1I94M

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 21
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i94M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1i94M02
1L2CA 4DR7M 3TWMA 2VQFM 1XNRM 1I94M 3GP1A 4GKJM 2UU9M 4X62M 4NRWA 4X64M 5A2QS 2ZM6M 4JI0M 4K0KM 1IBMM 1Z59A 1Z5BA 2UXBM 4DUYM 4JYAM 5ITTA 4DUZM 3T1HM 4NXMM 4LFCM 5IT9S 1N34M 4NRVA 4PDIA 2F5QA 3SATA 3OTOM 3U6LA 1XMQM 3J80S 1MU5A 1HNWM 4JI3M 4JI5M 4DV3M 2F5SA 3TWKA 3J81S 3U6MA 2OPFA 3SAUA 4DR3M 1L2BA 1L1TA 4MB7A 3VK7A 4X66M 1IBKM 5LMNM 5FLXS 3W0FA 1L1ZA 4DV6M 3GO8A 1HR0M 2ZBKB 2F4VM 2XZUA 1NNJA 4B3MM 3JAMS 4B3RM 4G4NA 4DR5M 1N36M 4CISA 1R2YA 2Q2EB 4OX9M 1K82A 1Z5AA 2HHHM 1Z5CA 3SAWA 1L2DA 1K3XA 2E5LM 1J5EM 4AQYM 4YY3M 1Q3CA 4PD2A 1TDHA 3DOAA 4PCZA 4NXNM 1Q39A 4LF7M 3JR5A 3A42A 4X65M 1IBLM 4DV2M 3U6OA 1XMOM 1EE8A 4DV1M 3GQ3A 4LFAM 4DR4M 3GPYA 4JI2M 1TDZA 4DV4M 3SASA 2EA0A 2HKJA 3GPUA 3A46A 3T1YM 5ITXA 4ITQA 4DV0M 4JV5M 1N32M 2F5NA 3VK8A 1HNZM 2OQ4A 3GQ5A 1PM5A 2UXDM 4G4OA 2VQEM 1PJIA 4DR2M 3SBJA 3J7AS 1XNQM 5BR8M 3U6PA 4YHHM 5ITRA 4JI4M 1R2ZA 3SARA 2XZFA 3GPXA 5LMUM 4DV5M 1K3WA 3JR4A 5IWAM 4LF4M 4DV7M 4B3TM 4LF9M 4LF6M 3U6SA 3U6DA 4JI6M 3TWLA 3GPPA 3SAVA 5ITUA 2UUAM 4B3SM 1FJGM 2UUBM 4JI8M 5ITXE 4GKKM 4PDGA 4LF5M 4G4RA 4G4QA 4JI1M 1MX0A 4DR6M 3C58A 1PJJA 3U6CA 4KHPM 2UUCM 4DR1M 2F5PA 5ITQA 3U6EA 1XC8A 2UXCM 1HNXM 5ITYA 4JI7M 4LFBM 3A45A 1KFVA 1N33M 3GQ4A 2F5OA 4LF8M 3U6QA 1Q3BA
chains in the Genus database with same CATH superfamily
1QAOA 4QHTA 2VF7A 3TWMA 1T6OA 3CGWA 3SMSA 2KRUA 2DAGA 3AV0A 2WSCF 2QENA 2CFOA 2EO2A 1R5LA 1TH4A 3FUUA 4X64M 2ZM6M 2DENA 3ZC7B 4G3OA 1WGLA 4K0KM 3FD9A 4G6ZA 2L09A 1UM8A 2M5ZA 1IBMM 2K0BX 1J7KA 3CF2A 4KODA 4LZZA 3HHZA 1V33A 1IY0A 5ITTA 2X49A 3FRHA 4DUZM 4NXMM 1HT2E 5IT9S 2XLJA 1OTRA 7CATA 1OIZA 2JY6B 4AW4A 1NY5A 2BJVA 1JR3D 4WP2A 4Z8XA 2F5QA 2XFSA 5DYGA 2L7IA 4IBKA 2DWZB 4XBOA 3SHGB 3KFUG 4B7HA 3B7ZA 2J5YA 3GLIE 1XWIA 4OW0A 4L78A 2C99A 3PVSA 4JI5M 3B9PA 5JI2E 4D81A 3NBXX 1GLNA 3U6MA 5EP3A 1NNUC 4DR3M 4GC5A 1L2BA 1PRBA 3KOZE 4MH0E 4L15A 1N75A 4LJ4A 3L28A 1DGGA 3GO8A 2NQ8C 3LW5F 3WHLA 1ZMWA 1QQWA 1Q02A 3RGSA 3SYLA 4MGYE 2C98A 1VG5A 2DAEA 3L29A 3R8FA 1DGHB 1PJSA 2D7HA 3I04M 2I7PA 1QUTA 3HHXA 5IREB 8CATA 5FTJA 1K3XA 1L2DA 3K2LA 2R62A 1WGNA 5GKNA 3Q8GA 3QYBA 4PCZA 1D0LA 4L4UA 1Q39A 2KHHA 3GLFB 2HWJA 1QANA 1SXJB 2LVOC 1XMOM 1EE8A 2MJ5B 2G3QA 2K9DA 3RFWA 2CUZA 3GQ3A 4LFAM 3KXEC 1NJGA 1NY6A 4AG5A 4LGMA 4XGIA 1VEGA 4RKUF 4DV4M 3SASA 3GLHA 1KYIA 2EKFA 5H37D 4L8RC 3VK8A 4KO8A 4QOSA 2KNZA 4L6V6 4G4OA 4M0WA 2LH0A 3KDSE 2VQEM 3M6AA 2LBCA 1OAOC 2M60A 1OFIA 2GQFA 1WHCA 3J7AS 3AJIB 1XXHB 1N77A 4D80A 2YR0A 1IQPA 3LQQA 5BR8M 4JI4M 2R45A 4FWGA 2HAKA 3QWLA 3UJNA 2QNJA 5LMUM 1K3WA 2HCBA 3RGPA 1ZQ9A 4CGYB 4GMQA 1IM2A 4B3TM 5EP2A 3U6SA 2CHQA 1UFZA 2DVWB 3IECA 4RF0A 3U6DA 2ZTDA 4NOOB 3GPPA 1CUKA 4QHSA 1J09A 1ZMUA 4LF5M 3HJ8A 1E9SA 1YSYA 4G4RA 2VF8A 5KQDA 1MX0A 3HZJA 3I4VA 4OVZA 3ZCBB 4GIPA 3KS8A 1XXHE 4P16A 1IXZA 3GLGE 3UK6A 2AHMA 1ZAEA 4TUWA 4FD2A 3U61B 4FCTA 4GRIA 4LFBM 1WR1B 4NL4H 4F1IA 1T3TA 3U60B 2F5OA 3NBIA 2Z7JA 1DGHA 4DBGB 4HEOA 2ZANA 2VQFM 1I4WA 1ORYB 3FRIA 2K6BA 3J27B 3KSXA 3GP1A 1XNRM 1OQYA 4GKJM 1N78A 2ZAOA 4BLCA 2UU9M 4X62M 3L26A 2QHOB 1G41A 2DKLA 3GLFA 3E46A 4JI0M 2QSFX 2MROB 1TF0B 1TH3A 2Z3XA 4P17A 5JI3E 2CHVA 3T15A 4RF1A 3GLGB 3AFHA 2OOBA 2UXBM 4JYAM 4LJ6A 3T1HM 4I8OA 1X37A 3DFZA 1QZEA 3PNYA 4HL4A 1N34M 3FUXA 3A98B 3HJQA 1P3QQ 2G8LA 1IFYA 1W5SA 2JY5A 2KW0A 3B7QA 4IJEA 5KPTA 1SXJE 4KHPM 1G8PA 2C96A 4IIWA 3U6LA 5F3WA 1KSFX 1MU5A 4JI3M 4LCBA 3AOEC 4FWHA 2J7OA 3SAUA 1ZMVA 4MB7A 2RGOA 2JY8A 1IBKM 3TQSA 5L8RF 1L1ZA 1IY2A 1VEKA 2O5RA 4DV6M 2F4VM 4Y28F 1TTEA 2XZUA 1NNJA 4LJ5A 1WIVA 3JAMS 4B3MM 5KO3A 1R2YA 2Q2EB 3KOWE 4OX9M 3L25A 2HHHM 1IXSA 2FE8A 2QPAA 3SC3A 3AL0C 3IG8A 2R18A 2CHGA 3ZQJA 4AQYM 2DI0A 1Q3CA 2CRUA 2ZAMA 4NXNM 3HHYA 5KQ8A 3D8LA 1S3SA 3TPZA 4LF7M 1IN5A 