1I94M

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 21
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i94M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1i94M02
4X66M 4B3RM 4LFAM 2UXDM 4DUYM 3SAWA 1R2ZA 1K3XA 4G4NA 1TDHA 1IBLM 4DR2M 1XMOM 4DR1M 4DR7M 4LF8M 2HHHM 4JI3M 4OX9M 5A2QS 1K3WA 1HNZM 4GKJM 4YHHM 5FLXS 3T1HM 3VK8A 4YY3M 3T1YM 2E5LM 5ITQA 3DOAA 1EE8A 4DR5M 3JAMS 3GO8A 1XC8A 5IT9S 1Z59A 2OPFA 3GQ3A 4PD2A 3SARA 5IWAM 2UU9M 4LF7M 5ITYA 2F5SA 2F5PA 5LMUM 4LF5M 3GQ4A 3TWMA 4DV3M 1Z5BA 3U6CA 3SBJA 1L2BA 1Q3CA 1R2YA 4JI1M 4NRWA 1L2CA 2UUBM 4G4QA 1MU5A 2EA0A 3OTOM 4B3MM 2UXBM 3A45A 4DV7M 2F5OA 4B3TM 4G4RA 4G4OA 1N36M 2F5NA 1XNRM 4NXNM 1TDZA 3GQ5A 3SATA 4LFCM 1K82A 3U6OA 3U6LA 4DV2M 3JR4A 4JI2M 4KHPM 3J81S 3U6PA 1IBMM 3A46A 1L2DA 4JI5M 5ITXE 2ZM6M 3W0FA 5ITXA 2ZBKB 4AQYM 1HR0M 1PJIA 4DR3M 3J7AS 3J80S 1NNJA 1IBKM 3U6SA 4CISA 1Q3BA 4K0KM 5LMNM 1FJGM 4JV5M 2F4VM 4X64M 1HNWM 3U6MA 2OQ4A 4PDGA 1HNXM 4JI0M 4DV0M 1Z5AA 3GPPA 3GPYA 3JR5A 3U6DA 1N32M 5ITUA 2XZFA 3TWLA 1XMQM 3A42A 3GPXA 4MB7A 4JI7M 4DV4M 3SAUA 4DR4M 4PDIA 4B3SM 3GPUA 4DV6M 4X62M 1J5EM 1Q39A 4NXMM 3C58A 2UXCM 3GP1A 2F5QA 1N34M 2UUAM 5ITTA 5BR8M 1I94M 4JYAM 2HKJA 4X65M 4JI8M 4JI6M 2Q2EB 4LFBM 4DV5M 2VQEM 1XNQM 4GKKM 1KFVA 1PM5A 1L1ZA 1N33M 4NRVA 2UUCM 3SASA 3U6QA 4ITQA 4DUZM 4JI4M 4PCZA 4LF9M 3U6EA 3VK7A 1PJJA 4DV1M 1L1TA 1Z5CA 1MX0A 3TWKA 3SAVA 4DR6M 4LF4M 2XZUA 2VQFM 4LF6M 5ITRA
chains in the Genus database with same CATH superfamily
1LTMA 3R9XB 4LFAM 4I4LA 2CWBA 1ZMVA 3KOYE 1JB0F 2JA2A 3AKZA 1R2ZA 1KSFX 4QHTA 2R6FA 1IBLM 1TH2A 4DR1M 4LF8M 3VDPA 3Q8GA 1SXJC 2AHMA 2JY8A 3HU1A 3FTDA 2K9DA 1DGHA 3I51A 5JI3E 1GL7A 2KZSA 3GLHB 2Z4RA 3LVVA 2CHVA 2R4JA 2Y0TA 5A2QS 1K3WA 2C98A 2DHYA 4JXJA 2BNKA 2BJWA 3W0LB 1EIJA 1GLNA 3KSJA 1IN7A 3T1YM 3IHPA 2OO9A 1UM8A 1EE8A 4I8OA 1NY6A 3FUXA 2R46A 3FRHA 1ZQ9A 1IXRC 2XH9A 1C1KA 3L28A 2UU9M 5ITYA 2JWSA 4L4UA 4LF5M 1QZMA 2VDBB 2CE7A 1IY1A 3TWMA 1OAOC 4FVMA 1IQPA 4REZA 1NO1A 1S3SA 1Z5BA 3U6CA 3BBZA 4LG2A 1XXHE 4IIWA 3ZH9B 2J5YA 3FUTA 2C96A 4HL4A 3VDUA 4JI1M 1VG5A 1XHBA 2WSEF 3FYDA 2G3QA 2B3TA 