3TWLA

Crystal structure of arabidopsis thaliana fpg
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
286
structure length
263
Chain Sequence
b'PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKNLWLELDSPPFPSFQFGMAGAIYIKWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLANPTSVSPISELGPDALLEPMTVDEFAESLAKKKITIKPLLLDQGYISGIGNWIADEVLYQARIHPLQTASSLSKEQCEALHTSIKEVIEKAVEVDADSSQFPSNWIFHNREKKPGKAFVDGKKIDFITAYVPELQKLYGKDAEKAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase 1
publication title Structural and biochemical studies of a plant formamidopyrimidine-DNA glycosylase reveal why eukaryotic Fpg glycosylases do not excise 8-oxoguanine.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 78
structure length 263
sequence length 286
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3twlA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3twlA01
2UXDM 1N32M 1I94M 4GKJM 4PCZA 4LF7M 2VQEM 3U6PA 3JR4A 5ITXA 4DV6M 4G4QA 4G4OA 5ITYA 2UUCM 4CISA 4LF8M 2VQFM 1NNJA 2UUBM 4LF4M 3TWKA 2F4VM 4B3RM 1MU5A 1XNRM 1TDHA 4LF6M 4PD2A 2UXCM 1EE8A 2XZUA 2F5NA 4JI1M 1XMOM 5BR8M 4DV0M 4DV7M 3VK7A 4JI6M 1HNWM 4JI3M 1HNZM 4NXMM 4GKKM 3U6QA 1R2YA 4ITQA 3GQ5A 4DR5M 1KFVA 1K3XA 4NXNM 4YHHM 2UXBM 1IBLM 3SAWA 3SASA 4LFBM 1N33M 1XMQM 1J5EM 2F5PA 4B3SM 5ITTA 4OX9M 2ZM6M 2OQ4A 1R2ZA 4K0KM 4DR6M 4JI4M 1HR0M 4DR3M 3U6EA 2Q2EB 1XC8A 1L2CA 4KHPM 2F5OA 1Z5CA 4DV2M 3U6LA 4JI7M 3U6DA 1K82A 2UUAM 3VK8A 4X66M 5ITRA 3GQ4A 4JI0M 1Z59A 2F5SA 3TWLA 3JR5A 4MB7A 4X64M 2HKJA 4AQYM 3T1HM 1PM5A 3A42A 3A45A 1FJGM 1L2DA 5LMUM 1Z5AA 4DV5M 2XZFA 4LFAM 5ITXE 4NRVA 4DR1M 3J81S 4DR4M 5IT9S 4DUYM 3U6SA 2HHHM 2F5QA 5LMNM 3T1YM 3GPUA 1PJIA 3SATA 4G4RA 4PDIA 4X62M 2EA0A 4DUZM 3U6MA 4YY3M 1Q3CA 1L1ZA 4DR7M 1Q3BA 4DV4M 5ITQA 4JI8M 4B3TM 4JYAM 1IBKM 5FLXS 3C58A 3GO8A 1PJJA 2UU9M 3JAMS 3TWMA 3GPYA 1TDZA 1MX0A 3SAUA 3U6CA 3GPXA 4LF9M 4DV3M 1HNXM 3W0FA 3GQ3A 2E5LM 4PDGA 4JV5M 3SBJA 4X65M 1N36M 4DR2M 3GP1A 3DOAA 3J80S 4LF5M 3J7AS 4DV1M 2ZBKB 3U6OA 5ITUA 5IWAM 1IBMM 3A46A 4G4NA 1L2BA 1XNQM 4NRWA 1L1TA 1Q39A 2OPFA 5A2QS 4JI2M 3SARA 3GPPA 1K3WA 3SAVA 3OTOM 4LFCM 1Z5BA 4B3MM 4JI5M 1N34M
chains in the Genus database with same CATH superfamily
2UXDM 1N32M 5IZ7D 2BJVA 4GKJM 4M9SA 1YUBA 1EFUB 3FKEA 3KSJA 2X49A 3HGIA 3RFWA 2C9CA 2FFJA 3TE6A 1QANA 1UFZA 1OAOC 4LF4M 2F4VM 2KNAA 4NOOB 1IXSA 1MU5A 2KA6B 2R0IA 4IJEA 4PD2A 3K2LA 1VG5A 2J5YA 2Y21A 2XZUA 4IIWA 2CV2A 3RGSA 2KZSA 3SHFA 3VFDA 4JI6M 2VDBB 4MGIE 4ITQA 3RGPA 2XGNA 1IBLM 2JY6B 4FD2A 3GLGA 3U60B 2DAMA 3AOEA 4Z8XA 4AG6A 3FTCA 2EKFA 1J5EM 2GQFA 4CGYB 5ITTA 4OX9M 1OFIA 1OIZA 1DO2A 2DENA 2LNHC 2LWXA 4LZZA 1HR0M 4DR3M 2WSEF 2DWMA 4DV2M 2QNJA 1K82A 1NSFA 1XB2B 5DFLA 3GQ4A 4IBIA 1IFYA 1H6UA 2JWSA 2I7PA 3KOZE 4NSOB 1WIVA 3SMSA 4BLCA 3U61A 3I04M 2V1CA 2J7OA 4FW9A 1QAMA 3NBIA 7CATA 3FUXA 1IN5A 3A42A 3A45A 3DA1A 1G8PA 2M60A 2V6ZM 3U5ZB 1QAOA 3E46A 2DNAA 4OVZB 3HHZA 5LMUM 1Z5AA 1NNUC 3HU2A 4DR1M 4QOSA 3J81S 3HHXA 2DKLA 2CV0A 4L8RC 3U6SA 4QHTA 2HHHM 3QAUA 2RGOA 3AL0C 3SATA 2JNHA 2EA0A 3E9SA 4IBCA 3FTFA 3FUWA 2HAKA 2ZAOA 3FYDA 3MK6A 4IBGA 2LVAA 2QBYB 2BWEA 4ZPXA 3KP0E 2YQZA 4LJ7A 4AI6A 5KO3A 1VDLA 4FWDA 3NBXX 1ZV1A 3B74A 1G4AE 1XHBA 2QHOB 2UU9M 4GRIA 3JAMS 1G71A 2DAEA 1MX0A 1AIPC 2CHGA 4LF9M 2LVOC 3ILKA 2E5LM 4PDGA 3KDSE 1HT1E 2L09A 1YSYA 4M0DA 2JA2A 2QCUA 2KEBA 4X65M 5FTMA 2AHMA 3KOWE 3Q8GA 3GP1A 1MN3A 4D80A 3GLFA 2FS1A 3LVVA 3LW5F 4DV1M 5ITUA 2N35A 3FUUA 2NQ8C 1WGLA 3QYEA 2DAGA 4L15A 1Q39A 4I5SA 1SXJC 3ZQJA 4JI2M 3SARA 2LVNC 1V92A 1VQ1A 2EUCA 4B3MM 3EIHA 3RE8A 2VF8A 3GLHB 1DGBA 4FCVA 1I94M 5L8RF 2WZJA 1OAIA 2VIIA 3GLIA 5ITYA 3T15A 1ZMVA 1N77A 2L7IA 1SXJA 2LHCA 4FVMA 4R7GA 1DGGA 2XLJA 4B7GA 2UUBM 1BVSA 3B7QA 1ZMWA 3KXEC 1TDHA 1IN7A 2C5RA 1JQJC 1TH2A 1GJTA 2BNKA 2JY7A 2QSFX 1C1KA 3L2AA 3ZCBB 2F5NA 4F1IA 3VK7A 4WP2A 4GITA 1D0KA 1NHWC 3U6QA 3GQ5A 2FE8A 2KHHA 1K3XA 1GO5A 3FRHA 3LCUA 3QWLA 4NXNM 3UGJA 3LQQA 4REZA 4FWHA 4M9ZA 1VDDA 3GLHE 4RF0A 2J7NA 2CV1A 2K9DA 