2H1RA

Crystal structure of a dimethyladenosine transferase from plasmodium falciparum
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
275
structure length
271
Chain Sequence
HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWCTLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 94
structure length 271
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.480 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2h1rA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h1rA01
3OFJA 4E31A 5E1BA 4BLWA 5LR6A 1JSXA 5M5BA 5ICCA 2G72A 3UJ6A 3I5UA 2K4MA 3ORHA 5MHTA 3EVDA 2FYTA 3WSTA 3T7RA 5D1NA 2OYRA 3V97A 4R8SA 4X63A 5DTMA 3QV2A 5FHQA 3VC1A 2JHCA 2PX5A 5DPMA 4EKIA 5LQJA 5LQKA 2XVAA 3G7UA 5BP7A 1QZZA 1EJ0A 4V0RA 2ONYA 5EIWA 5EIFA 5K0NA 2P7IA 1YFLA 3A4TA 4RYLA 2PT6A 1R18A 2OB1A 1SQFA 2PSSA 3KPYA 5GOZA 3Q87B 1JR4A 1XVAA 2PY6A 3KQOA 5K09A 5CIYA 3C3PA 3M70A 1XJ5A 3TPZA 5EEHA 3TMAA 4RTOA 2CWWA 3M6VA 4RX1A 3FPFA 3KPJA 2P3OA 3BGVA 5LSAA 1NKVA 5LQCA 2EJTA 4IKPA 1YFJA 2NNWB 1WY7A 5DLYA 3U81A 5K0FA 2UYHA 5CVUA 1VQ1A 2CMGA 1XCJA 3GRRA 1X1AA 3CJQA 1JG4A 3GO4A 1TW2A 3I64A 3I9FA 5K0BA 5E8RA 3O4FA 1X1CA 2ZTHA 5BW5A 1UIRA 3GJYA 3FPEA 3GRUA 4ER3A 3DMFA 2PX4A 3VYWA 3I53A 3MAGA 3O7WA 4RTJA 3FUTA 2BH2A 5FTWA 5DXAA 2NP7A 1P1BA 3FRHA 1YZHA 3A7EA 3PX3A 2XYRA 1SVUA 2B78A 1RI2A 4PYLA 4HRAA 5EHGA 5F2NA 7MHTA 3G89A 2YUIA 1M0EA 1M6YA 3EMDA 1VL5A 3ER8A 2G8NA 3SSNA 2XVMA 4QPNA 5EOVA 4QVKA 2PLWA 3DTNA 4YMGA 4OQDA 1I1NA 5KYGA 1SKMA 3O31A 3P97A 4C08A 3KR9A 3R0QA 2XYQA 2HMYB 3UJBA 4BLUA 4GC9A 3FUXA 3SX0A 5K0EA 1IXKA 5LQNA 4QTUB 2BM9A 4CTJA 3HEMA 3BUSA 4YMHA 2JHPA 1TW3A 3QOXA 4BP1A 4ER0A 4UOEA 2OZVA 3MERA 3GRVA 3NJRA 4O29A 3FZGA 4IV0A 4QVGA 5CM2Z 1EAMA 5C0OE 4RVHA 5E9JA 4E2ZA 4ER5A 2AS0A 2AZTA 1XTPA 3HCFA 2ZZMA 5HEKA 2QRVB 1R74A 2ZVJA 4PCAA 5GIOE 5CCBA 1RI3A 2AN4A 5ICEA 2B2CA 1Q0SA 2AR0A 2GPYA 1FJXA 1NW3A 4GBED 3OZSA 2Z6UA 4GC5A 4LECA 3LDFA 2YX1A 3RODA 2GB4A 3A26A 2IFTA 3BWCA 3UJCA 3FTFA 3QOWA 4P7GA 1L3BA 1V39A 4MWZA 3DH0A 3TFWA 4FT2A 3RW9A 3UA4A 2P3QA 5LQUA 2IDJA 3NVKI 4F85A 4HTFA 1YB2A 3KQVA 3TKAA 1NW7A 5ICGA 3T0IA 2YR0A 3UZUA 4P7JA 5C9ZA 5EPEA 2VDWA 5EHIA 2PV0A 3DOUA 2YXEA 1UFKA 4C03A 5EMMA 1TPYA 2P7HA 3HVIA 4WVLA 5DX1A 2ZZKA 3GCZA 4C4AA 4DMGA 5E1DA 1NE2A 2AOTB 1D2HA 3LBYA 4GOND 4QPPA 3DMGA 4E70A 4EVIA 4X1OA 4DCMA 1BHJA 1N7JA 5E9QA 3I58A 4YUYA 5FWDA 3R6TA 5DT2A 1AQIA 4BY9E 4RWZA 3G8AA 3P8ZA 1U2ZA 4E2YA 5FQNA 1OR8A 2P41A 1KR5A 3GXOA 1WXWA 3EGIA 4FT4A 2GA9A 4E33A 5EMLA 4YUXA 3FYDA 5E2AA 3G5LA 4FR0A 1D2GA 1M6EX 1N7IA 2BZGA 2O06A 3MGGA 4RTRA 4RTNA 4Z2YA 4QDKA 3K0BA 3LDGA 3HTXA 4A6EA 3SM3A 3UJDA 1INLA 3E7PA 2O07A 5EKUA 3C6MA 4H0NA 4AUKA 4CTKA 4KIGA 3IYLW 5BXYA 3HP7A 4MIKA 2O05A 3AJDA 4NECA 2ZLBA 3S68A 1JTEA 2IH5A 3ELDA 3NDIA 3LKDA 5GIPE 1PRYA 4OA8A 3EVGA 3HA5A 3NWEA 3PT9A 5E2BA 4OX9Y 2I6GA 3KKZA 4R8RA 4CKBA 3BWMA 1ZHFA 3SVZA 1FBNA 3KHKA 3KQSA 1YF3A 3LPMA 5EKXA 2Z6QA 5K8VA 2JH9A 1BOOA 3CJRA 3KQPA 3P2EA 5FADA 2OB2A 5CVVA 3TOSA 2IBSA 4DQ0A 5DTRA 3EVAA 2EJUA 2JG3A 1KPHA 1X1BA 3HCCA 9MHTA 4X41A 2FPOA 2AOVA 4PGGA 3L8DA 5GM2A 5DM0A 1NV9A 3PVCA 1EG2A 2O0LA 5F2OA 5FWAA 1WXXA 4YUWA 5CCXA 4PYOA 1KYZA 1Q0TA 3FTEA 4GOOD 5CVDA 3ERCA 4FZVA 3HA3A 3A25A 2ZULA 3MCTA 3VSEA 2VP3A 2EFJA 5KS2A 4PIMA 4EK9A 2DPMA 2QY6A 3BWBA 3R24A 2BR4A 2P35A 2YTZA 2BR3A 3B3FA 3CKKA 3CVOA 3D2LA 3HCDA 4PWYA 4U7PB 3M6WA 3BXOA 4C07A 2H1RA 5JUWA 1JG2A 5EQJB 5K01A 1G6Q1 3LDUA 3P9NA 2C7OA 4OQEA 2UYQA 3KR2A 4HC4A 1EIZA 2F8LA 2PX2A 5DXJA 2P3LA 3HVKA 4F86A 3OCJA 3NMUF 2JHAA 1EJ6A 3AXSA 1VP3A 2ZWVA 3HNRA 4RTQA 2B3TA 2ZBQA 1RJEA 3UJ7A 4R6XA 2PWYA 3ANXA 5T64A 3TR6A 5HIJA 4QTTB 2E5WA 4QQNA 3KR1A 5HZMA 10MHA 2B9EA 1T43A 5DX8A 4RTPA 4DM3A 4DA4A 3E23A 5KQRA 4KW7A 5E9WA 3EVBA 3SGLA 1KYWA 2QM3A 4RVDA 5T67A 4YV2A 2Y1WA 4YUVA 1H1DA 3EGEA 3EEOA 1NW6A 2AN3A 2DULA 4DZRA 3BKWA 2CL5A 3EPPA 3BT7A 4AZWA 1HMYA 1R6AA 1KHHA 4QDJA 2ZWAA 4IWNA 5E1MA 4EQZA 3H2BA 3TKYA 5K0GA 3GDHA 3B7PA 3LHDA 3LL7A 4CKCA 4PONA 2OBFA 4IV8A 2LD4A 3M6XA 5DTQA 4LWOA 4RTSA 4DCGA 2B25A 2WK1A 2ZW9A 3B3JA 5K0JA 1SUSA 5GWXA 5H02A 1KIAA 5FCDA 5FUBA 5FHRA 2NP6A 1IM8A 2YQZA 1PJZA 4U7TB 4CWAA 1VIDA 4ISCA 1WG8A 3KPWA 3OFKA 4BLVA 1RI1A 3F4KA 2ZIGA 3PFGA 5K05A 4FS8A 3ER9A 2P8JA 4M37A 4P58A 3UBTA 1DCTA 1G38A 2G1PA 1XCLA 3HCAA 5FULA 4AZTA 2ZBRA 2NXNA 5G02A 2GLUA 3SR4A 4HGZA 3M33A 1UWVA 3DUWA 5ICFA 5GINE 4PYQA 3ELWA 1ORIA 3OU2A 1D2CA 2NXJA 3FPGA 3MB5A 1VE3A 2HTEA 3P71T 3P9CA 4DKJA 2H11A 4HGYA 1RJGA 3DXZA 3IHTA 5CUQA 2C7QA 4EKGA 3E05A 1SUIA 4OBXA 5DSXA 1KP9A 3IEIA 5EMKA 2WA1A 1ZQ9A 2IIPA 5LQRA 1R8XA 2NXEA 1SG9A 1YUBA 2UZ4A 2PXXA 2IBTA 2ZBPA 1RJDA 2HNKA 2ORED 2BM8A 3G88A 4KVZA 1JSZA 2OY0A 3E8SA 3SMQA 2AN5A 2QRVA 3LBFA 5IH3A 3NDJA 4PYNA 2G71A 3DULA 3KQQA 4MHTA 4E2WA 4BP3A 1RJFA 3MHTA 3C6KA 4Y30A 3EVEA 2QYOA 3M4XA 5DWQA 1ZGJA 3LSTA 1O54A 5EEGA 4ER6A 1JG1A 3FTDA 1RI4A 2VZ9A 4KDRA 3FPJA 2HV9A 4R6WA 4QQKA 2G70A 5HIIA 1I9GA 2BR5A 4P7FA 3IV6A 1AQJA 3PX2A 3ME5A 3UJAA 2AOWA 2YVLA 2PXCA 5BW4A 3DXYA 3AWIA 3FUVA 3Q7EA 3T7TA 1O9HA 4YV0A 3GRYA 3OE4A 2IH4A 4K6MA 4A6DA 2P1DA 3DLIA 