3LQQA 2F5OA 3GLHA 4QOSA 3GLGA 2DWMA 4RNAA 1TDZA 2XFTA 3F92A 3KDSE 1WHCA 4GRIA 3GQ5A 2XZUA 2DWNA 3TL4X 5C18A 3Q8XA 3L26A 5E26A 4XK8F 3J81S 3U6PA 5JI2E 2HWJA 3RGSA 1L2DA 2ZM6M 1XXHB 1UFZA 2LTUA 1PJIA 3J7AS 1SXJD 1GABA 1R6BX 1Q02A 2VF8A 2LVNC 4WP2A 4MGHA 2CEAA 3IG8A 3RE8A 1NNUC 2JZ1A 4GC5A 2CFOA 3U6MA 2V1CA 3GRYA 2ZTCA 3HKPA 3U61A 1QANA 3K1JA 2OQ4A 1TTEA 4GMQA 3RGPA 3HJ8A 3B74A 4NL4H 1N32M 2LVOC 2RRUA 4M9XA 5ITUA 1XMQM 2LXEA 3A42A 1DO0A 1VEGA 2LBCA 3BXWA 3KOZE 3W68A 2DWZB 2X4AA 4KT0F 1VQ1A 5EXPA 4B3SM 3I01M 4LJ8A 3GPUA 4X62M 3C9PA 4XGIA 2LWXA 3R8FA 1SG9A 3U5ZB 1IM2A 2UUAM 3VKHA 4LCBA 1HJPA 4BB9A 1WR1B 2Z3XA 4X65M 2Y21A 3ILKA 1XWIA 1XNQM 4LJAA 1L1ZA 1N33M 2FNAA 4L15A 2JP7A 4F1IA 4NRVA 2UUCM 3SASA 1IN6A 5H37D 1MJGM 4D80A 4LF9M 1J7KA 4ZPXA 2ZTDA 3I4VA 4LJ7A 1HT1E 3HX3A 1OIPA 4DV1M 3ZQJA 1L1TA 1GVNA 2DWLA 1MX0A 3TWKA 4DR6M 1EFUB 2CHGA 2I7NA 3KXEC 1F4IA 4DBGB 2FE8A 2RGOA 4B3RM 2Z8YM 1FNNA 4FWDA 1K3XA 1E94E 1NSFA 2EKKA 2KDLA 2KNZA 3CTWB 2KW0A 3FTCA 4GC9A 4MGKE 5EP3A 1XMOM 4LJ5A 1IN4A 4HLQA 4DR7M 1OJLA 3PVSA 2H5XA 1GJSA 3M0EA 2KEBA 5KQ8A 2DAEA 1T3TA 3H4JA 3KP0E 1PRBA 3CF2A 3KS4A 3AOEA 1QDTA 3HJQA 3K2LA 2GNOA 1H6UA 4A3VB 1OAIA 1TR8A 1VEJA 1IN5A 2A5YB 1NV9A 4OW0A 4LZJA 4DR5M 3JAMS 4FWHA 2WZJA 3GLGB 2OPFA 1NHGC 4PD2A 5EXSA 3B7QA 5IREB 1WGLA 4B7HA 5L8RF 2R65A 2L7HA 2F5SA 2L2DA 3HHYA 4F2LA 4QOZC 3FKEA 3GQ4A 1N75A 2JXNA 4Z6YA 2XGNA 4D81A 2K0BX 5KPRA 4DV3M 3U60A 5FSWA 3ZCBB 2D7GA 3AOEC 3VFDA 2UXBM 1NY5A 5GKNA 1YE9A 2D7EA 3KSXA 4G4RA 5DNYA 1N36M 3I04M 4Z8XA 4MH0E 4NXNM 2GQFA 1QUSA 2V1UA 5DFLA 3EIEA 1K82A 2J7OA 3FRIA 3LCUA 4OU7A 2R62A 4AW4A 1QDRA 2MJ5B 3HY5A 4KHPM 1QAQA 2KXEA 2ZAMA 1L8QA 3FYCA 5ITXE 3C3DA 4AQYM 1GL6A 1HR0M 4GHLA 2MH8A 2YR0A 2K6BA 2XSZA 4AKHA 2KHHA 2JY5A 3J80S 4NOOB 2VIIA 2JNHA 1NNJA 3U6SA 1Q3BA 2NQ8C 1VDLA 4OVZB 1OFHA 1HNWM 5DYIA 4R71A 2FOIC 5FTKA 4BLCA 5EP4A 3GLHE 1LV7A 4FWGA 1HNXM 4JI0M 1YLAA 3B7NA 4QNRA 3PNYA 4DV0M 4FCVA 3PFIA 1OFIA 4OVZA 4JI7M 3SMSA 4LGMA 4NSRA 2QBYA 1IY0A 2G5GX 4RF1A 3SAUA 4R3DA 1T6OA 1V92A 2R45A 3LCVB 2BJVA 3GRUA 1J5EM 1NV8A 2LHCA 7CATA 2C99A 2DAGA 3J7BA 2APLA 4B08A 2DAMA 4MGIE 