2H1RA

Crystal structure of a dimethyladenosine transferase from plasmodium falciparum
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
271
Chain Sequence
HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWCTLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Dimethyladenosine transferase, putative
total genus 94
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.480 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2h1rA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h1rA01
3FTEA 2UZ4A 4GQBA 4KDCA 4QVKA 4BP1A 2UYHA 3JWJA 2B25A 2ONYA 2XVAA 1XJ5A 3LCVB 2DULA 5FCDA 2EFJA 3CVOA 3NVKI 3A4TA 2IPXA 3I5UA 5CUQA 1SUSA 5DXAA 1ZKDA 1XVAA 2I6GA 3BUSA 4KRGA 5EPEA 3UJDA 1G6Q1 4YUWA 3R9XB 3P9NA 1JTFA 1IM8A 2AVDA 3BWBA 3DULA 3GU3A 4LG1A 3KKZA 3OZTA 3GWZA 3EVDA 4GBED 3Q7EA 5FHQA 4ER0A 3FYDA 3OU7A 5K0EA 3RODA 5LR6A 4HH4A 5K0JA 1B42A 3CC8A 2OYRA 3EMBA 3M6UA 3GNLA 3A27A 3NWBA 5DRTA 3MAGA 3UFBA 2UYOA 3FPHA 2QM3A 1WG8A 4CTJA 5CVEA 3OPNA 3JWIA 3LL7A 5KYGA 5D1HA 3FZGA 3SGLA 3C6KA 2C7QA 4LWOA 2O0LA 2G8NA 1XXLA 1VE3A 5EZQA 4M38A 2G1PA 1TPYA 4PCLA 1L1EA 4E2WA 3HTXA 4EKIA 3REOA 2H00A 3GGDA 3HCBA 3PFHA 3QOXA 2P1DA 3FYCA 3QV2A 1NW5A 3LKZA 3SM3A 4FZVA 4EKGA 4EK9A 2VDUE 5GWXA 5F2KA 5G02A 2PX2A 2JHAA 3ME5A 3EGVA 3FTDA 1AV6A 3R0QA 2B2CA 2GB4A 3CJQA 3EEYA 1P1CA 3DUWA 5KS2A 3P9KA 3DMHA 4KIFA 3P2EA 2ESRA 2B9EA 5CM2Z 5DWQA 5EEHA 4X60A 5HIIA 4OX9Y 1FBNA 3M6VA 3OU6A 3OZSA 4R8SA 2ZFUA 3HA3A 5DRYA 5GP1A 4HTFA 5LQJA 3A7EA 4FGZA 3G2PA 2ZLBA 1R8XA 4PGHA 2FYTA 5GIOE 2VS1A 3KR9A 3GRRA 3TKAA 2PLWA 3GCZA 2PX8A 2ZWVA 1JSXA 2P40A 4F86A 3KPUA 4GC9A 3SVZA 1I9GA 5IKMA 2ZBRA 5DM0A 5DTQA 2R6ZA 4KWCA 4KDRA 3BWCA 3KQWA 2GS9A 1RJEA 2NXJA 1RJFA 1FP2A 3KQTA 3HVJA 3T0IA 9MHTA 5EMMA 5DX0A 4DCGA 2IGTA 3EVGA 1VPTA 4JXJA 2QE6A 3LCCA 3LKDA 3PFGA 3VC1A 5JR3A 4OA8A 4PNEA 4FSXA 5K05A 2N47A 1EG2A 1R00A 2AOUB 3B3FA 2P8JA 2FRXA 4H0NA 3LDGA 3B3JA 3DLCA 3OU2A 2PKWA 4C05A 1KXZA 4GC5A 5CIYA 3P8ZA 4RTRA 5MHTA 3LSTA 5FHRA 5K01A 3GIWA 2P35A 3I53A 4MWZA 3I58A 4FT2A 1VP3A 5E1OA 5KVAA 2O06A 1WXWA 1KR5A 5DSTA 4YUVA 3T7SA 4C04A 1SKMA 4PCAA 1UIRA 3ANXA 4ZTBA 5T67A 3P2IA 2O57A 2PGXA 4HGZA 4QPPA 4BY9E 1KPHA 4V0RA 1KIAA 1DUSA 2OO3A 3D2LA 2AOXA 4G56A 4RTNA 1WXXA 4PYLA 1Y8CA 4QPNA 1MHTA 2GAFA 1UWVA 5FWAA 5JUWA 2FCAA 4HTFB 4DQ0A 3EVCA 2I9KA 1BC5A 3LPMA 4DA4A 3KPVA 3E23A 3HP7A 3A26A 4RVDA 1R18A 4QTTB 5LQRA 1TW2A 4FT4A 3VSEA 3EEOA 2AOWA 1Z3CA 2ZBQA 2HV9A 3OE4A 5EG5A 4L7VA 4IWNA 3O7WA 3M6XA 5EEGA 3DLIA 4E32A 5C0OE 2OB1A 5DM4A 3V97A 1D2CA 3DR5A 4R6XA 2P3LA 5DM2A 4CKCA 3EVZA 3SSNA 4Y2HA 5M5BA 1X1CA 2WA2A 2XYQA 3TFWA 2QRVA 3OE5A 4C08A 5LQKA 3B89A 4P7FA 1JSZA 5DT2A 5CVUA 4F84A 3BKXA 1Q0SA 3CBGA 4OA5A 2AOUA 2CMGA 3LDUA 4GOND 3V8VA 2IH5A 1I1NA 2O07A 2IH2A 3P71T 3O4FA 3GRZA 5EC8A 4CKEA 4AUKA 4YMGA 3JWGA 3PTAA 5GIPE 1VQ1A 2IDJA 3CJRA 3PS9A 1NV8A 5EGSA 2I7CA 3EMDA 4U7PB 1VLMA 3KQVA 5EMKA 3FRHA 3TLJA 3U81A 3NVMB 3TM4A 3OFKA 3BGIA 4QDJA 2P7HA 5GM2A 1TW3A 1N2XA 3VYWA 2C7RA 3F4KA 4RVFA 2GA9A 5D1NA 2P3QA 2YVLA 3TOSA 1O54A 1QZZA 3EGEA 3P2KA 2V7EA 3R24A 4OBXA 3NTVA 4AZWA 4RVHA 3NDIA 4PYKA 4CKBA 1BOOA 2NP7A 5FULA 1EJ6A 3R3HA 4RYLA 5BW5A 2B3TA 2NYUA 4F85A 4QQKA 1NW8A 2V74B 3DXZA 2PXAA 2EJTA 3HVHA 1XTPA 1JR4A 1U2ZA 1X1DA 3KQPA 3KU1A 4OBWA 5E9WA 3NWEA 1JG3A 3UJCA 5EKXA 5LQUA 1QAOA 2UYCA 1VL5A 3UA3A 1P39A 5EIFA 2VDVE 2ZZKA 5ERGB 3M4XA 4RSRA 3RIEA 4PYNA 3UJBA 5KQSA 5K0FA 2B78A 4MQ4A 4RTJA 4U7TB 4YUXA 3LGAA 1FP1D 3HVIA 3KPJA 3UA4A 2OY0A 1HNNA 2ZWAA 4FP9A 4KW7A 2HTEA 4LWPA 5EZSA 2IH4A 3THSA 2OBFA 3BGDA 2YXEA 4ER6A 2PJDA 2IBTA 4DMGA 5C9ZA 3I9FA 2AOTB 4EMSA 2ZZMA 4GOMD 1WS6A 3BGVA 3LBFA 5EKUA 4C07A 1FJXA 2G70A 2ZBPA 2VZ9A 4MTLA 5FTWA 3UWPA 3FTCA 3G89A 3HCAA 4GOLD 4ATNA 4QTUB 4R8RA 1NW7A 5DTRA 1F3LA 2FHPA 1INLA 1SQFA 2LD4A 4GF5A 1QANA 1SVUA 1YZHA 2WK1A 3EVEA 2AOTA 3FTFA 5DSXA 3NDJA 3MQ2A 1ZG3A 2ORED 3C3PA 3KQSA 1L9KA 4FS8A 1JQ3A 5EOVA 5FADA 2YUIA 1PJZA 2H11A 5ICEA 1NBIA 1QAMA 2DPMA 4RTMA 5IH3A 5HFJA 3RW9A 2PT9A 5EMJA 2GPYA 1KYWA 1KPIA 3KQMA 1XCLA 4V0QA 2A14A 4PWYA 3MGGA 3P97A 4R05A 8MHTA 2PBFA 3BKWA 4MIKA 4RTLA 1ZHFA 4WXHA 3PB3A 5T64A 1DL5A 2AOVA 2PXXA 1KHHA 3G5TA 4HG2A 2ZIEA 1NBHA 2JHPA 2NNWB 5DX1A 2Q41A 2JJQA 4PGGA 1D2HA 5K0GA 1R74A 5CVJA 2Z6AA 2QY6A 2FPOA 2NXNA 3ID6C 3THRA 4CXMA 2ZVJA 2HR1A 3T7TA 4P7KA 4BLUA 2HWKA 4FR0A 3X0DA 1G8SA 1L3BA 3BWYA 5BXYA 3G88A 5EMLA 2PV0A 1SUIA 2IP2A 3S68A 1YB2A 2FK7A 3HA5A 4P58A 4XUDA 1N7JA 3B7PA 2CMHA 5HZMA 3O31A 4GEKA 2K4MA 1UFKA 2YTZA 3IHTA 3FUVA 1P1BA 3OCJA 3NW9A 4YV2A 1VIDA 1L3CA 3IEIA 3NJRA 1JG2A 3TKYA 2VP3A 5EVJA 3EVFA 3LDFA 3OZRA 5E2AA 4O29A 4YUYA 1XDZA 1JG1A 2ZIGA 3P9CA 1ZGJA 2PSSA 2Z6UA 5K0LA 3EVAA 3FUXA 3P9IA 7MHTA 2PXCA 1YFJA 2BM8A 3GO4A 2PT6A 2NXCA 3B5IA 3CGGA 5DM1A 3FPJA 3G2QA 1G55A 2AN5A 2CL5A 4KVZA 5HIJA 4RTOA 2ZSUA 1MJFA 4LECA 2OPBA 3UJ8A 3DMFA 3VC2A 5DPMA 5ICFA 2NP6A 3FUWA 3T7RA 5DLYA 3R6TA 4DZRA 4IKPA 4M37A 1G60A 5E1MA 2GH1A 2PY6A 4OQEA 5EHIA 2HNKA 3GJYA 4RV9A 3DTNA 1RI5A 3HNRA 1P91A 3BWMA 4NECA 4OQDA 3GRYA 1HMYA 3HA7A 1XDSA 4IV8A 3HEMA 4B17A 2FK8A 2ZCJA 4MHTA 2KW5A 1NT2A 