2ESRA 3G5TA 1NT2A 5DSTA 4GF5A 2P40A 3UJ9A 2PX8A 1VBFA 2R3SA 5C1IA 3R9XB 2AOUA 2CKDA 1NV8A 4CXMA 4C05A 2ZSUA 3JWHA 3KPVA 3LCVB 1JG3A 3JWJA 2AOTA 1R8YA 3HA7A 1P91A 2OKCA 5DRYA 1QAOA 2HR1A 4M36A 4KRGA 3FUWA 4MTLA 2CMHA 5HFJA 2Y1XA 4HG2A 5E8JA 3GRZA 4OA5A 3DXXA 3LECA 3G2PA 3B5IA 4GEKA 2UYOA 4PINA 1NBIA 2OXTA 4RTKA 1MHTA 5DM2A 4P7KA 3TLJA 2EX4A 3G2OA 5EZSA 2PGXA 3FPHA 1JQEA 5DM1A 1VPTA 5HIKA 4RTMA 3K6RA 3JWGA 5DRTA 5DM4A 2N47A 4ATNA 3FUUA 5JR3A 1DL5A 2R6ZA 1VP9A 4X61A 3GIWA 1ORHA 3CGGA 5EC8A 2FK8A 3MTIA 1L3IA 2V74B 5T6BA 1X19A 3B89A 3DR5A 3RIEA 1I4WA 4M7RA 1XDUA 2VDUE 5K03A 3LCUA 4KIFA 2GH1A 4OBWA 3OU7A 4GQBA 5KVAA 5CVEA 3ELYA 1MJFA 3UFBA 3KQWA 3R3HA 3PB3A 2EG5A 3MTEA 3DP7A 2ONZA 5FA8A 2KW5A 5GP1A 1XDSA 4ZTBA 4XCXA 5B1SA 3CJTA 4R05A 3G2QA 1QYRA 3LCCA 4FGZA 3PS9A 4Y2HA 3KQMA 4M38A 4EMSA 1G55A 3HCEA 3NTVA 2XBMA 3EVCA 2VS1A 5F2KA 3OPNA 4RTLA 3A27A 3CCFA 2Q41A 1L1EA 1HNNA 2IP2A 1QANA 3EVZA 3P2KA 4PYMA 1Z3CA 3GU3A 3P9KA 2NYUA 4AZSA 3CBGA 4HSGA 4YUZA 3DLCA 2AVDA 5FA5A 3G2MA 1QAQA 3C3YA 4DF3A 2FK7A 3DMHA 5U4XA 4PNEA 2V7EA 2PT9A 4LG1A 4LWPA 3ID6C 1ZGAA 4CKEA 1EQAA 2GS9A 4PYIA 2UYCA 5CD1A 3TRKA 4E32A 4HTFB 3UJ8A 4AZVA 2XYVA 4YV1A 4WXHA 1JTFA 2PXAA 3KU1A 4PYJA 2WA2A 3KPUA 5EMJA 4AX8A 1NW5A 5LQAA 2PBFA 2Z6AA 1R00A 1X1DA 4JXJA 4FP9A 3REOA 1NW8A 3HCBA 4RVFA 2H00A 2NXCA 1AF7A 3AY0A 2FRXA 1XDZA 2YXLA 1QAMA 3PFHA 4KDCA 3M6UA 5K0LA 3B3GA 3OZTA 3SXJA 3KR0A 4XUDA 5CVJA 5KQSA 1IY9A 3AXTA 4RSRA 5D1HA 1JQDA 3MQ2A 1DUSA 3UWPA 4F84A 8MHTA 1FP2A 1WS6A 4FSDA 5IKMA 4HH4A 1B42A 3THRA 2ZCJA 2I62A 3KQTA 3SSMA 3G8BA 2A14A 3GGDA 3BZBA 1SQGA 5HOQA 1FPQA 4RVGA 2AVNA 1P39A 2IDKA 3C0KA 3OZRA 3UA3A 2C7PA 2OPBA 4ER7A 1G8SA 3MCZA 3EGVA 4L7VA 4V0QA 4XUCA 3PTAA 3EMBA 2ZIFA 4RV9A 5HIMA 2AOXA 1FP1D 2IH2A 5HILA 3FTCA 3FRIA 5EZQA 2ERCA 2HWKA 4GUAA 1KPGA 4X60A 4G56A 5EGSA 3T7SA 1YZ3A 2PVCA 3FYCA 1BKYA 3THSA 1RI5A 4B17A 5DX0A 4XUEA 4E2XA 1VLMA 5K0CA 5GM1A 1ZKDA 3P9IA 3GNLA 1Y8CA 3NW9A 3CC8A 1BC5A 2GAFA 2VDVE 1AV6A 1F38A 4MQ4A 1NBHA 4GOMD 5EVJA 1P1CA 2JJQA 5EG5A 2YXDA 1KXZA 2AOUB 2PKWA 3OU6A 5FQOA 2JH8A 4C06A 3EVFA 3BKXA 3V8VA 3HVHA 2QE6A 3PLAE 2ZFUA 4C04A 4KWCA 2FCAA 3SSOA 1N2XA 3NWBA 3TM5A 2ADMA 3BWYA 1KPIA 3KQYA 3HVJA 3JWIA 5P8WA 1G60A 5ERGB 4PCLA 3A7DA 2IGTA 1JQ3A 2ZZNA 1G8AA 3LGAA 3P2IA 5E1OA 3BGDA 3LX6A 2PWPA 2FHPA 3VC2A 3HM2A 1ZG3A 1F3LA 3ELUA 4GOLD 2PJDA 1L9KA 4POOA 3OE5A 2C7RA 3NVMB 4PGHA 2O57A 2ZIEA 4FSXA 3X0DA 1O9GA 3TQSA 3LKZA 3BGIA 3EEYA 3GWZA 4E30A 2I7CA 2I9KA 1L3CA 1WZNA 4PIPA 2OO3A 4PYKA 2IPXA 1XXLA 3TM4A
chains in the Genus database with same CATH superfamily
4E31A 4P81A 2HMVA 3O4HA 1YE8A 1EJBA 2FN7A 3WAGA 1O6BA 1I6KA 4DIBA 3CX8A 1J2YA 1V7ZA 3WC4A 4MUEA 4N3NA 5JAUA 1MGPA 4QLOA 5HIAA 2XB2A 1UXJA 4WINA 1D4ZA 1FCJA 2PE5A 1CJTC 3QNUA 3IJRA 3DMFA 5F52A 4CLDA 2YIMA 3K09A 3BCSA 4EBBA 2DJ5A 2ZJZA 4C3VA 2QG6A 3TVTA 2EIHA 4RMNA 5G0VA 2SKEA 1XE3A 1ZUNB 2ZYUX 3HY4A 2NZWA 2B1JA 3RC3A 4RIGA 2VP5A 3SMSA 3W5HA 4L3VA 3LDFA 1IWPB 1ZOIA 5ADWA 3JD1A 2VJMA 4RA6A 2DBRA 4LMRA 3T0IA 3IEVA 3FZNA 2B21A 2E1PA 2HZBA 2G3YA 2K9DA 2VT3A 5IDQA 4ARUA 3BA6A 4MWDA 1Y8RA 4NCBA 3G5MA 4F6RB 1W59A 2IU6A 3X2FA 4U5QA 4RZHA 2QR3A 3B78A 5HBRA 3ENNA 4FHZA 2QTZA 3NDIA 4X0EA 4CMGA 5GIPE 1YL6A 3ZXSA 3T5GA 4PQEA 3SFTA 4A2QA 2W22A 2O6HA 1M10A 2G5CA 1R5BA 1L8XA 4NNPA 3VPGA 1I14A 3A9RA 1IUPA 4MUYA 3EDRA 3AVTA 5D7BA 1IZ8A 3I5MA 1U8YA 3AHEA 4N5IX 4JVLA 1O87A 2CLEB 3OTOM 1P3JA 3ZQJA 1EYZA 2Q9AA 3TEFA 4NBVA 5ES3A 4OM8A 2NX2A 3TAHA 1WD7A 1IBLB 4K81B 1N25A 1TE2A 4D1YA 3RJ5A 4LWZA 2X8AA 3NIBA 2QDKA 3CH4B 3CINA 1HOXA 3JQ9A 1U2SA 2P6OA 3GPDG 3BJMA 3D4OA 1E9SA 4MAAA 2QGZA 1DEXA 3RIHA 2PX3A 3SYTA 3JYPA 3ZHUA 4AX4A 2RGDA 5HQTA 3BWDD 4ARZA 1QBKC 5IZ4A 2VHYA 3NT2A 5AK6A 5JDIA 1M2WA 3G88A 3WADA 2RHMA 5KYUB 1B0ZA 4DV1B 3ORSA 1W2WB 3J81S 1CDEA 4IIVA 2HIAA 4IF4A 5JD4A 2FEMA 3X2SA 1U7DA 2TRSB 2JGDA 4CLOB 3G2NA 5J5CA 3RSZA 3ZI0A 3SQMA 3KB8A 1X7XA 1M2OB 1IG0A 4XTRA 2RARA 2V7PA 1T3SA 1EFCA 4KKVA 3OTWA 3FMIA 2FRVA 3NUQA 5HGXA 4ND5A 1YQUA 2EG5A 3LC2O 1IIBA 1AS0A 2BGWA 3H05A 2OQIA 4GM0A 4YCSA 5BWBA 4UXJA 4B82A 1P4HA 3NU1A 2I1WA 2XCSB 3EW9A 4LK2A 2QD5A 1RKUA 2GAOA 4M0EA 2QVGA 1P4AA 3FJ1A 1HLDA 3GUVA 3ZLBA 2WVAA 1GQOA 2F4VB 4M21A 3GJTA 4MLDA 3VTKA 1RWPA 1Z8NA 3KAKA 1Y89A 5FL7A 3G8BA 3R8XA 2NWQA 1VM6A 3EXFA 3VMMA 4Z1MD 3SS7X 1KORA 1LRKA 3VZPA 1QWSA 4CT5A 1GJSA 1QDTA 1Z4KA 2FG5A 2B4AA 4M0LA 5JSHA 5ERGB 1OLXA 2NU9B 2NSYA 2R86A 3HFSA 3NVMB 1F9EA 4E30A 3HDYA 4IG9A 3B51X 4A10A 1CUDA 1BDHA 1IMOA 4YJGB 1T5TA 2OV6A 4LN1A 4O02B 3CNNA 1HG0A 3KPYA 1HLPA 2XGGA 3VDQA 2CWWA 4XRGA 1NI4B 4IKPA 4HX9A 2JJ1D 1I94B 4XGRA 2OR3A 2P77A 4HWOA 2CUZA 4YY3M 3B5JA 1ZDMA 1YZHA 2XYRA 2V6GA 3ZCXA 4WY8A 1YR1A 3IO5A 3HV0A 1CQWA 2ZVDA 3PFKA 4DUGD 4DYDA 1PW5A 5CTAA 4MRNA 3RANA 4DQVA 2ZSAA 3IHLA 4IIWA 2FEWB 2H5IA 1NASA 2XFSA 2QRPA 4CIAA 5EMMA 1BJKA 3WLTA 2RGHA 1GP2A 2C84A 4WGGA 5JU6A 5T8KC 2CXPA 2C4VA 1FUYB 3SIWA 2GTIA 1B15A 2GJKA 1PS0A 2WZDA 1Y5IA 1J1ZA 1U2QA 5KHOC 5I48A 1PG0A 3VZSA 1X3LA 1TA0A 4ETNA 4CF5A 2Z6QA 2XZLA 3BC1A 3RFCA 2GO1A 2W7TA 3K35A 4LF7B 3VDXA 4NBTA 2VF4X 