1I94M

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 21
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i94M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1i94M02
4ITQA 1XNRM 1N33M 4X62M 1N34M 1R2ZA 1Z5BA 4NXMM 3TWMA 4OX9M 3TWKA 1Q39A 1MU5A 4GKKM 4PDIA 4DR2M 1HNXM 1Z5AA 3SBJA 4DR7M 4DR4M 1PJJA 1N32M 3JR4A 4X66M 4AQYM 3W0FA 3U6LA 2UUCM 3GQ3A 4LF4M 2XZFA 3GQ4A 5FLXS 3T1HM 1EE8A 5ITTA 4B3TM 1PM5A 4JI7M 2F5OA 4YHHM 4G4QA 1XC8A 3U6OA 4LF8M 4LFBM 3A46A 1XMQM 2ZM6M 1Q3CA 4DV3M 5IT9S 4JI4M 4DUZM 4G4NA 1NNJA 4DV7M 5ITRA 4LFCM 3SATA 2UUAM 4LF7M 3A42A 4B3SM 2OQ4A 5LMUM 4JI3M 1L2CA 4G4OA 4PDGA 3U6EA 2VQEM 1Q3BA 4LFAM 4NRWA 3OTOM 2F5SA 4PD2A 3GPYA 4JI2M 1L2DA 4DV6M 4NRVA 4YY3M 4DR1M 1TDZA 2ZBKB 3U6PA 4NXNM 4JI6M 3A45A 4JI0M 1IBKM 4B3MM 3U6DA 1IBLM 3JR5A 2EA0A 3GPPA 4CISA 3VK7A 4LF9M 1MX0A 2UUBM 1HNWM 2VQFM 1Z59A 4DV1M 2E5LM 2UXBM 4PCZA 3JAMS 3SAUA 1R2YA 3SAVA 3VK8A 1FJGM 4KHPM 5ITXE 3GPXA 3T1YM 4LF6M 1J5EM 4DV4M 1XMOM 1PJIA 4DR5M 1K3WA 4K0KM 2HHHM 4JI1M 5ITQA 5BR8M 3GPUA 4JI5M 2UXDM 1Z5CA 5ITXA 3GQ5A 4DV5M 1N36M 2F5NA 3SASA 2UXCM 4X64M 4JYAM 4DV0M 5ITUA 1K3XA 3TWLA 3SAWA 5IWAM 2OPFA 5LMNM 2F5PA 4X65M 3C58A 1XNQM 2F5QA 4GKJM 2HKJA 3J7AS 1HR0M 4JV5M 1I94M 4B3RM 1KFVA 3DOAA 4DR6M 3SARA 3GP1A 4JI8M 1TDHA 1K82A 4DR3M 2Q2EB 5ITYA 1HNZM 2XZUA 1L1TA 3J80S 3U6CA 3U6MA 2F4VM 3J81S 1L1ZA 4MB7A 4DV2M 4G4RA 3U6QA 1L2BA 5A2QS 1IBMM 2UU9M 4LF5M 4DUYM 3U6SA 3GO8A
chains in the Genus database with same CATH superfamily
2R65A 3FUVA 5KPZA 1XNRM 1ZMUA 1TR8A 4FW9A 2Z3XA 3I04M 5JI3E 2JA2A 4PT5A 3J27B 2ZTDA 1MU5A 4GC5A 2JZ1A 3FUUA 4GKKM 2C9OA 1QUSA 3K1JA 1PJJA 5IREB 1N32M 1OJLA 3UK6A 3E4RA 2BNKA 3QYBA 3KSXA 3PNVA 3D8LA 1DGGA 3KOXE 4P16A 3GQ3A 3KS8A 2DXIA 4HEOA 2ZANA 3K9OA 3NBIA 2XGNA 2BWEA 3L29A 3HHZA 2CEAA 2M60A 3FRIA 1JR3D 3LVVA 5FSWA 4B3TM 2G5GX 3EIHA 4B7FA 5EXXA 4YHHM 1IY0A 2RKOA 1XC8A 3A98B 4AKIA 1NO1A 1V92A 1Q3CA 4DV3M 5BPVA 5IT9S 4XK8F 1TF0B 1IQPA 4DUZM 2QCUA 1GABA 2KZUA 1G59A 2QP9X 3B7QA 3D8BA 3HHXA 1ORYB 3MHVC 3I51A 3L28A 4ANRA 5LMUM 2CRUA 1L2CA 1GO5A 2DAEA 2R45A 5FTMA 4PDGA 2QPAA 3GLHE 3KXEC 4WW0A 2DZNB 4R3DA 2JY5A 2KNVA 1GLNA 3IG8A 2VQEM 3VDUA 4FWDA 2WSFF 4I81A 1P3QQ 2LTUA 1QAOA 4LJ8A 2ZTCA 1VQ1A 4DV6M 2D7GA 3L2AA 2Z8YM 3VKHA 3W68A 2YQZA 2CWBA 1SG9A 2GNOA 3B89A 2V1CA 1DO0A 1G71A 3HJSA 5DYGA 3C3EA 3I01M 3LCVB 2QZ4A 2OOAA 3Q8XA 2DWZB 3CF6E 1GL6A 4IIWA 2VF7A 3U6DA 2Y0QA 4P17A 2EA0A 1PRBA 4IBEA 3R8FA 1SXJA 2RGOA 4CJ6A 1MX0A 2MH8A 3U60A 2UUBM 3GLIE 1PJSA 1ZMWA 3FYDA 3H4MA 4QNRA 4PCZA 4DV1M 1NV8A 1HQYE 2K0BX 3MMPA 1R2YA 3ILKA 3VK8A 1TGUA 1V34A 5EQTA 1FJGM 3MK6A 5ITXE 3GPXA 3T1YM 1C1KA 4GRIA 1UM8A 1T3TA 4FWGA 4HL4A 2DWLA 1XMOM 3LVWA 4QOSA 4K0KM 4NSRA 4GITA 1I4WA 5BR8M 1NJFA 2DAGA 2HHHM 4JI5M 1N77A 4LZZA 1KYIA 3LW5F 3GQ5A 4DV5M 2F5NA 2CHQA 3B7NA 1XB2B 3ZQJA 4M0DA 2CE7A 3KOYE 2HWJA 2R62A 1Z6TA 4FD2A 4M9SA 2EUCA 1K3XA 3GRVA 4XBOA 3TE6A 3L25A 1XXHE 2VDBB 3VFDA 2WZJA 3U60B 2XFTA 1IM2A 2F5PA 2JXNA 1E94E 4CGYB 5JI2E 1VG5A 3KP0E 1IXSA 3PFIA 2DAMA 2R4JA 3GLGA 3C58A 1HR0M 1XNQM 4GKJM 3DOAA 4MGZE 4LRTA 3VLFB 2DAIA 1TDHA 5DFLA 4DR3M 2C99A 2KW0A 3FE3A 4LJ9A 2LXEA 1L1TA 3K2LA 3AOEA 3SMPA 3B74A 4BB9A 2J7NA 4MB7A 2KDLA 3U6QA 1IBMM 4L15A 3DA1A 4ITQA 2L09A 2EKFA 3BOSA 2HL7A 2CV2A 4D81A 4KO8A 3B9PA 3FRHA 1XWIA 1Z5BA 2JY6B 1R2ZA 4AKGA 3I4YA 4IJFA 3K92A 1OQYA 3M0EA 3GLGB 4PDIA 1Z5AA 1IXSB 1VDDA 2R46A 3MJ5A 4OVZA 3W67A 2D7EA 2DVWB 2DI0A 4II7A 4AQYM 3GRRA 2QQ8A 3KP1E 1SXJC 4L6V6 2JZ0A 3RFWA 2UUCM 4MGKE 1N75A 2JY8A 1IN8A 5EP1A 3HKPA 3UGJA 1QQWA 3F92A 4M9XA 4AG5A 4EIWA 3T1HM 1G4AE 1EE8A 4FCVA 4MM3B 1QANA 5ITTA 2F5OA 4IBJA 2J5YA 2QNJA 2X49A 1QUTA 3U6OA 3A46A 1XMQM 3PXGA 4REZA 4L4UA 1D2NA 2XLJA 3CTWB 1QZEA 1WJ7A 4DV7M 1D0LA 2O01F 2ERCA 3SMSA 2FFJA 1JQJC 4Z6YA 3KFUG 2C96A 4OVZB 2OQ4A 2HAKA 1AUAA 1GVNA 2APLA 1WGNA 3GRUA 4G4OA 5DNYA 2R0IA 3QAUA 4CIZA 1EFUB 1IY2A 2ZAOA 5EXPA 4Z8XA 4NRWA 