3TWLA

Crystal structure of arabidopsis thaliana fpg
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
286
structure length
263
Chain Sequence
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAYVPELQKLYGKDAEKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase 1
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 78
structure length 263
sequence length 286
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twlA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twlA01
4G4QA 5FLXS 1K3XA 1Q39A 4JI4M 1HR0M 2F5PA 4JI2M 4DR6M 1J5EM 4CISA 2UXBM 4DR2M 1EE8A 3SBJA 2EA0A 4X65M 2Q2EB 2HHHM 3U6EA 1XNRM 1HNXM 2OPFA 1L1TA 4GKKM 4PD2A 2F5QA 2XZFA 2F5OA 5IT9S 5ITQA 1N33M 4KHPM 1N34M 5ITXA 1L2DA 4YHHM 4DV6M 1PM5A 1I94M 3U6LA 4GKJM 1L1ZA 4LF9M 3OTOM 2ZM6M 3U6MA 3U6PA 3SATA 1MU5A 4NRWA 1NNJA 1MX0A 1FJGM 3GPXA 4JI3M 1TDZA 4YY3M 3SAVA 4LFCM 1R2YA 5LMNM 4DV1M 2XZUA 5ITXE 5ITUA 1N32M 3GQ5A 1Q3CA 1Z5CA 3GO8A 3GQ4A 2E5LM 1IBMM 3J7AS 3A45A 3J80S 1L2CA 3U6SA 4JI1M 5LMUM 4DR3M 4X62M 4G4OA 3U6DA 2VQFM 4X66M 4DR7M 1Z5AA 3GQ3A 4JV5M 1L2BA 3JAMS 4DV5M 1KFVA 4MB7A 2ZBKB 3JR5A 4B3SM 3GPPA 4DUZM 4DV7M 4OX9M 1N36M 4JI7M 5ITRA 5A2QS 3GP1A 2F5NA 4PDIA 4DV3M 4DV0M 5IWAM 4NXMM 3C58A 1XMOM 4K0KM 4AQYM 2UU9M 3U6QA 1K3WA 4ITQA 1Q3BA 1PJIA 4DR1M 4G4RA 3U6OA 3SAUA 3T1YM 1Z59A 3A42A 3TWLA 1XC8A 1TDHA 2F4VM 4JI6M 4JI8M 5ITTA 3W0FA 1K82A 4PDGA 4DV4M 4DV2M 1Z5BA 3T1HM 4B3TM 4LFBM 3VK7A 5ITYA 3SASA 4NRVA 3SAWA 1IBKM 3J81S 1XMQM 4B3RM 2VQEM 4JI5M 3GPYA 3GPUA 3U6CA 4DR5M 1IBLM 2UUAM 4JI0M 3VK8A 3SARA 3DOAA 2UXCM 3TWMA 4LF6M 3A46A 4X64M 4LF7M 4LFAM 2F5SA 2HKJA 4PCZA 4LF5M 4JYAM 3JR4A 4G4NA 4DR4M 1XNQM 4DUYM 2UUBM 2UUCM 4B3MM 5BR8M 4NXNM 1PJJA 4LF8M 2UXDM 3TWKA 1R2ZA 4LF4M 1HNZM 2OQ4A 1HNWM
chains in the Genus database with same CATH superfamily
4MGKE 2W82A 3KFUG 5L8RF 2CHQA 3TQSA 1HT1E 4M0WA 4Y28F 1OKSA 1G8PA 3SYKA 1YSYA 3KP0E 1X37A 2DAKA 3GLHB 1DGHB 2QBYB 1V33A 2F5PA 2QBYA 3AFHA 1J5EM 4CISA 1EE8A 3FUTA 1SG9A 4LZJA 3FTEA 3H4MA 1HNXM 1NHWC 2VIIA 3Q8XA 1DO2A 5IT9S 2CV1A 4MGIE 4QOSA 4QNMA 4RNAA 1N34M 2M60A 4OVZB 2OOBA 3SC3A 4YHHM 5FTLA 3HZJA 1I94M 2ERCA 2D7EA 2MROB 1Z6TA 3D8LA 1UFZA 1GJSA 4Z8XA 4FWHA 3SATA 2MGWA 2V1CA 3H4JA 1IN8A 2DNAA 3GPXA 3KSXA 4JI3M 1NNUC 2KNAA 4GIPA 1WIVA 2LVQD 3D8BA 3KOWE 2L2DA 1XHBA 3MHVC 2XZUA 4EIWA 5KPRA 3I4VA 3K8ZA 1G71A 4PT5A 1Q3CA 2FOIC 3GO8A 3A98B 3GQ4A 3QYEA 4HL4A 3B89A 2DXIA 2JZ1A 3ZH9B 4XBOA 1ZAEA 2QHOB 2R18A 1WGNA 1QQWA 1UM8A 1Z5AA 4QHSA 1AIPC 1MJGM 1DGFA 2APLA 3DFZA 1L2BA 2ZANA 2B3TA 2L4FA 1FNNA 3AOEC 4RF0A 3BBZA 3HJ8A 4G6ZA 4IJFA 3K1JA 4DV7M 3KS8A 1N36M 4JI7M 4GMQA 4B7HA 3GP1A 1HJPA 4L4UA 1R4GA 4A3VB 1N77A 4AQYM 1JR3D 3W67A 1NHGC 1XXHB 3FYDA 4RKUF 2KDLA 2DVWB 2K9DA 2I7PA 3HU2A 3VFDA 3GLFB 3KOXE 4IJEA 4DBGB 4DR1M 1PJIA 3EIHA 3C3EA 3FUVA 2DKLA 1A5TA 2JWSA 2HL7A 4JXJA 3T1YM 3CF2A 2R62A 3GRUA 3HU1A 3B7NA 2D7HA 2JZ0A 2LVNC 3SHFA 2LVOC 1TGUA 3I01M 3DZDA 4F2LA 2JY8A 2KXEA 2Z4SA 4GC9A 4JI8M 4FCVA 3W0FA 2JP7A 1ZV1A 3WHKA 1Z5BA 3C9PA 4DV4M 3T1HM 3VK7A 2K47A 2CWBA 1IQPA 2ZAOA 1W5TA 4IBIA 2VQEM 4P17A 1KSFX 5EXSA 3SARA 3MJ5A 1ZMUA 3SMPA 2EKFA 4L78A 4NC6A 4AG5A 2L7HA 4LF6M 3KS4A 1IFYA 2QPAA 2OOAA 2DWZB 2G5GX 3RE8A 2WSEF 4JN6A 1VEJA 4LGMA 4CGYB 4IIWA 3GLHE 4HLQA 4IBGA 3VKHA 1G3IA 2LVPC 1NJFA 2X49A 2L4EA 4FW9A 1HNZM 1TF0B 1C7YA 2KRUA 3RGSA 2F5NA 2KW0A 1LV7A 1JR3A 1Q02A 4AKIA 3ZCBB 2CUZA 2KA6B 2KNVA 3B9PA 4I4LA 5DYGA 4BB9A 2CEAA 2EKKA 4KT0F 1WGLA 1ZMWA 4FWGA 2AHMA 4DR6M 1ZQ9A 2MJ5B 2Z8YM 4BLCA 2Z4RA 2CE7A 3K9PA 3KDSE 3TL4X 1JB0F 4L15A 2UXBM 3EIEA 4X65M 2LBCA 2YNMD 2BWBA 1NV9A 3IECA 2ZAMA 3AKZA 2F5QA 2C96A 3IHPA 2Z3XA 2C5RA 2DWMA 1N33M 2JUJA 4GH9A 4WW0A 4M9SA 5EP4A 5ITXA 1PM5A 1XB2B 1L1ZA 4LF9M 5IZ7D 2L09A 3KOYE 4D82A 4AZFA 3CTWB 1MU5A 4NRWA 5IREB 2UUAM 4FCTA 2V1UA 1MX0A 2C9CA 4LRSA 1FJGM 5KPZA 3THGA 3K2LA 3SAVA 1QZEA 3GRVA 5FTNA 5LMNM 1R2YA 3QWLA 2XSZA 2BJWA 2EUCA 4MGYE 3MMPA 1QDRA 3FRIA 1E94E 4WP2A 1QYRA 