2H1RA

Crystal structure of a dimethyladenosine transferase from plasmodium falciparum
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
271
Chain Sequence
b'HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWCTLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 94
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.480 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2h1rA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h1rA01
4FGZA 2WK1A 5D1NA 2UYCA 3LSTA 4GOOD 2BZGA 4MQ4A 1JG2A 2JG3A 1WZNA 3LBYA 1WY7A 5EPEA 3VYWA 2QM3A 2ZLBA 3KKZA 4ZTBA 4EKIA 5EZQA 3KQWA 3PX2A 2JHPA 1VLMA 4GOLD 4F84A 1XCJA 5T64A 3LCUA 4DKJA 3BZBA 3NVMB 3ANXA 3UA4A 2IH5A 4QTTB 3T0IA 4AZWA 1WS6A 3DXYA 3UJDA 2P8JA 3HM2A 4GUAA 5DWQA 2B25A 2CWWA 5CM2Z 3TRKA 2FCAA 4GF5A 3T7TA 4E33A 2EJTA 3L8DA 3M33A 3GGDA 4CKCA 5F2OA 3C3YA 5B1SA 1HMYA 4DQ0A 4P7FA 3HCAA 2P40A 3MGGA 3GRZA 2ZWAA 2OO3A 4BLUA 1L3BA 3G89A 2ERCA 2FK7A 4OQEA 2FHPA 3GRRA 3ER9A 2C7OA 5DX1A 4E70A 4C06A 3FTDA 4M36A 4RTLA 2JHAA 2VP3A 5HZMA 3IHTA 3JWJA 3GJYA 3R0QA 2GAFA 3HCBA 3LL7A 4QQNA 2EX4A 4PYMA 5EMKA 2PGXA 3V97A 1RJDA 3F4KA 1RI2A 1X1AA 1UIRA 3KPVA 4DA4A 1IM8A 2EFJA 1JG3A 4MWZA 5LQAA 3GIWA 1ORIA 5P8WA 3MHTA 2F8LA 3PT9A 2O57A 5DSXA 5FUBA 2AVNA 5LSAA 4RTNA 2IIPA 5EMMA 3KU1A 5FQOA 3TKAA 1AV6A 2YXLA 3OZTA 1HNNA 2C7PA 1NE2A 2PXAA 2GPYA 3PB3A 3G88A 3O4FA 3M4XA 2Y1XA 1M0EA 1JG1A 3B3FA 3DR5A 1ZHFA 3G7UA 4GC5A 4HRAA 3JWIA 1UWVA 4M38A 2PXCA 4O29A 4PGHA 4C03A 3TR6A 2VDUE 4RTMA 2VDVE 3CJRA 3RODA 3R24A 2OZVA 4E30A 4E2YA 3LX6A 4HH4A 2KW5A 2CL5A 3EVEA 3LCCA 5K0FA 2VZ9A 4IV8A 2NNWB 3HCEA 1NBIA 3IV6A 3P9KA 1JG4A 1R8YA 3NWBA 3LKZA 4UOEA 3FZGA 3QOWA 4X63A 5EC8A 2P3OA 1JQ3A 2H11A 3NTVA 3MCTA 4BLVA 3I9FA 3AXSA 3KPUA 4JXJA 2B3TA 5GIOE 2P3QA 2OPBA 5GINE 3NVKI 5CCXA 1BHJA 2PBFA 1SVUA 3G2QA 4RVDA 2QYOA 1NW7A 5ICGA 4YUXA 5HEKA 3PFGA 4QVKA 5KS2A 2IPXA 4HTFB 3DMHA 1P1CA 2B78A 2O0LA 1VP9A 3DP7A 4LG1A 4XUEA 2AR0A 4PIPA 3T7SA 3B3JA 2I9KA 3OU2A 5DTRA 2XBMA 5E2BA 4H0NA 1FP2A 3ME5A 3QOXA 2ZZNA 4PYLA 2YVLA 1SUSA 3BWCA 3G8BA 3LGAA 3OFKA 3DMFA 3DOUA 4PYKA 1JSXA 3PX3A 5G02A 2ESRA 4HGZA 2IBSA 4OBWA 3AJDA 4DF3A 3A25A 5FULA 5CVEA 1X1DA 3P9CA 2PT6A 1N2XA 1TW2A 5ICCA 3P71T 4CXMA 4FR0A 3OCJA 3IEIA 5KVAA 1D2CA 3LDFA 4QDJA 4AX8A 3KQTA 2K4MA 1I9GA 1QAOA 2YUIA 2V7EA 4M37A 2ZZMA 3HTXA 3LHDA 4PYJA 3KQPA 4EK9A 3TLJA 9MHTA 1KPHA 1NW3A 2G8NA 5K0LA 3REOA 5FTWA 2PSSA 3GNLA 5IKMA 10MHA 2OBFA 3DTNA 4AUKA 3GXOA 5EEHA 5LQKA 2HNKA 3K0BA 2IH2A 4FT2A 4KWCA 4XUDA 1WXWA 4DMGA 3EMBA 1I1NA 5GWXA 3R9XB 3CGGA 3BGDA 5BXYA 2NP7A 4PYQA 1IY9A 5ICEA 1PRYA 1FPQA 4XUCA 1V39A 2QRVA 3BUSA 3G2OA 3I58A 3ID6C 5EIWA 3V8VA 1NV9A 3FRHA 2ZIEA 2AOTA 3UJ6A 2FYTA 1KPGA 3JWGA 1FBNA 1RJFA 2P1DA 5BW4A 1YFJA 1Q0SA 1QAQA 1KPIA 2HMYB 2R6ZA 5CVUA 4AZVA 4YMHA 5C9ZA 3EEYA 1ORHA 4BP3A 5K0EA 2XYQA 3B3GA 1NW8A 3GRYA 1R18A 3KQQA 3NDIA 1QZZA 2OYRA 4U7PB 1VBFA 3A7EA 3G5LA 5FHRA 2AS0A 4WXHA 3T7RA 1QAMA 3G8AA 3LKDA 4KDRA 3A4TA 1X1BA 3M6WA 4GEKA 3RW9A 3P8ZA 3X0DA 4EVIA 3THSA 1VE3A 3VC1A 2JH9A 2IBTA 2WA1A 4GBED 3KPWA 5DM0A 5DRYA 3SSOA 2PXXA 4RX1A 4RV9A 1MJFA 4QPPA 3TOSA 5K03A 3SXJA 2GB4A 3FPHA 1INLA 4E32A 2UYOA 1X19A 3FPEA 3P2EA 4V0QA 5K0BA 2CMGA 2ZIFA 3PS9A 5DTQA 5HIMA 5C1IA 3VC2A 2XYRA 4E31A 5H02A 1VPTA 3Q7EA 4RTKA 1MHTA 4BP1A 3BWBA 1RJGA 4NECA 4HSGA 4M7RA 3M70A 4U7TB 1BC5A 3DUWA 4C07A 3P97A 2ZSUA 3EVBA 2FK8A 3C0KA 2PJDA 5EHIA 4C08A 5K8VA 4WVLA 3MTIA 2YQZA 4BY9E 3DLIA 1JSZA 1ZKDA 2NXEA 1NBHA 2GA9A 1O9GA 1EIZA 1R6AA 3FUWA 3HNRA 1FJXA 5DM2A 2YXDA 1VP3A 4EMSA 4PINA 3DLCA 2PY6A 2PV0A 2DULA 2OXTA 5T6BA 1SG9A 3HVHA 4OQDA 4R8RA 3UBTA 1RI4A 4P7GA 3EVCA 5EVJA 5EKXA 2OB1A 4GOMD 4LECA 4X1OA 3UJBA 3I53A 2HR1A 3UFBA 3JWHA 1YZ3A 4C05A 1P1BA 5KYGA 3AXTA 3DMGA 4RVGA 3FUTA 2IDJA 1M6YA 4QTUB 1R74A 5FADA 3DXZA 3LDUA 4BLWA 5HOQA 4LWPA 4YUVA 1AQJA 1P39A 5EZSA 1TPYA 3EVGA 4R6WA 4Y30A 3R3HA 3HP7A 1BOOA 5K0CA 5K0NA 2LD4A 1WXXA 1XJ5A 1XDZA 3ELDA 3FUVA 3O31A 1XDSA 2I62A 4PWYA 4RVHA 3ORHA 4CTJA 3BWYA 3TM4A 1XCLA 3FRIA 4QDKA 4ER0A 4MHTA 2PX4A 2FRXA 4L7VA 3UJ8A 3WSTA 2XVAA 3FUUA 5E1DA 5DTMA 3TFWA 3NWEA 5LR6A 3TQSA 1KR5A 1SQFA 3E7PA 3PVCA 2E5WA 5FWAA 3GO4A 5LQJA 5FA8A 3PTAA 1EAMA 5CVVA 2O06A 2XVMA 3D2LA 2PWYA 3ELUA 3GU3A 2NYUA 5LQCA 5HIJA 2Z6UA 3SM3A 2QE6A 2I6GA 3HVIA 5DX0A 3UJCA 2AOUA 3BKWA 1VIDA 1ZG3A 4QPNA 4QQKA 3FYCA 5HFJA 3Q87B 4PGGA 3UA3A 3SGLA 2EG5A 3FUXA 3C3PA 2G72A 3KQVA 5EMLA 1NV8A 1R8XA 3C6KA 5EGSA 4YV2A 3UJ7A 3CJQA 4PIMA 1EJ6A 4RTRA 3E23A 2PX2A 2ZWVA 3HVJA 4YV1A 4IWNA 3LPMA 3BT7A 2JHCA 3E05A 3B7PA 1U2ZA 5D1HA 2P35A 3BGVA 5DX8A 3G2PA 3EGEA 4PONA 4CKBA 1YUBA 1KYZA 5E9QA 3TMAA 3KQMA 4P7JA 2R3SA 3OU6A 4V0RA 4FSXA 5DT2A 3NW9A 3KQYA 3UJAA 3CBGA 3FYDA 4CWAA 5FCDA 5E9JA 4K6MA 2ZFUA 3RIEA 3BKXA 1JQEA 4OBXA 5K05A 1IXKA 1L9KA 2AOXA 2I7CA 5DM1A 4PYIA 3LECA 1I4WA 3ERCA 3TPZA 3GRUA 3GRVA 3PFHA 1O9HA 2ZW9A 3OZSA 1XDUA 4R6XA 3SVZA 2B9EA 3I64A 4YMGA 4CKEA 2AN5A 2Z6QA 2V74B 3C6MA 2G1PA 4FZVA 3ELWA 2PVCA 4X60A 3MAGA 2C7RA 4OX9Y 3P2KA 2Z6AA 2PLWA 5CUQA 4YV0A 3B5IA 5GOZA 3SX0A 5LQRA 2XYVA 1SUIA 1VL5A 1RJEA 3SSNA 2ZCJA 