1JR3E 3FKEA 3OTOM 2F5SA 1ZQ9A 4MGHA 2KRKA 3GPYA 4JI2M 1GL7A 2V1UA 4YY3M 1IY1A 3U6PA 3AOEC 2G8LA 4NXNM 3SHGB 1ZAEA 3CF2A 4JI0M 3R9XB 2Y20A 2L4FA 3BBZA 4RF0A 3HU3A 1NNUC 2LH0A 4GC9A 1IBLM 4JN6A 2XSZA 1HNWM 2RRUA 4S12A 2MROB 4IBDA 2UXBM 1L8QA 3SAUA 5DYIA 5EP4A 3LMMA 4KHPM 3HX3A 1NJGA 2CHGA 3CGWA 3GLIA 3T6PA 3VDPA 4LF6M 3FD9A 1J5EM 3GLHB 2OOBA 1H6UA 2R18A 3FYCA 3HHWA 2G3QA 1MN3A 5E26A 3GPUA 1VEKA 3C3DA 1HT1E 1NVMA 1MJGM 5ITXA 3U61B 2QENA 2R44A 4LRSA 4X64M 2UXCM 1DV0A 5FTJA 1WGLA 2DAKA 2MJ5B 3FTFA 5GKNA 1WIVA 4LJ5A 2DZLA 1IN5A 1NHGC 2WSCF 2CV0A 2LHGA 3SFZA 1OAIA 4TUWA 2KZSA 3FTEA 1QAMA 3HGIA 3SYLA 4JI8M 1E9SA 2NQ8C 4LJ4A 5EJCA 1DGFA 2Q2EB 4RKUF 5FTNA 2QHOB 5ITYA 3GLIB 3U6CA 1HNZM 4G3OA 2F4VM 2I7NA 3J81S 3M6AA 1V33A 1E9RA 3GLFE 4B7GA 1L2BA 5A2QS 2K47A 4LG2A 2JUJA 2DZOB 1QAQA 2YNMD 3GO8A 3GLFB 3FTDA 2VIIA 4GIPA 2CFOA 1KSFX 1S3SA 2CUZA 1N33M 4M9ZA 4X62M 1N34M 4NXMM 3TWMA 4OX9M 2FNAA 3TWKA 1Q39A 2DKLA 2LHCA 3DFZA 1PJQA 3E21A 4AKHA 4DR2M 3SBJA 4DR4M 4MGYE 3KOWE 1VEJA 5EXSA 2CHVA 1XXHB 3EIEA 4X66M 1IFYA 4D82A 2O25A 2CP8A 1DGHB 3E46A 4FCTA 2WSEF 4LF4M 2BWBA 2CV1A 2XZFA 1OFIA 3VKGA 3K8ZA 1IXRC 2BJVA 3GQ4A 3L26A 4NOOB 5FLXS 4AI6A 3KOZE 1PM5A 2YFQA 4JI7M 1R7RA 2Z4RA 3FUXA 1SXJE 2I7PA 4IBGA 3KVWA 3UJNA 4LF8M 5EP2A 3IECA 3BXWA 2LVPC 3FTCA 4LJAA 1A5TA 1SXJD 4IBKA 3W0LB 2C98A 2KNZA 4G4NA 1NNJA 2FE8A 4FCWA 2DENA 2KRUA 3WHKA 3ZH9B 4GMQA 2QSFX 5IZ7D 4B08A 4IJEA 1PJTA 5KQ8A 2UUAM 1JB0F 4AW4A 4CHTB 1QZMA 2X4AA 2H5XA 4Q7JA 2L2DA 3NBXX 2XF3A 5KQDA 3U6EA 3KDSE 4GEWA 1OTRA 1IN6A 4LFAM 1D0KA 3CF0A 4A3VB 2DWNA 4PD2A 4OU7A 5E6JA 2LVNC 4HLQA 4NRVA 4NSOB 3RGSA 2JWSA 3PNYA 2RGHA 4D80A 2ZBKB 4DR1M 3GRYA 1UFZA 1TDZA 1JR3A 4JI6M 3HWSA 2EO2A 3FUWA 4MGIE 3WHLA 3ZC7B 1IBKM 4B3MM 3AKZA 1NHWC 1T6OA 2KXEA 2M5ZA 2DHRA 4LGMA 4LF9M 2LVQD 2A5YB 1PGYA 1Z59A 2E5LM 2K6BA 1R4GA 1VEGA 2XFSA 4QHSA 3L27A 1FNNA 3SAVA 2LWXA 1GJSA 1YUBA 3NWLA 2FS1A 3UZUA 3IG5A 2X8AA 1W5SA 2Z4SA 2Z7JA 1IN7A 1NY5A 1K3WA 4DR5M 2QBYB 5ITQA 2JNHA 3GLHA 1LTMA 2EKKA 3SHFA 1WHCA 4RNAA 4Y28F 3U61A 2MGWA 2HCBA 1BVSA 4QNMA 1HT2E 2N35A 1NV9A 4IBIA 5IWAM 3B7ZA 4QOZC 4LGYA 1DGBA 1R5LA 4X65M 5FTKA 2HKJA 3QWLA 4BLCA 3U5ZB 7CATA 3HHYA 4QHTA 4DR6M 1K82A 3LQRA 1EIJA 2XZUA 3J80S 4KLNA 4W5WA 3U6MA 1CUKA 2KNAA 3ZCBB 5KPTA 2DWMA 2KEBA 2FH0A 1QDRA 3KS4A 4WP2A 1TH4A 5KO3A 3U6SA 2L7IA 3RGPA 1W5TA 1XHBA 3GLFA 1OIZA 1TTEA 1G8PA 2KHHA 5H37D 1Y8GA 2AHMA 4LCBA 4LY6A 2JY7A 2VF8A 4XGIA 1HNXM 3HU2A 4LZJA 5L8RF 4DR7M 1R6BX 2R6FA 3JR4A 4L8RC 2XEPA 3W0FA 2OO9A 4RF1A 3U6LA 1XXHA 4IBCA 2R4EA 2DNAA 4KODA 1DGHA 1TH2A 2GQFA 3AL0C 4FVMA 2C5RA 1G41A 4R7GA 1GJTA 1RU3A 4I5SA 2JP7A 1OFHA 2LNHC 2O5RA 1DO2A 4G4QA 4GH9A 2W82A 1NY6A 4LFBM 4I8OA 3UMMA 5F3WA 2ZM6M 2XSZD 1G3IA 4JI4M 2LVOC 1ZV1A 3AJIB 3TPZA 5ITRA 4LFCM 3SATA 3SYKA 1TH3A 1YSYA 4LF7M 3A42A 4B3SM 1GKIA 1J09A 4JI3M 4AG6A 1OIPA 1VDLA 3C9PA 3HU1A 1YE9A 4ZPXA 2C9CA 3T15A 3HY5A 2MR9A 1Q3BA 4AZFA 3IHPA 5C1BA 3M7GA 3RE8A 1OKSA 1L2DA 4LJ7A 5FTLA 4GHLA 2BJWA 5EP3A 5EXTA 1F4IA 2K9DA 3HJQA 3KW6A 1QDTA 1WR1B 1AIPC 4OW0A 4MH0E 1NSFA 3A45A 1Q02A 3THGA 1IXZA 2Y0TA 1WXQA 2P5TA 4B7HA 1SXJB 2KA6B 1YLAA 3J2PB 3K9PA 4JXJA 3GPPA 3JR5A 1IN4A 2Y21A 4F2LA 3VK7A 4CISA 3T38A 2V6ZM 2VQFM 2XH9A 3JAMS 1HJPA 5C18A 4L78A 4BBAA 3QYEA 8CATA 2DHYA 3TL4X 1T43A 3H4JA 3HZJA 3PVSA 3Q8GA 4KT0F 4LJ6A 2FOIC 1HQCA 2LVAA 4DV4M 4IBFA 1PJIA 4F1IA 3FUTA 4JI1M 1QVRA 4L16A 2UXDM 2QBYA 3HJ8A 1N78A 1Z5CA 2L6OA 1N36M 3SASA 2LBCA 4M0WA 3AOGA 4NL4H 3LQQA 3GLGE 4JYAM 4IBBA 4DV0M 5ITUA 1OAOC 4GHAA 3TWLA 3I4VA 3SAWA 2YR0A 3DZDA 2OPFA 3AFHA 5LMNM 2L4EA 4I4LA 1C7YA 1J7KA 2J7OA 3V76A 2H1RA 2F5QA 5KPRA 2D7HA 3LCUA 3J7AS 4JV5M 4DBGB 1LV7A 1I94M 2L7HA 1KFVA 4B3RM 1E32A 3SARA 1D0MA 3GP1A 1X37A 1QYRA 2B3TA 3AV0A 3U5ZA 3E9SA 4R71A 1ZMVA 1L1ZA 3J7BA 4WURA 4DV2M 4G4RA 2ZAMA 4NC6A 4UN2B 3KSJA 2EJSA 3SC3A 2UU9M 4LF5M 4G6ZA 4FWHA 4DUYM 3TQSA
chains in the Genus database with same CATH topology