4Q7JA 4DV2M 3U6OA 2I7NA 4FW9A 3ILKA 5EXPA 3GPYA 4JI2M 1NO1A 1TDZA 3GRUA 3IG5A 1JQJC 1HJPA 3A46A 2D7GA 2RKOA 4M9ZA 5ITXA 2DZNB 4KLNA 1GL7A 1N32M 3FTFA 1E94E 3VKGA 1HNZM 2WSEF 2OQ4A 1PM5A 3MHVC 2UXDM 1QZMA 4I4LA 2N35A 4BB9A 1PJIA 1E9RA 3TE6A 3MMPA 2RGHA 1OJLA 1GL6A 3KOYE 3KP0E 3RE8A 4WURA 4EIWA 5ITRA 1JR3A 2XZFA 5BPVA 4D82A 3GPXA 3LVVA 3FKEA 2XF3A 3HX3A 3C3EA 5C18A 5IWAM 3LQRA 4DV7M 4NSOB 1IN4A 4LF4M 1IN8A 2R6FA 3J2PB 1QAQA 3CF6E 3FTCA 1E32A 1V34A 3SAVA 4MGIE 1D0KA 3TL4X 3FYCA 4B08A 4GKKM 1XB2B 3HU2A 2B3TA 2H5XA 2FH0A 1IN7A 2XGNA 3FUVA 4GEWA 2CE7A 3NWLA 2Y0TA 3CF0A 1JR3E 4DR1M 5DYIA 3IHPA 2LHGA 3KS4A 2YQZA 1XC8A 2XSZA 1AIPC 2Y21A 3K9OA 4II7A 4JI7M 1EIJA 1HQYE 3A45A 4IBBA 4FCWA 4L16A 4CIZA 1OFHA 2DAMA 4LF8M 1QUSA 2DAIA 1G71A 4FWDA 4IBCA 4MGZE 4AZFA 2KEBA 2Z8YM 3Q8XA 2LVQD 3EIHA 3K1JA 2BWEA 1R6BX 5EP4A 1TR8A 3THGA 1QAMA 1PGYA 2LWXA 1Z5BA 3DZDA 1HT1E 4IBFA 4LRSA 4UN2B 1R4GA 2LVPC 4DUYM 4R7GA 2KXEA 2P5TA 4IBGA 2BJWA 3KOXE 1GKIA 5EXXA 3B7NA 4KT0F 4PDIA 3AOEA 1L8QA 3CTWB 3SATA 1C1KA 2DWLA 1G4AE 2J7NA 4GH9A 3VKHA 1QDTA 2KZSA 3BOSA 1XMQM 3GRYA 4FCVA 4OU7A 4DV3M 3M0EA 3J81S 2Z4SA 1TGUA 3FE3A 4X66M 3HKPA 1QYRA 2R65A 3W68A 5LMNM 5FLXS 1WXQA 3W0FA 3K9PA 4I5SA 2Z4RA 4W5WA 3H4JA 1D2NA 2DZOB 3GLIA 4CISA 3HHWA 1ZV1A 2DHRA 1N36M 4XK8F 3QAUA 1K82A 3KW6A 2JP7A 1XHBA 2QZ4A 1NSFA 1Z5CA 1LTMA 2R0IA 4AKGA 3SAWA 4AI6A 2E5LM 2QBYB 1TH2A 1YE9A 3BBZA 4Z6YA 1JB0F 1J5EM 1NV8A 3BXWA 3MJ5A 4F2LA 3UMMA 4PT5A 3HU1A 4PD2A 2R44A 1DGFA 3KSJA 2KA6B 1C7YA 2LHCA 4X65M 1IY1A 1D0MA 2X4AA 3KP1E 3V76A 5C1BA 1EFUB 5FTKA 4REZA 4QNMA 4R71A 3LMMA 4DR4M 5E6JA 1MJGM 4IBJA 4NC6A 2DWNA 2EA0A 4GHAA 2HL7A 4ITQA 1XXHA 4CHTB 4AKHA 1Y8GA 2F5NA 2KRKA 4A3VB 2OO9A 2FOIC 3M7GA 1W5TA 3C3DA 1BVSA 1VEJA 4RNAA 1LV7A 1OAIA 2RRUA 2ERCA 3C9PA 2JA2A 3H4MA 4I81A 2K47A 3GLHB 2CEAA 1XNQM 2EUCA 4R3DA 3HY5A 2DWMA 2X8AA 3U6PA 1DGBA 2KDLA 5DFLA 4YHHM 3J7BA 2CV1A 1PJTA 2LVAA 3SARA 4GHLA 2WZJA 1VQ1A 2BNKA 2JZ1A 2CV2A 3JR4A 2C9CA 4OVZB 4LGYA 2APLA 4LF9M 4LF6M 4IBEA 3VFDA 3FYDA 5KPRA 1R7RA 2JUJA 3TWLA 2FS1A 2UUAM 4B3SM 1FJGM 2V6ZM 4WW0A 4JI8M 1DV0A 5ITXE 2O01F 4PDGA 4G4QA 1NJFA 1OKSA 1QDRA 3T6PA 3VDUA 3U60A 4DR6M 4MM3B 3GLHE 2XH9A 1G3IA 4LY6A 1PJJA 3HJSA 3QYEA 2F5PA 2UUCM 5ITQA 2H1RA 3U6EA 2L4EA 2ZTCA 1MN3A 3HGIA 1SXJD 5EP1A 5FSWA 4CJ6A 1HNXM 2UXCM 1N33M 1YLAA 3E9SA 3KVWA 3DA1A 3GQ4A 3U6QA 4B7GA 3LVWA 1L2CA 4DR7M 2LNHC 2QBYA 2L6OA 1I94M 5E26A 1Z6TA 3WHKA 3U61A 3K92A 5FTNA 1DO2A 4NRWA 3PXGA 3U5ZB 5A2QS 3E4RA 2VDBB 2LTUA 1NHWC 1F4IA 3D8BA 1Z59A 1GO5A 2QCUA 5IZ7D 4M0DA 2XFTA 4LJ9A 4GC9A 4LFCM 2Y0QA 2LXEA 2YNMD 1AUAA 1WJ7A 4NRVA 1NHGC 4B7FA 2DZLA 4M9SA 2C5RA 2G5GX 1V92A 2KNAA 3F92A 4ANRA 3R9XB 4MGHA 3T38A 5DNYA 1A5TA 3AKZA 2C9OA 1SXJA 2JXNA 4LJ7A 3OTOM 2KNVA 3E21A 1VDDA 3J80S 1HNWM 2MH8A 1GJTA 2FNAA 1G59A 2F5SA 3TWKA 4LRTA 2KZUA 2JY7A 2JNHA 3GRVA 2OPFA 1IN6A 1L1TA 3VK7A 3AOGA 2MR9A 4IBDA 2V1UA 2CP8A 3FUTA 2A5YB 5FTMA 2ZBKB 5EJCA 1HR0M 5EXSA 2L7HA 2CV0A 4IJFA 2DHYA 3LCVB 4GITA 4B3RM 4G4NA 4DR5M 3W0LB 4ZPXA 4QOZC 1Z5AA 3I4YA 2VIIA 3GRRA 3SFZA 2GNOA 4MGKE 3K8ZA 3SMPA 4LZJA 3W67A 1VDLA 4YY3M 1TDHA 3DOAA 3HWSA 4JXJA 2V1CA 3SHFA 3I01M 3JR5A 3A42A 1IBLM 1IXSB 1SG9A 2L4FA 4M9XA 2L2DA 3GLIB 4DV1M 3L27A 4HLQA 2EJSA 2YFQA 3LCUA 1T43A 2XEPA 2O25A 3VLFB 2HKJA 3GPUA 3T1YM 1FNNA 4DV0M 3PFIA 4QNRA 3U5ZA 4JV5M 3PNVA 2QQ8A 3GQ5A 4AG6A 2MGWA 4S12A 2Y20A 4JN6A 3SYKA 5EQTA 3FUWA 4DR2M 3SBJA 2EKKA 2R4JA 3L2AA 2R46A 3HU3A 1IXRC 1R2ZA 4FVMA 2WSFF 2R4EA 4DV5M 5KPZA 1YUBA 4NSRA 3UGJA 4BBAA 1NVMA 3UZUA 2JZ0A 2QP9X 3GLFE 1NV9A 3EIEA 4IBIA 4JI6M 2JWSA 2DAKA 1GABA 5ITUA 2CWBA 3B74A 2D7EA 5FTLA 2UUBM 1GJSA 2BWBA 2W82A 1SXJC 4JI1M 1HQCA 1PJQA 3C58A 3U6CA 3I51A 1OIPA 3MK6A 4LG2A 4LJ8A 1H6UA 4AKIA 3VDPA 1QVRA 5ITYA 2FFJA 2OOAA 1RU3A 1GVNA 2LVNC 3B89A 3FTDA 1DO0A 3GLGA 1KFVA 3FTEA 3ZH9B 5EXTA 4LJAA 2DNAA 2DXIA 1Q3BA 2XSZD
chains in the Genus database with same CATH topology
