3QLUC 3T3OA 1I2ZA 1Q11A 3HUDA 2FVXA 3T9AA 5CBPA 3D6VA 3PUHA 2VXCA 1DBWA 2NYUA 3TR6A 1NG9A 2JZOA 4D4LA 3I9NA 2F5QA 2MGWA 1P1RA 4IYRA 4N54A 4NPHA 1QH0A 1VBNA 2WM9B 1FFSA 4GVLA 3K1ZA 5D6OA 3TINA 3VMFA 3ZKWA 5JS7A 4E11A 2GZMA 1E6CA 3KEFA 1Q39A 2F5SA 1M1NB 4LFBM 1KP2A 4R69A 1MO3A 3UHAA 2DPXA 2AOXA 1OJ7A 5L3SA 1U5CA 2R1VA 2HT1A 1H2AS 2PX4A 2ZM6B 1FYXA 1GQFA 1PKXA 3OA2A 3FNRA 3QU7A 3DEIA 2OHJA 1HYQA 5L8RF 4R83A 2HMVA 3PNKA 2GERA 2VDWB 1C3XA 4KXWA 5K2OA 2NLOA 3HC7A 2WUFA 4M0DA 2IA5A 5BN5A 4GEKA 4OHYA 1PLKA 4C6SA 5LKRA 4N65A 1GPUA 1DOHA 2BCJQ 4Z7JA 3DE4X 1NN5A 3EFOB 1PS8A 3H1AA 3HHYA 1ESMA 3L6OO 4I4IA 2CXOA 4HLCA 4IP0A 3FOBA 2C3MA 2BHSA 4I1IA 4WMLA 4B3JA 4UUNA 2QZZA 2YR0A 3DAGA 4ZEWA 1GOTA 2GO7A 3H5WA 3GMTA 3KO8A 5EL0A 1KQNA 2OXEA 1OBFO 3X2FA 1UXGA 4GX0A 5JZOA 2HADA 2UYCA 3IQGX 2ORWA 2X15A 4GEGA 2JVJA 5JVDA 1Q7BA 2FE1A 5FIUA 4XJSA 4R01A 1OXBB 3UFBA 5HPYB 5KX5F 1MBZA 3KKOA 1F6BA 1UJ4A 3KZNA 5EP4A 2IUSA 2OTCA 2Y1KA 3DMNA 5EE9A 4B40A 2BSQA 2QTRA 1B8UA 3B5IA 2I2CA 4B3DA 5M5BA 3BT7A 4PZPA 3U44B 4G25A 5FPHA 3A8TA 2YUTA 3TVYA 4G3OA 3LQ4A 5AFSA 3E22B 1IUOA 5FOXA 1MABB 2MCFA 2FSSA 5GADl 1W0KA 3U3DA 1IXSA 2AIRA 2FZ5A 3GRUA 1ZD1A 2IHUA 3BQ9A 3JR7A 3NHBA 4DV2M 3MT9A 1TEXA 3PEUA 4O2AB 1HGXA 1KP3A 2DWCA 4NBTA 4RYDA 1VYVA 2D54A 4RMHA 2GKGA 2PGAA 4BFSA 4LY6A 4BU0A 4FOLA 4TYMA 2I2WA 2QTFA 1E60A 2DWZB 4CM9D 3ZHXA 1XDDA 2B34A 1U98A 1R37A 3QBEA 2ZYRA 1K0UA 2VH5R 1WTAA 1C7RA 3GELA 4IJUA 1LRLA 4RGQA 4IXNA 4X63A 3USZA 1MN6A 1M1XB 6Q21A 3NUQA 4FCWA 3ZHCA 1X3LA 1J9ZA 2FSHA 2R4QA 3GRCA 4Q37A 4UULA 4EI7A 1A95A 4Z0HO 3L7JA 1WTCA 1WV0A 3ILKA 4QWWA 3DD5A 3A0RB 4MLCA 1RRVA 4KACA 3V4SA 5DASA 1GY8A 1OZFA 2R44A 1N8KA 1NFFA 2XZTA 4R6XA 1JECA 4J16C 4ZO6A 4BO9A 3JVUA 3MOGA 3L02A 4BMCA 2HRDA 3L0DA 4GH5A 3SC2B 2DERA 1FTNA 3IJRA 4IGAA 2QXUA 1PF7E 5JBQA 3J27B 2VP6A 3DOOA 1G60A 4D41A 5CVJA 2JVKA 2C4WA 3NOXA 1WMSA 2VDOB 4G0NA 3K35A 4I5DA 4IIUA 2XB2A 4HLUA 1ETHA 3E82A 2JLAA 3AZQA 3ORQA 4IXDA 4O33A 2AXNA 4KGXA 4OYYA 3RC3A 2V3WA 1KORA 3J7TA 2XUQA 4IDHA 4L3VA 2CLHB 4OX9M 3ECSA 5HFJA 2WAAA 2GM3A 3HCDA 3TLGA 1PT9A 5AMXA 3D8RA 3IQIX 2R6HA 2EZ8A 2XVAA 1FFBA 4OF4A 5EXPA 3WDSA 3GLFE 1KBZA 2X9LA 1HYGA 3GUHA 3OTGA 4JU9A 1JKMA 4FWTA 2HCJB 3BXHA 1F8UA 2PLNA 3AX6A 3A32A 2B8EA 4DEXA 1PFYA 1QDLB 4MVJF 1J00A 1UPXA 5TPZD 2O54A 5HJ2A 1V45E 4DM7A 1UM9A 2Q9UA 5BR4A 1II0A 3H5IA 4TLCA 5CXXA 1RPNA 3LT2A 1XEFA 1DEXA 4LWZA 1P8AA 3AR5A 3UKDA 3ODPA 2AJLI 1QG4A 1E1CA 4B3XA 2FMKA 4POAA 2XQIA 4HDMA 4Q16A 4B3RM 2BKAA 4QO8A 2M9MA 2CYCA 3S2YA 5LZ4A 1QV9A 3N6VA 3ZJ4A 4AJOA 4GUDA 4NMXB 2LD4A 4ZAXA 2HSWA 4MQ5A 4N40A 3AL0C 3PD0A 4REOA 4X85A 3RYIA 4ACAA 4B3HA 3CG4A 4EYSA 4LDQA 2BR3A 1Z5PA 2EFCB 2OT3B 1ZM7A 3IMKA 4UCFA 4EZIA 5JRZA 2N0SA 1T1RA 4D4IA 4EELA 1Z7YA 4I1SA 3PDIB 2ZVDA 2YIDA 4J1NA 1J5EB 1F9EA 5LZ9A 2BSXA 2HMUA 4FHGA 2FSUA 4ES6A 4JYBA 4YMHA 1N6NA 2ZE6A 5E95A 1HE8B 2Q5FA 1U9IC 4BFTA 1N1EA 3HNOA 4WHMA 3ETGA 2OO5A 5LQRA 1MQAA 4ER6A 1T3HA 2OYSA 1Z4KA 2XMPA 1PR1A 3CF6E 3BWCA 3IO5A 1SIBE 1GPBA 2P0AA 4JD5A 4M1EA 5JMTA 3W3AD 4TM8A 3EVZA 1C5KA 1EQ2A 1WCYA 2HHHM 2FPUA 3FKSD 4JP3A 4GRAA 5EJ8A 5HOQA 3FHTA 4D98A 1MABA 5EYPA 5ALOA 1J5PA 4YP7A 1Z2EA 1BVSA 1XP5A 5IAOA 5HCNA 4KQWA 5AK4A 4RZQA 2J9FA 5DFLA 3HU1A 3SMPA 2I6SA 1T3GA 3VC1A 1BCSB 1I2DA 1DTSA 5BORA 4E5VA 3BCSA 1J2UA 4MP8A 4W9NA 4EJSB 1YFKA 4HPJB 3NCTA 5K3FB 3RK4A 4CNQA 2XTNA 3QWBA 3MT7A 2O57A 1P80A 4I5EA 2B7LA 5FNZA 2VP9A 5B5SA 5CFNA 2WJAA 3RROA 5KEIA 2QE7D 5CK5A 1W47A 4UZSA 2UZ0A 1DXQA 1D8TA 1ZN8A 3CE6A 3MBOA 3R3WA 4MCJA 3NYWA 5AK5A 5EIXA 1HYHA 4LQCA 1XN4A 2NTNA 2Z9CA 5HTOA 2AFHE 4AW4A 1U1FA 2CDAA 1Z6TA 4TN5A 2Z3XA 1E9VA 1J22A 1V1MA 1X80B 2HRQA 4MYUA 1QRAA 3OEED 5E7IA 2C5GA 4DAOA 5FPKA 1OB2A 3W1EA 3FTCA 1S3IA 3PGXA 3FD9A 3TQOA 5EUBA 3PXCX 3D5EA 4NX2A 1GZ6A 5B1IA 3WLQA 1RZVA 1W2WB 4MWTA 3DGFC 2Y68A 4BGVA 3C7AA 2HX1A 3MGKA 1YASA 4D0RA 1FP1D 4HAZA 5I4KA 