2CHQA 2HKJA 1P3QQ 4WURA 2KZUA 4EIWA 2M60A 4JI8M 2JUJA 1X37A 1HQYE 1QQWA 2OOBA 4IBEA 4L8RC 1CUKA 1GJTA 1Y8GA 1T43A 3A98B 1PJSA 5FTLA 3U6QA 5IZ7D 1DGHB 2QZ4A 4ITQA 1DV0A 3VK7A 4FCTA 2QP9X 1G59A 1PJJA 3M7GA 2HAKA 4I81A 1Z5CA 2KRUA 3L2AA 2DAKA 3MJ5A 3SC3A 3SAVA 3AJIB 3HU2A 2DKLA 2VQFM 1ZAEA 4KODA 4UN2B 4X66M 5ITRA 3SBJA 2I7PA 2O25A 2UXDM 3L29A 4DUYM 2DVWB 4G4NA 5KO3A 4DR2M 2QHOB 4MGZE 2YQZA 2RGHA 3TPZA 4JI3M 4CHTB 2DXIA 1IY2A 3GLFB 2YNMD 3V76A 1QVRA 4OX9M 1VEKA 3K9OA 4ANRA 2N35A 3K8ZA 2R0IA 3VK8A 3KOXE 4QHSA 3DOAA 3T15A 5IT9S 1XB2B 2JY6B 2XLJA 3GQ3A 1SXJA 4LZZA 3SFZA 2K47A 1IN8A 1WXQA 5IWAM 3U5ZA 4GEWA 4LF7M 1OKSA 1G4AE 1TH3A 1XXHA 4IBJA 4M0WA 2F5PA 1VDDA 1R5LA 3H4MA 2L7IA 3HU3A 3B7ZA 3RFWA 4L16A 1OIZA 1Q3CA 2QPAA 2DI0A 4L78A 1L2CA 3QYEA 2Z4SA 2CUZA 3M6AA 3GLIB 1MU5A 2XF3A 3D8LA 2L09A 3A45A 4IBCA 2WSFF 1MN3A 1G41A 3HWSA 4LRTA 3HHZA 4G4OA 1XNRM 3AV0A 3DFZA 3SATA 1JR3A 4JN6A 4LFCM 2W82A 4GITA 5C1BA 3T38A 1E9RA 4MGYE 3C3EA 4P17A 1IBMM 4I5SA 3A46A 4RKUF 2V6ZM 2EKFA 3NWLA 3KW6A 1W5TA 1GO5A 3WHKA 2ZBKB 3KS8A 1V34A 4KLNA 1PJQA 2WSCF 4AG5A 4LY6A 1IBKM 4CIZA 1SXJB 3PXGA 1SXJE 4CISA 5EJCA 4IBKA 5LMNM 1D0KA 1TGUA 1FJGM 3DZDA 3HHWA 1DGFA 2Y0QA 1HQCA 2OOAA 3K9PA 2R44A 3BOSA 2H1RA 4IJFA 4PDGA 1D0LA 5E6JA 3UJNA 3GPYA 1QAOA 1Z6TA 2DENA 3U6DA 4NC6A 3KOWE 2XZFA 1E9SA 4TUWA 4IBIA 1TH4A 3GPXA 1J09A 3HZJA 4LJ6A 4KO8A 3SHGB 3FD9A 4AKGA 3QAUA 2FS1A 3TQSA 3IECA 2X49A 3CF6E 1QUTA 2QSFX 4RF0A 2FFJA 3FUVA 5KQDA 2LVPC 1OQYA 1DO2A 2P5TA 2LH0A 4IBGA 4DV6M 4NXMM 4LGYA 2QENA 4CGYB 4BBAA 1G8PA 2Z7JA 1N34M 1QAMA 1PGYA 5BR8M 1I94M 5EP2A 1R4GA 2CV1A 2RKOA 1GKIA 2Q2EB 3FUWA 3HHXA 3NBXX 5KPTA 4LFBM 2VF7A 3CF0A 3FUUA 1KFVA 1PM5A 3WHLA 1ORYB 5DYGA 2ZANA 1D2NA 3L25A 3PNVA 3IG5A 1JR3E 4M0DA 4PCZA 3GLIA 3B9PA 4DUZM 4P16A 2KNAA 2L6OA 4WW0A 3GLGE 3UZUA 1ZMWA 1DGGA 3MMPA 3T6PA 3AL0C 4NSOB 4LF4M 1I4WA 3E9SA 1QYRA 2HL7A 2QNJA 2DZOB 1V33A 5FTNA 1HT2E 3L27A 4D82A 1AUAA 2DHRA 3SAWA 1YSYA 2J7NA 2Y20A 3GLFE 3U60B 1TDHA 3B89A 4AI6A 2D7HA 3MK6A 3LQRA 2YFQA 3KFUG 2HHHM 4B7FA 3I4YA 3UK6A 3GLIE 3UMMA 4LRSA 1HNZM 2QQ8A 4FW9A 2R4EA 5FTMA 3VKGA 2KNVA 1G3IA 