3ER8A 2ZZNA 2CKDA 5E9QA 4QDKA 3G2OA 1R8YA 4ER5A 1M0EA 5DX8A 1T43A 3HCFA 2R3SA 2Y1XA 3EVBA 3SSOA 4RTSA 2OXTA 1NW3A 2AN4A 3UJ6A 1RJDA 3H2BA 3KQQA 4EVIA 3B3GA 3MTIA 4YMHA 2YXDA 1ORIA 5E1DA 2BR4A 2IBSA 3MHTA 4X63A 2UYQA 3M6WA 3IYLW 3FUTA 4M7RA 1PRYA 4BLWA 4E2ZA 5HILA 5F2NA 2GLUA 5K09A 5K0NA 2ADMA 2OB2A 5T6BA 1NW6A 1EJ0A 3DXYA 4AZTA 4DF3A 1X19A 2PX5A 3G2MA 4FSDA 3UZUA 4EQZA 2EX4A 5FWDA 3KHKA 5CCBA 3HVKA 1JG4A 3DOUA 3PX2A 5DTMA 3ORHA 3E8SA 3K6RA 5HIMA 1JTEA 4DM3A 1DCTA 3K0BA 4R6WA 3LBYA 5CVDA 1G8AA 5F2OA 4XUCA 4DCMA 5LSAA 4E2YA 4RWZA 2BH2A 3AWIA 1VP9A 3E05A 4X41A 3HM2A 2PWPA 4RTKA 2G71A 4ISCA 2JH9A 1H1DA 3MERA 5FA5A 1IXKA 2OZVA 3SX0A 3AY0A 5CVVA 3G7UA 1OR8A 1QAQA 4GUAA 3SR4A 1AQJA 3BZBA 3TRKA 2P3OA 1I4WA 1D2GA 3DMGA 1Q0TA 2IFTA 3BXOA 2ZIFA 3DP7A 3SMQA 1KP9A 3NMUF 5HOQA 4ER3A 2YQZA 3C3YA 4AZVA 4YV0A 4DKJA 4PYOA 2EJUA 2PX4A 4IV0A 3WSTA 4AZSA 3KR1A 5E2BA 3E7PA 3UBTA 1AF7A 3DXXA 3ELUA 1BKYA 2AN3A 5GOZA 1L3IA 3UJAA 10MHA 5LQNA 2Y1WA 2ERCA 3GRUA 2JHCA 1YZ3A 3KPYA 3PX3A 4CTKA 5E9JA 5GINE 5DXJA 1X1BA 4AX8A 3ERCA 3LHDA 5LQAA 1BHJA 1NKVA 4WVLA 2XBMA 3GRVA 1RI2A 2CWWA 1ZQ9A 4Y30A 4YV1A 2C7OA 1EAMA 3G8BA 1RJGA 2VDWA 5E8JA 4PYMA 1JQEA 5C1IA 1XCJA 3ELWA 5B1SA 2F8LA 1M6EX 3SXJA 4RTPA 4PIMA 2QRVB 4HSGA 4QQNA 4UOEA 3IV6A 2ZTHA 1EIZA 5GM1A 1NV9A 1SQGA 2XVMA 1FPQA 1X1AA 4A6EA 1WZNA 2PVCA 4Z2YA 2PWYA 1WY7A 3AXTA 3CCFA 2G72A 1EQAA 3PVCA 4PYQA 3HCCA 4C03A 5ICCA 3FPEA 2AZTA 4X1OA 4BLVA 2BR3A 3FUUA 4BP3A 2Z6QA 2O05A 3PT9A 5E1BA 4RVGA 4C06A 4E2XA 3M70A 2BM9A 2BZGA 3GXOA 4PONA 5BP7A 2YX1A 3HCEA 2ONZA 4GOOD 5HIKA 4XUEA 2P7IA 3TPZA 3MTEA 4K6MA 4C4AA 4QVGA 3FPFA 3JWHA 3MB5A 5BW4A 4M36A 4POOA 2I62A 1KYZA 1YUBA 5EQJB 3QOWA 3I64A 5K0CA 5K03A 5K0BA 2YXLA 1M6YA 2ZW9A 3UJ9A 4X61A 5CD1A 3LX6A 3EPPA 2P41A 1RI3A 2YR0A 2ZULA 5FUBA 2AR0A 2BR5A 5FA8A 3LCUA 3C6MA 1G38A 2AVNA 5K8VA 3C0KA 3ELDA 5FQOA 4RTQA 3TMAA 3MCTA 1JQDA 3TQSA 1AQIA 3HCDA 3OFJA 5U4XA 4PYJA 2JG3A 1N7IA 4HRAA 2WA1A 3KQYA 3AXSA 3A25A 3LECA 4E30A 2IDKA 4E31A 1IY9A 3G8AA 4P7GA 2IIPA 3Q87B 5FQNA 2AS0A 1O9HA 1RI1A 3G5LA 4HC4A 4KIGA 4PINA 3FPGA 1V39A 3TM5A 4YUZA 1YF3A 2E5WA 3A7DA 2HMYB 3CKKA 1ZGAA 3SSMA 5P8WA 1YFLA 1ORHA 2QYOA 3MCZA 4P7JA 2C7PA 3KR0A 1SG9A 4HGYA 3BT7A 3DH0A 5H02A 4CWAA 2XYRA 2JH8A 3ELYA 1VBFA 5CCXA 3KQOA 5ICGA 3KR2A 2OKCA 3ER9A 4PIPA 3FRIA 3GDHA 1KPGA 5EIWA 4A6DA 1RI4A 1F38A 1NE2A 3L8DA 4RX1A 3PLAE 1XDUA 1R6AA 4E70A 3CJTA 3M33A 3UJ7A 1QYRA 5KQRA 2H1RA 3KPWA 3TR6A 5LQCA 1O9GA 4E33A 3AJDA 4ER7A 3EGIA 2EG5A 4PYIA 2XYVA 5E8RA 4XCXA 5HEKA 5EHGA 2NXEA
chains in the Genus database with same CATH superfamily
3SS9X 1ZL0A 1KIMA 3QWLA 1KDPA 1B1AA 1O6GA 1PWYE 4MI9A 1KO4A 2A0UA 2H9AA 1FDVA 4Z8YA 2NO7A 1PNVA 1JAXA 2WIKA 2CMFA 2DH5A 4M99A 4Y9SA 3TTTA 3GFRA 6NULA 5BVGB 5HM8A 3UJHA 3GIDA 4OMFG 3U48A 1T3TA 1T2EA 4S24A 2VNJA 1RYMA 4C43A 4C6RA 4YUWA 2RE8A 1PJRA 1EDOA 4JVMA 2DG2A 3W77A 5A3SA 4ARVA 2QSUA 1CDZA 3IP7A 1PM5A 2I3BA 1IM2A 4BKOA 4F4FA 5J4LA 5LR6A 5EUMA 3A3OA 1J24A 2NACA 5FTKA 3D3WA 2OYRA 4X8MA 1UJBA 4QLOA 5ELLA 3UFBA 1Z35A 4BUZA 3TMYA 3GJ4A 4LRTB 3WGVA 3UKJA 4V0KA 1BJKA 1EVLA 3HPRA 1GEGA 4BAZA 3L79A 4MH0E 2LWXA 1BKDR 1KY2A 1W76A 3BE6A 4L1KA 2XSZA 1DJPA 1OIXA 1VI6A 1Y9JA 1ZUWA 1AUXA 2JA1A 3IEKA 3FNIA 5A4MS 8OHMA 5AKGA 2ZAIA 5EHNA 1LS6A 5KOYA 2YW2A 2PAAA 3JQAA 3PPWA 1NYLA 4OH1A 4CKEB 4AQYB 2PMWB 1DOZA 1UXGA 3K1ZA 5F2KA 4D8YA 2O1EA 3VHXB 4D56A 1CJSA 1EM8A 3FTDA 2NTYC 3JSAA 4HEJA 4U0KA 3WGQA 3L7CA 4EDHA 2GZHA 1TVKA 1ZWKA 2Q45A 5IF3A 3IHKA 1YUMA 1H5QA 1KK1A 4XPIB 1ZK3A 3HDQA 4UZFA 4X93A 5EEHA 3C16C 2QAGC 2FN9A 5JD6A 1X8LA 5JBIA 1CY2A 3FCAA 1SBNE 4US2R 2R1VA 2VRCD 4IP0A 3U44A 1J42A 3M83A 1L4MA 2WNSA 3DZFA 4KUEA 1BQEA 4WOKA 4ZOBA 3TTXA 2V8OA 3PEVA 3L84A 1NTOA 2ZYSA 4RANA 1OAKA 3ESAA 2FR8C 3NHYA 1M6HA 3C7AA 3DOFA 3TX6A 5BRNA 3SQXA 3TTSA 3MRXA 1AGNA 2MSKA 1I51A 4PTLA 4Q00A 4E08A 4J0CA 2JLZA 2P4SA 1CQPA 3Q40A 4PZ9A 5CPBA 5DTQA 5KPDA 2W90A 1AS3A 5D01A 1XU4A 2BBOA 2C2XA 4Y2RA 1W48A 1GN8A 4FDMA 1KWGA 4L8LA 4OL9A 1FFCA 1QTNA 1HDCA 2FOIC 2QQFA 2QXYA 1TTTA 5HG0A 4FCCA 5ECYA 4LUCA 1OTHA 1B43A 2XI4A 2PO5A 3PEFA 4PNEA 1NPTO 5K05A 1QTQA 4BFTA 4B3HA 1GILA 3HN6A 1ENYA 5ITXA 2BMVA 4PO1A 1O94D 3B3JA 2YZKA 1D7AA 2GLTA 1OVGA 3ZNNA 2CZCA 4MYHA 4KYTA 4LV8B 3EPKA 4CGYB 1BD4A 4E4YA 1E4VA 3DUFB 2Q4DA 2VWPA 3JD3A 3W90A 4GR4A 3SXUB 1EVQA 2FPUA 3BHNA 2NVOA 3H9EO 3FB1A 4WESA 1U1CA 4KFUA 1WXWA 5DCUA 3REFA 4AUNA 2KXEA 2BTQB 2GXSA 1O03A 1SVOA 3ANXA 4U0JA 3ZWWA 2O57A 9ATCA 5KQDA 1X94A 2CGEA 2QTWB 3QPAA 4ZRMA 4YQZA 1W4CA 4YI3A 4EBBA 4JL6A 1U1DA 5C8YB 1DHRA 4CEJA 2FHSA 1ECGA 1N0WA 4JQYA 4ND4A 5CX1A 3E21A 1GPNA 2GGSA 2ZRHA 3AUSA 3PEEA 1C1XB 1FVFA 1S89A 4PC2A 5FBLB 2JIOA 2H1WA 5JFGA 4HAXA 3H4MA 4RD1A 1X2EA 4KDFA 4Z0HO 2M5ZA 4KXFB 4TLLB 3VSEA 3EEOA 2YHAA 1G5TA 3MJEA 1N6HA 1QP8A 1L8LA 1SXJC 2ODNA 2P9HA 3QPWA 5AKLA 3L49A 3RARA 4MYDA 4BNMA 1G7SA 1UBOS 1JDJA 1L7QA 1J0BA 4LF7B 1JA1A 1HMPA 1Y37A 5EGNA 4D3DA 4UVEA 5KYYA 4QPJC 3QY0A 2VXYA 2YMLA 2YVAA 1WDMA 4L16A 1SQ0A 3SSNA 3GMTA 1YGPA 2OHIA 2P9CA 1OWNA 3HUDA 3LFHA 3QTLA 4FIDA 5AJUA 4W63A 3SYNA 2E3JA 