2CLLB 4LXHA 3S40A 1FDUA 5JZ9A 2B2XA 2H2FA 2W98A 3H87A 4E70A 1H1DA 5LP1A 1N2CB 2OBNA 1C1KA 1XD8A 3TBHA 2FFAA 2FGJA 4FN4A 3CUEF 3STVA 1NSYA 3M34A 5IT4A 3AVWA 3Q3GE 4BBAA 1W5SA 2PKXA 3OFND 3O8OB 4H1TA 2L7IA 4HMPA 4MVJG 3OZBA 3S99A 3KB1A 4RJLA 4K9SA 4BZPA 3UXMA 1L4NA 1P9WA 2XZDA 4MW1A 4YJ3B 3RVRA 3VVMA 2GXUA 3WNDA 2R0QC 3KVRA 4EPYA 3WQQA 4NCJA 3GNLA 2IP2A 1XVVA 1U0JA 3AF1A 4OAOA 1NR1A 1GG8A 2XSZD 3JVIA 3TUJC 2C82A 4ER7A 1UR5A 1FQKA 1XAHA 3BF7A 3BQNB 4FE7A 4GECA 1QTNA 4PPYA 1JH9A 3DBRB 2XD9A 4O4HF 4WCFA 5CM9C 4TTPA 4C4OA 1QOPB 4LJKA 3PQEA 4REQA 3BZUA 4E14A 2KYRA 1N3BA 2ODAA 4G81A 3A6ZA 4OU5A 4DV1B 2BKVA 2Y1FA 2H0QA 1M7GA 2COUA 4MQUA 1H6CA 4Z0NA 4CI9A 1N77A 1P0IA 3ZV7A 4Y1RA 2AW5A 2Y2VA 4OHUA 5LOVB 3VJRA 3QYBA 1P3DA 3MCUA 1BXRA 4BWGA 4CL8A 1X74A 1WV1A 2I6UA 3ORRA 2QD5A 1XA3A 1QMGA 5ALPA 3VC2A 4XB6B 5C8YF 4BVEA 2OXIA 1GRVA 1WF3A 1U2GA 1JUDA 2A1UA 2ET6A 2YY5A 3ZDCA 2RFLA 2P4HX 1AKRA 5LBIA 3UG6A 2FI1A 5THQA 4UN2B 1N2JA 4E1AA 3ZCSA 5J3JA 2ECFA 4FNAA 2QUAA 1T10A 1UZNA 1I30A 3IUBA 1KI8A 4I1UA 3OLQA 4DCPA 4F96A 4AXBA 2SCUA 1OIZA 5DHSA 5BQXA 3T5AA 1OWLA 2NUTB 4ZRNA 1I3KA 2J7KA 3PNQA 4BGUA 4JMLA 3ER9A 3HJQA 3WSWA 1H65A 4QAJA 5AW9A 4BEVA 3LO5A 4H3VA 3IIJA 3CEMA 2JIDA 1PUIA 5LIPA 4JLSA 1FQWA 2ZETA 5GM2A 2YYZA 4QDZA 3MJVA 4Q3NA 3Q12A 3PNBA 3ACCA 3OX4A 4OMDA 3RUHA 3TS1A 1GTRA 2QTWB 4TYPA 3UJ8A 5DOVA 2FUKA 1Z2DA 3PDCA 4AP6A 2RGAA 4UFPA 1I1HA 3PC6A 4KNWA 4MQFA 1FVXA 4LDNA 3Q3IA 3EXHB 1OGJA 3FKJA 3S2FA 1P3JA 2PZKA 1D03A 4YI3A 3F90A 1TA4A 2G0TA 3LXXA 4NE2A 1L1FA 5A9RA 1A9XA 2HF7A 4B7HA 1WULS 4NC9A 4YBZA 2IU6A 2IGBA 4DG5A 2C2BA 3UWOA 3HHPA 3QPWA 2QV7A 3VFDA 1QNLA 3B9BA 1M8FA 1DJMA 3VU0A 2VHZA 3DT6A 3HFJA 3RKRA 4MOWA 1ZI8A 3PP8A 3HA5A 4MV8A 2VP4A 2VWGA 4M7WA 3L2AA 3UMMA 2JASA 5TQ2A 3OD1A 3NV7A 3W34A 4CQJA 5FJIA 4N7RA 5FNVB 5CGZA 1M8KA 3HNPA 1E18A 3KHKA 4TMVA 1KARA 5G3ZA 4EHIA 2FOXA 2WAMA 1JEQA 3KOMA 1UJ2A 3Q8MA 3HY5A 1US8B 1ZVKA 2GJKA 1IOWA 4G0OA 3FNFA 4RIGA 3DZJA 5F12A 4Z9AA 4KPUB 5AOCA 6REQB 2BVNA 4TROA 5JG7A 1ESNA 2JGMA 2NSYA 6ADHA 5CB4F 3I9V6 5F2OA 1G1MA 3RR2A 3RK0A 4XEHA 5G3YA 5IT5A 5KB3A 3Q8GA 1Y1TA 3H5AA 4G4QA 3JR4A 4RHCA 2IYZA 1UFKA 4JH0A 3T15A 1UZMA 2X4IA 4PLTA 4L75A 1L9KA 2IP4A 3EGXB 3QVOA 4BX9A 4TN1A 1PL7A 4C6HA 5DPMA 3DKIA 1HUQA 3I0NA 3KYIB 2Y0TA 5IJAA 4OQYA 2BBSA 2JFYA 1DO2A 2HEGA 4IVPA 5HJ5A 5KJ6A 3W5CA 2Q9AA 5BNWA 1E3WB 3C5CA 3A2LA 1FTSA 3F4KA 4LSMA 1FZQA 2R2GA 4DREA 4DQ0A 2BKUA 3B51X 4NLLA 4WZAA 3GVHA 4Q4DA 2EZUA 3RC2A 1C30B 1NI4A 2F9MA 4UC0A 1WDTA 2O2ZA 3BD7A 2YZNA 3Q0EA 2JH9A 4LHSA 2XMDA 3UA3A 4F4IA 4P2BA 2FDCA 3PC2A 3GEDA 2VK8A 4KXUA 4DLYA 3C1TA 2IYXA 2CHFA 2KLBA 2PNFA 4EX7A 1EP1B 3JD0A 2K2WA 3LCMA 1GWNA 2R7LA 3REQB 4EHKA 4BCDA 2YVLA 3X43A 5JTTA 3OY2A 3TLXA 3U7QA 4AW9A 3QKUA 1QOQB 3RAFC 1XZGA 3ROTA 3W8FA 3BFKA 1UK8A 4HRVA 1Q0SA 2A1TR 3NHKA 4IV8A 1QTQA 2DHCA 4PC6A 1XB2B 4CKYA 4OXNA 4BLUA 3EMKA 4YV0A 1V7QA 1K8YB 4DJFC 1T4MA 1UFQA 2LDXA 3KRTA 1G18A 1KMMA 2AG1A 1UIMA 5T41A 1AHPA 1P4AA 3J7AS 5JDIA 4LJYA 2OM6A 2AG8A 3NW9A 4TVKA 3RE1A 1EM8B 5HK8A 1OLUA 3GP1A 1QBKC 1DWPA 3AOGA 3P9YA 2R8OA 3F47A 3T3HA 1CC1S 2VAVA 4RGBA 3HKBA 1M2GA 1G6OA 1VLMA 1WNFA 4FEGA 3QKSB 3RC8A 4ZEVA 2POQX 1I3NA 4PBSA 1TKCA 3V8NA 1FXUA 5E0OA 5BSEA 2PZAA 3H7IA 4FX2A 4MGEA 2H6EA 4RMGA 4HEHA 4CIYA 2QLFA 1A2KC 3V4FA 4WRRA 3DOIA 1EHCA 2J85A 1C8KA 2JCVA 3F0TA 4CL2A 3KS8A 4ZARA 2VQ3A 3EXHA 4HN9A 3SFZA 1RJ9A 2RI0A 5IF9A 1Z5VA 1Z35A 1B3BA 4K28A 1TMKA 4M83A 4EFKA 1Q22A 4G6ZA 4KN9S 1XQ1A 4K26A 1GKLA 2FFJA 2X7HA 2R48A 5HA5A 1ZMVA 1IJBA 4XX0B 5B2FA 3C3WA 5MF6A 3TQHA 3T3IA 2ZRCA 2O3JA 4EVQA 1ICIA 2E4UA 5DYYA 1E9AA 2OVBA 4KWCA 4O2RA 3W78A 3PGJA 1OXUA 4WJLA 2VSOA 5F7ZA 1EIJA 3W90A 2ZTMA 4O2LA 5M34A 3B60A 4DLWA 2HZ7A 4IIWA 1JIXA 5FL7D 3GLGA 4NAUA 5T3YA 5IEBA 1DOZA 3PPIA 1MOPA 3K6JA 3UB3A 1OI3A 3QA3E 5G4LA 2TMGA 2D0PB 2O7VA 1JU9A 1WZCA 2HM7A 4EA7A 4CEHB 3NTQA 3AKEA 