2CMHA 3EVZA 3OE4A 3P2IA 4EKGA 2YTZA 2ZTHA 3UJ9A 4DCMA 7MHTA 5F2NA 3KPJA 1P91A 2A14A 3GWZA 4PYOA 4B17A 1G8SA 4ATNA 1N7JA 1ZGJA 1TW3A 1Y8CA 5K09A 4P58A 2UYQA 3A26A 4IKPA 4XCXA 2YXEA 1AF7A 5EQJB 2ZVJA 3KPYA 4E2ZA 4PCAA 3KR1A 2PX8A 3DULA 5JUWA 3EVDA 4OA5A 8MHTA 1D2GA 1XVAA 3E8SA 3OU7A 2OY0A 4FS8A 1ZQ9A 1YZHA 4E2WA 1XXLA 5E1BA 4PNEA 2ZULA 1YB2A 3BWMA 2ZBRA 3MQ2A 4G56A 5EEGA 4KDCA 1RI3A 5IH3A 5DSTA 2QY6A 1Q0TA 1OR8A 4YUWA 2OB2A 3A7DA 1NKVA 3P9IA 1VQ1A 4HTFA 3AWIA 5E8RA 5FWDA 4RYLA 3LBFA 5CD1A 4YUZA 2NXCA 2Q41A 2IFTA 2ONYA 3KHKA 3OE5A 4DCGA 3FPGA 3DXXA 4A6DA 2B2CA 2AZTA 3M6UA 4CTKA 4RSRA 2P3LA 2AOUB 1JTFA 1YF3A 1NW6A 5FHQA 4EQZA 1XTPA 2IP2A 3KQSA 1JR4A 3EGIA 5BP7A 4GQBA 3A27A 3FTFA 3M6VA 4RTOA 3OPNA 1D2HA 4C4AA 2YX1A 2BM9A 4PYNA 4RTSA 1SKMA 3TM5A 3G5TA 3HCCA 3NMUF 4ISCA 1F38A 3NJRA 3QV2A 4HGYA 1AQIA 5F2KA 5CIYA 3EEOA 2ADMA 4GC9A 2GLUA 4KVZA 1G55A 3EVAA 5ERGB 3AY0A 3FTEA 3OFJA 1ZGAA 1L3CA 3HCDA 1B42A 3G2MA 3LDGA 2BR3A 1UFKA 4FSDA 2GS9A 4RTPA 2FPOA 3I5UA 5ICFA 5MHTA 2ZBQA 5E1MA 1JQDA 5E1OA 5LQUA 3CJTA 3EMDA 2GH1A 2BR4A 3CVOA 2BM8A 4AZSA 3SR4A 2JH8A 3KQOA 5EHGA 4YUYA 2C7QA 2O05A 1T43A 2AN4A 2NXNA 5EMJA 1N7IA 3K6RA 4Z2YA 2AOWA 2IGTA 3FPFA 4X41A 3NDJA 4PCLA 2PT9A 5U4XA 4POOA 1DL5A 2JJQA 1L1EA 5DM4A 4ER6A 2G70A 4KRGA 2PWPA 4ER7A 2P7IA 5K0JA 1G38A 3M6XA 4FT4A 4FP9A 1RI5A 3CC8A 5JR3A 2P7HA 3UWPA 2Y1WA 2QRVB 4KIGA 1JTEA 2EJUA 2H00A 5K01A 4MTLA 5K0GA 3GDHA 5LQNA 2AOTB 4HG2A 3HA7A 3EGVA 3IYLW 3GCZA 1H1DA 3BXOA 3MERA 4QVGA 1SQGA 1F3LA 3BGIA 3FTCA 2WA2A 2BH2A 1KYWA 3S68A 1DCTA 3ER8A 4E2XA 5E9WA 5GP1A 4DZRA 3MCZA 3HA3A 2ONZA 3PLAE 3SSMA 5EOVA 1FP1D 1PJZA 5CCBA 1YFLA 5EIFA 3THRA 1EJ0A 4MIKA 4R05A 3MB5A 1NW5A 2DPMA 1KXZA 4AZTA 2UZ4A 3O7WA 4RTQA 5GIPE 5FA5A 3R6TA 2VDWA 1EQAA 4KIFA 1O54A 3KR9A 1WG8A 2PKWA 2VS1A 4IV0A 3SMQA 2HTEA 4F85A 1KIAA 3HA5A 2CKDA 5T67A 3UZUA 1QANA 3HVKA 2OKCA 2ORED 3MTEA 4X61A 4ER5A 5HIKA 3CKKA 5E8JA 4P7KA 2O07A 4F86A 2NP6A 4GOND 5CVJA 3CCFA 5DXAA 1EG2A 1Z3CA 2H1RA 2AVDA 2HWKA 3FPJA 5HIIA 1G60A 1L3IA 3LCVB 4RVFA 2AN3A 3B89A 3U81A 4A6EA 5DPMA 4DM3A 2HV9A 3EPPA 1G8AA 5HILA 5C0OE 1KHHA 1NT2A 4R8SA 2ZIGA 3KR2A 3HEMA 5E2AA 1KP9A 3OZRA 2IDKA 4HC4A 4KW7A 3VSEA 5KQSA 2N47A 5DRTA 2P41A 4RTJA 1DUSA 1X1CA 1QYRA 2BR5A 2ZZKA 5M5BA 5CVDA 2IH4A 1R00A 3KR0A 4ER3A 5EG5A 5GM2A 5KQRA 3EVFA 5DXJA 2YR0A 3P9NA 4Y2HA 5FQNA 4C04A 1M6EX 5GM1A 4RWZA 2G71A 1RI1A 5BW5A 2UYHA 3DH0A 5DLYA 2NXJA 5EKUA 2ZBPA 1BKYA 4LWOA 4OA8A 2AOVA 2PX5A 3H2BA 3ELYA 3TKYA 1G6Q1 3HCFA
chains in the Genus database with same CATH superfamily
5A0TA 3K9NA 1ISIA 2D06A 4N4AA 1U8FO 1WE2A 2JHPA 3DAGA 1CUKA 2BV3A 3QF7A 1P1IA 3L7OA 5T3YA 4OU4A 3T7KA 1VPLA 3HBNA 4OU7A 1QLHA 3K09A 3RRYA 2CMDA 3JWJA 1UEIA 2NADA 3QLJA 3R7WA 4RJIA 2IVZA 1YR3A 1KVTA 3WDSA 1YDHA 3OJXA 1TDZA 5MN4A 4O1IA 3O73A 3VX3A 3RRZA 1JDJA 4G5FA 3S4YA 4UZSA 4GQIA 4PGAA 4QDXA 3L4KA 2XXAB 7YASA 2ROQA 1N5JA 2H2FA 3AEZA 5HFAA 2OPBA 4OTZA 2VQEM 2EA0A 1WX1A 2IIVA 4YLEA 5B7NA 1WUJS 4RQTA 1ISJA 1RYHA 3FJOA 3MWFA 4HLDA 3WRWA 3BJRA 4JVMA 4QGSA 2ES4A 1CHDA 2G5GX 4YCMA 3TZQA 2ESRA 4XR4A 2X4GA 5IN4A 4Z1OA 1VKHA 3IUMA 1EGAA 1BGWA 4WJLA 2WDZA 3ZU2A 4LRYA 2G5TA 3S27A 1RJFA 2G88A 3GQ4A 2JEZA 3ZDDA 1A9XA 2EV9A 3I73A 3RGGA 3S2FA 3IB6A 5GGXA 1XRNA 1P2TA 1FC0A 2R79A 1JN0A 3CUVA 2PDAA 2I8LA 1MJFA 2JI9A 5LZ7A 3LFTA 2FEOA 1ADJA 4PLGA 3INTA 5A2QS 4AF6A 4S3MA 5B55A 3HJGA 4R8KA 2PV0A 1BX3A 2GSDA 1XC7A 1G3QA 3U3ZA 3IQIX 3RK1A 2HR1A 4KRXA 3V5NA 3QVJA 3H5WA 1NSTA 4BLWA 4Y1FA 2JLUA 3QYJA 3R2JA 4RW0A 3RTCA 5AJWA 5EJMA 4K6OA 5EHQA 1P2VA 2L2DA 2WWFA 1TJ3A 3UWKA 3W9YA 4V1CB 1JFTA 4JIMA 3EQ2A 5SY9A 4MKZA 2Z3WA 5TVKA 3WDKA 1QOQB 3AFHA 5FXMA 4YV2A 1PJLA 3K1YA 3LLVA 3R8XA 4UHDA 4DVGA 1Y82A 2V45A 3F8SA 3BXWA 1HZZC 3DVLA 3C1TA 1T24A 2Y0CA 1GPJA 1LBEA 3QLUA 2IXBA 1G0OA 4DQVA 4HL4A 2HPZA 1VJ5A 2Y05A 3DE3X 4IKPA 4MWDA 3T6KA 2ZULA 2WSIA 3X1WA 1NLMA 4B0OA 3BG5A 3W7BA 3O5AA 2R1TB 4N5MA 1XQ6A 1D1PA 1MB9A 3BBLA 1GTZA 3NMUF 1GPNA 3TE6A 4MI3A 4BNZA 4B7XA 1Y6QA 1XMOB 5LPNA 1QGYA 5GAJA 2MDTA 5IWAB 1X2EA 1EWQA 2IZZA 3TVYA 3GEMA 5H1YA 3P0JA 3NBMA 4N3CA 1L7PA 5BMOA 4A16A 5G1OA 4O2LA 1DKLA 2WAYA 1JDVA 1Z5ZA 4BLCA 4RV4A 1E58A 5CB4B 3HDVA 4KMOA 1DCTA 2VRWA 4JSRA 1GA6A 2YYYA 4Y1RA 1NXXA 3ZE9A 1NHWC 1Z5BA 4AZTA 2WUWE 1QZ3A 4JV5M 1YL7A 1DKOA 3ET4A 1RYEA 5T4FA 5DOVA 2OKCA 1RIFA 4QD3A 1WD7A 3PPXA 2F3PA 2C3OA 1COWD 4KO1S 4D57A 3BIFA 4MW1A 1F9AA 3GGOA 3ROFA 1X1CA 3QYEA 1WKBA 1RLUA 2LCQA 2G40A 1C3OB 3FM9A 1OZHA 4REQB 1NJGA 1A9RA 4W1RA 1BVSA 2Q5QA 1CY0A 4KKXB 4H7KA 5JS2A 4PQYA 1LJ8A 4IH1A 3UJHA 3SK0A 4ZOBA 3AY7A 5FLXA 3ESAA 4R9RA 3UPUA 1WGNA 1WCXA 1KC3A 2EKQA 3HO1A 2J31A 3VGJA 1PUIA 3I6ZA 2YHIB 1YR9A 3GLGB 2OM6A 2NZJA 3WL5A 3SIPA 1BO6A 2JHAA 2GOYA 2AFRA 4PRLA 4IBJA 1AIPA 4KXVA 2FW7A 1CZNA 3RM3A 4YJHB 3RVJA 5H80A 4YLGA 1AZLA 1DIOB 2IS6A 1V96A 5DHTA 4TMTA 4UFPA 1PO7A 2VOEA 1WB4A 3N8IA 4X1KA 4DJEC 2CK3D 2ZVPX 3B3FA 3ISVA 4EW3A 1R0BA 4KYIB 1N2CB 3QNWA 1PNQA 4DFDA 3OTWA 3SYTA 1ONPA 5JEDA 3OM1A 3FZGA 3M81A 3GJZA 3QX3A 2JVIA 1OH7A 4DS3A 1BS2A 3H7IA 1QGAA 3ST7A 1E9AA 2YJNA 1DAIA 4GYKA 3CLUC 