3TWLA

Crystal structure of arabidopsis thaliana fpg
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
286
structure length
263
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAYVPELQKLYGKDAEKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Formamidopyrimidine-DNA glycosylase 1
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 78
structure length 263
sequence length 286
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twlA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twlA01
3GQ5A 2UU9M 5LMUM 3SBJA 4JI1M 4LFAM 2F5NA 1K82A 4X65M 2VQFM 1HNZM 4JI0M 2E5LM 3GQ3A 4JI5M 1N32M 1N34M 2HHHM 5A2QS 1XMQM 4PD2A 3GQ4A 3T1YM 4G4RA 5ITTA 1I94M 3U6LA 4JI7M 1TDZA 3SARA 1TDHA 1IBKM 1HNXM 4JI4M 1L2DA 4JI8M 1XC8A 4B3SM 4DR7M 5ITQA 1PJIA 3J80S 3U6PA 3U6SA 1Q3BA 2UXBM 3JR5A 4LFCM 4NXNM 3C58A 3A45A 2XZUA 2UXCM 1IBLM 1J5EM 4DV7M 5ITUA 2Q2EB 5ITXA 1NNJA 4GKKM 1Z59A 1N36M 3SAWA 4PCZA 3SAVA 3SAUA 4LF5M 4LF8M 2EA0A 4ITQA 5ITRA 4PDIA 1Q39A 2F5QA 2F4VM 4LF6M 1L1TA 4LF9M 4DV4M 3TWKA 4LFBM 4X64M 4NRWA 2ZBKB 3JAMS 3A46A 5IWAM 3U6OA 4MB7A 1PM5A 1XNRM 4B3MM 4DR5M 3GO8A 4DV1M 4DR3M 4NRVA 1K3WA 4G4NA 4DV2M 2OQ4A 4G4OA 3GPYA 3W0FA 2UUAM 1Z5CA 4YHHM 4JI6M 1HNWM 4OX9M 3T1HM 4X66M 4LF4M 1EE8A 3J7AS 5ITYA 5ITXE 5LMNM 2UXDM 4K0KM 1XNQM 4DR6M 5BR8M 2F5OA 3GPUA 3OTOM 4DR1M 4DR2M 5IT9S 3A42A 1L2BA 2VQEM 1Z5AA 1R2YA 1HR0M 3GP1A 3TWLA 3U6QA 2OPFA 1KFVA 4KHPM 3SATA 4YY3M 3TWMA 3U6EA 3VK7A 1IBMM 2XZFA 4NXMM 4LF7M 4DUZM 4JYAM 4DR4M 4JV5M 1N33M 1MX0A 4DV0M 4DV5M 1Z5BA 4G4QA 2UUBM 4CISA 2F5SA 4B3TM 1L2CA 1FJGM 1MU5A 3GPXA 2F5PA 4JI2M 5FLXS 3VK8A 3SASA 3GPPA 2UUCM 1K3XA 4JI3M 4PDGA 1L1ZA 3U6DA 4B3RM 4AQYM 1XMOM 4DV6M 3U6MA 2ZM6M 3U6CA 3DOAA 1Q3CA 1R2ZA 4DV3M 1PJJA 4X62M 3J81S 3JR4A 4DUYM 4GKJM 2HKJA
chains in the Genus database with same CATH superfamily
3GQ5A 2EKKA 4II7A 2DZOB 3B7QA 3PFIA 4A3VB 3TPZA 5IREB 2FNAA 2F5NA 4TUWA 4M0WA 2CWBA 1PJTA 4IBCA 3J7BA 4OW0A 4JI0M 1HJPA 1XXHE 3VLFB 2EJSA 2E5LM 1N32M 1N34M 4LJ5A 1OAOC 4PD2A 3FTCA 3GRRA 3SYKA 2XFTA 1OAIA 1QQWA 1IN6A 3RE8A 1HNXM 4JI4M 2O5RA 1G71A 1V34A 5FTKA 3D8BA 5FTJA 2N35A 2ZANA 2Y0QA 3CF6E 5ITQA 1OJLA 3HJSA 2ZAOA 2X8AA 3TE6A 2QPAA 3SHFA 3C58A 5EQTA 2D7HA 1IBLM 3IHPA 4DV7M 3I4VA 4MGKE 1E32A 2XFSA 1VEGA 3SFZA 3HJ8A 2QNJA 4REZA 2Q2EB 2DWZB 1Z59A 3KW6A 3I51A 3KP1E 3SAWA 3VKHA 1T3TA 2Z8YM 5BPVA 2RKOA 2OOAA 4IJEA 4FCWA 1WJ7A 2O01F 4PDIA 2XLJA 4LF6M 3AJIB 2RGHA 2ZBKB 3U61A 4AKHA 1W5TA 2APLA 1HT1E 3R8FA 2R46A 1MJGM 4AZFA 4NRVA 4DR3M 4DV2M 2KHHA 3ZCBB 1F4IA 4JI6M 1IFYA 4LGMA 1IXSB 1XWIA 1L8QA 2D7EA 5EP1A 5ITYA 3HZJA 3KS8A 2KW0A 3KXEC 4G3OA 1SXJB 2QBYA 2I7NA 4FCVA 2WSCF 2C9CA 2XEPA 3KSXA 5E6JA 1D2NA 4R71A 3FE3A 4W5WA 3R9XB 1DV0A 5JI3E 2DI0A 3MMPA 4WW0A 3A98B 1DGHB 5IT9S 2DVWB 2R4JA 2VF7A 1HR0M 3FUWA 4IBKA 3GP1A 1DGFA 3W68A 2RRUA 3SATA 1UM8A 3TWMA 1IBMM 1QDRA 2G3QA 4PT5A 2FH0A 3M0EA 1ORYB 4DR4M 1WR1B 1I4WA 1N33M 4G4QA 2XF3A 3SHGB 4DV5M 2LHGA 4GITA 3NWLA 1W5SA 1MU5A 1ZQ9A 4LZJA 1JB0F 3I01M 1ZMUA 3VK8A 1NO1A 2LVOC 3SASA 5C18A 1D0KA 3KDSE 1K3XA 2HWJA 1PJQA 4F2LA 4PDGA 3VFDA 3MHVC 4AQYM 1GVNA 2FFJA 2DAGA 2LVNC 3B7NA 3LCVB 1QYRA 1QZMA 1Y8GA 2XGNA 3B74A 3U6CA 3DOAA 1OKSA 2B3TA 4BBAA 1X37A 3HGIA 2BWEA 2CHQA 2J5YA 3GLHB 4DUYM 3T38A 4GKJM 2X49A 2Y0TA 3SMPA 1JQJC 3IECA 1VQ1A 4G6ZA 1J09A 1GJTA 1EFUB 3HU2A 4GIPA 4P16A 1Z6TA 1XXHB 5L8RF 3FUUA 2DAIA 1K82A 5E26A 1PJSA 4IIWA 2YNMD 3VDUA 4GC5A 4GC9A 3B89A 3L29A 5A2QS 3GLIE 1I94M 3J2PB 2CP8A 2DZLA 2KXEA 3QYEA 4IBFA 4LJ4A 3L2AA 3AOGA 5EXTA 1TDZA 1TDHA 1IBKM 1QAQA 2QCUA 1L2DA 4AKIA 2CHVA 1XC8A 2YR0A 4LRSA 3HHWA 3J80S 2VF8A 3U6PA 3BXWA 2DENA 4R7GA 3F92A 4CJ6A 5DNYA 1S3SA 2UXBM 2JWSA 3A45A 2XZUA 2C5RA 2UXCM 4KO8A 5KPZA 4MH0E 2BWBA 2FS1A 1OTRA 2EO2A 1OIPA 3SAVA 3FTFA 4NL4H 4I8OA 4RF1A 1NHGC 3SAUA 3PVSA 4IBIA 4IJFA 4IBJA 2KRUA 1QANA 2DWLA 4LF8M 5ITRA 5FSWA 1OIZA 1Q39A 4NOOB 4LF9M 1NY6A 2KZUA 3GLFE 4NRWA 2R4EA 3JAMS 3KOZE 4JN6A 3DZDA 4IBBA 4LJAA 