2R65A 3FUVA 5KPZA 1XNRM 4FW9A 2Z3XA 5JI3E 2JA2A 4PT5A 3J27B 1MU5A 4GC5A 4GKKM 3FUUA 2C9OA 3K1JA 1PJJA 5IREB 1N32M 1OJLA 3UK6A 3E4RA 2BNKA 3KSXA 3PNVA 3D8LA 1DGGA 3KOXE 4P16A 3GQ3A 3KS8A 2DXIA 2ZANA 3NBIA 2XGNA 3HHZA 3L29A 2CEAA 2M60A 3LVVA 1JR3D 5FSWA 4B3TM 2G5GX 3EIHA 4B7FA 5EXXA 4YHHM 1IY0A 2RKOA 1XC8A 3A98B 4AKIA 1Q3CA 4DV3M 5BPVA 5IT9S 1IQPA 4DUZM 2QCUA 2KZUA 1G59A 2QP9X 3D8BA 3HHXA 1ORYB 3MHVC 3I51A 3L28A 5LMUM 1L2CA 2R45A 5FTMA 4PDGA 2QPAA 3KXEC 4WW0A 2DZNB 4R3DA 2VQEM 1GLNA 3IG8A 3VDUA 4FWDA 4I81A 1QAOA 4LJ8A 4DV6M 2D7GA 3L2AA 3VKHA 2YQZA 2V1CA 1DO0A 3HJSA 5DYGA 3Q8XA 2QZ4A 4IIWA 2DWZB 3CF6E 1GL6A 3U6DA 2Y0QA 2EA0A 4IBEA 3R8FA 1SXJA 2RGOA 3U60A 1MX0A 2UUBM 3FYDA 3H4MA 4QNRA 4DV1M 4PCZA 1HQYE 1R2YA 3ILKA 3VK8A 1TGUA 1FJGM 5EQTA 3MK6A 5ITXE 3GPXA 3T1YM 1C1KA 4GRIA 1UM8A 1T3TA 4FWGA 4HL4A 2DWLA 1XMOM 3LVWA 4QOSA 4K0KM 4NSRA 4GITA 1I4WA 5BR8M 1NJFA 2HHHM 4JI5M 1N77A 4LZZA 1KYIA 3GQ5A 4DV5M 2F5NA 2CHQA 4M0DA 2CE7A 3KOYE 2R62A 1Z6TA 4FD2A 4M9SA 2EUCA 1K3XA 3GRVA 4XBOA 3TE6A 3L25A 3VFDA 3U60B 2XFTA 1IM2A 2F5PA 1E94E 4CGYB 5JI2E 3KP0E 3PFIA 3GLGA 3C58A 2R4JA 1XNQM 4GKJM 1HR0M 3DOAA 4MGZE 4LRTA 3VLFB 1TDHA 4DR3M 2C99A 2KW0A 4LJ9A 2LXEA 1L1TA 3K2LA 3AOEA 3SMPA 4BB9A 2J7NA 4MB7A 3U6QA 1IBMM 4L15A 3DA1A 4ITQA 2L09A 3BOSA 2HL7A 2CV2A 4D81A 4KO8A 3B9PA 1XWIA 1Z5BA 1R2ZA 4AKGA 3I4YA 4IJFA 3K92A 3M0EA 3GLGB 4PDIA 1Z5AA 1IXSB 1VDDA 2R46A 3MJ5A 4OVZA 2D7EA 2DVWB 4II7A 4AQYM 3GRRA 3KP1E 1SXJC 3RFWA 2UUCM 4MGKE 1N75A 5EP1A 1IN8A 3UGJA 3HKPA 1QQWA 4M9XA 4AG5A 4EIWA 3T1HM 1G4AE 1EE8A 4FCVA 4MM3B 1QANA 5ITTA 2F5OA 4IBJA 2X49A 3U6OA 3A46A 1XMQM 3PXGA 4REZA 4L4UA 1D2NA 2XLJA 3CTWB 4DV7M 3SMSA 2ERCA 2FFJA 1JQJC 4Z6YA 3KFUG 2C96A 4OVZB 2OQ4A 1GVNA 4G4OA 3GRUA 5DNYA 3QAUA 1IY2A 2ZAOA 5EXPA 4Z8XA 4NRWA 3OTOM 3FKEA 2F5SA 1ZQ9A 4MGHA 2KRKA 3GPYA 4JI2M 1GL7A 2V1UA 4YY3M 1IY1A 3U6PA 3AOEC 2G8LA 4NXNM 3SHGB 1ZAEA 3CF2A 4JI0M 3R9XB 2Y20A 4RF0A 1IBLM 3HU3A 1NNUC 2LH0A 4GC9A 4JN6A 2XSZA 1HNWM 4S12A 4IBDA 2UXBM 1L8QA 3SAUA 5DYIA 5EP4A 3LMMA 4KHPM 1NJGA 2CHGA 3GLIA 3VDPA 4LF6M 3FD9A 1J5EM 3GLHB 1H6UA 2R18A 3FYCA 3HHWA 5E26A 3GPUA 1NVMA 1HT1E 5ITXA 3U61B 2QENA 4LRSA 4X64M 2UXCM 5FTJA 3FTFA 5GKNA 4LJ5A 2CV0A 1IN5A 1NHGC 3SFZA 4TUWA 2KZSA 3FTEA 1QAMA 3HGIA 3SYLA 4JI8M 1E9SA 2NQ8C 4LJ4A 5EJCA 1DGFA 2Q2EB 5FTNA 5ITYA 3GLIB 1HNZM 3U6CA 2F4VM 2I7NA 3J81S 3M6AA 1E9RA 4B7GA 1L2BA 5A2QS 2K47A 4LG2A 2DZOB 1QAQA 2YNMD 3GO8A 3GLFB 3FTDA 2VIIA 4GIPA 2CFOA 1KSFX 1S3SA 2CUZA 1N33M 4M9ZA 4X62M 1N34M 4NXMM 3TWMA 4OX9M 2FNAA 3TWKA 1Q39A 3DFZA 4AKHA 4DR2M 3SBJA 4DR4M 4MGYE 3KOWE 5EXSA 2CHVA 1XXHB 3EIEA 4X66M 4D82A 1DGHB 4FCTA 4LF4M 2CV1A 2XZFA 1OFIA 3VKGA 3K8ZA 1IXRC 2BJVA 3GQ4A 3L26A 4NOOB 5FLXS 4AI6A 3KOZE 1PM5A 2YFQA 4JI7M 1R7RA 2Z4RA 3FUXA 1SXJE 2I7PA 4IBGA 3KVWA 3UJNA 4LF8M 5EP2A 3FTCA 4LJAA 1SXJD 4IBKA 3W0LB 2C98A 4G4NA 1NNJA 2FE8A 4FCWA 3WHKA 2KRUA 3ZH9B 4B08A 4GMQA 5IZ7D 5KQ8A 2UUAM 4IJEA 4AW4A 4CHTB 1QZMA 2X4AA 2XF3A 5KQDA 3U6EA 3KDSE 1IN6A 4LFAM 3CF0A 4A3VB 2DWNA 4PD2A 4OU7A 5E6JA 4HLQA 4NRVA 4NSOB 3RGSA 3PNYA 4DR1M 2RGHA 4D80A 2ZBKB 1TDZA 3GRYA 1JR3A 4JI6M 3HWSA 2EO2A 3FUWA 4MGIE 3WHLA 3ZC7B 1IBKM 4B3MM 3AKZA 1NHWC 2KXEA 2M5ZA 2DHRA 4LGMA 4LF9M 2A5YB 1Z59A 2E5LM 2XFSA 4QHSA 3L27A 1FNNA 3SAVA 2LWXA 1YUBA 3NWLA 3UZUA 3IG5A 2X8AA 1W5SA 2Z4SA 2Z7JA 1IN7A 1NY5A 1K3WA 4DR5M 2QBYB 5ITQA 3GLHA 3SHFA 4RNAA 3U61A 2HCBA 4QNMA 1HT2E 4IBIA 5IWAM 4QOZC 4LGYA 1DGBA 4X65M 5FTKA 2HKJA 3QWLA 4BLCA 3U5ZB 7CATA 3HHYA 4QHTA 4DR6M 1K82A 3LQRA 2XZUA 3J80S 4KLNA 4W5WA 3U6MA 3ZCBB 5KPTA 2DWMA 2KEBA 3KS4A 1TH4A 5KO3A 3U6SA 2L7IA 3RGPA 1W5TA 1XHBA 3GLFA 1G8PA 5H37D 2AHMA 4LCBA 4LY6A 4XGIA 1HNXM 3HU2A 4LZJA 4DR7M 1R6BX 3JR4A 4L8RC 2XEPA 3W0FA 4RF1A 3U6LA 1XXHA 4IBCA 2R4EA 4KODA 1DGHA 1TH2A 3AL0C 4FVMA 2C5RA 1G41A 4R7GA 4I5SA 1OFHA 2LNHC 2O5RA 1DO2A 4G4QA 4GH9A 2W82A 1NY6A 4LFBM 4I8OA 3UMMA 5F3WA 2ZM6M 