1EWKA 2XY4A 1OTXA 5KSPA 5CJPA 1NURA 4QDUA 2IIQA 4BIIA 3OZEA 1AN9A 3DZHA 5I9BA 2WV7A 4B3FX 4ZAGA 4XH9B 5DEOA 5LMCA 2QRQA 5HZMA 2PRYA 4F6LA 2CUTA 2PMFA 2QMOA 1YK0A 4ALNA 2BCGY 2AN3A 4D42A 3B9BA 2X8LA 5AW7A 4DJFC 1VIDA 1GLVA 2YZGA 1SC6A 1Z34A 3EFBA 4QTYA 2HBZA 3ZLUA 4JKOA 2OORA 5KREA 4TXJA 4TMTA 2D5CA 2NSJA 2VRCA 2DWCA 4PDGA 1C4XA 1JN0A 1L7EA 1AKRA 1E7RA 2QL5A 3HN6A 2O8BB 5LB4A 4DWJA 2YVKA 3E7FA 2V6ZM 4J0FA 3ROPA 1J24A 2I66A 4TMVA 5DMXA 1J2UA 1GGVA 4YP1A 2JI9A 4XCVA 1V5GA 2XQJA 5L53A 5TDHA 3NGMA 2QPOA 3SY8A 3FOWA 1YVDA 3GIWA 2DGDA 4D9GA 4ZI2A 3MSXA 4GI2A 3L82B 1E3JA 2DQZA 2Y99A 4W7IA 3TNDA 4Y6SA 3T5AA 3L4BC 2DX7A 4EJ6A 3C14C 3DHYA 1BQ4A 4CM4A 2EP7A 1LQUA 2RHOA 2IP2A 2Z0MA 5DGHA 2QOEA 3WLFA 4LNUB 1CZUA 2WM9B 3UUFA 3EXHA 3LYHA 4WEOA 4EA7A 3PVSA 3WXBA 3LQ2A 3PXEA 2A84A 3C3DA 5TIIA 4W5JA 3MLAA 4RUKA 5K0LA 5BN3B 2GZ1A 1C1KA 2VXOA 3PL1A 4S1WA 4I7EA 3CRW1 3TDMA 3NNDA 4KUGA 5CDTA 4R16A 3JARA 2GBIA 3MWEA 1H9AA 2FZ4A 3I6IA 3HKEB 2Q3JA 4ZAXA 4D0RA 4FOTA 2BGRA 3CR7A 2EF0A 1BH2A 1KE1A 3EFOA 4KWTA 4MPRA 2Y0DA 4Y9SA 3KSBC 3LLSA 4IOJA 4F2PA 3QG5A 1TQ8A 3FD9A 4ZMRA 1ZXXA 4GX0A 4XGNA 4OG2A 4RDXA 4EUNA 4Q9KA 3PG5A 4TTTS 1VHWA 3R5KA 1S8AA 4FHDA 4QU5A 2YS7A 4AF6A 2X4LA 3WS7A 2SKCA 5KYKA 1Z2DA 4X20A 1T2UA 3M6IA 3K9HA 3O4FA 4ZKEA 3ICWA 3VH4A 4OQFA 3KJZA 3PFBA 5A3QA 3PX3A 3QWHA 5CIQA 2PBLA 1KP3A 1N36M 5KYGA 4L5AA 3GPPA 3D6TB 3S0JA 1GAWA 4LYGA 4N5HX 3TTYA 2RONA 4YJHB 3P0HA 3TRJA 4F3CA 1OXSC 4BC1A 2IDZA 2Q4DA 3ZUGA 2CEAA 5CA1B 2IDJA 1W48A 1W581 1EZZA 4RKQA 1H8ED 2O8EA 3CCCA 2O0KA 3UMBA 2O2DA 4EEZA 1W73A 3NBYC 5DP2A 1GNSA 5ALSA 2C0PA 3FVQA 3IJEB 4B43A 2OXFA 4QHTA 3RF6A 4NXMM 3SNKA 1MQAA 3ZHVA 4DSUA 1EP2B 1M54A 2RGXA 2BFDA 4DCTA 2HJWA 3ZBTA 3QUSA 3KJEA 4MR9B 2J0EA 3F90A 1SEPA 3PPVA 2VJDA 3SXUB 3ZHRA 4ASUA 3A37A 2XZFA 3MC1A 2O20A 4DMMA 1XRPA 2G4VA 2ECKA 1O2DA 1XRQA 1YJAA 2WHPB 3SS9X 2VQFM 3TXAA 4IM7A 3EJ6A 1NLUA 4OHBA 2FMUA 1YDFA 2FP3A 1DQNA 3A11A 4Y6OA 2XHEA 4KK3A 2PKCA 3JAWA 1CUWA 2CXSA 3EF1A 4NAHA 4NBWA 4DV3B 4LKOA 3AR3A 1QE3A 2IEGA 1RWNA 1P4RA 3PR1A 1H4VB 3VHXB 2C4TA 1WE2A 4BNYA 2NXJA 2AYXA 5JAPA 4ND4A 1JR3E 4OHMA 1IOLA 2ASEA 5AM5A 3KKPA 3TIGA 4WPGA 3IAFA 3VJMA 3LQ4A 5HP4A 3FWHA 4ZEOA 4NJEA 2L17A 4E4TA 4PLGA 1J4AA 4PICA 5EIOA 3C8ZA 1LI4A 1N7GA 2YHSA 1HFKA 3ZVNA 1CNEA 1H2FA 4H1TA 3AR5A 5CGQB 5DSTA 1AZSC 1W7AA 3KB6A 5ALWA 4QJ4A 2JK0A 1TJ3A 4KPEC 1E8NA 4BNUA 1N9GA 5AM2A 4Z49A 4ZQFA 3JZIA 4RJ2A 5HJ7A 1G8MA 3EVTA 4C21A 5K6AC 2UUAB 2SNIE 4RL4A 1YKSA 2VHUA 1LZLA 4IRXA 2OQ4A 1H94A 1H2EA 5F21A 2P1ZA 4I66A 2W2OA 4FGZA 4NZMA 5DK4A 1F17A 4GI1A 4IH1A 2QM7A 4EMTA 3HYNA 3E81A 4ZODA 1V41E 4KI7A 2Q8QA 2J45A 3U6MA 3SZGA 4TSFA 2Q50A 3S5UA 4QHYA 4JUCA 5KOJB 4G0MA 4PXSA 3WKCA 1O6ZA 3JQ7B 3UFXA 4JYPA 4G5HA 5IKMA 4RYDA 1HSZA 3DE7X 2IC5A 3KXEC 1XHEA 2O6LA 4LKRA 2FMHA 2V6JA 3EQ2A 4ZCQA 3D8UA 1X13A 2PSFA 3H0EA 4X7RA 2AEFA 4FGLA 2WWFA 1BC5A 4I46A 3BMNB 2FY8A 3ZV3A 1TM3E 2AHMA 1OAOC 4A8JA 1XXHE 1Z6GA 3RS0A 3T35A 1G20E 1JB1A 3A7DA 4BASA 4CUKA 2IP4A 1IHYA 2XECA 2AQHA 3B6KA 1HT0A 3D2AA 6NULA 2QN1A 1YB5A 4BNDA 5M5BA 5AQ1A 3K70B 1RHMA 1ZK1A 4CM9A 4B8ZA 1WHTA 1E3DA 3QWLA 3DEYX 5BP7A 3VOAA 4OIFA 4C0LA 1AX9A 4Q1CA 3BPSA 4BZZA 1G4AE 1ESNA 3ECSA 5GOZA 2WF7A 5K3OA 1U98A 4OSEA 2HOQA 3HO8A 2H4JA 1IM2A 5EP4A 1I1QB 2XCOA 4DE5A 4OHVA 3TTXA 2ZTHA 1EHIA 4FBGA 5CM8B 2CLLB 3JQAB 2B78A 3GGCA 3WWPA 4FXPA 3Q4GA 2X41A 3HXTA 4R40A 3LUKA 1E58A 1CUCA 3HEMA 2CF5A 4I1RA 1OX4A 2UXDM 4Z0PA 4Y2SA 2AN4A 2VYFA 3O3CA 3V7NA 2WM8A 1T5LA 5TB5A 1V5WA 2FLWA 2X5JO 1F12A 2A9KA 1Z0UA 5ED0A 1RHRA 4WIAA 5F3WB 5E9QA 1ECLA 4RAOA 5LZ2A 1N4AA 1MAUA 3ZEAA 2W48A 3DL0A 4L22A 2REXB 2MJLA 2RAFA 4LRTA 4PHTA 1QKIA 2HGZA 5JIBA 721PA 2TMGA 3WMWA 4JI8B 3ZJUA 5LMNB 3DZGA 2J31A 4BLPA 1DAFA 2AQ8A 1L8OA 4LW8A 1I30A 3RI3A 4G36A 1G3RA 2JFWA 3HJQA 3I83A 1DKPA 2B6NA 4G5FA 4O4JB 1BGXT 1UFOA 4JN6A 2HQSA 4OP2A 2HMWA 3QKIA 3WYAA 3O3MB 1WQ4A 2WB2A 1ZVJA 1N7HA 5JMWA 2BFAA 4LZOA 3NEPX 4R9RA 3V3TA 1Q1GA 4LYAA 3F8SA 1SG6A 3NBMA 3PNMA 3ZNOA 1C1HA 1P0IA 2GHRA 3V4SA 1T2NA 2GJ8A 4QDJA 2XTNA 3KS9A 4H1VA 2IQIA 4LCJA 1NDUA 4G1BA 3BJRA 4X91A 2W98A 1F8GA 4C4PA 2YOHA 1NZFA 4CWAA 3F47A 1DTWB 1JPJA 1PJ2A 1PGYA 1PRBA 2X8BA 1K3FA 3P9CA 1YE3A 5DM60 3IESA 2QVCA 3O1LA 3ZIUA 1REQB 3LC7O 1OKKD 3H2ZA 3ZEIA 4UJ5A 3PQ3A 3BGWA 1E6LA 3RB8A 1P5HA 4MHTA 2OPHA 3RK4A 1Z6AA 2K0BX 5CNIA 4L78A 1BWPA 3U26A 3GBSA 5BN5A 2HSWA 4BQNA 3RS2A 4K6MA 4GICA 2AOUA 4CXMA 1FVFA 1AUPA 4GLLA 1WRBA 4RF5A 1V92A 1DGBA 2C2KA 3EZ9A 1YIDA 4CDGA 2Q5JA 3QIVA 4Y98A 1ONPA 4K6GA 2O1EA 1Q0ZA 2XKAA 4OYYA 1MZPA 2V74B 4S12A 4DLXA 1JQLB 5SY6A 3JYQA 4EG5A 1XVUA 3G5AA 1M8KA 2WHXA 1U3UA 2OXRA 5D51S 3PX7A 4Q02A 1SA0B 3QX9A 4RD0A 5F3RA 2HHHM 4RMIA 3P9QA 4C0AC 1J8QA 2ON6A 4NPHA 1VMIA 5FJJA 4UBOA 2G9QA 5LD2C 1UZLA 2ZEJA 2Y9MB 5DULA 1TK9A 4LSZA 3HB5X 1NY6A 2JFUA 2QX4A 1IONA 2A5YB 1X42A 4AQYB 3SSMA 1IXYA 1Y8RB 2C7PA 2FKAA 1YZKA 4BYGA 4UE6A 3DFFA 2JIDA 4A2WA 3WLLA 2OOAA 2FETA 2WG2A 5KOIA 1PR2A 4NU5A 1MU0A 3LKBA 5P21A 3JU3A 4QXPA 1VIVA 1RM5A 2PWPA 4OP3A 1BRMA 3OPXA 1W30A 5AXCA 4YRJA 4PYKA 5BY2A 3STXA 5JI3E 2FWMX 1TYDE 2XVAA 