1QAOA 4QHTA 3TWMA 3SMSA 2KRUA 3AV0A 2QENA 2CFOA 2EO2A 1TH4A 3FUUA 4X64M 2ZM6M 3ZC7B 4K0KM 3FD9A 4G6ZA 2L09A 1UM8A 2M5ZA 1IBMM 1J7KA 3CF2A 4KODA 4LZZA 3HHZA 5ITTA 1IY0A 4DUZM 2X49A 4NXMM 1HT2E 5IT9S 2XLJA 7CATA 4AW4A 1NY5A 2BJVA 1JR3D 4Z8XA 2F5QA 2XFSA 5DYGA 2L7IA 4IBKA 2DWZB 4XBOA 3SHGB 3KFUG 4B7HA 1XWIA 4OW0A 4L78A 2C99A 3PVSA 4JI5M 3B9PA 5JI2E 4D81A 1GLNA 3U6MA 5EP3A 1NNUC 4DR3M 4GC5A 1L2BA 3KOZE 4MH0E 4L15A 1N75A 4LJ4A 3L28A 1DGGA 3GO8A 2NQ8C 3WHLA 1QQWA 3RGSA 3SYLA 4MGYE 2C98A 3L29A 3R8FA 1DGHB 2D7HA 8CATA 2I7PA 3HHXA 5IREB 1K3XA 1L2DA 5FTJA 3K2LA 2R62A 5GKNA 4PCZA 4L4UA 1Q39A 3GLFB 1QANA 1SXJB 1XMOM 1EE8A 3RFWA 2CUZA 3GQ3A 4LFAM 3KXEC 1NJGA 1NY6A 4AG5A 4LGMA 4XGIA 4DV4M 3SASA 3GLHA 1KYIA 5H37D 4L8RC 3VK8A 4KO8A 4QOSA 4G4OA 4M0WA 2LH0A 3KDSE 2VQEM 3M6AA 2M60A 1OFIA 3J7AS 3AJIB 1XXHB 1N77A 4D80A 2YR0A 1IQPA 3LQQA 5BR8M 4JI4M 2R45A 4FWGA 3QWLA 3UJNA 5LMUM 1K3WA 2HCBA 3RGPA 1ZQ9A 4CGYB 4GMQA 1IM2A 4B3TM 5EP2A 3U6SA 2CHQA 2DVWB 4RF0A 3U6DA 4NOOB 3GPPA 4QHSA 1J09A 4LF5M 3HJ8A 1E9SA 1YSYA 4G4RA 5KQDA 1MX0A 3I4VA 4OVZA 3ZCBB 4GIPA 3KS8A 4P16A 1IXZA 3UK6A 2AHMA 1ZAEA 4TUWA 4FD2A 3U61B 4FCTA 4GRIA 4LFBM 4NL4H 1T3TA 3U60B 2F5OA 3NBIA 2Z7JA 1DGHA 2ZANA 2VQFM 1I4WA 1ORYB 3J27B 3KSXA 1XNRM 3GP1A 1N78A 4GKJM 2ZAOA 4BLCA 2UU9M 4X62M 3L26A 1G41A 3GLFA 4JI0M 1TH3A 2Z3XA 5JI3E 2CHVA 3T15A 4RF1A 3GLGB 3AFHA 2UXBM 4JYAM 4LJ6A 3T1HM 4I8OA 1X37A 3DFZA 3PNYA 4HL4A 1N34M 3FUXA 3A98B 3HJQA 2G8LA 1W5SA 2KW0A 4IJEA 5KPTA 1SXJE 1G8PA 2C96A 4IIWA 3U6LA 5F3WA 1KSFX 1MU5A 4JI3M 4LCBA 3AOEC 4FWHA 2J7OA 3SAUA 4MB7A 2RGOA 1IBKM 3TQSA 1L1ZA 1IY2A 2O5RA 4DV6M 2F4VM 2XZUA 1NNJA 4LJ5A 3JAMS 4B3MM 5KO3A 1R2YA 2Q2EB 3KOWE 4OX9M 3L25A 2HHHM 2FE8A 2QPAA 3SC3A 3AL0C 3IG8A 2R18A 2CHGA 4AQYM 1Q3CA 2ZAMA 4NXNM 3HHYA 5KQ8A 3D8LA 1S3SA 3TPZA 4LF7M 1IN5A 4DV2M 3U6OA 2I7NA 4FW9A 3ILKA 5EXPA 3GPYA 4JI2M 1TDZA 3GRUA 3IG5A 1JQJC 3A46A 2D7GA 2RKOA 4M9ZA 5ITXA 2DZNB 4KLNA 1GL7A 1N32M 3FTFA 1E94E 3VKGA 1HNZM 2OQ4A 1PM5A 3MHVC 2UXDM 1QZMA 4I4LA 4BB9A 1PJIA 1E9RA 3TE6A 2RGHA 1OJLA 1GL6A 3KOYE 3KP0E 3RE8A 4WURA 4EIWA 5ITRA 1JR3A 2XZFA 5BPVA 4D82A 3GPXA 3LVVA 3FKEA 2XF3A 5C18A 5IWAM 3LQRA 4DV7M 4NSOB 1IN4A 4LF4M 1IN8A 3J2PB 1QAQA 3CF6E 3FTCA 1E32A 3SAVA 4MGIE 3TL4X 3FYCA 4B08A 4GKKM 3HU2A 1IN7A 2XGNA 3FUVA 2CE7A 3NWLA 2Y0TA 3CF0A 4DR1M 5DYIA 3KS4A 2YQZA 1XC8A 2XSZA 2Y21A 4II7A 4JI7M 1HQYE 3A45A 4IBBA 4FCWA 4L16A 1OFHA 4LF8M 4FWDA 4IBCA 4MGZE 4AZFA 2KEBA 3Q8XA 3EIHA 3K1JA 3THGA 1R6BX 5EP4A 1QAMA 2LWXA 1Z5BA 3DZDA 1HT1E 4IBFA 4LRSA 4DUYM 4R7GA 2KXEA 2P5TA 4IBGA 2BJWA 3KOXE 1GKIA 5EXXA 4PDIA 3AOEA 1L8QA 3CTWB 3SATA 1C1KA 2DWLA 1G4AE 2J7NA 4GH9A 3VKHA 3BOSA 2KZSA 1XMQM 3GRYA 4FCVA 4OU7A 4DV3M 3M0EA 3J81S 2Z4SA 1TGUA 4X66M 3HKPA 1QYRA 2R65A 5LMNM 5FLXS 1WXQA 3W0FA 4I5SA 2Z4RA 4W5WA 1D2NA 2DZOB 3GLIA 4CISA 3HHWA 1N36M 2DHRA 3QAUA 1K82A 3KW6A 1XHBA 2QZ4A 1NSFA 1Z5CA 4AKGA 4AI6A 3SAWA 2E5LM 2QBYB 1TH2A 1YE9A 4Z6YA 1J5EM 3MJ5A 3UMMA 4PT5A 3HU1A 4PD2A 1DGFA 3KSJA 2KA6B 4X65M 1IY1A 3KP1E 2X4AA 5C1BA 5FTKA 4REZA 4QNMA 4DR4M 3LMMA 5E6JA 4IBJA 4GHAA 2DWNA 2EA0A 2HL7A 4ITQA 1XXHA 4CHTB 4AKHA 2F5NA 2KRKA 4A3VB 2FOIC 3M7GA 1W5TA 4RNAA 1LV7A 2ERCA 2JA2A 3H4MA 4I81A 2K47A 3GLHB 2CEAA 1XNQM 2EUCA 4R3DA 2DWMA 2X8AA 3U6PA 1DGBA 4YHHM 2CV1A 3J7BA 3SARA 4GHLA 2BNKA 2CV2A 3JR4A 2C9CA 4OVZB 4LGYA 4LF9M 4LF6M 4IBEA 3VFDA 3FYDA 5KPRA 1R7RA 3TWLA 2UUAM 4B3SM 1FJGM 2V6ZM 4WW0A 4JI8M 5ITXE 4PDGA 4G4QA 1NJFA 3U60A 4DR6M 3VDUA 4MM3B 1PJJA 2XH9A 1G3IA 4LY6A 2UUCM 3HJSA 2F5PA 4KHPM 5ITQA 2H1RA 3U6EA 3HGIA 2UXCM 1SXJD 5EP1A 5FSWA 1HNXM 1N33M 3E9SA 3KVWA 3DA1A 3GQ4A 3U6QA 4B7GA 3LVWA 1L2CA 4DR7M 2LNHC 2QBYA 2L6OA 1I94M 5E26A 1Z6TA 3WHKA 3U61A 3K92A 5FTNA 1DO2A 4NRWA 3PXGA 3U5ZB 5A2QS 3E4RA 1NHWC 3D8BA 1Z59A 2QCUA 5IZ7D 4M0DA 2XFTA 4LJ9A 4GC9A 4LFCM 2Y0QA 2LXEA 2YNMD 4NRVA 4B7FA 1NHGC 4M9SA 2C5RA 2G5GX 3R9XB 4MGHA 3T38A 5DNYA 