1I94M

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i94M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1i94M02
3SAVA 1L2CA 1IBKM 4JI3M 2E5LM 2UU9M 1XNQM 4B3RM 4GKKM 3JAMS 4NRVA 1K3XA 4LF9M 3GPYA 3A42A 1PJIA 2UUBM 1FJGM 4AQYM 5ITXE 1J5EM 2F5OA 4LF6M 3GO8A 4JI8M 4G4RA 4JI7M 1PJJA 3JR4A 4K0KM 4LFAM 4JV5M 4JYAM 1XMOM 5BR8M 3TWMA 5ITRA 5IT9S 4JI0M 3GPPA 3JR5A 2XZUA 1N36M 3T1HM 1XMQM 1K82A 3J7AS 3U6EA 4DV1M 1L1ZA 3U6CA 5LMUM 3U6OA 2HKJA 4DR5M 3GP1A 3U6LA 4GKJM 3GQ5A 3SATA 1TDZA 2VQEM 1Q3CA 3SBJA 1Z59A 3GPUA 4DV5M 2F5NA 3VK7A 1R2ZA 5A2QS 2ZBKB 5ITTA 4PD2A 4ITQA 4YHHM 4DV4M 2UXDM 3SAUA 4YY3M 4OX9M 4LFBM 4DV0M 4NXMM 1R2YA 1I94M 3SARA 2F5SA 1HNWM 1Q39A 4DUYM 3TWLA 4G4NA 1XNRM 4G4QA 1N32M 4DR1M 4X65M 1K3WA 5ITYA 1Z5AA 1Z5BA 1IBMM 3GQ3A 4MB7A 3U6MA 1HR0M 1XC8A 4B3SM 4DR4M 4DR6M 4JI1M 3U6QA 3OTOM 4JI2M 3A46A 1Q3BA 4JI6M 2UUCM 3GPXA 1N34M 1N33M 3DOAA 4X66M 1TDHA 1MU5A 4JI4M 2VQFM 1IBLM 4B3MM 1PM5A 3C58A 3VK8A 2OQ4A 3J80S 1NNJA 3SASA 3A45A 3W0FA 4PCZA 5ITXA 4DV6M 4G4OA 3GQ4A 4DR2M 1L2DA 4DUZM 4DR3M 2HHHM 3SAWA 4PDGA 4B3TM 2UUAM 4KHPM 1EE8A 2F5QA 4X64M 1HNXM 4LF5M 2Q2EB 3U6DA 2EA0A 3U6SA 1HNZM 2UXBM 1MX0A 1L2BA 4DV2M 3U6PA 3J81S 3T1YM 5IWAM 5LMNM 1KFVA 2OPFA 4DV3M 4PDIA 4LF4M 5ITUA 4LF8M 2ZM6M 2F5PA 4NRWA 4X62M 1L1TA 1Z5CA 4LF7M 2UXCM 4JI5M 4DR7M 4LFCM 3TWKA 5ITQA 2XZFA 2F4VM 4NXNM 4CISA 4DV7M 5FLXS
chains in the Genus database with same CATH superfamily
4GC9A 2C5RA 3JAMS 2L4FA 3EIHA 4NRVA 3IECA 4QNRA 1MJGM 4CHTB 1F4IA 3KFUG 1SXJC 4BB9A 1I4WA 5ITXE 1SXJA 3CF0A 2K9DA 1N77A 5EXTA 4JI8M 4G4RA 2V6ZM 5EP4A 1NV9A 1VDDA 4D80A 3GLFB 4LJ5A 4K0KM 1GVNA 1D0KA 1V92A 4II7A 4GMQA 3GLHA 1E32A 2QP9X 1Z6TA 2J7OA 5KQDA 3JR5A 1EIJA 2XZUA 4MH0E 1NV8A 4DBGB 4L16A 4LRSA 2HAKA 1Q02A 5LMUM 1ZMWA 3FTDA 3MJ5A 2QHOB 3MK6A 1TH4A 4NSRA 1RU3A 4XGIA 4I5SA 1DGHA 1QVRA 2XH9A 4IBEA 1G4AE 1XXHB 2KZSA 3GQ5A 4AKGA 1R4GA 2R44A 1TDZA 4R3DA 2VQEM 1Q3CA 2QENA 1QAOA 1DGHB 2H5XA 2JP7A 2MROB 1JR3E 5KO3A 2JZ1A 1G3IA 3HGIA 2CE7A 2LNHC 3QYEA 2F5NA 1G8PA 2FE8A 4HL4A 4FCWA 4D82A 4LJ8A 1TR8A 5ITTA 1GLNA 3K9PA 3QAUA 4IBFA 1EFUB 4OX9M 2CWBA 2ZTCA 4DV0M 5FTLA 1R2YA 1I94M 1DGGA 1GKIA 3NBIA 1XNRM 2JY5A 4G4QA 5BPVA 1SXJE 3L28A 4GRIA 4Z8XA 1IN5A 1IXRC 3J7BA 2VF7A 2QQ8A 3K1JA 3K9OA 2CHQA 2DENA 4M9XA 4F1IA 2OOBA 4M0DA 3GLHE 1IXSB 3GLGB 1TF0B 4B7GA 1Q3BA 2LH0A 5GKNA 2QBYB 2DWZB 3FRIA 4NOOB 1D2NA 3PNYA 4UN2B 3UK6A 5H37D 1IBLM 1VEKA 3THGA 3L26A 3I4VA 3SMPA 1IN7A 4MM3B 2DWMA 1L2DA 2F5OA 4MGHA 2RKOA 4DR3M 2HHHM 1X37A 2FNAA 3KP0E 3PFIA 4FD2A 3FTFA 2J5YA 4AW4A 4KHPM 3PVSA 4M0WA 1IY0A 5EXSA 2XSZD 2UXBM 4I8OA 4CJ6A 3I4YA 2LVOC 1QAMA 1WR1B 1IXZA 1WXQA 2CHVA 3IG8A 5EP3A 1L2BA 1VG5A 2LVAA 2LTUA 4HEOA 3IG5A 4WP2A 4LY6A 2EKKA 5F3WA 1NY6A 3M7GA 3B74A 3R8FA 1LV7A 1IY2A 3T6PA 4IBBA 3GLIA 1XB2B 2F5PA 1TH2A 4AI6A 4IBDA 3B7ZA 4IBGA 2L7HA 5KQ8A 2DZLA 4I4LA 2L4EA 2R18A 3GLIB 4LFCM 3EIEA 1AIPC 3M6AA 3QYBA 3SAUA 2F4VM 4NXNM 3KW6A 4REZA 1QZMA 4EIWA 5FLXS 1ZMUA 3SAVA 2K0BX 2OO9A 1DGBA 2JXNA 1L2CA 2UU9M 1XNQM 4B3RM 2XFSA 4IJEA 3ZC7B 2LXEA 3ZH9B 3W0LB 2LWXA 2KEBA 3GPYA 3SHFA 3LW5F 1OAIA 2FS1A 4AQYM 4XBOA 2CV2A 1JR3D 2HWJA 2KRUA 2C99A 4LF6M 2WSCF 1N75A 2DI0A 4JYAM 4LFAM 5FTNA 1MN3A 1XMOM 3LVVA 3UMMA 2DZNB 3LCUA 2KNAA 3HHXA 4JI0M 4NC6A 3MMPA 2FFJA 3DA1A 2CEAA 4RKUF 5C1BA 1XMQM 1K82A 2HL7A 2LVPC 2Y0TA 4LGMA 3U6CA 1L1ZA 3J7AS 1WGLA 3HJSA 1OIPA 1SXJD 3CF2A 5E26A 5L8RF 3GP1A 2DWLA 3U6LA 4L15A 4GKJM 2J7NA 3SATA 2WSFF 1QUTA 3LCVB 3V76A 1Z59A 1VEJA 3GPUA 1VQ1A 2RRUA 3AJIB 5KPRA 3GLFA 2Y21A 4IBKA 1GJTA 2ZANA 4KODA 1PJTA 5A2QS 2Y0QA 1TH3A 2ZBKB 3HJQA 4FW9A 1C7YA 4D81A 4OVZA 4L8RC 4B08A 4NXMM 4JXJA 3SHGB 1HNWM 2WSEF 2QZ4A 3I51A 3AOGA 4TUWA 3VKGA 4G4NA 3BXWA 3U61B 2MH8A 1N32M 4OVZB 1GL7A 2RGHA 1Z5AA 3FUXA 1XXHA 4Q7JA 1HJPA 1Z5BA 2V1CA 1IBMM 2XF3A 4OW0A 1YE9A 4A3VB 4LCBA 1HT2E 1T3TA 4QNMA 5DYGA 3CGWA 4GEWA 3WHKA 4JI6M 1J09A 2ERCA 3RFWA 4M9SA 