2E5LM 1CUKA 3J7AS 3F92A 2O01F 4FD2A 3RGPA 1VEGA 4L8RC 5EP2A 4CJ6A 4DR3M 4RF1A 2BNKA 3UJNA 4X62M 1LTMA 2R4JA 2R4EA 3FRHA 1SXJA 1GLNA 2BJVA 1BVSA 1T43A 2N35A 4FWDA 4IBKA 4OW0A 5GKNA 4X66M 1OIZA 3HWSA 3GQ3A 2XFSA 1GO5A 1OIPA 3E9SA 4IBJA 4CHTB 3I04M 4QNRA 2HCBA 2LXEA 3HKPA 1XXHE 3LQQA 5E6JA 3TE6A 3GLFE 3CGWA 4KO8A 1GVNA 3GPPA 4AKHA 4DUZM 1L8QA 3GRRA 4OX9M 1HT2E 1IM2A 3FUXA 3J7BA 1NO1A 5ITRA 5F3WA 3VKGA 1MN3A 2LTUA 1VDDA 4GRIA 1IN6A 5KO3A 4NXMM 1OAOC 1DGBA 2DHYA 4AG6A 3C58A 5JI3E 3U60A 4GEWA 1NJGA 4ANRA 1XMOM 4K0KM 4ITQA 3GLIB 1Q3BA 5H37D 3GLIA 3SFZA 3HGIA 3M0EA 3VDPA 4G4RA 5DYIA 2NQ8C 1XWIA 1T3TA 1Z59A 1QZMA 1QAQA 2D7GA 1S3SA 3HHWA 3K9OA 4QHTA 3W68A 2CV0A 1R7RA 3L2AA 1C1KA 1IY0A 3BOSA 4Z6YA 3RFWA 5ITTA 4GITA 2DAEA 2R45A 2R6FA 1XMQM 4B7FA 1PJQA 2K0BX 1RU3A 2DZLA 1JQJC 2WSFF 4IBFA 3GLGA 3HHYA 1P3QQ 4X64M 2F5SA 2M5ZA 3AOGA 4IBDA 4JYAM 1ZMVA 1YE9A 1XNQM 2RRUA 4GHLA 7CATA 3FTCA 3PNYA 1GL7A 5BR8M 1NY5A 1QANA 2O5RA 3ZC7B 5FSWA 2JY5A 3UMMA 4LF4M 1HNWM 1V92A 1YUBA 4G3OA 4IBBA 4G4QA 3HU3A 1K3XA 4NSRA 3PNVA 4LJ9A 1HR0M 4AKGA 3R9XB 4AW4A 2QENA 2HWJA 2XEPA 2XH9A 4L16A 1QUTA 2BWEA 2FH0A 4OU7A 2EA0A 2CHVA 3SBJA 2HHHM 1EFUB 1YLAA 3VDUA 1L1TA 2DAMA 4PD2A 2JA2A 2XZFA 2F5OA 5ITQA 3U61A 2DI0A 3AL0C 2JY7A 5BPVA 2HAKA 1L2DA 4W5WA 1EIJA 4S12A 2XSZD 1DV0A 2LVAA 3U6LA 4GKJM 1HQCA 1E9RA 1QVRA 3V76A 3BXWA 3KP1E 3OTOM 2ZM6M 2C98A 2CV2A 1HQYE 1PJSA 3I4YA 3U6PA 1VG5A 1NNJA 4GHAA 3FYCA 3C3DA 2P5TA 3PFIA 4LJ8A 2FFJA 2H5XA 2DHRA 3U5ZA 4LFCM 2VDBB 4TUWA 1SXJD 2CHGA 4LJAA 1NSFA 1OAIA 4LJ4A 1N32M 3GQ5A 1Z5CA 3QYBA 2YR0A 1GKIA 1IBMM 1R6BX 3FUUA 3MK6A 3KOZE 2KNZA 3J80S 3U6SA 3T15A 1WHCA 3B7ZA 4G4OA 1TH3A 2X8AA 1V34A 2OO9A 3GRYA 2XLJA 1PRBA 4GC5A 4DR7M 1QDTA 4JV5M 4UN2B 1OFIA 3JAMS 3TPZA 1KFVA 2Y20A 2ZTCA 5KPTA 2GNOA 2DWNA 4MGZE 1IN7A 1ORYB 3KVWA 4P16A 1PGYA 3HX3A 4HEOA 2XGNA 4LJ6A 4LGYA 5A2QS 2QSFX 4PDIA 3UZUA 1OTRA 4DV3M 5IWAM 1D2NA 3UGJA 1E9SA 2UU9M 5EQTA 5FTKA 1K3WA 3E21A 4REZA 1G41A 4LZZA 2KRKA 3L26A 3SAUA 1D0MA 2G8LA 8CATA 3IG8A 3LVVA 2RGOA 3FE3A 1N75A 1SXJB 3TWLA 1TDHA 2L7IA 3ZQJA 4LFBM 2DAGA 1W5SA 4B08A 1GABA 1OQYA 4M0DA 4I81A 5ITYA 2KZUA 4LCBA 2C9OA 2MR9A 3J81S 3DA1A 2J5YA 4JI5M 3GLHA 1DGHA 3I51A 5EXTA 1IBLM 1OFHA 1T6OA 2QP9X 4JI0M 2FE8A 2R65A 3FTDA 4BBAA 3VK8A 2VF8A 2H1RA 4NL4H 5DNYA 4FCWA 2EJSA 3U60B 4R7GA 1IXSB 4LF7M 4LFAM 4IBEA 5EP3A 1IXSA 2HKJA 2LHCA 3B7QA 4LF5M 5KQDA 2UUBM 2UUCM 4OVZA 3LCVB 4I5SA 3K92A 2CP8A 1DGGA 1PJJA 1J09A 4KLNA 4LF8M 3FTFA 2MH8A 1R2ZA 4I8OA 1VQ1A 3T38A 2OQ4A 1H6UA 3ILKA 2LHGA 4LG2A 1VEKA 5FLXS 1F4IA 1DO0A 4KODA 3PXGA 1Q39A 5EJCA 3SHGB 4JI4M 4D81A 5EXXA 4JI2M 4DR2M 3GLGB 1G59A 1IY2A 2Q2EB 1XNRM 3U6EA 1E32A 2OPFA 5EXPA 4GKKM 1JR3E 2X4AA 4M9XA 4LY6A 3QAUA 5EP1A 1R5LA 3AJIB 2CRUA 3J2PB 4MM3B 4DV6M 2K6BA 3W0LB 3Q8GA 2O25A 2GQFA 3U6MA 1IXZA 1Y8GA 4R3DA 2XFTA 2A5YB 2KHHA 1NV8A 3B74A 3L27A 3R8FA 1TDZA 4YY3M 3KSJA 4WURA 2LWXA 4DV1M 1J7KA 5ITXE 4MH0E 1D0KA 5DFLA 1GL6A 3WHLA 1NY6A 4XGIA 5ITUA 3NWLA 1QAMA 1TH2A 3HJSA 1NVMA 2R0IA 1XXHA 3PVSA 4LRTA 1GJTA 3E46A 1G4AE 3GLFA 3A45A 1L2CA 4JI1M 5LMUM 3FKEA 3U61B 3M7GA 2G3QA 2C99A 3U6DA 3CF0A 2FS1A 2VQFM 2JXNA 3T6PA 1IN4A 4LJ7A 4NOOB 2I7NA 3AOEA 4QOZC 4NSOB 2KEBA 1IN5A 5FTJA 4DV5M 2FNAA 1WJ7A 3E4RA 2LH0A 3SMSA 4Q7JA 2QNJA 4IBCA 3L29A 4MB7A 2RGHA 3KW6A 2ZBKB 1I4WA 2Y0QA 3JR5A 3U5ZB 4B3SM 1QAOA 3LCUA 2QQ8A 5JI2E 2Y21A 3L28A 3LVWA 1IY1A 1SXJE 3HJQA 4II7A 2DZOB 4DV0M 3L25A 1TR8A 4D80A 2EO2A 2YFQA 3FD9A 4B7GA 2L6OA 3J27B 3U6QA 4R71A 3AV0A 2YQZA 2RKOA 4F1IA 4FVMA 1WXQA 2ZTDA 3M6AA 2DWLA 2R44A 3LW5F 1IXRC 2DAIA 3VLFB 3U6OA 5E26A 1QUSA 3CF6E 1VDLA 2Z7JA 4LJ5A 3A42A 1XC8A 2CFOA 5C1BA 2JY6B 2V6ZM 3NBXX 4JI6M 2KZSA 3IG5A 4CIZA 5C18A 2LNHC 4PDGA 1K82A 4DV2M 4B3TM 3HHXA 2WZJA 2R46A 3FUWA 3LQRA 3LMMA 4M9ZA 4NRVA 3SASA 1SXJC 3GLIE 3SAWA 1IBKM 5FTMA 4B3RM 2WSCF 3GPYA 1TTEA 3GPUA 4DR5M 3U6CA 2JNHA 1OJLA 5KQ8A 3DOAA 2UXCM 3TWMA 1D0LA 3NBIA 3UK6A 3SYLA 3A46A 2DZNB 4XK8F 3KXEC 2DENA 4ZPXA 2J7NA 4L6V6 2F4VM 4PCZA 2QZ4A 4MGHA 3JR4A 2J7OA 4G4NA 4DR4M 4DUYM 1N78A 4AI6A 2XF3A 2Y0TA 4B3MM 1WR1B 1AUAA 4NXNM 2QCUA 3HHZA 1PJTA 3HY5A 2UXDM 2VF7A 1KYIA 3TWKA 3GLGE 4KHPM 1TH4A