3AKZA 2C9OA 1SXJA 4LJ7A 3OTOM 1VDDA 3J80S 1HNWM 2FNAA 1G59A 2F5SA 3TWKA 4LRTA 2KZUA 3GRVA 2OPFA 1IN6A 1L1TA 3VK7A 3AOGA 4IBDA 2V1UA 3FUTA 2A5YB 5FTMA 2ZBKB 5EJCA 1HR0M 5EXSA 2L7HA 2CV0A 4IJFA 4GITA 4B3RM 4G4NA 4DR5M 3W0LB 4ZPXA 4QOZC 1Z5AA 3I4YA 2VIIA 3GRRA 3SFZA 4MGKE 3K8ZA 3SMPA 4LZJA 4YY3M 1TDHA 3DOAA 3HWSA 4JXJA 2V1CA 3SHFA 3JR5A 3A42A 1IBLM 1IXSB 4M9XA 3GLIB 4DV1M 3L27A 4HLQA 2YFQA 2XEPA 3VLFB 2HKJA 3GPUA 3T1YM 1FNNA 4DV0M 3PFIA 4QNRA 3U5ZA 4JV5M 3PNVA 3GQ5A 4AG6A 4S12A 2Y20A 4JN6A 3SYKA 5EQTA 3FUWA 4DR2M 3SBJA 2R4JA 3L2AA 2R46A 3HU3A 1IXRC 1R2ZA 4FVMA 2R4EA 4DV5M 5KPZA 1YUBA 4NSRA 3UGJA 4BBAA 1NVMA 3UZUA 2QP9X 3EIEA 4IBIA 4JI6M 5ITUA 2D7EA 5FTLA 2UUBM 2W82A 1SXJC 4JI1M 1HQCA 3C58A 3U6CA 3I51A 3MK6A 4LG2A 4LJ8A 1H6UA 4AKIA 3VDPA 1QVRA 5ITYA 2FFJA 1GVNA 3FTDA 3GLGA 1KFVA 1DO0A 3FTEA 3ZH9B 5EXTA 4LJAA 2DXIA 1Q3BA 2XSZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2C A;  4DR7 M;  3TWM A;  2VQF M;  1XNR M;  1I94 M;  3GP1 A;  4GKJ M;  2UU9 M;  4X62 M;  4NRW A;  4X64 M;  5A2Q S;  2ZM6 M;  4JI0 M;  4K0K M;  1IBM M;  1Z59 A;  1Z5B A;  2UXB M;  4DUY M;  4JYA M;  5ITT A;  4DUZ M;  3T1H M;  4NXM M;  4LFC M;  5IT9 S;  1N34 M;  4NRV A;  4PDI A;  2F5Q A;  3SAT A;  3OTO M;  3U6L A;  1XMQ M;  3J80 S;  1MU5 A;  1HNW M;  4JI3 M;  4JI5 M;  4DV3 M;  2F5S A;  3TWK A;  3J81 S;  3U6M A;  2OPF A;  3SAU A;  4DR3 M;  1L2B A;  1L1T A;  4MB7 A;  3VK7 A;  4X66 M;  1IBK M;  5LMN M;  5FLX S;  3W0F A;  1L1Z A;  4DV6 M;  3GO8 A;  1HR0 M;  2ZBK B;  2F4V M;  2XZU A;  1NNJ A;  4B3M M;  3JAM S;  4B3R M;  4G4N A;  4DR5 M;  1N36 M;  4CIS A;  1R2Y A;  2Q2E B;  4OX9 M;  1K82 A;  1Z5A A;  2HHH M;  1Z5C A;  3SAW A;  1L2D A;  1K3X A;  2E5L M;  1J5E M;  4AQY M;  4YY3 M;  1Q3C A;  4PD2 A;  1TDH A;  3DOA A;  4PCZ A;  4NXN M;  1Q39 A;  4LF7 M;  3JR5 A;  3A42 A;  4X65 M;  1IBL M;  4DV2 M;  3U6O A;  1XMO M;  1EE8 A;  4DV1 M;  3GQ3 A;  4LFA M;  4DR4 M;  3GPY A;  4JI2 M;  1TDZ A;  4DV4 M;  3SAS A;  2EA0 A;  2HKJ A;  3GPU A;  3A46 A;  3T1Y M;  5ITX A;  4ITQ A;  4DV0 M;  4JV5 M;  1N32 M;  2F5N A;  3VK8 A;  1HNZ M;  2OQ4 A;  3GQ5 A;  1PM5 A;  2UXD M;  4G4O A;  2VQE M;  1PJI A;  4DR2 M;  3SBJ A;  3J7A S;  1XNQ M;  5BR8 M;  3U6P A;  4YHH M;  5ITR A;  4JI4 M;  1R2Z A;  3SAR A;  2XZF A;  3GPX A;  5LMU M;  4DV5 M;  1K3W A;  3JR4 A;  5IWA M;  4LF4 M;  4DV7 M;  4B3T M;  4LF9 M;  4LF6 M;  3U6S A;  3U6D A;  4JI6 M;  3TWL A;  3GPP A;  3SAV A;  5ITU A;  2UUA M;  4B3S M;  1FJG M;  2UUB M;  4JI8 M;  5ITX E;  4GKK M;  4PDG A;  4LF5 M;  4G4R A;  4G4Q A;  4JI1 M;  1MX0 A;  4DR6 M;  3C58 A;  1PJJ A;  3U6C A;  4KHP M;  2UUC M;  4DR1 M;  2F5P A;  5ITQ A;  3U6E A;  1XC8 A;  2UXC M;  1HNX M;  5ITY A;  4JI7 M;  4LFB M;  3A45 A;  1KFV A;  1N33 M;  3GQ4 A;  2F5O A;  4LF8 M;  3U6Q A;  1Q3B A; 
#chains in the Genus database with same CATH topology
 1QAO A;  4QHT A;  2VF7 A;  3TWM A;  1T6O A;  3CGW A;  3SMS A;  2KRU A;  2DAG A;  3AV0 A;  2WSC F;  2QEN A;  2CFO A;  2EO2 A;  1R5L A;  1TH4 A;  3FUU A;  4X64 M;  2ZM6 M;  2DEN A;  3ZC7 B;  4G3O A;  1WGL A;  4K0K M;  3FD9 A;  4G6Z A;  2L09 A;  1UM8 A;  2M5Z A;  1IBM M;  2K0B X;  1J7K A;  3CF2 A;  4KOD A;  4LZZ A;  3HHZ A;  1V33 A;  1IY0 A;  5ITT A;  2X49 A;  3FRH A;  4DUZ M;  4NXM M;  1HT2 E;  5IT9 S;  2XLJ A;  1OTR A;  7CAT A;  1OIZ A;  2JY6 B;  4AW4 A;  1NY5 A;  2BJV A;  1JR3 D;  4WP2 A;  4Z8X A;  2F5Q A;  2XFS A;  5DYG A;  2L7I A;  4IBK A;  2DWZ B;  4XBO A;  3SHG B;  3KFU G;  4B7H A;  3B7Z A;  2J5Y A;  3GLI E;  1XWI A;  4OW0 A;  4L78 A;  2C99 A;  3PVS A;  4JI5 M;  3B9P A;  5JI2 E;  4D81 A;  3NBX X;  1GLN A;  3U6M A;  5EP3 A;  1NNU C;  4DR3 M;  4GC5 A;  1L2B A;  1PRB A;  3KOZ E;  4MH0 E;  4L15 A;  1N75 A;  4LJ4 A;  3L28 A;  1DGG A;  3GO8 A;  2NQ8 C;  3LW5 F;  3WHL A;  1ZMW A;  1QQW A;  1Q02 A;  3RGS A;  3SYL A;  4MGY E;  2C98 A;  1VG5 A;  2DAE A;  3L29 A;  3R8F A;  1DGH