5JDIA 1AX9A 2OHHA 1U0EA 5DIFA 4OX9B 2AX4A 2FVXA 2WD8A 3B13B 3BA1A 3PGLA 4Z7QB 4KN8A 3B52X 4MUHA 2CMGA 2Z5FA 4I99A 2YXPX 3AQ4A 1TF7A 3I3OA 3P71T 5FL3A 3MINB 7CATA 2VJBA 3VYTB 4AUKA 1J6UA 2CV2A 2V7PA 5KCZA 4JFRA 1LX7A 1DV2A 5EXEA 3PTAA 3CURA 1VQ1A 4RHYA 3LKBA 4JJZA 5AM3A 3VVMA 2FPSA 3EXAA 5HQ3B 2R9VA 2VEDA 1TM2A 2W2MA 5K45A 2VH5R 2FPPB 4MJ3A 2KBFA 1KI7A 2BHSA 4DW8A 5JBNA 2ZI6A 4ITUA 4QBIA 1X37A 3X1XA 1KVTA 3JQ6A 1N2XA 2J7NA 2C7RA 3P96A 1QVRA 3F4KA 2JEZA 5D1NA 4ZAYA 4DLTA 1O54A 4HFJA 3G0CA 1Z0IA 3MWFA 1FVXA 2E21A 4J3FA 3C85A 2Q46A 3SZRA 3AR3A 1KBOA 3OE7D 5CIQA 3N39C 3WGHA 3HP1A 1E2NA 5DCLA 3S2IA 2K2QB 5KQGA 4TL7A 4AJ1A 4HXEB 4FYWA 3A6JA 2HIMA 4H4DA 4JP5A 4NATA 3SWWA 3IDAA 4DDVA 1P3JA 3DWEX 1F4LA 3SBDA 3M1LA 1SUEA 1T8PA 2H7XA 5EXSA 1U2ZA 3DJYA 4LF5B 2EFGA 5EJ5A 5L4LA 1TYZA 4RE5A 1P72A 5BR1A 2ZIXA 3HYRA 2QVLA 2DHYA 3UA3A 2DBQA 2R4QA 3HDHA 3FZQA 3H4VA 3M4XA 4B6SA 2AJCA 3HKEB 1DKPA 4KN9S 4QXRA 4DILA 5A0TA 3AB3A 3A2NA 3HVIA 3W3AA 4K9RA 1J06A 2QRNA 4NMXB 1TU4A 1BX3A 2XY4A 4EIWA 3EW9A 3F2IA 3WK5A 4EYKA 3GJXC 3PJDA 3DDZX 3RHTA 3UWDA 2YXEA 1LTHR 2GZAA 4I4IA 3UYLA 4CKWB 2UXCB 4P0TA 1N9GB 1ND5A 4HPWA 2YY5A 4MRVA 3RC7A 4IBBA 2ZZMA 3F5FA 4Y1GA 4KT0F 1AGRA 4EF4A 3QJ5A 4ND7A 3AI1A 3E1KA 1AUQA 2V8BA 1BZYA 3FKQA 1UFQA 5SY4A 3CNHA 4QTUB 3I9MA 4R8RA 3C5WP 1UEJA 2QI9C 2BBSA 3L1VA 4QU0A 5ALYA 2B5VA 4IKEA 3TLYA 5A5VA 2HK9A 4FYVA 4YT8A 1RWXA 2AOTA 3I09A 2CY0A 3NT5A 3I83A 4K6FA 1IY8A 3NS7A 5AOAA 5AVYA 3TGPA 1ZUD1 3ROKA 1GZVA 3V6MA 4CM9A 2ARKA 1LPMA 2OR3A 3FMFA 5B6JA 3VZCA 1NBIA 5HW0A 5A62A 2QRHA 5IH3A 4UATA 4DR3B 3U4QA 2DQYA 3JQRA 1Z15A 1IOLA 2PT7A 2Y20A 4H1VA 1Y33E 4CLOA 3U6PA 1XCLA 3NR2A 3V55A 1IBLM 3VOAA 3ILXA 4R81A 1VHTA 2LXNA 3P97A 1LK0A 4MITA 1KMMA 3N6VA 5D3QA 5GV8A 3BCUA 1D3AA 4MIKA 4OXIA 4DNOA 5CMLA 2IK8A 3D9QX 3FWNA 3O8QA 3IE0A 1AHHA 1AS2A 1V1RB 2AOVA 4KQ2A 2HZBA 3UOAB 1F8UA 2PSFA 2FDRA 4ASUA 4ESEA 3L1JA 2FQQA 4HB3A 1HNZB 3LHIA 4BQIA 1P2VA 1R9MA 1TZMA 5AHWA 4CETA 4IHJA 3THRA 2WI8A 2L4EA 4AJLA 3M81A 3I9V6 3A6GA 2QK4A 4ZAFA 3QE3A 2X9GA 4LEIA 1D04A 3EFBA 3GZTB 1KYVA 2FK7A 4DQUA 4TXNA 2WSMA 2BKVA 4Y6OA 1JPJA 3A1UA 3EODA 5G4KA 1R8SA 2H8GA 5HZMA 1LPPA 1V26A 2DLDA 1VBMA 3H87A 1P44A 4IDHA 4KSYA 4WKGA 5BNFA 2JFGA 3KT0A 5E3IA 4OYYA 3KAKA 3F9IA 1OQYA 3GRKA 1FTWA 3TEJA 1JG2A 2AI3A 1N2CE 2ZRQA 4ITRC 1I4OA 2DFVA 2EIHA 1OHHD 3I4VA 4OJQA 4CI0B 3MA0A 3BMNB 3GPDG 5C8XA 4HQLA 3RS7A 3BC1A 1YKFA 5U1PA 1P29A 4MIYA 3HFSA 5A2GA 4RA9A 3BF7A 1U2SA 2CFCA 5DKFA 3VPDA 1U90A 2NXCA 1IXSB 1NY6A 3HDVA 3OFSA 3Q6IA 3NETA 3G2QA 4OK6A 5F64A 3GFBA 4AWXA 2OLJA 2Z9BA 1V16A 4RH1A 5AVQA 2GM5A 1DEKA 4MQMA 3EC7A 3FCEA 1EMDA 2G40A 4N9WA 3WIVA 1QGED 3YASA 3AUJB 5DM70 4HD8A 4LPSA 1AGPA 3ZE7A 3LQ4A 4I55B 5GQSA 2DUUA 1EHCA 5FPQA 1YH3A 2J6BA 4RIFA 3O95A 1U28A 2W2OA 4XD7A 3A9TA 4EA7A 4ZT4A 2ODQA 2X0FA 3PDJA 3C3DA 2OLEA 1QCYA 1W4RA 1GCGA 1X7XA 2KW5A 1NT2A 2FUEA 1V11A 5AW9A 4BP9A 2YASA 5JATA 4D43A 2CLKB 1JIJA 4HPXB 4YBRA 1P1IA 1Y3HA 3ZXUB 3EXIA 1ENPA 3FHOA 4PVCA 1FE8A 1NIPA 3DE6X 4YMWA 4U6NA 2AJLI 3WZ2A 1W85B 1V71A 3H2BA 3KQQA 4RHCA 4F56A 2AG5A 3BTSA 5A6SB 3FROA 5EP4A 4PEVA 4QBKA 4ZU3A 4ZK2A 5FX2A 1PRYA 2RDMA 2AB0A 2QQEA 2WJHA 4W9RA 4Z4HA 1U8CB 2GN6A 1A96A 1PZFA 2GLUA 2ZRBA 1EXNA 3UMJA 4BJ1A 3BSWA 3OEED 4RF1A 5T6BA 4RIEA 3RFUA 1EJ0A 3FI9A 3QX3A 4CEIB 4DF3A 2PX3A 2Q21A 4EQZA 1RP1A 5JAPA 1E3WA 3K9BA 1EBBA 4J16A 3DOUA 2BFBB 4C20A 2P9YA 4FZRA 5AJHA 5SV2A 3HZRA 3BBPA 4G1CA 1YLAA 2OHJA 4RWZA 4WERA 1L7BA 1O94C 3HXQA 2G71A 4IBJA 2O1XA 1VCHA 1NXQA 2R25B 2F1JA 5H83A 2J09A 3KFVA 4KBYA 5FF9A 1Q6YA 3GJRA 4P33A 4JB2A 4ZP1A 2W37A 3EEFA 1P4JA 1I4WA 2VDBB 3MCUA 4UXIA 4BDSA 2VHYA 2YIMA 1PV1A 4YRGA 1LC0A 4RM2A 1VMIA 2GF9A 4J7AA 1W0KD 4PIVA 3SJUA 2Y4OA 2I2DA 2BONA 2EKBA 3A1NA 3MZ0A 4DLPA 4IV0A 4PF1A 5AJWA 5AOVA 3OM0A 3UBTA 3LXMA 1M74A 3BE5A 4DMLA 1RBMA 1JZQA 3DXXA 2GQFA 1M75A 1QG0A 1IAQA 2AYZA 2IY9A 2MR5A 2P62A 1ESDA 2C61A 2HHCA 2F00A 2I3DA 2UZ3A 3A6DA 3N76A 2QTTA 3IT0A 1PQUA 4HOYA 5K6TA 2JB9A 2JLRA 2YHIB 3E4RA 2GUWA 3MCWA 3QKSA 4ZO4A 3T54A 4LYHA 3KQUA 1NOIA 4G25A 3LH5A 4WVLA 3TZCA 3KXKA 1RI2A 2C7OA 3ZHQA 1JSLA 3BAZA 1AKTA 2ZTMA 3PQ2A 1TDHA 5F23A 2YV4A 4NBVA 4PZDA 2ZPUA 4P3PA 4TX1A 3F96A 2F8LA 3G17A 1MTZA 4RTPA 1JPVA 2QRVB 3HPQA 2I22A 2BMDA 1E1QD 1VJDA 2VK2A 4G1EB 4XYBA 2EG9A 4JGGA 3ZU2A 4C01A 1EXDA 2WPDA 1V5WA 3EF0A 3Q8KA 4TRJA 1QGZA 4DV3M 4J8PA 4XGNA 4BNKA 5TLSA 1FPMA 2XHEA 2AZTA 4X66M 4M1ZA 2GF2A 4R1MA 1J20A 4WE3A 2HSZA 3X2EA 4DXDA 1IULA 2HJHA 2BZGA 2E5FA 3SMPA 4P35A 1IBLB 2VXOA 4LKRA 4CCSA 5E7QA 3WGLA 4E5NA 2XFSA 2OFOA 3AHJA 3NAQA 3MB5A 1WBJB 4K05A 3HXTA 1JFLA 1UFVA 3EXHA 1CRQA 4KSCA 1KGSA 1U3DA 4HL6A 2W83A 3WI7A 2H08A 3FFBA 2F7SA 1RFLA 4Q12A 4ZU1X 3DEFA 3IKJA 5CD1A 3K6SA 2CNWD 4LBYA 2Z4TA 5ALOA 2JD0A 3LY8A 4KO1S 2JIPA 2HMWA 4E94A 1DLIA 1G38A 2ZUUA 5ERXA 3FFWA 3VH4A 5HJEA 1F2UA 4J3NA 2ID4A 3TR5A 1ESZA 1EUDB 3FBGA 1N1EA 3AX6A 4H3HB 5F1OA 2FSGA 2I67A 3SJCA 2PZAA 1ZSVA 2GJSA 3AERB 3AYZB 1KGDA 2AI2A 3FDIA 2J31A 3GB9A 2ZAMA 3MYYA 4X6UA 3WGNA 3FBWA 5CGZA 3X1DA 4H3VA 3H05A 3H9BA 1ORVA 3I1IA 3CKKA 3KSBC 1VA5A 4J43A 3VPBA 