3U6OA 1NV9A 2O25A 1PM5A 1XNRM 4B08A 4M9ZA 3L27A 4DV1M 2J7NA 5GKNA 1T43A 2R0IA 3QAUA 4MGZE 7CATA 3KOYE 1K3WA 3GPYA 1NVMA 1Z5CA 4GMQA 4L16A 3HHYA 3T1HM 4LGYA 4MM3B 4LF4M 4FD2A 4IBDA 2L4EA 4B7GA 2JY5A 2R6FA 2CV1A 5ITXE 3J7AS 2Z4SA 5EP4A 5LMNM 4AI6A 1GKIA 4LJ7A 2ZTDA 3ZQJA 4DBGB 2LBCA 5BR8M 3Q8GA 2K6BA 4B7HA 2FE8A 3UGJA 3D8LA 3A42A 3IG8A 1L2BA 1IN5A 1Z5AA 4M9XA 4R3DA 1WGLA 2DNAA 2M5ZA 3QYBA 2Z3XA 3VK7A 4QOZC 3U5ZA 3LVVA 2XZFA 3T15A 4NXMM 2JZ0A 3CGWA 3QWLA 2DXIA 4LF7M 3GRVA 2EUCA 4DUZM 2EKFA 2VIIA 4AG6A 2C98A 1MX0A 2UUBM 2Y20A 1BVSA 3CTWB 2WSEF 1T6OA 2MH8A 4CGYB 3AFHA 3FYCA 4KLNA 3GLIA 3HKPA 2Y21A 4FW9A 4LJ9A 2DKLA 5FLXS 3VKGA 2C99A 5KQDA 3K2LA 1IY2A 4JI3M 2C9OA 3FUTA 1L1ZA 3U61B 4LJ6A 3U60A 1YSYA 1QZEA 2QP9X 1XMOM 3GRUA 1LTMA 3U6MA 3K1JA 1G3IA 2R44A 1ZMVA 4DV3M 2G8LA 3EIEA 5H37D 4I81A 3J81S 5FTNA 4OVZA 2DAMA 5EXPA 2CE7A 3Q8XA 2UU9M 5LMUM 4L8RC 3I4YA 3SBJA 1PGYA 4UN2B 2HL7A 5DFLA 3WHLA 4RKUF 2OO9A 4LFAM 2WSFF 4X65M 4NSOB 2JUJA 2YFQA 3HY5A 4LG2A 1TH2A 2QBYB 4JI5M 1JR3A 2M60A 2QQ8A 2FOIC 4Z8XA 4B7FA 5C1BA 1AIPC 1IY0A 1IN7A 4AW4A 1GL7A 3GLGA 3GLFA 1VDLA 1NNUC 1A5TA 2K0BX 4NSRA 2V1UA 2MGWA 3SARA 2JY8A 3KS4A 3E4RA 5FTLA 2QZ4A 1GLNA 4B3SM 1E9RA 3FUXA 3U6SA 1Q3BA 1PRBA 2K47A 3GLHA 5JI2E 1IY1A 2XH9A 4NXNM 1H6UA 3SC3A 1CUKA 5EP2A 5ITXA 1SG9A 2K9DA 1NNJA 4GKKM 1N36M 3L26A 1TGUA 1UFZA 1ZMWA 1JR3D 2P5TA 2YQZA 3MJ5A 4MGHA 2I7PA 2BJVA 4HLQA 4Z6YA 4ITQA 1NY5A 1KYIA 2CV0A 2ZAMA 1HT2E 2L7HA 3H4JA 3HHZA 1SXJE 2F5QA 4DV4M 4QNRA 3W67A 2F4VM 4AKGA 3EIHA 2R45A 4MB7A 1KSFX 3L28A 2Z7JA 2W82A 3GO8A 4ZPXA 2V1CA 3UJNA 1GABA 2OQ4A 4LY6A 1TH4A 2Z4RA 3W0FA 1TH3A 4YHHM 2UUAM 5KQ8A 1HNWM 4OX9M 2NQ8C 1NSFA 4X66M 1G8PA 1YUBA 3K92A 3LCUA 3PNVA 2DAEA 3FKEA 4GH9A 4I5SA 3IG5A 3SYLA 2JXNA 2D7GA 3FTDA 4LZZA 1IXRC 4FWDA 2GQFA 4K0KM 4MGYE 3NBXX 3C9PA 4NC6A 1JR3E 3LMMA 5EJCA 1NJGA 2F5OA 4RNAA 3DA1A 2KA6B 2LVAA 1OFHA 3KP0E 3GPUA 3GLGE 3J27B 1QAMA 1OFIA 4EIWA 4CHTB 1R2YA 1R5LA 2ERCA 2L6OA 4GRIA 3U6QA 1E94E 4GHLA 4KHPM 3U6EA 3AV0A 2KDLA 3B9PA 3LW5F 4S12A 1N77A 4LJ8A 4Y28F 1VG5A 1MN3A 4GEWA 2BNKA 2R65A 2RGOA 2ZTCA 3GLHE 2JP7A 3LQRA 2MJ5B 1RU3A 3I04M 4WP2A 1G59A 4DV0M 1Z5BA 3TL4X 8CATA 4CISA 2F5SA 2CUZA 1L2CA 1FJGM 2HAKA 1GJSA 1VEJA 1WGNA 3H4MA 4I4LA 3AKZA 3ZH9B 4JXJA 3GPXA 1GO5A 4JI2M 3GPPA 3FRHA 3K8ZA 5DYGA 2V6ZM 3T6PA 3KOXE 4D82A 4QOSA 1LV7A 3UZUA 2QSFX 1TF0B 1HQCA 3CF2A 3FUVA 4XBOA 4KT0F 3B7ZA 3HHXA 3BBZA 1YLAA 2ZM6M 1QDTA 1Q3CA 4LCBA 4L4UA 1R2ZA 1E9SA 1PJJA 2JZ1A 1NV8A 4X62M 3FTEA 4Q7JA 3JR4A 3HX3A 2LVQD 5EP3A 2HKJA 1R4GA 2H1RA 2J7OA 2R18A 4BLCA 5F3WA 2CEAA 1AUAA 4JI1M 3M7GA 3E46A 1IXSA 1FNNA 2LXEA 4L78A 2VQFM 1DO0A 1IM2A 1HNZM 2DWNA 2AHMA 2L4FA 3GQ3A 3HJQA 2KNZA 2CV2A 1VDDA 2HHHM 1N75A 1XMQM 3GQ4A 1J7KA 4XK8F 1SXJA 4G4RA 3T1YM 5ITTA 2XSZA 1IN4A 3U6LA 3KOWE 4JI7M 1IN8A 2DZNB 3K9PA 2LWXA 3KVWA 1DGHA 3HU1A 3LQQA 4QHSA 3DFZA 3KSJA 4IBEA 4OU7A 3U5ZB 4JI8M 3AL0C 5EXXA 1PJIA 3E9SA 4DR7M 2VDBB 1VEKA 2C96A 3C3EA 3JR5A 4LFCM 3W0LB 4GHAA 4ANRA 4BB9A 3FYDA 2BJWA 3AOEA 1J5EM 3WHKA 5ITUA 1DGBA 3LVWA 1DGGA 1TTEA 1WIVA 2CRUA 3PNYA 2G5GX 2KNVA 1P3QQ 1SXJC 2CFOA 4FCTA 4L6V6 3VDPA 4IBGA 4PCZA 4XGIA 1WHCA 2DAKA 3GLIB 1XHBA 3RGSA 1QAOA 4CIZA 4LF5M 2EA0A 3FRIA 1SXJD 2XSZD 2LH0A 1L1TA 3U60B 3L25A 3TWKA 3UK6A 2OOBA 4X64M 4LFBM 2KRKA 3A46A 1Q02A 3AOEC 3HWSA 5IWAM 3K9OA 1EIJA 3KFUG 2A5YB 3GRYA 4M9SA 3PXGA 2L2DA 4OVZB 4DR5M 1QUSA 1IXZA 1TR8A 4B3MM 2QHOB 2HCBA 2CHGA 3FD9A 2DHYA 4G4NA 4G4OA 1HQYE 1WXQA 3RGPA 2H5XA 2JA2A 2GNOA 3V76A 2KNAA 1OQYA 2WZJA 2X4AA 4QNMA 1EE8A 2KEBA 4MGIE 1ZAEA 1YE9A 1C7YA 2L09A 1XXHA 2LNHC 3M6AA 2UXDM 2DWMA 2R62A 5IZ7D 1XNQM 5KO3A 2DHRA 3GLGB 2JNHA 3ZC7B 4RF0A 3GLFB 4DR6M 1V33A 1QVRA 1ZV1A 3THGA 3MK6A 3OTOM 4DR1M 4D80A 4DR2M 4FVMA 2VQEM 3BOSA 5KPTA 1NJFA 1D0MA 4HL4A 4M0DA 3TWLA 2OPFA 1KFVA 3RFWA 3SMSA 1XB2B 3C3DA 4KODA 4QHTA 4YY3M 2JY7A 4L15A 3TQSA 1GL6A 4JYAM 1V92A 1DO2A 3ILKA 2KZSA 4JV5M 2MR9A 2LHCA 4LRTA 1N78A 1C1KA 4B3TM 1IQPA 4P17A 3NBIA 1G4AE 5EXSA 4AG5A 5KPRA 1R7RA 2F5PA 2MROB 3UMMA 4WURA 5FTMA 2UUCM 2L7IA 4D81A 2LVPC 1QUTA 3CF0A 5DYIA 4B3RM 3U6DA 1D0LA 3HU3A 4DV6M 4FWGA 1NHWC 4HEOA 2LTUA 1R6BX 4FWHA 2QENA 2JY6B 4F1IA 1G41A 3E21A