1R5LA 5FTLA 3VKHA 3V76A 2L4FA 2MJ5B 1X37A 3HU3A 4K0KM 4BB9A 2DI0A 1DO0A 2CRUA 1IXSB 5BPVA 3TPZA 1R7RA 1Z5CA 2K6BA 2H5XA 3VK8A 2Y0QA 1YLAA 3KOYE 3FTEA 5ITRA 4I4LA 4IJFA 3SYKA 5JI2E 1IM2A 1TR8A 1HQYE 1HT2E 1Z59A 3C3EA 2DHRA 4W5WA 2ZTCA 3Q8XA 4XK8F 2ZANA 3HU1A 4L16A 3T1HM 1PM5A 1VEKA 3L27A 2O01F 1YE9A 3GLGB 2A5YB 5FTNA 1QQWA 2MROB 2ZTDA 3L25A 1WGNA 4FCTA 1E9RA 2RRUA 2GNOA 1GABA 1E94E 2HCBA 2KNVA 2L7HA 3GRUA 4LFAM 2MGWA 5KPTA 3IHPA 4LJ8A 3R9XB 2FH0A 3AJIB 4NRVA 1DGHA 4DR4M 3HWSA 2CHVA 4DUYM 2QENA 2Y20A 1Y8GA 4NC6A 3GPUA 2HL7A 1SXJD 4PDIA 4AG5A 4X62M 2DHYA 4YY3M 5EXXA 3KS4A 4JXJA 2R45A 1V33A 4DR7M 2CHQA 5EQTA 1EIJA 2APLA 3U61B 4JYAM 1RU3A 1E9SA 3K92A 4M0WA 2CFOA 5FLXS 1JR3E 3C58A 3W68A 3KSXA 3M6AA 4MGHA 4MM3B 4R3DA 3UK6A 4P16A 2LH0A 2R46A 4A3VB 4F2LA 3U6CA 3GLGE 2DVWB 4DV3M 2W82A 2EKKA 2JXNA 5EXPA 5EXTA 2MR9A 2ZAMA 5DYGA 3E21A 3IG5A 1OJLA 3LQRA 4PT5A 3UJNA 1XWIA 3H4JA 1IN4A 3KS8A 2OO9A 1GL7A 3QYBA 4MGYE 2ZBKB 5EP1A 2C99A 3EIEA 1PGYA 2Z4SA 3LVWA 4CJ6A 1MJGM 1OIPA 1PRBA 1T43A 1NHGC 3PVSA 3A46A 2LVPC 3L28A 2R65A 1T6OA 3FD9A 3FUTA 1XNQM 3GRRA 2BJWA 3B9PA 1D2NA 3PNVA 2R18A 2R4EA 1WR1B 3R8FA 3TQSA 3HX3A 2JP7A 2X4AA 4GC9A 3OTOM 3SAVA 1Z5BA 4JI5M 3AKZA 4LG2A 2G3QA 1OFHA 3LMMA 3WHLA 2YNMD 4PCZA 4LF7M 3HZJA 2X8AA 3GLFB 2XFTA 3U6PA 4LGYA 3HY5A 1J09A 5ITXA 4DV6M 4G4OA 4NL4H 4R71A 3GRYA 3CF2A 1TGUA 3B89A 2UUCM 4CISA 2D7EA 4G3OA 4GHLA 2D7HA 3SYLA 1JB0F 2V1UA 4LF6M 1XNRM 4IBDA 1OTRA 3UZUA 2UXCM 4LCBA 2LXEA 4Z6YA 1HQCA 3C3DA 2RGHA 3AOGA 1G41A 3MJ5A 4JI1M 4B7HA 2EO2A 3DZDA 4JI3M 1HNZM 3CF0A 4LJAA 4L78A 1R2YA 5FTJA 1V34A 5KQ8A 5FSWA 1P3QQ 2UXBM 3KW6A 4XBOA 2CWBA 3D8BA 3FE3A 2DXIA 2XH9A 3A98B 2L4EA 3AV0A 4KODA 4AW4A 1C7YA 3GLIB 3SASA 1XMQM 2F5PA 4LJ4A 3I4YA 3I51A 2ZM6M 1R2ZA 3FUVA 1TH3A 3GLFE 1J7KA 3PNYA 2DWZB 4JI4M 2D7GA 2BWBA 1A5TA 1IN8A 2DAIA 2Q2EB 2QZ4A 3U6EA 1XC8A 3WHKA 1ZAEA 3U6DA 2JY5A 4JI7M 5EXSA 1LV7A 1N34M 2K47A 4S12A 4X66M 3VKGA 3TL4X 2B3TA 3J27B 2CE7A 1QAQA 1KSFX 1IXZA 4KLNA 1CUKA 4OU7A 4MH0E 2F5SA 4I8OA 1D0LA 4MB7A 1OKSA 4X64M 2HKJA 2VF7A 1QVRA 4D82A 1Z6TA 4GHAA 1FJGM 4MGZE 4IBFA 1L2DA 3IECA 4WURA 1TF0B 2MH8A 4Y28F 5KQDA 3B7NA 1WXQA 3THGA 4DV5M 1XXHA 4HLQA 4BBAA 2XZFA 3DFZA 1SG9A 3GLIE 2Z4RA 5IT9S 4RF1A 1PJQA 2L6OA 2F5QA 3T1YM 4LRTA 1PJIA 1E32A 3BBZA 3U6MA 3SC3A 4DUZM 1DV0A 1UM8A 4M9XA 3B7ZA 4XGIA 3W0LB 3BXWA 1Q3BA 1L8QA 3M0EA 4DV4M 1L1ZA 1VEGA 5ITQA 4JI8M 3K1JA 1NVMA 3KP1E 4RNAA 5FTKA 3HJQA 2DZNB 3GO8A 1PJJA 2QP9X 1DGFA 2JZ1A 4KO8A 1IY0A 5EP2A 1ZMUA 2Z3XA 1R4GA 3TWMA 3GPYA 3D8LA 3GRVA 4CIZA 2DWNA 2QQ8A 4AKIA 1QUTA 3ZH9B 4JN6A 1IY2A 3F92A 3FTDA 5C1BA 3GQ3A 3L29A 4LJ6A 3T6PA 4CHTB 1DGHB 4QHSA 1Q02A 4QNMA 3NWLA 3HJSA 4GC5A 3ZC7B 3KFUG 3L26A 2DZOB 3J80S 1QZMA 4GH9A 4LF5M 2CEAA 1QUSA 3J7AS 1NJFA 2C96A 2XSZD 3U6OA 2Z7JA 3AOEC 3VDUA 1W5SA 4B08A 5IWAM 2Y0TA 4G6ZA 5DNYA 1IBMM 1IN6A 4G4NA 4TUWA 5KPZA 2R62A 3AFHA 2K0BX 1JR3A 1L1TA 2KZUA 1ZQ9A 3GPPA 1WHCA 2DAKA 4RKUF 1K3WA 2JUJA 2KNZA 4GEWA 4LFCM 1D0MA 3M7GA 5E6JA 1AUAA 1R6BX 3U60A 5KPRA 2VQEM 2YFQA 4LJ9A 1KYIA 3JR4A 3T38A 4G4QA 5IREB 2CP8A 2OOAA 4ANRA 2DWLA 2DZLA 2LVQD 4LF8M 2VQFM 2RKOA 4IBJA 1NNJA 1F4IA 3TWKA 4B3RM 3HKPA 2WSCF 5GKNA 3UMMA 1NY6A 1IXRC 2R4JA 2I7NA 2JY8A 3FYCA 1NY5A 1FNNA 1EE8A 3I4VA 1OQYA 1XMOM 5BR8M 1I4WA 4P17A 4DV0M 4DV7M 1HNWM 4IBBA 4NXMM 4GKKM 4UN2B 1QDTA 4AKHA 4DR5M 1KFVA 3CGWA 1NO1A 4B7FA 4WW0A 4KT0F 3K9PA 4YHHM 1QYRA 2LTUA 3SAWA 1IY1A 4L4UA 1IQPA 8CATA 3U5ZA 4LFBM 1N33M 1WJ7A 3LCVB 4B3SM 2L2DA 4DBGB 4L6V6 2EJSA 1N75A 4OVZA 3E4RA 2G5GX 2OQ4A 1GJSA 4DR6M 2C9OA 4QNRA 2G8LA 1L2CA 4KHPM 2F5OA 3U6LA 2R6FA 2UUAM 4OW0A 2XFSA 4AKGA 3CF6E 2FNAA 4HL4A 5E26A 4JI0M 3C9PA 3H4MA 2QPAA 3TWLA 3JR5A 2QBYA 3FRIA 5JI3E 1JR3D 3KOXE 4FCWA 4AQYM 3BOSA 1NV8A 3MHVC 3HJ8A 1GLNA 2JZ0A 2LBCA 2P5TA 1NV9A 3K9OA 3J7BA 1G59A 1S3SA 2H1RA 5ITXE 2Z8YM 3W67A 1SXJB 3CTWB 1N78A 5F3WA 5LMNM 2HWJA 4D81A 3IG8A 5H37D 4G4RA 2XSZA 1HJPA 4LZJA 3VLFB 1GVNA 4FWGA 4LY6A 1Q3CA 4GMQA 3PFIA 1NJGA 1QDRA 2FOIC 5DYIA 4B3TM 2KDLA 1IBKM 2XEPA 2KW0A 1PJTA 4EIWA 2KRKA 1TH4A 5EP3A 1TDZA 3HHWA 3I01M 3SAUA 2ERCA 2M5ZA 2C98A 4LRSA 3GPXA 1VEJA 1XXHB 3W0FA 5EP4A 2OOBA 1HNXM 2KRUA 2XF3A 4JV5M 1G3IA 1TTEA 3J2PB 2O5RA 3SHGB 3SBJA 1QZEA 3GLHA 4MGKE 3HHYA 4DR2M 2R44A 1N36M 2O25A 3DOAA 1SXJE 1GL6A 1T3TA 3KVWA 4AZFA 1LTMA 4HEOA 2LHGA 5C18A 2WSFF 1PJSA 4NSRA 3SMPA 2KXEA 3K8ZA 4LGMA 2YR0A 4Q7JA 4QOZC 2CUZA 1GKIA 1L2BA 3PXGA 4NRWA 4LJ5A 3VDPA 1W5TA 4IBKA 3SFZA 4I81A 1ORYB 5A2QS 4GIPA 2OPFA 4IBEA 3MMPA 5EJCA 4II7A 1XXHE