3PD0A 1SCNE 1N33M 3DOUA 3NR2A 3QUCA 4PE5B 2QPTA 3DAPA 3MWGA 2I6QA 1VBKA 2RB4A 2VNSA 1UMBA 3ZKAA 2DQ4A 3THYB 1H22A 3L2OB 2MCFA 3M7GA 2D7JA 2NUPA 2JVJA 4C01A 2JIPA 1TADA 2Z4TA 1JHAA 2QI9C 4Q1VA 2IOFA 1R18A 4OX9M 3I37X 4BKOA 4CQMB 1YBFA 3N2LA 2FFBA 3M7IA 2ZDGA 4M1TA 4O8CA 5H82A 3MBIA 3ZGZA 2X9NA 1VBMA 4MV1A 4TTJA 4U7TB 1P7WA 3V6MA 3CF0A 3R74A 1R15A 1PG0A 3T9BA 1DIBA 3I6YA 1EIZA 2HN9A 3HV0A 2A5GA 1TVEA 2Q46A 3ZCSA 3AMVA 2QTMA 1ELOA 4L8LA 1TCAA 1DOHA 1SKYE 4Y67A 3UMVA 1V1JA 4Y6LA 3KOWE 1YUNA 2XVAA 3EIWA 2VLIA 4JLJA 5LQJA 3DM9B 3ELUA 4KE6A 1OXMA 4DJ5X 1JLLA 4XD7A 5IXSA 2VNJA 5HPYB 4JT2A 4RY8A 2UDPA 3UAOA 2O2CA 1CY8A 4O0LA 7GPBA 5J5VA 4F2HA 2QAGC 1EFHA 2ZFUA 3TTWA 4Y7CA 1D4OA 5LFAA 1IQPA 1ANKA 3DEHA 2AKAB 4LPSA 4NFYA 1QQAA 4E3WA 1KDPA 1OZAA 2GETA 4LZPA 1PVOA 1UK7A 2F1IA 4UTNA 3EVZA 1YC5A 2JIBA 2GLTA 2FMIA 1VE6A 4JBYA 4EKNB 2APLA 4CKYA 3LW7A 1ABBA 1YZVA 4YP1A 5M2QA 4PCAA 1R4ZA 1XVAA 1ZJJA 3PD7A 4MRNA 4RMNA 2C5SA 2QZ9A 2P5TB 2I55A 1O0BA 1GA4A 3EGXB 3V7FA 3ZDBA 1Q84A 1PJ8A 3EWAA 2PN1A 2DSNA 1ZMVA 3AETB 5J2TF 1JALA 3RS0A 2OP0A 1XAGA 4IJ5A 3ABQB 4EHKA 1IRIA 2DY1A 1T2VA 4G5GA 1NUAA 2XUAA 2AR7A 3RAPR 1CR1A 4TRNA 1GD1O 4QNMA 1JEOA 4YAJA 1S3GA 4G5QA 4D9JA 2JC3A 5D86A 2BFPA 2WWVD 4IMPA 1LBSA 2AH5A 2V98A 4FP9A 5TE9A 1J2YA 3SIRA 2QIPA 3U5ZB 2SHKA 2AK3A 1WPRA 4RFSB 4XGQA 1E79A 4F2WA 3CNBA 1FZTA 2IVFA 3L84A 4BZWA 2CXPA 1F5NA 4IV0A 5K99A 4CV3A 4DY6A 1SVOA 4XJVA 1V8OA 1H9CA 3AUFA 3CURA 1S2DA 1FLVA 4BFLA 2EXXA 3I05A 3L28A 2M6SA 5AHKA 1OLOA 1O6FA 2QMUA 3EVFA 3FCSB 1V6SA 5EWMB 4MMXB 4QG3A 4L6AA 2AW5A 2JGLA 3O8DA 1V8DA 2BEWA 1VL8A 4PBSA 1N7HA 1IN1A 3GJXC 1KOFA 1J23A 3DWFA 1AVTA 4GF5A 4RMHA 4LF9B 5CLFA 4Y0AA 1IHDA 4QPCA 1TZCA 2C4KA 1HSZA 4D96A 5BYBA 4LZZA 4P3XA 5CU7A 4JB2A 5L8RF 3LHFA 4BVBA 4Q7QA 4UHBA 4OXYA 1VDLA 4CF4A 5JSHA 2WSMA 5K3EA 5BSEA 3ILHA 4TZ0A 5LNK1 5ENDA 1EVYA 4ZCIA 2JFGA 4ZRDA 2WJVA 1CWUA 4X0EA 5E6SA 4FTWA 2I6SA 5AOVA 2G28A 1GNPA 3PKZA 4YCBA 4MO9A 3KPUA 1B00A 1QGUA 3AL2A 3UWOA 3NVKI 3HYCA 3BCHA 3TD2A 4DARA 4MEJA 1L5SA 2GZAA 2B8EA 5TQJA 1R2YA 1E9VA 1MEEA 2UUOA 2ZIXA 3RC1A 2DNAA 5CVEA 3FOFC 2XMSA 1BQ3A 5JXJA 1P9LA 5BV7A 3DTVA 1OB5A 1PT5A 3N6VA 3FFWA 1NMSA 4HOYA 2HM7A 3QQ5A 3AL0C 3UV7A 4DPMA 1NU6A 3HI6A 1O95D 2W2KB 4ZVLA 3UH0A 3VR6A 3Q9SA 4ZYXA 1IM2A 1JW9B 2I3ZA 2GB4A 4CCSA 3VZDA 1XEXA 1M73E 5ITYA 4WACA 3SEZA 4DV4B 4DDVA 4C0AC 2WFLA 3TXAA 2Q99A 2Q5HA 3NHSA 3HY3A 3VR3D 3BN3A 2ZSEA 2X9GA 5PNTA 3DVSX 4UC0A 1ADCA 3PFBA 3I72A 4KRFA 3OZFA 3N0WA 4BTEA 1FFGA 5JD5A 3FUUA 3ZGOA 2OHIA 5DJ5A 1Z62A 2ZVQX 1NIJA 5I51A 2P2YA 2A57A 1NQUA 3ZKWA 2NQ2C 1H05A 4WZZA 1KMMA 3PPWA 3BH6A 4QUJA 2PZEA 2C8VA 4B3MB 4MOWA 1LX6A 1MOSA 2JGNA 3KQYA 3DKRA 4G2NA 3Q8LA 1GG8A 2W8ZA 3ZDEA 2XCSB 4TS1A 3WXBA 2WFZA 5KNDD 1C9DB 3EFOA 1Z6AA 3BFVA 4S05A 4K7JA 2HQBA 4MGIE 3AR5A 1NJ5A 1E5XA 5E0OA 4V39A 3G2JA 1ICEA 4RHEA 4FCTA 1SHZA 3I83A 4L9AA 3UK2A 1NN1A 2HF9A 2GUGA 1JEQB 4UBJA 1ZWLA 3QWFA 1O94D 5AKIA 1RZVA 3EGIA 1XZDA 4UUQA 2I3AA 1YK1A 1SKMA 1AKEA 2ADMA 2POCA 3IKLA 3T5BA 1P45A 2CVPA 2R0IA 4BWFB 5JBQA 3OMLA 4AZSA 1XU9A 2PCJA 4N5IX 3QFTA 1SCUB 4G1CA 4XEUA 5K01A 1WDLA 4LNUB 1XD8A 3GCZA 2D4HA 4G63A 2WQZA 2VRCA 1QKIA 3P7MA 1L1FA 2DPMA 3ZD9A 3LQ2A 2JK0A 4KFCA 3HVKA 2JIOA 4HNSA 4FGLA 2HXYA 3CCFA 1N6KA 5LDDC 4NC6A 5E0KB 4HS4A 4P4NA 1JH8A 1REQA 2FE8A 2VPIA 2ZXEA 5K4GA 1PZMA 1FU8A 2AFIA 2Q2EB 2XUQA 3PGLA 3NJ8A 1FDWA 1R50A 3HJTA 1O6ZA 1NQXA 2WZCA 4KAAA 3PJEA 4JDUA 3KXIA 5GJWC 3SCZA 3VDPA 2NUTA 2Y8EA 1KQNA 5CBPA 4QPJC 4E03A 2JGRA 3STUA 3X2SA 5AW8A 3CXRA 1LK5A 2YJTD 5AJTA 2JFZA 5SZIA 5GJBA 2NQ8C 2NO6A 1B74A 1ZICA 1OOEA 1N36B 2PJZA 4ZOEA 1DO2A 5BUSA 1HDEA 4GQAA 4MWZA 3ADPA 4XX0A 4S04A 1YNSA 3K31A 4ZPJA 1Y4UA 2WI8A 4O29A 3HXLA 1NPDA 3MRVA 1OREA 4NU8X 3U7QA 5AW7A 1JQJC 3SYKA 4DIKA 4KHZA 2MSCB 3OKAA 3OOYA 4HGOA 4P6VF 4BN0A 1YT5A 4J07A 2MHCA 1XOIA 3WIOA 5FFNA 5DM60 4JX9A 3GUHA 3KZ1E 3TK1A 5J4HA 4WXPA 4JI7M 1MGPA 1PT9A 4UE6A 5BQOA 4G89A 2ZZNA 2GAJA 3DEKA 3KKLA 5ESRA 1DAEA 1S89A 5L3QA 4QBHA 5KINB 4HN4B 2X49A 4JBWA 3OZAA 3FGPA 3JQ9C 3A46A 1GQFA 5BW4A 4EDHA 3CVXA 3C45A 1QZZA 1XVIA 3RK0A 4IJFA 3A4TA 4J43A 2WSCF 3KUUA 1D0KA 4YT4A 3WK5A 3N8HA 5CXUA 4CIXA 2IH4A 1BJTA 3HYTA 1XRPA 1XQXA 3TE7A 1BHO1 4RH1A 4DXDA 4N18A 3AVPA 1NBHA 2W00A 3NTRA 5HQ3A 2PKQP 2W6MA 1USUA 4YMSA 4H1HA 1ECJA 4LECA 4XVQA 4PEVA 2GFIA 1I3MA 3GPLA 2D7CA 2HF2A 2V7WA 3JW8A 2WTUA 1Y34E 1S2OA 2FRDA 1IWPB 1XDZA 4WKBA 2BMAA 4JYCA 3E7PA 3CA8A 1DWUA 3AH8A 1C7EA 3PFNA 3FSEA 3IIIA 1CVIA 2D3WA 4QM6A 3NRJA 4UPVA 2HI0A 1SY7A 2NNLD 2G72A 4JQYA 1UR5A 1LV7A 2KLHA 1NU8A 2XEDA 3UKDA 1NPYA 4UVHA 5JXGA 1FW6A 1SVSA 3SS8A 2N75A 4FC7A 5FCDA 1UKYA 2YRFA 5DISB 1UL1X 1H2EA 1I4WA 4NPHA 3PE3A 3LA8A 5DM70 4YFVA 3OKFA 1US8A 2ZRIA 4YV0A 3O7MA 4FEAA 1OBOA 1QO7A 4JLNA 1YVEI 4EYEA 1SA0A 3F7NA 2R8XA 4HYTA 4OVZA 3BMQA 1Z73A 1MP0A 2RONA 1JHRA 5D00A 4OQNA 2P2LA 3KSBC 4JI6B 4RZIA 3C4JA 4JJ4A 1TKAA 4C14A 4C0HA 4ZAGA 3L5KA 1IVNA 4LIPD 3FWHA 1NI5A 4X8MA 4TYWA 1EGVB 3B9RA 1X87A 4JYZA 5BWOA 3H87A 2YMLA 5B4VA 4TMZA 2Y0QA 2Y9PB 2GCIA 4BNHA 1UFKA 1GNVA 2FPOA 1ZK2A 4M98A 4CBVA 3DAHA 