chains in the Genus database with same CATH topology
3GQ5A 4II7A 2DZOB 3PFIA 4A3VB 3TPZA 5IREB 2FNAA 2F5NA 4TUWA 4M0WA 4IBCA 4OW0A 4JI0M 3J7BA 3VLFB 2E5LM 1N32M 1N34M 4LJ5A 4PD2A 3FTCA 3GRRA 3SYKA 2XFTA 1QQWA 1IN6A 3RE8A 1HNXM 4JI4M 2O5RA 5FTKA 3D8BA 5FTJA 2ZANA 2Y0QA 3CF6E 5ITQA 1OJLA 3HJSA 2ZAOA 2X8AA 3TE6A 2QPAA 3SHFA 3C58A 5EQTA 2D7HA 1IBLM 4DV7M 3I4VA 4MGKE 1E32A 2XFSA 3SFZA 3HJ8A 4REZA 2Q2EB 2DWZB 1Z59A 3KW6A 3I51A 3KP1E 3SAWA 3VKHA 1T3TA 5BPVA 2RKOA 4IJEA 4FCWA 4PDIA 2XLJA 4LF6M 3AJIB 2RGHA 2ZBKB 3U61A 4AKHA 1W5TA 3R8FA 1HT1E 2R46A 4AZFA 4NRVA 4DR3M 4DV2M 3ZCBB 4JI6M 4LGMA 1IXSB 1XWIA 1L8QA 2D7EA 5EP1A 5ITYA 3KS8A 2KW0A 3KXEC 1SXJB 2QBYA 2I7NA 4FCVA 2XEPA 2C9CA 3KSXA 5E6JA 1D2NA 4W5WA 3R9XB 5JI3E 4WW0A 3A98B 1DGHB 5IT9S 2DVWB 2R4JA 1HR0M 3FUWA 4IBKA 3GP1A 1DGFA 3SATA 1UM8A 3TWMA 1IBMM 4PT5A 3M0EA 1ORYB 4DR4M 1I4WA 1N33M 4G4QA 2XF3A 3SHGB 4DV5M 4GITA 3NWLA 1W5SA 1MU5A 1ZQ9A 4LZJA 3VK8A 3SASA 5C18A 3KDSE 1K3XA 4PDGA 3VFDA 3MHVC 4AQYM 1GVNA 2FFJA 1QYRA 1QZMA 2XGNA 3U6CA 3DOAA 4BBAA 1X37A 3HGIA 2CHQA 4DUYM 3GLHB 3T38A 4GKJM 2X49A 2Y0TA 3SMPA 1JQJC 4G6ZA 4GIPA 1J09A 3HU2A 4P16A 1Z6TA 1XXHB 3FUUA 1K82A 5E26A 4IIWA 2YNMD 3VDUA 4GC5A 4GC9A 3L29A 5A2QS 1I94M 3J2PB 5EXTA 2KXEA 4IBFA 4LJ4A 3L2AA 3AOGA 1TDZA 1TDHA 1IBKM 1QAQA 2QCUA 1L2DA 4AKIA 2CHVA 1XC8A 2YR0A 4LRSA 3HHWA 3J80S 3U6PA 4R7GA 5DNYA 2UXBM 1S3SA 3A45A 2UXCM 2XZUA 2C5RA 4KO8A 5KPZA 4MH0E 2EO2A 3SAVA 3FTFA 4NL4H 4I8OA 4RF1A 1NHGC 3SAUA 3PVSA 4IBIA 4IJFA 4IBJA 2KRUA 1QANA 2DWLA 4LF8M 5ITRA 5FSWA 4NOOB 1Q39A 4LF9M 1NY6A 2KZUA 4NRWA 2R4EA 3JAMS 3KOZE 4JN6A 3DZDA 4IBBA 4LJAA 3U6OA 1PM5A 1XNRM 4B08A 4M9ZA 3L27A 4DV1M 2J7NA 5GKNA 3QAUA 4MGZE 7CATA 1K3WA 3KOYE 3GPYA 1NVMA 1Z5CA 4GMQA 4L16A 3HHYA 3T1HM 4LGYA 4MM3B 4LF4M 4FD2A 4IBDA 4B7GA 2CV1A 3J7AS 5ITXE 2Z4SA 5EP4A 5LMNM 4AI6A 1GKIA 4LJ7A 5BR8M 4B7HA 2FE8A 3UGJA 3D8LA 3A42A 3IG8A 1L2BA 1IN5A 1Z5AA 4M9XA 4R3DA 2M5ZA 2Z3XA 3VK7A 4QOZC 3U5ZA 3LVVA 2XZFA 3T15A 4NXMM 2DXIA 3QWLA 4LF7M 3GRVA 2EUCA 4DUZM 2VIIA 4AG6A 2C98A 1MX0A 2UUBM 2Y20A 3CTWB 4CGYB 3AFHA 3FYCA 4KLNA 3GLIA 3HKPA 2Y21A 4FW9A 4LJ9A 5FLXS 2C99A 5KQDA 3K2LA 1IY2A 4JI3M 2C9OA 3FUTA 1L1ZA 3U61B 4LJ6A 3U60A 1YSYA 2QP9X 1XMOM 3GRUA 3U6MA 3K1JA 1G3IA 4DV3M 2G8LA 3EIEA 5H37D 4I81A 3J81S 5FTNA 4OVZA 5EXPA 2CE7A 3Q8XA 2UU9M 5LMUM 4L8RC 3I4YA 3SBJA 3WHLA 2HL7A 4LFAM 4X65M 4NSOB 2YFQA 4LG2A 1TH2A 2QBYB 4JI5M 1JR3A 2M60A 4Z8XA 2FOIC 4B7FA 5C1BA 1IY0A 1IN7A 4AW4A 1GL7A 3GLGA 3GLFA 4NSRA 1NNUC 2V1UA 3SARA 3KS4A 3E4RA 5FTLA 2QZ4A 1GLNA 4B3SM 1E9RA 3FUXA 3U6SA 1Q3BA 2K47A 3GLHA 5JI2E 1IY1A 2XH9A 4NXNM 1H6UA 3SC3A 5EP2A 5ITXA 1NNJA 4GKKM 1N36M 3L26A 1TGUA 1JR3D 2P5TA 2YQZA 3MJ5A 4MGHA 2I7PA 2BJVA 4HLQA 4Z6YA 4ITQA 1NY5A 1KYIA 2CV0A 2ZAMA 1HT2E 2L7HA 2F5QA 3HHZA 1SXJE 2F4VM 4DV4M 4QNRA 4AKGA 3EIHA 2R45A 4MB7A 1KSFX 3L28A 2Z7JA 2W82A 3GO8A 4ZPXA 2V1CA 3UJNA 2OQ4A 4LY6A 1TH4A 2Z4RA 3W0FA 1TH3A 4YHHM 2UUAM 5KQ8A 1HNWM 4OX9M 2NQ8C 1NSFA 4X66M 1G8PA 1YUBA 3K92A 3PNVA 4GH9A 3FKEA 3SYLA 4I5SA 3IG5A 2D7GA 3FTDA 4LZZA 1IXRC 4FWDA 4K0KM 4MGYE 3LMMA 5EJCA 1NJGA 2F5OA 4RNAA 3DA1A 2KA6B 1OFHA 3KP0E 3GPUA 3J27B 1QAMA 1OFIA 4EIWA 4CHTB 1R2YA 2ERCA 2L6OA 4GRIA 3U6QA 1E94E 4GHLA 4KHPM 3U6EA 3AV0A 3B9PA 4S12A 1N77A 4LJ8A 2BNKA 2R65A 2RGOA 3LQRA 1G59A 4DV0M 1Z5BA 3TL4X 8CATA 4CISA 2F5SA 2CUZA 1L2CA 1FJGM 3H4MA 4I4LA 3AKZA 3ZH9B 4JXJA 3GPXA 4JI2M 3GPPA 3K8ZA 5DYGA 2V6ZM 3KOXE 4D82A 4QOSA 1LV7A 3UZUA 1HQCA 3CF2A 3FUVA 4XBOA 3HHXA 2ZM6M 1Q3CA 4LCBA 4L4UA 1R2ZA 1E9SA 1PJJA 4X62M 3FTEA 3JR4A 5EP3A 2HKJA 2R18A 2H1RA 2J7OA 4BLCA 5F3WA 2CEAA 4JI1M 3M7GA 1FNNA 2LXEA 4L78A 2VQFM 1DO0A 1IM2A 1HNZM 2DWNA 2AHMA 3GQ3A 3HJQA 2CV2A 1VDDA 2HHHM 1N75A 1XMQM 3GQ4A 1J7KA 3T1YM 1SXJA 