chains in the Genus database with same CATH topology
2UXDM 1N32M 5IZ7D 2BJVA 4GKJM 4M9SA 1YUBA 3FKEA 3KSJA 2X49A 3HGIA 3RFWA 2C9CA 2FFJA 3TE6A 1QANA 2F4VM 4LF4M 4NOOB 1MU5A 2KA6B 4IJEA 4PD2A 3K2LA 2Y21A 2XZUA 4IIWA 2CV2A 3RGSA 2KZSA 3SHFA 3VFDA 4JI6M 4MGIE 4ITQA 3RGPA 2XGNA 1IBLM 4FD2A 3U60B 3GLGA 3AOEA 4Z8XA 4AG6A 3FTCA 1J5EM 4CGYB 5ITTA 4OX9M 1OFIA 1DO2A 2LNHC 2LWXA 4LZZA 1HR0M 4DR3M 2DWMA 4DV2M 1K82A 1NSFA 3GQ4A 4IBIA 1H6UA 2I7PA 3KOZE 4NSOB 3SMSA 3U61A 4BLCA 2V1CA 2J7OA 4FW9A 1QAMA 3NBIA 7CATA 3FUXA 1IN5A 3A42A 3A45A 3DA1A 1G8PA 2M60A 2V6ZM 3U5ZB 1QAOA 3HHZA 4OVZB 5LMUM 1Z5AA 1NNUC 3HU2A 4DR1M 4QOSA 3J81S 3HHXA 2CV0A 4L8RC 3U6SA 4QHTA 2HHHM 3QAUA 2RGOA 3AL0C 3SATA 2EA0A 3E9SA 4IBCA 3FTFA 3FUWA 2ZAOA 3FYDA 3MK6A 4IBGA 2QBYB 4ZPXA 3KP0E 2YQZA 4LJ7A 4AI6A 5KO3A 4FWDA 1G4AE 1XHBA 2UU9M 4GRIA 3JAMS 1MX0A 2CHGA 4LF9M 3ILKA 2E5LM 4PDGA 3KDSE 1HT1E 2L09A 1YSYA 4M0DA 2JA2A 2QCUA 2KEBA 4X65M 5FTMA 2AHMA 3KOWE 3GP1A 4D80A 3GLFA 3LVVA 4DV1M 5ITUA 3FUUA 2NQ8C 4L15A 1Q39A 4I5SA 1SXJC 4JI2M 3SARA 2EUCA 4B3MM 3EIHA 3RE8A 3GLHB 4FCVA 1DGBA 1I94M 2VIIA 3GLIA 5ITYA 3T15A 1N77A 2L7IA 1SXJA 4FVMA 4R7GA 2XLJA 1DGGA 4B7GA 2UUBM 3KXEC 1TDHA 1IN7A 2C5RA 1JQJC 1TH2A 2BNKA 3L2AA 1C1KA 3ZCBB 2F5NA 3VK7A 4GITA 1NHWC 3U6QA 3GQ5A 2FE8A 1K3XA 3QWLA 4NXNM 3UGJA 3LQQA 4REZA 4FWHA 4M9ZA 1VDDA 4RF0A 2J7NA 2CV1A 3VKHA 5FTLA 4K0KM 1X37A 3HU3A 4BB9A 1DO0A 1IXSB 5BPVA 3TPZA 1R7RA 1Z5CA 3VK8A 2Y0QA 3KOYE 3FTEA 5ITRA 4I4LA 4IJFA 3SYKA 5JI2E 1IM2A 1HQYE 1HT2E 1Z59A 4W5WA 2DHRA 3Q8XA 2ZANA 3HU1A 4L16A 3T1HM 1PM5A 3L27A 1YE9A 3GLGB 2A5YB 5FTNA 1QQWA 3L25A 4FCTA 1E9RA 1E94E 2HCBA 2L7HA 3GRUA 5KPTA 4LFAM 3R9XB 4LJ8A 3AJIB 4NRVA 4DR4M 1DGHA 3HWSA 2CHVA 4DUYM 2QENA 2Y20A 3GPUA 2HL7A 1SXJD 4PDIA 4AG5A 4X62M 4YY3M 5EXXA 3KS4A 4JXJA 2R45A 4DR7M 2CHQA 5EQTA 3U61B 4JYAM 1E9SA 3K92A 4M0WA 2CFOA 5FLXS 3C58A 3KSXA 3M6AA 4MGHA 4MM3B 4R3DA 3UK6A 4P16A 2LH0A 2R46A 4A3VB 3U6CA 2DVWB 4DV3M 2W82A 5EXPA 5EXTA 2ZAMA 5DYGA 3IG5A 1OJLA 3LQRA 4PT5A 3UJNA 1XWIA 1IN4A 3KS8A 1GL7A 4MGYE 2ZBKB 5EP1A 2C99A 3EIEA 2Z4SA 3LVWA 1NHGC 3PVSA 3A46A 3L28A 2R65A 3FD9A 3FUTA 1XNQM 3GRRA 2BJWA 3B9PA 1D2NA 3PNVA 2R18A 2R4EA 3R8FA 3TQSA 2X4AA 4GC9A 3OTOM 3SAVA 1Z5BA 4JI5M 3AKZA 4LG2A 1OFHA 3LMMA 3WHLA 2YNMD 4PCZA 4LF7M 2X8AA 3GLFB 2XFTA 3U6PA 4LGYA 1J09A 5ITXA 4DV6M 4G4OA 4NL4H 3GRYA 3CF2A 1TGUA 2UUCM 4CISA 2D7EA 4GHLA 2D7HA 3SYLA 1XNRM 2V1UA 4LF6M 4IBDA 3UZUA 2UXCM 4LCBA 2LXEA 4Z6YA 1HQCA 3MJ5A 2RGHA 3AOGA 1G41A 4JI1M 4B7HA 2EO2A 3DZDA 4JI3M 1HNZM 3CF0A 4LJAA 4L78A 1R2YA 5FTJA 5KQ8A 5FSWA 2UXBM 3KW6A 4XBOA 3D8BA 2DXIA 2XH9A 3A98B 4KODA 3AV0A 3SASA 4AW4A 3GLIB 1XMQM 2F5PA 4LJ4A 3I4YA 3I51A 2ZM6M 1R2ZA 3FUVA 1TH3A 1J7KA 3PNYA 2DWZB 4JI4M 2D7GA 2QZ4A 1IN8A 2Q2EB 3U6EA 1XC8A 3WHKA 1ZAEA 3U6DA 4JI7M 5EXSA 1LV7A 2K47A 4S12A 4X66M 3VKGA 3TL4X 3J27B 2CE7A 1QAQA 1KSFX 1IXZA 4KLNA 4OU7A 4MH0E 2F5SA 4I8OA 4MB7A 4X64M 2HKJA 1QVRA 4D82A 1Z6TA 4GHAA 1FJGM 4MGZE 4IBFA 1L2DA 4WURA 5KQDA 1WXQA 3THGA 4DV5M 1XXHA 4HLQA 4BBAA 2XZFA 3DFZA 2Z4RA 5IT9S 4RF1A 2F5QA 2L6OA 3T1YM 4LRTA 1PJIA 1E32A 3U6MA 3SC3A 4DUZM 1UM8A 4M9XA 4XGIA 3W0LB 3M0EA 1Q3BA 1L8QA 1L1ZA 4DV4M 5ITQA 4JI8M 3K1JA 1NVMA 3KP1E 4RNAA 5FTKA 3HJQA 2DZNB 3GO8A 1PJJA 2QP9X 1DGFA 4KO8A 5EP2A 1IY0A 2Z3XA 3TWMA 3GPYA 3D8LA 3GRVA 2DWNA 4AKIA 3ZH9B 4JN6A 1IY2A 3FTDA 5C1BA 3GQ3A 3L29A 4LJ6A 4CHTB 1DGHB 4QHSA 4QNMA 3NWLA 3HJSA 4GC5A 3ZC7B 3KFUG 3L26A 2DZOB 3J80S 1QZMA 4GH9A 4LF5M 2CEAA 3J7AS 1NJFA 2C96A 2XSZD 