5KHAA 3D4LA 5IK2D 4TUYF 1JEJA 2I6FA 3ENZA 3K6SA 5A4MS 1BOFA 1L3CA 1P7PA 1SVLA 3L7YA 1DEAA 1NL3A 3CRQA 3JQ8B 3P26A 4LXXA 4A7PA 1XUOA 1X2EA 4MRAA 4YYZA 1JWLA 5A4IS 1WY5A 3CW9A 4Q1DA 4N6OA 3UYKA 4V0LA 1BU8A 1MV8A 4BNLA 3AVVA 2AMVA 1V9SA 3FM9A 1I4WA 3N28A 2P2YA 4G1EB 3ZKAA 4ADSG 4B3CA 1FJXA 3GRZA 4EY8A 3MHTA 3HB5X 2GD1O 4DIMA 1L4GA 3N2KA 2EJSA 3RQSA 3C0KA 4F1WA 4FK8A 5L4LA 4GLJA 2NVUA 2WINI 1VFNA 1F2TB 4UBMA 2VCHA 1Y8QB 3TW6A 2C98A 3HHZA 1SIOA 1CUDA 1GYPA 1JALA 1QCCA 1ST2A 2ZAIA 3OKPA 4OJQA 4RHYA 2FB9A 2IOQA 1MEJA 1A0OA 1YS7A 3F5FA 4EBBA 3DO6A 4EPRA 1XL0A 4LF4M 3ESBA 3OZGA 4M21A 3RS2A 1N5OX 2IEYA 1M5TA 2VTDA 3ETNA 3V1MA 4FDTA 1GPKA 3MIZA 1CU1A 4RHTA 1PEAA 3HKCA 4QD3A 1PGNA 5AXBA 4TKUA 1BW9A 3SHGB 1XROA 2E89A 1ACJA 2WJ4A 5DF1A 4CV0A 5I45A 2H51A 4JSTA 3VC7A 1S2NA 5A6SA 1UQRA 4IBJA 2ZJ8A 2VNHA 1OAKA 1CF4A 1P6XA 3S2GA 1W93A 1LBQA 2FPOA 4GGOA 1JZSA 4JB3A 4LZZA 4IIGA 5C1BA 1BKDR 2W2PA 4YCJA 3USCS 3WO0A 1L5QA 5B3JA 3BEDA 3L07A 4RXMA 3TXXA 4QFMA 2QY9A 4B4UA 5ARDA 4WEOA 1X7YA 1NJSA 2WLTA 2ZCJA 4Y2VA 1U5AA 2C0PA 3IAXA 3VPCA 3G9UA 1K5PA 2O50A 4FOPA 4MULA 1E2EA 1ZW6A 2WHPB 3JQ6A 3NWPA 2HLDD 2IDKA 3BBLA 5A5VA 5C1PA 1TU4A 2ID4A 3C5VA 5JCXA 5KTRA 2B92A 4BAGA 4ZMSA 3D8BA 2D62A 1A82A 2PWYA 4OJYA 2Y0EA 1TKAA 4EL5A 1W34A 1O9GA 1E69A 2JGIA 2PGXA 2QN2A 5AKLA 3ZNOA 5DM60 2GRUA 3QBDA 3RSGA 1L7QA 2AR9A 3FTEA 1JDBC 3I6BA 4M1YA 5JAIA 1Y1LA 2X5NA 2ACVA 1RAEA 2PBFA 1ISJA 1HNWM 3K0BA 4QOFA 4HH0A 4PSCA 1LSUA 4V0NA 2JCYA 4MUAA 5HF8A 3NUZA 1XZPA 1U2ZA 4KFRA 2WIFA 5C4IA 9ATCA 4FYVA 5JJIA 1DKPA 3TD9A 1ZNQO 4ZOLF 5INTA 5TV2A 3GPLA 1Z74A 5AT1A 4PAWA 5AUNB 2G76A 1BVYF 4EG4A 1AURA 2IYSA 3ROPA 3W9BA 3K70C 3KZCA 3E5NA 1MB2A 4DGSA 4ZOAA 2CLIB 3QG1A 1KE1A 3ZLTA 1O58A 3KDPA 3FTPA 4HDQB 3FH0A 5DX1A 4OLBA 2HHLA 2F3QA 3C39A 2A9QA 2I87A 3OA0A 1V16B 4ZT6A 4JUBA 5DLEA 5LMCA 4JB8A 2P67A 4R3UC 4OVZB 2HGZA 2DTDA 1UF9A 4QUEA 1RYEA 4RFSB 4X97A 3O2SB 5KTNA 1W48A 3H13A 1ZGBA 3QVSA 6NULA 2IUFA 1E3LA 2ZBUA 1ZLYA 5MHTA 5EJ4A 4ZGGA 2GXQA 1VKOA 1QIIA 1EGHA 2PFSA 3D4IA 4MQ6A 4BQNA 3IEMA 1VCMA 4PCVA 1M34E 4WQMA 3ELBA 3M6MD 2GPBA 1CSEE 1RW4A 3I04M 3A1FA 3FROA 3KHSA 5BURA 4G0WA 1VA4A 5C0OE 5JDIC 1N0VC 1CUSA 1A9YA 3NHPA 3MS4A 3WGKA 2QW0X 4ZIRA 1A1SA 3W9SA 2JH8A 1PGJA 4RV5A 4EKGA 2EERA 5EMJA 2IV7A 1XLWA 1WOMA 1JIVA 4I50F 3VHQA 3OMXA 4E5PA 2FOIA 1TUBB 1GYQA 1Y6RA 1TM2A 3CT4A 4ETWA 3GLHE 2JS7A 5JU6A 3C1OA 3T9CA 1SVSA 3KFLA 4KW7A 2CV1A 1SQ5A 3AB3A 3SAUA 1Z5WA 3WKBA 5DHAA 4BHTA 3DC2A 4IOJA 3QV1A 3GFFA 4MZDA 3EXAA 1VE5A 3R7SA 3S1LA 4D92A 1UK9A 2Q5IA 4Y18A 3UCFA 4Q9AA 5K3AA 2R87A 4PANA 5LA6A 1AK9A 2OGWA 2XQGA 2XZFA 2Q1TA 3UB4A 1MENA 1KZ7B 3LDFA 4YHBA 4CIDA 2ODPA 2C92A 1P0CA 1Q50A 2O5RA 3H1PA 3CH4B 3IFSA 4NYJR 4AZ0A 3PQ3A 4DKXA 3IDZA 3KXIA 4D6YA 3O83A 3RGGA 1ORYB 3JAWA 5JS6A 3PU6A 3QFCA 4AD8A 1Z0UA 1M1YB 3SMSA 1M83A 3VZRA 2EG9A 1P3QQ 1GZ5A 5KNCD 1NMSA 1VBFA 2B37A 4OLHA 3TL4X 2APLA 3VM6A 2IHYA 3ZCQA 2Q5CA 5L3SB 1FFXA 1E7YA 2GPTA 3PRJA 3L6UA 3P2IA 3UGJA 3QUSA 3VPXA 4MHSA 1GGHA 1P5JA 2RHDA 3J80S 4TWJA 2P9BA 3SR0A 4KLNA 1V2GA 4D42A 1N75A 2RHHA 3EHDA 4YRBA 1R10A 4Q9NA 3A37A 4L02A 3NAQA 1DIOB 1OC2A 1X7WA 1SVMA 2PSHA 4EF6A 1GAJA 5MN5A 2RHLA 3K9OA 2E1PA 4GM4A 4V0QA 3T5GA 3SHWA 1E66A 4NBRA 1L8XA 3UKOA 1GKUB 4R41A 5CURA 1KYXA 3S28A 4X65B 2QYOA 2IK8A 4Q24A 1QFXA 2YV4A 3LS2A 1PG2A 3HI6A 1CUWA 4DCTA 1JHXA 4MWBA 1E61A 2RGXA 1WQ3A 4IH1A 2CJWA 5ITYA 1H9AA 3QX8A 2WFLB 2QTZA 4XW2A 4EB8A 3HKEA 1DT5A 5HSGA 5I4IA 1JLLA 2FN7A 3B6JA 4POOA 4Q9IA 2QHXA 5DIZA 3BD9A 1HZZC 2EQ5A 2J3QA 3FOEC 4S24A 5DX0A 3LW8A 4W7SA 2CLCX 4MGKE 1G20E 2RGNA 5B57C 1EXWA 2RAUA 3MJCA 3UOGA 3BB3A 2HPVA 4RQTA 2X0EA 2IPMA 4FEYA 1GAXA 2BELA 5FBKA 5A03A 1I1QB 3M89A 2GTPA 5F5LA 2C5BA 4P80A 3HKPA 3F6SA 3DOAA 3EXEA 4ND5A 1B7GO 1DC3A 1Z4NA 2WLSA 2X41A 4YALA 1UT5A 3PC4A 1XZBA 4JGBA 4UHJA 2VHQA 1M2FA 3PGMA 4Y6LA 1FYWA 3H2ZA 5FLEX 3TOVA 2JFUA 1BWQA 