4G4RA 5ITTA 2XSZA 1IN4A 3U6LA 3KOWE 4JI7M 1IN8A 2DZNB 2LWXA 3KVWA 1DGHA 3HU1A 3LQQA 4QHSA 3DFZA 3KSJA 4IBEA 3U5ZB 4JI8M 3AL0C 4DR7M 5EXXA 1PJIA 3E9SA 2C96A 3JR5A 4LFCM 3W0LB 4GHAA 4BB9A 3FYDA 2BJWA 3AOEA 1J5EM 3WHKA 5ITUA 1DGBA 3LVWA 1DGGA 3PNYA 4FCTA 2G5GX 4OU7A 1SXJC 2CFOA 3VDPA 4IBGA 4PCZA 4XGIA 3GLIB 1XHBA 3RGSA 1QAOA 4LF5M 2EA0A 1SXJD 2XSZD 2LH0A 1L1TA 3U60B 3L25A 3TWKA 3UK6A 4LFBM 4X64M 2KRKA 3A46A 3AOEC 3HWSA 5IWAM 3KFUG 2A5YB 3GRYA 4M9SA 3PXGA 4OVZB 4DR5M 4B3MM 1IXZA 2HCBA 2CHGA 3FD9A 4G4NA 4G4OA 1HQYE 1WXQA 3RGPA 2JA2A 3VKGA 2X4AA 4QNMA 1EE8A 2KEBA 4MGIE 1ZAEA 1YE9A 2L09A 1XXHA 2LNHC 3M6AA 2UXDM 2DWMA 2R62A 5IZ7D 1XNQM 5KO3A 2DHRA 3GLGB 3ZC7B 4DR6M 4RF0A 3GLFB 1QVRA 3THGA 3MK6A 3OTOM 4DR1M 4D80A 4DR2M 4FVMA 2VQEM 3BOSA 5KPTA 1NJFA 3TWLA 4HL4A 4M0DA 1KFVA 2OPFA 3RFWA 3SMSA 4KODA 4QHTA 4YY3M 4L15A 3TQSA 1GL6A 4JYAM 1DO2A 3ILKA 2KZSA 4JV5M 4LRTA 1N78A 1C1KA 4B3TM 1IQPA 3NBIA 1G4AE 5EXSA 4AG5A 5KPRA 1R7RA 2F5PA 3UMMA 4WURA 5FTMA 2UUCM 2L7IA 4D81A 3CF0A 5DYIA 4B3RM 3U6DA 3HU3A 4DV6M 4FWGA 1NHWC 1R6BX 4FWHA 2QENA 1G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ5 A;  2UU9 M;  5LMU M;  3SBJ A;  4JI1 M;  4LFA M;  2F5N A;  1K82 A;  4X65 M;  2VQF M;  1HNZ M;  4JI0 M;  2E5L M;  3GQ3 A;  4JI5 M;  1N32 M;  1N34 M;  2HHH M;  5A2Q S;  1XMQ M;  4PD2 A;  3GQ4 A;  3T1Y M;  4G4R A;  5ITT A;  1I94 M;  3U6L A;  4JI7 M;  1TDZ A;  3SAR A;  1TDH A;  1IBK M;  1HNX M;  4JI4 M;  1L2D A;  4JI8 M;  1XC8 A;  4B3S M;  4DR7 M;  5ITQ A;  1PJI A;  3J80 S;  3U6P A;  3U6S A;  1Q3B A;  2UXB M;  3JR5 A;  4LFC M;  4NXN M;  3C58 A;  3A45 A;  2XZU A;  2UXC M;  1IBL M;  1J5E M;  4DV7 M;  5ITU A;  2Q2E B;  5ITX A;  1NNJ A;  4GKK M;  1Z59 A;  1N36 M;  3SAW A;  4PCZ A;  3SAV A;  3SAU A;  4LF5 M;  4LF8 M;  2EA0 A;  4ITQ A;  5ITR A;  4PDI A;  1Q39 A;  2F5Q A;  2F4V M;  4LF6 M;  1L1T A;  4LF9 M;  4DV4 M;  3TWK A;  4LFB M;  4X64 M;  4NRW A;  2ZBK B;  3JAM S;  3A46 A;  5IWA M;  3U6O A;  4MB7 A;  1PM5 A;  1XNR M;  4B3M M;  4DR5 M;  3GO8 A;  4DV1 M;  4DR3 M;  4NRV A;  1K3W A;  4G4N A;  4DV2 M;  2OQ4 A;  4G4O A;  3GPY A;  3W0F A;  2UUA M;  1Z5C A;  4YHH M;  4JI6 M;  1HNW M;  4OX9 M;  3T1H M;  4X66 M;  4LF4 M;  1EE8 A;  3J7A S;  5ITY A;  5ITX E;  5LMN M;  2UXD M;  4K0K M;  1XNQ M;  4DR6 M;  5BR8 M;  2F5O A;  3GPU A;  3OTO M;  4DR1 M;  4DR2 M;  5IT9 S;  3A42 A;  1L2B A;  2VQE M;  1Z5A A;  1R2Y A;  1HR0 M;  3GP1 A;  3TWL A;  3U6Q A;  2OPF A;  1KFV A;  4KHP M;  3SAT A;  4YY3 M;  3TWM A;  3U6E A;  3VK7 A;  1IBM M;  2XZF A;  4NXM M;  4LF7 M;  4DUZ M;  4JYA M;  4DR4 M;  4JV5 M;  1N33 M;  1MX0 A;  4DV0 M;  4DV5 M;  1Z5B A;  4G4Q A;  2UUB M;  4CIS A;  2F5S A;  4B3T M;  1L2C A;  1FJG M;  1MU5 A;  3GPX A;  2F5P A;  4JI2 M;  5FLX S;  3VK8 A;  3SAS A;  3GPP A;  2UUC M;  1K3X A;  4JI3 M;  4PDG A;  1L1Z A;  3U6D A;  4B3R M;  4AQY M;  1XMO M;  4DV6 M;  3U6M A;  2ZM6 M;  3U6C A;  3DOA A;  1Q3C A;  1R2Z A;  4DV3 M;  1PJJ A;  4X62 M;  3J81 S;  3JR4 A;  4DUY M;  4GKJ M;  2HKJ A; 
#chains in the Genus database with same CATH topology
 3GQ5 A;  2EKK A;  4II7 A;  2DZO B;  3B7Q A;  3PFI A;  4A3V B;  3TPZ A;  5IRE B;  2FNA A;  2F5N A;  4TUW A;  4M0W A;  2CWB A;  1PJT A;  4IBC A;  3J7B A;  4OW0 A;  4JI0 M;  1HJP A;  1XXH E;  3VLF B;  2EJS A;  2E5L M;  1N32 M;  1N34 M;  4LJ5 A;  1OAO C;  4PD2 A;  3FTC A;  3GRR A;  3SYK A;  2XFT A;  1OAI A;  1QQW A;  1IN6 A;  3RE8 A;  1HNX M;  4JI4 M;  2O5R A;  1G71 A;  1V34 A;  5FTK A;  3D8B A;  5FTJ A;  2N35 A;  2ZAN A;  2Y0Q A;  3CF6 E;  5ITQ A;  1OJL A;  3HJS A;  2ZAO A;  2X8A A;  3TE6 A;  2QPA A;  3SHF A;  3C58 A;  5EQT A;  2D7H A;  1IBL M;  3IHP A;  4DV7 M;  3I4V A;  4MGK E;  1E32 A;  2XFS A;  1VEG A;  3SFZ A;  3HJ8 A;  2QNJ A;  4REZ A;  2Q2E B;  2DWZ B;  1Z59 A;  3KW6 A;  3I51 A;  3KP1 E;  3SAW A;  3VKH A;  1T3T A;  2Z8Y M;  5BPV A;  2RKO A;  2OOA A;  4IJE A;  4FCW A;  1WJ7 A;  2O01 F;  4PDI A;  2XLJ A;  4LF6 