1OTRA 3E46A 3HHWA 2JY8A 2ZAMA 2K6BA 4R71A 1N34M 1N33M 2EKFA 5EJCA 1MU5A 3VLFB 2VQFM 4B3MM 2G3QA 1IN8A 4GH9A 4FWDA 4PT5A 1V33A 2O25A 3RGSA 3C9PA 3J80S 2O01F 2X4AA 4PCZA 3U5ZB 2MR9A 4DUZM 3UJNA 3UGJA 4WW0A 5FSWA 3SAWA 4BLCA 3GLFE 8CATA 4B7HA 4B3TM 1IQPA 3CF6E 4X64M 2F5QA 1NY5A 1UFZA 1IXSA 3U6DA 3U6SA 1HNZM 4FVMA 2QCUA 4AG6A 3GLGA 1ZV1A 3F92A 3FUTA 3HX3A 2QBYA 2YFQA 3UZUA 1PJSA 4DV2M 3FD9A 3K92A 3U60A 1DO2A 2EO2A 1WIVA 2XFTA 2ZAOA 3TE6A 1E9SA 3J27B 3U60B 1PJQA 2O5RA 3HU3A 4LZJA 4AKHA 1XXHE 3GRRA 1DV0A 4LF8M 4QOSA 2G8LA 2AHMA 5DNYA 1L1TA 1Z5CA 5FTKA 2Z4RA 4LF7M 3AL0C 2YNMD 4M9ZA 4ANRA 3HZJA 3PXGA 2YR0A 1QDTA 3LVWA 5ITQA 3HWSA 4CIZA 2BNKA 1IBKM 4JI3M 2LHGA 4QOZC 1K3XA 4LF9M 3E21A 1FJGM 2MGWA 1NVMA 1TTEA 1Y8GA 2X8AA 2Y20A 3ILKA 2CHGA 1J5EM 3GO8A 5EP2A 4IBJA 4JI7M 1PJJA 2WZJA 3KOYE 3JR4A 2G5GX 2ZTDA 3LMMA 1QYRA 1QZEA 1W5TA 3TQSA 1NHWC 3HU1A 3J2PB 3GLGE 1HQCA 5IT9S 2BJWA 3AKZA 3A98B 2CV0A 3L2AA 4DV1M 4IIWA 1NNUC 2VDBB 1GJSA 1YSYA 3RGPA 3HKPA 3Q8GA 3KOXE 2KDLA 5JI2E 2DAEA 4OU7A 4GC5A 2KNVA 1AUAA 1GL6A 5KPZA 2DAGA 3T38A 4Y28F 3FUVA 2XSZA 4F2LA 4LZZA 2D7EA 2DHYA 1R2ZA 3E4RA 1HT1E 1NHGC 3KSJA 4YHHM 2NQ8C 3GRYA 1YUBA 3K8ZA 4LJ6A 1OJLA 2CRUA 2JY6B 2JZ0A 3H4MA 1D0LA 3NWLA 4MGYE 2DAIA 3SARA 3GRVA 2DVWB 4DR1M 4IBIA 2R4EA 2BWEA 1VEGA 1K3WA 1NJFA 4AKIA 3AFHA 4G6ZA 4S12A 1ZAEA 2M60A 3U6MA 2M5ZA 1G41A 4CGYB 1HR0M 1IN4A 2LVQD 1G71A 1OIZA 2MJ5B 4GIPA 3FTCA 4HLQA 3WHLA 4B3SM 3GLIE 4JI1M 4DR4M 1IFYA 4GITA 4MGKE 2OOAA 1BVSA 2DAMA 2HCBA 3KS4A 1OFHA 3GPXA 1YLAA 4KO8A 2KNZA 3LQRA 4G3OA 1TDHA 4L6V6 4JI4M 2LHCA 4LG2A 3BBZA 3KXEC 3SC3A 3L27A 2LBCA 2KZUA 2VIIA 1PM5A 3AV0A 1R6BX 5FTMA 3U61A 3VK8A 2OQ4A 3FYDA 1JB0F 1NNJA 3SASA 3W0FA 4DV6M 3C3EA 4JV5M 4G4OA 4DR2M 4GHLA 2DZOB 4DV7M 2KHHA 2VF8A 3FYCA 4NL4H 3VDUA 2R6FA 1N78A 2R46A 3TPZA 1QUSA 3H4JA 2UUAM 1EE8A 1R7RA 4LF5M 2Q2EB 2EA0A 2Z7JA 1WGNA 1MX0A 3LQQA 2BJVA 3I01M 2R65A 4L4UA 3VKHA 4I81A 1KYIA 3U6PA 5DFLA 3J81S 3T1YM 4MGIE 4P16A 4ZPXA 2XEPA 1KFVA 3E9SA 2OPFA 1OAOC 4PDIA 3T15A 1PRBA 1QQWA 1SXJB 4LF4M 2C9CA 3KS8A 3B7QA 1QDRA 2EUCA 3CTWB 3KP1E 3NBXX 3HHYA 2Z4SA 2ZM6M 3U5ZA 2KA6B 2LVNC 3AOEC 4RF0A 4NRWA 2UXCM 2JWSA 5JI3E 3AOEA 2Z3XA 1QAQA 2JY7A 1QANA 2I7PA 2JUJA 3GLHB 4LJAA 4GHAA 2XZFA 4P17A 1WJ7A 3B9PA 4AG5A 4CISA 4B7FA 2X49A 3SYKA 2P5TA 3Q8XA 3W67A 2E5LM 1SG9A 2APLA 3MHVC 5IZ7D 4IJFA 5IREB 5KPTA 1XWIA 2JNHA 5FTJA 4XK8F 2UUBM 3A42A 1ZMVA 3SFZA 3BOSA 3ZQJA 3PNVA 4BBAA 3KDSE 3HU2A 1P3QQ 1ORYB 4LRTA 2JA2A 4WURA 1UM8A 3L25A 2BWBA 3KSXA 4LGYA 3B7NA 4FWHA 3FUWA 2R0IA 3GRUA 5BR8M 3HHZA 3TWMA 2C98A 4LJ7A 2CFOA 5ITRA 1DGFA 2GQFA 3HJ8A 3GPPA 3I04M 1H6UA 1J7KA 2DKLA 3D8LA 3T1HM 1N36M 3K2LA 1DO0A 3U6EA 4KT0F 3U6OA 2FH0A 2C96A 2HKJA 4DR5M 1WHCA 4JN6A 2H1RA 1R5LA 3KOWE 2KXEA 4RF1A 4L78A 3D8BA 2R45A 1E94E 2DNAA 3SBJA 2F5SA 2XLJA 2DHRA 1D0MA 5EQTA 2K47A 4FCTA 1JQJC 1W5SA 4DV5M 1GABA 2RGOA 5C18A 2N35A 3IHPA 3VK7A 4FCVA 3W68A 4ITQA 1V34A 4PD2A 4DV4M 2UXDM 2XGNA 2QSFX 4YY3M 1NO1A 2EJSA 4W5WA 4LFBM 2GNOA 2W82A 3VDPA 1IN6A 1ZQ9A 1CUKA 1Q39A 3DFZA 1LTMA 2QPAA 2D7HA 4KLNA 4LJ9A 4NSOB 3TWLA 4DUYM 4RNAA 5EXPA 4X65M 2CP8A 1XHBA 1KSFX 5ITYA 1OQYA 2D7GA 3GQ3A 1VDLA 4MB7A 3TL4X 2A5YB 4LJ4A 1XC8A 4MGZE 4DR6M 3SMSA 1HQYE 3U6QA 1NSFA 3OTOM 1G59A 4JI2M 1S3SA 3FRHA 5EP1A 3A46A 2UUCM 2Z8YM 1IY1A 1IM2A 3DZDA 3M0EA 1E9RA 2YQZA 3C3DA 3DOAA 4X66M 1A5TA 2B3TA 2DWNA 1GO5A 3C58A 1FNNA 5DYIA 4QHTA 3A45A 3FKEA 3KOZE 5ITXA 2KW0A 2CV1A 3GQ4A 3RE8A 2FOIC 4R7GA 3L29A 4IBCA 1T43A 5E6JA 4PDGA 2DXIA 3FE3A 3SYLA 3VFDA 1OFIA 3R9XB 1NJGA 2R62A 1HNXM 3KVWA 2R4JA 2L7IA 2C9OA 2DAKA 5EXXA 1C1KA 1OKSA 2I7NA 4AZFA 5IWAM 5LMNM 4QHSA 4DV3M 2QNJA 1T6OA 5ITUA 3FTEA 7CATA 2CUZA 3B89A 4X62M 1L8QA 2L09A 4Z6YA 4JI5M 1JR3A 2L2DA 4DR7M 3HY5A 3QWLA 4FWGA 3TWKA 2V1UA 4GKKM 2L6OA 1PGYA 1TGUA 1PJIA 3ZCBB 2KRKA 3FUUA
chains in the Genus database with same CATH topology