chains in the Genus database with same CATH topology
4MGKE 2W82A 3KFUG 2CHQA 3TQSA 1HT1E 4M0WA 3SYKA 1G8PA 1YSYA 3KP0E 1X37A 3GLHB 1DGHB 2QBYB 2F5PA 2QBYA 3AFHA 1J5EM 4CISA 1EE8A 3FUTA 4LZJA 3FTEA 3H4MA 1HNXM 1NHWC 2VIIA 3Q8XA 1DO2A 5IT9S 2CV1A 4MGIE 4QOSA 4QNMA 4RNAA 1N34M 2M60A 4OVZB 3SC3A 4YHHM 5FTLA 1I94M 2ERCA 2D7EA 1Z6TA 3D8LA 4Z8XA 4FWHA 3SATA 2V1CA 1IN8A 3GPXA 3KSXA 4JI3M 1NNUC 4GIPA 3D8BA 3KOWE 1XHBA 3MHVC 2XZUA 4EIWA 5KPRA 3I4VA 3K8ZA 4PT5A 1Q3CA 2FOIC 3GO8A 3A98B 3GQ4A 4HL4A 2DXIA 3ZH9B 4XBOA 1ZAEA 2R18A 1QQWA 1UM8A 1Z5AA 4QHSA 1DGFA 1L2BA 3DFZA 2ZANA 1FNNA 3AOEC 4RF0A 3HJ8A 4G6ZA 4IJFA 3K1JA 4DV7M 3KS8A 1N36M 4JI7M 4GMQA 4B7HA 3GP1A 4L4UA 4A3VB 1N77A 4AQYM 1JR3D 1NHGC 1XXHB 3FYDA 2DVWB 3HU2A 2I7PA 3VFDA 3GLFB 1PJIA 3KOXE 4IJEA 4DR1M 3EIHA 3FUVA 4JXJA 2HL7A 3T1YM 3CF2A 3HU1A 3GRUA 2R62A 2D7HA 3SHFA 1TGUA 3DZDA 2KXEA 2Z4SA 4GC9A 4JI8M 4FCVA 3W0FA 3WHKA 4DV4M 1Z5BA 3T1HM 3VK7A 2K47A 1IQPA 2ZAOA 1W5TA 4IBIA 2VQEM 1KSFX 5EXSA 3SARA 3MJ5A 3SMPA 4L78A 4AG5A 2L7HA 4LF6M 3KS4A 2QPAA 2DWZB 2G5GX 3RE8A 4JN6A 4LGMA 4CGYB 4IIWA 4HLQA 4IBGA 3VKHA 1G3IA 1NJFA 2X49A 4FW9A 1HNZM 2F5NA 2KRUA 3RGSA 2KW0A 1LV7A 1JR3A 4AKIA 3ZCBB 2CUZA 2KA6B 3B9PA 4I4LA 4BB9A 5DYGA 2CEAA 4FWGA 2AHMA 4DR6M 1ZQ9A 4BLCA 2Z4RA 2CE7A 3KDSE 3TL4X 2UXBM 4L15A 3EIEA 4X65M 2YNMD 2ZAMA 3AKZA 2F5QA 2C96A 2Z3XA 2C5RA 2DWMA 1N33M 4GH9A 4WW0A 4M9SA 5EP4A 5ITXA 1PM5A 1L1ZA 4LF9M 5IZ7D 2L09A 3KOYE 4D82A 4AZFA 3CTWB 1MU5A 4NRWA 5IREB 2UUAM 4FCTA 2V1UA 1MX0A 2C9CA 4LRSA 1FJGM 5KPZA 3THGA 3K2LA 3SAVA 3GRVA 1R2YA 5FTNA 5LMNM 3QWLA 2XSZA 2BJWA 2EUCA 4MGYE 1E94E 1QYRA 2E5LM 3J7AS 4FD2A 3RGPA 4L8RC 5EP2A 4DR3M 4RF1A 2BNKA 3UJNA 4X62M 2R4EA 2R4JA 1SXJA 1GLNA 2BJVA 4IBKA 4OW0A 4X66M 4FWDA 5GKNA 3HWSA 3GQ3A 2XFSA 3E9SA 4IBJA 4CHTB 4QNRA 2HCBA 2LXEA 3HKPA 3LQQA 5E6JA 3TE6A 4KO8A 1GVNA 3GPPA 4AKHA 4DUZM 1L8QA 3GRRA 4OX9M 1HT2E 1IM2A 3FUXA 3J7BA 5ITRA 5F3WA 3VKGA 1VDDA 4GRIA 1IN6A 5KO3A 4NXMM 1DGBA 4AG6A 3C58A 5JI3E 3U60A 1XMOM 1NJGA 4K0KM 4ITQA 3GLIB 1Q3BA 5H37D 3GLIA 3SFZA 3HGIA 3M0EA 3VDPA 4G4RA 5DYIA 2NQ8C 1XWIA 1T3TA 1Z59A 1QZMA 1QAQA 2D7GA 1S3SA 3HHWA 4QHTA 2CV0A 1R7RA 3L2AA 1C1KA 1IY0A 3BOSA 4Z6YA 3RFWA 5ITTA 4GITA 2R45A 1XMQM 4B7FA 1JQJC 3GLGA 4IBFA 3HHYA 4X64M 2F5SA 2M5ZA 3AOGA 4IBDA 4JYAM 1YE9A 1XNQM 4GHLA 7CATA 3FTCA 3PNYA 1GL7A 5BR8M 1NY5A 1QANA 2O5RA 3ZC7B 5FSWA 3UMMA 4LF4M 1HNWM 1YUBA 4IBBA 4G4QA 3HU3A 1K3XA 4NSRA 3PNVA 4LJ9A 1HR0M 4AKGA 3R9XB 4AW4A 2QENA 2XH9A 2XEPA 4L16A 4OU7A 4TUWA 3SBJA 2EA0A 2CHVA 2HHHM 3VDUA 1L1TA 4PD2A 2JA2A 2XZFA 2F5OA 5ITQA 3U61A 3AL0C 1L2DA 5BPVA 4W5WA 4S12A 2XSZD 3U6LA 4GKJM 1HQCA 1E9RA 1QVRA 3OTOM 3KP1E 2ZM6M 2C98A 2CV2A 1HQYE 3I4YA 3U6PA 1NNJA 4GHAA 3FYCA 2P5TA 3PFIA 4LJ8A 2FFJA 3U5ZA 2DHRA 4LFCM 1SXJD 2CHGA 4LJAA 1NSFA 4LJ4A 1N32M 3GQ5A 1Z5CA 2YR0A 1GKIA 1IBMM 1R6BX 3FUUA 3MK6A 3KOZE 3J80S 3U6SA 3T15A 4G4OA 1TH3A 2X8AA 3GRYA 2XLJA 4GC5A 4DR7M 4JV5M 1OFIA 3JAMS 3TPZA 1KFVA 2Y20A 5KPTA 2DWNA 4MGZE 1IN7A 1ORYB 3KVWA 4P16A 2XGNA 4LJ6A 4LGYA 5A2QS 4PDIA 3UZUA 4DV3M 5IWAM 1D2NA 3UGJA 1E9SA 2UU9M 5EQTA 5FTKA 1K3WA 4REZA 1G41A 4LZZA 2KRKA 3L26A 3SAUA 2G8LA 8CATA 3IG8A 3LVVA 2RGOA 1N75A 1SXJB 3TWLA 1TDHA 2L7IA 4LFBM 1W5SA 4B08A 4M0DA 4I81A 5ITYA 2KZUA 4LCBA 2C9OA 3J81S 3DA1A 4JI5M 3GLHA 1DGHA 3I51A 5EXTA 1IBLM 1OFHA 2QP9X 4JI0M 4BBAA 2FE8A 2R65A 3FTDA 3VK8A 2H1RA 4NL4H 5DNYA 4FCWA 3U60B 4R7GA 1IXSB 4LF7M 4LFAM 4IBEA 5EP3A 2HKJA 4LF5M 5KQDA 2UUBM 2UUCM 4OVZA 4I5SA 3K92A 1DGGA 1PJJA 1J09A 4KLNA 4LF8M 3FTFA 1R2ZA 4I8OA 3T38A 2OQ4A 1H6UA 3ILKA 4LG2A 5FLXS 1DO0A 4KODA 3PXGA 1Q39A 5EJCA 3SHGB 4JI4M 4D81A 5EXXA 4JI2M 4DR2M 3GLGB 1G59A 1IY2A 2Q2EB 1XNRM 3U6EA 1E32A 2OPFA 5EXPA 4GKKM 2X4AA 4M9XA 4LY6A 3QAUA 5EP1A 3AJIB 3J2PB 