1II8B 5SICE 3HJ8A 1A9OA 3TOCA 1HL7A 4BNUA 3OZUA 5DW3A 3X1WA 1QG2A 4B35A 1PJ2A 4UKDA 4CMBA 2ACEA 1C7EA 3R24A 4LVOA 3ANNA 4J3FA 1GN9A 3NX4A 4E51A 1Y82A 2L09A 2XUOA 4YJHA 1JSRA 4HWSA 3U81A 2Y05A 1U2GC 3R23A 4QDKA 4C0KA 3O94A 4Z49A 5T4BA 2XB4A 3TWMA 5BN5B 1YS9A 4CVNA 4D5GA 1LDGA 3L2OB 2O06A 2YIVX 1U0GA 4M8LA 1YRAA 4RV9A 1GVHA 2QMZA 2VWQA 1K27A 3M2PA 4EHLA 3VPFA 1RXUA 4D79A 2ZUFA 3U3RA 3TIXB 3L0YA 5BUSA 3PXEA 5KQMA 4WOPA 4MWCA 1Z3CA 4LF5B 5DTIA 2OZVA 4I5GA 4CT0A 3THXA 3B2QA 4MK4A 2O0MA 4AP5A 4CEIB 4P6VF 1BH6A 2AC4A 3O75A 3SYTA 2JXNA 5C9ZA 1YDWA 2ZRJA 5U9CA 1WBBA 1JLRA 4YJFB 1IAQA 2G8LA 3F6RA 4P9NA 1OF1A 5H9VA 3E9YA 3JYOA 4IFTA 3SSAA 1EHIA 3LXMA 1UXIA 2C54A 2D1SA 2PSJA 3DPSA 4JBWA 5F9MA 3KKZA 4R1MA 4PYOA 1FNNA 3OUTA 3KS9A 4QBFA 1Z8DA 3WLEA 1DIRA 1OWMA 2W6NA 3COWA 4RMNA 3Q11A 2XODA 3T3EA 1TA0A 3P20A 3KQQA 4FD3A 1IBRA 1L1QA 2ZJYA 4J2HA 2C9CA 1J7KA 4YN3A 5JWRA 3EEOA 5D51S 3LQFA 4JXZA 1NAHA 2M1ZA 4OTZA 1PT7A 4G4IA 4CL3A 4TVOA 4NQZA 4RZXA 1FFXB 4OD0A 3I8OA 1F8FA 3ENVA 1NVFA 3ZC3A 5IP5A 3DV0B 3P9XA 2FMUA 3AY3A 4L22A 4F1IA 4IMPA 1NF8A 5IT9S 1YCDA 2XCQA 3EGXA 5CAEB 5KU7A 1DKMA 2H5IA 2R47A 2FLWA 4UNQA 4CT4B 1W581 4KO2S 3TL2A 3G5TA 4LDRA 5KMGB 4I4NA 4NDZA 5G2OA 1W5AA 2HQ1A 2IZ1A 3DHNA 3HNRA 3WYAA 4DM4A 1ZESA 2QUIA 3GFTA 4WN9A 1RZRD 2RH4A 4N3GA 1KRXA 3CRMA 1U65A 4BRUA 4DV3B 5EEGA 3VR4D 4YJ3F 4A6EA 1KFCB 3N53A 2V6BA 2BCEA 2J46A 3ED1A 5JEEA 1OASA 2IHVA 3CWCA 4K6KA 1NQUA 2ZVJA 5CCBA 1SB8A 2KM1A 3EOAI 4PQEA 3LV8A 4WXPA 1T1EA 1PU2A 1SURA 4IH4A 1QQBA 2F3SA 5BUCA 4Z2AA 3EIQA 3VX3A 3B6KA 2WD7B 2GDZA 3O47A 5KI6A 3U3ZA 4EB3A 1AY0A 1I7DA 4NYIR 5REQA 4GOJA 5BSTA 1GO2A 1JSCA 5ALRA 3EBPA 5JLJA 3PC3A 3NATA 1AS0A 5E2BA 4YRGA 3ZZ1A 4RK0A 1SOWA 1SOUA 2ANBA 3NHLA 1W4LA 3C8MA 1JDPA 2YDYA 4BVBA 4DUGA 4NCBA 1K97A 1LLQA 2A5YB 1EM8A 3KSRA 1VPWA 3RTCA 1ZWKA 1Z2OX 2OD2A 3RDPA 2C2HA 1P72A 2PQMA 4BMNA 2HJSA 4ZFNA 5CLLA 3AV3A 3KW6A 5BN1A 1XP8A 1SEPA 3LHDA 3SIWA 2CV0A 2XLCA 3GK3A 2VPYA 3R0VA 1N5IA 1YZGA 1SPXA 4TZTA 1MGPA 4YRZA 4H2DA 2QNJA 4ZC1A 1BJRE 1GT6A 3KTAB 2D0OB 3D3EA 1CHNA 3ICOA 3WMEA 3AYZB 3NXKA 4U7GA 2O2HA 5JARA 3LGAA 1QUSA 3FDZB 1QXSA 3LOPA 4Q4LA 4Z86A 2O4CA 3WRWA 2GK3A 1JEOA 1NRWA 3L9XA 3ZE0B 5FBRB 2WM3A 1R50A 3IHTA 3W06A 1UEXC 1L4MA 2PWZA 1G5FA 2NQTA 3OE4A 2QPAA 5K1ZA 2R6R1 3FNIA 3A6LA 4UW9A 2CJFA 2FZEA 3KOZE 4PTLA 4B6QA 4ZU6X 1SC3A 2Q3CA 2JZ0A 3SN6A 4QQFA 1R0LA 3F6PA 3OX3A 1LSOA 4EEKA 4GAEA 3KT3A 2B7BA 2K7ZA 3FCAA 3HA3A 3L0BA 3NHYA 2X42A 2XLJA 4TMYA 1VE7A 2FSFA 4LZWA 1Z06A 8AT1A 2GZ1A 2A92A 2PFKA 3O0TA 4AQYM 1IEXA 1ODFA 1MT0A 4RJIA 3AF5A 2B36A 3IYLW 4FFSA 3BJEA 4KZPA 1JAYA 1NT4A 4M8SA 4MUKA 3T0GA 4ED9A 3NBMA 2HF9A 2IPAB 3D1JA 2OBBA 3JASB 1SVNA 3EGCA 1IUNA 4M55A 4UTXA 2C1EA 3NBZC 1VPDA 2B82A 3D7MA 3JZFA 4RNCA 1KK1A 1STOA 5H59A 3SAJA 2J31A 3L49A 4TTIA 4AJ2A 5TGZA 1KC1A 4G86A 3HG7A 4YX9A 4Z6KA 5B4TA 5KNDH 1S02A 1NJFA 2JFQA 5IDWA 3SZMA 5EKUA 4B6PA 1TAHA 1XKLA 2I33A 5I8PA 2XCLA 3LRTA 3U1TA 3BXEA 2VXYA 3VZCA 2F6RA 3WWOA 4KYVA 3PIDA 3PXGA 1ZC4A 1SG0A 3ES9A 5KTYA 3NHFA 4OQZA 4LZPA 4ZDKA 1BROA 8OHMA 1TLTA 1T1SA 3AHDA 3N2KB 3WFZA 3OURA 3WYBA 1VSUA 4L74A 1RZUA 4QUHA 4MJXA 3M3DA 2IZ5A 3MTAA 4DPLA 2BFPA 1QLHA 2VSXA 2B35A 3UJNA 1H2FA 5DK6A 2NIPA 3IDQA 5BPVA 2PUFA 1H1LA 1PSDA 4AJEA 1GFWA 4KV7A 2C7RA 3P9RA 1LRJA 3WZ2A 2RH8A 4MS3B 1H66A 2X1MA 1DIHA 4PG7A 1ZR4A 3DMFA 2OZEA 2SECE 3L0PA 2K5UA 4HQFA 1CRZA 2WW8A 4TVBA 3LCCA 4U63A 1OLOA 4CQNA 5C1OA 1P9RA 3NGMA 1L7PA 1J1ZA 3OU6A 3PGKA 4I4TA 4MUBA 1KAEA 2XX3A 2P6PA 1XTQA 1EVQA 2J5KA 3NWOA 4EDHA 3E2PA 3KAQA 1Y5LA 3QF4A 2XZPA 3U7EB 3Q3CA 2PQ2A 4R0VA 5AIAA 1R4MB 1ZIPA 1IDN1 4D3FA 4ENSA 3Q7SA 2IODA 1GGEA 3B82A 4C04A 3MAAC 4D99A 3HP1A 3AUFA 4ZV4A 2QN9A 1RJDA 4OB8A 3KKMA 2KEBA 3HJCA 3N2IA 1MB4A 4Y0AA 3UJ7A 4RV4A 2GLUA 1SBTA 2P9TA 4JJ6A 4LF9B 3HO8A 5DWDA 1NPYA 2F48A 3PFKA 3S4YA 4ENVA 5A62A 4G1UC 1E1RD 5IUKC 2D13A 1NBMA 2C97A 