2XSZD 1G3IA 4JI4M 3AJIB 3TPZA 5ITRA 4LFCM 3SATA 3SYKA 1TH3A 1YSYA 4LF7M 3A42A 4B3SM 1GKIA 1J09A 4JI3M 4AG6A 3HU1A 1YE9A 4ZPXA 2C9CA 3T15A 1Q3BA 4AZFA 5C1BA 3M7GA 3RE8A 1L2DA 4LJ7A 5FTLA 4GHLA 2BJWA 5EP3A 5EXTA 3HJQA 3KW6A 4OW0A 4MH0E 1NSFA 3A45A 3THGA 1IXZA 2Y0TA 1WXQA 2P5TA 4B7HA 1SXJB 2KA6B 3J2PB 3JR5A 4JXJA 3GPPA 1IN4A 2Y21A 4CISA 3VK7A 3T38A 2V6ZM 2VQFM 2XH9A 3JAMS 5C18A 4L78A 4BBAA 8CATA 3TL4X 3PVSA 4LJ6A 2FOIC 1HQCA 4DV4M 4IBFA 1PJIA 3FUTA 4JI1M 1QVRA 4L16A 2UXDM 2QBYA 3HJ8A 1N78A 1Z5CA 2L6OA 1N36M 3SASA 4M0WA 3AOGA 4NL4H 3LQQA 4JYAM 4IBBA 4DV0M 5ITUA 4GHAA 3TWLA 3I4VA 3SAWA 2YR0A 3DZDA 2OPFA 3AFHA 5LMNM 4I4LA 1J7KA 2J7OA 2H1RA 2F5QA 5KPRA 2D7HA 3J7AS 4JV5M 1LV7A 1I94M 2L7HA 1KFVA 4B3RM 1E32A 3SARA 3GP1A 3U5ZA 3AV0A 1X37A 1QYRA 3E9SA 1L1ZA 3J7BA 4WURA 4DV2M 4G4RA 2ZAMA 3KSJA 3SC3A 2UU9M 4LF5M 4G6ZA 4FWHA 4DUYM 3TQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITQ A;  1XNR M;  1N33 M;  4X62 M;  1N34 M;  1R2Z A;  1Z5B A;  4NXM M;  3TWM A;  4OX9 M;  3TWK A;  1Q39 A;  1MU5 A;  4GKK M;  4PDI A;  4DR2 M;  1HNX M;  1Z5A A;  3SBJ A;  4DR7 M;  4DR4 M;  1PJJ A;  1N32 M;  3JR4 A;  4X66 M;  4AQY M;  3W0F A;  3U6L A;  2UUC M;  3GQ3 A;  4LF4 M;  2XZF A;  3GQ4 A;  5FLX S;  3T1H M;  1EE8 A;  5ITT A;  4B3T M;  1PM5 A;  4JI7 M;  2F5O A;  4YHH M;  4G4Q A;  1XC8 A;  3U6O A;  4LF8 M;  4LFB M;  3A46 A;  1XMQ M;  2ZM6 M;  1Q3C A;  4DV3 M;  5IT9 S;  4JI4 M;  4DUZ M;  4G4N A;  1NNJ A;  4DV7 M;  5ITR A;  4LFC M;  3SAT A;  2UUA M;  4LF7 M;  3A42 A;  4B3S M;  2OQ4 A;  5LMU M;  4JI3 M;  1L2C A;  4G4O A;  4PDG A;  3U6E A;  2VQE M;  1Q3B A;  4LFA M;  4NRW A;  3OTO M;  2F5S A;  4PD2 A;  3GPY A;  4JI2 M;  1L2D A;  4DV6 M;  4NRV A;  4YY3 M;  4DR1 M;  1TDZ A;  2ZBK B;  3U6P A;  4NXN M;  4JI6 M;  3A45 A;  4JI0 M;  1IBK M;  4B3M M;  3U6D A;  1IBL M;  3JR5 A;  2EA0 A;  3GPP A;  4CIS A;  3VK7 A;  4LF9 M;  1MX0 A;  2UUB M;  1HNW M;  2VQF M;  1Z59 A;  4DV1 M;  2E5L M;  2UXB M;  4PCZ A;  3JAM S;  3SAU A;  1R2Y A;  3SAV A;  3VK8 A;  1FJG M;  4KHP M;  5ITX E;  3GPX A;  3T1Y M;  4LF6 M;  1J5E M;  4DV4 M;  1XMO M;  1PJI A;  4DR5 M;  1K3W A;  4K0K M;  2HHH M;  4JI1 M;  5ITQ A;  5BR8 M;  3GPU A;  4JI5 M;  2UXD M;  1Z5C A;  5ITX A;  3GQ5 A;  4DV5 M;  1N36 M;  2F5N A;  3SAS A;  2UXC M;  4X64 M;  4JYA M;  4DV0 M;  5ITU A;  1K3X A;  3TWL A;  3SAW A;  5IWA M;  2OPF A;  5LMN M;  2F5P A;  4X65 M;  3C58 A;  1XNQ M;  2F5Q A;  4GKJ M;  2HKJ A;  3J7A S;  1HR0 M;  4JV5 M;  1I94 M;  4B3R M;  1KFV A;  3DOA A;  4DR6 M;  3SAR A;  3GP1 A;  4JI8 M;  1TDH A;  1K82 A;  4DR3 M;  2Q2E B;  5ITY A;  1HNZ M;  2XZU A;  1L1T A;  3J80 S;  3U6C A;  3U6M A;  2F4V M;  3J81 S;  1L1Z A;  4MB7 A;  4DV2 M;  4G4R A;  3U6Q A;  1L2B A;  5A2Q S;  1IBM M;  2UU9 M;  4LF5 M;  4DUY M;  3U6S A;  3GO8 A; 
#chains in the Genus database with same CATH topology
 2R65 A;  3FUV A;  5KPZ A;  1XNR M;  1ZMU A;  1TR8 A;  4FW9 A;  2Z3X A;  3I04 M;  5JI3 E;  2JA2 A;  4PT5 A;  3J27 B;  2ZTD A;  1MU5 A;  4GC5 A;  2JZ1 A;  3FUU A;  4GKK M;  2C9O A;  1QUS A;  3K1J A;  1PJJ A;  5IRE B;  1N32 M;  1OJL A;  3UK6 A;  3E4R A;  2BNK A;  3QYB A;  3KSX A;  3PNV A;  3D8L A;  1DGG A;  3KOX E;  4P16 A;  3GQ3 A;  3KS8 A;  2DXI A;  4HEO A;  2ZAN A;  3K9O A;  3NBI A;  2XGN A;  2BWE A;  3L29 A;  3HHZ A;  2CEA A;  2M60 A;  3FRI A;  1JR3 D;  3LVV A;  5FSW A;  4B3T M;  2G5G X;  3EIH A;  4B7F A;  5EXX A;  4YHH M;  1IY0 A;  2RKO A;  1XC8 A;  3A98 B;  4AKI A;  1NO1 A;  1V92 A;  1Q3C A;  4DV3 M;  5BPV A;  5IT9 S;  4XK8 F;  1TF0 B;  1IQP A;  4DUZ M;  2QCU A;  1GAB A;  2KZU A;  1G59 A;  2QP9 X;  3B7Q A;  3D8B A;  3HHX A;  1ORY B;  3MHV C;  3I51 A;  3L28 A;  4ANR A;  5LMU M;  2CRU A;  1L2C A;  1GO5 A;  2DAE A;  2R45 A;  5FTM A;  4PDG A;  2QPA A;  3GLH E;  3KXE C;  4WW0 A;  2DZN B;  4R3D A;  2JY5 A;  2KNV A;  1GLN A;  3IG8 A;  2VQE M;  3VDU A;  4FWD A;  2WSF F;  4I81 