B;  1PJS A;  2D7H A;  3I04 M;  2I7P A;  1QUT A;  3HHX A;  5IRE B;  8CAT A;  5FTJ A;  1K3X A;  1L2D A;  3K2L A;  2R62 A;  1WGN A;  5GKN A;  3Q8G A;  3QYB A;  4PCZ A;  1D0L A;  4L4U A;  1Q39 A;  2KHH A;  3GLF B;  2HWJ A;  1QAN A;  1SXJ B;  2LVO C;  1XMO M;  1EE8 A;  2MJ5 B;  2G3Q A;  2K9D A;  3RFW A;  2CUZ A;  3GQ3 A;  4LFA M;  3KXE C;  1NJG A;  1NY6 A;  4AG5 A;  4LGM A;  4XGI A;  1VEG A;  4RKU F;  4DV4 M;  3SAS A;  3GLH A;  1KYI A;  2EKF A;  5H37 D;  4L8R C;  3VK8 A;  4KO8 A;  4QOS A;  2KNZ A;  4L6V 6;  4G4O A;  4M0W A;  2LH0 A;  3KDS E;  2VQE M;  3M6A A;  2LBC A;  1OAO C;  2M60 A;  1OFI A;  2GQF A;  1WHC A;  3J7A S;  3AJI B;  1XXH B;  1N77 A;  4D80 A;  2YR0 A;  1IQP A;  3LQQ A;  5BR8 M;  4JI4 M;  2R45 A;  4FWG A;  2HAK A;  3QWL A;  3UJN A;  2QNJ A;  5LMU M;  1K3W A;  2HCB A;  3RGP A;  1ZQ9 A;  4CGY B;  4GMQ A;  1IM2 A;  4B3T M;  5EP2 A;  3U6S A;  2CHQ A;  1UFZ A;  2DVW B;  3IEC A;  4RF0 A;  3U6D A;  2ZTD A;  4NOO B;  3GPP A;  1CUK A;  4QHS A;  1J09 A;  1ZMU A;  4LF5 M;  3HJ8 A;  1E9S A;  1YSY A;  4G4R A;  2VF8 A;  5KQD A;  1MX0 A;  3HZJ A;  3I4V A;  4OVZ A;  3ZCB B;  4GIP A;  3KS8 A;  1XXH E;  4P16 A;  1IXZ A;  3GLG E;  3UK6 A;  2AHM A;  1ZAE A;  4TUW A;  4FD2 A;  3U61 B;  4FCT A;  4GRI A;  4LFB M;  1WR1 B;  4NL4 H;  4F1I A;  1T3T A;  3U60 B;  2F5O A;  3NBI A;  2Z7J A;  1DGH A;  4DBG B;  4HEO A;  2ZAN A;  2VQF M;  1I4W A;  1ORY B;  3FRI A;  2K6B A;  3J27 B;  3KSX A;  3GP1 A;  1XNR M;  1OQY A;  4GKJ M;  1N78 A;  2ZAO A;  4BLC A;  2UU9 M;  4X62 M;  3L26 A;  2QHO B;  1G41 A;  2DKL A;  3GLF A;  3E46 A;  4JI0 M;  2QSF X;  2MRO B;  1TF0 B;  1TH3 A;  2Z3X A;  4P17 A;  5JI3 E;  2CHV A;  3T15 A;  4RF1 A;  3GLG B;  3AFH A;  2OOB A;  2UXB M;  4JYA M;  4LJ6 A;  3T1H M;  4I8O A;  1X37 A;  3DFZ A;  1QZE A;  3PNY A;  4HL4 A;  1N34 M;  3FUX A;  3A98 B;  3HJQ A;  1P3Q Q;  2G8L A;  1IFY A;  1W5S A;  2JY5 A;  2KW0 A;  3B7Q A;  4IJE A;  5KPT A;  1SXJ E;  4KHP M;  1G8P A;  2C96 A;  4IIW A;  3U6L A;  5F3W A;  1KSF X;  1MU5 A;  4JI3 M;  4LCB A;  3AOE C;  4FWH A;  2J7O A;  3SAU A;  1ZMV A;  4MB7 A;  2RGO A;  2JY8 A;  1IBK M;  3TQS A;  5L8R F;  1L1Z A;  1IY2 A;  1VEK A;  2O5R A;  4DV6 M;  2F4V M;  4Y28 F;  1TTE A;  2XZU A;  1NNJ A;  4LJ5 A;  1WIV A;  3JAM S;  4B3M M;  5KO3 A;  1R2Y A;  2Q2E B;  3KOW E;  4OX9 M;  3L25 A;  2HHH M;  1IXS A;  2FE8 A;  2QPA A;  3SC3 A;  3AL0 C;  3IG8 A;  2R18 A;  2CHG A;  3ZQJ A;  4AQY M;  2DI0 A;  1Q3C A;  2CRU A;  2ZAM A;  4NXN M;  3HHY A;  5KQ8 A;  3D8L A;  1S3S A;  3TPZ A;  4LF7 M;  1IN5 A;  4Q7J A;  4DV2 M;  3U6O A;  2I7N A;  4FW9 A;  3ILK A;  5EXP A;  3GPY A;  4JI2 M;  1NO1 A;  1TDZ A;  3GRU A;  3IG5 A;  1JQJ C;  1HJP A;  3A46 A;  2D7G A;  2RKO A;  4M9Z A;  5ITX A;  2DZN B;  4KLN A;  1GL7 A;  1N32 M;  3FTF A;  1E94 E;  3VKG A;  1HNZ M;  2WSE F;  2OQ4 A;  1PM5 A;  3MHV C;  2UXD M;  1QZM A;  4I4L A;  2N35 A;  4BB9 A;  1PJI A;  1E9R A;  3TE6 A;  3MMP A;  2RGH A;  1OJL A;  1GL6 A;  3KOY E;  3KP0 E;  3RE8 A;  4WUR A;  4EIW A;  5ITR A;  1JR3 A;  2XZF A;  5BPV A;  4D82 A;  3GPX A;  3LVV A;  3FKE A;  2XF3 A;  3HX3 A;  3C3E A;  5C18 A;  5IWA M;  3LQR A;  4DV7 M;  4NSO B;  1IN4 A;  4LF4 M;  1IN8 A;  2R6F A;  3J2P B;  1QAQ A;  3CF6 E;  3FTC A;  1E32 A;  1V34 A;  3SAV A;  4MGI E;  1D0K A;  3TL4 X;  3FYC A;  4B08 A;  4GKK M;  1XB2 B;  3HU2 A;  2B3T A;  2H5X A;  2FH0 A;  1IN7 A;  2XGN A;  3FUV A;  4GEW A;  2CE7 A;  3NWL A;  2Y0T A;  3CF0 A;  1JR3 E;  4DR1 M;  5DYI A;  3IHP A;  2LHG A;  3KS4 A;  2YQZ A;  1XC8 A;  2XSZ A;  1AIP C;  2Y21 A;  3K9O A;  4II7 A;  4JI7 M;  1EIJ A;  1HQY E;  3A45 A;  4IBB A;  4FCW A;  4L16 A;  4CIZ A;  1OFH A;  2DAM A;  4LF8 M;  1QUS A;  2DAI A;  1G71 A;  4FWD A;  4IBC A;  4MGZ E;  4AZF A;  2KEB A;  2Z8Y M;  3Q8X A;  2LVQ D;  3EIH A;  3K1J A;  2BWE A;  1R6B X;  5EP4 A;  1TR8 A;  3THG A;  1QAM A;  1PGY A;  2LWX A;  1Z5B A;  3DZD