1GM5A 3O6VA 3WYNA 4LK3A 4N76A 2CYAA 4F5DA 4AXXA 3R6WA 2ZKIA 1C4KA 1QGOA 1Z75A 1OFIA 3MA0A 3E4DA 5DYGA 4U4AA 3HO6A 3DNFA 4QDUA 3EVTA 4QJ3A 2FUG6 3MCVA 4TRJA 5FADA 1PX2A 4FFRA 4Q1BA 5F4BA 4AY6A 4K81B 4AJHA 1PYOA 3IG5A 1NOIA 3CPEA 4MROA 1DJOA 1XDBA 2XTJA 4K03A 4COOA 1E6MA 4ENPA 2FMTA 4L50A 4EY6A 2JI6A 4HC4A 5ECGC 4E03A 4ITVA 4LFBB 2GJSA 2HMTA 4WESA 1DLIA 4ON9A 3KTDA 4ZT7A 8ADHA 4RD2A 1ZDMA 4L5AA 1O5OA 2QPTA 2Q27A 1S3SA 5TDHA 1JNYA 1TU3A 2B4KA 3A45A 1V7ZA 4HHEA 2V0NA 2EU8A 3C7TA 1DVRA 3CE9A 3HHEA 4A8HA 4UTNA 3FFXA 3PTAA 3GXOA 5HKAA 1TMYA 3GLFA 3CF6R 1YTUA 3JR5A 1WXHA 2KWIA 4CU2A 5CFRA 4CZ2A 2JJMA 3DE0X 3ZD8A 1F06A 5ES4B 1PGYA 2GK7A 1P2FA 2VLIA 2BKLA 2FJUA 3MPUA 4BQPA 4DSUA 5JS1A 1M2VB 4N8EA 1Z8FA 1WP9A 2Y0CA 3HY6A 4RS3A 3OOSA 3CX7A 5DNDA 1NLUA 2YZ7A 2WABA 3KQYA 2I66A 3FFBA 4K9PA 2CVHA 1E94E 3NEJA 3DLBA 1O96B 3OX2A 5JJBA 1NBOA 1GZSA 2VDNB 4X3CA 3I64A 1DLJA 3EDCA 5CUQA 3TNDA 2VQFB 3K6RA 3WL3A 1EFTA 2Z6UA 4IDDA 2OD7A 3TDMA 1TJ3A 2PL3A 2Q3JA 4CT5A 5BOSA 3ZDAA 3DULA 3KS4A 1KZ9A 3FAZA 1BS9A 2W8BA 3N6RA 2DPLA 4MJ3A 3V7UA 1RU3A 4BY9E 3HYCA 3QLUA 3KFXA 3BXPA 4A4DA 2B9VA 2JZNA 3L6EA 4H77A 1R16A 1F0YA 1CP2A 1Z25A 1F2DA 3VKHA 3S2UA 1SA0A 3B1YA 2ZB4A 2ZQ5A 1O95D 3B7PA 4F04A 4US2R 4PGHA 4BIIA 1MTOA 3E5HA 5A9SA 5J4KA 1WR8A 3ZE6A 4B3BA 1RVDA 5A3RA 2V7VA 5ALTA 2WAOA 1CJVC 3X1KA 1YFJA 1VHLA 1ZD2P 3LP6A 2IU0A 1G7SA 4NZYA 1E2GA 1K4YA 4XWTA 2IHTA 4WLVA 1QTRA 2AFIB 4JVNA 1BMQA 3A6KA 1I7NA 1Z0DA 1PJ8A 3PXBA 3LIPA 5F2KA 5FF9A 4C30A 1E62A 1O0BA 4KK3A 3WL7A 3ZDYB 2JFXA 3P71T 2H54A 3T4EA 4P4NA 3D6HA 4NS4A 1SKAA 3PIRA 2V1CA 3ETHA 1ZGJA 4Z3KA 2H5EA 4MW5A 3U3KA 5EPEA 1Z56C 4C6RA 3F7MA 4JP2A 3EVNA 4LYGA 5CNMA 3RPEA 4DIDA 1FIUA 4ZEOA 1MDFA 3B5JA 3GEPA 4D9EA 1S6YA 4PFSA 4IAOA 1LBHA 1GT91 3SJZA 3LRPA 4M38A 2C5SA 3T3NA 2XUDA 1FLNA 4IICA 1FJHA 3QTTA 1TJNA 4DCMA 4D3DA 5BYAA 3DFFA 5K4GA 2Q4EA 1WS6A 3IUSA 4OQFA 1KZ4A 4OREX 5SZJA 3OOEA 4A1FA 4JOSA 1P62B 3AIKA 1PKEA 2RGCA 5FLXA 1FSSA 1DX4A 1OLXB 4XCQA 3GCXA 5CBKA 2Z2XA 3SEFA 1QIGA 2HK8A 1DNPA 5AHOA 4LPKA 3LUJA 1T2EA 1ZL2A 4W1SA 3V8QA 3DE3X 4RHFA 3DTTA 3VPBA 3IERA 1L4EA 4UAGA 5LZ2A 2CJWB 1AXGA 4OU4A 3VU9A 3SM9A 7YASA 2O59A 4EZBA 2O8FB 1QRRA 2POCA 4MCIA 3HN2A 5K0GA 2YTZA 2QJWA 2Z56A 1A4RA 5J1SB 1DELA 2XBUA 3CPHA 3V1TC 3K09C 1SUCA 5KIAA 2QRUA 2BM0A 3IR7A 3IRUA 1DAHA 5C7LO 4LYHA 2PANA 2QMUA 3RBVA 1GRNA 3RS7A 1UBSB 1AN0A 1TK3A 3DCNA 1D6MA 1VC2A 2INGX 3K96A 3MD9A 2Q6IA 3VKWA 5JO9A 2JCBA 2OGSA 4I81A 3HL4A 1GNTA 2A0YA 4GPAA 4EA9A 5KQRA 3W8RA 3GMIA 2WU0A 3EUEA 4GHLA 3ZXUB 2PGDA 3DP7A 4US0R 5KBYA 4GBGA 2PUHA 1QVAA 3QFRA 4ANFA 3D81A 2XGJA 2OLEA 3CRW1 1W46A 3ZHZA 3LFHA 1YNOA 3VGJA 2PJUA 3BXOA 4GOOD 2QVXX 3EPHA 4M9SA 1EE8A 1NNLA 5ALDA 4DCNA 4DLNA 3A3PA 2R45A 2REQB 1C9KA 4L57A 2LTUA 4Q3KA 3UMVA 1C8VB 1GGKA 2IYWA 3N8KA 5E2AA 4AX4A 2V4ZA 2VRBA 2OHHA 2VQEM 1CDEA 1NVVQ 1X7YB 2I7CA 2QQ5A 3ZVLA 4AUMA 4ZEMA 2P4QA 1I01A 3S8EA 2F4VM 3TKYA 1GAWA 3EVDA 4YECA 3SR4A 4RAOA 3CTPA 1L8QA 2PG3A 2CW5A 3JX9A 1UJ5A 3KKLA 4PO8A 3VR6A 1TM5E 3OEEA 2VL7A 1P33A 4D9KA 1GNPA 2AUTA 2G0AA 3JPYA 1V25A 1G8HA 4BPBA 3LWDA 3H4VA 3QY9A 4C05A 3RYCA 1UC8A 3THSA 1FDVA 3IB3A 1KRHA 3VYSB 2REXB 4FUQA 3RKUA 2FTKE 3HXTA 1HFEL 4HTFA 4P82A 4WFQA 2V6MA 1CXZA 2I62A 1A8HA 1BDMA 2VTEA 4BFWA 5KNDD 3KJQA 5KX5B 3EF3A 4GC5A 1CR2A 3NONA 4AKHA 4JI6M 1BMTA 1K9VF 2VDVE 4KQFA 4ZO4A 1ZH6A 4AKEA 2AFHB 4FB4A 5GONA 1TTEA 1P1FA 1JTFA 1HKUA 1GCUA 2IEBA 2VJBA 4RANA 1HFWA 1UPUA 2OFFA 1QQWA 2CNBA 3ZGVA 2GRAA 4NZNA 3MUNA 2WT4A 2EQBA 4L16A 2A5LA 2HRZA 2QX7A 2WTXA 2X6RA 3CIFA 1WKBA 3Q2KA 4ZT3A 1SELA 1Z4JA 4A0FA 2EAUA 3IVXA 2PTGA 3N8DA 3S55A 4E6EA 5ABPA 1ZMOA 2C5RA 2BGRA 4URFA 4KVGA 2A8YA 2NXCA 3AVXA 4WLOA 2VQFM 1SHTX 2WP8J 3AC0A 4QGGA 1DQRA 3OZAA 2WTNA 1YTLA 1W4CA 1F7UA 3AVUA 1GQQA 2GYVA 1HE2A 4BNXA 5JHGB 3E2MA 4HL4A 4CU5A 4RVFA 3F8SA 4ZU1X 1QAQA 4UEJA 4CL0A 1SCNE 5FEUA 5CD1A 3WK5A 3U5ZA 