4GKJM 4YHHM 5FLXS 2C5RA 3T1HM 2QCUA 4YY3M 2E5LM 2EJSA 3FTEA 5ITQA 4M9SA 4XBOA 4IBFA 1C7YA 1XC8A 3GO8A 2LVAA 4M9ZA 3HGIA 1Z59A 2R18A 1W5SA 3QWLA 3SARA 1YUBA 1IXSA 4QNMA 2BWBA 5LMUM 2CP8A 4IJEA 3E4RA 4FCWA 3LVWA 1ZMUA 1L2BA 1NJFA 3ZC7B 1JR3D 1R2YA 1RU3A 4NRWA 4CJ6A 2XEPA 3W67A 2UUBM 4G4QA 1IXSB 2EA0A 3OTOM 4B3MM 3CGWA 8CATA 4DV7M 4B3TM 3DA1A 2F5NA 2X8AA 2C9CA 2KRKA 3GRVA 1E32A 3E46A 2O5RA 5BPVA 3U6OA 3U6LA 3AOGA 2ERCA 1WJ7A 3JR4A 4DV2M 1TF0B 3U61B 4JI2M 3K92A 1NHWC 2DNAA 2MR9A 3E21A 2JY7A 4Q7JA 3MHVC 4JI5M 4LJ9A 5FTJA 1BVSA 3W0FA 5ITXA 2DZLA 4PT5A 4DR3M 1IXZA 1N77A 2LHGA 1WIVA 5EP1A 1D0MA 1KYIA 2CV2A 2G8LA 1WGNA 2M5ZA 4AZFA 4K0KM 4JV5M 5EXTA 5F3WA 2F4VM 4X64M 2QBYB 3GRRA 4S12A 3TE6A 1QZEA 3KVWA 4G3OA 3SYLA 4GHAA 4L6V6 3GPPA 1Z5AA 3JR5A 3EIHA 4HEOA 3LW5F 4R7GA 3HJSA 1AIPC 1A5TA 4MM3B 3TWLA 3FTFA 1R7RA 4MB7A 2BWEA 1ZV1A 1DGBA 4DV4M 3AFHA 4DR4M 4FD2A 4PDIA 2EUCA 3D8BA 2UXCM 1Q39A 3C58A 2C9OA 1PJTA 3QYBA 3GP1A 4LJ4A 2F5QA 2LNHC 5EXXA 1NJGA 3J2PB 5ITTA 3J27B 1OTRA 4JYAM 2O01F 2FH0A 2LVQD 5KPZA 3SYKA 4JI6M 1N78A 4IBDA 4II7A 2XSZD 3UGJA 4DV5M 1G71A 2MGWA 2EO2A 4IBBA 1JQJC 2VQEM 3THGA 2CRUA 2JZ0A 3SMPA 4G6ZA 4GKKM 3KP1E 2XFSA 3VLFB 2MROB 4AG6A 2KA6B 2HCBA 4AKIA 2DAIA 5EQTA 4GIPA 4JI4M 4W5WA 2CV0A 3FE3A 3SHFA 2DZNB 4Y28F 3U6EA 1IFYA 2L4FA 4GH9A 3NBIA 3LMMA 2ZAOA 3GLFA 1NVMA 4LF6M 4B7GA 2L4EA
chains in the Genus database with same CATH topology
3R9XB 4LFAM 4I4LA 1R2ZA 3KOYE 2JA2A 3AKZA 1KSFX 4QHTA 1IBLM 1TH2A 4DR1M 4LF8M 3VDPA 1SXJC 2AHMA 3HU1A 3FTDA 1DGHA 3I51A 5JI3E 1GL7A 2KZSA 3GLHB 2Z4RA 3LVVA 2CHVA 2R4JA 2Y0TA 5A2QS 1K3WA 2C98A 4JXJA 2BNKA 2BJWA 3W0LB 1GLNA 3KSJA 1IN7A 3T1YM 1UM8A 1EE8A 4I8OA 1NY6A 3FUXA 2R46A 1ZQ9A 1IXRC 2XH9A 1C1KA 3L28A 2UU9M 5ITYA 4L4UA 4LF5M 1QZMA 2CE7A 1IY1A 3TWMA 4FVMA 1IQPA 4REZA 1S3SA 1Z5BA 3U6CA 4LG2A 4IIWA 3ZH9B 3FUTA 4JI1M 2C96A 4HL4A 3VDUA 1XHBA 3FYDA 3LQQA 2F5OA 3GLHA 4QOSA 3GLGA 2DWMA 4RNAA 1TDZA 2XFTA 3KDSE 3GQ5A 2XZUA 4GRIA 2DWNA 3TL4X 5C18A 3Q8XA 3L26A 5E26A 3J81S 3U6PA 5JI2E 3RGSA 1L2DA 2ZM6M 1XXHB 1PJIA 3J7AS 1SXJD 1R6BX 4MGHA 2CEAA 3IG8A 3RE8A 1NNUC 4GC5A 2CFOA 