4GC9A 2C5RA 3JAMS 3EIHA 4NRVA 4QNRA 4CHTB 3KFUG 1SXJC 4BB9A 1I4WA 5ITXE 1SXJA 3CF0A 1N77A 5EXTA 4JI8M 4G4RA 2V6ZM 5EP4A 1VDDA 4D80A 3GLFB 4LJ5A 4K0KM 1GVNA 4II7A 4GMQA 3GLHA 1E32A 2QP9X 1Z6TA 2J7OA 5KQDA 3JR5A 2XZUA 4MH0E 4L16A 4LRSA 5LMUM 3FTDA 3MJ5A 3MK6A 1TH4A 4NSRA 4XGIA 4I5SA 1DGHA 1QVRA 2XH9A 4IBEA 1G4AE 1XXHB 2KZSA 3GQ5A 4AKGA 1TDZA 4R3DA 2VQEM 1Q3CA 2QENA 1QAOA 1DGHB 5KO3A 3HGIA 1G3IA 2CE7A 2LNHC 2F5NA 1G8PA 2FE8A 4HL4A 4FCWA 4D82A 4LJ8A 5ITTA 1GLNA 3QAUA 4IBFA 4OX9M 4DV0M 5FTLA 1R2YA 1I94M 1DGGA 1GKIA 3NBIA 1XNRM 4G4QA 5BPVA 1SXJE 3L28A 4GRIA 4Z8XA 1IN5A 3K1JA 1IXRC 3J7BA 2CHQA 4M9XA 4M0DA 1IXSB 3GLGB 4B7GA 1Q3BA 2LH0A 5GKNA 2QBYB 2DWZB 4NOOB 1D2NA 3PNYA 3UK6A 5H37D 1IBLM 3THGA 3L26A 3I4VA 3SMPA 1IN7A 4MM3B 2DWMA 1L2DA 2F5OA 4MGHA 2RKOA 4DR3M 2HHHM 1X37A 2FNAA 3KP0E 3PFIA 4FD2A 3FTFA 4AW4A 4KHPM 3PVSA 4M0WA 1IY0A 5EXSA 2XSZD 2UXBM 4I8OA 3I4YA 1QAMA 1WXQA 1IXZA 3IG8A 2CHVA 5EP3A 1L2BA 3IG5A 4LY6A 5F3WA 1NY6A 3M7GA 3R8FA 1LV7A 1IY2A 4IBBA 3GLIA 2F5PA 1TH2A 4AI6A 4IBDA 5KQ8A 4IBGA 2L7HA 4I4LA 2R18A 3GLIB 4LFCM 3EIEA 3M6AA 2F4VM 4NXNM 3KW6A 4REZA 1QZMA 4EIWA 5FLXS 3SAVA 1L2CA 1XNQM 4B3RM 1DGBA 2UU9M 4GKKM 2XFSA 4IJEA 3ZC7B 2LXEA 3ZH9B 3W0LB 2LWXA 2KEBA 3GPYA 3SHFA 4AQYM 4XBOA 2CV2A 1JR3D 2KRUA 2C99A 4LF6M 1N75A 4JYAM 4LFAM 5FTNA 1XMOM 3LVVA 3UMMA 2DZNB 3HHXA 4JI0M 2FFJA 3DA1A 2CEAA 5C1BA 1XMQM 1K82A 2HL7A 2Y0TA 1L1ZA 4LGMA 3U6CA 3J7AS 3HJSA 3CF2A 1SXJD 5E26A 3GP1A 2DWLA 3U6LA 4L15A 4GKJM 2J7NA 3SATA 1Z59A 3GPUA 3AJIB 3GLFA 2Y21A 4IBKA 4KODA 2ZANA 5A2QS 2Y0QA 1TH3A 2ZBKB 3HJQA 4FW9A 4D81A 4OVZA 4L8RC 4B08A 4NXMM 4JXJA 3SHGB 1HNWM 4TUWA 2QZ4A 3I51A 3AOGA 3VKGA 4G4NA 3U61B 1N32M 4OVZB 1GL7A 2RGHA 1Z5AA 3FUXA 1XXHA 1Z5BA 2V1CA 1IBMM 2XF3A 4OW0A 1YE9A 4A3VB 4LCBA 1HT2E 1T3TA 4QNMA 5DYGA 3WHKA 4JI6M 1J09A 2ERCA 3RFWA 4M9SA 3HHWA 2ZAMA 1N34M 1N33M 5EJCA 1MU5A 3VLFB 2VQFM 4B3MM 1IN8A 4GH9A 4FWDA 4PT5A 3RGSA 3J80S 2X4AA 4PCZA 3U5ZB 4DUZM 3UJNA 3UGJA 4WW0A 5FSWA 3SAWA 4BLCA 8CATA 4B7HA 4B3TM 1IQPA 3CF6E 4X64M 2F5QA 1NY5A 3U6DA 3U6SA 1HNZM 4FVMA 2QCUA 4AG6A 3GLGA 3FUTA 2QBYA 2YFQA 3UZUA 4DV2M 3U60A 3FD9A 3K92A 1DO2A 2EO2A 2XFTA 2ZAOA 3TE6A 1E9SA 3J27B 3U60B 2O5RA 3HU3A 4LZJA 4AKHA 3GRRA 4LF8M 4QOSA 2G8LA 2AHMA 5DNYA 1L1TA 1Z5CA 5FTKA 2Z4RA 4LF7M 3AL0C 2YNMD 4M9ZA 3PXGA 2YR0A 3LVWA 5ITQA 3HWSA 2BNKA 1IBKM 4JI3M 4QOZC 1K3XA 4LF9M 1FJGM 1NVMA 2X8AA 2Y20A 3ILKA 2CHGA 1J5EM 3GO8A 5EP2A 4IBJA 4JI7M 1PJJA 3KOYE 3JR4A 2G5GX 3LMMA 1QYRA 1W5TA 3TQSA 1NHWC 3HU1A 3J2PB 5IT9S 1HQCA 2BJWA 3AKZA 3A98B 2CV0A 3L2AA 4DV1M 4IIWA 1NNUC 1YSYA 3RGPA 3HKPA 3KOXE 5JI2E 4OU7A 4GC5A 1GL6A 5KPZA 3T38A 3FUVA 2XSZA 4LZZA 2D7EA 1R2ZA 3E4RA 1HT1E 1NHGC 3KSJA 4YHHM 2NQ8C 3GRYA 1YUBA 3K8ZA 4LJ6A 1OJLA 3H4MA 3NWLA 4MGYE 5KPRA 3SAUA 3SARA 3GRVA 2DVWB 4DR1M 4IBIA 2R4EA 1K3WA 1NJFA 4AKIA 3AFHA 4G6ZA 4S12A 1ZAEA 2M60A 3U6MA 2M5ZA 1G41A 4CGYB 1HR0M 1IN4A 4GIPA 3WHLA 4B3SM 4HLQA 4DR4M 3FTCA 4JI1M 4GITA 4MGKE 2HCBA 3KS4A 1OFHA 3GPXA 4KO8A 3LQRA 1TDHA 4JI4M 4LG2A 3KXEC 3SC3A 3L27A 2VIIA 2KZUA 1PM5A 3AV0A 1R6BX 5FTMA 3U61A 3VK8A 2OQ4A 3FYDA 1NNJA 3SASA 4JV5M 3W0FA 4DV6M 4GHLA 4G4OA 4DR2M 2DZOB 4DV7M 3FYCA 4NL4H 3VDUA 1N78A 2R46A 3TPZA 2UUAM 1EE8A 1R7RA 4LF5M 2Q2EB 2EA0A 2Z7JA 1MX0A 3LQQA 2BJVA 2R65A 4L4UA 3VKHA 4I81A 1KYIA 3U6PA 3J81S 3T1YM 4MGIE 4P16A 4ZPXA 2XEPA 1KFVA 3E9SA 2OPFA 4PDIA 4LF4M 3T15A 1QQWA 1SXJB 2C9CA 3KS8A 3CTWB 2ZM6M 2EUCA 3KP1E 3HHYA 4NRWA 3U5ZA 2Z4SA 2KA6B 3AOEC 4RF0A 2UXCM 5JI3E 3AOEA 2Z3XA 1QAQA 4LJAA 1QANA 2I7PA 3GLHB 4GHAA 2XZFA 3B9PA 4AG5A 4CISA 4B7FA 2X49A 3SYKA 2P5TA 3Q8XA 2E5LM 5IZ7D 3MHVC 4IJFA 5IREB 5KPTA 1XWIA 5FTJA 2UUBM 3A42A 3SFZA 3BOSA 3PNVA 4BBAA 3KDSE 3HU2A 1ORYB 4LRTA 2JA2A 4WURA 1UM8A 3L25A 3KSXA 4LGYA 4FWHA 3FUWA 3GRUA 5BR8M 3HHZA 3TWMA 2C98A 4LJ7A 2CFOA 5ITRA 1DGFA 3HJ8A 3GPPA 1H6UA 1J7KA 3D8LA 3T1HM 1N36M 3K2LA 1DO0A 3U6EA 3U6OA 2C96A 2HKJA 4DR5M 4JN6A 2H1RA 3KOWE 4RF1A 2KXEA 