A;  1HT1 E;  4IBF A;  4LRS A;  4UN2 B;  1R4G A;  2LVP C;  4DUY M;  4R7G A;  2KXE A;  2P5T A;  4IBG A;  2BJW A;  3KOX E;  1GKI A;  5EXX A;  3B7N A;  4KT0 F;  4PDI A;  3AOE A;  1L8Q A;  3CTW B;  3SAT A;  1C1K A;  2DWL A;  1G4A E;  2J7N A;  4GH9 A;  3VKH A;  1QDT A;  2KZS A;  3BOS A;  1XMQ M;  3GRY A;  4FCV A;  4OU7 A;  4DV3 M;  3M0E A;  3J81 S;  2Z4S A;  1TGU A;  3FE3 A;  4X66 M;  3HKP A;  1QYR A;  2R65 A;  3W68 A;  5LMN M;  5FLX S;  1WXQ A;  3W0F A;  3K9P A;  4I5S A;  2Z4R A;  4W5W A;  3H4J A;  1D2N A;  2DZO B;  3GLI A;  4CIS A;  3HHW A;  1ZV1 A;  2DHR A;  1N36 M;  4XK8 F;  3QAU A;  1K82 A;  3KW6 A;  2JP7 A;  1XHB A;  2QZ4 A;  1NSF A;  1Z5C A;  1LTM A;  2R0I A;  4AKG A;  3SAW A;  4AI6 A;  2E5L M;  2QBY B;  1TH2 A;  1YE9 A;  3BBZ A;  4Z6Y A;  1JB0 F;  1J5E M;  1NV8 A;  3BXW A;  3MJ5 A;  4F2L A;  3UMM A;  4PT5 A;  3HU1 A;  4PD2 A;  2R44 A;  1DGF A;  3KSJ A;  2KA6 B;  1C7Y A;  2LHC A;  4X65 M;  1IY1 A;  1D0M A;  2X4A A;  3KP1 E;  3V76 A;  5C1B A;  1EFU B;  5FTK A;  4REZ A;  4QNM A;  4R71 A;  3LMM A;  4DR4 M;  5E6J A;  1MJG M;  4IBJ A;  4NC6 A;  2DWN A;  2EA0 A;  4GHA A;  2HL7 A;  4ITQ A;  1XXH A;  4CHT B;  4AKH A;  1Y8G A;  2F5N A;  2KRK A;  4A3V B;  2OO9 A;  2FOI C;  3M7G A;  1W5T A;  3C3D A;  1BVS A;  1VEJ A;  4RNA A;  1LV7 A;  1OAI A;  2RRU A;  2ERC A;  3C9P A;  2JA2 A;  3H4M A;  4I81 A;  2K47 A;  3GLH B;  2CEA A;  1XNQ M;  2EUC A;  4R3D A;  3HY5 A;  2DWM A;  2X8A A;  3U6P A;  1DGB A;  2KDL A;  5DFL A;  4YHH M;  3J7B A;  2CV1 A;  1PJT A;  2LVA A;  3SAR A;  4GHL A;  2WZJ A;  1VQ1 A;  2BNK A;  2JZ1 A;  2CV2 A;  3JR4 A;  2C9C A;  4OVZ B;  4LGY A;  2APL A;  4LF9 M;  4LF6 M;  4IBE A;  3VFD A;  3FYD A;  5KPR A;  1R7R A;  2JUJ A;  3TWL A;  2FS1 A;  2UUA M;  4B3S M;  1FJG M;  2V6Z M;  4WW0 A;  4JI8 M;  1DV0 A;  5ITX E;  2O01 F;  4PDG A;  4G4Q A;  1NJF A;  1OKS A;  1QDR A;  3T6P A;  3VDU A;  3U60 A;  4DR6 M;  4MM3 B;  3GLH E;  2XH9 A;  1G3I A;  4LY6 A;  1PJJ A;  3HJS A;  3QYE A;  2F5P A;  2UUC M;  5ITQ A;  2H1R A;  3U6E A;  2L4E A;  2ZTC A;  1MN3 A;  3HGI A;  1SXJ D;  5EP1 A;  5FSW A;  4CJ6 A;  1HNX M;  2UXC M;  1N33 M;  1YLA A;  3E9S A;  3KVW A;  3DA1 A;  3GQ4 A;  3U6Q A;  4B7G A;  3LVW A;  1L2C A;  4DR7 M;  2LNH C;  2QBY A;  2L6O A;  1I94 M;  5E26 A;  1Z6T A;  3WHK A;  3U61 A;  3K92 A;  5FTN A;  1DO2 A;  4NRW A;  3PXG A;  3U5Z B;  5A2Q S;  3E4R A;  2VDB B;  2LTU A;  1NHW C;  1F4I A;  3D8B A;  1Z59 A;  1GO5 A;  2QCU A;  5IZ7 D;  4M0D A;  2XFT A;  4LJ9 A;  4GC9 A;  4LFC M;  2Y0Q A;  2LXE A;  2YNM D;  1AUA A;  1WJ7 A;  4NRV A;  1NHG C;  4B7F A;  2DZL A;  4M9S A;  2C5R A;  2G5G X;  1V92 A;  2KNA A;  3F92 A;  4ANR A;  3R9X B;  4MGH A;  3T38 A;  5DNY A;  1A5T A;  3AKZ A;  2C9O A;  1SXJ A;  2JXN A;  4LJ7 A;  3OTO M;  2KNV A;  3E21 A;  1VDD A;  3J80 S;  1HNW M;  2MH8 A;  1GJT A;  2FNA A;  1G59 A;  2F5S A;  3TWK A;  4LRT A;  2KZU A;  2JY7 A;  2JNH A;  3GRV A;  2OPF A;  1IN6 A;  1L1T A;  3VK7 A;  3AOG A;  2MR9 A;  4IBD A;  2V1U A;  2CP8 A;  3FUT A;  2A5Y B;  5FTM A;  2ZBK B;  5EJC A;  1HR0 M;  5EXS A;  2L7H A;  2CV0 A;  4IJF A;  2DHY A;  3LCV B;  4GIT A;  4B3R M;  4G4N A;  4DR5 M;  3W0L B;  4ZPX A;  4QOZ C;  1Z5A A;  3I4Y A;  2VII A;  3GRR A;  3SFZ A;  2GNO A;  4MGK E;  3K8Z A;  3SMP A;  4LZJ A;  3W67 A;  1VDL A;  4YY3 M;  1TDH A;  3DOA A;  3HWS A;  4JXJ A;  2V1C A;  3SHF A;  3I01 M;  3JR5 A;  3A42 A;  1IBL M;  1IXS B;  1SG9 A;  2L4F A;  4M9X A;  2L2D A;  3GLI B;  4DV1 M;  3L27 A;  4HLQ A;  2EJS A;  2YFQ A;  3LCU A;  1T43 A;  2XEP A;  2O25 A;  3VLF B;  2HKJ A;  3GPU A;  3T1Y M;  1FNN A;  4DV0 M;  3PFI A;  4QNR A;  3U5Z A;  4JV5 M;  3PNV A;  2QQ8 A;  3GQ5 A;  4AG6 A;  2MGW A;  4S12 A;  2Y20 A;  4JN6 A;  3SYK A;  5EQT A;  3FUW A;  4DR2 M;  3SBJ A;  2EKK A;  2R4J A;  3L2A A;  2R46 A;  3HU3 A;  1IXR C;  1R2Z A;  4FVM A;  2WSF F;  2R4E A;  4DV5 M;  5KPZ A;  1YUB A;  4NSR A;  3UGJ A;  4BBA A;  1NVM A;  3UZU A;  2JZ0 A;  2QP9 X;  3GLF E;  1NV9 A;  3EIE A;  4IBI A;  4JI6 M;  2JWS A;  2DAK A;  1GAB A;  5ITU A;  2CWB A;  3B74 A;  2D7E A;  5FTL A;  2UUB M;  1GJS A;  2BWB A;  2W82 A;  1SXJ C;  4JI1 M;  1HQC A;  1PJQ A;  3C58 A;  3U6C A;  3I51 A;  1OIP A;  3MK6 A;  4LG2 A;  4LJ8 A;  1H6U A;  4AKI A;  3VDP A;  1QVR A;  5ITY A;  2FFJ A;  2OOA A;  1RU3 A;  1GVN A;  2LVN C;  3B89 A;  3FTD A;  1DO0 A;  3GLG A;  1KFV A;  3FTE A;  3ZH9 B;  5EXT A;  4LJA A;  2DNA A;  2DXI A;  1Q3B A;  2XSZ D; 