2G70A 2C07A 2VDKB 2V3VA 2WF6A 1SOAA 1OX4A 4EJSC 5A3VA 1C1HA 1SKAA 1O8BA 4RDCA 1RPTA 4WNAA 2BONA 2LKCA 2QTGA 3IESA 4BIIA 4NG4A 2F67A 2YCLA 3TL6A 2R84A 2H1SA 2IYRA 2NSHA 2PX6A 3TXYA 4F86A 2NP6A 1RKXA 5LXTA 2VQFM 1IPFA 2O2SA 5HIIA 2OV4A 3TRHA 5LB2A 3A3OA 4TLMB 2VSYA 3K1ZA 5H3HA 4GPIB 2GARA 1F7VA 2Q8NA 2FW8A 2EGUA 1ZCBA 3BDVA 2PX5A 3I12A 1FRZA 3U3DA 3TKYA 3E61A 4YRDA 1U0JA 1UKCA 3W8RA 1FE8A 2HA3A 1W88A 3KZMA 3EOZA 4YY3M 1J9GA 2PFSA 3T1TA 3VKVA 4LE0A 3FJ1A 3PXGA 4Q3NA 4QGHA 1A9ZA 4OFXA 3ROTA 3OT4A 3R09A 3DDWA 1P74A 5C7OO 4MUBA 5U1PA 3VA7A 1T3GA 3IQZA 4JXZA 1F2UB 3THOA 3BF7A 3MS4A 2QM7A 5JYEA 1E20A 2C7PA 1H2AS 2C54A 5AW4A 4A3VB 1DQRA 3VBEA 4PAMA 2PQ6A 4D79A 3R0ZA 1MHPA 2L0XA 2NUAB 1M8FA 3A1TA 5BW8A 5EQTA 3EJ6A 3BMCB 1AKVA 3CLSD 1F7UA 2ACEA 2WT9A 4I50A 3WLHA 1FNMA 3C9PA 3T7SA 1RWNA 1XLTC 5LJIA 5CX1B 4PZPA 1KEVA 2CL0X 3O9MA 4JLWA 4URZR 4CEHA 2B30A 2FOLA 4KGXA 2L4EA 4OP1A 5DHUA 1KS2A 4XD2A 2WMOB 3AY6A 2AOTA 5DLEA 3H5RA 1S8FA 4Z4IA 5D3MB 5C9ZA 3OT1B 5K0EA 5B3KA 4N54A 1L4UA 3ND5A 3Q8WA 4Q9NA 1TEVA 4E88A 3G8AA 2YMQA 4GEKA 4CTOA 5A62A 1Z63A 4HRYA 2O3JA 1OU4A 1NATA 1GV1A 1OV6A 4ZZ1A 1VPTA 5DW3A 1JAIA 1XN1A 1DC5A 4NNJA 1EFVB 3G23A 4RXUA 3Q3VA 3WWDA 1L7BA 2PSDA 3R5HA 1HQKA 3HVHA 4NU5A 5CVTA 3WA7A 3HUFA 4LK3A 4AXXA 1EDBA 5A9TA 3G5UA 1FSSA 4D2IA 1CUBA 3FUVA 5BV0A 1ZJ5A 2CHEA 2IOFK 3QVWA 4WBXC 3NJ4A 3IJEB 1U7XA 4J29A 3AF2A 2BHLA 1XDGA 5LCXA 1ZX1A 1ZJYA 3OTHA 4I7EA 4NJMA 4DRXB 2ZRMA 2HREA 3F97A 1QIIA 2F3TA 3VC3A 3EBOA 1XEWY 4HLCA 4HDSB 3VO9A 2FWIA 2A4MA 3AHJA 4LGVA 5TQ2B 3HO6A 1CJCA 4KBGA 3K2EA 1FDOA 4QOIA 1JLKA 3DBOB 3SSNA 3UK6A 1CB7A 3STXA 4BFVA 1RADA 4IILA 2R8PA 2MYNA 4ARSA 3KKOA 3IT3A 2FSIA 2CT8A 1PFWA 1W1WA 2GYUA 1Y3IA 4MR7A 3ZV4A 4AJJA 2WIKA 2B2CA 4UUPA 1W5TA 3N5CA 2H5IA 3IT0A 5LYYA 1OROA 2MGWA 4QUHA 4HYEA 2FPGA 3II6X 4JU9A 5HSGA 5K3AA 4PC3A 1ST3A 4I3GA 2IP4A 5AK0A 1HFEL 3K6RA 4IJ6A 3ZDZB 1KMHA 3LVFO 1E1RA 3I1FA 4XM0A 1QFZA 3AYXB 4LHVA 2HJ9A 1MX5A 5I7RA 3KJZA 4IGAA 5C31A 1CETA 4WBNF 2O1XA 2HCBA 2PS3A 1GAXA 3PEEA 1BEEA 3MMXA 1LJLA 3LXXA 5E3JA 6LDHA 3JQPA 3MWLA 1OD6A 2I7VA 4BYGA 4Y6PA 3CKKA 3AR2A 4KR9A 1LQTA 4CG3A 1Q21A 1X1TA 2Q3FA 3QHQA 4MUAA 1Q74A 4NV3A 4KW7A 4ZJZA 3HE3A 5KQRA 2YR0A 2O3TA 1X1QA 4AWBA 3A6GA 1TT5A 1SXJE 1LTMA 2KQUA 3JVUA 5DXFA 4JYMA 3CX4A 4TWBA 3SHGB 2GNPA 2Q1XA 4IJKA 3QUTA 2XXJA 4OQFA 2X3FA 1KJYA 3G6WA 4L5JA 5CIWA 2EKFA 2EJTA 2ATIA 5LWQA 1P19A 2XZPA 1LZKA 5JDCA 1GJTA 4Q4HB 2RHTA 3OF2A 1AMUA 1MTOA 2AFVA 2DPYA 3RSFA 2VK2A 4RD2A 4G81A 2AQKA 5BN1A 4E1AA 4KWTA 4L4ZA 3F5MA 3OTQA 1MB4A 4QIHA 5H8WA 1NE2A 2VYNA 1JPUA 2J09A 4Q1EA 2R00C 4HF7A 2OP1A 2VJPA 3LCCA 3OF3A 3I2HA 4GECA 4A9AA 2W4IA 5E7MA 1ONNA 5IPFA 3NM6B 3LX4A 2OO5A 3FKSA 4N12A 2GF0A 1XLVA 2D1QA 2YDYA 3KOOA 5HTOA 3SX4A 5C46F 1XZBA 1TUGA 4LCJA 2P4UA 2PV7A 3GROA 1JP7A 3D7LA 4I6EA 1XUOA 3HGQA 2OSBA 4XIYA 1WPXA 1XTRA 3Q72A 1L7QA 2P30A 3AUUA 1K6MA 2LHGA 1PD0A 4OOEA 3DE4X 4UHFA 4EW6A 2IPLA 2HRBA 5LA6A 1U11A 3FRHA 2EARA 2E0IA 3FNHA 1ORHA 1KQ3A 4G85A 2GILA 1Y7LA 2ONKA 2IBTA 4A2PA 4P36A 4E32A 4V0QA 3U7EB 4A8PA 3LSYA 1KZHA 2MR6A 1NVKA 4HT3B 3IAAA 2KA6B 1TJPB 4WZAA 5CLQA 2JBAA 2VJDA 3V1KA 2GJKA 3GPCA 3MIIA 2G63A 2IW3A 3J81A 3T5TA 1H3NA 1DQPA 3TECE 3PIIA 2Z9DA 5E95A 3CW2A 4D9HA 3GVPA 4F3KA 4L78A 4JJEA 2EX0A 1FJ2A 2IY8A 5FA8A 2SKDA 2O06A 3TDKA 4OVKA 2I67A 4IZHA 3OPMA 3F98A 4R1LA 3DGFC 4D99A 1HM5A 3OCVA 3B74A 2GD0A 1YUBA 3DR3A 2ZTMA 1K4YA 2R3SA 3AHIA 1DZ3A 2XUKA 2VUHB 1YJQA 5LMUB 3OZGA 1B8OA 1HDZA 1HYBA 2EGGA 4FB4A 2Z4SA 2YJGA 4K3VA 3R7WB 3GDGA 2UZ0A 2RHMA 2IS4A 3IP6A 4LYFA 4NOKA 1J7JA 5AUOB 4INAA 3GR6A 3HU1A 2HMSA 1K3UB 2PRKA 4GX2A 1JYFA 1NKVA 3GFBA 4FWIB 4IOJA 2NXCA 2VDRB 1IAQA 1GZ7A 3V1LA 3F6RA 1XTKA 4E1BA 2EBUA 1FSFA 4BMVA 2WAOA 3QV2A 3IPAA 3FWZA 3HWSA 3HCDA 4Q24A 4QYIA 1V1RB 3UMGA 3U48A 2PA0A 3JAWA 4RZXA 1D1TA 3ABSB 3AR7A 4B3CA 3K96A 1X14A 3I92A 3WJ2A 1RRGA 1XLUA 2PT9A 4N8DA 1EYZA 1DIRA 3JD1A 4Z0TA 1QGZA 2JJ1A 4O2BA 1ODJA 5JCZA 2EJUA 3R3JA 4WBNA 2BIFA 3W5BA 2OL4A 3F67A 4QASA 4RKRA 1BCSA 3BB4A 3WGUA 3K0CC 1A9XB 4BB6A 2ERYA 3WWCA 2Y2VA 3FCXA 4UNRA 1YI8A 3TGLA 5D5QA 3R6TA 4OF4A 5J43A 2WIAA 4M21A 4CCYA 1B76A 3GLQA 1C1YA 3ORYA 4FNOA 3LQ4A 3J2PB 5JECA 1T4CA 1CUCA 4DQDA 3OZRA 3ASUA 3PGA1 2ZZKA 3VR1A 4UQPA 2XE4A 5AOCA 1PGQA 1VIMA 2HU5A 2V8BA 1C7IA 4V24A 2VSQA 4U9IS 2C2OA 3IMCA 4JI5M 2KHZA 2ATEA 3V7UA 4KQHA 3JQAD 3PX2A 5FA6A 4EO9A 1AHNA 5E9AA 5JAZA 3GDWA 5AUQA 2VDMB 3FCCA 4CLRA 3OX1A 5DX1A 3JAKB 4KOEC 4EF6A 1CVRA 1R6UA 1XL1A 3OQPA 3QWHA 4WERA 1HK7A 5FV4A 4DR3B 5DSXA 2CNWD 2PZKA 5JFTA 3O4FA 3JWIA 3HB4X 3RSOA 3TQCA 1TJNA 4AJLA 1Y9ZA 1YDMA 5GIOE 1HNZB 4FCVA 1SVUA 2VYQA 3FGZA 4G4SP 4I5DA 2PL5A 3DNPA 2FH5B 1CQJA 3WL3A 2NX2A 4QX6A 3OP4A 5KHOC 4OCZA 3KQTA 1QAOA 4EHBA 2GK6A 4X7RA 3REOA 3EDQA 2W8BA 4WK6A 4H7EA 2VYFA 4NYMQ 1M2EA 3EEYA 2H92A 2IY9A 1R27A 5BSMA 1T6YA 2ZGVA 3KP0E 3WGTA 4TSFD 5F98A 1XO1A 5HKKA 2WUEA 2GZMA 2XYRA 2BFDA 4Y1RB 4RTKA 5HKLA 1B8NA 2ZB7A 1FVXA 2LXNA 2P65A 3IPYA 3QOYA 3HYLA 1MO5A 4RF3A 4NMMA 3F6SA 1LY1A 2IU0A 4W1PA 2V9PA 2FEKA 3I9NA 4RVCA 3BWVA 1DTWA 2BMDA 5G0TA 1QHXA 1F6BA 