4MM3B 4DV6M 3W0LB 3U6MA 1IXZA 4R3DA 2XFTA 2A5YB 3L27A 3R8FA 1TDZA 4YY3M 3KSJA 4WURA 2LWXA 4DV1M 1J7KA 5ITXE 4MH0E 3WHLA 1GL6A 1NY6A 4XGIA 5ITUA 3NWLA 1QAMA 1TH2A 3HJSA 1NVMA 3PVSA 1XXHA 4LRTA 1G4AE 3GLFA 3A45A 1L2CA 4JI1M 5LMUM 3FKEA 3U61B 3M7GA 2C99A 3U6DA 3CF0A 2VQFM 1IN4A 4LJ7A 4NOOB 2I7NA 3AOEA 4QOZC 4NSOB 2KEBA 1IN5A 5FTJA 4DV5M 2FNAA 3E4RA 2LH0A 3SMSA 4IBCA 3L29A 4MB7A 3KW6A 2RGHA 2ZBKB 1I4WA 2Y0QA 3JR5A 3U5ZB 4B3SM 1QAOA 5JI2E 2Y21A 3L28A 3LVWA 1IY1A 1SXJE 3HJQA 4II7A 2DZOB 4DV0M 3L25A 4D80A 2EO2A 2YFQA 3FD9A 4B7GA 2L6OA 3J27B 3U6QA 3AV0A 2YQZA 2RKOA 4FVMA 1WXQA 3M6AA 2DWLA 3VLFB 3U6OA 1IXRC 5E26A 3CF6E 2Z7JA 4LJ5A 3A42A 1XC8A 2CFOA 5C1BA 2V6ZM 2F4VM 4JI6M 2KZSA 3IG5A 5C18A 1K82A 2LNHC 4PDGA 4B3TM 4DV2M 3HHXA 2R46A 3FUWA 3LQRA 3LMMA 4M9ZA 4NRVA 3SASA 1SXJC 3SAWA 1IBKM 5FTMA 4B3RM 3GPYA 3GPUA 3U6CA 4DR5M 1OJLA 5KQ8A 3DOAA 2UXCM 3TWMA 3NBIA 3UK6A 3SYLA 3A46A 2DZNB 3KXEC 4ZPXA 2J7NA 4PCZA 2QZ4A 4MGHA 3JR4A 2J7OA 4G4NA 4DR4M 4DUYM 1N78A 4AI6A 2XF3A 2Y0TA 4B3MM 4NXNM 2QCUA 3HHZA 2UXDM 1KYIA 3TWKA 4KHPM 1TH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4Q A;  5FLX S;  1K3X A;  1Q39 A;  4JI4 M;  1HR0 M;  2F5P A;  4JI2 M;  4DR6 M;  1J5E M;  4CIS A;  2UXB M;  4DR2 M;  1EE8 A;  3SBJ A;  2EA0 A;  4X65 M;  2Q2E B;  2HHH M;  3U6E A;  1XNR M;  1HNX M;  2OPF A;  1L1T A;  4GKK M;  4PD2 A;  2F5Q A;  2XZF A;  2F5O A;  5IT9 S;  5ITQ A;  1N33 M;  4KHP M;  1N34 M;  5ITX A;  1L2D A;  4YHH M;  4DV6 M;  1PM5 A;  1I94 M;  3U6L A;  4GKJ M;  1L1Z A;  4LF9 M;  3OTO M;  2ZM6 M;  3U6M A;  3U6P A;  3SAT A;  1MU5 A;  4NRW A;  1NNJ A;  1MX0 A;  1FJG M;  3GPX A;  4JI3 M;  1TDZ A;  4YY3 M;  3SAV A;  4LFC M;  1R2Y A;  5LMN M;  4DV1 M;  2XZU A;  5ITX E;  5ITU A;  1N32 M;  3GQ5 A;  1Q3C A;  1Z5C A;  3GO8 A;  3GQ4 A;  2E5L M;  1IBM M;  3J7A S;  3A45 A;  3J80 S;  1L2C A;  3U6S A;  4JI1 M;  5LMU M;  4DR3 M;  4X62 M;  4G4O A;  3U6D A;  2VQF M;  4X66 M;  4DR7 M;  1Z5A A;  3GQ3 A;  4JV5 M;  1L2B A;  3JAM S;  4DV5 M;  1KFV A;  4MB7 A;  2ZBK B;  3JR5 A;  4B3S M;  3GPP A;  4DUZ M;  4DV7 M;  4OX9 M;  1N36 M;  4JI7 M;  5ITR A;  5A2Q S;  3GP1 A;  2F5N A;  4PDI A;  4DV3 M;  4DV0 M;  5IWA M;  4NXM M;  3C58 A;  1XMO M;  4K0K M;  4AQY M;  2UU9 M;  3U6Q A;  1K3W A;  4ITQ A;  1Q3B A;  1PJI A;  4DR1 M;  4G4R A;  3U6O A;  3SAU A;  3T1Y M;  1Z59 A;  3A42 A;  3TWL A;  1XC8 A;  1TDH A;  2F4V M;  4JI6 M;  4JI8 M;  5ITT A;  3W0F A;  1K82 A;  4PDG A;  4DV4 M;  4DV2 M;  1Z5B A;  3T1H M;  4B3T M;  4LFB M;  3VK7 A;  5ITY A;  3SAS A;  4NRV A;  3SAW A;  1IBK M;  3J81 S;  1XMQ M;  4B3R M;  2VQE M;  4JI5 M;  3GPY A;  3GPU A;  3U6C A;  4DR5 M;  1IBL M;  2UUA M;  4JI0 M;  3VK8 A;  3SAR A;  3DOA A;  2UXC M;  3TWM A;  4LF6 M;  3A46 A;  4X64 M;  4LF7 M;  4LFA M;  2F5S A;  2HKJ A;  4PCZ A;  4LF5 M;  4JYA M;  3JR4 A;  4G4N A;  4DR4 M;  1XNQ M;  4DUY M;  2UUB M;  2UUC M;  4B3M M;  5BR8 M;  4NXN M;  1PJJ A;  4LF8 M;  2UXD M;  3TWK A;  1R2Z A;  4LF4 M;  1HNZ M;  2OQ4 A;  1HNW M; 
#chains in the Genus database with same CATH topology
 4MGK E;  2W82 A;  3KFU G;  5L8R F;  2CHQ A;  3TQS A;  1HT1 E;  4M0W A;  4Y28 F;  1OKS A;  1G8P A;  3SYK A;  1YSY A;  3KP0 E;  1X37 A;  2DAK A;  3GLH B;  1DGH B;  2QBY B;  1V33 A;  2F5P A;  2QBY A;  3AFH A;  1J5E M;  4CIS A;  1EE8 A;  3FUT A;  1SG9 A;  4LZJ A;  3FTE A;  3H4M A;  1HNX M;  1NHW C;  2VII A;  3Q8X A;  1DO2 A;  5IT9 S;  2CV1 A;  4MGI E;  4QOS A;  4QNM A;  4RNA A;  1N34 M;  2M60 A;  4OVZ B;  2OOB A;  3SC3 A;  4YHH M;  5FTL A;  3HZJ A;  1I94 M;  2ERC A;  2D7E A;  2MRO B;  1Z6T A;  3D8L A;  1UFZ A;  1GJS A;  4Z8X A;  4FWH A;  3SAT A;  2MGW A;  2V1C A;  3H4J A;  1IN8 A;  2DNA A;  3GPX A;  3KSX A;  4JI3 M;  1NNU C;  2KNA A;  4GIP A;  1WIV A;  2LVQ D;  3D8B A;  3KOW E;  2L2D A;  1XHB A;  3MHV C;  2XZU A;  4EIW A;  5KPR A;  3I4V A;  3K8Z A;  1G71 A;  4PT5 A;  1Q3C A;  2FOI C;  3GO8 A;  3A98 B;  3GQ4 A;  3QYE A;  4HL4 