#chains in the Genus database with same CATH homology
 1QAO A;  4QHT A;  3TWM A;  3SMS A;  2KRU A;  3AV0 A;  2QEN A;  2CFO A;  2EO2 A;  1TH4 A;  3FUU A;  4X64 M;  2ZM6 M;  3ZC7 B;  4K0K M;  3FD9 A;  4G6Z A;  2L09 A;  1UM8 A;  2M5Z A;  1IBM M;  1J7K A;  3CF2 A;  4KOD A;  4LZZ A;  3HHZ A;  5ITT A;  1IY0 A;  4DUZ M;  2X49 A;  4NXM M;  1HT2 E;  5IT9 S;  2XLJ A;  7CAT A;  4AW4 A;  1NY5 A;  2BJV A;  1JR3 D;  4Z8X A;  2F5Q A;  2XFS A;  5DYG A;  2L7I A;  4IBK A;  2DWZ B;  4XBO A;  3SHG B;  3KFU G;  4B7H A;  1XWI A;  4OW0 A;  4L78 A;  2C99 A;  3PVS A;  4JI5 M;  3B9P A;  5JI2 E;  4D81 A;  1GLN A;  3U6M A;  5EP3 A;  1NNU C;  4DR3 M;  4GC5 A;  1L2B A;  3KOZ E;  4MH0 E;  4L15 A;  1N75 A;  4LJ4 A;  3L28 A;  1DGG A;  3GO8 A;  2NQ8 C;  3WHL A;  1QQW A;  3RGS A;  3SYL A;  4MGY E;  2C98 A;  3L29 A;  3R8F A;  1DGH B;  2D7H A;  8CAT A;  2I7P A;  3HHX A;  5IRE B;  1K3X A;  1L2D A;  5FTJ A;  3K2L A;  2R62 A;  5GKN A;  4PCZ A;  4L4U A;  1Q39 A;  3GLF B;  1QAN A;  1SXJ B;  1XMO M;  1EE8 A;  3RFW A;  2CUZ A;  3GQ3 A;  4LFA M;  3KXE C;  1NJG A;  1NY6 A;  4AG5 A;  4LGM A;  4XGI A;  4DV4 M;  3SAS A;  3GLH A;  1KYI A;  5H37 D;  4L8R C;  3VK8 A;  4KO8 A;  4QOS A;  4G4O A;  4M0W A;  2LH0 A;  3KDS E;  2VQE M;  3M6A A;  2M60 A;  1OFI A;  3J7A S;  3AJI B;  1XXH B;  1N77 A;  4D80 A;  2YR0 A;  1IQP A;  3LQQ A;  5BR8 M;  4JI4 M;  2R45 A;  4FWG A;  3QWL A;  3UJN A;  5LMU M;  1K3W A;  2HCB A;  3RGP A;  1ZQ9 A;  4CGY B;  4GMQ A;  1IM2 A;  4B3T M;  5EP2 A;  3U6S A;  2CHQ A;  2DVW B;  4RF0 A;  3U6D A;  4NOO B;  3GPP A;  4QHS A;  1J09 A;  4LF5 M;  3HJ8 A;  1E9S A;  1YSY A;  4G4R A;  5KQD A;  1MX0 A;  3I4V A;  4OVZ A;  3ZCB B;  4GIP A;  3KS8 A;  4P16 A;  1IXZ A;  3UK6 A;  2AHM A;  1ZAE A;  4TUW A;  4FD2 A;  3U61 B;  4FCT A;  4GRI A;  4LFB M;  4NL4 H;  1T3T A;  3U60 B;  2F5O A;  3NBI A;  2Z7J A;  1DGH A;  2ZAN A;  2VQF M;  1I4W A;  1ORY B;  3J27 B;  3KSX A;  1XNR M;  3GP1 A;  1N78 A;  4GKJ M;  2ZAO A;  4BLC A;  2UU9 M;  4X62 M;  3L26 A;  1G41 A;  3GLF A;  4JI0 M;  1TH3 A;  2Z3X A;  5JI3 E;  2CHV A;  3T15 A;  4RF1 A;  3GLG B;  3AFH A;  2UXB M;  4JYA M;  4LJ6 A;  3T1H M;  4I8O A;  1X37 A;  3DFZ A;  3PNY A;  4HL4 A;  1N34 M;  3FUX A;  3A98 B;  3HJQ A;  2G8L A;  1W5S A;  2KW0 A;  4IJE A;  5KPT A;  1SXJ E;  1G8P A;  2C96 A;  4IIW A;  3U6L A;  5F3W A;  1KSF X;  1MU5 A;  4JI3 M;  4LCB A;  3AOE C;  4FWH A;  2J7O A;  3SAU A;  4MB7 A;  2RGO A;  1IBK M;  3TQS A;  1L1Z A;  1IY2 A;  2O5R A;  4DV6 M;  2F4V M;  2XZU A;  1NNJ A;  4LJ5 A;  3JAM S;  4B3M M;  5KO3 A;  1R2Y A;  2Q2E B;  3KOW E;  4OX9 M;  3L25 A;  2HHH M;  2FE8 A;  2QPA A;  3SC3 A;  3AL0 C;  3IG8 A;  2R18 A;  2CHG A;  4AQY M;  1Q3C A;  2ZAM A;  4NXN M;  3HHY A;  5KQ8 A;  3D8L A;  1S3S A;  3TPZ A;  4LF7 M;  1IN5 A;  4DV2 M;  3U6O A;  2I7N A;  4FW9 A;  3ILK A;  5EXP A;  3GPY A;  4JI2 M;  1TDZ A;  3GRU A;  3IG5 A;  1JQJ C;  3A46 A;  2D7G A;  2RKO A;  4M9Z A;  5ITX A;  2DZN B;  4KLN A;  1GL7 A;  1N32 M;  3FTF A;  1E94 E;  3VKG A;  1HNZ M;  2OQ4 A;  1PM5 A;  3MHV C;  2UXD M;  1QZM A;  4I4L A;  4BB9 A;  1PJI A;  1E9R A;  3TE6 A;  2RGH A;  1OJL A;  1GL6 A;  3KOY E;  3KP0 E;  3RE8 A;  4WUR A;  4EIW A;  5ITR A;  1JR3 A;  2XZF A;  5BPV A;  4D82 A;  3GPX A;  3LVV A;  3FKE A;  2XF3 A;  5C18 A;  5IWA M;  3LQR A;  4DV7 M;  4NSO B;  1IN4 A;  4LF4 M;  