1K6XA 1N9ZA 5AM3A 4KKVA 4UAVA 2V7UA 5FWAA 4G8CA 2D1FA 3MMPA 4EA8A 3JYQA 2PWYA 2PSFA 3T9FA 4CF3A 2Z6UA 4EIWA 3TDMA 1PYOA 3FYCA 3VKWA 2VUSA 2CY0A 3UA3A 1WHSA 1GADO 1EE1A 1HGXA 1SFRA 4KTVE 2WZQA 4IVQA 3ZDQA 3FYUA 2RGNA 1FNDA 1RNLA 3BCSA 4ECEA 4Z1MA 3RIEA 4PQFA 3NOQA 2BGJA 2B4QA 2B9VA 1GO2A 4K81B 4BS9A 3ELWA 3M6LA 2YHSA 2ZCJA 4DBGB 5IM4A 3L07A 3G0CA 5A7HA 1WULS 1NOIA 3L29A 2R1VA 2R87A 4CMAA 5BQXA 3GFFA 5DP1A 1I4LD 2AE2A 4FOPA 2WEKA 3PE4A 2Q6IA 5EZYF 4WP2A 4BNFA 3GW8A 4ICIA 2XMGA 1RQXA 5A4MS 1GPUA 4FFNA 4YHHM 1W9MA 4ZDIA 4ZVQA 5K7SA 5KPDA 1QCDA 4PM4A 4GYJA 1LA2A 1EFAA 3GFGA 2G8LA 3ZN2A 1ZNWA 3KP1E 2IC5A 5J1SB 1T0IA 5DF1A 2EIXA 3OIVA 2IDMA 3AVUA 3DQQA 1X39A 1G38A 1UMBB 1VMEA 3DAYA 2NUPB 3CVUA 5IVPA 1KOJA 3PRHA 1OIWA 4NABA 7CATA 1T8WA 4IUYA 3IIKA 5CFQA 4TROA 4J16C 1TMYA 4FI3C 4XWGA 2QMYA 3AI3A 1OWPA 2WE8A 4DNFA 4DWWA 3DE6X 5DBGA 2PFKA 1KIAA 4X8HA 2C96A 4RAQA 3OLZA 3H9UA 1S4MA 3QJGA 5D6NA 1E2LA 1PR9A 3GZJA 1PTJA 4L8VA 2R7NA 3RFCA 4INJA 2JJ2A 3H11A 5JC1A 4R68A 5B1EA 3BIWA 1LRJA 5JXIA 2LVPC 4QREA 1KMCA 1E8NA 1H93A 2ZAIA 5FLEX 4GI5A 1PAUA 4BNJA 5EPEA 3IUJA 4PAGA 4V0ME 3MM4A 1P2SA 4M0PA 5CPBA 1JLLB 3LC0A 4AZWA 1ZH6A 3OPQA 1XCMA 1Q15A 3L6BA 2C2YA 1NXOA 3MGGA 2MSNA 3TLKA 2OXIA 4KX3A 2QV7A 5EESA 1YA6A 4JI3M 4PLPA 2UYGA 5ARCA 3KPVA 4WLFA 2WAAA 3F6EX 3INNA 3O4IA 1CUHA 5K3FA 2WJ3A 4NSRA 4PV7A 2UUBM 1PQWA 3IP8A 4TUYA 2V1XA 4ZK2A 1TLLA 3IV6A 1U4SA 5MGNA 2W93A 3HHEA 4CL8A 1FSZA 3WADA 4CM9D 1Q50A 1ZUHA 4B4OA 3VSDA 2CNNA 8GPBA 1U65A 4G1MB 1U2PA 3MUNA 2X3UA 1NX6A 3NHMA 1VMDA 2J3IA 2Z5GA 1BHSA 2HMTA 4UNPA 4F8JA 3S29A 3D6HA 1EDOA 1PEAA 4FHZA 5EXXA 2OV3A 4URVR 2OBFA 5EEHA 4ESVA 2YJ6A 1BD3A 2ZRNA 1I1NA 5HWSA 3GAMA 3FPLA 4DNOA 3ZWXA 2D2FA 1NVBA 4OAQA 3SBJA 2QQ0A 2BSQA 1N2EA 3GFVA 5DFLA 1WPQA 4D43A 1I94B 1O6BA 1XZQA 3B1FA 1L4BA 4G9GA 3L0BA 2AEMA 3ER9A 2VQ3A 1GKUB 1J1IA 3THWA 1QGDA 4YBZA 3T9DA 2YWBA 5DGIA 2JCSA 1W8IA 5JWHA 1II9A 1HYEA 5DHAA 2ZI3A 5I9BA 3IG8A 4CUJA 3TSYA 1YO6A 3HUEA 1LH0A 1Z4KA 1Y63A 3UT0A 3Q1LA 2HDNB 1G2PA 2FMTA 6CHYA 1G3UA 5E1DA 4PAWA 4C2UA 4MKHA 3R75A 3HDTA 4IIHA 1IVSA 1ZMUA 4OHWA 2JZOA 3SM3A 3SXUA 3W7AA 1D2MA 3IUQA 1UAYA 4K6KA 1DGBA 2C42A 2I4RA 2I65A 2BEWB 2R6JA 2VJKA 2V58A 3Q5GA 2ZWMA 3ZY4A 3ZHOA 2BFFA 1NBAA 4WCVA 1MC4A 5JAIA 1EUDA 4OYRA 1K0FA 3IP5A 4HRVA 3B1XA 4H9GA 3OM0A 5KYXA 3DB2A 3QEMA 3NPMA 1ZN7A 3DC7A 4ZRMA 1K5HA 1R0RE 2L82A 1BS9A 4IBOA 5FPHA 2X9LA 4H3HB 5EZYA 3H4MA 5E6SB 4RAOA 3AY3A 4QJ4A 3NGMA 4DDHA 2ZJBA 1GGJA 4RPHA 3R77A 4DMHA 2IUUA 4ND4A 2HIAA 4YJFA 1NQAO 1QGUB 1PEYA 1Z2DA 4UVDA 2LUOA 2P67A 2BUBA 4EPVA 1XHFA 2KZSA 1L7XA 1WXFA 1ECCA 5TX7A 2BM9A 2R4QA 5ALVA 4C29A 4MGKE 3Q3IA 1W96A 4CR6A 1OIPA 1KXJA 4YR7A 2IIBA 3UAZA 1T6BY 3DTVB 3TX2A 1E1QD 4KRGA 4ER7A 4AJIA 3E3OA 5TMPA 2REBA 1H6CA 4GHLA 5HJ5A 3IYLW 5AHWA 3OOHA 3K4QA 1MH1A 1ZYUA 2QXTA 3IUNA 3T1YM 3JY6A 1G9TA 1OAAA 3AV0B 2P0YA 2JIRA 5LJLA 2A0WA 2DECA 1HURA 2ZE6A 3RIHA 5BN5B 1XEXB 3WSWA 3HCPA 4F4DA 4RK5A 3PVSA 1I10A 4M0LA 4EY4A 4GKAA 5LMZA 1HLPA 3C1UA 2IPOA 3I5AA 4FFDA 5DRTA 5M5BA 5I9TA 3BE4A 1PJIA 2QX6A 4OFZA 3UW1A 2OUKA 2LDBA 3D2BA 1W4LA 3R6LA 2RB5A 3HCFA 3RD5A 2FWJA 1MB3A 1R5BA 1SUDA 2R7KA 3NB0A 1R5LA 1WY7A 1V3VA 1JEAA 4OLJA 4NZ9A 1WVIA 2VF8A 3UOWA 1TTPB 4TT3A 3FMIA 5LBUA 1Q7RA 5ER9A 3ZKWB 1KFEB 1FU4A 1Z0AA 2HQSA 1PG2A 5T41A 5AUNB 2VKTA 5KPJA 4X66B 1AHPA 4YXWA 1TH2A 1HUQA 1ES9A 3WGMA 4ZGBA 3DOHA 1BMFA 3MHTA 4DMMA 3EFOB 5TC4A 4D3DA 1ZHFA 3SOPA 3LF2A 4Y2PA 3HJ8A 5KSYA 5L8VA 5G0WA 3P2MA 1JHXA 3ZGXA 5HNKA 2YZGA 2NO9A 3I61A 5KTTA 3OTIA 4OKNA 3MS7A 3E1KA 2I87A 2IHNA 2XBMA 2O2IA 5E2BA 4H0NA 3KWLA 5J2TB 1R0KA 3E1SA 3KYJB 1FMLA 4YQYA 2PSSA 1OC4A 4HQFA 5FBRB 4YJ2A 5FTLA 3UWDA 3V00A 3P9QA 1OYWA 2Q28A 1NTOA 4J3JA 2VWGA 4EY7A 3WGOA 4LYDA 3U3OA 3D0KA 1SZDA 4FYJA 5IKPA 2QZPA 4CPDA 3LX8A 3PEYA 3IODA 3DCJA 3KPWA 2OCXA 1N2HA 3V8EA 2G6TA 3P2EA 5KEIA 4GLJA 1RYZA 3F6CA 4Z4FA 2ZJZA 5BPHA 3KFUG 1Y81A 2VBGA 1U3VA 4H4CA 3DYBA 2CUNA 3GEIA 4QJ3A 3W06A 1D6NA 4LKRA 3SMVA 2IE0A 4D80A 4OHXA 1E94E 1JR3E 5K0CA 3ZWQA 2HIMA 1REQB 2GHQA 1AKRA 3GLUA 1GUYA 3GDFA 4L73A 3USES 2AFIB 1LTKA 2M5ZA 4LCEA 4YP0A 3N0TA 3HFRA 2R1UA 4QPNA 1J2UA 1QK4A 2PKRA 1MW8X 4HH0A 2JHCA 1EPUA 4A1OA 2NUTB 1HOTA 5CBPB 4DV0B 2OBYA 3DLBA 4RHYA 2COEA 3HR8A 5LMCA 2NVWA 5CNIA 1YCDA 3H7AA 3JTEA 5BY2A 3BHNA 3OH8A 1N25A 3R20A 1NUUA 4ZQCB 4Y9SA 1JLSA 3PL1A 2HHHB 1UBUS 2ZTHA 3F4BA 4YQZA 4XX0B 4CN9A 3MJCA 3BWEA 1Z4IA 4YCAA 4AJNA 2CYCA 1PNOA 2WR8A 1RWKA 4E51A 2QU7A 3RHFA 3T54A 3U7QB 1RCTE 4ZFNA 1IEXA 2JVKA 2KXEA 2WFAA 3G2KA 1JTFA 5E2IA 1XTPA 1E7SA 2W58A 4F6RB 1SMKA 4XVCA 1KSJA 2JAOA 4PYNA 3IPRA 3VSBA 1F38A 3CY6A 4PVDA 2GLUA 2EUCA 3TNDA 2F8MA 2OM2A 3ZK8A 5DW0A 1J5EM 4K26A 5L3QB 3I3OA 3CG0A 1HR0B 1OLUA 4Q02A 5K0JA 3EQZA 1RI5A 1E62A 5JR3A 4R84A 5K0GA 1CF4A 1UMKA 4HG2A 1B6GA 4YDQA 1NC1A 5CB8A 1SZJG 1IJFA 3SMSA 1ZI9A 1B6TA 4YPVA 4MRPA 4KVAA 4P4SA 3B7QA 1NR1A 2X2EA 3RK4A 1BE8A 4BBAA 2FN8A 3F6BX 1U3TA 4RD0A 2PGIA 3VO2A 3OJEA 2GHIA 1T3SA 4JJGA 4DUGD 2WTBA 3KJEA 5HQ3B 1F0KA 1JIKA 1LGYA 5H4HA 4H4DA 4ZQGA 1QFMA 2OQ4A 2GSWA 1R00A 1WJ7A 1CIVA 3I8SA 5FUMA 