3U6MA 2V1CA 3GRYA 3HKPA 3U61A 1QANA 3K1JA 2OQ4A 4GMQA 3RGPA 3HJ8A 4NL4H 1N32M 4M9XA 5ITUA 1XMQM 2LXEA 3A42A 1DO0A 3KOZE 2DWZB 2X4AA 5EXPA 4B3SM 4LJ8A 3GPUA 4X62M 4XGIA 2LWXA 3R8FA 3U5ZB 1IM2A 2UUAM 3VKHA 4LCBA 4BB9A 2Z3XA 4X65M 2Y21A 3ILKA 1XWIA 1XNQM 4LJAA 1L1ZA 1N33M 2FNAA 4L15A 4NRVA 2UUCM 3SASA 1IN6A 5H37D 4D80A 4LF9M 1J7KA 4ZPXA 3I4VA 4LJ7A 1HT1E 4DV1M 1L1TA 2DWLA 1GVNA 1MX0A 3TWKA 4DR6M 2CHGA 2I7NA 3KXEC 2FE8A 2RGOA 4B3RM 1FNNA 4FWDA 1K3XA 1E94E 1NSFA 3CTWB 3FTCA 4MGKE 5EP3A 2KW0A 4GC9A 1XMOM 4DR7M 4LJ5A 1IN4A 4HLQA 1OJLA 3PVSA 3M0EA 2KEBA 5KQ8A 1T3TA 3KP0E 3CF2A 3KS4A 3AOEA 3HJQA 3K2LA 4A3VB 1H6UA 1IN5A 2A5YB 4OW0A 4LZJA 4DR5M 3JAMS 4FWHA 3GLGB 2OPFA 1NHGC 4PD2A 5EXSA 5IREB 4B7HA 2R65A 2L7HA 2F5SA 3HHYA 4QOZC 3FKEA 3GQ4A 1N75A 4Z6YA 2XGNA 4D81A 5KPRA 4DV3M 3U60A 5FSWA 3ZCBB 2D7GA 3AOEC 3VFDA 2UXBM 1NY5A 5GKNA 1YE9A 2D7EA 3KSXA 4G4RA 5DNYA 1N36M 4Z8XA 4MH0E 4NXNM 2V1UA 3EIEA 1K82A 2J7OA 4OU7A 2R62A 4AW4A 4KHPM 1QAQA 2KXEA 2ZAMA 1L8QA 3FYCA 5ITXE 4AQYM 1GL6A 1HR0M 4GHLA 2YR0A 2XSZA 4AKHA 3J80S 4NOOB 2VIIA 1NNJA 3U6SA 1Q3BA 2NQ8C 4OVZB 1OFHA 1HNWM 5DYIA 2FOIC 5FTKA 4BLCA 5EP4A 1LV7A 4FWGA 1HNXM 4JI0M 4DV0M 4QNRA 3PNYA 4FCVA 3PFIA 1OFIA 4OVZA 4JI7M 3SMSA 4LGMA 4NSRA 2QBYA 1IY0A 2G5GX 4RF1A 3SAUA 4R3DA 2R45A 2BJVA 3GRUA 1J5EM 7CATA 2C99A 3J7BA 4B08A 4MGIE 2CHQA 2HKJA 4WURA 2KZUA 4EIWA 2M60A 4JI8M 1X37A 1HQYE 1QQWA 4IBEA 4L8RC 3A98B 5FTLA 3U6QA 5IZ7D 1DGHB 2QZ4A 4ITQA 3VK7A 4FCTA 2QP9X 1G59A 1PJJA 3M7GA 4I81A 1Z5CA 2KRUA 3L2AA 3MJ5A 3SC3A 3SAVA 3AJIB 3HU2A 2VQFM 1ZAEA 4KODA 5ITRA 4X66M 3SBJA 2I7PA 2UXDM 3L29A 4DUYM 2DVWB 4G4NA 5KO3A 4DR2M 4MGZE 2YQZA 2RGHA 3TPZA 4JI3M 4CHTB 2DXIA 1IY2A 3GLFB 2YNMD 1QVRA 4OX9M 3K8ZA 3VK8A 3KOXE 4QHSA 3DOAA 3T15A 5IT9S 2XLJA 3GQ3A 1SXJA 4LZZA 3SFZA 2K47A 1IN8A 1WXQA 5IWAM 3U5ZA 4LF7M 1XXHA 1G4AE 1TH3A 4IBJA 4M0WA 2F5PA 1VDDA 3H4MA 3HU3A 2L7IA 3RFWA 4L16A 1Q3CA 2QPAA 4L78A 1L2CA 2Z4SA 2CUZA 3M6AA 3GLIB 1MU5A 2XF3A 3D8LA 2L09A 3A45A 4IBCA 4LRTA 3HWSA 1G41A 3HHZA 4G4OA 1XNRM 3AV0A 3DFZA 3SATA 1JR3A 4JN6A 4LFCM 2W82A 4GITA 5C1BA 3T38A 1E9RA 4MGYE 1IBMM 4I5SA 3A46A 