2Q7XA 2FI1A 4LE0A 5CLJA 4HFJA 1KDPA 1XD9A 4IQ0A 2OQRA 4ZREA 2JVIA 5T5QA 1SVKA 3PQFA 3I01A 3PGMA 4INZA 4YUAA 4JWTA 5AI9A 2FEXA 3EMDA 1VL5A 2BMEA 4OQDA 2O2JA 1JNXX 3KR9A 4RCVA 4KHPM 4M9ZA 3LDHA 4R7GA 3BUSA 2BP7A 4XBOA 4JB0A 2HJHA 2Z8XA 2J32A 3MTBA 1Z4QA 4WI1A 3L9XA 1B74A 1UJ4A 1WM1A 2IUEA 4UAUA 1CUIA 1R12A 4UUOA 3ORYA 4AW4A 1LVGA 5CURA 4LDNA 3IQXA 5BW8A 2J3QA 4IJ6A 1TF5A 4QGGA 2P4UA 2WFLA 3B7ZA 2O8CA 2IEZA 1C0PA 5AW0A 1KWGA 1DIGA 2HF9A 2QRLA 3CT6A 2C94A 4L0CA 4IR7A 3CZAA 1U2ZA 4LGCA 2L42A 1KKLA 1H2XA 1X7XB 5CX1A 1X38A 2XE8A 3OPQA 5JS2A 1V5FA 1KI6A 2ATEA 3PF9A 1G16A 1U11A 1O89A 3WRWA 1YZVA 3T3GA 1AHIA 1FDUA 4KKXB 4YP0A 1E60A 5FFMA 3CBQA 1WQ1R 3BHNA 4TVSA 3RVBA 3WLHA 4KLNA 1S3IA 4FZ5A 3FN4A 1JG2A 2XF2A 3IO3A 1KJWA 1Z4LA 2NU7A 3PUKA 4ACAA 1P4GA 1G6HA 1PLKA 1QOPB 2Q2VA 3VU9A 2Y0PA 3F96A 2B9EA 2VUIB 2OUIA 3UT5B 3KEMA 1TO2E 1VLVA 4O5AA 2H18A 4LTMA 4RVDA 5KO3A 1RLJA 1NOJA 3QF4A 1YS1X 3RVOA 4AG3A 2BC9A 5GV8A 3BIFA 3VSAA 1PJZA 2X9QA 2GLTA 4Z9BA 4IBBA 2DLDA 5KO2A 3NHPA 5IDYA 1ZGCA 4MVJA 4BZXA 2C83A 1RIFA 2HU8A 3K9CA 3ELWA 1IEVA 4IDHA 1OI7A 3OI7A 1KY5A 2QM0A 3CZCA 1GU7A 4ZHQA 5C5EA 4EG6A 2DR2A 2WSSA 1SRQA 2C03A 4B46A 4AJ4A 4EELA 1NVDA 4LV6A 1KI1A 4WY2A 2QORA 1PFQA 2YVLA 1P3DA 1DQSA 4YLEA 3OOSA 3U5ZB 4IF6A 3PHJA 2BNKA 2IF2A 1CUYA 2YHIA 4CKXA 5GAJA 3BYZA 2H2WA 1FK8A 3H5WA 3DWIA 5C1OA 2R0IA 3VGJA 4JJFA 4EJSC 4AU1A 1MF7A 6LDHA 3H2SA 4Q03A 3H6KA 3IJPA 3LCUA 4OBWA 5KQ8A 1N9ZA 1ZI6A 4D3XA 1TT7A 3MRVA 5I7AA 2P75A 4Y2JA 3F5FA 3RVDA 4EG0A 4CM7A 2I4TA 3WYNA 2I3GA 4NXNM 1E6WA 2P9ZA 4URZR 3W9YA 4ZAYA 5CD9A 2O0JA 3OJFA 4G4IA 1SQGA 3I6QA 2D00A 3S3TA 1XEAA 1U8ZA 3OCXA 2JCGA 3HBNA 3D2CA 1FFCA 1ULUA 2HQBA 3FKEA 2W70A 4K8OA 4XSHA 4IDFA 1P1CA 2NV6A 3G9XA 1RADA 1P8AA 2XEPA 4HNAA 4J4TA 4GGOA 3PDCA 3UOAB 1PM5A 1W4ZA 2DFKB 2IWHA 3R20A 1UK9A 1Y3CE 3WDSA 5MDHA 1WMBA 2JC3A 4QOJA 4N82A 2BWJA 1QONA 4ZU6X 2FR0A 1Q74A 3U4IA 2ZB8A 3RFWA 2UZ3A 4D4KA 2XCQA 2PX5A 2YHUA 4LRSB 2WSYB 3TDKA 4GO1A 3O4VA 3A4TA 4XIGS 3V8PA 2ZXUA 3H75A 3B6ZA 1RM0A 1BMFD 3KQOA 5DLQC 1UOOA 4WECA 2WWGA 2WSCF 3MG9A 3TQFA 1SIBE 1AH2A 1V9LA 3WV5A 4MJ7A 1GEGA 1MO5A 4H0CA 3U60A 5KSOA 1FUIA 4E5MA 5EHGA 1ZA1A 4XX0A 3VR6A 5KYVA 2W2QA 2Y8EA 5AJTA 1DC7A 1QWOA 3NJRA 4EDFA 2LTAA 4GHLA 4E2ZA 3MBOA 1YE9A 2W4MA 1U8CB 3KM0A 3FRJA 1DCKA 1XMXA 3K0CC 4W5QA 3K16A 4LFBB 1JI3A 4ZIRB 4MQBA 3EISA 3UA4A 4NQZA 1SVNA 1VLLA 1PR4A 3IXLA 2X77A 3REQA 2B34A 1PDWA 1KF0A 4QOZC 5CDFA 4GITA 3OZAA 4MWEA 1LDMA 1HR0M 2Z04A 2WU1A 1XQ6A 1WUTA 3U13A 1T9HA 4YIKA 2FE1A 2ZTVA 1V4BA 4CM4B 3QUBA 3K9GA 3OQHA 3AONB 3F6RA 2VP3A 3LOUA 1Y5LA 3KEFA 1TM1E 3IT3A 3EXHB 1D6JA 2PAFA 2J0VA 2GD2A 3T3DA 1HYEA 4RTQA 2X0NA 2VOEA 5FNVB 5KNLA 3QE9Y 4ZEXA 4QKQA 3ZIAA 1C3XA 2CNOA 1TD1A 3W06A 5ITTA 2TS1A 2HSJA 5LN1A 1PJJA 3JARB 1BAPA 1RRKA 3MWEB 1DDGA 5FPTA 1IC6A 3IE1A 3NHYA 4JB8A 4ISCA 5HZGA 3T0GA 4R98A 1NRJB 1OIWA 1NVAA 2OV2A 4MTCA 2ZJ0A 2FSGA 4URWR 1YA6A 3RWMB 3O9MA 1WGNA 1CJUC 4O4IF 3A6EA 3VR5H 4KFUA 5ENDA 3QLVA 1WU7A 4DV0M 4ER6A 3WGQA 3IV6A 5BO5A 3WWCA 3HJFA 1XCMA 1WVGA 4J76A 2Z5FA 3GFPA 4HTAA 1SBTA 3GRZA 2EFYA 3H2YA 4HDAA 1GZSA 2FS1A 3AL3A 4MCAA 2V4MA 1UXHA 2ZIVB 2H9AA 2Y20A 4BKRA 4QYIA 3ZE9A 1GY8A 1GGKA 4ZFNA 2HQOA 4DIDA 3LHFA 4KIFA 1M76A 2YZNA 3V6LA 1QHXA 3PZRA 3EFEA 5F1OA 1IWOA 4Z4FA 3PLNA 2XUOA 4MH0R 1QHNA 4EPYA 4PZ0A 5JEDA 4TWRA 1FUUA 1HE8B 3MTJA 1WPXA 3ABQB 5I9TA 1CDOA 2PT5A 5DT9A 4UASA 1VYTA 4G9EA 5EMNA 3V80A 4U4AA 4CQJA 3P9SA 1BGVA 1PV2A 3C16C 3UMMA 4I3HA 3RSLA 5TQJA 3IR5A 4BNNA 1WNTA 1Z0JA 1G8PA 1FFSA 3FTCA 2ZETA 1XDBA 4DA0A 3VPCA 1NPDA 1RDFA 2BFDB 1ZITA 5HR5A 1UBGA 3RFXA 1RHJA 2A92A 3OU6A 4EI7A 3TZEA 3C58A 4S1PA 1DCMA 4V2IA 4GMQA 3I4CA 1LLUA 3A6ZA 2YN2A 3FLEA 4HD8A 1DJOA 1OZ0A 3E1SA 5EJMA 1UWKA 3RVKA 1JKIA 1YIOA 2QUAA 4QYSA 4G4NA 2WICA 5CH5A 3AP1A 5LLSA 4RX1A 3WGVA 1XEWY 2W6IA 1F8UA 1JG4A 2M60A 2HAEA 3HSKA 5KTMA 1YL5A 5HJEA 1CNFA 4WJZA 4IJFA 2NP7A 4WFIA 2AUMA 3TW8A 3LK7A 2B4KA 1V1MA 1V33A 4CT0A 3TQQA 2Z5GA 5CYOA 1DJQA 4PLWA 3QOXA 4YRCA 4ER0A 4JV5B 3TZCA 2R0QC 1ZN8A 4ZDJA 5HM8A 4XQ9A 5TT1A 3W5VA 4QZVA 1NNLA 4NJEB 3WKAA 2IS6A 4AJOA 3OM9A 3TW6A 2D2VA 1THMA 1TYCA 2GBGA 5HKBA 3SLRA 2LIPA 3DE2X 1X7ZA 3F6CA 3GVHA 3LHKA 2C20A 5HBGA 2PLRA 2JLCA 1YI0A 4EVIA 5FOQA 1BHJA 4I1OA 3OJEA 2ZSDA 1M2EA 3PGKA 4BTEA 2Z2YA 3EGIA 2ZDHA 3EZ2A 1SXJA 1BXZA 3EH2A 3PNPA 2QTGA 3L7BA 2X5OA 5JVDB 1KZGB 5D87A 1AU9A 1P5ZB 5LJLA 2P2NA 3KOXE 3P2EA 4HNVA 1R0WA 2R7NA 4C4YA 2OSVA 4RZXA 3IEXA 4H27A 5F78A 3KOMA 2HA4A 3HB4X 4QQ8A 3D2LA 2DJIA 3NHZA 4YMUA 2XOKD 5JS8A 1ND6A 3HKDB 2JLSA 3ETEA 3OCJA 1ZWKA 4ME6A 3WIEA 1TD9A 3QYFA 4YRZA 3P4UA 5JCZA 3MEQA 4GI3A 5G1OA 1KVUA 1TAHA 3DDNA 5KYYB 3BILA 2OT3B 3EPPA 3FGPA 4XDHA 1OQYA 4FNOA 4Y28F 1VSUA 3LX8A 2YN0A 1C29B 3B7PA 2ZU0C 3CNHA 1W52X 4YDSA 1NVMB 4DCGA 4R01A 3SLGA 1ZI9A 1RVDA 4RULA 1M2NA 3R7AA 4TN5A 1Y81A 3DDSA 2HTEA 4WEQA 3DXZA 3A3NA 2LV8A 1P61B 4JS0A 4BNDB 3NFYA 2XNJA 1XU4A 4KXVA 1EHCA 4KO8A 1TCCA 3HYLA 1RM3A 5FBHA 3MHTA 1WHTB 1OQAA 4ZDKA 4QUEA 2QCUA 4OMFG 3BMOA 3ZWOA 1FL9A 3NIWA 1ICIA 3AP3A 3D3QA 3FUVA 3T7TA 2H2HA 1R6XA 3CPEA 3VBEA 5IABA 2IL1A 