4L78A 3D8BA 2R45A 1E94E 2F5SA 3SBJA 2XLJA 2DHRA 5EQTA 2K47A 4FCTA 1JQJC 1W5SA 4DV5M 2RGOA 5C18A 3VK7A 4FCVA 4ITQA 4PD2A 4DV4M 2UXDM 2XGNA 4YY3M 4W5WA 4LFBM 2W82A 3VDPA 1IN6A 1ZQ9A 3DFZA 1Q39A 4KLNA 4LJ9A 2QPAA 2D7HA 4NSOB 3TWLA 4DUYM 4RNAA 5EXPA 4X65M 1XHBA 1KSFX 5ITYA 2D7GA 3GQ3A 4MB7A 3TL4X 2A5YB 4LJ4A 1XC8A 4MGZE 4DR6M 3SMSA 1HQYE 3U6QA 1NSFA 3OTOM 1G59A 4JI2M 1S3SA 5EP1A 3A46A 2UUCM 1IY1A 1IM2A 3DZDA 3M0EA 1E9RA 2YQZA 3DOAA 4X66M 2DWNA 3C58A 1FNNA 5DYIA 4QHTA 3A45A 3FKEA 3KOZE 5ITXA 2KW0A 2CV1A 3GQ4A 3RE8A 2FOIC 4R7GA 3L29A 4IBCA 5E6JA 4PDGA 2DXIA 3SYLA 3VFDA 1OFIA 3R9XB 1NJGA 2R62A 1HNXM 3KVWA 2R4JA 2L7IA 2C9OA 5EXXA 1C1KA 2I7NA 4AZFA 5IWAM 5LMNM 4QHSA 4DV3M 5ITUA 3FTEA 7CATA 2CUZA 4X62M 1L8QA 2L09A 4Z6YA 4JI5M 1JR3A 4DR7M 3QWLA 4FWGA 3TWKA 2V1UA 2L6OA 1TGUA 1PJIA 3ZCBB 2KRKA 3FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAV A;  1L2C A;  1IBK M;  4JI3 M;  2E5L M;  2UU9 M;  1XNQ M;  4B3R M;  4GKK M;  3JAM S;  4NRV A;  1K3X A;  4LF9 M;  3GPY A;  3A42 A;  1PJI A;  2UUB M;  1FJG M;  4AQY M;  5ITX E;  1J5E M;  2F5O A;  4LF6 M;  3GO8 A;  4JI8 M;  4G4R A;  4JI7 M;  1PJJ A;  3JR4 A;  4K0K M;  4LFA M;  4JV5 M;  4JYA M;  1XMO M;  5BR8 M;  3TWM A;  5ITR A;  5IT9 S;  4JI0 M;  3GPP A;  3JR5 A;  2XZU A;  1N36 M;  3T1H M;  1XMQ M;  1K82 A;  3J7A S;  3U6E A;  4DV1 M;  1L1Z A;  3U6C A;  5LMU M;  3U6O A;  2HKJ A;  4DR5 M;  3GP1 A;  3U6L A;  4GKJ M;  3GQ5 A;  3SAT A;  1TDZ A;  2VQE M;  1Q3C A;  3SBJ A;  1Z59 A;  3GPU A;  4DV5 M;  2F5N A;  3VK7 A;  1R2Z A;  5A2Q S;  2ZBK B;  5ITT A;  4PD2 A;  4ITQ A;  4YHH M;  4DV4 M;  2UXD M;  3SAU A;  4YY3 M;  4OX9 M;  4LFB M;  4DV0 M;  4NXM M;  1R2Y A;  1I94 M;  3SAR A;  2F5S A;  1HNW M;  1Q39 A;  4DUY M;  3TWL A;  4G4N A;  1XNR M;  4G4Q A;  1N32 M;  4DR1 M;  4X65 M;  1K3W A;  5ITY A;  1Z5A A;  1Z5B A;  1IBM M;  3GQ3 A;  4MB7 A;  3U6M A;  1HR0 M;  1XC8 A;  4B3S M;  4DR4 M;  4DR6 M;  4JI1 M;  3U6Q A;  3OTO M;  4JI2 M;  3A46 A;  1Q3B A;  4JI6 M;  2UUC M;  3GPX A;  1N34 M;  1N33 M;  3DOA A;  4X66 M;  1TDH A;  1MU5 A;  4JI4 M;  2VQF M;  1IBL M;  4B3M M;  1PM5 A;  3C58 A;  3VK8 A;  2OQ4 A;  3J80 S;  1NNJ A;  3SAS A;  3A45 A;  3W0F A;  4PCZ A;  5ITX A;  4DV6 M;  4G4O A;  3GQ4 A;  4DR2 M;  1L2D A;  4DUZ M;  4DR3 M;  2HHH M;  3SAW A;  4PDG A;  4B3T M;  2UUA M;  4KHP M;  1EE8 A;  2F5Q A;  4X64 M;  1HNX M;  4LF5 M;  2Q2E B;  3U6D A;  2EA0 A;  3U6S A;  1HNZ M;  2UXB M;  1MX0 A;  1L2B A;  4DV2 M;  3U6P A;  3J81 S;  3T1Y M;  5IWA M;  5LMN M;  1KFV A;  2OPF A;  4DV3 M;  4PDI A;  4LF4 M;  5ITU A;  4LF8 M;  2ZM6 M;  2F5P A;  4NRW A;  4X62 M;  1L1T A;  1Z5C A;  4LF7 M;  2UXC M;  4JI5 M;  4DR7 M;  4LFC M;  3TWK A;  5ITQ A;  2XZF A;  2F4V M;  4NXN M;  4CIS A;  4DV7 M;  5FLX S; 
#chains in the Genus database with same CATH topology
 4GC9 A;  2C5R A;  3JAM S;  2L4F A;  3EIH A;  4NRV A;  3IEC A;  4QNR A;  1MJG M;  4CHT B;  1F4I A;  3KFU G;  1SXJ C;  4BB9 A;  1I4W A;  5ITX E;  1SXJ A;  3CF0 A;  2K9D A;  1N77 A;  5EXT A;  4JI8 M;  4G4R A;  2V6Z M;  5EP4 A;  1NV9 A;  1VDD A;  4D80 A;  3GLF B;  4LJ5 A;  4K0K M;  1GVN A;  1D0K A;  1V92 A;  4II7 A;  4GMQ A;  3GLH A;  1E32 A;  2QP9 X;  1Z6T A;  2J7O A;  5KQD A;  3JR5 A;  1EIJ A;  2XZU A;  4MH0 E;  1NV8 A;  4DBG B;  4L16 A;  4LRS A;  2HAK A;  1Q02 A;  5LMU M;  1ZMW A;  3FTD A;  3MJ5 A;  2QHO B;  3MK6 A;  1TH4 A;  4NSR A;  1RU3 A;  4XGI A;  4I5S A;  1DGH A;  1QVR A;  2XH9 A;  4IBE A;  1G4A E;  1XXH B;  2KZS A;  3GQ5 A;  4AKG A;  1R4G A;  2R44 A;  1TDZ A;  4R3D A;  2VQE M;  1Q3C A;  2QEN A;  1QAO A;  1DGH B;  2H5X A;  2JP7 A;  2MRO B;  1JR3 E;  5KO3 A;  2JZ1 A;  1G3I A;  3HGI A;  2CE7 A;  2LNH C;  3QYE A;  2F5N A;  1G8P A;  2FE8 A;  4HL4 A;  4FCW A;  4D82 A;  4LJ8 A;  1TR8 A;  5ITT A;  1GLN A;  3K9P A;  3QAU A;  4IBF A;  1EFU B;  4OX9 M;  2CWB A;  2ZTC A;  4DV0 M;  5FTL A;  1R2Y A;  1I94 