M;  3AJI B;  2RGH A;  2ZBK B;  3U61 A;  4AKH A;  1W5T A;  2APL A;  1HT1 E;  3R8F A;  2R46 A;  1MJG M;  4AZF A;  4NRV A;  4DR3 M;  4DV2 M;  2KHH A;  3ZCB B;  1F4I A;  4JI6 M;  1IFY A;  4LGM A;  1IXS B;  1XWI A;  1L8Q A;  2D7E A;  5EP1 A;  5ITY A;  3HZJ A;  3KS8 A;  2KW0 A;  3KXE C;  4G3O A;  1SXJ B;  2QBY A;  2I7N A;  4FCV A;  2WSC F;  2C9C A;  2XEP A;  3KSX A;  5E6J A;  1D2N A;  4R71 A;  3FE3 A;  4W5W A;  3R9X B;  1DV0 A;  5JI3 E;  2DI0 A;  3MMP A;  4WW0 A;  3A98 B;  1DGH B;  5IT9 S;  2DVW B;  2R4J A;  2VF7 A;  1HR0 M;  3FUW A;  4IBK A;  3GP1 A;  1DGF A;  3W68 A;  2RRU A;  3SAT A;  1UM8 A;  3TWM A;  1IBM M;  1QDR A;  2G3Q A;  4PT5 A;  2FH0 A;  3M0E A;  1ORY B;  4DR4 M;  1WR1 B;  1I4W A;  1N33 M;  4G4Q A;  2XF3 A;  3SHG B;  4DV5 M;  2LHG A;  4GIT A;  3NWL A;  1W5S A;  1MU5 A;  1ZQ9 A;  4LZJ A;  1JB0 F;  3I01 M;  1ZMU A;  3VK8 A;  1NO1 A;  2LVO C;  3SAS A;  5C18 A;  1D0K A;  3KDS E;  1K3X A;  2HWJ A;  1PJQ A;  4F2L A;  4PDG A;  3VFD A;  3MHV C;  4AQY M;  1GVN A;  2FFJ A;  2DAG A;  2LVN C;  3B7N A;  3LCV B;  1QYR A;  1QZM A;  1Y8G A;  2XGN A;  3B74 A;  3U6C A;  3DOA A;  1OKS A;  2B3T A;  4BBA A;  1X37 A;  3HGI A;  2BWE A;  2CHQ A;  2J5Y A;  3GLH B;  4DUY M;  3T38 A;  4GKJ M;  2X49 A;  2Y0T A;  3SMP A;  1JQJ C;  3IEC A;  1VQ1 A;  4G6Z A;  1J09 A;  1GJT A;  1EFU B;  3HU2 A;  4GIP A;  4P16 A;  1Z6T A;  1XXH B;  5L8R F;  3FUU A;  2DAI A;  1K82 A;  5E26 A;  1PJS A;  4IIW A;  2YNM D;  3VDU A;  4GC5 A;  4GC9 A;  3B89 A;  3L29 A;  5A2Q S;  3GLI E;  1I94 M;  3J2P B;  2CP8 A;  2DZL A;  2KXE A;  3QYE A;  4IBF A;  4LJ4 A;  3L2A A;  3AOG A;  5EXT A;  1TDZ A;  1TDH A;  1IBK M;  1QAQ A;  2QCU A;  1L2D A;  4AKI A;  2CHV A;  1XC8 A;  2YR0 A;  4LRS A;  3HHW A;  3J80 S;  2VF8 A;  3U6P A;  3BXW A;  2DEN A;  4R7G A;  3F92 A;  4CJ6 A;  5DNY A;  1S3S A;  2UXB M;  2JWS A;  3A45 A;  2XZU A;  2C5R A;  2UXC M;  4KO8 A;  5KPZ A;  4MH0 E;  2BWB A;  2FS1 A;  1OTR A;  2EO2 A;  1OIP A;  3SAV A;  3FTF A;  4NL4 H;  4I8O A;  4RF1 A;  1NHG C;  3SAU A;  3PVS A;  4IBI A;  4IJF A;  4IBJ A;  2KRU A;  1QAN A;  2DWL A;  4LF8 M;  5ITR A;  5FSW A;  1OIZ A;  1Q39 A;  4NOO B;  4LF9 M;  1NY6 A;  2KZU A;  3GLF E;  4NRW A;  2R4E A;  3JAM S;  3KOZ E;  4JN6 A;  3DZD A;  4IBB A;  4LJA A;  3U6O A;  1NV9 A;  2O25 A;  1PM5 A;  1XNR M;  4B08 A;  4M9Z A;  3L27 A;  4DV1 M;  2J7N A;  5GKN A;  1T43 A;  2R0I A;  3QAU A;  4MGZ E;  7CAT A;  3KOY E;  1K3W A;  3GPY A;  1NVM A;  1Z5C A;  4GMQ A;  4L16 A;  3HHY A;  3T1H M;  4LGY A;  4MM3 B;  4LF4 M;  4FD2 A;  4IBD A;  2L4E A;  4B7G A;  2JY5 A;  2R6F A;  2CV1 A;  5ITX E;  3J7A S;  2Z4S A;  5EP4 A;  5LMN M;  4AI6 A;  1GKI A;  4LJ7 A;  2ZTD A;  3ZQJ A;  4DBG B;  2LBC A;  5BR8 M;  3Q8G A;  2K6B A;  4B7H A;  2FE8 A;  3UGJ A;  3D8L A;  3A42 A;  3IG8 A;  1L2B A;  1IN5 A;  1Z5A A;  4M9X A;  4R3D A;  1WGL A;  2DNA A;  2M5Z A;  3QYB A;  2Z3X A;  3VK7 A;  4QOZ C;  3U5Z A;  3LVV A;  2XZF A;  3T15 A;  4NXM M;  2JZ0 A;  3CGW A;  3QWL A;  2DXI A;  4LF7 M;  3GRV A;  2EUC A;  4DUZ M;  2EKF A;  2VII A;  4AG6 A;  2C98 A;  1MX0 A;  2UUB M;  2Y20 A;  1BVS A;  3CTW B;  2WSE F;  1T6O A;  2MH8 A;  4CGY B;  3AFH A;  3FYC A;  4KLN A;  3GLI A;  3HKP A;  2Y21 A;  4FW9 A;  4LJ9 A;  2DKL A;  5FLX S;  3VKG A;  2C99 A;  5KQD A;  3K2L A;  1IY2 A;  4JI3 M;  2C9O A;  3FUT A;  1L1Z A;  3U61 B;  4LJ6 A;  3U60 A;  1YSY A;  1QZE A;  2QP9 X;  1XMO M;  3GRU A;  1LTM A;  3U6M A;  3K1J A;  1G3I A;  2R44 A;  1ZMV A;  4DV3 M;  2G8L A;  3EIE A;  5H37 D;  4I81 A;  3J81 S;  5FTN A;  4OVZ A;  2DAM A;  5EXP A;  2CE7 A;  3Q8X A;  2UU9 M;  5LMU M;  4L8R C;  3I4Y A;  3SBJ A;  1PGY A;  4UN2 B;  2HL7 A;  5DFL A;  3WHL A;  4RKU F;  2OO9 A;  4LFA M;  2WSF F;  4X65 M;  4NSO B;  2JUJ A;  2YFQ A;  3HY5 A;  4LG2 A;  1TH2 A;  2QBY B;  4JI5 M;  1JR3 A;  2M60 A;  2QQ8 A;  2FOI C;  4Z8X A;  4B7F A;  5C1B A;  1AIP C;  1IY0 A;  1IN7 A;  4AW4 A;  1GL7 A;  3GLG A;  3GLF A;  