2B2XA 1P3Y1 3K8QA 1LLDA 1QH8A 4KYIB 3SD7A 1OY1A 3AI1A 1NIPA 3EUEA 1QP0A 4IDOA 1OI4A 5E3HA 1N0UA 4IS2A 1YRQA 1Q3TA 5HQ3A 4Q3DA 4QGAA 3BHJA 2IW1A 4ARIA 1QDUA 3IKJA 4PRLA 3UAZA 1CZOA 4LJKA 3PENA 5MN5A 4IOMA 1RYNA 5KKNB 4HQOA 3DP7A 3E1KA 1QF7A 4W9NA 4JUIA 2CGEA 3G0IA 4M8SA 3OPNA 3JQGB 2YH2A 5ITXA 3V2UA 2KDLA 1KYVA 2K7ZA 3BIJA 4IYJA 3SIRA 1L8LA 2DSTA 2UYCA 3GQBA 2WV9A 4UBMA 3ZI4A 1OXMA 1TRKA 1YMQA 5FUWA 4KQCA 3HJHA 3UUGA 1Y48E 2J5QA 4A15A 3RQIA 3V1MA 3V8MA 1G5HA 1YQXA 3IDSA 2YRWA 1A1SA 2JVKA 1C41A 1NGSA 3KS8A 1U5BA 3IBFA 4XLTA 1P44A 1D6NA 2P5TA 4GH5A 1UM9B 5C7OO 3FGNA 3D9QX 2J08A 4K5QA 2MTBA 2DVWB 2PL5A 5CK5A 4DOMA 2R96A 4CJXA 2Z8ZA 1NHGA 3HM2A 3SZ3A 2NQ8C 2ZIEA 1WZNA 5HMLA 1KY4A 4ZT3A 3P9YA 2XUKA 1ZMVA 2JDID 2G1JA 2WJGA 3PQ5A 1G5RA 2TMKA 3BCUA 2XTAA 4DMLA 4RTOA 4XD7D 2PUJA 4LRUA 4M86A 5TXGA 3KVOA 1KO8A 2ZE5A 1K9SA 2BE9A 1KS9A 1WTAA 1IBKM 2GN2A 1TUEA 4CEJB 3K0AA 4JI2M 3IUYA 1DOAA 3WRYA 1EGHA 1M5RA 4ND1A 4C7KA 4LJAA 4EB6A 4TYWA 1XSEA 4LV8B 4XR9A 2UZ1A 4YT4A 3R76A 1V3UA 1ARZA 3EZFA 2ZVJA 4F6CA 1O9BA 2HRBA 3EOZA 4EYOA 1EP3B 3QG1A 2JGIA 5BN5B 4W5RA 2E5LB 1UEXC 5AKHA 2WPDD 4YBZA 4J7CA 2W2XA 1X80A 4DN6A 3NHJA 4AL4A 1JBQA 2RGWA 1Q7TA 1QFZA 3UJHA 3LP8A 3UAYA 5EUQB 1C3OB 2SICE 5LP6F 1VKZA 4J2TA 1YB1A 4IPTA 3P1JA 5CB6A 2VHWA 3KOZE 1RXIA 4FD3A 3UCEA 4G5OA 1JHDA 4B6OA 1A2BA 2PU7A 3TRIA 4H0NA 2UU9B 2HGSA 3HLTA 2RD2A 1Z56C 3GFSA 1VE1A 1OAIA 1RE1A 4LXTA 1X37A 1KPHA 1Z5WA 3AY6A 2R44A 2P91A 3L43A 4E2YA 1ORRA 3AVYA 1UJCA 2Q9UA 3ZZ1A 2F3RA 1JR3D 4MGEA 5TQ2A 5IEBA 4HK4A 4TZ0A 1T5OA 4GZ3A 2GMWA 3FLMA 2VWHA 3DVLA 3UMJA 2B8JA 3AB8A 3SGLA 4OM7A 2GN1A 1E1QA 1XPJA 2CL5A 2J0QA 4ALLA 4BO1A 4DCOA 1PGPA 4K9NA 3B1ZA 4TTPA 4WKGA 1L2CA 4Y7DA 3X2EA 2VWPA 4DSNA 2NVOA 2P8JA 5ERXA 2ZBRA 2JRLA 4YJ2A 5H70A 1NR1A 3OFND 5JNSA 3FWKA 2IYFA 3IBCA 3QTTA 1W9MA 3G3EA 1IUKA 4MLCA 3AJRA 3O95A 4EYEA 3AVOA 4UEJA 4TTVA 3GY0A 5H3HA 1RQNA 1GVNB 3E8XA 1KDYA 1VL1A 2GJ4A 3ML1A 3NTQA 4OHOA 3IP3A 1JI0A 2VL7A 1R8YA 3RAGA 1Z0KA 2PGXA 5DNUA 4FGWA 1B0AA 3L4JA 4PS1A 3VNRA 5IN5A 2DP4E 2QPTA 1Z5NA 3I0ZA 3LDAA 4U7HA 4NQRA 2A0WA 4MV4A 1DDIA 1H2ZA 2X13A 1T36B 1PKEA 3L2AA 2BP7B 1T15A 1MH9A 5BV7A 4DDWA 4UXIA 1FU7A 4KQ1A 4FM9A 4MAFA 5JSKA 4EX7A 2FK7A 1CZLA 1U0BB 5IC6A 1A9OA 5AESA 2PGIA 3FMVA 2WFLB 2QZPA 1AMOA 2GM9A 1IY9A 1TYAE 1LPSA 5BRNA 3R6GA 3GFVA 2KNZA 1M8JA 2RBKA 5CX1B 4X90A 3PBKA 2FX3A 5TQ0A 2CUKA 2ZK7A 2JZOA 1YUNA 1ECFA 2QXUA 2YWDA 2RCNA 1XO1A 3ZD6A 1UJ2A 3PFIA 1U8TA 2H4HA 3ZW9A 1RRFA 1W8IA 2DCMA 1F3LA 3TPCA 1T5HX 1D1SA 4IHKA 3L6DA 1CB7A 3EJWA 1W88B 1N6PA 3W8EA 5IP5A 4BNLA 1UZAA 2NU7B 1AUXA 1L4FA 1X1SA 2ZT6A 3I2KA 4MINA 1L7BA 3MGKA 2GZDA 3OE1A 1B2LA 1FC0A 4JI5B 1W5EA 2CLSA 2O2EA 4RDCA 3OMXA 1J1UA 3HEAA 5DHPA 3IOBA 4JI4M 2MYTA 3IQZA 4L2IA 4ZI3A 5CYGA 2VRWA 3QF4B 2RGNA 3BD9A 1C0LA 4CZ2A 1FNNA 2XD9A 1NRXA 3STUA 3NBXX 3D3WB 4UBNA 4GX2A 3ZU6A 2OA0A 3EGXA 3JQBC 2EFDB 2F3SA 2JCXA 4H1UA 3L84A 3X1ZA 4AJKA 4DIUA 4K9QA 1PHPA 3VTAA 4NSRA 1K7EB 1Y9JA 2GPWA 4UHFA 4PGMA 3SBXA 1EESA 2X6QA 4BP1A 2B4QA 3GGPA 5BUSA 2Q2EB 3Q1KA 1T8WA 4P0QB 2ZQYA 4DLZA 4IGIA 4RLFA 3LCJA 4M1MA 4RKEA 3GJ7A 5KJ1A 4IDCA 5GPBA 2WU8A 4HQLA 2J6CA 2WAMA 4R2HA 3G79A 4LZAA 4Q7QA 3GCWA 4NARA 2YHIB 3ZLJA 1NNI1 3QAUA 5FLXA 3R74A 1LRLA 5JZSA 3ZY3A 3LWNA 1ZO8A 1AGNA 4FJ0A 1R50A 4MDYA 1VCIA 3BL6A 221PA 2O07A 4IBIA 3ELDA 2O2IA 3O3NB 2RAUA 5KNBD 4J0IA 3OM1A 4PG5A 2BDEA 1FFHA 3T7CA 2DLCX 1DUVG 2QVXX 4RJLA 2DFPA 3P27A 1X1EA 3ZQKA 1O03A 3TRFA 3HXMA 2XBLA 1ZJ6A 1JL3A 1C8LA 4BCBA 2IHUA 2PWYA 3KR1A 1NVKA 3QZUA 5E9WA 4R3NA 4LHSA 4O3FA 1G18A 2C7BA 4X84A 1GTZA 3DMDA 2W2LA 1FTQA 4U0KA 1F0NA 1Q17A 1GARA 4Z6YA 2QLTA 1C1DA 1V7PC 1GGHA 1NW9B 4CI0B 3RVPA 1TXGA 2OGWA 3KKEA 1SUSA 3K6JA 3NHFA 3TWKA 4EHHA 1ZCBA 1RRVA 2I2FA 2ZG6A 1V16A 5KVQA 3COJA 4M54A 1S2OA 1X70A 1JDTA 1CY2A 2WZQA 4DHEA 3TI9A 5KKCA 4FYVA 2GNAA 2QUBA 1K63A 2XGNA 1MGOA 4C5AA 3CVYA 4TMYA 3FAKA 2DUNA 4KR3A 4EG7A 2APLA 3KQQA 2AEMA 4J4BA 2QYOA 1CZKA 4MUMA 4QYMA 3SC3A 3PX2A 3RUHA 1YMVA 4X62M 1F8YA 4LC9A 4ZKDA 1G17A 3IT1A 4F4JA 2ZI7A 1JG3A 1S2GA 1NBME 4M3NA 4KBFA 4Q1EA 4TV8F 1NJ1A 2VBFA 1MFPA 1VPTA 2N47A 4ZD6A 4XX0B 5ITUA 3QEBZ 2Y1CA 5EP3A 4Y2QA 2VDUE 2IWRA 3ZCSA 2B5OA 2PWZA 1TIBA 2I6FA 1NN0A 3RQSA 4D8TA 3Q2KA 3HJCA 4MPTA 2G5TA 3CX7A 1RT9A 2QD4A 4K6FA 1K8QA 1F7VA 3DKPA 1FW8A 3FZQA 2B4TO 3DVQX 3LX4A 3Q15C 5DSZA 1TJ4A 2FQ1A 4P6VF 4YMIA 4ETIA 2HPHA 1VCHA 1Z22A 1TEZA 1W5TA 3SKVA 3FSEA 4X7BA 2A5LA 3L7IA 1GRNA 1ODIA 3A9UA 1YC2A 2CE2X 2OCKA 3R44A 4IQGA 3BZBA 2R6FA 5BT8A 1IBMM 5JQGA 1J9GA 4M9UA 1U63A 4RE6A 1N92A 3X43A 3ASZA 5HKKD 1O97D 3HJRA 3G2JA 3ND5A 2AGVA 5B6PA 4PCLA 5FPHA 3BGDA 3HH8A 3ETLA 3LYLA 2PBZA 3NEAA 1QOZA 3ZLTA 4KGDA 2I5PO 1E2PA 3T7RA 5CCDA 3WGMA 3IFSA 3T5MA 1EJ0A 1J8VA 1QO0A 2EXXA 5JMPA 2HCJB 1JAIA 4HL4A 3ZE2B 4RZSA 5HF6A 4XFDA 2QM8A 2JAOA 2XI4A 3DZJA 2GFHA 3ZH9B 3RKUA 1LDBA 1BVRA 3ZHBA 4KQIA 1Y1PA 1VHJA 1GVHA 4IILA 3ETJA 2OM6A 3RUEA 3W4KA 1NQUA 1NZJA 1JKMA 3I73A 2JEOA 4O0MA 1L4KA 1X7YA 4JX8A 1O58A 4L9WA 2WFZA 2BTQB 1PSWA 2KQUA 1UMCA 4ZAVA 3CLSC 3DA1A 3QKRB 1G9TA 1U94A 3T5DA 4BMDA 3IHPA 1P8JA 1XNRM 