M;  1DGG A;  1GKI A;  3NBI A;  1XNR M;  2JY5 A;  4G4Q A;  5BPV A;  1SXJ E;  3L28 A;  4GRI A;  4Z8X A;  1IN5 A;  1IXR C;  3J7B A;  2VF7 A;  2QQ8 A;  3K1J A;  3K9O A;  2CHQ A;  2DEN A;  4M9X A;  4F1I A;  2OOB A;  4M0D A;  3GLH E;  1IXS B;  3GLG B;  1TF0 B;  4B7G A;  1Q3B A;  2LH0 A;  5GKN A;  2QBY B;  2DWZ B;  3FRI A;  4NOO B;  1D2N A;  3PNY A;  4UN2 B;  3UK6 A;  5H37 D;  1IBL M;  1VEK A;  3THG A;  3L26 A;  3I4V A;  3SMP A;  1IN7 A;  4MM3 B;  2DWM A;  1L2D A;  2F5O A;  4MGH A;  2RKO A;  4DR3 M;  2HHH M;  1X37 A;  2FNA A;  3KP0 E;  3PFI A;  4FD2 A;  3FTF A;  2J5Y A;  4AW4 A;  4KHP M;  3PVS A;  4M0W A;  1IY0 A;  5EXS A;  2XSZ D;  2UXB M;  4I8O A;  4CJ6 A;  3I4Y A;  2LVO C;  1QAM A;  1WR1 B;  1IXZ A;  1WXQ A;  2CHV A;  3IG8 A;  5EP3 A;  1L2B A;  1VG5 A;  2LVA A;  2LTU A;  4HEO A;  3IG5 A;  4WP2 A;  4LY6 A;  2EKK A;  5F3W A;  1NY6 A;  3M7G A;  3B74 A;  3R8F A;  1LV7 A;  1IY2 A;  3T6P A;  4IBB A;  3GLI A;  1XB2 B;  2F5P A;  1TH2 A;  4AI6 A;  4IBD A;  3B7Z A;  4IBG A;  2L7H A;  5KQ8 A;  2DZL A;  4I4L A;  2L4E A;  2R18 A;  3GLI B;  4LFC M;  3EIE A;  1AIP C;  3M6A A;  3QYB A;  3SAU A;  2F4V M;  4NXN M;  3KW6 A;  4REZ A;  1QZM A;  4EIW A;  5FLX S;  1ZMU A;  3SAV A;  2K0B X;  2OO9 A;  1DGB A;  2JXN A;  1L2C A;  2UU9 M;  1XNQ M;  4B3R M;  2XFS A;  4IJE A;  3ZC7 B;  2LXE A;  3ZH9 B;  3W0L B;  2LWX A;  2KEB A;  3GPY A;  3SHF A;  3LW5 F;  1OAI A;  2FS1 A;  4AQY M;  4XBO A;  2CV2 A;  1JR3 D;  2HWJ A;  2KRU A;  2C99 A;  4LF6 M;  2WSC F;  1N75 A;  2DI0 A;  4JYA M;  4LFA M;  5FTN A;  1MN3 A;  1XMO M;  3LVV A;  3UMM A;  2DZN B;  3LCU A;  2KNA A;  3HHX A;  4JI0 M;  4NC6 A;  3MMP A;  2FFJ A;  3DA1 A;  2CEA A;  4RKU F;  5C1B A;  1XMQ M;  1K82 A;  2HL7 A;  2LVP C;  2Y0T A;  4LGM A;  3U6C A;  1L1Z A;  3J7A S;  1WGL A;  3HJS A;  1OIP A;  1SXJ D;  3CF2 A;  5E26 A;  5L8R F;  3GP1 A;  2DWL A;  3U6L A;  4L15 A;  4GKJ M;  2J7N A;  3SAT A;  2WSF F;  1QUT A;  3LCV B;  3V76 A;  1Z59 A;  1VEJ A;  3GPU A;  1VQ1 A;  2RRU A;  3AJI B;  5KPR A;  3GLF A;  2Y21 A;  4IBK A;  1GJT A;  2ZAN A;  4KOD A;  1PJT A;  5A2Q S;  2Y0Q A;  1TH3 A;  2ZBK B;  3HJQ A;  4FW9 A;  1C7Y A;  4D81 A;  4OVZ A;  4L8R C;  4B08 A;  4NXM M;  4JXJ A;  3SHG B;  1HNW M;  2WSE F;  2QZ4 A;  3I51 A;  3AOG A;  4TUW A;  3VKG A;  4G4N A;  3BXW A;  3U61 B;  2MH8 A;  1N32 M;  4OVZ B;  1GL7 A;  2RGH A;  1Z5A A;  3FUX A;  1XXH A;  4Q7J A;  1HJP A;  1Z5B A;  2V1C A;  1IBM M;  2XF3 A;  4OW0 A;  1YE9 A;  4A3V B;  4LCB A;  1HT2 E;  1T3T A;  4QNM A;  5DYG A;  3CGW A;  4GEW A;  3WHK A;  4JI6 M;  1J09 A;  2ERC A;  3RFW A;  4M9S A;  1OTR A;  3E46 A;  3HHW A;  2JY8 A;  2ZAM A;  2K6B A;  4R71 A;  1N34 M;  1N33 M;  2EKF A;  5EJC A;  1MU5 A;  3VLF B;  2VQF M;  4B3M M;  2G3Q A;  1IN8 A;  4GH9 A;  4FWD A;  4PT5 A;  1V33 A;  2O25 A;  3RGS A;  3C9P A;  3J80 S;  2O01 F;  2X4A A;  4PCZ A;  3U5Z B;  2MR9 A;  4DUZ M;  3UJN A;  3UGJ A;  4WW0 A;  5FSW A;  3SAW A;  4BLC A;  3GLF E;  8CAT A;  4B7H A;  4B3T M;  1IQP A;  3CF6 E;  4X64 M;  2F5Q A;  1NY5 A;  1UFZ A;  1IXS A;  3U6D A;  3U6S A;  1HNZ M;  4FVM A;  2QCU A;  4AG6 A;  3GLG A;  1ZV1 A;  3F92 A;  3FUT A;  3HX3 A;  2QBY A;  2YFQ A;  3UZU A;  1PJS A;  4DV2 M;  3FD9 A;  3K92 A;  3U60 A;  1DO2 A;  2EO2 A;  1WIV A;  2XFT A;  2ZAO A;  3TE6 A;  1E9S A;  3J27 B;  3U60 B;  1PJQ A;  2O5R A;  3HU3 A;  4LZJ A;  4AKH A;  1XXH E;  3GRR A;  1DV0 A;  4LF8 M;  4QOS A;  2G8L A;  2AHM A;  5DNY A;  1L1T A;  1Z5C A;  5FTK A;  2Z4R A;  4LF7 M;  3AL0 C;  2YNM D;  4M9Z A;  4ANR A;  3HZJ A;  3PXG A;  2YR0 A;  1QDT A;  3LVW A;  5ITQ A;  3HWS A;  4CIZ A;  2BNK A;  1IBK M;  4JI3 M;  2LHG A;  4QOZ C;  1K3X A;  4LF9 M;  3E21 A;  1FJG M;  2MGW A;  1NVM A;  1TTE A;  1Y8G A;  2X8A A;  2Y20 A;  3ILK A;  2CHG A;  1J5E M;  3GO8 A;  5EP2 A;  4IBJ A;  4JI7 M;  1PJJ A;  2WZJ A;  3KOY E;  3JR4 A;  2G5G X;  2ZTD A;  3LMM A;  1QYR