4BU0A 1FDWA 2REBA 1L1ZA 2IV2X 1JT2A 3SSMA 3GGJA 3UMCA 4EFNA 5K3EA 2R62A 1DAPA 3M1IA 4KK3A 1F5NA 1EVYA 4KXLA 1T4BA 1SG9A 5AI0A 1E5DA 2Z0MA 3DOAA 2VO1A 3OG9A 1G4UR 1ZGCA 3AM4A 4YRDA 5DB4A 1RABA 5BYKA 4DRYA 3LRPA 1RAEA 1K6XA 3QWFA 4YJHA 5C32A 2KZSA 1QFYA 1UP4A 2OKCA 2C00A 1ZD2P 3CRVA 4QOHA 1NONA 3CZCA 2VF8A 2Z4RA 2XZUA 1IN8A 2RKWA 2MWMA 1YDFA 1SHUX 1XDUA 3GJZA 3WWOA 2H5XA 3KDSE 3UJ7A 4Q66C 1Z26A 4NH0A 4X92A 5CLIA 4YCJA 1O9GA 3JQAB 5FBVB 3S7ZA 3WX0A 4NZPA 1BSVA 3LM8A 4DCGA 4KX5A 1P1RA 3MT0A 4W1PA 1TJNA 3SF0A 3FTEA 4D9FA 1G2IA 1KH2A 1L6IA 1NM5C 2QNIA 4Q47A 2IELA 2SKDA 2VYND 3D8NA 5JARA 4CCYB 3LCVB 2ODBA 4B32A 3NVKI 2EF1A 1OLXB 2QPLA 3CEPB 5CUQA 1WB5A 3U6LA 3C6XA 2K7ZA 1QIMA 3TZ6A 1PCXA 4UM7A 4X44A 4RHTA 1NZDA 1KP3A 2VSXA 3GI1A 4PY2A 1M6NA 3TLGB 4B4UA 3BWBA 4MUXA 4LG1A 4DV7B 1XLWA 3R8CA 4Y6SA 2QD4A 2ZG6A 4WBNA 5BNWA 5JSQA 1NR5A 3L7YA 4B3GA 2OD7A 3GMSA 5AW3A 4M86A 5FO0A 2WT8A 4PQEA 4TLMB 2ZKLA 3EMBA 1GYQA 4ZEMA 4HL4A 2QF7A 3KTOA 4KAFA 5IBPA 3ZJUA 1BWQA 4IDOA 3MVEA 2DFLA 3A70A 4IDEA 4DJTA 4QBTA 5JDCC 4NENA 2MCFA 1U1EA 4MGZE 2ZYIA 2IOFA 4Q9NA 3FZGA 5AM5A 4DLAA 4DHEA 2AGVA 5DASA 1GGHA 2GZSA 2JGNA 4AULA 3ZNQA 1P5HA 2CFSA 3Q1KA 2ACEA 3LLMA 2C78A 3HCBA 3NBAA 5K3FB 3PFHA 1K6MA 2VJNA 3U16A 3FYCA 2P1DA 1ECLA 1MJNA 3SR0A 2LP4Y 3DCYA 2I7PA 4CKCB 3PDWA 1TVEA 2PS0A 3EIEA 3V4FA 1VKRA 3W1WA 1HDGO 1HLDA 1SKUA 1TYCA 2IYWA 3K72B 3WB9A 5HKAA 5JCZA 1QQTA 1RT9A 2XCRB 4JI8B 4B85A 1P1CA 2E2WA 1TCAA 2II6A 2N3ZA 1H2AS 4OB7A 3E5MA 3UH1A 1TUEA 3DM9B 4MWDA 3KVRA 3OD1A 3WE7A 4BRSA 5BXQC 4OX9Y 2J9YB 5FA6A 4B6GA 4UCFA 2OSBA 2PE5A 1XZJA 3ZH9B 4F9GA 1U9YA 3KU4A 4CZ2A 5IJWA 2LNHC 3BREA 4MPJA 5DBHX 3G2PA 3KTDA 2QT0A 5KTTA 1PEAA 1Z3IX 4HLDA 4PGHA 3Q8MA 2O8BB 5AYVA 4CLDA 4AURA 1SVLA 4HWKA 2PZGA 5DWVA 3EC1A 1F3OA 5BN5B 2HKIA 1DPFA 1IB6A 2RHJA 3NOQA 4TMKA 3NGLA 4W9NA 3WKEA 4DA4A 5LZ4A 1RSZA 1Y1SA 1N5RA 2QU8A 1MVNA 2FG5A 3FHTA 1P8JA 2FP3A 2R4UA 1V8ZA 2CVPA 1GSHA 2IPOA 3DHNA 1JFFB 1ITZA 3RJ9A 1OFUA 4B44A 5JXGA 1MQSA 2K6GA 3BK7A 2YV2A 1RQ7A 2PNJA 3TBFA 4ABTA 4OHPA 4LXGA 2JI9A 2GEJA 2YJ5A 3T1YM 3B1KA 4B3MB 2PUWA 4QSHA 2AFIB 1CUBA 3ROTA 5HVNA 5AJXA 4UUAA 3D8LA 1R10A 3PUKA 1H6AA 1LGYA 3EOBI 3I6QA 4GH5A 1HQDA 2G88A 1E2KA 4JN6B 4M8IA 4MV1A 4AICA 1KYTA 1JFSA 4BLOA 4N5LA 3HO8A 5JMPA 3I58A 4D0NA 1ODSA 1LF5A 1SU4A 2GUGA 4XWGA 1SQ5A 5KVAA 4J1TC 4M9RA 1EWKA 2AFHB 2R4EA 1CJMA 1ZGBA 2V7BA 3ABRB 5TNXA 2O0MA 1B0AA 2HWYA 2SCUB 4X85A 1RZUA 4GX5A 4C4XA 3EFOA 4I5IA 1Z8FA 2NTNA 4D4GA 2BH9A 3S27A 2ZJ5A 3OTOB 4XIYA 2AFVA 2VJMA 3FAKA 2OO3A 3WYFA 5MFPA 2VTVA 3GFGA 3V4VB 4RTNA 1Q19A 1Y5IA 2P2SA 3GELA 4JBHA 1E59A 1Y8RA 3C98A 1YZYA 1U6JA 3KDPA 4HTFB 1C3EA 3K5PA 4AX4A 1AG9A 3FD8A 1ABFA 1K2WA 3DMDA 5CA1A 1NXOA 1R18A 2PGAA 4G5SA 3O75A 4FT4A 1I6MA 2VTBB 3FJOA 3QBTA 6PFKA 3M0EA 2X1HA 3Q0TA 1SA0A 1PGJA 2D1RA 4QAJA 4LX0A 5D7NA 2OCAA 1EK2A 1A9QA 2FKNA 3MWKA 4KNWA 2BPOA 1E3SA 5C80A 3PFWO 4HZGA 1O5TA 3L0PA 2FFJA 3WL6A 2WD7A 4J0KA 1AHIA 4AIIA 4CKCA 3IPLA 1UAAA 3HB5X 4KLZA 3WGZA 3A1EA 3KUKA 3QFSA 4CMGA 4YY3B 1Q84A 2FFHA 4WMLA 4C08A 1JB9A 4I9GA 3K9NA 1FSSA 2IOYA 5DT2A 5FFFA 4GEGA 1HNWM 4URHA 5AW2A 3BKXA 2MINB 3QPDA 4P9NA 3BMQA 5IG2A 3O7MA 4IBEA 3MMPA 2PA3A 4FN5A 4H15A 2BGJA 4O4LF 4W5RA 1YDGA 1LJ8A 2GI4A 3KWFA 4DV1B 3MJTA 3V4OA 3PRJA 2P1ZA 3KV3O 1R16A 3ANLA 4FWHA 3BDAA 4MLCA 3CH7A 3OIUA 3PSAA 4V0SA 2Z3VA 1XHBA 4P32A 4XJXA 1VDZA 4IH9A 2GXUA 2ILVA 5JISA 9GPBA 4U6QA 1C4KA 3DCIA 4BV8A 4B4WA 1LPSA 3VPCA 1N3IA 2ADOA 3I32A 2B6NA 2EL7A 4HN2A 5HDBB 5EJ6A 1D0MA 1QO0A 4JR2A 4N82A 2IU0A 5LOVA 2FKAA 4PSUA 3D0RA 5EUCA 1W4BA 1G8YA 1LLCA 5IM5A 4DV2B 5ILOA 3C6ZA 3KYCA 4QDXA 1VDDA 2O5RA 5KNDA 1GAWA 1UJCA 3QKWA 1CE8B 3PFFA 4JCCA 4JJ7A 2R5FA 3GXBA 4B84A 4G3OA 1M73E 3QKRB 1SK8A 4A8JB 4CCWA 2P6MA 3DVQX 3R23A 1QAOA 4YAKA 1CD5A 1ZCFA 1O7JA 2BVNA 2XMRA 3DDNA 4GE0A 3C3MA 4HMQA 1T5BA 3AP3A 2KE5A 3UJBA 3V2GA 4GP9A 4R3NA 5K0FA 1MJHA 1G42A 3DMRA 4MQ4A 4HLQB 3NH9A 2LHCA 1USUA 1WTAA 2W70A 3B7QA 2C5LA 5D51S 4EW1A 5C7OO 5J2TB 1U7PA 3B1YA 4FWTA 4ZAGA 3SPXA 3CO0S 3WKDA 3JR5A 4X90A 1MH1A 2W8BA 2O9JA 3A1DA 2IBTA 1NATA 1I0ZA 1NLUA 3WL5A 3F8SA 3COVA 1P4AA 1VC2A 3I9FA 4MR8A 3U6QA 2ATEA 2R60A 2WIJA 3I6BA 3R5FA 1DHTA 2E49A 2QIPA 2VAXA 4GPBA 4MIOA 5HF9A 3HTXA 1H8HA 4LFAM 4GOLD 3AV0B 5LL6P 3HWX1 4QDTA 1G63A 1MX9A 2BFOA 2RIRA 5DGXA 2XPCA 2M9MA 3CH6A 5D8DA 1T3SA 4JQCA 4KGZA 4ZJYA 4D42A 4YCLA 1ZRNA 4QZVA 3HXMA 4RK4A 3UT6A 2IHKA 4OFBA 3AHFA 1NX9A 3MXOA 2V6MA 4GDFA 2DE0X 3QVWA 5FO1A 4G5XA 2M6RA 1FXUA 4CLRA 3L0ZA 3ZX5A 4WTOA 1R4NB 3T94A 2A86A 3GCWA 4TUYA 2GPYA 1U7HA 2QX4A 1IPEA 1ZH6A 6REQA 5KOJB 3B38A 3QG1A 4JWKA 5FT9A 4Z51A 3I2GA 5KAMA 3U4CA 2ZIUB 1BWPA 1RRPA 2X7HA 4QHSA 3P4XA 121PA 3W2HA 1DL5A 2FJ0A 2P9QA 2J5BA 3P4UA 1YI1A 3F3KA 4RNCA 3VJMA 4EJ2A 5DX1A 5F3WB 4IBCA 1JXAA 5K0GA 5KQ8A 4W9MC 4EG8A 2P4EA 3CLRD 4FI3C 1YVPA 3DZJA 3GMDA 4RF4A 2DQZA 3CTPA 4WASA 4Z3OA 5AM1A 3GMIA 3HR8A 3OO1A 1QR6A 5F5NA 3BF8A 1TMOA 3G1UA 5EMLA 1UJ2A 2V6ZM 1T6ZA 4KXNA 1T0HB 2BDEA 4OUDB 3GBPA 4D82A 4Y2UA 5H9VA 2V7XA 3TRHA 2D2IA 4P22A 1IVSA 1VSVA 1UDXA 2GKSA 3LLSA 5IBQA 3W5JA 1T5OA 7ABPA 