A;  3B89 A;  2DXI A;  2JZ1 A;  3ZH9 B;  4XBO A;  1ZAE A;  2QHO B;  2R18 A;  1WGN A;  1QQW A;  1UM8 A;  1Z5A A;  4QHS A;  1AIP C;  1MJG M;  1DGF A;  2APL A;  3DFZ A;  1L2B A;  2ZAN A;  2B3T A;  2L4F A;  1FNN A;  3AOE C;  4RF0 A;  3BBZ A;  3HJ8 A;  4G6Z A;  4IJF A;  3K1J A;  4DV7 M;  3KS8 A;  1N36 M;  4JI7 M;  4GMQ A;  4B7H A;  3GP1 A;  1HJP A;  4L4U A;  1R4G A;  4A3V B;  1N77 A;  4AQY M;  1JR3 D;  3W67 A;  1NHG C;  1XXH B;  3FYD A;  4RKU F;  2KDL A;  2DVW B;  2K9D A;  2I7P A;  3HU2 A;  3VFD A;  3GLF B;  3KOX E;  4IJE A;  4DBG B;  4DR1 M;  1PJI A;  3EIH A;  3C3E A;  3FUV A;  2DKL A;  1A5T A;  2JWS A;  2HL7 A;  4JXJ A;  3T1Y M;  3CF2 A;  2R62 A;  3GRU A;  3HU1 A;  3B7N A;  2D7H A;  2JZ0 A;  2LVN C;  3SHF A;  2LVO C;  1TGU A;  3I01 M;  3DZD A;  4F2L A;  2JY8 A;  2KXE A;  2Z4S A;  4GC9 A;  4JI8 M;  4FCV A;  3W0F A;  2JP7 A;  1ZV1 A;  3WHK A;  1Z5B A;  3C9P A;  4DV4 M;  3T1H M;  3VK7 A;  2K47 A;  2CWB A;  1IQP A;  2ZAO A;  1W5T A;  4IBI A;  2VQE M;  4P17 A;  1KSF X;  5EXS A;  3SAR A;  3MJ5 A;  1ZMU A;  3SMP A;  2EKF A;  4L78 A;  4NC6 A;  4AG5 A;  2L7H A;  4LF6 M;  3KS4 A;  1IFY A;  2QPA A;  2OOA A;  2DWZ B;  2G5G X;  3RE8 A;  2WSE F;  4JN6 A;  1VEJ A;  4LGM A;  4CGY B;  4IIW A;  3GLH E;  4HLQ A;  4IBG A;  3VKH A;  1G3I A;  2LVP C;  1NJF A;  2X49 A;  2L4E A;  4FW9 A;  1HNZ M;  1TF0 B;  1C7Y A;  2KRU A;  3RGS A;  2F5N A;  2KW0 A;  1LV7 A;  1JR3 A;  1Q02 A;  4AKI A;  3ZCB B;  2CUZ A;  2KA6 B;  2KNV A;  3B9P A;  4I4L A;  5DYG A;  4BB9 A;  2CEA A;  2EKK A;  4KT0 F;  1WGL A;  1ZMW A;  4FWG A;  2AHM A;  4DR6 M;  1ZQ9 A;  2MJ5 B;  2Z8Y M;  4BLC A;  2Z4R A;  2CE7 A;  3K9P A;  3KDS E;  3TL4 X;  1JB0 F;  4L15 A;  2UXB M;  3EIE A;  4X65 M;  2LBC A;  2YNM D;  2BWB A;  1NV9 A;  3IEC A;  2ZAM A;  3AKZ A;  2F5Q A;  2C96 A;  3IHP A;  2Z3X A;  2C5R A;  2DWM A;  1N33 M;  2JUJ A;  4GH9 A;  4WW0 A;  4M9S A;  5EP4 A;  5ITX A;  1PM5 A;  1XB2 B;  1L1Z A;  4LF9 M;  5IZ7 D;  2L09 A;  3KOY E;  4D82 A;  4AZF A;  3CTW B;  1MU5 A;  4NRW A;  5IRE B;  2UUA M;  4FCT A;  2V1U A;  1MX0 A;  2C9C A;  4LRS A;  1FJG M;  5KPZ A;  3THG A;  3K2L A;  3SAV A;  1QZE A;  3GRV A;  5FTN A;  5LMN M;  1R2Y A;  3QWL A;  2XSZ A;  2BJW A;  2EUC A;  4MGY E;  3MMP A;  1QDR A;  3FRI A;  1E94 E;  4WP2 A;  1QYR A;  2E5L M;  1CUK A;  3J7A S;  3F92 A;  2O01 F;  4FD2 A;  3RGP A;  1VEG A;  4L8R C;  5EP2 A;  4CJ6 A;  4DR3 M;  4RF1 A;  2BNK A;  3UJN A;  4X62 M;  1LTM A;  2R4J A;  2R4E A;  3FRH A;  1SXJ A;  1GLN A;  2BJV A;  1BVS A;  1T43 A;  2N35 A;  4FWD A;  4IBK A;  4OW0 A;  5GKN A;  4X66 M;  1OIZ A;  3HWS A;  3GQ3 A;  2XFS A;  1GO5 A;  1OIP A;  3E9S A;  4IBJ A;  4CHT B;  3I04 M;  4QNR A;  2HCB A;  2LXE A;  3HKP A;  1XXH E;  3LQQ A;  5E6J A;  3TE6 A;  3GLF E;  3CGW A;  4KO8 A;  1GVN A;  3GPP A;  4AKH A;  4DUZ M;  1L8Q A;  3GRR A;  4OX9 M;  1HT2 E;  1IM2 A;  3FUX A;  3J7B A;  1NO1 A;  5ITR A;  5F3W A;  3VKG A;  1MN3 A;  2LTU A;  1VDD A;  4GRI A;  1IN6 A;  5KO3 A;  4NXM M;  1OAO C;  1DGB A;  2DHY A;  4AG6 A;  3C58 A;  5JI3 E;  3U60 A;  4GEW A;  1NJG A;  4ANR A;  1XMO M;  4K0K M;  4ITQ A;  3GLI B;  1Q3B A;  5H37 D;  3GLI A;  3SFZ A;  3HGI A;  3M0E A;  3VDP A;  4G4R A;  5DYI A;  2NQ8 C;  1XWI A;  1T3T A;  1Z59 A;  1QZM A;  1QAQ A;  2D7G A;  1S3S A;  3HHW A;  3K9O A;  4QHT A;  3W68 A;  2CV0 A;  1R7R A;  3L2A A;  1C1K A;  1IY0 A;  3BOS A;  4Z6Y A;  3RFW A;  5ITT A;  4GIT A;  2DAE A;  2R45 A;  2R6F A;  1XMQ M;  4B7F A;  1PJQ A;  2K0B X;  1RU3 A;  2DZL A;  1JQJ C;  2WSF F;  4IBF A;  3GLG A;  3HHY A;  1P3Q Q;  4X64 M;  2F5S A;  2M5Z A;  3AOG A;  4IBD A;  4JYA M;  1ZMV A;  1YE9 A;  1XNQ M;  2RRU A;  4GHL A;  7CAT A;  3FTC A;  3PNY A;  1GL7 A;  5BR8 M;  1NY5 A;  1QAN A;  2O5R A;  3ZC7 B;  5FSW A;  2JY5 A;  3UMM A;  4LF4 M;  1HNW M;  1V92 A;  1YUB A;  4G3O A;  4IBB A;  4G4Q A;  3HU3 A;  1K3X A;  4NSR A;  3PNV A;  4LJ9 A;  1HR0 M;  4AKG A;  3R9X B;  4AW4 A;  2QEN