A;  1QZE A;  1W5T A;  3TQS A;  1NHW C;  3HU1 A;  3J2P B;  3GLG E;  1HQC A;  5IT9 S;  2BJW A;  3AKZ A;  3A98 B;  2CV0 A;  3L2A A;  4DV1 M;  4IIW A;  1NNU C;  2VDB B;  1GJS A;  1YSY A;  3RGP A;  3HKP A;  3Q8G A;  3KOX E;  2KDL A;  5JI2 E;  2DAE A;  4OU7 A;  4GC5 A;  2KNV A;  1AUA A;  1GL6 A;  5KPZ A;  2DAG A;  3T38 A;  4Y28 F;  3FUV A;  2XSZ A;  4F2L A;  4LZZ A;  2D7E A;  2DHY A;  1R2Z A;  3E4R A;  1HT1 E;  1NHG C;  3KSJ A;  4YHH M;  2NQ8 C;  3GRY A;  1YUB A;  3K8Z A;  4LJ6 A;  1OJL A;  2CRU A;  2JY6 B;  2JZ0 A;  3H4M A;  1D0L A;  3NWL A;  4MGY E;  2DAI A;  3SAR A;  3GRV A;  2DVW B;  4DR1 M;  4IBI A;  2R4E A;  2BWE A;  1VEG A;  1K3W A;  1NJF A;  4AKI A;  3AFH A;  4G6Z A;  4S12 A;  1ZAE A;  2M60 A;  3U6M A;  2M5Z A;  1G41 A;  4CGY B;  1HR0 M;  1IN4 A;  2LVQ D;  1G71 A;  1OIZ A;  2MJ5 B;  4GIP A;  3FTC A;  4HLQ A;  3WHL A;  4B3S M;  3GLI E;  4JI1 M;  4DR4 M;  1IFY A;  4GIT A;  4MGK E;  2OOA A;  1BVS A;  2DAM A;  2HCB A;  3KS4 A;  1OFH A;  3GPX A;  1YLA A;  4KO8 A;  2KNZ A;  3LQR A;  4G3O A;  1TDH A;  4L6V 6;  4JI4 M;  2LHC A;  4LG2 A;  3BBZ A;  3KXE C;  3SC3 A;  3L27 A;  2LBC A;  2KZU A;  2VII A;  1PM5 A;  3AV0 A;  1R6B X;  5FTM A;  3U61 A;  3VK8 A;  2OQ4 A;  3FYD A;  1JB0 F;  1NNJ A;  3SAS A;  3W0F A;  4DV6 M;  3C3E A;  4JV5 M;  4G4O A;  4DR2 M;  4GHL A;  2DZO B;  4DV7 M;  2KHH A;  2VF8 A;  3FYC A;  4NL4 H;  3VDU A;  2R6F A;  1N78 A;  2R46 A;  3TPZ A;  1QUS A;  3H4J A;  2UUA M;  1EE8 A;  1R7R A;  4LF5 M;  2Q2E B;  2EA0 A;  2Z7J A;  1WGN A;  1MX0 A;  3LQQ A;  2BJV A;  3I01 M;  2R65 A;  4L4U A;  3VKH A;  4I81 A;  1KYI A;  3U6P A;  5DFL A;  3J81 S;  3T1Y M;  4MGI E;  4P16 A;  4ZPX A;  2XEP A;  1KFV A;  3E9S A;  2OPF A;  1OAO C;  4PDI A;  3T15 A;  1PRB A;  1QQW A;  1SXJ B;  4LF4 M;  2C9C A;  3KS8 A;  3B7Q A;  1QDR A;  2EUC A;  3CTW B;  3KP1 E;  3NBX X;  3HHY A;  2Z4S A;  2ZM6 M;  3U5Z A;  2KA6 B;  2LVN C;  3AOE C;  4RF0 A;  4NRW A;  2UXC M;  2JWS A;  5JI3 E;  3AOE A;  2Z3X A;  1QAQ A;  2JY7 A;  1QAN A;  2I7P A;  2JUJ A;  3GLH B;  4LJA A;  4GHA A;  2XZF A;  4P17 A;  1WJ7 A;  3B9P A;  4AG5 A;  4CIS A;  4B7F A;  2X49 A;  3SYK A;  2P5T A;  3Q8X A;  3W67 A;  2E5L M;  1SG9 A;  2APL A;  3MHV C;  5IZ7 D;  4IJF A;  5IRE B;  5KPT A;  1XWI A;  2JNH A;  5FTJ A;  4XK8 F;  2UUB M;  3A42 A;  1ZMV A;  3SFZ A;  3BOS A;  3ZQJ A;  3PNV A;  4BBA A;  3KDS E;  3HU2 A;  1P3Q Q;  1ORY B;  4LRT A;  2JA2 A;  4WUR A;  1UM8 A;  3L25 A;  2BWB A;  3KSX A;  4LGY A;  3B7N A;  4FWH A;  3FUW A;  2R0I A;  3GRU A;  5BR8 M;  3HHZ A;  3TWM A;  2C98 A;  4LJ7 A;  2CFO A;  5ITR A;  1DGF A;  2GQF A;  3HJ8 A;  3GPP A;  3I04 M;  1H6U A;  1J7K A;  2DKL A;  3D8L A;  3T1H M;  1N36 M;  3K2L A;  1DO0 A;  3U6E A;  4KT0 F;  3U6O A;  2FH0 A;  2C96 A;  2HKJ A;  4DR5 M;  1WHC A;  4JN6 A;  2H1R A;  1R5L A;  3KOW E;  2KXE A;  4RF1 A;  4L78 A;  3D8B A;  2R45 A;  1E94 E;  2DNA A;  3SBJ A;  2F5S A;  2XLJ A;  2DHR A;  1D0M A;  5EQT A;  2K47 A;  4FCT A;  1JQJ C;  1W5S A;  4DV5 M;  1GAB A;  2RGO A;  5C18 A;  2N35 A;  3IHP A;  3VK7 A;  4FCV A;  3W68 A;  4ITQ A;  1V34 A;  4PD2 A;  4DV4 M;  2UXD M;  2XGN A;  2QSF X;  4YY3 M;  1NO1 A;  2EJS A;  4W5W A;  4LFB M;  2GNO A;  2W82 A;  3VDP A;  1IN6 A;  1ZQ9 A;  1CUK A;  1Q39 A;  3DFZ A;  1LTM A;  2QPA A;  2D7H A;  4KLN A;  4LJ9 A;  4NSO B;  3TWL A;  4DUY M;  4RNA A;  5EXP A;  4X65 M;  2CP8 A;  1XHB A;  1KSF X;  5ITY A;  1OQY A;  2D7G A;  3GQ3 A;  1VDL A;  4MB7 A;  3TL4 X;  2A5Y B;  4LJ4 A;  1XC8 A;  4MGZ E;  4DR6 M;  3SMS A;  1HQY E;  3U6Q A;  1NSF A;  3OTO M;  1G59 A;  4JI2 M;  1S3S A;  3FRH A;  5EP1 A;  3A46 A;  2UUC M;  2Z8Y M;  1IY1 A;  1IM2 A;  3DZD A;  3M0E A;  1E9R A;  2YQZ A;  3C3D A;  3DOA A;  4X66 M;  1A5T A;  2B3T A;  2DWN A;  1GO5 A;  3C58 A;  1FNN A;  5DYI A;  4QHT A;  3A45 A;  3FKE A;  3KOZ E;  5ITX A;  2KW0 A;  2CV1 A;  3GQ4 A;  3RE8 A;  2FOI C;  4R7G A;  3L29 A;  4IBC A;  1T43 A;  5E6J A;  4PDG A;  2DXI A;  3FE3 A;  3SYL A;  3VFD A;  1OFI A;  3R9X B;  1NJG A;  2R62 A;  1HNX M;  3KVW A;  2R4J A;  2L7I A;  2C9O A;  2DAK A;  5EXX A;  1C1K A;  1OKS A;  2I7N A;  4AZF A;  5IWA M;  5LMN M;  4QHS A;  4DV3 M;  2QNJ A;  1T6O A;  5ITU A;  3FTE A;  7CAT A;  2CUZ A;  3B89 A;  4X62 M;  1L8Q A;  2L09 A;  4Z6Y A;  4JI5 M;  1JR3 A;  2L2D A;  4DR7 M;  3HY5 A;  3QWL A;  4FWG A;  3TWK A;  2V1U A;  4GKK M;  2L6O A;  1PGY A;  1TGU A;  1PJI A;  3ZCB B;  2KRK A;  3FUU A; 