4A3SA 2D1RA 3CLUC 2YWXA 4X9XA 4BQQA 4WA8A 5B58T 2WV7A 4D3XA 4YH1A 3ZV6A 2YOGA 1EUYA 1PDOA 1WAMA 2EF0A 2YIJA 3AG5A 4Q0MA 1TVEA 1U28C 4YXWD 1Z45A 5DN6D 3DGEC 3GX1A 3Q8WA 5JD6A 4KHPB 1CRPA 1JQLB 4LJ6A 2QE7A 1KFJB 3AERB 5G1OA 4BNTA 3ZQ6A 5KSZA 2Z8YM 5M04A 4AP9A 2Z9BA 2NP7A 4UD2A 4NNPA 4O1IA 4ZAGA 2DCUA 1EFVB 1DSSG 1W94A 1T3TA 1GJSA 1XLTC 2O5VA 1EP2B 2SKEA 4TWZA 3N7AA 2FOIC 1BMDA 1C7ZA 3EISA 3SJCA 3UN1A 2PBZA 3L6CA 3CLUD 5J5CA 5IT9A 2CEKA 4EGJA 1CJCA 1KERA 4UPEA 3WFIA 1X3SA 3HPRA 1IJFA 4NF2A 3RWMB 5BWNA 1U7OA 1DAIA 1YA4A 5T5QA 1KQGA 3T6PA 1CY1A 4IMRA 1B0PA 1HE5A 3BMCB 4EWLA 1IOZA 1G64A 2AXQA 3KPYA 2FGKA 4Q1VA 5EFZA 3UAXA 3W7BA 1IOLA 4B34A 2WEKA 3PFGA 4YV2A 4C7MA 1K3TA 2KHZA 2NV2B 2NACA 4LNUA 1NKSA 1VLJA 1QU2A 3LPNA 4F56A 4BKOA 3E53A 2JJ1D 3HBMA 2YVKA 3S7TA 2BCGY 2K87A 5HIMA 1EFDN 3CS3A 3ILVA 4LNAA 4NYIQ 4U2DA 4WK0B 4WOJA 1Q0ZA 4GIPA 3BE5A 1U0BB 2BDTA 2VFAA 2NO1A 1DDGA 1ZKDA 3RH0A 1B73A 3QVUA 1FVFA 1C3OA 3HCRA 5FA6A 2WWWA 3T06B 2OQIA 5BYJA 4O63O 3IOCA 3DT9A 3M81A 4IX9A 1MQ9A 4GR4A 3A6DA 3OPYB 1QHEA 3A1SA 2XYQA 3B48A 3OM0A 4M49A 3WY9A 1F8YA 2JLQA 3GNTA 4KN5A 2XQVA 2C5HA 2YW2A 3E8SA 4BGIA 3JD4A 1R15A 1MVOA 2DENA 2Q2WA 4ENRA 1F2TA 2BFMA 2ZB3A 2K4MA 3OO0A 3GJ7A 3HGIA 2ZRDA 3Q6IA 4FGLA 4HMQA 4I5SA 1ZUHA 2CFOA 1S3FA 4JT8A 4R3WA 3RC7A 3MJ5A 4KLZA 2I4LA 4Q4AB 3WG9A 1RE0A 1CFJA 4IILA 4WXHA 3ZBPA 2HV9A 1Q0UA 3EF0A 4NSOB 1IMOA 1AV6A 1POXA 4DV4B 1R7RA 5IVKA 1HETA 2VCYA 2E5LM 4M98A 5EIAA 1GZ4A 1Y1RA 3K9HA 1Q0PA 2H4JA 2KS6A 4MQFB 5A2QA 1ML4A 3SYNA 1CUJA 1J8MF 2ZJ7A 2CJYA 1G3RA 2NVOA 3IUQA 4I9HA 4R1PA 2PJDA 2QRGA 3SIRA 4DR4M 3FSJX 4N0DA 1LBSA 4RK1A 5ES3A 3HHXA 2OBYA 1A8PA 3OQIB 1MNQA 3CSUA 3D8UA 4UASA 3EVFA 3VPSA 1SHKA 1SKYE 2I6QA 3P9PA 4RELA 1Y7TA 1RQRA 5EIFA 1I2BA 3PRHA 2XGOA 2ONJA 3VAYA 3ZXIA 4FTWA 3D7RA 4UEOA 1KZYC 2WYVA 4MW7A 2CXQA 5BN4B 4LFAB 1Y4UA 2WF5A 1VCOA 4UM9B 3ACDA 3DEJA 4GKKM 2QNIA 1ULHA 5IHPA 2NO7A 2CNKA 3G2IA 3EGVA 2EUCA 4EFMA 2R8ZA 5CG1A 3I9KA 2F64A 2JFOA 1NQOA 4HAIA 2G70A 4F5EA 3W7VA 5AJXA 3KU4A 4C88A 3DTVD 1UBLS 1HDOA 4R1OA 2KI5A 3NC4A 4PXSA 3MJTA 4HL6A 2QRJA 5A04A 5M7EA 2IZ0A 1E3TA 1Z83A 3KQTA 1DJQA 3T1TA 4GDFA 4LRXA 1GU0A 1EA5A 1VLHA 3VC3A 4D56A 4YA6A 2FN9A 1IPHA 2PMKA 4BVKA 2RHMA 2R4EA 4FMPA 3OLYA 2J0UA 1XU4A 3W1WA 3SDSA 5CB4A 5D6NA 3GZNB 1PG0A 4O2AF 4QYSA 2AJCA 4ZQHA 3NHRA 3R8CA 6YASA 1K68A 5JAOA 1A71A 4BMPB 2BSAA 5E6RA 2FPIA 3G0GA 2A7XA 5FRDA 4NXNB 1F8XA 3GL9A 3IBCA 3OCZA 3OP4A 4FQ5A 4X8MA 5CCXA 3I62A 1TTHA 4WJZA 4WOCA 3CGGA 4KXFB 4PYKA 4DNOA 4Z9BA 4DPKA 1ZSNA 2C2GA 3BE8A 5C53B 3BTVA 3H16A 3MTEA 3MPOA 3SHFA 4H0CA 1IHXA 1JXOA 3OM9A 3QFHA 4ND8B 4B4WA 4MWEA 2ZPTX 4FFNA 4C3UA 5C3MA 5HIJA 3A3KA 5KYGA 1W36C 5KYTA 2C8LA 1P2BA 4JYCA 1QE5A 2BPOA 3BTUA 3LWBA 3VYUB 5JVDF 2PZJA 4INAA 5IEJA 1Q3BA 4DR7B 2FU5C 4PSUA 4X44A 2KNVA 1SZCA 2IXGA 4BNIA 2VP5A 2Y0DA 1KOLA 5JYBA 3KQNA 1PDWA 3DZ8A 2Q3BA 2QUBA 3LLSA 2XB8A 1MR3F 5I7AA 2DUMA 1LX7A 5GZ3A 3RAEC 4J0EA 1TJ4A 1S8FA 2QX4A 3NYRA 2GFQA 4I1VA 1ZC3A 1RAGA 3ZDRA 2YNMA 2X5XA 3FPFA 1DKOA 1AVTA 1QMPA 2CUNA 1L7RA 1UBFA 3KUCA 5KZMB 4YVFA 3RJZA 2VYQA 1DOAA 1KKMA 5KTKA 2E48A 2ZBEA 2GN4A 1PHPA 5ILOA 1HDGO 1UDRA 1Y8RA 4IDGA 1TC2A 1D8AA 3QEOA 4JEIA 2HFKA 3I42A 1A72A 2B8TA 1KKUA 5A5EA 2X9GA 4CQMA 2RK3A 2XZLA 3HB9A 2ZI9A 1FF9A 1P2GA 4LHZA 1SIWA 4G0MA 1CZOA 1F0NA 4ZO7A 3LC1O 1K8RA 4RMJA 4JSRA 3KKQA 2E6KA 4R2HA 3CKKA 1VSTA 3MMXA 3ZGZA 3K20A 5G0SA 4JP5A 5LP6F 5C46F 3TTTA 1E6EA 4ZO9A 1U2RA 3L28A 3OEHD 4TUYA 5KTTA 3EZGA 5T64A 2C2WA 1Q12A 3MW8A 4IBKA 3EMDA 3TRIA 3MJHA 1VGQA 3HBFA 4UFOA 3ZZUA 3NP9A 3EMVA 2M5ZA 5IDXA 2JK0A 1BC5A 1YBAA 1LPSA 1BXGA 1QSGA 1RQXA 5AM5A 5HK9A 1BRMA 4ND6A 2BRUA 3RS8A 2KLHA 1JJIA 5IREB 4LYJA 1GZ7A 3C3AA 2RGHA 4GYJA 4KUEA 2QZ4A 3O3NB 4N49A 4NZ9A 4YS6A 4TS9A 3E1GA 3NGLA 3V2UA 4Q4JB 5FULA 3LE8A 3ZVRA 5EESA 3IAAA 4NKRA 5MFZA 2Z8ZA 3GRKA 5JBIA 3GIWA 4BRSA 2KE5A 1ANKA 1P3Y1 