2V6ZM 3NWLA 3KW6A 1W5TA 3WHKA 2ZBKB 3KS8A 4KLNA 4AG5A 4LY6A 1IBKM 1SXJB 3PXGA 1SXJE 4CISA 5EJCA 4IBKA 5LMNM 1TGUA 1FJGM 3DZDA 3HHWA 1DGFA 2Y0QA 1HQCA 3BOSA 2H1RA 4IJFA 4PDGA 5E6JA 3UJNA 3GPYA 1QAOA 1Z6TA 3U6DA 3KOWE 2XZFA 1E9SA 4TUWA 4IBIA 1TH4A 3GPXA 1J09A 4LJ6A 4KO8A 3SHGB 3FD9A 4AKGA 3QAUA 3TQSA 2X49A 3CF6E 4RF0A 2FFJA 3FUVA 5KQDA 1DO2A 2LH0A 2P5TA 4IBGA 4DV6M 4NXMM 4LGYA 2QENA 4CGYB 4BBAA 1G8PA 2Z7JA 1N34M 1QAMA 5BR8M 1I94M 5EP2A 2CV1A 2RKOA 1GKIA 2Q2EB 3FUWA 3HHXA 5KPTA 4LFBM 3CF0A 3FUUA 1KFVA 1PM5A 3WHLA 1ORYB 5DYGA 2ZANA 1D2NA 3L25A 3PNVA 3IG5A 3GLIA 4M0DA 4PCZA 4DUZM 3B9PA 4P16A 2L6OA 4WW0A 3UZUA 1DGGA 3AL0C 4NSOB 4LF4M 1I4WA 3E9SA 1QYRA 2HL7A 2DZOB 5FTNA 1HT2E 3L27A 4D82A 2DHRA 3SAWA 1YSYA 2J7NA 2Y20A 3U60B 1TDHA 4AI6A 2D7HA 3MK6A 3LQRA 2YFQA 3KFUG 2HHHM 4B7FA 3I4YA 3UK6A 3UMMA 4LRSA 1HNZM 4FW9A 2R4EA 5FTMA 3VKGA 1G3IA 4GKJM 4YHHM 5FLXS 2C5RA 3T1HM 2QCUA 4YY3M 2E5LM 3FTEA 5ITQA 4M9SA 4XBOA 4IBFA 1XC8A 3GO8A 4M9ZA 3HGIA 1Z59A 2R18A 1W5SA 3QWLA 3SARA 1YUBA 4QNMA 5LMUM 4IJEA 3E4RA 4FCWA 3LVWA 1L2BA 1NJFA 3ZC7B 1JR3D 1R2YA 4NRWA 2XEPA 2UUBM 4G4QA 1IXSB 2EA0A 3OTOM 4B3MM 8CATA 4DV7M 4B3TM 3DA1A 2F5NA 2X8AA 2C9CA 2KRKA 3GRVA 1E32A 2O5RA 5BPVA 3U6OA 3U6LA 3AOGA 2ERCA 4DV2M 3JR4A 3U61B 4JI2M 3K92A 1NHWC 3MHVC 4JI5M 4LJ9A 5FTJA 3W0FA 5ITXA 4PT5A 4DR3M 1IXZA 1N77A 5EP1A 1KYIA 2CV2A 2G8LA 2M5ZA 4AZFA 4K0KM 4JV5M 5EXTA 5F3WA 2F4VM 4X64M 2QBYB 3GRRA 4S12A 3TE6A 3KVWA 3SYLA 4GHAA 3GPPA 1Z5AA 3JR5A 3EIHA 4R7GA 3HJSA 3TWLA 4MM3B 3FTFA 1R7RA 4MB7A 1DGBA 4DV4M 3AFHA 4DR4M 4FD2A 4PDIA 2EUCA 3D8BA 2UXCM 1Q39A 3C58A 2C9OA 3GP1A 4LJ4A 2F5QA 2LNHC 5EXXA 1NJGA 3J2PB 5ITTA 3J27B 4JYAM 5KPZA 3SYKA 4JI6M 1N78A 4IBDA 4II7A 2XSZD 3UGJA 4DV5M 2VQEM 2EO2A 4IBBA 1JQJC 4GKKM 3THGA 3SMPA 4G6ZA 3KP1E 2XFSA 3VLFB 4AG6A 2KA6B 2HCBA 4AKIA 5EQTA 4GIPA 4JI4M 4W5WA 2CV0A 3SHFA 3U6EA 2DZNB 4GH9A 3NBIA 3LMMA 2ZAOA 3GLFA 1NVMA 4B7GA 4LF6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 M;  4B3R M;  4LFA M;  2UXD M;  4DUY M;  3SAW A;  1R2Z A;  1K3X A;  4G4N A;  1TDH A;  1IBL M;  4DR2 M;  1XMO M;  4DR1 M;  4DR7 M;  4LF8 M;  2HHH