3NJRA 4HUQB 1UT6A 1YR8A 2O2XA 4OGFA 2WR8A 4TTSA 3T1VA 4Q9DA 5EJ2A 4BCDA 3HN2A 4IR7A 2Q6OA 3SR3A 2QQ0A 3MG9A 2IYNA 13PKA 4NHEA 2R4JA 2P0EA 1OFVA 3ZZUA 4XDHA 5A71A 3J7AS 4P3YA 2OGTA 4YY3M 4KQ1A 4HNTA 3ZE1B 1EFRA 3FPJA 1G55A 1UKCA 2CL5A 2GM3A 1II9A 2FZEA 4FHGA 4KNVA 4WY5A 4ENWA 5LQDA 1T15A 3DMFA 3VC2A 1ZV1A 1NVFA 3C41J 3L4SO 3LT1A 4DSAA 1V2GA 5SZJA 1L5OA 2L18A 2J4FA 3NC0C 3Q85A 1QVAA 4M37A 1V3TA 4C4ZA 1UXJA 3SQDA 1P5RA 1XTVA 4FHFA 2FN8A 2R1TB 3TSOA 4DN6A 1RBQA 3T4XA 1K68A 3AR5A 3KOWE 1X9HA 1C0LA 4AMBA 2PMBA 1YACA 5LMUM 3QLVA 5EIBD 2G8LA 3LUFA 4WCFA 4EY8A 2YNMA 1QONA 2QZ4A 2PGDA 4QDKA 1OU0A 4FNOA 4RF2A 4BQSA 4A2PA 4D2IA 3O93A 5A0FA 5BURA 4J0DA 3DAOA 1X7XB 1J90A 1T2NA 5GJVC 3AFMA 5I3CA 1FS5A 3O8NA 5DISB 3BFVA 3RHFA 1DE0A 1YVRA 3MRVA 1X1SA 4FHDA 1B76A 2OESA 2X6TA 2BE9A 3I12A 4MSUA 3O3MB 1E64A 1GFWA 1LLDA 4HUJA 4MB0A 1SOUA 2JNHA 1WZIA 3R5KA 1U99A 2JLAA 2XVXA 1IZ7A 2WJYA 5F2EA 4JI3B 5IFLA 1Z5BA 3FMVA 4CMCA 5AUPB 3EXHC 1C14A 1CNMA 2OCGA 3G6KA 2Q2OA 3OETA 1G3IA 2VYQA 4N3BA 3TUIC 4QHTA 2OBXA 3AGPA 1TUBA 4Q3NA 2DWNA 4BQRA 3P0EA 2VYFA 4RK5A 2HNBA 1G8AA 4LRSB 4LZOA 1C9KA 4UBJA 2IYTA 2DJIA 3RWBA 3F47A 1UXHA 3U4AA 1OX5A 1TECE 4D7AA 1E2DA 1OPXA 1GUYA 1Z74A 1AKMA 3EXEA 3H2YA 3MC1A 2YNMC 3TRFA 5KKAA 1VPDA 4WCFC 4ZFNA 3WBKA 5JMTA 1IXKA 1T9GS 2MROB 2OZVA 3JQ9A 1PWZA 3G7UA 1RAAA 1UINA 3MTAA 5HCNA 1GP2A 1N2JA 1NF2A 2ZDQA 4NNJA 4F5DA 1D07A 1GPMA 1C9JA 1I7LA 1FTGA 3NBYC 4MLDA 2EJVA 4AG6A 2FDXA 2QKYA 5EQTA 3KJGA 4XSHA 3KM0A 3V80A 5HOQA 4B3SB 3AVVA 2WWRA 1UPUA 2IZOA 4M7WA 2OAQ1 3D7SA 5DJ5A 5JRZA 3ACDA 3HR7A 2JLSA 5F1YA 4L74A 3U3RA 1UXOA 3DD5A 2HSJA 2QU7A 3UATA 4IRUB 5DBOA 1U7XA 5GOZA 2PCLA 1E8MA 1YRYE 4L51A 1SU7A 2ERCA 5KDLA 2EERA 3EEQA 3WB1A 3D7MA 1P7PA 3RAGA 3LHDA 2I7NA 1PK9A 1Y5RA 1C0IA 4G0MA 2XBMA 2N46A 2Q7XA 4YV1A 1E0DA 4HEOA 4KZPA 1UIMA 2OFPA 3IAS6 3HY6A 1Z0FA 1OREA 3C3BA 4PHHA 3RYFB 3WMWA 2Q2QA 3F67A 4BNWA 1XCJA 3H84A 3OCCA 3PNQA 4NR0A 4I1PA 5KVSA 4TKLA 3THYA 1A4UA 4PIMA 3TN7A 3HKBB 3OZVA 3O1IC 4DLXA 5TMPA 3H11B 4XGIA 5LYYA 3X3HA 4L95C 3TW6A 5JTUA 1N6NA 1X1QA 1V92A 1C30B 1WZNA 2Z5GA 2HSGA 3FIUA 2I33A 4PYQA 3AXTA 4D25A 1ZYUA 2HDHA 3C70A 3O8OA 2BR3A 4X1OA 5CCDA 4P16A 2YC2C 1MAWA 5B1DA 3HFRA 4NK5A 4UHBA 1COWA 3RUDA 3IEXA 1RPNA 1MT0A 3QU7A 2E37A 2EBWA 2F55A 4M46A 4MVJE 3E03A 1PL8A 3HACA 1FFDA 1MLDA 2C4UA 3FOWA 4JLUA 5BT8A 2AA3A 1IEWA 1KVUA 4GXTA 1Z2OX 4RGBA 5KYYB 5EJEA 1AQUA 2I62A 1CQJA 1FFXA 1Q57A 1QK5A 1QWSA 4RVUA 5J2UF 3DDOA 4MMYB 4N1AA 5JYBA 1M6YA 2A3RA 4RWEA 5LXTA 1S2NA 5EVCA 2YICA 2GD0A 3LK6A 2I66A 3SOZA 4EY3A 3NVAA 2B4RO 3I6ZA 3HB0A 2QL7A 3D8HA 4PVDA 3C0KA 4L2IB 4QTZA 1TFUA 1W36C 1UWCA 3NYRA 2D5CA 2QI9F 5I51A 1N0HA 3OFJA 3VBEA 1XD2B 4OJTA 1N7IA 2G6TA 2WJ6A 4IM7A 1PT5A 2PR7A 2H31A 4DDHA 1NGSA 1P2DA 4GWGA 5D6OA 4B3TB 3NNDA 4TSFD 2AS0A 4YXWD 2RARA 2D0IA 4A82A 3A7DA 3DDHA 4QU5A 3HLYA 4N0QA 4XFJA 3ZTYA 3ROQA 1JDPA 3ZQJA 3GWGA 1L7MA 3AC0A 3KR0A 2Q6LA 4I4TF 4IJVA 2F1RA 5JVDF 4KXXA 3HKDA 1S7CA 1UAGA 3UMRA 1P0QA 1SMKA 4BP8A 1M72A 5AD1A 4IBOA 1TR8A 1GWNA 4UAUA 1ZAEA 2Y93A 2DWLA 4WGFA 5F4ZA 5FRDA 2RJ3A 4H7FA 2TMGA 1RS0A 2WHYA 2MMGA 5FLKA 1A8HA 4WSOA 5CLLA 5JQGF 5LQCA 2G1KA 1W0JD 4MKGA 5CRIA 2F3PA 4CDMA 1UUFA 1W9HA 5A7HA 3RTCA 2P2DA 1U0OC 4Q5IA 1DEOA 3KVWA 3N6XA 2FJPA 2H4FA 4Q4AB 1L1FA 3T3MB 5JTTA 4LFBB 1RKXA 5B3AA 2V59A 1Z62A 1WQ3A 1NJSA 4B7GA 1E0KA 1E2FA 1NXTA 2PPVA 2XVAA 1W0CA 2BDUA 3ZU3A 5JZSA 4Y6PA 4LJKA 3S2YA 4I9HA 4A03A 2WTAA 4OATA 1XVAA 1WETA 1Y7IA 1DWUA 2JGFA 3E8XA 4KK4A 5JNWA 4HN4B 2ADFA 3LTNC 1H9CA 1F2VA 2C0CA 4Y9DA 3S2ZA 1IMJA 3H0EA 1HDEA 1GCOA 4ER0A 2PMDA 3IBCA 4DYVA 1IJFA 1WBDA 2EVWX 2PGJA 3OOJA 1ZGHA 4JR0A 4KQGA 4LOKA 2XUPA 5HF8A 1PTJC 3ANMA 4Q4HA 4GMFA 1NHGC 3U26A 1HWYA 4K0RA 3ZQUA 1P17A 4ITVA 2DI0A 5K3OA 2EBUA 2QMUA 3I04A 3RUEA 4ZAXA 3EIXA 3O2JA 2QN8A 4GL2A 2JAXA 3VM6A 1YS2X 5FBQB 1W88A 3TZLA 4MW4A 2H00A 2O3RA 3D1VA 4I4TA 4LRUA 3ZD6A 3GLGA 1YZUA 1EFUB 4LE0A 5ER6A 3UPDA 1ZD1A 2HUNA 4KQIA 1YAJA 3ABIA 3HB7A 3SM3A 1Z6GA 4XIIA 4UBMA 1BCSA 1N5LA 1O95A 3MGCA 1DXOA 3B1VA 2BUBA 1Q1QA 2I2FA 2VT6A 2ZWIA 2QT9A 2DSTA 3B9RA 3FETA 3HJAA 1U4NA 3UNXA 5JXJA 4U2FA 3CSUA 1UPXA 3LVVA 3KYJB 3MTGA 1JHMA 3AY7A 3LRTA 3M6VA 4LZNA 4EY6A 1QLHA 1WR8A 2D62A 1HYEA 2O2EA 3D3EA 2JY7A 3P9XA 3SAUA 5GP1A 2RGXA 3U80A 4PT5A 3BGOS 4P54A 4NRDA 1ZM9A 2QX8A 3II6X 1XRLA 2VF4X 5SZHB 2FYTA 2HRBA 4HXFB 3SYRA 4D3XA 4ERNA 1R4GA 1L6RA 3ILSA 5EHQA 4EHAA 3KJNA 4X64M 3M5DA 2WM9B 3OF5A 2ZWVA 2R7MA 3PQFA 5BVGA 1JSXA 4LRTA 2EU8A 2Y76A 2QYHA 3PFKA 5J4HA 3UAXA 4Z53A 1QHIA 1RXWA 1UZMA 1Y8RB 3FKSA 3THYB 3OLZA 1PLLA 3KQWA 1ZY2A 5LA6A 4OB8A 1GZUA 4CLXA 4MARA 2D0DA 3G7NA 3OPMA 5I7WA 4F97A 2QE7A 3UAWA 3H0KA 4AROA 4XR4A 3D3WB 3GLTA 4J91A 1MO3A 3V32A 3RS4A 4PD2A 1Q6ZA 1ULUA 3BH0A 3I2YX 1YVEI 3IQEA 2ZJOA 5CBKA 5JR3A 1NXVA 1NDQA 1TCBA 4C2TA 1WSAA 1QH1B 2XIQA 2ZUVA 5C8YF 1JKJA 1NXSA 1ESNA 1VLZA 3UG6A 5IC4A 5BOVA 3V5NA 5JASA 1LU9A 2OZEA 2QVCA 4Q15A 1LW7A 3ER6A 3KKOA 3OY2A 2A88A 4MRRA 2IHVA 1ZCZA 2BFDB 1IL0A 3EW7A 4HDMB 1PUXA 4LAFA 4LZJA 3WYGA 4OEHA 2H1IA 3Q8LA 3OCUA 1GAQA 2C8LA 4MGYR 4CMEA 5HCIA 4UVIA 