2GKOA 1M6EX 4JR1A 4YLYA 1RE1A 3JQBA 1ZVQA 8LDHA 3EIUA 4WACA 4NRWA 2C7PA 1W4AA 2IYTA 3TEMA 5JBNA 2R6CA 4QULA 1CP3A 4B3RB 1W8DA 2FN3A 3A6HA 4IJEA 1GJRA 2WWHA 2XBMA 3VDUA 1PJLA 1OWNA 1TYEB 1NASA 3N2EA 1TYBE 4ENTA 2VP3A 4IZHA 2XY4A 1QE3A 4MXDA 5ADUS 4L0DA 5CB6A 3IAUA 1TDHA 2OKGA 1WHSA 2IYEA 1V1MB 1IAVA 5AH0A 4KYIB 5MGNA 2R65A 3IP1A 1HR0M 3DV0A 3R9XB 3QVXA 4ILEA 4KRGA 5KJEA 4E88A 4RQAA 3QMPA 3V8MA 1Z4QA 2QRQA 3RAPR 1JZQA 2W8BB 1YR9A 4U00A 3AK4A 3G17A 1KEZA 5AKKA 3OPMA 1PNQA 4EUKA 2BZ0A 4QOHA 1JL3A 4FS8A 3P2EA 4NARA 5L7YA 2JGLA 5DNYA 4PM4A 1OJLA 2NVUB 3AUKA 3WZLA 1LNZA 1N2XA 4LRTB 4C4YA 3JRXA 2QLLA 4RNAA 2YZGA 3ESCA 3HVRA 1BX3A 2PUCA 4GX5A 1UWKA 3MK6A 1V9CA 1ZGAA 2AC7A 2P9GA 3TPFA 1S3GA 4KMMA 4S0XA 1GPNA 2E37A 2YRWA 3KJGA 2ABWA 3KB8A 3S8MA 4EG0A 1C8BA 3DZHA 5BR1A 3C70A 3GUVA 4FHZA 2ZWAA 5KNCA 1WF6A 2VJMB 3ZW8A 2GZDA 1TZJA 3P9NA 2G88A 3EPLA 4AAYA 4EYKA 1SU4A 2JIZD 3PZBA 4DV1M 2ZTCA 1V1RA 1GVNA 2YRXA 2IOFK 3WJ2A 1G98A 2RHRA 2QEQA 3JYLA 4MUNA 1P1CA 1QZEA 2VDBB 4M8NE 4F4HA 3SVTA 2C7VA 2DGDA 2WHRA 2QRLA 4LC9A 5GIOE 2OWDA 5TQ0B 1WEKA 4L3WA 4NV1A 5JT1A 5LKAA 4LMRA 1XMOM 3VK8A 3A6EA 5DHPA 3U9SA 4IBIA 1XN1A 4JBYA 2D2XA 2BH2A 4L72A 4GBED 4PSKA 3J7BA 1TH3A 1OAOA 4DA4A 5GP1A 3U44A 1G8AA 4K5QA 4PHTA 3EHEA 3IELA 1JT2A 3SBEA 1D3AA 1GD1O 2EWWA 3N76A 2C7BA 1EWYA 1PJCA 1X6VA 1LKZA 1E5VA 1G42A 4J7CA 2FZ4A 3AETB 3B3FA 5IVPA 1GUAA 1YUNA 3ZW9A 4B7ZA 7REQB 1Z5ZA 3C7KA 3I9MA 1I1OA 3DYBA 3Q7RA 2BM1A 2C4NA 3AU8A 1JKIA 1GL6A 5E6JA 4PSVA 5B3KA 3B1KA 2LE0A 1LC3A 2ODBA 3QI2A 3QE9Y 1DUIA 2PIDA 3KT0A 3LVFO 5DYWA 4M9UA 5ENZA 3RIYA 3ZDFA 4AICA 1ODJA 4KNYA 1MO4A 1Z0KA 4ZJYA 5B30A 1OXVA 5YASA 2LPMA 4GS5A 2MSLA 3TD2A 2HREA 2NZ8A 1XTRA 5CFZA 3FZEA 1XNRM 3D0QA 3TI9A 4DCUA 2DQKA 1SWWA 3S1AA 2QI9C 5IU6A 2QJFA 4MV7A 2AT1A 3I45A 3FUCA 1VG9B 2G1UA 3BFVA 2NZVG 3LC0A 4LBYA 4ROSA 3IX7A 4BTEA 4HWOA 2C59A 2KJQA 1VIYA 3K2EA 3RREA 4A8TA 4NCKA 4B43A 4LDAA 1UMBA 3PG5A 2X76A 3DW1X 2HYIC 3DLAA 4UOEA 1FX0B 3BBZA 3IECA 1KO1A 1RPJA 4FFMA 4B71A 4DLRA 3BK1A 5AW4A 4YJ2F 4A91A 2AQHA 4XSVA 5CA0F 2PCLA 5DV9A 4IJFA 4MA0A 4QOGA 3BIXA 4NNOA 4L2IB 3FBTA 3KSUA 2PGJA 1UQTA 4Q3AA 3TD6A 3W2FA 4B48A 2IYFA 4MW4A 2WYWA 4GEWA 2VCEA 4ML3A 3ANXA 2YVAA 3L3BA 3K8YA 3CEAA 3NTRA 4P4SA 3UK0A 2WRZA 2NO6A 2UU9M 1E1YA 3CN9A 3GGJA 4KXMA 4L07A 1V4VA 3KPUA 2FG7C 3TZBA 1FNMA 3HR4A 2JRCA 1SBHA 5EMMA 1B41A 2CD7A 3OWOA 4YCSA 5JRDS 2VQDA 2L4FA 2F1JA 5U1PA 1I13A 1T8SA 4J4TA 4S2UA 3RIEA 2B83A 4TV9F 1V3TA 3FFAA 3U56A 1H85A 4EO9A 2GWHA 2CFTA 2X4LA 3N70A 4HVLA 2QTHA 2A57A 3AOEA 3IDFA 1HY3A 4J0HA 1UANA 3CY6A 1HQKA 3CX4A 4ZAVA 5ILGA 3TDKA 3DB1A 2Z6VA 1D1PA 2JLBA 5ALQA 4MARA 2XVMA 4INJA 4DT1B 1PWZA 2EZ4A 1RKBA 2QQGA 1A97A 4BVHA 2JEZA 2PX2A 1TECE 3FGNA 1U90A 4RZIA 3FMFA 2A6PA 3KB6A 7REQA 2EBFX 1DARA 3T1OA 3DTVA 2XJ9A 2W2MA 3PGA1 2P2GA 1O95C 4O08A 2YMLA 4RH1A 2FQQA 4H7PA 2OXRA 5BYKA 2OG2A 4N7BA 1BYIA 1GITA 3E3OA 1A5TA 3PUIA 4AS3A 4BVAA 5FNVF 3R20A 4HI0E 4YJHB 4DV7M 3R4VA 4M86A 5A3VA 3S44A 3S5JA 4CM6A 2C9MA 4U2FA 2GZRA 1JG3A 4M53A 5ALMA 2CL5A 2ZREA 2P0YA 2BKXA 3GT7A 4KWIA 1FSPA 2EWMA 4ZHQA 1H2YA 1HSZA 2AWOA 2IH5A 4EKDA 5EJEA 2DTXA 2OESA 3NJ4A 4QG3A 3GPUA 3CLSC 1CB7A 3PI6A 4CM3A 3EQ6A 4ESOA 4W9NC 3BAZA 1Y8ZA 4GPTA 4JX8A 1CUYA 1VL0A 3OEYA 4YRCA 1V7CA 2UYYA 2J7NA 1V37A 3CU5A 3EAQA 3HDVA 3IV9A 3RBXA 3CBGA 5IXJA 3DAYA 3KB2A 1U9YA 1YH3A 2RMKA 4M89A 2O8BB 3EFHA 1WWKA 4CLXA 1Y8CA 2O25A 1VQ1A 1AUXA 1YFZA 1E2IA 1T34A 1U7HA 1A9SA 1HLPA 1JLLB 3HI4A 4LSWA 4MAFA 5EHQA 3T6KA 2YIMA 4AZTA 5JDCC 4I6GA 1WCWA 4QDTA 3REQA 4PZUA 2B2CA 4MYHA 1N6LA 1C8LA 3QYFA 4CKBA 4M99A 4WZ6A 4AF7A 1KYVA 3LP5A 2F5OA 4PR0A 1HT0A 3IS3A 3BGVA 4GH9A 1CR6A 1KQOA 2IPOA 2DM6A 2V7TA 3JQAD 2EFJA 3OIVA 4Q9HA 4KR9A 1WG8A 2EEPA 3PEVA 5KYXA 3VR6H 1KQFA 1NXQA 3DFZA 3FVWA 3NASA 1DG1G 2HF2A 1Z88A 4RKWA 2PD3A 2OOBA 4L0CA 4Q93A 2OILA 4EUFA 3AUXA 1E5DA 1ZN2A 1HT3A 2P5SA 1EZ4A 