M;  4JI3 M;  4OX9 M;  5A2Q S;  1K3W A;  1HNZ M;  4GKJ M;  4YHH M;  5FLX S;  3T1H M;  3VK8 A;  4YY3 M;  3T1Y M;  2E5L M;  5ITQ A;  3DOA A;  1EE8 A;  4DR5 M;  3JAM S;  3GO8 A;  1XC8 A;  5IT9 S;  1Z59 A;  2OPF A;  3GQ3 A;  4PD2 A;  3SAR A;  5IWA M;  2UU9 M;  4LF7 M;  5ITY A;  2F5S A;  2F5P A;  5LMU M;  4LF5 M;  3GQ4 A;  3TWM A;  4DV3 M;  1Z5B A;  3U6C A;  3SBJ A;  1L2B A;  1Q3C A;  1R2Y A;  4JI1 M;  4NRW A;  1L2C A;  2UUB M;  4G4Q A;  1MU5 A;  2EA0 A;  3OTO M;  4B3M M;  2UXB M;  3A45 A;  4DV7 M;  2F5O A;  4B3T M;  4G4R A;  4G4O A;  1N36 M;  2F5N A;  1XNR M;  4NXN M;  1TDZ A;  3GQ5 A;  3SAT A;  4LFC M;  1K82 A;  3U6O A;  3U6L A;  4DV2 M;  3JR4 A;  4JI2 M;  4KHP M;  3J81 S;  3U6P A;  1IBM M;  3A46 A;  1L2D A;  4JI5 M;  5ITX E;  2ZM6 M;  3W0F A;  5ITX A;  2ZBK B;  4AQY M;  1HR0 M;  1PJI A;  4DR3 M;  3J7A S;  3J80 S;  1NNJ A;  1IBK M;  3U6S A;  4CIS A;  1Q3B A;  4K0K M;  5LMN M;  1FJG M;  4JV5 M;  2F4V M;  4X64 M;  1HNW M;  3U6M A;  2OQ4 A;  4PDG A;  1HNX M;  4JI0 M;  4DV0 M;  1Z5A A;  3GPP A;  3GPY A;  3JR5 A;  3U6D A;  1N32 M;  5ITU A;  2XZF A;  3TWL A;  1XMQ M;  3A42 A;  3GPX A;  4MB7 A;  4JI7 M;  4DV4 M;  3SAU A;  4DR4 M;  4PDI A;  4B3S M;  3GPU A;  4DV6 M;  4X62 M;  1J5E M;  1Q39 A;  4NXM M;  3C58 A;  2UXC M;  3GP1 A;  2F5Q A;  1N34 M;  2UUA M;  5ITT A;  5BR8 M;  1I94 M;  4JYA M;  2HKJ A;  4X65 M;  4JI8 M;  4JI6 M;  2Q2E B;  4LFB M;  4DV5 M;  2VQE M;  1XNQ M;  4GKK M;  1KFV A;  1PM5 A;  1L1Z A;  1N33 M;  4NRV A;  2UUC M;  3SAS A;  3U6Q A;  4ITQ A;  4DUZ M;  4JI4 M;  4PCZ A;  4LF9 M;  3U6E A;  3VK7 A;  1PJJ A;  4DV1 M;  1L1T A;  1Z5C A;  1MX0 A;  3TWK A;  3SAV A;  4DR6 M;  4LF4 M;  2XZU A;  2VQF M;  4LF6 M;  5ITR A; 
#chains in the Genus database with same CATH topology
 1LTM A;  3R9X B;  4LFA M;  4I4L A;  2CWB A;  1ZMV A;  3KOY E;  1JB0 F;  2JA2 A;  3AKZ A;  1R2Z A;  1KSF X;  4QHT A;  2R6F A;  1IBL M;  1TH2 A;  4DR1 M;  4LF8 M;  3VDP A;  3Q8G A;  1SXJ C;  2AHM A;  2JY8 A;  3HU1 A;  3FTD A;  2K9D A;  1DGH A;  3I51 A;  5JI3 E;  1GL7 A;  2KZS A;  3GLH B;  2Z4R A;  3LVV A;  2CHV A;  2R4J A;  2Y0T