3U6OA 2Z7JA 3AOEC 3VDUA 1W5SA 4B08A 5IWAM 2Y0TA 4G6ZA 5DNYA 1IBMM 1IN6A 4G4NA 4TUWA 5KPZA 2R62A 3AFHA 1L1TA 1JR3A 2KZUA 1ZQ9A 3GPPA 1K3WA 4LFCM 3M7GA 5E6JA 1R6BX 3U60A 5KPRA 2VQEM 2YFQA 4LJ9A 1KYIA 3JR4A 3T38A 4G4QA 5IREB 2DWLA 4LF8M 2VQFM 2RKOA 4IBJA 1NNJA 3TWKA 4B3RM 3HKPA 5GKNA 3UMMA 1NY6A 1IXRC 2R4JA 2I7NA 3FYCA 1NY5A 1FNNA 1EE8A 3I4VA 1XMOM 5BR8M 1I4WA 4DV0M 4DV7M 4GKKM 1HNWM 4IBBA 4NXMM 4AKHA 4DR5M 1KFVA 4B7FA 4WW0A 4YHHM 1QYRA 3SAWA 1IY1A 4L4UA 1IQPA 8CATA 3U5ZA 4LFBM 1N33M 4B3SM 4OVZA 1N75A 3E4RA 2G5GX 2OQ4A 4DR6M 2C9OA 4QNRA 2G8LA 1L2CA 4KHPM 2F5OA 3U6LA 2UUAM 4OW0A 2XFSA 4AKGA 3CF6E 2FNAA 4HL4A 5E26A 4JI0M 3H4MA 2QPAA 3TWLA 3JR5A 2QBYA 5JI3E 1JR3D 3KOXE 4FCWA 4AQYM 3BOSA 3MHVC 3HJ8A 1GLNA 2P5TA 3J7BA 1G59A 1S3SA 2H1RA 5ITXE 1SXJB 3CTWB 1N78A 5F3WA 5LMNM 4D81A 3IG8A 5H37D 4G4RA 2XSZA 3VLFB 4LZJA 1GVNA 4FWGA 4LY6A 1Q3CA 4GMQA 3PFIA 1NJGA 2FOIC 5DYIA 4B3TM 1IBKM 2XEPA 2KW0A 4EIWA 2KRKA 1TH4A 5EP3A 1TDZA 3HHWA 3SAUA 2ERCA 2M5ZA 2C98A 4LRSA 3GPXA 1HNXM 1XXHB 3W0FA 5EP4A 2KRUA 2XF3A 4JV5M 1G3IA 3J2PB 3SBJA 2O5RA 3SHGB 3GLHA 4MGKE 3HHYA 4DR2M 1N36M 3DOAA 1SXJE 1GL6A 1T3TA 3KVWA 4AZFA 5C18A 4NSRA 3SMPA 2KXEA 3K8ZA 4LGMA 2YR0A 4QOZC 2CUZA 1GKIA 1L2BA 3PXGA 4NRWA 4LJ5A 3VDPA 1W5TA 4IBKA 3SFZA 4I81A 1ORYB 5A2QS 4GIPA 2OPFA 4IBEA 5EJCA 4II7A 1N34M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD M;  1N32 M;  1I94 M;  4GKJ M;  4PCZ A;  4LF7 M;  2VQE M;  3U6P A;  3JR4 A;  5ITX A;  4DV6 M;  4G4Q A;  4G4O A;  5ITY A;  2UUC M;  4CIS A;  4LF8 M;  2VQF M;  1NNJ A;  2UUB M;  4LF4 M;  3TWK A;  2F4V M;  4B3R M;  1MU5 A;  1XNR M;  1TDH A;  4LF6 M;  4PD2 A;  2UXC M;  1EE8 A;  2XZU A;  2F5N A;  4JI1 M;  1XMO M;  5BR8 M;  4DV0 M;  4DV7 M;  3VK7 A;  4JI6 M;  1HNW M;  4JI3 M;  1HNZ M;  4NXM M;  4GKK M;  3U6Q A;  1R2Y A;  4ITQ A;  3GQ5 A;  4DR5 M;  1KFV A;  1K3X A;  4NXN M;  4YHH M;  2UXB M;  1IBL M;  3SAW A;  3SAS A;  4LFB M;  1N33 M;  1XMQ M;  1J5E M;  2F5P A;  4B3S M;  5ITT A;  4OX9 M;  2ZM6 M;  2OQ4 A;  1R2Z A;  4K0K M;  4DR6 M;  4JI4 M;  1HR0 M;  4DR3 M;  3U6E A;  2Q2E B;  1XC8 A;  1L2C A;  4KHP M;  2F5O A;  1Z5C A;  4DV2 M;  3U6L A;  4JI7 M;  3U6D A;  1K82 A;  2UUA M;  3VK8 A;  4X66 M;  5ITR A;  3GQ4 A;  4JI0 M;  1Z59 A;  2F5S A;  3TWL A;  3JR5 A;  4MB7 A;  4X64 M;  2HKJ A;  4AQY M;  3T1H M;  1PM5 A;  3A42 A;  3A45 A;  1FJG M;  1L2D A;  5LMU M;  1Z5A A;  4DV5 M;  2XZF A;  4LFA M;  5ITX E;  4NRV A;  4DR1 M;  3J81 S;  4DR4 M;  5IT9 S;  4DUY M;  3U6S A;  2HHH M;  2F5Q A;  5LMN M;  3T1Y M;  3GPU A;  1PJI A;  3SAT A;  4G4R A;  4PDI A;  4X62 M;  2EA0 A;  4DUZ M;  3U6M A;  4YY3 M;  1Q3C A;  1L1Z A;  4DR7 M;  1Q3B A;  4DV4 M;  5ITQ A;  4JI8 M;  4B3T M;  4JYA M;  1IBK M;  5FLX S;  3C58 A;  3GO8 A;  1PJJ A;  2UU9 M;  3JAM S;  3TWM A;  3GPY A;  1TDZ A;  1MX0 A;  3SAU A;  3U6C A;  3GPX A;  4LF9 M;  4DV3 M;  1HNX M;  3W0F A;  3GQ3 A;  2E5L M;  4PDG A;  4JV5 M;  3SBJ A;  4X65 M;  1N36 M;  4DR2 M;  3GP1 A;  3DOA A;  3J80 S;  4LF5 M;  3J7A S;  4DV1 M;  2ZBK B;  3U6O A;  5ITU A;  5IWA M;  1IBM M;  3A46 A;  4G4N A;  1L2B A;  1XNQ M;  4NRW A;  1L1T A;  1Q39 A;  2OPF A;  5A2Q S;  4JI2 M;  3SAR A;  3GPP A;  1K3W A;  3SAV A;  3OTO M;  4LFC M;  1Z5B A;  4B3M M;  4JI5 M;  1N34 M; 
#chains in the Genus database with same CATH topology
 2UXD M;  1N32 M;  5IZ7 D;  2BJV A;  4GKJ M;  4M9S A;  1YUB A;  1EFU B;  3FKE A;  3KSJ A;  2X49 A;  3HGI A;  3RFW A;  2C9C A;  2FFJ A;  3TE6 A;  1QAN A;  1UFZ A;  1OAO C;  4LF4 M;  2F4V M;  2KNA A;  4NOO B;  1IXS A;  1MU5 A;  2KA6 B;  2R0I A;  4IJE A;  4PD2 A;  3K2L A;  1VG5 A;  2J5Y A;  2Y21 A;  2XZU A;  4IIW A;  2CV2 A;  3RGS A;  2KZS A;  3SHF A;  3VFD A;  4JI6 M;  2VDB B;  4MGI E;  4ITQ A;  3RGP A;  2XGN A;  1IBL M;  2JY6 B;  4FD2 A;  3GLG A;  3U60 B;  2DAM A;  3AOE A;  4Z8X A;  4AG6 A;  3FTC A;  2EKF A;  1J5E M;  2GQF A;  4CGY B;  5ITT A;  4OX9 M;  1OFI A;  1OIZ A;  1DO2 A;  2DEN A;  2LNH C;  2LWX A;  4LZZ A;  1HR0 M;  4DR3 M;  2WSE