1CR0A 2NVWA 4JU8A 3NJ4A 1NQXA 2AXNA 3GJ5A 4R8LA 1ABBA 4N7JA 4EJ0A 4CM8A 4NZYA 1RRFA 4DKXA 1XRJA 3CB4A 3BILA 1IRXA 1M34E 1G59A 1NUPA 2FWMX 2NLOA 4URUR 3RSHA 4B3IA 5L4NA 4KXVA 2A9RA 1RXYA 4DG9A 1EE8A 1XMVA 3ONVA 5LLDA 5JUWA 1OAOC 4AQ7A 3U44B 1VYHA 2BFCB 3PXAA 4FKBA 2R6HA 1K3TA 4M1EA 5PNTA 5JEEA 4BNJA 3H3JA 2NMVA 1FQOA 3Q9SA 4I8XA 5H3CA 5LZ9A 2ISSD 1V48A 1K7FB 2GN0A 3KZ1E 4JBLA 1FP7A 4WCVA 1TW2A 4A8JA 3N2GA 2B7CA 4OJMX 1KJNA 3DJFA 4ABYA 4EAQA 2VDOB 2BHRA 1OH5A 3RC8A 2XA1A 4EHBA 5CU7A 1ZK4A 4UN2B 1CX9B 1E79A 2A57A 2H2WA 2JFXA 4JJ4A 4Q82A 4BE4A 4YPVA 3A6HA 5L7WA 1C41A 3ZGVA 4C7JA 5C4IA 1OROA 3ICOA 2VK8A 3OPXA 4LYYA 5CLQA 4UHCA 3W7VA 2H6EA 3LQQA 9LDBA 1V3UA 4B33A 5BV1A 3L29A 2J07A 3B2QA 4ZXPA 4G23A 1JFRA 3DDWA 4P86A 5LFAA 1THMA 2J7OA 4DE5A 1JSZA 5JADA 4NICA 1Q0SA 4QKQA 1NP7A 2QVYX 5CD9A 3I62A 1CFJA 3E15A 3N7TA 3FYTA 2DBRA 2QAGA 4QU8A 3W9SA 3R76A 3ZLBA 2GPNA 4CKEA 1BJTA 4BRUA 1WV1A 8GPBA 4AAYA 2XMDA 5GIPE 1NUTA 3F49S 3LHFA 1F8FA 1LJLA 1TAHA 2J5KA 3MWEB 1NVUQ 3VR5A 2XZTA 3E1SA 3R3YA 2J7PA 5E95A 1Z75A 4JQOA 5AOBA 5IKXA 3RRJA 2BEWA 3U13A 3BWEA 4XQEA 4LFBM 2FWAA 3B7GA 5F1PA 4C22A 1DOAA 2XSZD 2RB5A 3AETB 5JD4A 2B2XA 3D2CA 2XUIA 4ID3A 1T29A 2FAXA 3LFUA 2FP4B 3AEKB 4OBXA 4R7GA 5EUBA 2BGNA 2Z9DA 2WFMA 3WWCA 4C30A 4IYJA 3U31A 3HMQA 3SC2B 3BB4A 2WPDD 2AEEA 2CJXA 2J3JA 2BAGA 2M2IA 3AK4A 2C5BA 1PR0A 5D3MA 1DUIA 2IDMA 1KE2A 3VTFA 2NYUA 2ZCUA 3BZWA 2IF2A 4J2HA 1W34A 4IGKA 1U3WA 1ZICA 1M6VB 1NZJA 3NHPA 5DXFA 2EJTA 4N8SA 4AS2A 5E3HA 3O8RA 2ROQA 2UVPB 1SIUA 2ZTLA 2YCBA 3SJBA 2HMVA 3UJCA 2OCYC 4MX8A 3UYKA 4UTRA 4KMMA 1JFTA 3GVPA 3CX8A 4FX2A 3W79A 1JH9A 3QEOA 1V9LA 1GQOA 4MZXA 1MAHA 2B35A 4YWJA 4JJAA 4EF6A 5KWIA 3WA7A 1RKUA 2DBZA 3NT4A 4R1UA 1AJEA 1TK9A 4O02B 1E5QA 1EDZA 4LNHA 4JLKA 3G8CA 1ZW1A 2UVPA 3KO8A 4P38A 1VLLA 5IWCA 1BO6A 3DEKA 3B1ZA 4JH0A 3EYAA 3G0BA 3K8QA 4WD3A 5BSTA 4C21A 2IH4A 1OFTA 1P0CA 3AUXA 1VZ2A 4QJIA 4A8JC 4CQLA 4F4UA 2J48A 2VDNB 2VBGA 1EUDA 3PCRB 1KJ9A 2L69A 1QOZA 4IO0A 2BGMA 2ODWA 1M5RA 1PAUA 4DIBA 3FWKA 4HGQA 2HSDA 3AR6A 2OG1A 1O89A 4ATNA 1MIOA 2XOKD 3A8TA 3T3GA 4UE3S 2FZVA 4JI4B 1WMFA 5KHOC 2JWSA 5K1ZA 1UMBB 4ZVUA 1HGXA 5C7YA 2FEMA 5CDHA 2QTGA 4TYWA 1KRWA 1U02A 1O96B 2AZMA 1DGHA 3K5HA 3VSDA 4DMMA 1JIXA 1VIMA 1XLVA 4FXPA 4FM9A 5TS3A 3O3NB 4OQFA 4E88A 1DO0A 1WUYA 3Q3HA 4Q21A 4QFDA 3M6FA 3MFYA 2F9FA 3NEPX 2JI8A 5KQMA 1L5WA 2PGOA 3UT5A 1T3GA 4ENRA 1N1DA 3FCXA 3JCZA 2CLMB 5EMJA 1S1CA 2B21A 1E32A 2VHCA 3LT5A 3PGKA 4JEIA 2WKRA 5KNDH 3LC2O 4I5DA 3MGGA 4QYSA 1E60A 3RTGA 4E3ZA 5ALDA 1E1CB 2GHRA 3BKWA 1KZHA 2ZYVX 1GR0A 1XZ8A 3KUXA 1V3QE 3DZGA 4MQ5A 1EVKA 3GQ3A 3QEMA 1O6ZA 3UXYA 4EGCB 2ZIEA 3VR3D 1A8SA 3WSWA 3F7OA 1D2HA 3F6RA 4K1XA 1DT3A 3OX4A 4KQHA 4Q6BA 5HKOA 4DJAA 2NXNA 4IIJB 1DOHA 2WJJA 4GMGA 3EIOA 4MR9B 2CJPA 3L8CA 2Q5QA 3CLVA 1DDGA 1LBTA 1TKAA 3JQBA 3JYLA 4HLUC 3FWYA 4LY3A 3WMXA 2Z2JA 1NBME 3J80S 2YVUA 2CLDX 3SEQA 3UAGA 1OAOA 1YRHA 4JVOA 2XWQA 3EQ2A 4Y6RA 3IUJA 4D96A 1UFKA 3IAUA 1JJIA 4GKAA 5JT1A 4IV5A 3TXXA 3LQYA 4KI0A 4PV7A 2W42A 2YOHA 2V97A 1VPLA 4NCNA 1HQCA 2CW5A 5EVJA 3THXB 4RDHA 2XB9A 1TL7C 3GLIB 2MSLA 4K2HA 3THGA 1MO6A 4TVKA 1WD7A 3KQLA 4PNPA 1BDMA 3W2EA 4W5NA 3VGPA 4EYOA 2HY7A 3WB0A 2V7WA 2V3VA 3ILHA 3G8DA 3KX2A 3P9IA 3PF9A 1L5FA 4X54A 5AIBA 8ABPA 1ZZGA 1SBZA 4JUCA 9LDTA 5DM1A 3CNLA 5EA2A 2AN5A 2Q4OA 2BEUB 3T6PA 2WT9A 3AZPA 3GAZA 3ZDDA 5A05A 1DG3A 5JH7B 4NOOB 2E6KA 1QPBA 1EIWA 1Z4QA 1AXEA 1SWWA 2PKYX 5T57A 3R6GA 3W5SA 5KNBD 3F92A 4LF9B 2EHDA 1WY5A 4WZBA 3L46A 4NPCA 2L09A 3PFBA 1MBZA 3DVAB 5IFKA 2OPHA 4AJ9A 4IV8A 4K86A 4EGFA 5CW1A 3HEMA 1R88A 1FX1A 1W1IA 2QTFA 3BULA 1IPFA 1KOLA 4Q1AA 4BMXA 2SKEA 3W2GA 3CH5A 1GYPA 1SIBE 4HEHA 4N12A 4YXFA 2QUIA 5CFQA 2JJYA 3HB4X 4Z4CA 3GPIA 4BE9A 4Q3DA 3J81A 1YR9A 3H65A 4O1MA 1W5FA 4RAQA 1YAHA 2GCIA 3TNLA 2YV3A 4F3TA 1A8IA 2MSDB 3DR3A 4TMFA 3E22B 5F2NA 3R09A 4X5OA 1CF4A 2PUBA 5F9FA 4BWGA 3I23A 3R1IA 1XCPA 4KIUA 3UANA 1IWPB 1KFJB 3RYTC 1GUDA 4DSNA 4CM7A 2DETA 3VPFA 4FEEA 5AFSA 3ZE8A 1Z7WA 4UREA 2HCRA 2VL7A 1G7RA 1L4NA 1NMEA 1GL9B 3NT2A 3S1AB 2FMUA 3OTIA 1BA2A 4D0GA 4CF7A 1K8QA 1ECFA 3K0BA 2GWRA 4TS4A 5LU9A 1KFKB 1V45E 4NPAA 5DHPA 5IBRA 2WU4A 4G4QA 3BE8A 3AWIA 4M21A 5AI9A 5CNJA 1LSSA 3M9WA 3ADOA 5IAAA 1DXYA 1GKUB 4F3KA 4ISCA 8CATA 2JH9A 3CLKA 4G4IA 5CDFA 4D8XA 3KXDA 5FFMA 1EFKA 3AGQA 1OR8A 5AKXA 1HDZA 5BYJA 4ZV9A 1MCZA 5AI8A 3RVKA 3BZBA 4CDNA 1Q3CA 1D5CA 1GZDA 1MVOA 2CLIB 4MWTA 1J9ZA 4D80A 2EXXA 3KLMX 4QUBA 4ZO7A 4KPEC 1O6CA 3RVLA 3TCNA 1E5XA 1MA3A 1COWD 3MELA 1WXQA 3S99A 2F5OA 2XT6A 4J0FA 4BBZA 2UXBM 1AKRA 4AZSA 4DSOA 4HWSA 3A1FA 4JOCA 1AF7A 3ZWVA 2IYQA 4QXMA 2I99A 1UANA 3GRUA 5DSZA 3KPYA 3JQ8B 4KP7A 1HI9A 5KNBA 3B6ZA 4JOSA 2CDAA 3F6SA 3I37X 4ERXA 3GP8A 1DJMA 1XMOB 2QN3A 1B2RA 3IQZA 4L0CA 3MS2A 5JAZA 4INJA 3DWIA 4DR1M 3ORSA 4I66A 4R9SA 5E8JA 1Y8QB 1DAEA 1JQEA 4GBGA 3WGMA 1LPAB 1ZISA 2GQ0A 2CWBA 3PC4A 2OE2A 2YZGA 4JJ6A 1W5TA 4JLVA 4LC0A 4MMXB 4LSGA 1SBTA 3QXSA 4RW0A 5K20A 1GKIA 2AD1A 3HV2A 2Z6VA 3CF4A 1Y0BA 1N6LA 1F5SA 1DBPA 1KS2A 1IRIA 3K0CC 4UOEA 5I4KA 3ENQA 4CQMA 4UMFA 4IH4A 2FW1A 1QUSA 2O20A 