A;  2HWJ A;  2XEP A;  2XH9 A;  4L16 A;  1QUT A;  2BWE A;  2FH0 A;  4OU7 A;  2EA0 A;  2CHV A;  3SBJ A;  2HHH M;  1EFU B;  1YLA A;  3VDU A;  1L1T A;  2DAM A;  4PD2 A;  2JA2 A;  2XZF A;  2F5O A;  5ITQ A;  3U61 A;  2DI0 A;  3AL0 C;  2JY7 A;  5BPV A;  2HAK A;  1L2D A;  4W5W A;  1EIJ A;  4S12 A;  2XSZ D;  1DV0 A;  2LVA A;  3U6L A;  4GKJ M;  1HQC A;  1E9R A;  1QVR A;  3V76 A;  3BXW A;  3KP1 E;  3OTO M;  2ZM6 M;  2C98 A;  2CV2 A;  1HQY E;  1PJS A;  3I4Y A;  3U6P A;  1VG5 A;  1NNJ A;  4GHA A;  3FYC A;  3C3D A;  2P5T A;  3PFI A;  4LJ8 A;  2FFJ A;  2H5X A;  2DHR A;  3U5Z A;  4LFC M;  2VDB B;  4TUW A;  1SXJ D;  2CHG A;  4LJA A;  1NSF A;  1OAI A;  4LJ4 A;  1N32 M;  3GQ5 A;  1Z5C A;  3QYB A;  2YR0 A;  1GKI A;  1IBM M;  1R6B X;  3FUU A;  3MK6 A;  3KOZ E;  2KNZ A;  3J80 S;  3U6S A;  3T15 A;  1WHC A;  3B7Z A;  4G4O A;  1TH3 A;  2X8A A;  1V34 A;  2OO9 A;  3GRY A;  2XLJ A;  1PRB A;  4GC5 A;  4DR7 M;  1QDT A;  4JV5 M;  4UN2 B;  1OFI A;  3JAM S;  3TPZ A;  1KFV A;  2Y20 A;  2ZTC A;  5KPT A;  2GNO A;  2DWN A;  4MGZ E;  1IN7 A;  1ORY B;  3KVW A;  4P16 A;  1PGY A;  3HX3 A;  4HEO A;  2XGN A;  4LJ6 A;  4LGY A;  5A2Q S;  2QSF X;  4PDI A;  3UZU A;  1OTR A;  4DV3 M;  5IWA M;  1D2N A;  3UGJ A;  1E9S A;  2UU9 M;  5EQT A;  5FTK A;  1K3W A;  3E21 A;  4REZ A;  1G41 A;  4LZZ A;  2KRK A;  3L26 A;  3SAU A;  1D0M A;  2G8L A;  8CAT A;  3IG8 A;  3LVV A;  2RGO A;  3FE3 A;  1N75 A;  1SXJ B;  3TWL A;  1TDH A;  2L7I A;  3ZQJ A;  4LFB M;  2DAG A;  1W5S A;  4B08 A;  1GAB A;  1OQY A;  4M0D A;  4I81 A;  5ITY A;  2KZU A;  4LCB A;  2C9O A;  2MR9 A;  3J81 S;  3DA1 A;  2J5Y A;  4JI5 M;  3GLH A;  1DGH A;  3I51 A;  5EXT A;  1IBL M;  1OFH A;  1T6O A;  2QP9 X;  4JI0 M;  2FE8 A;  2R65 A;  3FTD A;  4BBA A;  3VK8 A;  2VF8 A;  2H1R A;  4NL4 H;  5DNY A;  4FCW A;  2EJS A;  3U60 B;  4R7G A;  1IXS B;  4LF7 M;  4LFA M;  4IBE A;  5EP3 A;  1IXS A;  2HKJ A;  2LHC A;  3B7Q A;  4LF5 M;  5KQD A;  2UUB M;  2UUC M;  4OVZ A;  3LCV B;  4I5S A;  3K92 A;  2CP8 A;  1DGG A;  1PJJ A;  1J09 A;  4KLN A;  4LF8 M;  3FTF A;  2MH8 A;  1R2Z A;  4I8O A;  1VQ1 A;  3T38 A;  2OQ4 A;  1H6U A;  3ILK A;  2LHG A;  4LG2 A;  1VEK A;  5FLX S;  1F4I A;  1DO0 A;  4KOD A;  3PXG A;  1Q39 A;  5EJC A;  3SHG B;  4JI4 M;  4D81 A;  5EXX A;  4JI2 M;  4DR2 M;  3GLG B;  1G59 A;  1IY2 A;  2Q2E B;  1XNR M;  3U6E A;  1E32 A;  2OPF A;  5EXP A;  4GKK M;  1JR3 E;  2X4A A;  4M9X A;  4LY6 A;  3QAU A;  5EP1 A;  1R5L A;  3AJI B;  2CRU A;  3J2P B;  4MM3 B;  4DV6 M;  2K6B A;  3W0L B;  3Q8G A;  2O25 A;  2GQF A;  3U6M A;  1IXZ A;  1Y8G A;  4R3D A;  2XFT A;  2A5Y B;  2KHH A;  1NV8 A;  3B74 A;  3L27 A;  3R8F A;  1TDZ A;  4YY3 M;  3KSJ A;  4WUR A;  2LWX A;  4DV1 M;  1J7K A;  5ITX E;  4MH0 E;  1D0K A;  5DFL A;  1GL6 A;  3WHL A;  1NY6 A;  4XGI A;  5ITU A;  3NWL A;  1QAM A;  1TH2 A;  3HJS A;  1NVM A;  2R0I A;  1XXH A;  3PVS A;  4LRT A;  1GJT A;  3E46 A;  1G4A E;  3GLF A;  3A45 A;  1L2C A;  4JI1 M;  5LMU M;  3FKE A;  3U61 B;  3M7G A;  2G3Q A;  2C99 A;  3U6D A;  3CF0 A;  2FS1 A;  2VQF M;  2JXN A;  3T6P A;  1IN4 A;  4LJ7 A;  4NOO B;  2I7N A;  3AOE A;  4QOZ C;  4NSO B;  2KEB A;  1IN5 A;  5FTJ A;  4DV5 M;  2FNA A;  1WJ7 A;  3E4R A;  2LH0 A;  3SMS A;  4Q7J A;  2QNJ A;  4IBC A;  3L29 A;  4MB7 A;  2RGH A;  3KW6 A;  2ZBK B;  1I4W A;  2Y0Q A;  3JR5 A;  3U5Z B;  4B3S M;  1QAO A;  3LCU A;  2QQ8 A;  5JI2 E;  2Y21 A;  3L28 A;  3LVW A;  1IY1 A;  1SXJ E;  3HJQ A;  4II7 A;  2DZO B;  4DV0 M;  3L25 A;  1TR8 A;  4D80 A;  2EO2 A;  2YFQ A;  3FD9 A;  4B7G A;  2L6O A;  3J27 B;  3U6Q A;  4R71 A;  3AV0 A;  2YQZ A;  2RKO A;  4F1I A;  4FVM A;  1WXQ A;  2ZTD A;  3M6A A;  2DWL A;  2R44 A;  3LW5 F;  1IXR C;  2DAI A;  3VLF B;  3U6O A;  5E26 A;  1QUS A;  3CF6 E;  1VDL A;  2Z7J A;  4LJ5 A;  3A42 A;  1XC8 A;  2CFO A;  5C1B A;  2JY6 B;  2V6Z M;  3NBX X;  4JI6 M;  2KZS A;  3IG5 A;  4CIZ A;  5C18 A;  2LNH C;  4PDG A;  1K82 A;  4DV2 M;  4B3T M;  3HHX