2JCBA 1M6EX 2G04A 4KXXA 3IJPA 4Z9YA 4XVRA 5HMMA 3RSCA 2K0BX 3Q3GE 4HAUA 3EF1A 2DR2A 4W1SA 4NAUA 3DPIA 2UUAM 3L5OA 3GCGA 4A27A 3ZE2B 3E5MA 5BVGB 5J47A 4KE8A 3RTBA 2ODAA 2H52A 2NZXA 4F9GA 2BFBA 5IWCA 1YFKA 4H6PA 1NM5C 3PPVA 2FLKA 3EMVA 4A8TA 3COYA 3N76A 5J58A 3PIRA 3AVWA 1QZTA 1U0SY 3PT9A 2J0QA 4NOLA 7ADHA 3MWJA 1US8B 4HVTA 3MJEA 3G0GA 1SA0B 2CL5A 4QPDA 1ZJWA 2JI8A 3QNMA 4RKUF 2JY6B 4OVZB 3BMQB 4XB2A 2R47A 5B1YA 5ITQA 5HIAA 4OQ4A 1CZHA 5JE8A 5JXWA 1DELA 1TFRA 3WGIA 2NTYC 1QX4A 1UQRA 4DC0A 4EG3A 4LDQA 2PJUA 1KZYC 4UAUA 3U56A 4BNVA 3IBGA 2PUGA 4UQLA 2ZJ0A 1QGOA 4Q1CA 4IQFA 3PWTA 4R7GA 3BEOA 1VCMA 5AHRA 3KJHA 4IH9A 1QAQA 3C5HA 3VRHA 4NU0A 3U16A 1OX4B 3OQBA 2WJ4A 3THSA 4MUJA 4K5QA 2DUUA 4WNAB 4HGQA 4E31A 1XTZA 4OIFA 3DBRA 4IBEA 3OWHA 2IITA 4X62B 4IDNA 5B6IA 1L4HA 421PA 5DM2A 2XMRA 4YRSA 1HE8B 4G5XA 2P9CA 5BSRA 1B43A 4O4IA 5LXTB 1CV2A 3CE9A 1PJTA 2MSLA 1T6OA 1EVQA 4L95C 1XNRB 4ROSA 2QZJA 5CDYA 4MROA 4OSOA 4F7DA 1FNBA 1BDIA 4BQPA 4EH1A 3IL2A 1GRRA 2PO5A 2AX3A 1E7YA 4DR2B 2FPPA 2BW0A 5EP1A 3EZYA 1EVEA 1ZCAA 2HJSA 3BYZA 3BILA 2YIDA 3JQGA 2QP3A 1W88B 4EO7A 3UWMA 1FTQA 1CFZA 2HUPA 3MPOA 1D9ZA 3I6MA 2DERA 3QE0A 5HUJA 3MAGA 5LXTF 3RE8A 2GEVA 3TSAA 1OH8A 3NH9A 3GFQA 4KIWA 2EF1A 2ZE7A 1OTYA 4DCMA 5TV2A 3DFZA 4JKIA 1NBOA 4FVMA 4HNAA 5DSTA 5T3UA 4LJYA 5DHSA 4MGHA 2G9NA 3KHUA 3D4PA 3RI3A 1JKFA 4MDYA 1CUEA 4I50B 2YX1A 3ANSA 4DT1A 4ZICA 1IFXA 1L9XA 2XLCA 2Z57A 1J42A 4L02A 4FDVA 3ANTA 3JQ6A 4M60A 1YDEA 4CEHB 5BRNA 4W5WA 4FJ1A 5KNCD 3SF0A 3WLNA 4P5EA 4LE2A 1V37A 1XCGB 2DT8A 4LRQA 4ARCA 2OV1A 2AOTB 3FH0A 2CWDA 1KK1A 3TYXA 3HXOA 3BTOA 5LYJF 1ZD8A 1U0OC 4PCUA 5C1BA 1UK9A 1JTVA 2IHTA 5K6AC 1N78A 3M4ZA 2R6GA 2OA0A 4PZ0A 4FKBA 1C7ZA 5F7JA 3AIMA 3EC1A 1NVAA 4I50F 3TW0A 2Y93A 1XZ8A 4RXTA 2CJPA 2GUWA 4OH7A 4BNUA 5A7FA 1GAQA 1Z06A 3NBKA 4KXQA 2EWMA 4P92A 1ZU5A 2VT3A 3ZHUA 1UWLA 4V1CI 6ABPA 1JPNA 3L05A 2J5BA 4F38A 4QYTA 4JR1A 4C0JA 2XCUA 4E5YA 5ICSA 1RIIA 2OPFA 4FYIA 1ZM7A 2CC2A 4V0SA 4WRRA 4HUTA 1NA5A 2ZM6M 2KNVA 4NJMB 1UBKS 3M33A 3LP8A 4FZ3A 2I76A 3SVTA 1ZL0A 3SHOA 3D4OA 4XTCS 3IC5A 1KYIA 1W85B 1IE3A 4ZQHA 3CWQA 4TN5A 4ZO7A 2LCFA 2GESA 3OY7A 3KUXA 2EX4A 1L4EA 1TX4B 4IF6A 1TQ6A 3FI0A 1FSPA 4PQGA 1VEJA 1JFLA 3EVTA 2F8LA 3V1MA 1F51E 5HBGA 5A3QA 1Q6YA 1UPBA 3S2GA 4JI1M 1E3QA 2UXDM 5EJ4A 3E9ZA 5D5PA 1K2WA 4F5WA 4MW2A 2E5LM 2OOKA 1L7VC 1IZ8A 1H65A 4PN7A 1AB6A 3LIPA 2P3QA 4DXAA 3W5JA 1NUHA 4P38A 4PO1A 5I8ZA 2MSEB 3ZHXA 4MR7B 3FMOB 1W5EA 2YS6A 3SBEA 4HGZA 4KU4A 3IIJA 2X8WA 1Q1GA 1T2AA 1AF4A 1G2QA 4QDJA 1DBQA 4KBYA 1QHFA 1G3IA 4K1LA 3ZDYB 2V1CA 4LF8M 2PGOA 3V1NA 1VE1A 3OKPA 4R2JA 1WZCA 2QRVA 2WHRA 1JDZA 1UBGA 2BUAA 4RQUA 2NZVG 1KMHB 2VIIA 4ZXPA 2ZAYA 1XZJA 2XBLA 4X7BA 4Q19A 1UBCA 3C3BA 3FOAA 3E15A 4PLVA 1Y5RA 5FOWA 1M2GA 4ZVUA 1K88A 2VHEA 2C3PA 3OLXA 1DS6A 5DTQA 3OZIA 4BP1A 5J4YA 1TXGA 3WR5A 5LU9A 1KSHA 5F5NA 3SZRA 3FUWA 1UP4A 1CR0A 5I7AA 5EJ6A 1DG1G 4UQOA 3LYAA 5TS3A 3VXKA 2C9ZA 4LJ6A 2VEOA 3L0ZA 3OAAA 3WYCA 4BNNA 2PYZA 3TM4A 2QVGA 1MO3A 5K3SA 5DH9A 1DGGA 3WK8A 1CUSA 1VZ2A 1FRQA 2AJ8A 4N5DA 1YI0A 1TT5B 3BKWA 3NLLA 1LFAA 3Q87B 4MMYB 3CJQA 4FLEA 1ISMA 2ZWVA 4G65A 4LF7M 2HDWA 3PF8A 1KWKA 2R25B 3T1HB 2WUDA 1LQUA 2HEIA 2X5NA 4KK3A 3GLGE 1JT9A 2D0IA 2Z6AA 4NG5A 3H1TA 3FR7A 4PYOA 1C0IA 4OQQA 3CT4A 4BEVA 4XFDA 1ZQ9A 5E1BA 1RE1A 3BWMA 1YC2A 3VDXA 4EF4A 3H4IA 4JI8B 4PN3A 4PBTA 3T3GA 4G4NA 4GL2A 1R4GA 1D2HA 1E1DA 1GYQA 2AG6A 1Y1KE 3HBFA 3FIJA 1NOJA 5JCXA 3FKEA 3F5DA 1Y7TA 4N8EA 4YPFA 3KJFA 3NHAA 1E2GA 3VHLB 1OW3B 1MAVA 3FTPA 1EFRD 5LA6B 2E48A 3ZE1B 1CQZA 3OE1A 5LYJA 5KWSA 5DN6D 3BZWA 2CWBA 1UC5B 3AUKA 2BH2A 3JQRA 4UBIA 4YAFA 1YR7A 3WLQA 3W2IA 4N0QA 2GJAA 1SXGA 2MOKA 2ODTX 3OA2A 1E99A 2JIMA 1S3FA 1SUEA 3Q5EA 1QIMA 1W36B 1SVNA 4TQGA 3VHXA 1ZJ6A 1ECFA 2JEYA 2JBAB 3RUCA 4IF4A 2WSFF 1G64A 1PQPA 1XTSA 4RTJA 1XZMA 4EPRA 2ACWA 3W3AD 5LM3A 2VEDA 2P68A 4LC0A 5LA6F 3I9KA 1PU2A 3GN2A 2JNHA 4QTZA 1MAHA 3QI2A 5C8VA 3U4QA 3JYNA 3KE9A 1D0IA 3U3XA 2B25A 2V4MA 2QDXA 2X4LA 5L7WA 5E4YA 4ZMSA 3CUEF 3K70C 2FU5C 2ZTLA 1IZYA 1SBTA 4G5SA 2O23A 3F96A 4RANA 1JIJA 2A5DA 3IAS1 4X90A 1P2FA 3KEOA 5DMHA 2IOQA 4ZEXA 4GC5A 4L22A 4C0WA 4DVJA 1ADYA 3VFDA 4U2DA 1QUFA 5BUCA 3KSRA 1X0VA 2C29D 3P9KA 2ID9A 4R1MA 4BPBA 3BXEA 2P2ZA 1Q95A 4QC2A 3BXPA 4CR7A 3KOXE 2X13A 4UM7A 1N32M 3N07A 5AKJA 3OFKA 2XUJA 4FUQA 4NWIA 3GD5A 4YAOA 3PV0A 4TVBA 5CIQA 3ES9A 1WF3A 3OCJA 2V9ZA 5C7YA 2QD2A 3H2SA 3UKOA 4ALLA 2RHOA 1WV1A 1PGJA 1U7TA 2CFIA 4DJAA 3JAWB 4QE3A 3MHVC 4ACBA 3L4BA 5C35A 2NU8A 1PI3A 5JJ5A 3SJ7A 5I7VA 3LUKA 3QMMA 4KNWA 2AI3A 4C4OA 2HSZA 2ONJA 1Z5WA 2CCJA 3FSRA 3QFSA 4O2BB 4NFSA 3D7KA 4WBNB 1ZK0A 2Y1FA 3DZFA 1CQXA 1YR1A 1BCSB 5DM0A 3DVAA 3L7YA 2IYWA 3MOSA 1I4TD 4M7RA 2DBQA 7AT1A 2ZSUA 4QG7A 5CW1A 3C14C 4CCYB 3QKTA 5F3DA 2NV6A 1PR4A 4ND6A 1W52X 3GFTA 1NXPA 2WYHA 3A11A 1FFYA 5CITA 2B4KA 2KX7A 1RE0A 3O1IC 2F8TA 4KLCA 4DJDC 4HMPA 3ZLUA 5MF6A 5DGHA 1WHTA 2AN9A 2RE8A 3S40A 2ZT5A 4RACA 3ETCA 3P2YA 4UPDA 4YP7A 1GNLA 1YZUA 3PCTA 4A0FA 3Q15C 4O2BF 4J1TC 1HG0A 3GYGA 4P8RA 3L7IA 4Y0NA 2XEPA 1YLAA 1GTMA 1QOZA 2GAAA 1ZNXA 3M3DA 