1VDL A;  1NNU C;  1A5T A;  2K0B X;  4NSR A;  2V1U A;  2MGW A;  3SAR A;  2JY8 A;  3KS4 A;  3E4R A;  5FTL A;  2QZ4 A;  1GLN A;  4B3S M;  1E9R A;  3FUX A;  3U6S A;  1Q3B A;  1PRB A;  2K47 A;  3GLH A;  5JI2 E;  1IY1 A;  2XH9 A;  4NXN M;  1H6U A;  3SC3 A;  1CUK A;  5EP2 A;  5ITX A;  1SG9 A;  2K9D A;  1NNJ A;  4GKK M;  1N36 M;  3L26 A;  1TGU A;  1UFZ A;  1ZMW A;  1JR3 D;  2P5T A;  2YQZ A;  3MJ5 A;  4MGH A;  2I7P A;  2BJV A;  4HLQ A;  4Z6Y A;  4ITQ A;  1NY5 A;  1KYI A;  2CV0 A;  2ZAM A;  1HT2 E;  2L7H A;  3H4J A;  3HHZ A;  1SXJ E;  2F5Q A;  4DV4 M;  4QNR A;  3W67 A;  2F4V M;  4AKG A;  3EIH A;  2R45 A;  4MB7 A;  1KSF X;  3L28 A;  2Z7J A;  2W82 A;  3GO8 A;  4ZPX A;  2V1C A;  3UJN A;  1GAB A;  2OQ4 A;  4LY6 A;  1TH4 A;  2Z4R A;  3W0F A;  1TH3 A;  4YHH M;  2UUA M;  5KQ8 A;  1HNW M;  4OX9 M;  2NQ8 C;  1NSF A;  4X66 M;  1G8P A;  1YUB A;  3K92 A;  3LCU A;  3PNV A;  2DAE A;  3FKE A;  4GH9 A;  4I5S A;  3IG5 A;  3SYL A;  2JXN A;  2D7G A;  3FTD A;  4LZZ A;  1IXR C;  4FWD A;  2GQF A;  4K0K M;  4MGY E;  3NBX X;  3C9P A;  4NC6 A;  1JR3 E;  3LMM A;  5EJC A;  1NJG A;  2F5O A;  4RNA A;  3DA1 A;  2KA6 B;  2LVA A;  1OFH A;  3KP0 E;  3GPU A;  3GLG E;  3J27 B;  1QAM A;  1OFI A;  4EIW A;  4CHT B;  1R2Y A;  1R5L A;  2ERC A;  2L6O A;  4GRI A;  3U6Q A;  1E94 E;  4GHL A;  4KHP M;  3U6E A;  3AV0 A;  2KDL A;  3B9P A;  3LW5 F;  4S12 A;  1N77 A;  4LJ8 A;  4Y28 F;  1VG5 A;  1MN3 A;  4GEW A;  2BNK A;  2R65 A;  2RGO A;  2ZTC A;  3GLH E;  2JP7 A;  3LQR A;  2MJ5 B;  1RU3 A;  3I04 M;  4WP2 A;  1G59 A;  4DV0 M;  1Z5B A;  3TL4 X;  8CAT A;  4CIS A;  2F5S A;  2CUZ A;  1L2C A;  1FJG M;  2HAK A;  1GJS A;  1VEJ A;  1WGN A;  3H4M A;  4I4L A;  3AKZ A;  3ZH9 B;  4JXJ A;  3GPX A;  1GO5 A;  4JI2 M;  3GPP A;  3FRH A;  3K8Z A;  5DYG A;  2V6Z M;  3T6P A;  3KOX E;  4D82 A;  4QOS A;  1LV7 A;  3UZU A;  2QSF X;  1TF0 B;  1HQC A;  3CF2 A;  3FUV A;  4XBO A;  4KT0 F;  3B7Z A;  3HHX A;  3BBZ A;  1YLA A;  2ZM6 M;  1QDT A;  1Q3C A;  4LCB A;  4L4U A;  1R2Z A;  1E9S A;  1PJJ A;  2JZ1 A;  1NV8 A;  4X62 M;  3FTE A;  4Q7J A;  3JR4 A;  3HX3 A;  2LVQ D;  5EP3 A;  2HKJ A;  1R4G A;  2H1R A;  2J7O A;  2R18 A;  4BLC A;  5F3W A;  2CEA A;  1AUA A;  4JI1 M;  3M7G A;  3E46 A;  1IXS A;  1FNN A;  2LXE A;  4L78 A;  2VQF M;  1DO0 A;  1IM2 A;  1HNZ M;  2DWN A;  2AHM A;  2L4F A;  3GQ3 A;  3HJQ A;  2KNZ A;  2CV2 A;  1VDD A;  2HHH M;  1N75 A;  1XMQ M;  3GQ4 A;  1J7K A;  4XK8 F;  1SXJ A;  4G4R A;  3T1Y M;  5ITT A;  2XSZ A;  1IN4 A;  3U6L A;  3KOW E;  4JI7 M;  1IN8 A;  2DZN B;  3K9P A;  2LWX A;  3KVW A;  1DGH A;  3HU1 A;  3LQQ A;  4QHS A;  3DFZ A;  3KSJ A;  4IBE A;  4OU7 A;  3U5Z B;  4JI8 M;  3AL0 C;  5EXX A;  1PJI A;  3E9S A;  4DR7 M;  2VDB B;  1VEK A;  2C96 A;  3C3E A;  3JR5 A;  4LFC M;  3W0L B;  4GHA A;  4ANR A;  4BB9 A;  3FYD A;  2BJW A;  3AOE A;  1J5E M;  3WHK A;  5ITU A;  1DGB A;  3LVW A;  1DGG A;  1TTE A;  1WIV A;  2CRU A;  3PNY A;  2G5G X;  2KNV A;  1P3Q Q;  1SXJ C;  2CFO A;  4FCT A;  4L6V 6;  3VDP A;  4IBG A;  4PCZ A;  4XGI A;  1WHC A;  2DAK A;  3GLI B;  1XHB A;  3RGS A;  1QAO A;  4CIZ A;  4LF5 M;  2EA0 A;  3FRI A;  1SXJ D;  2XSZ D;  2LH0 A;  1L1T A;  3U60 B;  3L25 A;  3TWK A;  3UK6 A;  2OOB A;  4X64 M;  4LFB M;  2KRK A;  3A46 A;  1Q02 A;  3AOE C;  3HWS A;  5IWA M;  3K9O A;  1EIJ A;  3KFU G;  2A5Y B;  3GRY A;  4M9S A;  3PXG A;  2L2D A;  4OVZ B;  4DR5 M;  1QUS A;  1IXZ A;  1TR8 A;  4B3M M;  2QHO B;  2HCB A;  2CHG A;  3FD9 A;  2DHY A;  4G4N A;  4G4O A;  1HQY E;  1WXQ A;  3RGP A;  2H5X A;  2JA2 A;  2GNO A;  3V76 A;  2KNA A;  1OQY A;  2WZJ A;  2X4A A;  4QNM A;  1EE8 A;  2KEB A;  4MGI E;  1ZAE A;  1YE9 A;  1C7Y A;  2L09 A;  1XXH A;  2LNH C;  3M6A A;  2UXD M;  2DWM A;  2R62 A;  5IZ7 D;  1XNQ M;  5KO3 A;  2DHR A;  3GLG B;  2JNH A;  3ZC7 B;  4RF0 A;  3GLF B;  4DR6 M;  1V33 A;  1QVR A;  1ZV1 A;  3THG A;  3MK6 A;  3OTO M;  4DR1 M;  4D80 A;  4DR2 M;  4FVM A;  2VQE M;  3BOS A;  