A;  1P3Q Q;  2LTU A;  1QAO A;  4LJ8 A;  2ZTC A;  1VQ1 A;  4DV6 M;  2D7G A;  3L2A A;  2Z8Y M;  3VKH A;  3W68 A;  2YQZ A;  2CWB A;  1SG9 A;  2GNO A;  3B89 A;  2V1C A;  1DO0 A;  1G71 A;  3HJS A;  5DYG A;  3C3E A;  3I01 M;  3LCV B;  2QZ4 A;  2OOA A;  3Q8X A;  2DWZ B;  3CF6 E;  1GL6 A;  4IIW A;  2VF7 A;  3U6D A;  2Y0Q A;  4P17 A;  2EA0 A;  1PRB A;  4IBE A;  3R8F A;  1SXJ A;  2RGO A;  4CJ6 A;  1MX0 A;  2MH8 A;  3U60 A;  2UUB M;  3GLI E;  1PJS A;  1ZMW A;  3FYD A;  3H4M A;  4QNR A;  4PCZ A;  4DV1 M;  1NV8 A;  1HQY E;  2K0B X;  3MMP A;  1R2Y A;  3ILK A;  3VK8 A;  1TGU A;  1V34 A;  5EQT A;  1FJG M;  3MK6 A;  5ITX E;  3GPX A;  3T1Y M;  1C1K A;  4GRI A;  1UM8 A;  1T3T A;  4FWG A;  4HL4 A;  2DWL A;  1XMO M;  3LVW A;  4QOS A;  4K0K M;  4NSR A;  4GIT A;  1I4W A;  5BR8 M;  1NJF A;  2DAG A;  2HHH M;  4JI5 M;  1N77 A;  4LZZ A;  1KYI A;  3LW5 F;  3GQ5 A;  4DV5 M;  2F5N A;  2CHQ A;  3B7N A;  1XB2 B;  3ZQJ A;  4M0D A;  2CE7 A;  3KOY E;  2HWJ A;  2R62 A;  1Z6T A;  4FD2 A;  4M9S A;  2EUC A;  1K3X A;  3GRV A;  4XBO A;  3TE6 A;  3L25 A;  1XXH E;  2VDB B;  3VFD A;  2WZJ A;  3U60 B;  2XFT A;  1IM2 A;  2F5P A;  2JXN A;  1E94 E;  4CGY B;  5JI2 E;  1VG5 A;  3KP0 E;  1IXS A;  3PFI A;  2DAM A;  2R4J A;  3GLG A;  3C58 A;  1HR0 M;  1XNQ M;  4GKJ M;  3DOA A;  4MGZ E;  4LRT A;  3VLF B;  2DAI A;  1TDH A;  5DFL A;  4DR3 M;  2C99 A;  2KW0 A;  3FE3 A;  4LJ9 A;  2LXE A;  1L1T A;  3K2L A;  3AOE A;  3SMP A;  3B74 A;  4BB9 A;  2J7N A;  4MB7 A;  2KDL A;  3U6Q A;  1IBM M;  4L15 A;  3DA1 A;  4ITQ A;  2L09 A;  2EKF A;  3BOS A;  2HL7 A;  2CV2 A;  4D81 A;  4KO8 A;  3B9P A;  3FRH A;  1XWI A;  1Z5B A;  2JY6 B;  1R2Z A;  4AKG A;  3I4Y A;  4IJF A;  3K92 A;  1OQY A;  3M0E A;  3GLG B;  4PDI A;  1Z5A A;  1IXS B;  1VDD A;  2R46 A;  3MJ5 A;  4OVZ A;  3W67 A;  2D7E A;  2DVW B;  2DI0 A;  4II7 A;  4AQY M;  3GRR A;  2QQ8 A;  3KP1 E;  1SXJ C;  4L6V 6;  2JZ0 A;  3RFW A;  2UUC M;  4MGK E;  1N75 A;  2JY8 A;  1IN8 A;  5EP1 A;  3HKP A;  3UGJ A;  1QQW A;  3F92 A;  4M9X A;  4AG5 A;  4EIW A;  3T1H M;  1G4A E;  1EE8 A;  4FCV A;  4MM3 B;  1QAN A;  5ITT A;  2F5O A;  4IBJ A;  2J5Y A;  2QNJ A;  2X49 A;  1QUT A;  3U6O A;  3A46 A;  1XMQ M;  3PXG A;  4REZ A;  4L4U A;  1D2N A;  2XLJ A;  3CTW B;  1QZE A;  1WJ7 A;  4DV7 M;  1D0L A;  2O01 F;  2ERC A;  3SMS A;  2FFJ A;  1JQJ C;  4Z6Y A;  3KFU G;  2C96 A;  4OVZ B;  2OQ4 A;  2HAK A;  1AUA A;  1GVN A;  2APL A;  1WGN A;  3GRU A;  4G4O A;  5DNY A;  2R0I A;  3QAU A;  4CIZ A;  1EFU B;  1IY2 A;  2ZAO A;  5EXP A;  4Z8X A;  4NRW A;  1JR3 E;  3FKE A;  3OTO M;  2F5S A;  1ZQ9 A;  4MGH A;  2KRK A;  3GPY A;  4JI2 M;  1GL7 A;  2V1U A;  4YY3 M;  1IY1 A;  3U6P A;  3AOE C;  2G8L A;  4NXN M;  3SHG B;  1ZAE A;  3CF2 A;  4JI0 M;  3R9X B;  2Y20 A;  2L4F A;  3BBZ A;  4RF0 A;  3HU3 A;  1NNU C;  2LH0 A;  4GC9 A;  1IBL M;  4JN6 A;  2XSZ A;  1HNW M;  2RRU A;  4S12 A;  2MRO B;  4IBD A;  2UXB M;  1L8Q A;  3SAU A;  5DYI A;  5EP4 A;  3LMM A;  4KHP M;  3HX3 A;  1NJG A;  2CHG A;  3CGW A;  3GLI A;  3T6P A;  3VDP A;  4LF6 M;  3FD9 A;  1J5E M;  3GLH B;  2OOB A;  1H6U A;  2R18 A;  3FYC A;  3HHW A;  2G3Q A;  1MN3 A;  5E26 A;  3GPU A;  1VEK A;  3C3D A;  1HT1 E;  1NVM A;  1MJG M;  5ITX A;  3U61 B;  2QEN A;  2R44 A;  4LRS A;  4X64 M;  2UXC M;  1DV0 A;  5FTJ A;  1WGL A;  2DAK A;  2MJ5 B;  3FTF A;  5GKN A;  1WIV A;  4LJ5 A;  2DZL A;  1IN5 A;  1NHG C;  2WSC F;  2CV0 A;  2LHG A;  3SFZ A;  1OAI A;  4TUW A;  2KZS A;  3FTE A;  1QAM A;  3HGI A;  3SYL A;  4JI8 M;  1E9S A;  2NQ8 C;  4LJ4 A;  5EJC A;  1DGF A;  2Q2E B;  4RKU F;  5FTN A;  2QHO B;  5ITY A;  3GLI B;  3U6C A;  1HNZ M;  4G3O A;  2F4V M;  2I7N A;  3J81 S;  3M6A A;  1V33 A;  1E9R A;  3GLF E;  4B7G A;  1L2B A;  5A2Q S;  2K47 A;  4LG2 A;  2JUJ A;  2DZO B;  1QAQ A;  2YNM D;  3GO8 A;  3GLF B;  3FTD A;  2VII A;  4GIP A;  2CFO A;  1KSF X;  1S3S A;  2CUZ A;  1N33 M;  4M9Z A;  4X62 