F;  2DWM A;  4DV2 M;  2QNJ A;  1K82 A;  1NSF A;  1XB2 B;  5DFL A;  3GQ4 A;  4IBI A;  1IFY A;  1H6U A;  2JWS A;  2I7P A;  3KOZ E;  4NSO B;  1WIV A;  3SMS A;  4BLC A;  3U61 A;  3I04 M;  2V1C A;  2J7O A;  4FW9 A;  1QAM A;  3NBI A;  7CAT A;  3FUX A;  1IN5 A;  3A42 A;  3A45 A;  3DA1 A;  1G8P A;  2M60 A;  2V6Z M;  3U5Z B;  1QAO A;  3E46 A;  2DNA A;  4OVZ B;  3HHZ A;  5LMU M;  1Z5A A;  1NNU C;  3HU2 A;  4DR1 M;  4QOS A;  3J81 S;  3HHX A;  2DKL A;  2CV0 A;  4L8R C;  3U6S A;  4QHT A;  2HHH M;  3QAU A;  2RGO A;  3AL0 C;  3SAT A;  2JNH A;  2EA0 A;  3E9S A;  4IBC A;  3FTF A;  3FUW A;  2HAK A;  2ZAO A;  3FYD A;  3MK6 A;  4IBG A;  2LVA A;  2QBY B;  2BWE A;  4ZPX A;  3KP0 E;  2YQZ A;  4LJ7 A;  4AI6 A;  5KO3 A;  1VDL A;  4FWD A;  3NBX X;  1ZV1 A;  3B74 A;  1G4A E;  1XHB A;  2QHO B;  2UU9 M;  4GRI A;  3JAM S;  1G71 A;  2DAE A;  1MX0 A;  1AIP C;  2CHG A;  4LF9 M;  2LVO C;  3ILK A;  2E5L M;  4PDG A;  3KDS E;  1HT1 E;  2L09 A;  1YSY A;  4M0D A;  2JA2 A;  2QCU A;  2KEB A;  4X65 M;  5FTM A;  2AHM A;  3KOW E;  3Q8G A;  3GP1 A;  1MN3 A;  4D80 A;  3GLF A;  2FS1 A;  3LVV A;  3LW5 F;  4DV1 M;  5ITU A;  2N35 A;  3FUU A;  2NQ8 C;  1WGL A;  3QYE A;  2DAG A;  4L15 A;  1Q39 A;  4I5S A;  1SXJ C;  3ZQJ A;  4JI2 M;  3SAR A;  2LVN C;  1V92 A;  1VQ1 A;  2EUC A;  4B3M M;  3EIH A;  3RE8 A;  2VF8 A;  3GLH B;  1DGB A;  4FCV A;  1I94 M;  5L8R F;  2WZJ A;  1OAI A;  2VII A;  3GLI A;  5ITY A;  3T15 A;  1ZMV A;  1N77 A;  2L7I A;  1SXJ A;  2LHC A;  4FVM A;  4R7G A;  1DGG A;  2XLJ A;  4B7G A;  2UUB M;  1BVS A;  3B7Q A;  1ZMW A;  3KXE C;  1TDH A;  1IN7 A;  2C5R A;  1JQJ C;  1TH2 A;  1GJT A;  2BNK A;  2JY7 A;  2QSF X;  1C1K A;  3L2A A;  3ZCB B;  2F5N A;  4F1I A;  3VK7 A;  4WP2 A;  4GIT A;  1D0K A;  1NHW C;  3U6Q A;  3GQ5 A;  2FE8 A;  2KHH A;  1K3X A;  1GO5 A;  3FRH A;  3LCU A;  3QWL A;  4NXN M;  3UGJ A;  3LQQ A;  4REZ A;  4FWH A;  4M9Z A;  1VDD A;  3GLH E;  4RF0 A;  2J7N A;  2CV1 A;  2K9D A;  1R5L A;  5FTL A;  3VKH A;  3V76 A;  2L4F A;  2MJ5 B;  1X37 A;  3HU3 A;  4K0K M;  4BB9 A;  2DI0 A;  1DO0 A;  2CRU A;  1IXS B;  5BPV A;  3TPZ A;  1R7R A;  1Z5C A;  2K6B A;  2H5X A;  3VK8 A;  2Y0Q A;  1YLA A;  3KOY E;  3FTE A;  5ITR A;  4I4L A;  4IJF A;  3SYK A;  5JI2 E;  1IM2 A;  1TR8 A;  1HQY E;  1HT2 E;  1Z59 A;  3C3E A;  2DHR A;  4W5W A;  2ZTC A;  3Q8X A;  4XK8 F;  2ZAN A;  3HU1 A;  4L16 A;  3T1H M;  1PM5 A;  1VEK A;  3L27 A;  2O01 F;  1YE9 A;  3GLG B;  2A5Y B;  5FTN A;  1QQW A;  2MRO B;  2ZTD A;  3L25 A;  1WGN A;  4FCT A;  1E9R A;  2RRU A;  2GNO A;  1GAB A;  1E94 E;  2HCB A;  2KNV A;  2L7H A;  3GRU A;  4LFA M;  2MGW A;  5KPT A;  3IHP A;  4LJ8 A;  3R9X B;  2FH0 A;  3AJI B;  4NRV A;  1DGH A;  4DR4 M;  3HWS A;  2CHV A;  4DUY M;  2QEN A;  2Y20 A;  1Y8G A;  4NC6 A;  3GPU A;  2HL7 A;  1SXJ D;  4PDI A;  4AG5 A;  4X62 M;  2DHY A;  4YY3 M;  5EXX A;  3KS4 A;  4JXJ A;  2R45 A;  1V33 A;  4DR7 M;  2CHQ A;  5EQT A;  1EIJ A;  2APL A;  3U61 B;  4JYA M;  1RU3 A;  1E9S A;  3K92 A;  4M0W A;  2CFO A;  5FLX S;  1JR3 E;  3C58 A;  3W68 A;  3KSX A;  3M6A A;  4MGH A;  4MM3 B;  4R3D A;  3UK6 A;  4P16 A;  2LH0 A;  2R46 A;  4A3V B;  4F2L A;  3U6C A;  3GLG E;  2DVW B;  4DV3 M;  2W82 A;  2EKK A;  2JXN A;  5EXP A;  5EXT A;  2MR9 A;  2ZAM A;  5DYG A;  3E21 A;  3IG5 A;  1OJL A;  3LQR A;  4PT5 A;  3UJN A;  1XWI A;  3H4J A;  1IN4 A;  3KS8 A;  2OO9 A;  1GL7 A;  3QYB A;  4MGY E;  2ZBK B;  5EP1 A;  2C99 A;  3EIE A;  1PGY A;  2Z4S A;  3LVW A;  4CJ6 A;  1MJG M;  1OIP A;  1PRB A;  1T43 A;  1NHG C;  3PVS A;  3A46 A;  2LVP C;  3L28 A;  2R65 A;  1T6O A;  3FD9 A;  3FUT A;  1XNQ M;  3GRR A;  2BJW A;  3B9P A;  1D2N A;  3PNV A;  2R18 A;  2R4E A;  1WR1 B;  3R8F A;  3TQS A;  3HX3 A;  2JP7 A;  2X4A A;  4GC9 A;  3OTO M;  3SAV A;  1Z5B A;  4JI5 M;  3AKZ A;  4LG2 A;  2G3Q A;  1OFH A;  3LMM A;  3WHL A;  2YNM D;  4PCZ A;  4LF7 M;  3HZJ A;  2X8A A;  3GLF B;  2XFT A;  3U6P A;  4LGY A;  3HY5 A;  1J09 A;  5ITX A;  4DV6 M;  4G4O A;  4NL4 H;  4R71 