#chains in the Genus database with same CATH homology
 4GC9 A;  2C5R A;  3JAM S;  3EIH A;  4NRV A;  4QNR A;  4CHT B;  3KFU G;  1SXJ C;  4BB9 A;  1I4W A;  5ITX E;  1SXJ A;  3CF0 A;  1N77 A;  5EXT A;  4JI8 M;  4G4R A;  2V6Z M;  5EP4 A;  1VDD A;  4D80 A;  3GLF B;  4LJ5 A;  4K0K M;  1GVN A;  4II7 A;  4GMQ A;  3GLH A;  1E32 A;  2QP9 X;  1Z6T A;  2J7O A;  5KQD A;  3JR5 A;  2XZU A;  4MH0 E;  4L16 A;  4LRS A;  5LMU M;  3FTD A;  3MJ5 A;  3MK6 A;  1TH4 A;  4NSR A;  4XGI A;  4I5S A;  1DGH A;  1QVR A;  2XH9 A;  4IBE A;  1G4A E;  1XXH B;  2KZS A;  3GQ5 A;  4AKG A;  1TDZ A;  4R3D A;  2VQE M;  1Q3C A;  2QEN A;  1QAO A;  1DGH B;  5KO3 A;  3HGI A;  1G3I A;  2CE7 A;  2LNH C;  2F5N A;  1G8P A;  2FE8 A;  4HL4 A;  4FCW A;  4D82 A;  4LJ8 A;  5ITT A;  1GLN A;  3QAU A;  4IBF A;  4OX9 M;  4DV0 M;  5FTL A;  1R2Y A;  1I94 M;  1DGG A;  1GKI A;  3NBI A;  1XNR M;  4G4Q A;  5BPV A;  1SXJ E;  3L28 A;  4GRI A;  4Z8X A;  1IN5 A;  3K1J A;  1IXR C;  3J7B A;  2CHQ A;  4M9X A;  4M0D A;  1IXS B;  3GLG B;  4B7G A;  1Q3B A;  2LH0 A;  5GKN A;  2QBY B;  2DWZ B;  4NOO B;  1D2N A;  3PNY A;  3UK6 A;  5H37 D;  1IBL M;  3THG A;  3L26 A;  3I4V A;  3SMP A;  1IN7 A;  4MM3 B;  2DWM A;  1L2D A;  2F5O A;  4MGH A;  2RKO A;  4DR3 M;  2HHH M;  1X37 A;  2FNA A;  3KP0 E;  3PFI A;  4FD2 A;  3FTF A;  4AW4 A;  4KHP M;  3PVS A;  4M0W A;  1IY0 A;  5EXS A;  2XSZ D;  2UXB M;  4I8O A;  3I4Y A;  1QAM A;  1WXQ A;  1IXZ A;  3IG8 A;  2CHV A;  5EP3 A;  1L2B A;  3IG5 A;  4LY6 A;  5F3W A;  1NY6 A;  3M7G A;  3R8F A;  1LV7 A;  1IY2 A;  4IBB A;  3GLI A;  2F5P A;  1TH2 A;  4AI6 A;  4IBD A;  5KQ8 A;  4IBG A;  2L7H A;  4I4L A;  2R18 A;  3GLI B;  4LFC M;  3EIE A;  3M6A A;  2F4V M;  4NXN M;  3KW6 A;  4REZ A;  1QZM A;  4EIW A;  5FLX S;  3SAV A;  1L2C A;  1XNQ M;  4B3R M;  1DGB A;  2UU9 M;  4GKK M;  2XFS A;  4IJE A;  3ZC7 B;  2LXE A;  3ZH9 B;  3W0L B;  2LWX A;  2KEB A;  3GPY A;  3SHF A;  4AQY M;  4XBO A;  2CV2 A;  1JR3 D;  2KRU A;  2C99 A;  4LF6 M;  1N75 A;  4JYA M;  4LFA M;  5FTN A;  1XMO M;  3LVV A;  3UMM A;  2DZN B;  3HHX A;  4JI0 M;  2FFJ A;  3DA1 A;  2CEA A;  5C1B A;  1XMQ M;  1K82 A;  2HL7 A;  2Y0T A;  1L1Z A;  4LGM A;  3U6C A;  3J7A S;  3HJS A;  3CF2 A;  1SXJ D;  5E26 A;  3GP1 A;  2DWL A;  3U6L A;  4L15 A;  4GKJ M;  2J7N A;  3SAT A;  1Z59 A;  3GPU A;  3AJI B;  3GLF A;  2Y21 A;  4IBK A;  4KOD A;  2ZAN A;  5A2Q S;  2Y0Q A;  1TH3 A;  2ZBK B;  3HJQ A;  4FW9 A;  4D81 A;  4OVZ A;  4L8R C;  4B08 A;  4NXM M;  4JXJ A;  3SHG B;  1HNW M;  4TUW A;  2QZ4 A;  3I51 A;  3AOG A;  3VKG A;  4G4N A;  3U61 B;  1N32 M;  4OVZ B;  1GL7 A;  2RGH A;  1Z5A A;  3FUX A;  1XXH A;  1Z5B A;  2V1C A;  1IBM M;  2XF3 A;  4OW0 A;  1YE9 A;  4A3V B;  4LCB A;  1HT2 E;  1T3T A;  4QNM A;  5DYG A;  3WHK A;  4JI6 M;  1J09 A;  2ERC A;  3RFW A;  4M9S A;  3HHW A;  2ZAM A;  1N34 M;  1N33 M;  5EJC A;  1MU5 A;  3VLF B;  2VQF M;  4B3M M;  1IN8 A;  4GH9 A;  4FWD A;  4PT5 A;  3RGS A;  3J80 S;  2X4A A;  4PCZ A;  3U5Z B;  4DUZ M;  3UJN A;  3UGJ A;  4WW0 A;  5FSW A;  3SAW A;  4BLC A;  8CAT A;  4B7H A;  4B3T M;  1IQP A;  3CF6 E;  4X64 M;  2F5Q A;  1NY5 A;  3U6D A;  3U6S A;  1HNZ M;  4FVM A;  2QCU A;  4AG6 A;  3GLG A;  3FUT A;  2QBY A;  2YFQ A;  3UZU A;  4DV2 M;  3U60 A;  3FD9 A;  3K92 A;  1DO2 A;  2EO2 A;  2XFT A;  2ZAO A;  3TE6 A;  1E9S A;  3J27 B;  3U60 B;  2O5R A;  3HU3 