M;  1N34 M;  4NXM M;  3TWM A;  4OX9 M;  2FNA A;  3TWK A;  1Q39 A;  2DKL A;  2LHC A;  3DFZ A;  1PJQ A;  3E21 A;  4AKH A;  4DR2 M;  3SBJ A;  4DR4 M;  4MGY E;  3KOW E;  1VEJ A;  5EXS A;  2CHV A;  1XXH B;  3EIE A;  4X66 M;  1IFY A;  4D82 A;  2O25 A;  2CP8 A;  1DGH B;  3E46 A;  4FCT A;  2WSE F;  4LF4 M;  2BWB A;  2CV1 A;  2XZF A;  1OFI A;  3VKG A;  3K8Z A;  1IXR C;  2BJV A;  3GQ4 A;  3L26 A;  4NOO B;  5FLX S;  4AI6 A;  3KOZ E;  1PM5 A;  2YFQ A;  4JI7 M;  1R7R A;  2Z4R A;  3FUX A;  1SXJ E;  2I7P A;  4IBG A;  3KVW A;  3UJN A;  4LF8 M;  5EP2 A;  3IEC A;  3BXW A;  2LVP C;  3FTC A;  4LJA A;  1A5T A;  1SXJ D;  4IBK A;  3W0L B;  2C98 A;  2KNZ A;  4G4N A;  1NNJ A;  2FE8 A;  4FCW A;  2DEN A;  2KRU A;  3WHK A;  3ZH9 B;  4GMQ A;  2QSF X;  5IZ7 D;  4B08 A;  4IJE A;  1PJT A;  5KQ8 A;  2UUA M;  1JB0 F;  4AW4 A;  4CHT B;  1QZM A;  2X4A A;  2H5X A;  4Q7J A;  2L2D A;  3NBX X;  2XF3 A;  5KQD A;  3U6E A;  3KDS E;  4GEW A;  1OTR A;  1IN6 A;  4LFA M;  1D0K A;  3CF0 A;  4A3V B;  2DWN A;  4PD2 A;  4OU7 A;  5E6J A;  2LVN C;  4HLQ A;  4NRV A;  4NSO B;  3RGS A;  2JWS A;  3PNY A;  2RGH A;  4D80 A;  2ZBK B;  4DR1 M;  3GRY A;  1UFZ A;  1TDZ A;  1JR3 A;  4JI6 M;  3HWS A;  2EO2 A;  3FUW A;  4MGI E;  3WHL A;  3ZC7 B;  1IBK M;  4B3M M;  3AKZ A;  1NHW C;  1T6O A;  2KXE A;  2M5Z A;  2DHR A;  4LGM A;  4LF9 M;  2LVQ D;  2A5Y B;  1PGY A;  1Z59 A;  2E5L M;  2K6B A;  1R4G A;  1VEG A;  2XFS A;  4QHS A;  3L27 A;  1FNN A;  3SAV A;  2LWX A;  1GJS A;  1YUB A;  3NWL A;  2FS1 A;  3UZU A;  3IG5 A;  2X8A A;  1W5S A;  2Z4S A;  2Z7J A;  1IN7 A;  1NY5 A;  1K3W A;  4DR5 M;  2QBY B;  5ITQ A;  2JNH A;  3GLH A;  1LTM A;  2EKK A;  3SHF A;  1WHC A;  4RNA A;  4Y28 F;  3U61 A;  2MGW A;  2HCB A;  1BVS A;  4QNM A;  1HT2 E;  2N35 A;  1NV9 A;  4IBI A;  5IWA M;  3B7Z A;  4QOZ C;  4LGY A;  1DGB A;  1R5L A;  4X65 M;  5FTK A;  2HKJ A;  3QWL A;  4BLC A;  3U5Z B;  7CAT A;  3HHY A;  4QHT A;  4DR6 M;  1K82 A;  3LQR A;  1EIJ A;  2XZU A;  3J80 S;  4KLN A;  4W5W A;  3U6M A;  1CUK A;  2KNA A;  3ZCB B;  5KPT A;  2DWM A;  2KEB A;  2FH0 A;  1QDR A;  3KS4 A;  4WP2 A;  1TH4 A;  5KO3 A;  3U6S A;  2L7I A;  3RGP A;  1W5T A;  1XHB A;  3GLF A;  1OIZ A;  1TTE A;  1G8P A;  2KHH A;  5H37 D;  1Y8G A;  2AHM A;  4LCB A;  4LY6 A;  2JY7 A;  2VF8 A;  4XGI A;  1HNX M;  3HU2 A;  4LZJ A;  5L8R F;  4DR7 M;  1R6B X;  2R6F A;  3JR4 A;  4L8R C;  2XEP A;  3W0F A;  2OO9 A;  4RF1 A;  3U6L A;  1XXH A;  4IBC A;  2R4E A;  2DNA A;  4KOD A;  1DGH A;  1TH2 A;  2GQF A;  3AL0 C;  4FVM A;  2C5R A;  1G41 A;  4R7G A;  1GJT A;  1RU3 A;  4I5S A;  2JP7 A;  1OFH A;  2LNH C;  2O5R A;  1DO2 A;  4G4Q A;  4GH9 A;  2W82 A;  1NY6 A;  4LFB M;  4I8O A;  3UMM A;  5F3W A;  2ZM6 M;  2XSZ D;  1G3I A;  4JI4 M;  2LVO C;  1ZV1 A;  3AJI B;  3TPZ A;  5ITR A;  4LFC M;  3SAT A;  3SYK A;  1TH3 A;  1YSY A;  4LF7 M;  3A42 A;  4B3S M;  1GKI A;  1J09 A;  4JI3 M;  4AG6 A;  1OIP A;  1VDL A;  3C9P A;  3HU1 A;  1YE9 A;  4ZPX A;  2C9C A;  3T15 A;  3HY5 A;  2MR9 A;  1Q3B A;  4AZF A;  3IHP A;  5C1B A;  3M7G A;  3RE8 A;  1OKS A;  1L2D A;  4LJ7 A;  5FTL A;  4GHL A;  2BJW A;  5EP3 A;  5EXT A;  1F4I A;  2K9D A;  3HJQ A;  3KW6 A;  1QDT A;  1WR1 B;  1AIP C;  4OW0 A;  4MH0 E;  1NSF A;  3A45 A;  1Q02 A;  3THG A;  1IXZ A;  2Y0T A;  1WXQ A;  2P5T A;  4B7H A;  1SXJ B;  2KA6 B;  1YLA A;  3J2P B;  3K9P A;  4JXJ A;  3GPP A;  3JR5 A;  1IN4 A;  2Y21 A;  4F2L A;  3VK7 A;  4CIS A;  3T38 A;  2V6Z M;  2VQF M;  2XH9 A;  3JAM S;  1HJP A;  5C18 A;  4L78 A;  4BBA A;  3QYE A;  8CAT A;  2DHY A;  3TL4 X;  1T43 A;  3H4J A;  3HZJ A;  3PVS A;  3Q8G A;  4KT0 F;  4LJ6 A;  2FOI C;  1HQC A;  2LVA A;  4DV4 M;  4IBF A;  1PJI A;  4F1I A;  3FUT A;  4JI1 M;  1QVR A;  4L16 A;  2UXD M;  2QBY A;  3HJ8 A;  1N78 A;  1Z5C A;  2L6O A;  1N36 M;  3SAS A;  2LBC A;  4M0W A;  3AOG A;  4NL4 H;  3LQQ A;  3GLG E;  4JYA M;  4IBB A;  4DV0 M;  5ITU A;  1OAO C;  4GHA A;  3TWL A;  3I4V A;  3SAW A;  2YR0 A;  3DZD A;  2OPF A;  3AFH A;  5LMN M;  2L4E A;  4I4L A;  1C7Y A;  1J7K A;  2J7O A;  3V76 A;  2H1R A;  2F5Q A;  5KPR A;  2D7H A;  3LCU A;  3J7A S;  4JV5 M;  4DBG B;  1LV7 A;  1I94 M;  2L7H A;  1KFV A;  4B3R M;  1E32 A;  3SAR A;  1D0M A;  3GP1 A;  1X37 A;  1QYR A;  2B3T A;  3AV0 A;  3U5Z A;  3E9S A;  4R71 A;  1ZMV A;  1L1Z A;  3J7B A;  4WUR A;  4DV2 M;  4G4R A;  2ZAM A;  4NC6 A;  4UN2 B;  3KSJ A;  2EJS A;  3SC3 A;  2UU9 M;  4LF5 M;  4G6Z A;  4FWH A;  4DUY M;  3TQS A; 