A;  3GRY A;  3CF2 A;  1TGU A;  3B89 A;  2UUC M;  4CIS A;  2D7E A;  4G3O A;  4GHL A;  2D7H A;  3SYL A;  1JB0 F;  2V1U A;  4LF6 M;  1XNR M;  4IBD A;  1OTR A;  3UZU A;  2UXC M;  4LCB A;  2LXE A;  4Z6Y A;  1HQC A;  3C3D A;  2RGH A;  3AOG A;  1G41 A;  3MJ5 A;  4JI1 M;  4B7H A;  2EO2 A;  3DZD A;  4JI3 M;  1HNZ M;  3CF0 A;  4LJA A;  4L78 A;  1R2Y A;  5FTJ A;  1V34 A;  5KQ8 A;  5FSW A;  1P3Q Q;  2UXB M;  3KW6 A;  4XBO A;  2CWB A;  3D8B A;  3FE3 A;  2DXI A;  2XH9 A;  3A98 B;  2L4E A;  3AV0 A;  4KOD A;  4AW4 A;  1C7Y A;  3GLI B;  3SAS A;  1XMQ M;  2F5P A;  4LJ4 A;  3I4Y A;  3I51 A;  2ZM6 M;  1R2Z A;  3FUV A;  1TH3 A;  3GLF E;  1J7K A;  3PNY A;  2DWZ B;  4JI4 M;  2D7G A;  2BWB A;  1A5T A;  1IN8 A;  2DAI A;  2Q2E B;  2QZ4 A;  3U6E A;  1XC8 A;  3WHK A;  1ZAE A;  3U6D A;  2JY5 A;  4JI7 M;  5EXS A;  1LV7 A;  1N34 M;  2K47 A;  4S12 A;  4X66 M;  3VKG A;  3TL4 X;  2B3T A;  3J27 B;  2CE7 A;  1QAQ A;  1KSF X;  1IXZ A;  4KLN A;  1CUK A;  4OU7 A;  4MH0 E;  2F5S A;  4I8O A;  1D0L A;  4MB7 A;  1OKS A;  4X64 M;  2HKJ A;  2VF7 A;  1QVR A;  4D82 A;  1Z6T A;  4GHA A;  1FJG M;  4MGZ E;  4IBF A;  1L2D A;  3IEC A;  4WUR A;  1TF0 B;  2MH8 A;  4Y28 F;  5KQD A;  3B7N A;  1WXQ A;  3THG A;  4DV5 M;  1XXH A;  4HLQ A;  4BBA A;  2XZF A;  3DFZ A;  1SG9 A;  3GLI E;  2Z4R A;  5IT9 S;  4RF1 A;  1PJQ A;  2L6O A;  2F5Q A;  3T1Y M;  4LRT A;  1PJI A;  1E32 A;  3BBZ A;  3U6M A;  3SC3 A;  4DUZ M;  1DV0 A;  1UM8 A;  4M9X A;  3B7Z A;  4XGI A;  3W0L B;  3BXW A;  1Q3B A;  1L8Q A;  3M0E A;  4DV4 M;  1L1Z A;  1VEG A;  5ITQ A;  4JI8 M;  3K1J A;  1NVM A;  3KP1 E;  4RNA A;  5FTK A;  3HJQ A;  2DZN B;  3GO8 A;  1PJJ A;  2QP9 X;  1DGF A;  2JZ1 A;  4KO8 A;  1IY0 A;  5EP2 A;  1ZMU A;  2Z3X A;  1R4G A;  3TWM A;  3GPY A;  3D8L A;  3GRV A;  4CIZ A;  2DWN A;  2QQ8 A;  4AKI A;  1QUT A;  3ZH9 B;  4JN6 A;  1IY2 A;  3F92 A;  3FTD A;  5C1B A;  3GQ3 A;  3L29 A;  4LJ6 A;  3T6P A;  4CHT B;  1DGH B;  4QHS A;  1Q02 A;  4QNM A;  3NWL A;  3HJS A;  4GC5 A;  3ZC7 B;  3KFU G;  3L26 A;  2DZO B;  3J80 S;  1QZM A;  4GH9 A;  4LF5 M;  2CEA A;  1QUS A;  3J7A S;  1NJF A;  2C96 A;  2XSZ D;  3U6O A;  2Z7J A;  3AOE C;  3VDU A;  1W5S A;  4B08 A;  5IWA M;  2Y0T A;  4G6Z A;  5DNY A;  1IBM M;  1IN6 A;  4G4N A;  4TUW A;  5KPZ A;  2R62 A;  3AFH A;  2K0B X;  1JR3 A;  1L1T A;  2KZU A;  1ZQ9 A;  3GPP A;  1WHC A;  2DAK A;  4RKU F;  1K3W A;  2JUJ A;  2KNZ A;  4GEW A;  4LFC M;  1D0M A;  3M7G A;  5E6J A;  1AUA A;  1R6B X;  3U60 A;  5KPR A;  2VQE M;  2YFQ A;  4LJ9 A;  1KYI A;  3JR4 A;  3T38 A;  4G4Q A;  5IRE B;  2CP8 A;  2OOA A;  4ANR A;  2DWL A;  2DZL A;  2LVQ D;  4LF8 M;  2VQF M;  2RKO A;  4IBJ A;  1NNJ A;  1F4I A;  3TWK A;  4B3R M;  3HKP A;  2WSC F;  5GKN A;  3UMM A;  1NY6 A;  1IXR C;  2R4J A;  2I7N A;  2JY8 A;  3FYC A;  1NY5 A;  1FNN A;  1EE8 A;  3I4V A;  1OQY A;  1XMO M;  5BR8 M;  1I4W A;  4P17 A;  4DV0 M;  4DV7 M;  1HNW M;  4IBB A;  4NXM M;  4GKK M;  4UN2 B;  1QDT A;  4AKH A;  4DR5 M;  1KFV A;  3CGW A;  1NO1 A;  4B7F A;  4WW0 A;  4KT0 F;  3K9P A;  4YHH M;  1QYR A;  2LTU A;  3SAW A;  1IY1 A;  4L4U A;  1IQP A;  8CAT A;  3U5Z A;  4LFB M;  1N33 M;  1WJ7 A;  3LCV B;  4B3S M;  2L2D A;  4DBG B;  4L6V 6;  2EJS A;  1N75 A;  4OVZ A;  3E4R A;  2G5G X;  2OQ4 A;  1GJS A;  4DR6 M;  2C9O A;  4QNR A;  2G8L A;  1L2C A;  4KHP M;  2F5O A;  3U6L A;  2R6F A;  2UUA M;  4OW0 A;  2XFS A;  4AKG A;  3CF6 E;  2FNA A;  4HL4 A;  5E26 A;  4JI0 M;  3C9P A;  3H4M A;  2QPA A;  3TWL A;  3JR5 A;  2QBY A;  3FRI A;  5JI3 E;  1JR3 D;  3KOX E;  4FCW A;  4AQY M;  3BOS A;  1NV8 A;  3MHV C;  3HJ8 A;  1GLN A;  2JZ0 A;  2LBC A;  2P5T A;  1NV9 A;  3K9O A;  3J7B A;  1G59 A;  1S3S A;  2H1R A;  5ITX E;  2Z8Y M;  3W67 A;  1SXJ B;  3CTW B;  1N78 A;  5F3W A;  5LMN M;  2HWJ A;  4D81 A;  3IG8 A;  5H37 D;  4G4R A;  2XSZ A;  1HJP A;  4LZJ A;  3VLF B;  1GVN A;  4FWG A;  4LY6 A;  1Q3C A;  4GMQ A;  3PFI A;  1NJG A;  1QDR A;  2FOI C;  5DYI A;  4B3T M;  2KDL A;  1IBK M;  2XEP A;  2KW0 A;  