2VDRB 1SC3A 1I01A 4OQMA 1L5VA 2XDWA 2QHOB 1WU7A 2Q5EA 4V0ME 4B7UA 3H1TA 2BFCA 1SVKA 1L5NA 5JPIA 5IC6A 1BXRA 4P92A 3QFTA 4XUEA 5CLJA 1H0SA 1A5SB 1F0KA 3BJZA 3VI3B 3SIXA 1QS0A 1G20E 1NJ6A 1F6WA 2JLUA 2W11A 1XFDA 3UJ9A 2Q3MA 1N34B 2TECE 3AVQA 2GCNA 4G36A 4MPDA 3KLPX 3LU1A 3ZE6A 4BC1A 5IW8A 2HHLA 5CNMA 5F7JA 1QV9A 2Z58A 2ZULA 3BEDA 4L07A 4YV7A 2LPMA 4PSCA 5FA8A 1QGYA 4RYDA 1V35A 2CEKA 3DPUA 3HBJA 5I01A 1LK7A 1GGJA 3O82A 2HX1A 2V5UA 5LA6B 2VSFA 1LW6E 4IXNA 2JG3A 3Q15C 2H4YA 1H3NA 2QSYA 3LECA 1XEFA 4XYEA 2IDKA 2Z3ZA 3AY3A 1BQ4A 3BG5A 1GGMA 3G9QA 4LY9A 2R1TA 3CZAA 3G9ZA 3IPXA 2YCLA 1CJTC 3DZIA 4GKVA 3TTYA 2J1LA 4ZI2A 3THWA 1QMGA 3WYDA 4OQLA 4PDGA 3MJ5A 4ZT5A 3VJRA 3K09A 1GFSA 1PKEA 3C2QA 1NP6A 3VO9A 4ALNA 5ITSA 2AE1A 3A28A 4Y9UA 5IJXA 2CDNA 5AKZA 1RBZA 4EJMA 4TKUA 1TM3E 2C2BA 2OCIA 2V7QA 2VQ3A 2BFBA 3DH0A 3RM3A 4EYEA 5I6DA 5JPDA 1X80B 3EZ6A 3RVPA 2GF0A 2JCVA 3PITA 3PKIA 2WU3A 5IARA 3HK2A 1HORA 4D5EA 3C87A 3LQRA 5IEJA 3C1AA 3EISA 1RC0A 2FWPA 2PM8A 5K0TA 3RJ5A 4CIBA 3GLSA 3ZUGA 1QYRA 3SQNA 3U6EA 4XSGA 3TQRA 1F7VA 1GRCA 4N0EA 3OEEA 2WF5A 2FTKE 3LMKA 1LDEA 5DEOA 4WBNF 1QZEA 1NVVQ 2OV2A 3AF5A 3OQ1A 3TB4A 2GNOA 1HT0A 3E4CA 3WLIA 1KZ6A 4IDAA 1OTXA 4G5QA 4TWRA 5ES4B 3L1KA 5JSZB 4E5SA 1E6UA 2FV8A 4G97A 3SXUA 4A0QA 5FPYA 4NYMR 2VDWB 1L4YA 3ETHA 3O4RA 5DXAA 3DNMA 3SM9A 4CL8A 4EUEA 2XF3A 4FQ7A 2VJAA 5B3JC 2IWHA 1JTFA 1EX6A 4DV1M 4GBMA 2XMPA 5CH3A 4AJIA 2HCBA 1YS6A 1XTQA 4UASA 3PNLA 2D2EA 1KAEA 3GDOA 1UQTA 3OLCX 2RFLA 3CMCO 3Q7EA 2RGEA 1AKQA 2EBHX 4QUAA 5TV2A 3SC3A 2HA6A 2ICAA 2WUWE 3CC8A 3NYIA 3WQHA 2PL3A 1E99A 1V5IA 1XDBA 1B4DA 1AUAA 4KTTE 4RJ2A 3ZQKA 2ZRDA 3BHIA 5IXYA 3OOSA 4HH0A 2APJA 4F4IA 3V7WA 4HZUB 3B82A 5DULA 3AU8A 2QP3A 4PFJA 5EZQA 4CN9A 5JRDS 4EELA 1L1EA 2QX9A 2Z5LA 3ENZA 3OF2A 2F5PA 2VPPA 3Q0IA 4KO2S 4MPRA 3REOA 3FA2A 4WL0A 1MAUA 2VWQA 1DKOA 2MJLA 2OM6A 2QE7D 3RDPA 4EKGA 1VJ5A 2RGNA 4B6QA 5EPOA 1U1GA 3SKVA 1KZ1A 4DC9A 1GZ4A 3VSAA 1UOQA 4TKMA 3FCOA 3EEYA 1A95A 3KW6A 4DAOA 3KUDA 3K70C 1OYVA 1WHTB 1TQ8A 3B1JA 4BE7B 4IFEA 4CIWA 2JIDA 1DQSA 3ERCA 1V8PA 1UMDB 1Z8HA 3OTOM 3Q3JB 1ZN9A 2R6DA 2R44A 3RFWA 2YRXA 2A0WA 1KEVA 3DQPA 3C39A 3IESA 4G41A 4PICA 4R84A 1GQRA 4PAGA 2VP9A 3ZV5A 3H42B 1S9DA 2W43A 3QV1A 1V95A 3UCEA 3HCWA 4O2BA 3BB1A 2O2JA 3A05A 3FYUA 3SXPA 5D5HA 1PK7A 4QOSA 1S2DA 2QUJA 1SJ9A 5L51A 5AKHA 3L6DA 4R2JA 4ECEA 2HJGA 3C3JA 4J49A 3AJRA 1ADYA 3QOFA 4EB6B 2WM3A 3MWGA 4GPTA 2X9NA 5CIWA 5A02A 3T3OA 1N2EA 4F2DA 3GPPA 1I4EB 2X6QA 3IULA 4RSGA 4TTVA 2BGIA 1L7EA 1WR1B 1VHQA 4DWWA 4TVSA 3BHMA 2F5NA 2BLNA 4RA6B 3A45A 1JJAA 1N1GA 2BI8A 2IU6A 2VOJA 3PNMA 3QKIA 1BGVA 3LCCA 1C9EA 3VC1A 3WIEA 4LDNA 1BWSA 4PXAA 1D8AA 2W7TA 2I2WA 1LTMA 3DAYA 3PZBA 3KXIA 4G1FA 3KQHA 5B58T 3H8JA 3P5SA 4GOXA 4EMBA 1JEYA 4ZRNA 1E1YA 3F7TA 3FPAA 2P5SA 4JNKA 4UHHA 4AVYA 1JDVA 1VSBA 3IDOA 1G8JA 1OI3A 2GAJA 3BD8A 4GM1A 4GQIA 5FI1B 1O5IA 2ZJ0A 4P83A 3DB2A 3KAJA 3B9PA 1EP2B 5K01A 4KI7A 1Q77A 1GG8A 1ZM3A 1GNRA 1HG1A 2G25A 3H3FA 3L7JA 4UPVA 1G4HA 3FF4A 5BWLA 5KIAA 4LWQA 3PI7A 2GERA 2GN9A 2JFBA 2OVFA 2XGSA 1I3OA 4K9PA 1TFRA 3RU3A 1GV1A 4IEEA 1Z7EA 5JNUA 2YKGA 2H8KA 3K1AB 2E7ZA 1Z45A 1DUSA 2JL1A 3L0BA 4Y18A 3L01A 4QPNA 4O5AA 3BWDD 2PV7A 4NNOA 3L04A 5A06A 2I9KA 1N3YA 4Q03A 2IHUA 4ALJA 1MDFA 2IJGX 2UKDA 4RD2A 2MOKA 3WGKA 1VKHA 1ICEA 2Y99A 1G0NA 4GX2A 3VOBA 3WL8A 2V5AA 2XRMA 3C4VA 2PGNA 1RYFA 2ZB7A 1G18A 2HMSA 4BVEA 5KOHB 5IT9A 3C3EA 3NBXX 4K9DA 1Y3CE 3DO5A 1GPDG 4LMAA 4NZZA 4XLLA 1AO3A 4JUDX 1B3BA 3B8HA 3T4EA 2UAGA 3T61A 4D4JA 2PUCA 2OB1A 3JR7A 3U3KA 3CLSD 2P75A 1Z2NX 2K6BA 2EGUA 4UTNA 4EB3A 3PXBA 4DLNA 3H4TA 1RQRA 4X7PA 4NG5A 1TT5A 2HJ9A 3GEPA 1VL6A 3D6VA 1B6TA 1YJ5A 3DTVA 5DBGA 2JKVA 3TFWA 3A0UA 5B36A 3QPUA 1WNFA 2OP0A 2IKQA 3RC3A 1E3DA 3UMSA 3ZXYA 4CM4A 4G0VA 1IBKM 1D1TA 4A0GA 4E22A 1PSDA 2F3SA 4NG4A 3T7EA 3E22A 5JAIA 4IHKA 4DSUA 5JU6A 1MU0A 3OX1A 2RH8A 2K47A 4EGAA 4YMGA 1DVRA 2H1CA 1DRVA 2AWNA 4E5DA 4RD6A 1HZZC 3I76A 2DZDA 3IGFA 4BVBA 1IN4A 3T0FA 2XQVA 3EMDA 4U7PB 3NHMA 2FUNB 5AKEA 2HT1A 3N7AA 1XRPA 2OAEA 3NEAA 2V6JA 3IBFA 1BE1A 4ZMBA 4LC1A 2C3MA 2QN2A 3K2QA 3D3NA 4GPZA 2VSQA 1Z17A 3ZDQA 3FIJA 1ECBA 3W6ZA 4OQYA 4PLVA 1BEEA 4G0NA 3QF7A 3VNQA 2G28A 1PFGA 1RQ2A 4MW2A 5HE9A 3T5GA 2V45A 2ZB3A 2YUTA 1ZMRA 1Y4DE 5FI5A 1YDEA 2EIXA 4UNSA 3PHIA 5H7XA 3C1UA 2QRKA 1XCGB 3IAM1 1YUNA 1MX1A 5EKXA 2FFQA 3H5VA 4FB5A 2OCDA 4X3CA 5GZ6A 2HPHA 1LDNA 5KYUB 1LQTA 1A1VA 5ERGB 4RKWA 3GT3A 3TLBA 2QNJA 5F7ZA 3CF6E 4AJEA 5IM4A 5JJCA 4RTJA 4YUXA 4OI4A 4W8GA 1EVIA 1OZ0A 2WAXA 1E2JA 3PK0A 5IHXA 1CEEA 1DC6A 1HNNA 4KW7A 2QSJA 1Y1PA 1Y4AE 3QXXA 1H85A 4AY4A 2RHBA 3CY6A 4N8EA 4R69A 1PJCA 3P0JA 3Q9UA 1DELA 3KAPA 4KXWA 4CW7A 3ETCA 5C9ZA 3QYBA 3TNFA 2MINA 1P7ZA 1Q44A 3LX5A 1YJBA 2FCRA 1QK4A 2CJWB 4E7PA 3PXEA 5GMOA 1TIPA 1J33A 5FTWA 3FTCA 3H4IA 1E18A 4L5BA 3HJ8A 1BYIA 1R4MA 3NHAA 3NTQA 4HNGA 5CK4A 5BQXA 3WRVA 1F3LA 4RMJA 4B7AA 2J9GA 1KFEB 4DV0M 3T15A 3DC2A 4DDMA 4TMXA 1K5PA 3F5MA 4TSFA 1S8FA 3K9OA 1WKVA 3IAXA 4GFDA 4HYEA 4LSWA 3B12A 4UCWA 1JI3A 3G85A 4W7HA 2FWIA 3SMVA 2KHZA 2VHTA 1U2RA 4Q4LA 4RHXA 2O8DA 5BY2A 2Q4RA 1KO7A 