4MPDA 3PC2A 2AF4C 3KUCA 4QUJA 5HK8A 5EP2A 1PFUA 1Z82A 2IA5A 4B3TM 3K72B 5JFOA 4R2WA 4F72A 3DFUA 3TSOA 2BI7A 3OQOA 3FD8A 4MP8A 2R8RA 3WJ7A 2AI1A 3PFFA 4URHA 3TWMA 2QUHA 3ILKA 4TXMA 2IEIA 2CYCA 2F8TA 4V2UA 3OZBA 4MZDA 5ANRB 1DU4A 3BIXA 3H5AA 4TXLA 1EFUA 5KAPA 3WO1A 1OFGA 2BR4A 2KLHA 3MS7A 1Q39A 2VJKA 3AJAA 4G4GA 4WP2A 1T25A 1CJSA 3I4YA 4OP1A 3F9CA 4YN3A 4YFYA 3TG2A 3WYFA 3EBPA 3QOYA 4RABA 1ONSA 2LE0A 3CZPA 1Z4NA 4BLQA 2I34A 1TI7A 1RACA 3RHSA 4CKCA 3Q2OA 3HFRA 2WK1A 4DV6M 1CIPA 5CGZA 2WUGA 2R68A 3FTPA 3H0CA 1BD3A 1PYDA 2IYPA 3EXIA 4OFXA 2H0AA 1VPDA 2XJ9A 2XWQA 3IODA 5THKA 3IP9A 4LVNA 5BUQA 1GFIA 3B85A 2Y0BA 2R4TA 2BKEA 4QXRA 8GPBA 5EEGA 4AMGA 2J4DA 4TKLA 3QYEA 2FKNA 3AUFA 3F8TA 2WIKA 4O2BF 4BL5A 4M1KA 3NHWA 1ACMA 2KHZA 1WXHA 3KYDA 1P1RA 4YAJA 2OAGA 2ZANA 4BGDA 1HZZC 4TWBA 4B6SA 1XZDA 4UCQA 2OP1A 1DKLA 2YXBA 1D7OA 2GYVA 5CJ2A 2QU7A 2O52A 2PRZA 1ORHA 1WV1A 2ZRQA 3V1NA 3TW8B 2RHGB 4EY3A 1TF2A 2JGMA 4HBZA 3RVNA 4FCWA 4RIEA 2XUPA 3L6RA 5FA8A 4ZWNA 1GZVA 4BNVA 3MTQA 1Z6XA 5LNK1 2P9YA 3CLRC 5AKKA 4RIIA 5I5EA 1AKTA 3ND6A 1O94A 1CEYA 2GVZC 3G2HA 3R7WB 3R40A 2HNAA 3EQ8A 2FN4A 1L2BA 1WS6A 4V38A 3C24A 1M1UA 3PXDA 5KCMA 4WUVA 5L6MB 3KS4A 4HCJA 4X60A 2R65A 3IDQA 2YV5A 2M6KA 2KBEA 2NNLD 3FWYA 3HUEA 3DD5A 1G6KA 3RAJA 3QP9A 1H4TA 4FDAA 2DEUA 2G0TA 4C04A 4D9IA 2V5AA 3RHFA 5KNCH 5ALUA 2ADMA 1EB8A 5DYNA 2NT3A 3EZYA 3NAZA 3R7DA 2QE7A 1JEYA 4DNFA 4YXWD 1OPXA 3HJ8A 4TV9A 1X8KA 4E5YA 4PIPA 1EBBA 2FOIA 1GR1A 5C8YF 1PNRA 1P74A 6PFKA 1JUDA 1ZZEA 1DG3A 2R8YA 2DQYA 4OXYA 2P78A 3SBJA 1DE0A 3LZCA 5JQWA 4WDQA 3GT4A 4HR7A 1YCHA 3RS9A 3VJKA 5LQCA 3KJQA 2RKWA 4B79A 5FBZA 4MP3A 4DDKA 3UG7A 4CIDA 4MAMA 3BJEA 4TS3A 4DC9A 3MD0A 4RK7A 4Z54A 4BBJA 5FFFA 2YUTA 5A5DA 1GXSA 2HBRA 3LYAA 3G7NA 3JPWA 1TW3A 2DUUA 4Q7LA 2E4UA 4O4HB 5A02A 1N78A 1JDNA 4M9SA 2DTXA 3LY7A 421PA 1STOA 2JIZA 4GKJB 1XU9A 1GG8A 2VHEA 4GYKA 4NV1A 5HF8A 5AKGA 3V33A 2OAQ1 3O1JC 4R81A 2H54A 4G0ZA 5GKNA 1YI8A 4CKWA 4JLNA 4BMYA 3OA0A 3LG2A 2JY5A 1ZGBA 1PEKE 1Y7LA 4E3WA 5JJLA 1NUTA 5LKAA 2CHVA 1YRBA 5IKOA 3H17A 1TVKA 5BSUA 4Z4CA 4GMDA 4BAUA 1JEDA 4F2GA 3OEEA 1UBNA 3IBGA 3I5XA 3RYFA 1QIDA 4E5SA 2HZ7A 3HCDA 2OFPA 1M6HA 2JXNA 1ZAYA 2CKMA 2PR2A 3HNOA 4QG3A 2C99A 4G6ZA 4C30A 4AD8A 4ESOA 1OXXK 4ZU3A 4HPJB 4YQFA 1RLOA 3FYUC 4UBIA 3VPXA 4EQZA 1O7JA 2JKZA 1MB4A 2XVZA 4PONA 3L92A 2KHHA 2VJMB 3ZI7A 4RA6B 4PPNA 3UGKA 1HEYA 1P7VA 2P5TB 4HQ0A 2CNDA 1RI1A 3MHPA 4OU5A 4OLFA 2VPXA 2EP8A 1E2HA 3THYA 4B76A 4HEHA 1KP9A 4MDHA 2J5RA 3L0YA 3IMFA 5E6RA 4UZFA 4KVZA 1KGDA 2IXGA 2Q4BA 4X9XA 3AKDA 2PKQP 1C80A 1YUMA 2OD2A 5E38A 2XD4A 4HGOA 3QHPA 4D2IA 3HWWA 2QRGA 1AVTA 4CQMD 3LC1O 4DJDC 3ZZMA 3QFFA 2QT0A 1RXUA 3ESYA 2R1VA 5CT8A 3BERA 4NH4A 4PQRA 5KC8A 1MOPA 2B4YA 4E5VA 1HA3A 3R5SA 2SECE 1G8HA 5D5HA 5DI9A 1NNSA 4KFSA 2I80A 3TNYA 5BNWA 2P2SA 4EB6B 1N3BA 2UZ1B 4JGGA 2UDPA 4ZJPA 1W5AA 3V9PA 5F2EA 2I76A 3A1EA 4FOOA 4NYJQ 4C0SA 2AMVA 5AM0A 1KXJA 1FXSA 2OK8A 4B6EA 1AQNA 4N03A 2FMIA 1V7QA 1X80B 2VXYA 1MX9A 3CGWA 4KDCA 1ZMWA 4ARZB 4B32A 3NAMA 4UAGA 3M5WA 2QTCA 5JAOA 5KPDA 4KP7A 4RL6A 3P9XA 1C4OA 3FRIA 5I7VA 1LD3A 4D4IA 1YJBA 4LJ9A 4L9AA 4Q5IA 2JGDB 1JU4A 5EVJA 3DS8A 4NWIA 3AEUA 5ALXA 2YMLA 5LQSA 3UC5A 4OJKA 5JPDA 2JFOA 1ADJA 3W5AA 2I7CA 3EIXA 1WDKA 2DWUA 4B8WA 3IDAA 1TFUA 3GVXA 1AO0A 4G67A 2K4MA 5FPKA 1TQ2A 3DEAA 4HNGA 5KPZA 2Y77A 2YMPA 1MMFB 1AK2A 1A2KC 2J9XB 1IZ0A 4MUKA 1PE0A 2CF6A 4TYMA 3GLFE 3O0DA 5I9NA 5AI8A 2GASA 2GK4A 2WUWE 2QL6A 2VF8A 1NQWA 4TYYA 2R7LA 4CMCA 1OWNA 2AEJA 3I64A 5KNDA 4L85A 5ISMA 1PR9A 1PEDA 3RVMA 4Z3OA 3DW3X 1WZIA 4PQFA 3S28A 4LF6M 1D4OA 1O4WA 1UPXA 3KE9A 1Z0DA 3EXFB 2M5ZA 5C0OE 3TD2A 3PRKE 2KEBA 1ZD8A 4U7WA 5AHRA 3D4LA 2ZKLA 5BSFA 4F9FA 2XMDA 4ZT6A 2VHQA 4N3AA 4JASB 1ZGZA 1OLXB 4WAUA 3QE2A 4G5QA 3D3JA 3VXKA 2ZZKA 1MJ5A 4YHHM 1N7JA 3Q3CA 4IS3A 1HTTA 1JHPA 3JVDA 2X3UA 4E14A 4E1BA 5IH7A 4I8IA 2I22A 4DLPA 5EYPA 4LOKA 5C5CA 2WUVA 1VPEA 4B3SM 5DWVA 4WZBA 4L57A 1UP6A 3D4NA 3ET4A 3OQ1A 4PYOA 1JXMA 1T6NA 4DFDA 5SZKB 1G21E 2QSZA 4NATA 4NP6A 4HB0A 3UXHA 1MJHA 2DR3A 4NRDA 1Z5OA 2C7OA 3KQNA 4NESA 1YDEA 4X3PA 3N8GA 2H1WA 4EYGA 2GYWA 2FPSA 1QIEA 1KZHA 2F5NA 1KMQA 2PLAA 5TQ0B 4GT1A 4XAQA 5HMMA 4UNNA 1BJTA 1CZHA 3UAVA 3KP0E 3UEOA 4FNAA 2ZIGA 1EDZA 1YZGA 4WJKB 2RKOA 4YRRA 3F1LA 4EY8A 4PC7A 1VE3A 2GJAA 3DAGA 2G9UA 5DYGA 4C4XA 5M34A 2R4EA 2N9UA 1I0LA 1ZIPA 1SKYB 4HJXA 2A5GA 4OB6A 4E2WA 1CEXA 1DIHA 3TLGA 1NIJA 3R3XA 5J40A 4OBBA 1PJLA 4IHJF 2GT1A 2C3UA 3GRYA 3AL2A 2JI4A 4GZ5A 4PG6A 3HFJA 2D2XA 2H5JA 4L2IB 4G23A 1DS6A 4F8YA 4KQFA 2BH9A 2R6DA 1JMKC 4TWJA 1I1HA 4EX6A 4AFNA 2Q45A 1NF2A 4KO3S 3EGXB 3U6EA 4I36A 4Y1RA 3PGXA 1QH0A 5KMGA 1M75A 2XAUA 1U3WA 1BSVA 3E7WA 1TC1A 3ETDA 3S27A 1N8NA 1OC4A 5H5JA 1KFVA 3AHGA 4FOPA 3M4ZA 1U1GA 3ILSA 4KB5A 4TWZA 2V7EA 3H2HA 5I7RA 3SEQA 3DUFA 3I0MA 1Q5PA 2Z6AA 4A92A 5E7MA 1TZJA 4NEGA 4D44A 2LWIA 3NHMA 3GBPA 3LXXA 4XUDA 3EHDA 4M8NE 8MHTA 3THRA 5FI3A 2VPTA 4RVGA 1T0PA 2RHHA 3N7TA 1P5JA 1XZQA 4TS9A 4D81A 5EGSA 3THSA 3GFQA 1GG2A 3EG9A 2AV6A 1LX6A 3NONA 4FNGA 5IKEA 4H7FA 1WMAA 4GOLD 2QA5A 4MICA 4D8UA 2R00A 1PJCA 3OZCA 