A;  2WZJ A;  2R46 A;  3FUW A;  3LQR A;  3LMM A;  4M9Z A;  4NRV A;  3SAS A;  1SXJ C;  3GLI E;  3SAW A;  1IBK M;  5FTM A;  4B3R M;  2WSC F;  3GPY A;  1TTE A;  3GPU A;  4DR5 M;  3U6C A;  2JNH A;  1OJL A;  5KQ8 A;  3DOA A;  2UXC M;  3TWM A;  1D0L A;  3NBI A;  3UK6 A;  3SYL A;  3A46 A;  2DZN B;  4XK8 F;  3KXE C;  2DEN A;  4ZPX A;  2J7N A;  4L6V 6;  2F4V M;  4PCZ A;  2QZ4 A;  4MGH A;  3JR4 A;  2J7O A;  4G4N A;  4DR4 M;  4DUY M;  1N78 A;  4AI6 A;  2XF3 A;  2Y0T A;  4B3M M;  1WR1 B;  1AUA A;  4NXN M;  2QCU A;  3HHZ A;  1PJT A;  3HY5 A;  2UXD M;  2VF7 A;  1KYI A;  3TWK A;  3GLG E;  4KHP M;  1TH4 A; 
#chains in the Genus database with same CATH homology
 4MGK E;  2W82 A;  3KFU G;  2CHQ A;  3TQS A;  1HT1 E;  4M0W A;  3SYK A;  1G8P A;  1YSY A;  3KP0 E;  1X37 A;  3GLH B;  1DGH B;  2QBY B;  2F5P A;  2QBY A;  3AFH A;  1J5E M;  4CIS A;  1EE8 A;  3FUT A;  4LZJ A;  3FTE A;  3H4M A;  1HNX M;  1NHW C;  2VII A;  3Q8X A;  1DO2 A;  5IT9 S;  2CV1 A;  4MGI E;  4QOS A;  4QNM A;  4RNA A;  1N34 M;  2M60 A;  4OVZ B;  3SC3 A;  4YHH M;  5FTL A;  1I94 M;  2ERC A;  2D7E A;  1Z6T A;  3D8L A;  4Z8X A;  4FWH A;  3SAT A;  2V1C A;  1IN8 A;  3GPX A;  3KSX A;  4JI3 M;  1NNU C;  4GIP A;  3D8B A;  3KOW E;  1XHB A;  3MHV C;  2XZU A;  4EIW A;  5KPR A;  3I4V A;  3K8Z A;  4PT5 A;  1Q3C A;  2FOI C;  3GO8 A;  3A98 B;  3GQ4 A;  4HL4 A;  2DXI A;  3ZH9 B;  4XBO A;  1ZAE A;  2R18 A;  1QQW A;  1UM8 A;  1Z5A A;  4QHS A;  1DGF A;  1L2B A;  3DFZ A;  2ZAN A;  1FNN A;  3AOE C;  4RF0 A;  3HJ8 A;  4G6Z A;  4IJF A;  3K1J A;  4DV7 M;  3KS8 A;  1N36 M;  4JI7 M;  4GMQ A;  4B7H A;  3GP1 A;  4L4U A;  4A3V B;  1N77 A;  4AQY M;  1JR3 D;  1NHG C;  1XXH B;  3FYD A;  2DVW B;  3HU2 A;  2I7P A;  3VFD A;  3GLF B;  1PJI A;  3KOX E;  4IJE A;  4DR1 M;  3EIH A;  3FUV A;  4JXJ A;  2HL7 A;  3T1Y M;  3CF2 A;  3HU1 A;  3GRU A;  2R62 A;  2D7H A;  3SHF A;  1TGU A;  3DZD A;  2KXE A;  2Z4S A;  4GC9 A;  4JI8 M;  4FCV A;  3W0F A;  3WHK A;  4DV4 M;  1Z5B A;  3T1H M;  3VK7 A;  2K47 A;  1IQP A;  2ZAO A;  1W5T A;  4IBI A;  2VQE M;  1KSF X;  5EXS A;  3SAR A;  3MJ5 A;  3SMP A;  4L78 A;  4AG5 A;  2L7H A;  4LF6 M;  3KS4 A;  2QPA A;  2DWZ B;  2G5G X;  3RE8 A;  4JN6 A;  4LGM A;  4CGY B;  4IIW A;  4HLQ A;  4IBG A;  3VKH A;  1G3I A;  1NJF A;  2X49 A;  4FW9 A;  1HNZ M;  2F5N A;  2KRU A;  3RGS A;  2KW0 A;  1LV7 A;  1JR3 A;  4AKI A;  3ZCB B;  2CUZ A;  2KA6 B;  3B9P A;  4I4L A;  4BB9 A;  5DYG A;  2CEA A;  4FWG A;  2AHM A;  4DR6 M;  1ZQ9 A;  4BLC A;  2Z4R A;  2CE7 A;  3KDS E;  3TL4 X;  2UXB M;  4L15 A;  3EIE A;  4X65 M;  2YNM D;  2ZAM A;  3AKZ A;  2F5Q A;  2C96 A;  2Z3X A;  2C5R A;  2DWM A;  1N33 M;  4GH9 A;  4WW0 A;  4M9S A;  5EP4 A;  5ITX A;  1PM5 A;  1L1Z A;  4LF9 M;  5IZ7 D;  2L09 A;  3KOY E;  4D82 A;  4AZF A;  3CTW B;  1MU5 A;  4NRW A;  5IRE B;  2UUA M;  4FCT A;  2V1U A;  1MX0 A;  2C9C A;  4LRS A;  1FJG M;  5KPZ A;  3THG A;  3K2L A;  3SAV A;  3GRV A;  1R2Y A;  5FTN A;  5LMN M;  3QWL A;  2XSZ A;  2BJW A;  2EUC A;  4MGY E;  1E94 E;  1QYR A;  2E5L M;  3J7A S;  4FD2 A;  3RGP A;  4L8R C;  5EP2 A;  4DR3 M;  4RF1 A;  2BNK A;  3UJN A;  4X62 M;  2R4E A;  2R4J A;  1SXJ A;  1GLN A;  2BJV A;  4IBK A;  4OW0 A;  4X66 M;  4FWD A;  5GKN A;  3HWS A;  3GQ3 A;  2XFS A;  3E9S A;  4IBJ A;  4CHT B;  4QNR A;  2HCB A;  2LXE A;  3HKP A;  3LQQ A;  5E6J A;  3TE6 A;  4KO8 A;  1GVN A;  3GPP A;  4AKH A;  4DUZ M;  1L8Q A;  3GRR A;  4OX9 M;  1HT2 E;  1IM2 A;  3FUX A;  3J7B A;  5ITR A;  5F3W A;  3VKG A;  1VDD A;  4GRI A;  1IN6 A;  5KO3 A;  4NXM M;  1DGB A;  4AG6 A;  3C58 A;  5JI3 E;  3U60 A;  1XMO M;  1NJG A;  4K0K M;  4ITQ A;  3GLI B;  1Q3B A;  5H37 D;  3GLI A;  3SFZ A;  3HGI A;  3M0E A;  3VDP A;  4G4R A;  5DYI A;  2NQ8 C;  1XWI A;  1T3T A;  1Z59 A;  1QZM A;  1QAQ A;  2D7G A;  1S3S A;  3HHW A;  4QHT A;  2CV0 A;  1R7R A;  3L2A A;  1C1K A;  1IY0 A;  3BOS A;  4Z6Y A;  3RFW A;  5ITT A;  4GIT A;  2R45 A;  1XMQ M;  4B7F