2VF7A 1LSSA 3JRNA 1JA9A 4CM3A 4DQKA 2TMKA 3FYDA 4PC2A 1Q0UA 5ISMA 1VIYA 1JHPA 5FPYA 2UXBB 2JD1A 1IY8A 2AOXA 4CLRB 2ZIVB 3UGQA 2OSVA 1TO2E 3JQCA 1G18A 5BQ3A 4EDFA 3L0OA 4GFDA 1AS3A 1KWGA 3ORRA 3VTAA 3S70A 4GVXA 3ENKA 1ZGGA 1MORA 2WU3A 2QVXX 5LB4A 4DC1A 3JQ8A 3KETA 4FS8A 3MCVA 3VTKA 2IY7A 1ND5A 1K06A 3TZEA 2OB2A 1QMGA 3V4LA 5F7ZA 1M2HA 1U31A 5ER6A 5TPZD 3NYWA 1V34A 1FUKA 2C3MA 1TZ2A 1NBEA 2WV9A 1YRAA 4Q37A 3NKLA 2PL3A 2O8BA 1CQJB 2BKXA 2H17A 5F9HA 3C3MA 2RGOA 4F2PA 4YJGA 3QVMA 1XU7A 3B2QA 4NQZA 4TXLA 3VOSA 1DXHA 4RVUA 4IGKA 2HWXA 5EIEA 5F7XA 2W8BB 5I4KA 3I4YA 3OFSA 1MQ8B 1UEJA 4QVGA 3RIGA 4PLWA 5JLJA 1RAEA 2NZ8A 3C5CA 1QK3A 3M1IA 3WLOA 1KY5A 3NHPA 4RTQA 5KTNA 1Z2AA 2B2XA 3Q11A 3FXAA 2BFDB 2IEIA 3T7AA 3HADA 3OCYA 2JLVA 4H7FA 2GZHA 4MRMA 4I1UA 3EFBA 3V42A 5GZ1A 3M5DA 1P3Y1 3GELA 1DTWB 5FJJA 3IKTA 2FMFA 2Z56A 3MSCA 4ZT3A 1GSHA 3PCXA 2ZYWX 4L7QA 3LBYA 2TYSB 4IS3A 3VYWA 2QTCA 1XKLA 2AEJA 3EBLA 5AFSA 2XWQA 1WA5A 4K6HA 2ZATA 3T7TA 3VNSA 2J3LA 4CGYA 4MQ5A 3LTEA 5JTUA 2X0EA 3FYUB 3I2GA 3ED5A 1OPXA 2BI7A 1RI2A 5C52B 3UPTA 2BM1A 5D84A 3GIWA 1GT6A 1JG6A 4HNVA 4PFSA 4DILA 5G40A 3IEMA 4YONB 2YBDA 4OQXA 1F0NA 1W0JA 2R1VB 4HS9A 2IEAA 4P33A 4QOFA 1XEAA 3H2JA 2WT8A 4NYJR 5A0FA 3JV7A 3PFGA 2HD4A 2QX8A 1P6XA 4PVCA 3STTA 3T38A 4Z54A 2ZRFA 3UC5A 4PD2A 5BRJA 2QLBA 3MQFA 5ALPA 1OFVA 4PX9A 3SHQA 2R5WA 3D6FA 1UBRS 2BGGA 1I3NA 4FONA 3K9PA 1KNXA 5LL6P 1PRYA 3L8EA 2IUEA 4HVAA 2FYTA 1O95A 4OHKA 1NW8A 2DHCA 1SUFA 1NF8A 2GNOA 5IM4F 2VJYA 3DL4A 5ECYA 1Z15A 1CB0A 2F3QA 4R1NA 4RC9A 5K03A 5F1KA 3FPHA 2J3DA 4IQ0A 1DBSA 3L77A 2VNKA 1JHQA 1BVHA 4X54A 1T0PA 2FPIA 3K35A 4RIHA 2QN7A 1O0CA 2Q6TA 1RFGE 2QRLA 4AUEA 4ENUA 3DZKA 3WLIA 5EKXA 4U8GA 2FVYA 3GGCA 3NBQA 3FUCA 4M49A 6GPBA 2DY0A 2YXBA 3H11B 3E4RA 1QJ4A 3TLCA 4XYGA 2E5WA 2VXCA 1ENZA 2JP7A 5LQCA 4OI2A 2XH9A 2Q8QA 3GHHA 2PO7A 3MT7A 3VYTB 4XCVA 5EGSA 2WPDA 3W2FA 1C7JA 4GXTA 2DFTA 5M04A 1DWOA 3W5CA 2ZIWB 5SV2A 3LPDA 1CCWA 2VDLB 4JJZA 4P1ZA 4GD3Q 3FCAA 3ITKA 5LZ2A 3FCUB 1UXIA 2ENWA 4D0RA 2XOEA 5THXA 5A4FS 1A69A 5E7QA 1LPSA 1GRVA 1ZVMA 1QPBA 4X20A 4ZOCA 1OASA 3RKSA 1ZGJA 2X4IA 4BJHB 1Q1EA 3Q6MA 3BD6A 4PNEA 4XUGB 5IH3A 1RI3A 4QUKA 3AFOA 4TUYB 1G20E 1O94A 2VTKA 1VQ1A 1S8OA 2AZTA 2W70A 4TKVA 3Q88A 4L6IA 4QXAA 4B8ZA 4P4UA 3PR3A 5G4KA 3EVAA 4YCDA 3HI4A 3CW9A 3VAZA 2QQEA 1E6UA 5BUZA 2XIJA 1L6RA 1OT5A 4E0BA 2IRWA 3L1HA 1QQ6A 3LFUA 4KREA 2IU4A 4EAQA 1XMQB 4X8OA 2DX7A 1AGRA 5DO9A 3EWNA 3SSMA 3TTXA 3L02A 4RU1A 4TUYF 3SJUA 3TZBA 4R05A 4Q4DA 3PQ3A 1QS0A 3MUOA 1XZLA 4HK4A 5CFRA 1SJ9A 4C0QC 1YZTA 1QANA 3ZBPA 5B7GA 4TLAA 3W0LB 3THWB 2IIQA 3ZDRA 3BWXA 5DXAA 4UBOA 1BCRA 2AHRA 4UJ5A 4YFYA 1T9BA 4ZARA 3MWEA 1J00A 2G08A 2CHQA 1DT3A 4Q93A 2A59A 2QRPA 3AG5A 3CLRD 4S2EA 4UM8B 4BY9E 3L43A 1GU0A 4FYMA 3WNVA 4FWDA 4A0SA 4P32A 4DKJA 3SXUB 3GGGA 4ME6A 4N0MA 4HLUC 2NWQA 4W9NA 1MO2A 4CG1A 1PLKA 2HWWA 3RS9A 1ZWKA 3CHYA 3EF0A 4OQMA 4DADA 4XQGA 4D26A 4W5JA 1E4YA 5FNVA 5JS7A 2C5AA 2P6UA 2A9QA 2BFFB 1EUDB 5KBYA 4GRDA 3MTDA 2QA5A 3J80A 2B8JA 2QN1A 1XT6A 1DRWA 3CLHA 3OQ1A 1TEHA 4ZT6A 3TAXA 5DFAA 5KYXB 3QEMB 1FRFS 5ITZA 3HS3A 3KOUA 3SS7X 3MINA 2PZBA 1TEXA 5EZYB 1YDWA 3VOAA 1Z5AA 4CF7A 2M60A 4ZDJA 2EFYA 2AR0A 4MGIR 4YJFB 3V7YA 2A5FA 1OB2A 1W47A 1D7OA 2Y71A 2N0SA 1F17A 1HKHA 1U1CA 3LHDA 1QO9A 3OOJA 5KSWB 5EHNA 1W0KA 4FOLA 2GQ0A 5ECWA 3LUCA 1IY9A 1YULA 1G59A 4FJ0A 2CBXA 4H3KB 5F7OA 1KZ4A 2XDQA 4L6V6 1UF9A 2Q4BA 2EIHA 4FYVA 4OATA 4AQYM 1YJBA 4W5QA 4DDMA 1EFTA 4X1KB 4E5VA 1WD5A 1RTKA 2EW2A 2LKDA 4TL6A 2G9ZA 2R4JA 4RX1A 5DNWA 5IVKA 3A1UA 4FFBA 3R4VA 4QOGA 3TOCA 3JU3A 1VP3A 4HH3C 5DBFA 4EJ2A 3CXUA 3UFBA 1KO8A 4DV5B 4W9MC 1M6YA 2HIHA 1R8QA 4I9GA 3E53A 4CMCA 5AW1A 5FL3A 3N3BC 1VECA 1CUYA 3TCKA 3MRXA 1Y37A 1NXQA 4MR8A 3I2FA 3FZNA 2GWRA 3DT6A 1EAMA 4TTVA 3OPYA 1KI8A 5BN4A 2QE6A 1GRCA 4YS6A 3Q2OA 1L5HA 3QFCA 1IBCA 1VLJA 3E23A 4RF4A 4W4TA 4POAA 1AXEA 3QKWA 1PS0A 1S0UA 2ZB4A 3OCZA 1HE3A 2J7NA 1QBKC 3Q5DA 1BQEA 2WWGA 5K05A 3GRUA 1SHJA 4Y6SA 4TTRA 1CR4A 1JU3A 4JOBA 4D1YA 4AIRA 4LQCA 2DTDA 1T5SA 3P20A 4IJQA 2UYQA 4AKIA 4Z3OA 4WJKB 4LRWA 4QUEA 1XRQA 3IEPA 3TWLA 4NRVA 2DQZA 2VF4X 1MUUA 2W90A 2ODWA 4J49A 2DJ5A 5A05A 2WT4A 3E3AA 4EQZA 1EESA 1G21A 1PJ3A 3VISA 3TL2A 3SEAA 2E55A 2J9XB 4QBTA 3M5CA 3J7TA 4RTPA 3VJRA 1J8MF 2FUCA 1W6UA 4X91A 3TEJA 1SUBA 2D00A 4R1PA 4UUAA 2Y66A 1N7IA 1WXIA 3KL4A 2IWRA 1JNXX 1OAOA 4K1XA 4ZMRA 4JI0M 4DDKA 1L1EA 2X77A 1BX1A 4KO4S 3DEAA 4B8YA 3DAOA 1AMOA 1DX9A 4FYYA 4BEBA 4LYEA 1HFWA 4WQMA 3PLAE 5TR9A 4AS2A 5I47A 2J9RA 3K16A 3MB5A 5FOTA 2C9DA 1UOPA 4KN8A 2VDWA 5B4UA 1SR8A 4BZZA 1U7ZA 3KJQA 1P44A 2DQSA 1WXQA 1XZAA 3CWZA 4LC9A 4JP8A 1NQWA 2HPHA 3OTOB 4MPDA 1TH3A 3ANNA 1DRJA 2GRAA 4ADSG 2BBTA 5AK6A 2QMZA 5KKAA 3GA7A 1MNAA 4YJ2F 4OJNA 4JHLA 2FFRA 3GLSA 1Q7CA 4MYRA 1G6OA 3R3UA 1P6UA 5EN4A 1V8PA 4HX2A 3PA6A 2W2LD 1U9YA 4BQQA 3PUYA 3QA9A 1Y6RA 5FBQB 1QQTA 1C8BA 5FI5A 4GMKA 2P40A 3S1AA 4WADA 3I76A 2VZ8A 4ZWNA 2GN0A 1JU4A 2XT6A 2W6QA 3UK0A 2FEXA 4B6RA 1NNLA 2E1PA 1PGOA 2OBBA 5JARA 1EEHA 5A9RA 3G7UA 2G17A 1RRPA 1PFQA 2PXCA 3HKEA 3GVHA 1RRFA 1S01A 4HH4A 1NBIA 2FV8A 