5KPT A;  1NJF A;  1D0M A;  4HL4 A;  4M0D A;  3TWL A;  2OPF A;  1KFV A;  3RFW A;  3SMS A;  1XB2 B;  3C3D A;  4KOD A;  4QHT A;  4YY3 M;  2JY7 A;  4L15 A;  3TQS A;  1GL6 A;  4JYA M;  1V92 A;  1DO2 A;  3ILK A;  2KZS A;  4JV5 M;  2MR9 A;  2LHC A;  4LRT A;  1N78 A;  1C1K A;  4B3T M;  1IQP A;  4P17 A;  3NBI A;  1G4A E;  5EXS A;  4AG5 A;  5KPR A;  1R7R A;  2F5P A;  2MRO B;  3UMM A;  4WUR A;  5FTM A;  2UUC M;  2L7I A;  4D81 A;  2LVP C;  1QUT A;  3CF0 A;  5DYI A;  4B3R M;  3U6D A;  1D0L A;  3HU3 A;  4DV6 M;  4FWG A;  1NHW C;  4HEO A;  2LTU A;  1R6B X;  4FWH A;  2QEN A;  2JY6 B;  4F1I A;  1G41 A;  3E21 A; 
#chains in the Genus database with same CATH homology
 3GQ5 A;  4II7 A;  2DZO B;  3PFI A;  4A3V B;  3TPZ A;  5IRE B;  2FNA A;  2F5N A;  4TUW A;  4M0W A;  4IBC A;  4OW0 A;  4JI0 M;  3J7B A;  3VLF B;  2E5L M;  1N32 M;  1N34 M;  4LJ5 A;  4PD2 A;  3FTC A;  3GRR A;  3SYK A;  2XFT A;  1QQW A;  1IN6 A;  3RE8 A;  1HNX M;  4JI4 M;  2O5R A;  5FTK A;  3D8B A;  5FTJ A;  2ZAN A;  2Y0Q A;  3CF6 E;  5ITQ A;  1OJL A;  3HJS A;  2ZAO A;  2X8A A;  3TE6 A;  2QPA A;  3SHF A;  3C58 A;  5EQT A;  2D7H A;  1IBL M;  4DV7 M;  3I4V A;  4MGK E;  1E32 A;  2XFS A;  3SFZ A;  3HJ8 A;  4REZ A;  2Q2E B;  2DWZ B;  1Z59 A;  3KW6 A;  3I51 A;  3KP1 E;  3SAW A;  3VKH A;  1T3T A;  5BPV A;  2RKO A;  4IJE A;  4FCW A;  4PDI A;  2XLJ A;  4LF6 M;  3AJI B;  2RGH A;  2ZBK B;  3U61 A;  4AKH A;  1W5T A;  3R8F A;  1HT1 E;  2R46 A;  4AZF A;  4NRV A;  4DR3 M;  4DV2 M;  3ZCB B;  4JI6 M;  4LGM A;  1IXS B;  1XWI A;  1L8Q A;  2D7E A;  5EP1 A;  5ITY A;  3KS8 A;  2KW0 A;  3KXE C;  1SXJ B;  2QBY A;  2I7N A;  4FCV A;  2XEP A;  2C9C A;  3KSX A;  5E6J A;  1D2N A;  4W5W A;  3R9X B;  5JI3 E;  4WW0 A;  3A98 B;  1DGH B;  5IT9 S;  2DVW B;  2R4J A;  1HR0 M;  3FUW A;  4IBK A;  3GP1 A;  1DGF A;  3SAT A;  1UM8 A;  3TWM A;  1IBM M;  4PT5 A;  3M0E A;  1ORY B;  4DR4 M;  1I4W A;  1N33 M;  4G4Q A;  2XF3 A;  3SHG B;  4DV5 M;  4GIT A;  3NWL A;  1W5S A;  1MU5 A;  1ZQ9 A;  4LZJ A;  3VK8 A;  3SAS A;  5C18 A;  3KDS E;  1K3X A;  4PDG A;  3VFD A;  3MHV C;  4AQY M;  1GVN A;  2FFJ A;  1QYR A;  1QZM A;  2XGN A;  3U6C A;  3DOA A;  4BBA A;  1X37 A;  3HGI A;  2CHQ A;  4DUY M;  3GLH B;  3T38 A;  4GKJ M;  2X49 A;  2Y0T A;  3SMP A;  1JQJ C;  4G6Z A;  4GIP A;  1J09 A;  3HU2 A;  4P16 A;  1Z6T A;  1XXH B;  3FUU A;  1K82 A;  5E26 A;  4IIW A;  2YNM D;  3VDU A;  4GC5 A;  4GC9 A;  3L29 A;  5A2Q S;  1I94 M;  3J2P B;  5EXT A;  2KXE A;  4IBF A;  4LJ4 A;  3L2A A;  3AOG A;  1TDZ A;  1TDH A;  1IBK M;  1QAQ A;  2QCU A;  1L2D A;  4AKI A;  2CHV A;  1XC8 A;  2YR0 A;  4LRS A;  3HHW A;  3J80 S;  3U6P A;  4R7G A;  5DNY A;  2UXB M;  1S3S A;  3A45 A;  2UXC M;  2XZU A;  2C5R A;  4KO8 A;  5KPZ A;  4MH0 E;  2EO2 A;  3SAV A;  3FTF A;  4NL4 H;  4I8O A;  4RF1 A;  1NHG C;  3SAU A;  3PVS A;  4IBI A;  4IJF A;  4IBJ A;  2KRU A;  1QAN A;  2DWL A;  4LF8 M;  5ITR A;  5FSW A;  4NOO B;  1Q39 A;  4LF9 M;  1NY6 A;  2KZU A;  4NRW A;  2R4E A;  3JAM S;  3KOZ E;  4JN6 A;  3DZD A;  4IBB A;  4LJA A;  3U6O A;  1PM5 A;  1XNR M;  4B08 A;  4M9Z A;  3L27 A;  4DV1 M;  2J7N A;  5GKN A;  3QAU A;  4MGZ E;  7CAT A;  1K3W A;  3KOY E;  3GPY A;  1NVM A;  1Z5C A;  4GMQ A;  4L16 A;  3HHY A;  3T1H M;  4LGY A;  4MM3 B;  4LF4 M;  4FD2 A;  4IBD A;  4B7G A;  2CV1 A;  3J7A S;  5ITX E;  2Z4S A;  5EP4 A;  5LMN M;  4AI6 A;  1GKI A;  4LJ7 A;  5BR8 M;  4B7H A;  2FE8 A;  3UGJ A;  3D8L A;  3A42 A;  3IG8 A;  1L2B A;  1IN5 A;  1Z5A A;  4M9X A;  4R3D A;  2M5Z A;  2Z3X A;  3VK7 A;  4QOZ C;  3U5Z A;  3LVV A;  2XZF A;  3T15 A;  4NXM M;  2DXI A;  3QWL A;  4LF7 M;  3GRV A;  2EUC A;  4DUZ M;  2VII A;  4AG6 A;  2C98 A;  1MX0 A;  2UUB M;  2Y20 A;  3CTW B;  4CGY B;  3AFH A;  3FYC A;  4KLN A;  3GLI A;  3HKP A;  2Y21 A;  4FW9 A;  4LJ9 A;  5FLX S;  2C99 A;  5KQD A;  3K2L A;  1IY2 A;  4JI3 M;  2C9O A;  3FUT A;  1L1Z A;  3U61 B;  4LJ6 A;  3U60 A;  1YSY A;  2QP9 X;  1XMO M;  