A;  1JQJ C;  3GLG A;  4IBF A;  3HHY A;  4X64 M;  2F5S A;  2M5Z A;  3AOG A;  4IBD A;  4JYA M;  1YE9 A;  1XNQ M;  4GHL A;  7CAT A;  3FTC A;  3PNY A;  1GL7 A;  5BR8 M;  1NY5 A;  1QAN A;  2O5R A;  3ZC7 B;  5FSW A;  3UMM A;  4LF4 M;  1HNW M;  1YUB A;  4IBB A;  4G4Q A;  3HU3 A;  1K3X A;  4NSR A;  3PNV A;  4LJ9 A;  1HR0 M;  4AKG A;  3R9X B;  4AW4 A;  2QEN A;  2XH9 A;  2XEP A;  4L16 A;  4OU7 A;  4TUW A;  3SBJ A;  2EA0 A;  2CHV A;  2HHH M;  3VDU A;  1L1T A;  4PD2 A;  2JA2 A;  2XZF A;  2F5O A;  5ITQ A;  3U61 A;  3AL0 C;  1L2D A;  5BPV A;  4W5W A;  4S12 A;  2XSZ D;  3U6L A;  4GKJ M;  1HQC A;  1E9R A;  1QVR A;  3OTO M;  3KP1 E;  2ZM6 M;  2C98 A;  2CV2 A;  1HQY E;  3I4Y A;  3U6P A;  1NNJ A;  4GHA A;  3FYC A;  2P5T A;  3PFI A;  4LJ8 A;  2FFJ A;  3U5Z A;  2DHR A;  4LFC M;  1SXJ D;  2CHG A;  4LJA A;  1NSF A;  4LJ4 A;  1N32 M;  3GQ5 A;  1Z5C A;  2YR0 A;  1GKI A;  1IBM M;  1R6B X;  3FUU A;  3MK6 A;  3KOZ E;  3J80 S;  3U6S A;  3T15 A;  4G4O A;  1TH3 A;  2X8A A;  3GRY A;  2XLJ A;  4GC5 A;  4DR7 M;  4JV5 M;  1OFI A;  3JAM S;  3TPZ A;  1KFV A;  2Y20 A;  5KPT A;  2DWN A;  4MGZ E;  1IN7 A;  1ORY B;  3KVW A;  4P16 A;  2XGN A;  4LJ6 A;  4LGY A;  5A2Q S;  4PDI A;  3UZU A;  4DV3 M;  5IWA M;  1D2N A;  3UGJ A;  1E9S A;  2UU9 M;  5EQT A;  5FTK A;  1K3W A;  4REZ A;  1G41 A;  4LZZ A;  2KRK A;  3L26 A;  3SAU A;  2G8L A;  8CAT A;  3IG8 A;  3LVV A;  2RGO A;  1N75 A;  1SXJ B;  3TWL A;  1TDH A;  2L7I A;  4LFB M;  1W5S A;  4B08 A;  4M0D A;  4I81 A;  5ITY A;  2KZU A;  4LCB A;  2C9O A;  3J81 S;  3DA1 A;  4JI5 M;  3GLH A;  1DGH A;  3I51 A;  5EXT A;  1IBL M;  1OFH A;  2QP9 X;  4JI0 M;  4BBA A;  2FE8 A;  2R65 A;  3FTD A;  3VK8 A;  2H1R A;  4NL4 H;  5DNY A;  4FCW A;  3U60 B;  4R7G A;  1IXS B;  4LF7 M;  4LFA M;  4IBE A;  5EP3 A;  2HKJ A;  4LF5 M;  5KQD A;  2UUB M;  2UUC M;  4OVZ A;  4I5S A;  3K92 A;  1DGG A;  1PJJ A;  1J09 A;  4KLN A;  4LF8 M;  3FTF A;  1R2Z A;  4I8O A;  3T38 A;  2OQ4 A;  1H6U A;  3ILK A;  4LG2 A;  5FLX S;  1DO0 A;  4KOD A;  3PXG A;  1Q39 A;  5EJC A;  3SHG B;  4JI4 M;  4D81 A;  5EXX A;  4JI2 M;  4DR2 M;  3GLG B;  1G59 A;  1IY2 A;  2Q2E B;  1XNR M;  3U6E A;  1E32 A;  2OPF A;  5EXP A;  4GKK M;  2X4A A;  4M9X A;  4LY6 A;  3QAU A;  5EP1 A;  3AJI B;  3J2P B;  4MM3 B;  4DV6 M;  3W0L B;  3U6M A;  1IXZ A;  4R3D A;  2XFT A;  2A5Y B;  3L27 A;  3R8F A;  1TDZ A;  4YY3 M;  3KSJ A;  4WUR A;  2LWX A;  4DV1 M;  1J7K A;  5ITX E;  4MH0 E;  3WHL A;  1GL6 A;  1NY6 A;  4XGI A;  5ITU A;  3NWL A;  1QAM A;  1TH2 A;  3HJS A;  1NVM A;  3PVS A;  1XXH A;  4LRT A;  1G4A E;  3GLF A;  3A45 A;  1L2C A;  4JI1 M;  5LMU M;  3FKE A;  3U61 B;  3M7G A;  2C99 A;  3U6D A;  3CF0 A;  2VQF M;  1IN4 A;  4LJ7 A;  4NOO B;  2I7N A;  3AOE A;  4QOZ C;  4NSO B;  2KEB A;  1IN5 A;  5FTJ A;  4DV5 M;  2FNA A;  3E4R A;  2LH0 A;  3SMS A;  4IBC A;  3L29 A;  4MB7 A;  3KW6 A;  2RGH A;  2ZBK B;  1I4W A;  2Y0Q A;  3JR5 A;  3U5Z B;  4B3S M;  1QAO A;  5JI2 E;  2Y21 A;  3L28 A;  3LVW A;  1IY1 A;  1SXJ E;  3HJQ A;  4II7 A;  2DZO B;  4DV0 M;  3L25 A;  4D80 A;  2EO2 A;  2YFQ A;  3FD9 A;  4B7G A;  2L6O A;  3J27 B;  3U6Q A;  3AV0 A;  2YQZ A;  2RKO A;  4FVM A;  1WXQ A;  3M6A A;  2DWL A;  3VLF B;  3U6O A;  1IXR C;  5E26 A;  3CF6 E;  2Z7J A;  4LJ5 A;  3A42 A;  1XC8 A;  2CFO A;  5C1B A;  2V6Z M;  2F4V M;  4JI6 M;  2KZS A;  3IG5 A;  5C18 A;  1K82 A;  2LNH C;  4PDG A;  4B3T M;  4DV2 M;  3HHX A;  2R46 A;  3FUW A;  3LQR A;  3LMM A;  4M9Z A;  4NRV A;  3SAS A;  1SXJ C;  3SAW A;  1IBK M;  5FTM A;  4B3R M;  3GPY A;  3GPU A;  3U6C A;  4DR5 M;  1OJL A;  5KQ8 A;  3DOA A;  2UXC M;  3TWM A;  3NBI A;  3UK6 A;  3SYL A;  3A46 A;  2DZN B;  3KXE C;  4ZPX A;  2J7N A;  4PCZ A;  2QZ4 A;  4MGH A;  3JR4 A;  2J7O A;  4G4N A;  4DR4 M;  4DUY M;  1N78 A;  4AI6 A;  2XF3 A;  2Y0T A;  4B3M M;  4NXN M;  2QCU A;  3HHZ A;  2UXD M;  1KYI A;  3TWK A;  4KHP M;  1TH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...