#chains in the Genus database with same CATH homology
 2R65 A;  3FUV A;  5KPZ A;  1XNR M;  4FW9 A;  2Z3X A;  5JI3 E;  2JA2 A;  4PT5 A;  3J27 B;  1MU5 A;  4GC5 A;  4GKK M;  3FUU A;  2C9O A;  3K1J A;  1PJJ A;  5IRE B;  1N32 M;  1OJL A;  3UK6 A;  3E4R A;  2BNK A;  3KSX A;  3PNV A;  3D8L A;  1DGG A;  3KOX E;  4P16 A;  3GQ3 A;  3KS8 A;  2DXI A;  2ZAN A;  3NBI A;  2XGN A;  3HHZ A;  3L29 A;  2CEA A;  2M60 A;  3LVV A;  1JR3 D;  5FSW A;  4B3T M;  2G5G X;  3EIH A;  4B7F A;  5EXX A;  4YHH M;  1IY0 A;  2RKO A;  1XC8 A;  3A98 B;  4AKI A;  1Q3C A;  4DV3 M;  5BPV A;  5IT9 S;  1IQP A;  4DUZ M;  2QCU A;  2KZU A;  1G59 A;  2QP9 X;  3D8B A;  3HHX A;  1ORY B;  3MHV C;  3I51 A;  3L28 A;  5LMU M;  1L2C A;  2R45 A;  5FTM A;  4PDG A;  2QPA A;  3KXE C;  4WW0 A;  2DZN B;  4R3D A;  2VQE M;  1GLN A;  3IG8 A;  3VDU A;  4FWD A;  4I81 A;  1QAO A;  4LJ8 A;  4DV6 M;  2D7G A;  3L2A A;  3VKH A;  2YQZ A;  2V1C A;  1DO0 A;  3HJS A;  5DYG A;  3Q8X A;  2QZ4 A;  4IIW A;  2DWZ B;  3CF6 E;  1GL6 A;  3U6D A;  2Y0Q A;  2EA0 A;  4IBE A;  3R8F A;  1SXJ A;  2RGO A;  3U60 A;  1MX0 A;  2UUB M;  3FYD A;  3H4M A;  4QNR A;  4DV1 M;  4PCZ A;  1HQY E;  1R2Y A;  3ILK A;  3VK8 A;  1TGU A;  1FJG M;  5EQT A;  3MK6 A;  5ITX E;  3GPX A;  3T1Y M;  1C1K A;  4GRI A;  1UM8 A;  1T3T A;  4FWG A;  4HL4 A;  2DWL A;  1XMO M;  3LVW A;  4QOS A;  4K0K M;  4NSR A;  4GIT A;  1I4W A;  5BR8 M;  1NJF A;  2HHH M;  4JI5 M;  1N77 A;  4LZZ A;  1KYI A;  3GQ5 A;  4DV5 M;  2F5N A;  2CHQ A;  4M0D A;  2CE7 A;  3KOY E;  2R62 A;  1Z6T A;  4FD2 A;  4M9S A;  2EUC A;  1K3X A;  3GRV A;  4XBO A;  3TE6 A;  3L25 A;  3VFD A;  3U60 B;  2XFT A;  1IM2 A;  2F5P A;  1E94 E;  4CGY B;  5JI2 E;  3KP0 E;  3PFI A;  3GLG A;  3C58 A;  2R4J A;  1XNQ M;  4GKJ M;  1HR0 M;  3DOA A;  4MGZ E;  4LRT A;  3VLF B;  1TDH A;  4DR3 M;  2C99 A;  2KW0 A;  4LJ9 A;  2LXE A;  1L1T A;  3K2L A;  3AOE A;  3SMP A;  4BB9 A;  2J7N A;  4MB7 A;  3U6Q A;  1IBM M;  4L15 A;  3DA1 A;  4ITQ A;  2L09 A;  3BOS A;  2HL7 A;  2CV2 A;  4D81 A;  4KO8 A;  3B9P A;  1XWI A;  1Z5B A;  1R2Z A;  4AKG A;  3I4Y A;  4IJF A;  3K92 A;  3M0E A;  3GLG B;  4PDI A;  1Z5A A;  1IXS B;  1VDD A;  2R46 A;  3MJ5 A;  4OVZ A;  2D7E A;  2DVW B;  4II7 A;  4AQY M;  3GRR A;  3KP1 E;  1SXJ C;  3RFW A;  2UUC M;  4MGK E;  1N75 A;  5EP1 A;  1IN8 A;  3UGJ A;  3HKP A;  1QQW A;  4M9X A;  4AG5 A;  4EIW A;  3T1H M;  1G4A E;  1EE8 A;  4FCV A;  4MM3 B;  1QAN A;  5ITT A;  2F5O A;  4IBJ A;  2X49 A;  3U6O A;  3A46 A;  1XMQ M;  3PXG A;  4REZ A;  4L4U A;  1D2N A;  2XLJ A;  3CTW B;  4DV7 M;  3SMS A;  2ERC A;  2FFJ A;  1JQJ C;  4Z6Y A;  3KFU G;  2C96 A;  4OVZ B;  2OQ4 A;  1GVN A;  4G4O A;  3GRU A;  5DNY A;  3QAU A;  1IY2 A;  2ZAO A;  5EXP A;  4Z8X A;  4NRW A;  3OTO M;  3FKE A;  2F5S A;  1ZQ9 A;  4MGH A;  2KRK A;  3GPY A;  4JI2 M;  1GL7 A;  2V1U A;  4YY3 M;  1IY1 A;  3U6P A;  3AOE C;  2G8L A;  4NXN M;  3SHG B;  1ZAE A;  3CF2 A;  4JI0 M;  3R9X B;  2Y20 A;  4RF0 A;  1IBL M;  3HU3 A;  1NNU C;  2LH0 A;  4GC9 A;  4JN6 A;  2XSZ A;  1HNW M;  4S12 A;  4IBD A;  2UXB M;  1L8Q A;  3SAU A;  5DYI A;  5EP4 A;  3LMM A;  4KHP M;  1NJG A;  2CHG A;  3GLI A;  3VDP A;  4LF6 M;  3FD9 A;  1J5E M;  3GLH B;  1H6U A;  2R18 A;  3FYC A;  3HHW A;  5E26 A;  3GPU A;  1NVM A;  1HT1 E;  5ITX A;  3U61 B;  2QEN A;  4LRS A;  4X64 M;  2UXC M;  5FTJ A;  3FTF