1PJT A;  4EIW A;  2KRK A;  1TH4 A;  5EP3 A;  1TDZ A;  3HHW A;  3I01 M;  3SAU A;  2ERC A;  2M5Z A;  2C98 A;  4LRS A;  3GPX A;  1VEJ A;  1XXH B;  3W0F A;  5EP4 A;  2OOB A;  1HNX M;  2KRU A;  2XF3 A;  4JV5 M;  1G3I A;  1TTE A;  3J2P B;  2O5R A;  3SHG B;  3SBJ A;  1QZE A;  3GLH A;  4MGK E;  3HHY A;  4DR2 M;  2R44 A;  1N36 M;  2O25 A;  3DOA A;  1SXJ E;  1GL6 A;  1T3T A;  3KVW A;  4AZF A;  1LTM A;  4HEO A;  2LHG A;  5C18 A;  2WSF F;  1PJS A;  4NSR A;  3SMP A;  2KXE A;  3K8Z A;  4LGM A;  2YR0 A;  4Q7J A;  4QOZ C;  2CUZ A;  1GKI A;  1L2B A;  3PXG A;  4NRW A;  4LJ5 A;  3VDP A;  1W5T A;  4IBK A;  3SFZ A;  4I81 A;  1ORY B;  5A2Q S;  4GIP A;  2OPF A;  4IBE A;  3MMP A;  5EJC A;  4II7 A;  1XXH E; 
#chains in the Genus database with same CATH homology
 2UXD M;  1N32 M;  5IZ7 D;  2BJV A;  4GKJ M;  4M9S A;  1YUB A;  3FKE A;  3KSJ A;  2X49 A;  3HGI A;  3RFW A;  2C9C A;  2FFJ A;  3TE6 A;  1QAN A;  2F4V M;  4LF4 M;  4NOO B;  1MU5 A;  2KA6 B;  4IJE A;  4PD2 A;  3K2L A;  2Y21 A;  2XZU A;  4IIW A;  2CV2 A;  3RGS A;  2KZS A;  3SHF A;  3VFD A;  4JI6 M;  4MGI E;  4ITQ A;  3RGP A;  2XGN A;  1IBL M;  4FD2 A;  3U60 B;  3GLG A;  3AOE A;  4Z8X A;  4AG6 A;  3FTC A;  1J5E M;  4CGY B;  5ITT A;  4OX9 M;  1OFI A;  1DO2 A;  2LNH C;  2LWX A;  4LZZ A;  1HR0 M;  4DR3 M;  2DWM A;  4DV2 M;  1K82 A;  1NSF A;  3GQ4 A;  4IBI A;  1H6U A;  2I7P A;  3KOZ E;  4NSO B;  3SMS A;  3U61 A;  4BLC A;  2V1C A;  2J7O A;  4FW9 A;  1QAM A;  3NBI A;  7CAT A;  3FUX A;  1IN5 A;  3A42 A;  3A45 A;  3DA1 A;  1G8P A;  2M60 A;  2V6Z M;  3U5Z B;  1QAO A;  3HHZ A;  4OVZ B;  5LMU M;  1Z5A A;  1NNU C;  3HU2 A;  4DR1 M;  4QOS A;  3J81 S;  3HHX A;  2CV0 A;  4L8R C;  3U6S A;  4QHT A;  2HHH M;  3QAU A;  2RGO A;  3AL0 C;  3SAT A;  2EA0 A;  3E9S A;  4IBC A;  3FTF A;  3FUW A;  2ZAO A;  3FYD A;  3MK6 A;  4IBG A;  2QBY B;  4ZPX A;  3KP0 E;  2YQZ A;  4LJ7 A;  4AI6 A;  5KO3 A;  4FWD A;  1G4A E;  1XHB A;  2UU9 M;  4GRI A;  3JAM S;  1MX0 A;  2CHG A;  4LF9 M;  3ILK A;  2E5L M;  4PDG A;  3KDS E;  1HT1 E;  2L09 A;  1YSY A;  4M0D A;  2JA2 A;  2QCU A;  2KEB A;  4X65 M;  5FTM A;  2AHM A;  3KOW E;  3GP1 A;  4D80 A;  3GLF A;  3LVV A;  4DV1 M;  5ITU A;  3FUU A;  2NQ8 C;  4L15 A;  1Q39 A;  4I5S A;  1SXJ C;  4JI2 M;  3SAR A;  2EUC A;  4B3M M;  3EIH A;  3RE8 A;  3GLH B;  4FCV A;  1DGB A;  1I94 M;  2VII A;  3GLI A;  5ITY A;  3T15 A;  1N77 A;  2L7I A;  1SXJ A;  4FVM A;  4R7G A;  2XLJ A;  1DGG A;  4B7G A;  2UUB M;  3KXE C;  1TDH A;  1IN7 A;  2C5R A;  1JQJ C;  1TH2 A;  2BNK A;  3L2A A;  1C1K A;  3ZCB B;  2F5N A;  3VK7 A;  4GIT A;  1NHW C;  3U6Q A;  3GQ5 A;  2FE8 A;  1K3X A;  3QWL A;  4NXN M;  3UGJ A;  3LQQ A;  4REZ A;  4FWH A;  4M9Z A;  1VDD A;  4RF0 A;  2J7N A;  2CV1 A;  3VKH A;  5FTL A;  4K0K M;  1X37 A;  3HU3 A;  4BB9 A;  1DO0 A;  1IXS B;  5BPV A;  3TPZ A;  1R7R A;  1Z5C A;  3VK8 A;  2Y0Q A;  3KOY E;  3FTE A;  5ITR A;  4I4L A;  4IJF A;  3SYK A;  5JI2 E;  1IM2 A;  1HQY E;  1HT2 E;  1Z59 A;  4W5W A;  2DHR A;  3Q8X A;  2ZAN A;  3HU1 A;  4L16 A;  3T1H M;  1PM5 A;  3L27 A;  1YE9 A;  3GLG B;  2A5Y B;  5FTN A;  1QQW A;  3L25 A;  4FCT A;  1E9R A;  1E94 E;  2HCB A;  2L7H A;  3GRU A;  5KPT A;  4LFA M;  3R9X B;  4LJ8 A;  3AJI B;  4NRV A;  4DR4 M;  1DGH A;  3HWS A;  2CHV A;  4DUY M;  2QEN A;  2Y20 A;  3GPU A;  2HL7 A;  1SXJ D;  4PDI A;  4AG5 A;  4X62 M;  4YY3 M;  5EXX A;  3KS4 A;  4JXJ A;  2R45 A;  4DR7 M;  2CHQ A;  5EQT A;  3U61 B;  4JYA M;  1E9S A;  3K92 A;  4M0W A;  2CFO A;  5FLX S;  3C58 A;  3KSX A;  3M6A A;  4MGH A;  4MM3 B;  4R3D A;  3UK6 A;  4P16 A;  2LH0 A;  2R46 A;  4A3V B;  3U6C A;  2DVW B;  4DV3 M;  2W82 A;  5EXP A;  5EXT A;  2ZAM A;  5DYG A;  3IG5 A;  1OJL A;  3LQR A;  4PT5 A;  3UJN A;  1XWI A;  1IN4 A;  3KS8 A;  1GL7 A;  4MGY E;  2ZBK B;  5EP1 A;  2C99 A;  3EIE A;  2Z4S A;  3LVW A;  1NHG C;  3PVS A;  3A46 A;  3L28 A;  2R65 A;  3FD9 A;  3FUT A;  1XNQ M;  3GRR A;  2BJW A;  3B9P A;  1D2N A;  3PNV A;  2R18 A;  2R4E A;  3R8F A;  3TQS