3EXHA 3LKZA 4KI7A 4MVJP 2Q3MA 1YS7A 1DBVO 3L4EA 5LP6C 2R751 1Y5LA 3G2QA 4HVCA 3SAUA 5C1DA 4PG5A 1RXVA 3JVEA 3T7IA 2I6TA 2QTNA 3G8BA 2WILA 3AJDA 2WG0A 1P80A 2JIZA 2N1MA 4NCHA 5KNDH 1KDZA 2YZ2A 2XT9A 4AMZA 1E7MA 4H60A 1WXGA 3UHAA 5FF9A 2CXUA 2P5YA 4GVPA 2GBIA 5JCJA 3WBBA 3QFFA 1H1LA 1OLUB 3K0KA 1G98A 2IUYA 2LDXA 1G17A 3QU7A 3CLUD 3LLUA 4KDRA 3HJCA 4MV3A 3PRKE 1ODLA 3COJA 4KQ9A 4X6LA 1ZS9A 1V3UA 1UFZA 3A4MA 3PSHA 3L4JA 2WYOA 1WR8A 4P4SB 4RPGA 2FWBA 3HCOA 3H1EA 1R8SA 1V92A 2AR9A 3HZZA 1NBME 3EZNA 4LF4M 5L9AA 4UJ3A 3NIGB 3NDBB 4F1WA 2XITA 1LPPA 4BQOA 3E9MA 4HBZA 4WL0A 3LPNA 2PZAA 2ZIXB 3INYA 1KE2A 2CD9A 2G1UA 2INGX 2ZJ8A 4KHPM 2PH7A 3HVIA 1SKBA 2A1TR 1OXSC 4PT5A 2Q9AA 1H42A 3F9IA 4RCYA 2Q4OA 5FSWA 1A8SA 5IJ0A 3E8XA 4W5OA 4I1PA 4Q00A 5JYCA 2ZUBA 2JDID 3NV7A 3R5XA 4M0WA 3N05A 1P1JA 2C88A 3B3AA 1PN3A 4I55A 2BFBB 4OKSA 3NBAA 4WOCA 2X76A 4DG8A 2LVOC 1II8A 2R62A 1QQBA 5JWOA 2WFLB 3BBZA 2H1LA 1DARA 3OE4A 1QF6A 3OPXA 7MHTA 3N28A 3GG2A 2QOEA 5EKDA 1OGJA 3G0IA 2IYTA 2XOKA 2QUZA 3AUTA 4LBZA 5BSWA 3WYNA 2I4OA 4A6PA 3G8CA 3D4NA 3CZ4A 4E4RA 4M1KA 3HJFA 5C8DA 5KVCA 3DZIA 2XUFA 4FFVA 5B58C 1QM5A 1ZI8A 3EEOA 1RBMA 1A9PA 4ENPA 3ZHYA 5FR1A 4PU0A 1OILA 3GLFA 4NNPA 4DLSA 1DWQA 5GTDA 2QD5A 2IT1A 4LWQA 3H83A 1OWLA 5DOZA 5D2CA 5U4XA 5DKFA 3I9LA 2PRYA 1A76A 3NASA 4IFIA 5DIZA 1PZFA 3LOPA 1ABEA 3ENQA 3MERA 3EEQA 5TT0A 2DFKB 4MB6A 1PJRA 2Z3XA 4KR7A 2UYYA 2DMRA 3MJRA 4ALKA 4FIZA 2FWNA 3DBRB 2F5SA 1QRDA 1VPVA 2NO0A 2UXCM 4IQGA 3IUBA 1ISSA 2X5JO 4QQFA 3LKVA 5B1IA 5CGQB 5GV7A 1IXZA 4R7ZA 1A5TA 4HC4A 1IY0A 1BMTA 4O4IB 4DKXA 1W93A 1Z39A 4AJ2A 2XRZA 2FSVC 1MOQA 4K0KB 2B82A 3KHTA 4TLLB 2C8KA 5ILQA 1L7EA 3PC7A 1E1LA 4B6QA 4FYXA 4BFUA 2FPPB 1DHTA 3T3HA 3JQGB 2P4EA 4K28A 1QTRA 4TYMA 3RJ9A 3I1JA 4JMLA 4FW9A 1Q2UA 3BXFA 3SHWA 1UDWA 2W71A 4RV5A 2WQ6A 2OFPA 4E5SA 4XYEA 4RTNA 3EQ6A 4O4IF 3G88A 4BPRA 4AKEA 3X2FA 1PWZA 2VDVE 2OZVA 3VDMA 1IHXA 5ES3A 4AN1A 2G77B 4Z4QA 1I7QB 1ZO8A 4IZOA 2E85A 3KVNA 3OLYA 5GY7A 4YCJA 2ETVA 2VDJA 4L0QA 3KT8A 2R68A 4X1YA 1RKQA 1RVDA 3JQQA 1VHQA 3AU8A 3EOAI 3SU8A 3IR6A 3G13A 4RGQA 3IEIA 4DT1B 1NHGA 4PQRA 3R4CA 4LX8A 1EX6A 5TIIA 3IHWA 2QRMA 3BGDA 3E82A 3ZWWA 2AZXA 4NS1A 2PQ2A 3H17A 3K92A 1XZHA 1W5BA 3ETEA 2B0JA 2R8ZA 2J0SA 1RC1A 2BRUC 4IDQA 2JEOA 3FGOA 2GBPA 3OJOA 4J0GA 4F2DA 4P3YA 1YRWA 4FXPA 1K6JA 5BNTA 3NAGA 2XMCA 2VDNB 5FO1A 2VDQB 3L8MA 1L5RA 1SG9A 1KETA 4X1OA 3RIMA 3ICQB 1QDEA 4NMXB 1RLIA 2R60A 4G0OA 3E35A 4PSUA 3VU3A 4WKGA 1B26A 2WKSA 3RBXA 5AH0A 1XDSA 3FRIA 3UJ8A 1KYYA 5HW0A 1QKKA 3PQ4A 1IDN1 3K2BA 1T2CA 3MFYA 4JA2A 2JJMA 3V80A 3N9IA 3K3PA 2P2SA 3W2TA 5JD4A 1QF9A 1NV8A 2FPWA 3PPIA 2O2ZA 4RTRA 4Y6GB 3VTZA 1QIEA 3PNYA 1ENYA 2PGNA 4J7XA 2GBGA 1Y8RA 5AM1A 4D98A 1NLZA 4I4NA 3RWOA 1G5IA 2ZIAA 2R48A 2AJBA 3QOFA 4Z9AA 1HBJA 3NQ41 1EXMA 2JI4A 1ENOA 5EE5B 2YXEA 2JLWA 4QU0A 4JLMA 2IYVA 3ETDA 1Q0TA 4M4SA 3KS8A 4OFWA 1UMCA 1NONA 2VRNA 4NLLA 2RH4A 4RSRA 4UARA 1NSFA 2BGWA 3DMNA 2PMWB 3COPA 4H59A 4D4KA 1AQIA 4MITA 4G07A 4D9KA 1YV9A 2DH6A 2YWGA 3C6XA 3RADC 3IAXA 3V1YA 1HYHA 4G09A 2I6XA 4Z6YA 1T9AA 3MGKA 1U2EA 3D3EA 4LOKA 1II0A 2QRVB 2VWHA 4ZAYA 4XFJA 1FVFA 3MYYA 3FMPB 1A98A 1RPZA 4LQLA 1TYDE 3TVDA 3ND7A 4GOXA 2BJVA 4WCDA 5JCOA 2X22A 1JJAA 2PIAA 1J07A 2KWIA 1O54A 4I8DA 1GG9A 1OH5A 1NFRA 2XWSA 4LYAA 5DLQC 3CPJB 2H1RA 3ZV6A 3B89A 2EW1A 4NE9A 5B64A 4OG2A 1G9XA 4KPFC 1KDRA 4N39A 3CX7A 3TF5A 2XQJA 1F8XA 2D4AA 3JZIA 1AA6A 4P34A 5JRDS 2NXJA 1XRMA 1X42A 4Y2GA 1KEZA 4UTZA 3LG2A 3MJDA 3LVRE 3SLKA 1RC8A 2O52A 1X9GA 1Z2PX 3OQJA 3RSZA 1ZBQA 2FCAA 2ZRBA 5JD6A 5FBVB 3DQZA 3OPVA 5F77A 5K8IA 2IUFA 1EK6A 4O25A 3CZAA 4P7FA 4DQUA 1WIWA 4JDPA 1FQWA 1SD1A 2WLTA 1GG2A 3ABIA 3WHKA 2PUTA 2I4LA 1X70A 4DYVA 1EHIA 4E09A 5LMNB 4ENQA 4YRNA 5HF5A 3KQUA 4WLUA 1WNTA 3FRJA 2E7ZA 2GXUA 1IBKM 1QXSA 2DAPA 1I13A 4UTRA 2W6JA 1DFHA 1K89A 1XPJA 4LXUA 3MCTA 3AXSA 2OAEA 4E12A 2R1ZA 1NW7A 3ZDCA 1HA3A 1RWWA 1KH2A 2QX4A 3ME5A 1XJ0A 3DMFA 1Q0LA 1Z29A 1ZVKA 3DBVO 4YQEA 3W8DA 2WHXA 1TMGE 2CGEA 4KXFB 1X1DA 1N0VC 2FWAA 2PS1A 1A1SA 2O0KA 5EL0A 3WWEA 2P0AA 1MABA 1Z38A 4WA7A 3U6SA 4JUFA 5GWXA 5DLDA 1Z9BA 2XYHA 2B4AA 1D2EA 4AI6A 4EG4A 3H2YA 1Q16A 2HEGA 1DUIA 4DR1M 4TSFA 4RIIA 1Z5CA 3IP7A 2E4UA 5LYJB 2OV8A 2X7JA 2C5EA 1XA0A 1DCFA 3DWIA 2EW8A 3JRWA 5K5EA 4EHLA 2CHGA 1LLFA 4RSGA 4WNIA 3C0KA 3QYFA 3JQFA 3URKA 1ARZA 1UJ5A 1I51A 4EMSA 3C87A 4F45A 3B7ZA 3AINA 4R8RA 3VHXB 1PLJA 4D0GA 1QIFA 4AKHA 1SVKA 1PW5A 5HGXA 2QUKA 2WABA 2ZBUA 3U7RA 1X9HA 3EJWA 4BO9A 3U13A 3LZ6A 5KOJA 4G0YA 3ICVA 5IBQA 3L18A 1Q22A 3BJEA 1IBMB 5BRAA 3D59A 5DX0A 2AOUA 2Z2XA 3K9BA 3M1AA 4J94A 3SAJA 1MV8A 4Q47A 4L5BA 2LE0A 5B3JC 3MD9A 2W0SA 4W8HA 5AVZA 3ML1A 1G291 5I01A 3U4QB 1XQYA 2JFFA 1P5ZB 3F3MA 3ZDFA 1PR2A 1LBTA 4HLNA 3TUIC 2AQHA 1N9KA 3N59A 4J3NA 2B7LA 3JWEA 2Z6QA 2JLQA 2ZYSA 3W6NA 4G5YA 2PVPA 3MG9A 1E9SA 2C3YA 4EB8A 1R0ZA 5I45A 4Q01A 3HR4A 1MIHA 3B1JA 1XZPA 5CTJA 3PUHA 3E8SA 1SXHA 1TK2A 1AGYA 3NTQA 4RPKA 2BTEA 3UV3A 3RU2A 1F1BA 1GAJA 4H3SA 1V6CA 3CRNA 2D5CA 4YUZA 3CH7A 2V6FA 3DOFA 4IYJA 4MEAA 3WLKX 1F4LA 3EUEA 2WIDA 4CMEA 4HDOB 2OGZA 4M7WA