4PD2A 4UE3S 4FW9A 2R5NA 3CO5A 3LPDA 2Q7DA 3RT7A 1U2DC 4H4EA 2NU6B 1PJZA 1A9QA 1R9JA 2H9AA 3NNSA 2C0QA 3P9KA 1PHRA 4WN9B 3HU3A 3ZLUA 1Z8HA 4AKTA 4DDUA 1OA1A 4NCAA 2YQ4A 1AIPC 1P1HA 2UYOA 1XC8A 4FVMA 2XNJA 3L8CA 2B4TO 2EX1A 2V59A 5L3QA 1JQDA 4JI5M 1P75A 1DC7A 2IW1A 4FFLA 3LVQE 1RPZA 5E26A 1ZD3A 4UBJA 2PL1A 2PVSA 2YW9A 3RUIA 4Q82A 3L4JA 1FS5A 1TM4E 3WBKA 4MP3A 4Y2JA 1D7AA 4F91B 4P81A 4ZVUA 3ZI0A 3J81A 1GIAA 1I4LD 2A30A 3QUBA 2QLBA 3T1QA 4WXEA 4E13A 4F92B 4E0BA 4JUAA 2QRKA 3ROEA 4IBDA 1DP4A 1UKZA 2DSNA 4WL0A 4WBXC 3DONA 3Q9NA 4EATA 8MHTA 1IDOA 2BEWA 3ZXXA 5AW1A 2NO5A 3BILA 2IHKA 3KXDA 3UFXA 1YIAA 2N35A 1NY5A 1Z5GA 2J3JA 4D26A 4PZCA 2LGJA 3R5JA 1PR5A 4TXJA 5K8TA 1HDYA 2XWPA 1Q1EA 4G0ZA 4GKAA 1L5ZA 2DHRA 2EW1A 5HG0A 1S7GA 4Z6YA 2WWRA 5JJLA 4Y1RB 4F3KA 5IAJA 1NVUQ 4FCCA 4REMA 1SQSA 2OCLA 4ENUA 1NJGA 1H2RS 3RHFA 3FYCA 1E9FA 3WB2A 5IWAM 2KNZA 1K0FA 4I55A 4TUYB 3HXOA 2ZYVX 3BREA 5TSDA 2IBMA 1B00A 3SD7A 2QD1A 4MV5A 3UK1A 1B6GA 5I9TA 1DKRA 4JBGA 5CH3A 4YWHA 4Z53A 1CUFA 1UK7A 3GT3A 2P41A 3BN3A 1TCBA 2HA5A 1P5FA 2V0CA 3O9ZA 2REBA 5CM8B 5G0WA 4R7GA 5IYZF 1B43A 4H0NA 2JCGA 5IKXA 1O6CA 3VR5A 4YV1A 2AUMA 3NBFA 4XE5A 1L7DA 2ZIVB 3I58A 2EARA 2VZ0A 4D96A 4Q1AA 1CNMA 1B2RA 2IIVA 3W8NA 4QGSA 1WHCA 7ADHA 2ZBPA 3VTAA 4B3IA 1SCBA 1V6AA 2GUWA 4KDFA 3OF3A 2GB4A 1N7HA 1ZNXA 2XMBA 4RFVA 5AVKA 3ZLBA 4DN6A 3UMBA 1T2FA 1TYDE 1P60A 1P9OA 2B1JA 1FFHA 3P32A 4XVQA 2LVOC 1JJFA 2BZ1A 2WDZA 3B70A 1E2KA 2BC9A 3I01A 1G8YA 4CG0A 2WZBA 3DVQX 4G4OA 1V4BA 1WB9A 1BMFA 3KEGA 1T8WA 2DRIA 2H65A 2WHEA 4YC7A 4DHEA 2NXJA 2NZYA 3OCXA 3K8OE 4UOZA 3B9RA 4FYIA 3KD3A 1VZ3A 1KI7A 2EKZA 2R1UA 4HYEA 4MV4A 2E5LB 3SY8A 2HN9A 5BNIA 4RZUA 2AOUB 3DE5X 4PLVA 1U02A 1QPGA 2HCBA 2XB6A 4DQXA 2JL1A 5E6UB 2XKAA 4WBNA 1T5TA 2Q1SA 4JGIA 4QTUB 4IR7A 1MAUA 2W9XA 3IODA 4TWAA 4ZAZA 2UXDB 4IDAA 4I8IA 5KPRA 1RKUA 3HWRA 4KFTA 4GZ3A 4BPRA 4EI2A 3U61B 1KO7A 1BQ4A 2H92A 3LKVA 3D6TB 1HQCA 1YQEA 2HJ9A 1NXVA 4E5NA 3LCVB 3RIGA 1KYTA 1G55A 5M3BA 1TADA 4CKEA 1EB9A 1PNRA 3HK2A 3EJWA 3RGSA 4MMYB 3NTLA 5DSTA 1Q02A 2H9IA 4TV9A 4KQKA 4OHBA 1ZH4A 2J0UB 3GGDA 3LLUA 5AIBA 4ZEXA 1ZSYA 4FHDA 3BM5A 2FSVA 4B3SM 1T2VA 4YQYA 3KUKA 4D45A 4CF7A 2AVDA 2AFIA 3GW8A 1GZ3A 1ULUA 2UDPA 1SMKA 3AP2A 2FY8A 3CV3A 3BMQB 1CUBA 3FDFA 3DC7A 3SG0A 1XYYA 1U7PA 3OOWA 3ZY4A 4BV2A 1IN4A 3ABOB 3IEUA 1E0AA 1Z5AA 5KTMA 2JEOA 3V5NA 4H4DA 4ZJUA 2CXNA 5TARA 2L2DA 1VL2A 3O1HB 2YFYA 4FLFA 3F71A 1WLYA 1K8XB 4URVR 4M7RA 4OVZA 4PQFA 1CYEA 2JAHA 4BBJA 5ESRA 3DAOA 1PL6A 5H5JA 1RXEA 5BRAA 1EKXA 2XF8A 2ZRIA 4V1CA 1T4CA 3ETLA 2G5CA 4JYAB 1BEEA 3K5HA 2IS2A 2OVFA 2CB9A 3CINA 1JDZA 2DAGA 2MR5A 2WHQA 3EAFA 4K9QA 3VYRB 3OZEA 3WE7A 4KQ9A 4D46A 2P6NA 2DPHA 2XJ4A 1CERA 3EPPA 4U5XA 4V24A 5C3UA 4MDEA 1VP9A 3LXRA 1IB6A 2ZYGA 2OHOA 3AILA 4OAPA 1HDRA 1HOXA 3UWSA 1FXSA 2QXTA 4NYMQ 3WGQA 2Z8XA 2KZSA 2FFQA 2BFNA 3AHCA 2DFLA 3OAAA 2PKRA 4JEMA 4PNPA 4H35A 2V0GA 4KOAA 4GYYA 3CRZA 5EE5B 1T26A 5EP1A 1KJYA 3O4VA 3R5KA 4KPUA 3T9FA 3KJZA 1GDHA 3LUFA 2CXPA 2O05A 1Y98A 3JWPA 3NORA 2HMYB 3QKTA 4PINA 2BGUA 5BNZA 4H7FA 3E46A 2EL7A 3CLRC 5EFOA 5H0IA 3A6PC 3OKCA 3LH5A 1P4JA 3O0DA 2AMLA 2VSQA 4L0QA 3T5BA 2EGGA 3D6JA 3SJAA 1J8VA 3ZV5A 2ZR0A 1UAAA 1AM4D 4FWDA 1T4GA 4D81A 2ZI7A 3OFNA 3K5IA 5BP7A 1RZRA 2PX0A 3QUAA 4GPIB 2FR0A 4OHKA 1JS1X 1DPFA 1OKKD 2H1IA 2JBHA 2WB4A 5BW4A 3LQ2A 4Q4HB 4QBGB 5IW8A 3BD6A 2FV8A 3M82A 4N5LA 4RVUA 1OT5A 1I1NA 4H3HB 3RUFA 1F5NA 3ZWPA 1NWHA 1UKAA 5H3CA 2AOUA 2P65A 2VA8A 3FX2A 5GJCA 4QBIA 4RL4A 3GWZA 3UWKA 4LJ8A 4KWHA 5ECWA 1K4KA 2NU9A 3ZDEA 4PGFA 2OCXA 2I7PA 2X4DA 1CQJA 3WGGA 4HG2A 2Q8PA 3EAGA 1Z0IA 2V65A 2PV7A 2Q2NA 1LVGA 2GZ3A 1K7YA 2XOKD 3DKRA 2DI0A 3FMOB 2IZOA 3PFCA 5TLSA 2V5UA 4XSGA 4D4MA 3NT4A 1I9GA 4JI4M 2QM3A 3C3XA 1EVZA 1R74A 4RJJA 4UCXA 1WD5A 2OYCA 3BCRA 2M1XA 3Q15C 3EFOA 2HPHA 5LQMA 2J5QA 1IUKA 3GOHA 2C4VA 3HJSA 4MGZE 3CT6A 4PGAA 1K3WA 2ZUCA 5DYNA