A;  2X4A A;  4GC9 A;  3OTO M;  3SAV A;  1Z5B A;  4JI5 M;  3AKZ A;  4LG2 A;  1OFH A;  3LMM A;  3WHL A;  2YNM D;  4PCZ A;  4LF7 M;  2X8A A;  3GLF B;  2XFT A;  3U6P A;  4LGY A;  1J09 A;  5ITX A;  4DV6 M;  4G4O A;  4NL4 H;  3GRY A;  3CF2 A;  1TGU A;  2UUC M;  4CIS A;  2D7E A;  4GHL A;  2D7H A;  3SYL A;  1XNR M;  2V1U A;  4LF6 M;  4IBD A;  3UZU A;  2UXC M;  4LCB A;  2LXE A;  4Z6Y A;  1HQC A;  3MJ5 A;  2RGH A;  3AOG A;  1G41 A;  4JI1 M;  4B7H A;  2EO2 A;  3DZD A;  4JI3 M;  1HNZ M;  3CF0 A;  4LJA A;  4L78 A;  1R2Y A;  5FTJ A;  5KQ8 A;  5FSW A;  2UXB M;  3KW6 A;  4XBO A;  3D8B A;  2DXI A;  2XH9 A;  3A98 B;  4KOD A;  3AV0 A;  3SAS A;  4AW4 A;  3GLI B;  1XMQ M;  2F5P A;  4LJ4 A;  3I4Y A;  3I51 A;  2ZM6 M;  1R2Z A;  3FUV A;  1TH3 A;  1J7K A;  3PNY A;  2DWZ B;  4JI4 M;  2D7G A;  2QZ4 A;  1IN8 A;  2Q2E B;  3U6E A;  1XC8 A;  3WHK A;  1ZAE A;  3U6D A;  4JI7 M;  5EXS A;  1LV7 A;  2K47 A;  4S12 A;  4X66 M;  3VKG A;  3TL4 X;  3J27 B;  2CE7 A;  1QAQ A;  1KSF X;  1IXZ A;  4KLN A;  4OU7 A;  4MH0 E;  2F5S A;  4I8O A;  4MB7 A;  4X64 M;  2HKJ A;  1QVR A;  4D82 A;  1Z6T A;  4GHA A;  1FJG M;  4MGZ E;  4IBF A;  1L2D A;  4WUR A;  5KQD A;  1WXQ A;  3THG A;  4DV5 M;  1XXH A;  4HLQ A;  4BBA A;  2XZF A;  3DFZ A;  2Z4R A;  5IT9 S;  4RF1 A;  2F5Q A;  2L6O A;  3T1Y M;  4LRT A;  1PJI A;  1E32 A;  3U6M A;  3SC3 A;  4DUZ M;  1UM8 A;  4M9X A;  4XGI A;  3W0L B;  3M0E A;  1Q3B A;  1L8Q A;  1L1Z A;  4DV4 M;  5ITQ A;  4JI8 M;  3K1J A;  1NVM A;  3KP1 E;  4RNA A;  5FTK A;  3HJQ A;  2DZN B;  3GO8 A;  1PJJ A;  2QP9 X;  1DGF A;  4KO8 A;  5EP2 A;  1IY0 A;  2Z3X A;  3TWM A;  3GPY A;  3D8L A;  3GRV A;  2DWN A;  4AKI A;  3ZH9 B;  4JN6 A;  1IY2 A;  3FTD A;  5C1B A;  3GQ3 A;  3L29 A;  4LJ6 A;  4CHT B;  1DGH B;  4QHS A;  4QNM A;  3NWL A;  3HJS A;  4GC5 A;  3ZC7 B;  3KFU G;  3L26 A;  2DZO B;  3J80 S;  1QZM A;  4GH9 A;  4LF5 M;  2CEA A;  3J7A S;  1NJF A;  2C96 A;  2XSZ D;  3U6O A;  2Z7J A;  3AOE C;  3VDU A;  1W5S A;  4B08 A;  5IWA M;  2Y0T A;  4G6Z A;  5DNY A;  1IBM M;  1IN6 A;  4G4N A;  4TUW A;  5KPZ A;  2R62 A;  3AFH A;  1L1T A;  1JR3 A;  2KZU A;  1ZQ9 A;  3GPP A;  1K3W A;  4LFC M;  3M7G A;  5E6J A;  1R6B X;  3U60 A;  5KPR A;  2VQE M;  2YFQ A;  4LJ9 A;  1KYI A;  3JR4 A;  3T38 A;  4G4Q A;  5IRE B;  2DWL A;  4LF8 M;  2VQF M;  2RKO A;  4IBJ A;  1NNJ A;  3TWK A;  4B3R M;  3HKP A;  5GKN A;  3UMM A;  1NY6 A;  1IXR C;  2R4J A;  2I7N A;  3FYC A;  1NY5 A;  1FNN A;  1EE8 A;  3I4V A;  1XMO M;  5BR8 M;  1I4W A;  4DV0 M;  4DV7 M;  4GKK M;  1HNW M;  4IBB A;  4NXM M;  4AKH A;  4DR5 M;  1KFV A;  4B7F A;  4WW0 A;  4YHH M;  1QYR A;  3SAW A;  1IY1 A;  4L4U A;  1IQP A;  8CAT A;  3U5Z A;  4LFB M;  1N33 M;  4B3S M;  4OVZ A;  1N75 A;  3E4R A;  2G5G X;  2OQ4 A;  4DR6 M;  2C9O A;  4QNR A;  2G8L A;  1L2C A;  4KHP M;  2F5O A;  3U6L A;  2UUA M;  4OW0 A;  2XFS A;  4AKG A;  3CF6 E;  2FNA A;  4HL4 A;  5E26 A;  4JI0 M;  3H4M A;  2QPA A;  3TWL A;  3JR5 A;  2QBY A;  5JI3 E;  1JR3 D;  3KOX E;  4FCW A;  4AQY M;  3BOS A;  3MHV C;  3HJ8 A;  1GLN A;  2P5T A;  3J7B A;  1G59 A;  1S3S A;  2H1R A;  5ITX E;  1SXJ B;  3CTW B;  1N78 A;  5F3W A;  5LMN M;  4D81 A;  3IG8 A;  5H37 D;  4G4R A;  2XSZ A;  3VLF B;  4LZJ A;  1GVN A;  4FWG A;  4LY6 A;  1Q3C A;  4GMQ A;  3PFI A;  1NJG A;  2FOI C;  5DYI A;  4B3T M;  1IBK M;  2XEP A;  2KW0 A;  4EIW A;  2KRK A;  1TH4 A;  5EP3 A;  1TDZ A;  3HHW A;  3SAU A;  2ERC A;  2M5Z A;  2C98 A;  4LRS A;  3GPX A;  1HNX M;  1XXH B;  3W0F A;  5EP4 A;  2KRU A;  2XF3 A;  4JV5 M;  1G3I A;  3J2P B;  3SBJ A;  2O5R A;  3SHG B;  3GLH A;  4MGK E;  3HHY A;  4DR2 M;  1N36 M;  3DOA A;  1SXJ E;  1GL6 A;  1T3T A;  3KVW A;  4AZF A;  5C18 A;  4NSR A;  3SMP A;  2KXE A;  3K8Z A;  4LGM A;  2YR0 A;  4QOZ C;  2CUZ A;  1GKI A;  1L2B A;  3PXG A;  4NRW A;  4LJ5 A;  3VDP A;  1W5T A;  4IBK A;  3SFZ A;  4I81 A;  1ORY B;  5A2Q S;  4GIP A;  2OPF A;  4IBE A;  5EJC A;  4II7 A;  1N34 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...