1RHUA 3ZE7A 3EK2A 3RUAA 4KEAA 3VR1A 4HRYA 4R8LA 4QU0A 1J2RA 1YAHA 2BUBA 2P7IA 1YBVA 4K8RB 3EE6A 5CH3A 1QNFA 3R0XA 3BGSA 4IFBA 3L1JA 1XDDA 2UYHA 1FNDA 1G3QA 1XCJA 4D26A 4OXNA 3OLZA 3LK6A 2RRUA 4INOA 5DDIP 1Y6QA 4X85A 3Q7SA 2EO2A 1ZY2A 2CXTA 1JLSA 5AVQA 1CQJA 3GPCA 3RBZA 3K9PA 2ZUEA 4WX2B 1H8HA 3T99A 2IOYA 2F00A 3QEOA 5ALEA 2PEZA 3TQOA 1NYLA 1E1DA 1CR4A 3H4MA 4QEDA 4HLCA 1ZH8A 3ZNQA 1SBHA 4UHEA 2ZAMA 4PW0A 1VFNA 2WM2A 1AE1A 5C9ZA 1QNLA 1BU5A 3EFOB 4NOKA 2HU5A 4PIVA 4YI3A 5I8ZA 2FTKE 2VJLA 4QAJA 5EWLA 2YXNA 3OZUA 4W1QA 2WMYA 4RS3A 4P16A 3NBZC 4Z86A 4Z2YA 4UBJA 2QI9C 5LOVF 4D5GA 4DJAA 4PR0A 4MVWA 1VL0A 1KY3A 4PGAA 2ANCA 3EVGA 2XNDA 3B7NA 2ZTSA 1Y6GA 3IPRA 2XCUA 1YVRA 4ZV7A 1GQYA 4KVGA 4X20B 2RB5A 4E51A 3H5TA 3R3SA 5GM2A 2R1UA 5CDYA 4QUIA 1UODA 1HFJA 2GAIA 4X54A 5JYEA 1CUXA 3WWOA 3P2OA 4LRWA 2ZWVA 4RKFA 2AKYA 3IPCA 5BMVF 5FTLA 1T2VA 4B9EA 2DFDA 4AKSA 4AJEA 3AVUA 4U9UA 1KYWA 3TTUA 5G0TA 3PEFA 3I61A 5JQGB 1YR2A 1L7QA 3PL5A 4KVFA 4G65A 3B6JA 4NMXB 1C7EA 4D9JA 1CKEA 4ZTUB 2O8EB 4TXNA 5J43A 4M37A 2VJQA 4ARCA 5G4KA 1E2NA 4MRAA 4OXIA 4TTQA 1Z18A 1XHLA 1MB9A 3SYKA 3A4IA 3AF0A 1JALA 1M9NA 1ODTC 2QNIA 3QE0A 5HCIA 3C8UA 2W2VA 3OPYI 2AN5A 1P3QQ 2IXEA 1HQYE 2C5FA 2HJSA 4MX8A 3EB9A 4G0OA 1IY0A 1ADYA 4JD5A 2OCLA 2P5SA 4HY3A 1RAAA 2FSHA 1LEHA 4LEIA 3PC3A 1M1NA 2IT1A 2WYVA 2G7MC 2ZI5A 1G6OA 2PTHA 3GN1A 4Z7NB 1X0XA 1J5EB 4O3MA 4ZYZA 1L7NA 3ADCA 3JAWB 3C5WP 3SR3A 1J70A 1X7YB 3GJ0A 4KNVA 3TRHA 1EP1B 1UMCB 5TS2A 1ISSA 3IXMA 2V3WA 4JI0M 4ZYWA 4QODA 1ZEJA 4EFLA 2ATVA 1SCJA 3RGWS 5CITA 2W6QA 4LG1A 1EQ2A 1FP6A 3GEHA 4D4HA 3JTMA 4AX8A 2H00A 3LF1A 3QLEA 2Q2NA 2IS1A 1KERA 3GGDA 4LI3X 3VPHA 4PSDA 4B7UA 5ALIA 4BJ5A 4AWBA 4C7JA 4I4TF 2WZJA 3PQ2A 4ZV9A 4BJ6A 3IERA 2PRKA 3UH1A 3J81k 4PHCA 1S01A 2DH6A 2J8ZA 2V7WA 1KPIA 1N9GB 2J46A 2I2WA 2VUTA 1EFUB 3BXHA 1BHQ1 4EWLA 3TQSA 3SATA 3QLTA 4NYMQ 5KI6A 1FYXA 5MFPA 2ID7A 4RWEA 1RNLA 4HNTA 1QZUA 5J2UA 5BORA 1XCOA 3GEDA 4YJ3A 3LUBA 3C1AA 4KXWA 2QX8A 4RD3A 4MGYE 4J1TA 1KEEA 2R97A 4XWGA 3GT0A 3H86A 1XVAA 1C7ZA 5E6JA 5K6RA 3D8NA 5IC5A 4CKCB 4LI0A 1J6UA 4BE7B 1OF1A 2XOXA 4WJLA 4JLKA 1JIKA 3T7AA 5SYAA 3OETA 3UFXB 1MKYA 3DKVA 3NI2A 2CDAA 3STTA 2N42A 3EMVA 3R6LA 4KR9A 4C76A 2CVPA 4TM8A 1P72A 1MRSA 2IKQA 1BMQA 4P3YA 1O5OA 4A8JB 2ODPA 3WDLA 5AHXA 1P7PA 5JECA 1Z6QA 4OI2A 3DEIA 3T9EA 3SG0A 4EZBA 5U4QA 4NMHA 5DX1A 2QRMA 3I4FA 4IICA 4LJ8A 3AZQA 1S3FA 1YI1A 4FEEA 4RVOA 4FMCB 4DMKA 1UOPA 5I8PA 2WIAA 4XKJA 3UAOA 1KAQA 3H9JA 3QBJA 2QD3A 4NCHA 1J0AA 1RP7A 3A6PC 4GWGA 5TY0A 3DT6A 4MR8A 3UT6A 1AV7A 4L4RA 4BMCA 3F4BA 4LAFA 2XKKA 1K6JA 5A3RA 4U1RA 1BMDA 4DCJA 3GDGA 3RC8A 1ZYUA 2AYYA 1QCYA 3B2NA 3CLUC 1P2BA 3WMFA 2WOOA 1CS0A 2RH8A 2ZS8A 2VNSA 3FVRA 1DPGA 1OX4B 3ET5A 3MTDA 2GARA 1EJ2A 2O4UX 3FNEA 1XEFA 5TVGA 3ULKA 3S2GA 4AJJA 3N0WA 3OZGA 2Q9BA 1NBMD 1H9BA 4ZVUA 2ZVQX 3L7MA 1KIFA 2XAAA 1MHPA 4DIEA 3QYAA 2Z3WA 4JLPA 4TQUS 2AMLA 3DDHA 4TV9B 4RF2A 3E53A 2DHCA 2GD0A 4LRTB 3W90A 4AO8A 3UXYA 4XLZA 4EAAA 4EKYA 5K20A 4U7FA 1QIFA 2G71A 3PPXA 1SUEA 4MRRA 4ISBA 5HHTA 1X94A 4BVLA 1F6DA 3VKUA 1UF9A 1PR3A 1JA9A 1J56A 1M2JA 2ESRA 2PX8A 1N32B 5C1IA 1SU6A 4XB6B 3GZTB 3CEJA 4DTIA 4JN6B 1A88A 2KE5A 3I5AA 4WFKA 3FCSB 2HN9A 1CP3A 2A0FA 3SZMA 5E8JA 2GKOA 2AEEA 1PJAA 3U3DA 1BVHA 1DT3A 3N59A 3FCYA 4BN5A 1O95C 4X6UA 3JWGA 5DHAA 4ATNA 4IKEA 2FH0A 2BHNA 2PUVA 3E9MA 3DR5A 4DWVA 5JDCC 5K3SA 4U02A 1R0LA 5CB4F 1M1ZA 3FOCA 1S2LA 1YVPA 5JYBA 1DX9A 4PG8A 5AJXA 3SQXA 4QBGB 1PWXA 2PH5A 4KWEA 1IHPA 4C29A 3FUCA 1QAQA 4XYMA 3I12A 3U3RA 3KFXA 1QUFA 4OYRA 1SNYA 1Z5BA 1IZ7A 4ZOCA 4QLBA 1R00A 4P5EA 3HHYA 4Z2AA 2NVBA 3OIYA 3PQEA 1V0JA 1MN6A 2NV0A 3HABA 1U5CA 3KBBA 5HIMA 2ERCA 1QFSA 3QU5A 5DX0A 4RM2A 2CWBA 1PS8A 3P9IA 3AVWA 2ZRIA 4QO8A 1Z8DA 3L25A 2QR5A 1CSEE 3ECAA 2AOUB 5DP1A 4AMZA 5CEEA 5KU7A 2KJQA 2G09A 4YBRA 1TVKB 1HM5A 1U0OC 3I2JA 3JWIA 1JWBB 1COWA 3LLUA 5BV2P 1FTYA 3SVLA 3TVYA 4B2LA 5B1IA 2WC1A 1PZXA 1QZMA 3LRTA 2IHNA 5JNVA 2I1LA 3SHGB 4UW9A 1XKLA 4IBDA 4FGSA 3VC1A 3DFZA 3AEZA 3R7LA 4P4TA 2GXQA 2BJHA 2PT6A 1KBOA 2W4QA 1P7ZA 4NJOA 4MUAA 3OKAA 3Q87B 4YS6A 4WN3A 4BWYA 3DPIA 3RIYA 3KPJA 3VSDA 1HSOA 4E1VA 2WUDA 3AU8A 3QA3E 4NAUA 1TEVA 4LJSA 5A2QA 1JVBA 4NR0A 5FTWA 4QARA 1NMZA 1FS4A 1MEJA 1ZBDA 4ITUA 3TX2A 4QPNA 2M9MA 3G02A 2DFVA 4ZOLA 2ET6A 3B6MA 3EIOA 4DDTA 5J2TA 2IBSA 4GXRA 3DVRX 3MCUA 4KXLA 1WDWB 4D97A 5CFRA 5A2GA 4I08A 1HQCA 1EGMB 2ZJFA 4IBOA 4H7HA 3DCNA 4IZHA 4KX3A 1B6GA 2Y1LA 4N8EA 1QUSA 3LTNC 2JKVA 4FFWA 5KZMB 1FVXA 1RVV1 3WGNA 4ZV4A 2Y66A 3S70A 2OV8A 4O4LF 1XRMA 4BAZA 4ZCMA 2R6CA 1OW3B 3C4JA 4M1OA 3ADBA 3UJDA 1NQTA 1EK6A 3WBKA 1NJFA 3LP6A 5LXTA 1ODCA 1OIZA 1LC3A 4YRDA 1RIIA 3G2LA 4CKBA 1Z7WA 4FMDB 3EW7A 2G80A 1QLJA 4MV0A 3T1NA 4AJPA 2JI8A 5DM0A 3DO5A 4R9VA 4Z4HA 1T8PA 1OWPA 3H3XA 3WMEA 5JUWA 2IXAA 3NKFA 3PIRA 2ZE8A 1X9HA 3C4QA 1DLIA 1XYYA 2HHJA 3NKVA 4YRLA 1YQ9A 4KCGA 5C8VA 5GMOA 2NYRA 3EZXA 3PNYA 1CUBA 4YO8A 2DBQA 3A1FA 1XC8A 4LVOA 1TH3A 3PYLA 1JPUA 4OKNA 1XQ9A 3CW2A 2B25A 1E2BA 4UVDA 4C4SA 2O8CB 1S7CA 4AMYA 7MHTA 5K05A 1WNFA 4QUDA 3M33A 4GLBA 2IPNA 3MMPA 3P71T 1P77A 2EWWA 4MITA 