2DPMA 2P30A 2DUNA 2FGKA 3IBYA 2W6OA 4N7MA 4O4HF 1TYBE 3HHZA 1Z33A 4X9XA 4WOPA 1MRSA 2IYSA 4WXHA 2J3EA 4E0BA 4TN1A 1S01A 2PXXA 4Q3AA 1G9TA 2A67A 1BE0A 1JBKA 1KYYA 4G86A 2Q41A 2WG2A 4DV3B 4ENTA 3FJYA 5B58C 3W5VA 2D6FA 4LF7M 1UMKA 4PQFA 2JHFA 1QF6A 1VOTA 5AICA 3PWTA 1L3BA 4ISBA 2R87A 3FAZA 1Z0UA 3VNSA 3DFMA 3OF3A 3L6EA 3SZUA 2XCSB 4QPDA 3K4HA 5ARCA 3WLAA 1L7XA 4V1CI 1CYEA 3U6OA 5AMXA 3L5KA 3OQ6A 3PJFA 2G1JA 4MS4B 4BKRA 2XKKA 6YASA 2C2HA 5ITRA 1YI0A 2Z2IA 4WLEA 2YJ4A 1KC3A 4CV0A 3EPLA 4HDRA 4FCVA 5GJWC 3ACBA 5TR9A 1GCAA 5HGXA 1T3ZA 2M6SA 4P34A 1PV4A 2PX6A 3W1EA 1E6MA 2HEGA 2O3UA 2ZOSA 4W99A 1FDUA 3DL2A 3SIPA 3M5PA 2VUTA 4X95A 2ST1A 4KQCA 1X42A 1ZGZA 2OUIA 3D3KA 2AFHA 4UJ5A 1N75A 5DTEA 7MHTA 1C1HA 1OFGA 5JD5A 1OWPA 4UHEA 1WSBA 4Q48A 1XZLA 4EA6A 2YFKA 5EE3A 4HDCA 1LDBA 3RAPR 1M8PA 4IIYA 1CW2B 2HJSA 4CLRB 3FCCA 3ZY3A 3A1TA 5BPFA 3OKAA 3CONA 4C3ZA 1Q14A 2X9LA 4ARBA 2DY1A 4JL8A 1AHNA 3I45A 1G60A 4MHSA 4YRJA 3AVUA 1ESCA 4JR1A 4OQEA 3TCKA 2X5JO 3GJYA 3Q8XB 5J58A 3CWQA 5FOTA 1CJKC 1ID8A 3BWMA 4EPTA 3OTWA 1RYHA 5B55A 5DDIP 3JQGA 3IXQA 5IVIA 3AG5A 1PFUA 4DOMA 1TUIA 4DR3M 1T43A 1NUAA 2CXXA 3HCFA 2CDBA 2JI4A 3GA5A 2DU8A 3TQHA 1R4MB 1P7CA 1ZOSA 1CC1S 3DFFA 3Q12A 3TJMA 4CL0A 5IN4A 2ATCA 4QTXA 1QF7A 3IT2A 3TO5A 1GT6A 2I71A 3KJEA 1GD1O 2ZT8A 2C29D 5KJCA 4OMUA 5DHRA 2AJBA 3E70C 1ADCA 4LW8A 1U8EA 3BX1A 2WV7A 3JZAA 4FE3A 5ALWA 2HDNB 3OQMA 2ZE8A 4C2UA 2ONKA 2OB2A 4PLCA 4ZTZB 1NW4A 5CDGA 2WV9A 3IUMA 5JMOA 3D0OA 1VG9B 3BXFA 1KO8A 1KERA 5TPZA 2ZDHA 1LCIA 1DRKA 5BYAA 2SCUA 1DCTA 1JB1A 1M9NA 2J3HA 4YYEA 2DB3A 4HBGA 3BPSA 1RYBA 4XX0B 2OENG 2GVDC 3WKAA 4HI0E 3RADC 1U2EA 3RUCA 3UV7A 1JMYA 1R12A 2GHIA 3TIGA 4DLSA 4XSVA 1VB5A 3VSCA 4RORA 3CR8A 3ZDCA 1H1DA 4BZZA 4ZHSA 5LKRA 3D54D 2ZYTX 1IWOA 5H8WA 5CVVA 3SR4A 3V3KA 4OB6A 1VGRA 4GUAA 3W5IA 5KUTA 2GPJA 4MKRA 4AW4A 4QE3A 4B6PA 1TEZA 1IBKB 5AJYA 1H8HD 3QHPA 4YO7A 1FLNA 1LA2A 1NNSA 2DPXA 2XWJI 4OX9M 3JARB 3R4VA 5K8JB 1VB3A 4IQ4A 2BELA 5DGIA 4Y2TA 3VZSA 4X64B 1HT3A 1E6KA 4M1KA 3AF3A 3BBZA 3BIOA 4EHNA 1TZ2A 1W46A 2W98A 2WD7B 3T5DA 5J43A 2FQWA 5LQNA 3K30A 4YK7A 1EIJA 1YZ3A 1Y42X 1ZC3A 2GAOA 3C4QA 3PX3A 4PLZA 4PZLA 3HBLA 5HZKA 3HJUA 3X1MA 5I7FA 4EEKA 1ZAKA 2OFFA 3FGOA 4D57A 4F1WA 5IDYA 4YHHM 4K6GA 4URZR 1ZDMA 2F90A 1RAHA 5EIOA 2QJWA 4DA7A 3CKLA 3DBIA 4GMHA 3ROEA 1YB7A 3WGOA 3GZNB 3W5UA 2XRFA 4IICA 1IPHA 4Y2YA 3MUOA 3PUYA 4AB1A 1SC6A 4QQNA 1U7TA 2I2XB 4PPYA 4JT2A 1ATZA 3KT8A 2H1LA 3HZJA 2WIFA 4GPAA 4E4RA 5B7GA 3ZHXA 2JFOA 2PWYA 1WY7A 2DWCA 3E61A 1VHLA 2A0KA 2XUQA 3OBBA 2EX1A 4PG5A 4ZJUA 4PLPA 2EA0A 1PT7A 2HB6A 3A0RB 3LL4A 2XE6A 4N8DA 4RE6A 1LLFA 3NLLA 3BIWA 4KWTA 1A4XA 3M70A 3EF1A 4REZA 4O4IF 3D5TA 2GCGA 1KR2A 1TB4A 3P0RA 2ONZA 2VJKA 4O2AF 1OC2A 4PG7A 4QDOA 4LHWA 3LUGA 3DLAA 4C4AA 3HZZA 4DDUA 4JI8M 3BB3A 3P9ZA 2O0KA 4RCVA 3WHLA 4XQCA 1T1SA 2O8CB 1B23P 1M2HA 4OKIA 3ZBTA 5KZMB 4I5FA 2GXAA 1YA4A 1R5BA 3V7NA 5K0CA 3C6BA 3STYA 5JCJD 2VRBA 2ZW9A 4RPLA 1DXQA 3LUCA 2HHJA 3MXTA 3U4HA 1QHSA 3EPPA 3VR5D 4RPGA 3GNSA 4MK4A 5HKKD 2VBIA 3QKTA 5JZ9A 4MJXA 4ON9A 4CIXA 5K99A 4NXNB 1XIVA 2AR0A 2BR5A 2O3QA 2NYAA 5F78A 2OV1A 2OZLA 3D6MA 1E4EB 1IHUA 4F2HA 2QRPA 3U4MA 4QYIB 3D3QA 4HRAA 3IHPA 2YN4A 4JNCA 2UXCM 2BZSA 1RTTA 4U9IS 3T7AA 4RULA 4PPQA 2LGJA 3RBZA 3QVTA 4JKIA 2PUGA 3MLBA 1C7IA 5FBHA 3RYIB 3ML1A 1VFPA 2FDCA 1SEVA 3FY4A 3IBSA 4WFQA 1IIRA 3RYHA 2BJHA 3KD2A 5LPNA 1OF1A 1WWKA 5ILQA 3O91A 4PZAA 1FS6A 1WL8A 2RHHA 3ELYA 2CVHA 2FSPA 3O84A 4FVMA 1R6DA 2GSWA 1QUFA 4FFMA 2HO5A 1FOEB 4URYR 3VI4B 1ZBDA 1Z68A 1E8DA 1VM6A 3SOPA 4EKYA 3ESRA 1WIWA 5HRAA 4TRRA 4DUZB 2BMEA 3CJTA 5KQRA 2AC2A 1O8BA 2EOAA 4ACBA 1M8KA 3BMXA 4DV2M 4B7FA 5AOCA 3RT1A 1UMDA 3KCQA 3W3AH 3WTCA 3EGIA 4E33A 3ADDA 4EL5A 1N7HA 3ZZ1A 3LXXA 4LI3X 1II8A 2RJNA 4C78A 1KYIA 3ZBPA 4M7PA 3AR9A 5CFMA 2QZ9A 5H9WA 2WW8A 4BP1A 4MRAA 1LQ2A 1HF3A 1XF1A 2C31A 1VSTA 2YWRA 2KYRA 2PEYA 3BXEA 1X7ZB 4PPFA 4CF3A 4DR1B 3FOFC 1YL6A 2NN3C 5K0ZA 5JY6A 2PZMA 1ZEMA 4A2QA 2F9LA 1BXZA 2XKJE 4QGHA 3N0XA 4M0CA 4OLJA 4PS0A 4E14A 5C4MA 2CBGA 3DWGA 1IDN1 4LY0A 2D1YA 2IYPA 4OJNA 3VVCA 3PPYA 5BN1A 4EWLA 5EIEA 3D6HA 3OTQA 1M1UA 2QENA 1T8WA 1T8RA 2GZMA 4XYMA 4MUYA 3T7KA 2ZYDA 3CZQA 4MCIA 5FHQA 3ZCQA 5BWMA 2XCOA 4JB8A 1EDEA 4IY1A 4V0MA 5THKA 4YHBA 3U1TA 3V2IA 5K0JA 2R7NA 2XAAA 3M6UA 4S35A 3ZCUA 2Q9CA 2Q2WA 3B1XA 3L7OA 1L7DA 1IZ8A 4LZWA 1PKXA 5DN6A 1R0XA 2HMUA 1JHRA 3UVEA 2ZUSA 5CEEA 5I5EA 1U0LA 3C6KA 4UUBA 1JEYB 4NONA 1XXLA 1VE3A 1US8B 4BQOA 5HP4A 4ARAA 4PCLA 2WP8J 3QVGB 1N2ZA 2ECQA 3PQCA 4I1VA 3GGDA 3GLIE 2O1WA 3M1AA 5L6MB 6LDHA 2BCEA 3OZDA 4FZVA 3UFXB 2VDUE 3VNRA 4NJMB 4FFRA 4Q3OA 3NYWA 4MUGA 4QFCA 5PGMA 1QV7A 3ZCVA 3AP2A 1JXMA 4HVTA 3CJQA 3LPDA 3OAAD 1V4NA 1W19A 2NGRA 1ESEA 4U8GA 5B3JA 4CJXA 5KOIA 3CRQA 1M67A 1L5KA 1WSDA 1V9CA 3TK1A 1XTRA 1FZTA 1KMHA 1QHGA 3DHWC 1RQPA 1WHTA 2FR0A 4XLTA 4HDNB 5IMBA 4BU1A 3KKLA 3OM9A 1VXOA 1JG6A 4BKMA 4Y0NA 4B4VA 1CRLA 4O1HA 5T6MA 1N2CA 4CYMA 4Z1OA 4J7UA 1V8BA 3P0FA 4MJLA 5GIOE 3V9AA 1ZN8A 1F8GA 1U5BA 3SHOA 1P9LA 3DBOB 3DG9A 3ZXXA 3VNVA 3AHIA 2BHLA 2GYWA 5EJMA 1TD1A 1Z6ZA 1SHTX 2LIPA