1IN8 A;  3J2P B;  1QAQ A;  3CF6 E;  3FTC A;  1E32 A;  3SAV A;  4MGI E;  3TL4 X;  3FYC A;  4B08 A;  4GKK M;  3HU2 A;  1IN7 A;  2XGN A;  3FUV A;  2CE7 A;  3NWL A;  2Y0T A;  3CF0 A;  4DR1 M;  5DYI A;  3KS4 A;  2YQZ A;  1XC8 A;  2XSZ A;  2Y21 A;  4II7 A;  4JI7 M;  1HQY E;  3A45 A;  4IBB A;  4FCW A;  4L16 A;  1OFH A;  4LF8 M;  4FWD A;  4IBC A;  4MGZ E;  4AZF A;  2KEB A;  3Q8X A;  3EIH A;  3K1J A;  3THG A;  1R6B X;  5EP4 A;  1QAM A;  2LWX A;  1Z5B A;  3DZD A;  1HT1 E;  4IBF A;  4LRS A;  4DUY M;  4R7G A;  2KXE A;  2P5T A;  4IBG A;  2BJW A;  3KOX E;  1GKI A;  5EXX A;  4PDI A;  3AOE A;  1L8Q A;  3CTW B;  3SAT A;  1C1K A;  2DWL A;  1G4A E;  2J7N A;  4GH9 A;  3VKH A;  3BOS A;  2KZS A;  1XMQ M;  3GRY A;  4FCV A;  4OU7 A;  4DV3 M;  3M0E A;  3J81 S;  2Z4S A;  1TGU A;  4X66 M;  3HKP A;  1QYR A;  2R65 A;  5LMN M;  5FLX S;  1WXQ A;  3W0F A;  4I5S A;  2Z4R A;  4W5W A;  1D2N A;  2DZO B;  3GLI A;  4CIS A;  3HHW A;  1N36 M;  2DHR A;  3QAU A;  1K82 A;  3KW6 A;  1XHB A;  2QZ4 A;  1NSF A;  1Z5C A;  4AKG A;  4AI6 A;  3SAW A;  2E5L M;  2QBY B;  1TH2 A;  1YE9 A;  4Z6Y A;  1J5E M;  3MJ5 A;  3UMM A;  4PT5 A;  3HU1 A;  4PD2 A;  1DGF A;  3KSJ A;  2KA6 B;  4X65 M;  1IY1 A;  3KP1 E;  2X4A A;  5C1B A;  5FTK A;  4REZ A;  4QNM A;  4DR4 M;  3LMM A;  5E6J A;  4IBJ A;  4GHA A;  2DWN A;  2EA0 A;  2HL7 A;  4ITQ A;  1XXH A;  4CHT B;  4AKH A;  2F5N A;  2KRK A;  4A3V B;  2FOI C;  3M7G A;  1W5T A;  4RNA A;  1LV7 A;  2ERC A;  2JA2 A;  3H4M A;  4I81 A;  2K47 A;  3GLH B;  2CEA A;  1XNQ M;  2EUC A;  4R3D A;  2DWM A;  2X8A A;  3U6P A;  1DGB A;  4YHH M;  2CV1 A;  3J7B A;  3SAR A;  4GHL A;  2BNK A;  2CV2 A;  3JR4 A;  2C9C A;  4OVZ B;  4LGY A;  4LF9 M;  4LF6 M;  4IBE A;  3VFD A;  3FYD A;  5KPR A;  1R7R A;  3TWL A;  2UUA M;  4B3S M;  1FJG M;  2V6Z M;  4WW0 A;  4JI8 M;  5ITX E;  4PDG A;  4G4Q A;  1NJF A;  3U60 A;  4DR6 M;  3VDU A;  4MM3 B;  1PJJ A;  2XH9 A;  1G3I A;  4LY6 A;  2UUC M;  3HJS A;  2F5P A;  4KHP M;  5ITQ A;  2H1R A;  3U6E A;  3HGI A;  2UXC M;  1SXJ D;  5EP1 A;  5FSW A;  1HNX M;  1N33 M;  3E9S A;  3KVW A;  3DA1 A;  3GQ4 A;  3U6Q A;  4B7G A;  3LVW A;  1L2C A;  4DR7 M;  2LNH C;  2QBY A;  2L6O A;  1I94 M;  5E26 A;  1Z6T A;  3WHK A;  3U61 A;  3K92 A;  5FTN A;  1DO2 A;  4NRW A;  3PXG A;  3U5Z B;  5A2Q S;  3E4R A;  1NHW C;  3D8B A;  1Z59 A;  2QCU A;  5IZ7 D;  4M0D A;  2XFT A;  4LJ9 A;  4GC9 A;  4LFC M;  2Y0Q A;  2LXE A;  2YNM D;  4NRV A;  4B7F A;  1NHG C;  4M9S A;  2C5R A;  2G5G X;  3R9X B;  4MGH A;  3T38 A;  5DNY A;  3AKZ A;  2C9O A;  1SXJ A;  4LJ7 A;  3OTO M;  1VDD A;  3J80 S;  1HNW M;  2FNA A;  1G59 A;  2F5S A;  3TWK A;  4LRT A;  2KZU A;  3GRV A;  2OPF A;  1IN6 A;  1L1T A;  3VK7 A;  3AOG A;  4IBD A;  2V1U A;  3FUT A;  2A5Y B;  5FTM A;  2ZBK B;  5EJC A;  1HR0 M;  5EXS A;  2L7H A;  2CV0 A;  4IJF A;  4GIT A;  4B3R M;  4G4N A;  4DR5 M;  3W0L B;  4ZPX A;  4QOZ C;  1Z5A A;  3I4Y A;  2VII A;  3GRR A;  3SFZ A;  4MGK E;  3K8Z A;  3SMP A;  4LZJ A;  4YY3 M;  1TDH A;  3DOA A;  3HWS A;  4JXJ A;  2V1C A;  3SHF A;  3JR5 A;  3A42 A;  1IBL M;  1IXS B;  4M9X A;  3GLI B;  4DV1 M;  3L27 A;  4HLQ A;  2YFQ A;  2XEP A;  3VLF B;  2HKJ A;  3GPU A;  3T1Y M;  1FNN A;  4DV0 M;  3PFI A;  4QNR A;  3U5Z A;  4JV5 M;  3PNV A;  3GQ5 A;  4AG6 A;  4S12 A;  2Y20 A;  4JN6 A;  3SYK A;  5EQT A;  3FUW A;  4DR2 M;  3SBJ A;  2R4J A;  3L2A A;  2R46 A;  3HU3 A;  1IXR C;  1R2Z A;  4FVM A;  2R4E A;  4DV5 M;  5KPZ A;  1YUB A;  4NSR A;  3UGJ A;  4BBA A;  1NVM A;  3UZU A;  2QP9 X;  3EIE A;  4IBI A;  4JI6 M;  5ITU A;  2D7E A;  5FTL A;  2UUB M;  2W82 A;  1SXJ C;  4JI1 M;  1HQC A;  3C58 A;  3U6C A;  3I51 A;  3MK6 A;  4LG2 A;  4LJ8 A;  1H6U A;  4AKI A;  3VDP A;  1QVR A;  5ITY A;  2FFJ A;  1GVN A;  3FTD A;  3GLG A;  1KFV A;  1DO0 A;  3FTE A;  3ZH9 B;  5EXT A;  4LJA A;  2DXI A;  1Q3B A;  2XSZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...