1KI6B 1XRSB 2BN4A 3KSJA 4Q7MB 2ZBPA 2HNKA 1U80A 3F9RA 1XTQA 4MQUA 1SUCA 4Z8YA 1H0KA 3NATA 1A5TA 1FMFA 1AN0A 1IXSA 4G4OA 5AW3A 2G06A 1L5GB 3WL5A 2C4UA 3KXIA 1MQ9A 4F1IA 5ITYA 5CFNA 3R5TA 2JGAA 1VA4A 1H5UA 4DAEA 1CY6A 1Y8AA 1C30A 4G01B 3VU9B 3FY4A 2A57A 4U7GA 3RLFA 3GUUA 1VPWA 4GQIA 5KVAA 1A82A 3ELYA 2Y2VA 4AC9A 1JE1A 3NS7A 4I0WB 2IYZA 1M2VA 1P18A 3CPSA 2VH2A 4R1UA 3GAZA 1BEUB 4MPPA 2L6OA 2X9VA 1KRXA 3CZMA 3PI6A 3TAUA 2W2NA 3T6KA 4LRYA 3HHXA 1CFJA 2LH0A 3F5MA 1Z5GA 1ZD1A 4TWIA 4R9NA 4E32A 3ETGA 4D3SA 2FW0A 3VO9A 3REOA 2YS6A 4PAOA 1P29A 3N2NA 4ZHQB 2B36A 4S1NA 1AKUA 4TKUA 3OO0A 1E2GA 2ACWA 2N3ZA 4PAMA 3NZEA 3FMGA 4TLMB 3HWX1 1M66A 1KZ1A 1J7JA 3GNLA 5EYPB 1VJGA 2A3RA 1IHUA 2CE7A 1E2UA 4AJIA 1PJ3A 1LPMA 4DR7M 4WZBB 1ADFA 4Q3BA 3CF2A 5DNYA 1JU3A 2OZEA 3EAGA 1JQ3A 4Y9TA 3ADOA 2AA3A 3GAAA 3PUVA 2PN1A 1JH9A 1W4AA 2OO3A 2PMCA 4PFSA 3V1TC 2PJRA 5BN4A 2HL6A 1CVIA 5DTMA 2YMMA 5ALPA 1IZYA 5ALOA 3OJXA 3A6KA 4DYVA 3UK2A 5AHOA 3GV0A 3IUJA 4KTTE 4A9AA 5EE1A 3B1XA 1I3MA 4GM4A 4FYHA 3MWKA 2G07A 2BHLA 2OFWA 5IBCA 4PHHA 1XTSA 4H7IA 4YAWA 3LI2A 3IMCA 2OBLA 5L95A 4GP7A 1JHMA 2P1RA 1TIPA 4MMXB 4QWMA 4B3MB 1OYYA 1Q15A 3D7RA 1I24A 2XQGA 4FGKA 3DTNA 1KK1A 4YMGA 1E66A 4XPIA 3S1SA 1U04A 4L07A 3FKQA 1E63A 1RPAA 3VYSB 1CQPA 4BVGA 2NN3C 5ESRA 5HEKA 5EXTA 1MORA 1NJ8A 3TLGB 1E6KA 2F5QA 4YO7A 3W5IA 3W8FA 2VHZA 3BL8A 4HNAB 3GP1A 4KQKA 1MPXA 5EIBC 1U0RA 5ALFA 2WWTA 3AEKA 3CUVA 1Z4OA 1XTVA 3J7AS 4II7A 2Q29A 3VR5D 3VUFA 4GQAA 2F3UA 1QVWA 1RKVA 3A36A 2CNKA 1V8ZA 1EA5A 1R5OA 3C6MA 2JEZA 4RACA 5KMGB 1GQSA 2BBSA 1QYDA 3BWMA 4Q0MA 2CHQA 2GSWA 4OJNA 1P19A 1CRWG 5DTRA 4MIYA 3TGPA 4GU5A 2KM1A 1M6WA 4NC9A 3ZCRA 2E5FA 1U31A 1U28A 2V7QA 2UUOA 3U60B 3RYHA 2GEJA 1I9CA 1JDZA 3PC8A 3R9IA 1EDEA 3HL0A 1OI3A 2JHAA 2Z2JA 4MJXA 4PTZA 3IRVA 2YCLA 3TW4A 3GMIA 2XMRA 2WNSA 2VHXA 1VJTA 1L5NA 3MXOA 1EIJA 1ELOA 3EHEA 1PT7A 2CLFB 2CYAA 4IV8A 2D54A 1NU8A 3HJGA 1C14A 3U16A 1MT3A 2D2EA 1UC4B 3REQB 4JY7A 4EMBA 2B6HA 2QMUA 2WFMA 3JQRA 3K5WA 2G1PA 1LF0A 2H1HA 6YASA 1BN7A 4Q1AA 3H1PA 3MBKA 3B7GA 3FPAA 3ZDZB 5BR8B 1L1RA 2O2SA 1BDBA 1ZQ9A 2QLJA 4NZNA 3DG9A 1RHQA 2ZRAA 2IYTA 5A4IS 5FUXA 1DKQA 2C77A 4FEAA 3IILA 3D6UA 3FKSD 4RD2A 3NDJA 4PYNA 2QP4A 2V58A 2JGEA 1EK2A 1QTIA 2Z98A 4B48A 4L8FA 5DN6A 5HOEA 1XZJA 4HVCA 3KUUA 1K66A 4PXAA 2JFHA 3WIVA 4QOEA 3RVJA 3AKEA 3W7BA 1RZRA 3AIMA 2I4LA 1RQ7A 4LA4A 3GJ6A 2ZUWA 4Y67A 2FFHA 1P9LA 2I0FA 1LPNA 1AD2A 4X45A 5J5VA 2QYTA 4CNQA 3MUNA 1R9MA 4UTZA 2YWEA 1W47A 5AI6A 1CVRA 1RJWA 3UB4A 2ZDQA 1CQJB 2ORIA 2Q7DA 3OHPA 3CG4A 1RP1A 1DFIA 3P94A 3KZNA 4MW7A 5IZCA 2BEKA 4HQNA 4QGSA 1J22A 1HE2A 4MW5A 5EFOA 4YCDA 3GFOA 5T3YA 3FROA 821PA 3WQQA 4IFTA 2FZWA 2XXBA 4JWKA 3NTRA 5DMHA 4EYSA 4M88A 1ISGA 4S3MA 2LHCA 2GWRA 3AI7A 2J0UA 5FI1B 2XNCA 3LL4A 4ZO4A 2J3JA 1KPGA 3FCOA 4KC0A 2O1XA 1Y8CA 3PWTA 3NC0C 1RBYA 4AK9A 1NFRA 4R1NA 4BV8A 3PLAE 3H5LA 4AKEA 5B1HA 5A71A 5KWEA 2B2NA 2YNMC 1GZ7A 5KYXA 2HIGA 5JO9A 4LMBA 1T34A 4QYIB 2XB9A 4A8HA 8OHMA 1T2FA 5LBUA 1PD1A 4DQUA 5BR4A 4B45A 1G2OA 1T3GA 2H65A 1MB0A 4BQOA 1B4DA 3KL4A 4KXYA 3FXAA 1ST2A 3RRBA 2ORVA 1AOXA 4ENWA 4ZCSA 2P9HA 5E8RA 3VVMA 3IKLA 3O8QA 1KK2A 1RWMA 2OLKA 2HAKA 2EKFA 2GCGA 4OK6A 4PYLA 5I47A 1VHDA 3E3OA 3U9LA 4MGIR 2I6QA 3U2QA 4OTZA 3G0GA 5CFOA 1Q57A 1SVOA 3KV1A 2X15A 4F46A 1F3OA 5KVSA 1U2RA 3H42B 4YAFA 5ERYA 4YMHA 4DIFA 1NLFA 1X87A 3SJZA 5L7WA 1CRLA 2XZUA 1DPFA 1S6YA 2I6XA 3E9QA 2MHCA 4RQBA 3KHUA 1TDZA 3TTWA 3OM8A 4LECA 3Q5EA 4ERNA 4RF0A 5HUHA 5GONA 1BG6A 5EPEA 2UYYA 2P7HA 3CZ4A 4I2NA 1QG0A 3JQFA 3HDVA 3UW3A 3Q3HA 4BO7A 4U39A 3QW2A 3AF4A 3G5LA 4GECA 1DV2A 3RVLA 2GK7A 4XI9A 3IURA 1J00A 2FRDC 3PR3A 2IE0A 2L18A 1DWOA 5AHKA 3HP7A 3CZ5A 4KGXA 4A26A 3HY6A 3OY7A 3E03A 1X1TA 1OBVA 1DBWA 1Z36A 4UEKA 1VJ5A 3ZCBB 3OCVA 3VR4A 2GZAA 4DBLC 1DINA 1WQ3A 3A4LA 3A3YA 3NBKA 3BWBA 2ROQA 1V1MB 4S0ZA 1EE1A 3U6BA 3L1UA 3WL8A 3GLGE 3O8DA 2X23A 3WK9A 1UJ6A 1RAEA 2C1XA 3SYNA 3LNTA 3PGLA 3NOQA 3Q3VA 3HWRA 3ZHZA 2GD1O 2ZIXA 3JWEA 3IXQA 2VP2A 2YC2C 3G2KA 4ZZ1A 2JIMA 1X7ZB 2NP6A 4TLAA 2C58A 2Y76A 2D7JA 4KSCA 1JAXA 3OCYA 3Q3EA 1UWVA 3FBTA 1ABFA 4JOSA 4Y8VA 5DBEX 2VTKA 4FSHA 3DCIA 2HCBA 5TS3A 1SXJB 4Q39A 4DR5M 2B5WA 2QQFA 2Q2OA 4PN3A 1SZPA 4PNZA 2QYSA 4X66M 1ID1A 4B8YA 5AVRA 4YJ3B 4D9CA 1WXFA 2D62A 1T8TA 5EHQA 3PUYA 3KAQA 5J4VA 4DV2M 1R6BX 5TV2A 3NPAA 2YWJA 1GZHB 4D9BA 1Z0SA 2IZOA 5J1TB 1Y1KE 2UYOA 1NBIA 2HA5A 3PTZA 1YTUA 3C6ZA 3GAFA 4K9SA 2QKYA 1E32A 4IIHA 4IBFA 4HGRA 4B80A 5EPOA 2J07A 5D3MA 3FNIA 1ZNYA 3TZ6A 2PIAA 5CRIA 1JEAA 2BMWA 4RH0A 4ON9A 5GJWC 2VS1A 3MJSA 5TX7A 4N8SA 4J29A 4MCJA 1S89A 1PJTA 4HATA 2OLEA 3ZBPA 3DMHA 2QN3A 3SC6A 1KVTA 4YCNA 2L2QA 4NOLA 1EP9A 4V0MA 3BG5A 2YXLA 4ZOQI 2PQ0A 5K8IA 5UKDA 1JFSA 5LPNA 2HA7A 1PWZA 2FPGA 1IEWA 3H5VA 5TPZA 3BMOB 3WB0A 2HWKA 4KUHA 3DR3A 4CJ6A 3HR8A 3V32A 1FFXA 2PYDA 5IVIA 1VRVA 5JEEA 2R6JA 4H7EA 3GGSA 2II6A 1QH8B 3LLMA 3LQRA 4BX0A 4PC1A 3NXSA 1K5DA 4MR8B 4EEXA 4KX5A 4I81A 2NO4A 1I5RA 2R8ZA 3PCTA 1U81A 4PDIA 5HQ3B 1Z59A 2FUEA 2GEUA 4D6XA 2GPAA 1L5VA 3ORQA 3SBEA 7AT1A 2XQKA 1VG1A 1BFKA 1OC2A 2XR1A 3ZR4B 4ADSG 4IIJF 5L3SA