A;  5GKN A;  4LJ5 A;  2CV0 A;  1IN5 A;  1NHG C;  3SFZ A;  4TUW A;  2KZS A;  3FTE A;  1QAM A;  3HGI A;  3SYL A;  4JI8 M;  1E9S A;  2NQ8 C;  4LJ4 A;  5EJC A;  1DGF A;  2Q2E B;  5FTN A;  5ITY A;  3GLI B;  1HNZ M;  3U6C A;  2F4V M;  2I7N A;  3J81 S;  3M6A A;  1E9R A;  4B7G A;  1L2B A;  5A2Q S;  2K47 A;  4LG2 A;  2DZO B;  1QAQ A;  2YNM D;  3GO8 A;  3GLF B;  3FTD A;  2VII A;  4GIP A;  2CFO A;  1KSF X;  1S3S A;  2CUZ A;  1N33 M;  4M9Z A;  4X62 M;  1N34 M;  4NXM M;  3TWM A;  4OX9 M;  2FNA A;  3TWK A;  1Q39 A;  3DFZ A;  4AKH A;  4DR2 M;  3SBJ A;  4DR4 M;  4MGY E;  3KOW E;  5EXS A;  2CHV A;  1XXH B;  3EIE A;  4X66 M;  4D82 A;  1DGH B;  4FCT A;  4LF4 M;  2CV1 A;  2XZF A;  1OFI A;  3VKG A;  3K8Z A;  1IXR C;  2BJV A;  3GQ4 A;  3L26 A;  4NOO B;  5FLX S;  4AI6 A;  3KOZ E;  1PM5 A;  2YFQ A;  4JI7 M;  1R7R A;  2Z4R A;  3FUX A;  1SXJ E;  2I7P A;  4IBG A;  3KVW A;  3UJN A;  4LF8 M;  5EP2 A;  3FTC A;  4LJA A;  1SXJ D;  4IBK A;  3W0L B;  2C98 A;  4G4N A;  1NNJ A;  2FE8 A;  4FCW A;  3WHK A;  2KRU A;  3ZH9 B;  4B08 A;  4GMQ A;  5IZ7 D;  5KQ8 A;  2UUA M;  4IJE A;  4AW4 A;  4CHT B;  1QZM A;  2X4A A;  2XF3 A;  5KQD A;  3U6E A;  3KDS E;  1IN6 A;  4LFA M;  3CF0 A;  4A3V B;  2DWN A;  4PD2 A;  4OU7 A;  5E6J A;  4HLQ A;  4NRV A;  4NSO B;  3RGS A;  3PNY A;  4DR1 M;  2RGH A;  4D80 A;  2ZBK B;  1TDZ A;  3GRY A;  1JR3 A;  4JI6 M;  3HWS A;  2EO2 A;  3FUW A;  4MGI E;  3WHL A;  3ZC7 B;  1IBK M;  4B3M M;  3AKZ A;  1NHW C;  2KXE A;  2M5Z A;  2DHR A;  4LGM A;  4LF9 M;  2A5Y B;  1Z59 A;  2E5L M;  2XFS A;  4QHS A;  3L27 A;  1FNN A;  3SAV A;  2LWX A;  1YUB A;  3NWL A;  3UZU A;  3IG5 A;  2X8A A;  1W5S A;  2Z4S A;  2Z7J A;  1IN7 A;  1NY5 A;  1K3W A;  4DR5 M;  2QBY B;  5ITQ A;  3GLH A;  3SHF A;  4RNA A;  3U61 A;  2HCB A;  4QNM A;  1HT2 E;  4IBI A;  5IWA M;  4QOZ C;  4LGY A;  1DGB A;  4X65 M;  5FTK A;  2HKJ A;  3QWL A;  4BLC A;  3U5Z B;  7CAT A;  3HHY A;  4QHT A;  4DR6 M;  1K82 A;  3LQR A;  2XZU A;  3J80 S;  4KLN A;  4W5W A;  3U6M A;  3ZCB B;  5KPT A;  2DWM A;  2KEB A;  3KS4 A;  1TH4 A;  5KO3 A;  3U6S A;  2L7I A;  3RGP A;  1W5T A;  1XHB A;  3GLF A;  1G8P A;  5H37 D;  2AHM A;  4LCB A;  4LY6 A;  4XGI A;  1HNX M;  3HU2 A;  4LZJ A;  4DR7 M;  1R6B X;  3JR4 A;  4L8R C;  2XEP A;  3W0F A;  4RF1 A;  3U6L A;  1XXH A;  4IBC A;  2R4E A;  4KOD A;  1DGH A;  1TH2 A;  3AL0 C;  4FVM A;  2C5R A;  1G41 A;  4R7G A;  4I5S A;  1OFH A;  2LNH C;  2O5R A;  1DO2 A;  4G4Q A;  4GH9 A;  2W82 A;  1NY6 A;  4LFB M;  4I8O A;  3UMM A;  5F3W A;  2ZM6 M;  2XSZ D;  1G3I A;  4JI4 M;  3AJI B;  3TPZ A;  5ITR A;  4LFC M;  3SAT A;  3SYK A;  1TH3 A;  1YSY A;  4LF7 M;  3A42 A;  4B3S M;  1GKI A;  1J09 A;  4JI3 M;  4AG6 A;  3HU1 A;  1YE9 A;  4ZPX A;  2C9C A;  3T15 A;  1Q3B A;  4AZF A;  5C1B A;  3M7G A;  3RE8 A;  1L2D A;  4LJ7 A;  5FTL A;  4GHL A;  2BJW A;  5EP3 A;  5EXT A;  3HJQ A;  3KW6 A;  4OW0 A;  4MH0 E;  1NSF A;  3A45 A;  3THG A;  1IXZ A;  2Y0T A;  1WXQ A;  2P5T A;  4B7H A;  1SXJ B;  2KA6 B;  3J2P B;  3JR5 A;  4JXJ A;  3GPP A;  1IN4 A;  2Y21 A;  4CIS A;  3VK7 A;  3T38 A;  2V6Z M;  2VQF M;  2XH9 A;  3JAM S;  5C18 A;  4L78 A;  4BBA A;  8CAT A;  3TL4 X;  3PVS A;  4LJ6 A;  2FOI C;  1HQC A;  4DV4 M;  4IBF A;  1PJI A;  3FUT A;  4JI1 M;  1QVR A;  4L16 A;  2UXD M;  2QBY A;  3HJ8 A;  1N78 A;  1Z5C A;  2L6O A;  1N36 M;  3SAS A;  4M0W A;  3AOG A;  4NL4 H;  3LQQ A;  4JYA M;  4IBB A;  4DV0 M;  5ITU A;  4GHA A;  3TWL A;  3I4V A;  3SAW A;  2YR0 A;  3DZD A;  2OPF A;  3AFH A;  5LMN M;  4I4L A;  1J7K A;  2J7O A;  2H1R A;  2F5Q A;  5KPR A;  2D7H A;  3J7A S;  4JV5 M;  1LV7 A;  1I94 M;  2L7H A;  1KFV A;  4B3R M;  1E32 A;  3SAR A;  3GP1 A;  3U5Z A;  3AV0 A;  1X37 A;  1QYR A;  3E9S A;  1L1Z A;  3J7B A;  4WUR A;  4DV2 M;  4G4R A;  2ZAM A;  3KSJ A;  3SC3 A;  2UU9 M;  4LF5 M;  4G6Z A;  4FWH A;  4DUY M;  3TQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...