3GRU A;  3U6M A;  3K1J A;  1G3I A;  4DV3 M;  2G8L A;  3EIE A;  5H37 D;  4I81 A;  3J81 S;  5FTN A;  4OVZ A;  5EXP A;  2CE7 A;  3Q8X A;  2UU9 M;  5LMU M;  4L8R C;  3I4Y A;  3SBJ A;  3WHL A;  2HL7 A;  4LFA M;  4X65 M;  4NSO B;  2YFQ A;  4LG2 A;  1TH2 A;  2QBY B;  4JI5 M;  1JR3 A;  2M60 A;  4Z8X A;  2FOI C;  4B7F A;  5C1B A;  1IY0 A;  1IN7 A;  4AW4 A;  1GL7 A;  3GLG A;  3GLF A;  4NSR A;  1NNU C;  2V1U A;  3SAR A;  3KS4 A;  3E4R A;  5FTL A;  2QZ4 A;  1GLN A;  4B3S M;  1E9R A;  3FUX A;  3U6S A;  1Q3B A;  2K47 A;  3GLH A;  5JI2 E;  1IY1 A;  2XH9 A;  4NXN M;  1H6U A;  3SC3 A;  5EP2 A;  5ITX A;  1NNJ A;  4GKK M;  1N36 M;  3L26 A;  1TGU A;  1JR3 D;  2P5T A;  2YQZ A;  3MJ5 A;  4MGH A;  2I7P A;  2BJV A;  4HLQ A;  4Z6Y A;  4ITQ A;  1NY5 A;  1KYI A;  2CV0 A;  2ZAM A;  1HT2 E;  2L7H A;  2F5Q A;  3HHZ A;  1SXJ E;  2F4V M;  4DV4 M;  4QNR A;  4AKG A;  3EIH A;  2R45 A;  4MB7 A;  1KSF X;  3L28 A;  2Z7J A;  2W82 A;  3GO8 A;  4ZPX A;  2V1C A;  3UJN A;  2OQ4 A;  4LY6 A;  1TH4 A;  2Z4R A;  3W0F A;  1TH3 A;  4YHH M;  2UUA M;  5KQ8 A;  1HNW M;  4OX9 M;  2NQ8 C;  1NSF A;  4X66 M;  1G8P A;  1YUB A;  3K92 A;  3PNV A;  4GH9 A;  3FKE A;  3SYL A;  4I5S A;  3IG5 A;  2D7G A;  3FTD A;  4LZZ A;  1IXR C;  4FWD A;  4K0K M;  4MGY E;  3LMM A;  5EJC A;  1NJG A;  2F5O A;  4RNA A;  3DA1 A;  2KA6 B;  1OFH A;  3KP0 E;  3GPU A;  3J27 B;  1QAM A;  1OFI A;  4EIW A;  4CHT B;  1R2Y A;  2ERC A;  2L6O A;  4GRI A;  3U6Q A;  1E94 E;  4GHL A;  4KHP M;  3U6E A;  3AV0 A;  3B9P A;  4S12 A;  1N77 A;  4LJ8 A;  2BNK A;  2R65 A;  2RGO A;  3LQR A;  1G59 A;  4DV0 M;  1Z5B A;  3TL4 X;  8CAT A;  4CIS A;  2F5S A;  2CUZ A;  1L2C A;  1FJG M;  3H4M A;  4I4L A;  3AKZ A;  3ZH9 B;  4JXJ A;  3GPX A;  4JI2 M;  3GPP A;  3K8Z A;  5DYG A;  2V6Z M;  3KOX E;  4D82 A;  4QOS A;  1LV7 A;  3UZU A;  1HQC A;  3CF2 A;  3FUV A;  4XBO A;  3HHX A;  2ZM6 M;  1Q3C A;  4LCB A;  4L4U A;  1R2Z A;  1E9S A;  1PJJ A;  4X62 M;  3FTE A;  3JR4 A;  5EP3 A;  2HKJ A;  2R18 A;  2H1R A;  2J7O A;  4BLC A;  5F3W A;  2CEA A;  4JI1 M;  3M7G A;  1FNN A;  2LXE A;  4L78 A;  2VQF M;  1DO0 A;  1IM2 A;  1HNZ M;  2DWN A;  2AHM A;  3GQ3 A;  3HJQ A;  2CV2 A;  1VDD A;  2HHH M;  1N75 A;  1XMQ M;  3GQ4 A;  1J7K A;  3T1Y M;  1SXJ A;  4G4R A;  5ITT A;  2XSZ A;  1IN4 A;  3U6L A;  3KOW E;  4JI7 M;  1IN8 A;  2DZN B;  2LWX A;  3KVW A;  1DGH A;  3HU1 A;  3LQQ A;  4QHS A;  3DFZ A;  3KSJ A;  4IBE A;  3U5Z B;  4JI8 M;  3AL0 C;  4DR7 M;  5EXX A;  1PJI A;  3E9S A;  2C96 A;  3JR5 A;  4LFC M;  3W0L B;  4GHA A;  4BB9 A;  3FYD A;  2BJW A;  3AOE A;  1J5E M;  3WHK A;  5ITU A;  1DGB A;  3LVW A;  1DGG A;  3PNY A;  4FCT A;  2G5G X;  4OU7 A;  1SXJ C;  2CFO A;  3VDP A;  4IBG A;  4PCZ A;  4XGI A;  3GLI B;  1XHB A;  3RGS A;  1QAO A;  4LF5 M;  2EA0 A;  1SXJ D;  2XSZ D;  2LH0 A;  1L1T A;  3U60 B;  3L25 A;  3TWK A;  3UK6 A;  4LFB M;  4X64 M;  2KRK A;  3A46 A;  3AOE C;  3HWS A;  5IWA M;  3KFU G;  2A5Y B;  3GRY A;  4M9S A;  3PXG A;  4OVZ B;  4DR5 M;  4B3M M;  1IXZ A;  2HCB A;  2CHG A;  3FD9 A;  4G4N A;  4G4O A;  1HQY E;  1WXQ A;  3RGP A;  2JA2 A;  3VKG A;  2X4A A;  4QNM A;  1EE8 A;  2KEB A;  4MGI E;  1ZAE A;  1YE9 A;  2L09 A;  1XXH A;  2LNH C;  3M6A A;  2UXD M;  2DWM A;  2R62 A;  5IZ7 D;  1XNQ M;  5KO3 A;  2DHR A;  3GLG B;  3ZC7 B;  4DR6 M;  4RF0 A;  3GLF B;  1QVR A;  3THG A;  3MK6 A;  3OTO M;  4DR1 M;  4D80 A;  4DR2 M;  4FVM A;  2VQE M;  3BOS A;  5KPT A;  1NJF A;  3TWL A;  4HL4 A;  4M0D A;  1KFV A;  2OPF A;  3RFW A;  3SMS A;  4KOD A;  4QHT A;  4YY3 M;  4L15 A;  3TQS A;  1GL6 A;  4JYA M;  1DO2 A;  3ILK A;  2KZS A;  4JV5 M;  4LRT A;  1N78 A;  1C1K A;  4B3T M;  1IQP A;  3NBI A;  1G4A E;  5EXS A;  4AG5 A;  5KPR A;  1R7R A;  2F5P A;  3UMM A;  4WUR A;  5FTM A;  2UUC M;  2L7I A;  4D81 A;  3CF0 A;  5DYI A;  4B3R M;  3U6D A;  3HU3 A;  4DV6 M;  4FWG A;  1NHW C;  1R6B X;  4FWH A;  2QEN A;  1G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...