A;  4LZJ A;  4AKH A;  3GRR A;  4LF8 M;  4QOS A;  2G8L A;  2AHM A;  5DNY A;  1L1T A;  1Z5C A;  5FTK A;  2Z4R A;  4LF7 M;  3AL0 C;  2YNM D;  4M9Z A;  3PXG A;  2YR0 A;  3LVW A;  5ITQ A;  3HWS A;  2BNK A;  1IBK M;  4JI3 M;  4QOZ C;  1K3X A;  4LF9 M;  1FJG M;  1NVM A;  2X8A A;  2Y20 A;  3ILK A;  2CHG A;  1J5E M;  3GO8 A;  5EP2 A;  4IBJ A;  4JI7 M;  1PJJ A;  3KOY E;  3JR4 A;  2G5G X;  3LMM A;  1QYR A;  1W5T A;  3TQS A;  1NHW C;  3HU1 A;  3J2P B;  5IT9 S;  1HQC A;  2BJW A;  3AKZ A;  3A98 B;  2CV0 A;  3L2A A;  4DV1 M;  4IIW A;  1NNU C;  1YSY A;  3RGP A;  3HKP A;  3KOX E;  5JI2 E;  4OU7 A;  4GC5 A;  1GL6 A;  5KPZ A;  3T38 A;  3FUV A;  2XSZ A;  4LZZ A;  2D7E A;  1R2Z A;  3E4R A;  1HT1 E;  1NHG C;  3KSJ A;  4YHH M;  2NQ8 C;  3GRY A;  1YUB A;  3K8Z A;  4LJ6 A;  1OJL A;  3H4M A;  3NWL A;  4MGY E;  5KPR A;  3SAU A;  3SAR A;  3GRV A;  2DVW B;  4DR1 M;  4IBI A;  2R4E A;  1K3W A;  1NJF A;  4AKI A;  3AFH A;  4G6Z A;  4S12 A;  1ZAE A;  2M60 A;  3U6M A;  2M5Z A;  1G41 A;  4CGY B;  1HR0 M;  1IN4 A;  4GIP A;  3WHL A;  4B3S M;  4HLQ A;  4DR4 M;  3FTC A;  4JI1 M;  4GIT A;  4MGK E;  2HCB A;  3KS4 A;  1OFH A;  3GPX A;  4KO8 A;  3LQR A;  1TDH A;  4JI4 M;  4LG2 A;  3KXE C;  3SC3 A;  3L27 A;  2VII A;  2KZU A;  1PM5 A;  3AV0 A;  1R6B X;  5FTM A;  3U61 A;  3VK8 A;  2OQ4 A;  3FYD A;  1NNJ A;  3SAS A;  4JV5 M;  3W0F A;  4DV6 M;  4GHL A;  4G4O A;  4DR2 M;  2DZO B;  4DV7 M;  3FYC A;  4NL4 H;  3VDU A;  1N78 A;  2R46 A;  3TPZ A;  2UUA M;  1EE8 A;  1R7R A;  4LF5 M;  2Q2E B;  2EA0 A;  2Z7J A;  1MX0 A;  3LQQ A;  2BJV A;  2R65 A;  4L4U A;  3VKH A;  4I81 A;  1KYI A;  3U6P A;  3J81 S;  3T1Y M;  4MGI E;  4P16 A;  4ZPX A;  2XEP A;  1KFV A;  3E9S A;  2OPF A;  4PDI A;  4LF4 M;  3T15 A;  1QQW A;  1SXJ B;  2C9C A;  3KS8 A;  3CTW B;  2ZM6 M;  2EUC A;  3KP1 E;  3HHY A;  4NRW A;  3U5Z A;  2Z4S A;  2KA6 B;  3AOE C;  4RF0 A;  2UXC M;  5JI3 E;  3AOE A;  2Z3X A;  1QAQ A;  4LJA A;  1QAN A;  2I7P A;  3GLH B;  4GHA A;  2XZF A;  3B9P A;  4AG5 A;  4CIS A;  4B7F A;  2X49 A;  3SYK A;  2P5T A;  3Q8X A;  2E5L M;  5IZ7 D;  3MHV C;  4IJF A;  5IRE B;  5KPT A;  1XWI A;  5FTJ A;  2UUB M;  3A42 A;  3SFZ A;  3BOS A;  3PNV A;  4BBA A;  3KDS E;  3HU2 A;  1ORY B;  4LRT A;  2JA2 A;  4WUR A;  1UM8 A;  3L25 A;  3KSX A;  4LGY A;  4FWH A;  3FUW A;  3GRU A;  5BR8 M;  3HHZ A;  3TWM A;  2C98 A;  4LJ7 A;  2CFO A;  5ITR A;  1DGF A;  3HJ8 A;  3GPP A;  1H6U A;  1J7K A;  3D8L A;  3T1H M;  1N36 M;  3K2L A;  1DO0 A;  3U6E A;  3U6O A;  2C96 A;  2HKJ A;  4DR5 M;  4JN6 A;  2H1R A;  3KOW E;  4RF1 A;  2KXE A;  4L78 A;  3D8B A;  2R45 A;  1E94 E;  2F5S A;  3SBJ A;  2XLJ A;  2DHR A;  5EQT A;  2K47 A;  4FCT A;  1JQJ C;  1W5S A;  4DV5 M;  2RGO A;  5C18 A;  3VK7 A;  4FCV A;  4ITQ A;  4PD2 A;  4DV4 M;  2UXD M;  2XGN A;  4YY3 M;  4W5W A;  4LFB M;  2W82 A;  3VDP A;  1IN6 A;  1ZQ9 A;  3DFZ A;  1Q39 A;  4KLN A;  4LJ9 A;  2QPA A;  2D7H A;  4NSO B;  3TWL A;  4DUY M;  4RNA A;  5EXP A;  4X65 M;  1XHB A;  1KSF X;  5ITY A;  2D7G A;  3GQ3 A;  4MB7 A;  3TL4 X;  2A5Y B;  4LJ4 A;  1XC8 A;  4MGZ E;  4DR6 M;  3SMS A;  1HQY E;  3U6Q A;  1NSF A;  3OTO M;  1G59 A;  4JI2 M;  1S3S A;  5EP1 A;  3A46 A;  2UUC M;  1IY1 A;  1IM2 A;  3DZD A;  3M0E A;  1E9R A;  2YQZ A;  3DOA A;  4X66 M;  2DWN A;  3C58 A;  1FNN A;  5DYI A;  4QHT A;  3A45 A;  3FKE A;  3KOZ E;  5ITX A;  2KW0 A;  2CV1 A;  3GQ4 A;  3RE8 A;  2FOI C;  4R7G A;  3L29 A;  4IBC A;  5E6J A;  4PDG A;  2DXI A;  3SYL A;  3VFD A;  1OFI A;  3R9X B;  1NJG A;  2R62 A;  1HNX M;  3KVW A;  2R4J A;  2L7I A;  2C9O A;  5EXX A;  1C1K A;  2I7N A;  4AZF A;  5IWA M;  5LMN M;  4QHS A;  4DV3 M;  5ITU A;  3FTE A;  7CAT A;  2CUZ A;  4X62 M;  1L8Q A;  2L09 A;  4Z6Y A;  4JI5 M;  1JR3 A;  4DR7 M;  3QWL A;  4FWG A;  3TWK A;  2V1U A;  2L6O A;  1TGU A;  1PJI A;  3ZCB B;  2KRK A;  3FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...