A;  5A2Q S;  1K3W A;  2C98 A;  2DHY A;  4JXJ A;  2BNK A;  2BJW A;  3W0L B;  1EIJ A;  1GLN A;  3KSJ A;  1IN7 A;  3T1Y M;  3IHP A;  2OO9 A;  1UM8 A;  1EE8 A;  4I8O A;  1NY6 A;  3FUX A;  2R46 A;  3FRH A;  1ZQ9 A;  1IXR C;  2XH9 A;  1C1K A;  3L28 A;  2UU9 M;  5ITY A;  2JWS A;  4L4U A;  4LF5 M;  1QZM A;  2VDB B;  2CE7 A;  1IY1 A;  3TWM A;  1OAO C;  4FVM A;  1IQP A;  4REZ A;  1NO1 A;  1S3S A;  1Z5B A;  3U6C A;  3BBZ A;  4LG2 A;  1XXH E;  4IIW A;  3ZH9 B;  2J5Y A;  3FUT A;  2C96 A;  4HL4 A;  3VDU A;  4JI1 M;  1VG5 A;  1XHB A;  2WSE F;  3FYD A;  2G3Q A;  2B3T A;  3LQQ A;  2F5O A;  3GLH A;  4QOS A;  3GLG A;  2DWM A;  4RNA A;  1TDZ A;  2XFT A;  3F92 A;  3KDS E;  1WHC A;  4GRI A;  3GQ5 A;  2XZU A;  2DWN A;  3TL4 X;  5C18 A;  3Q8X A;  3L26 A;  5E26 A;  4XK8 F;  3J81 S;  3U6P A;  5JI2 E;  2HWJ A;  3RGS A;  1L2D A;  2ZM6 M;  1XXH B;  1UFZ A;  2LTU A;  1PJI A;  3J7A S;  1SXJ D;  1GAB A;  1R6B X;  1Q02 A;  2VF8 A;  2LVN C;  4WP2 A;  4MGH A;  2CEA A;  3IG8 A;  3RE8 A;  1NNU C;  2JZ1 A;  4GC5 A;  2CFO A;  3U6M A;  2V1C A;  3GRY A;  2ZTC A;  3HKP A;  3U61 A;  1QAN A;  3K1J A;  2OQ4 A;  1TTE A;  4GMQ A;  3RGP A;  3HJ8 A;  3B74 A;  4NL4 H;  1N32 M;  2LVO C;  2RRU A;  4M9X A;  5ITU A;  1XMQ M;  2LXE A;  3A42 A;  1DO0 A;  1VEG A;  2LBC A;  3BXW A;  3KOZ E;  3W68 A;  2DWZ B;  2X4A A;  4KT0 F;  1VQ1 A;  5EXP A;  4B3S M;  3I01 M;  4LJ8 A;  3GPU A;  4X62 M;  3C9P A;  4XGI A;  2LWX A;  3R8F A;  1SG9 A;  3U5Z B;  1IM2 A;  2UUA M;  3VKH A;  4LCB A;  1HJP A;  4BB9 A;  1WR1 B;  2Z3X A;  4X65 M;  2Y21 A;  3ILK A;  1XWI A;  1XNQ M;  4LJA A;  1L1Z A;  1N33 M;  2FNA A;  4L15 A;  2JP7 A;  4F1I A;  4NRV A;  2UUC M;  3SAS A;  1IN6 A;  5H37 D;  1MJG M;  4D80 A;  4LF9 M;  1J7K A;  4ZPX A;  2ZTD A;  3I4V A;  4LJ7 A;  1HT1 E;  3HX3 A;  1OIP A;  4DV1 M;  3ZQJ A;  1L1T A;  1GVN A;  2DWL A;  1MX0 A;  3TWK A;  4DR6 M;  1EFU B;  2CHG A;  2I7N A;  3KXE C;  1F4I A;  4DBG B;  2FE8 A;  2RGO A;  4B3R M;  2Z8Y M;  1FNN A;  4FWD A;  1K3X A;  1E94 E;  1NSF A;  2EKK A;  2KDL A;  2KNZ A;  3CTW B;  2KW0 A;  3FTC A;  4GC9 A;  4MGK E;  5EP3 A;  1XMO M;  4LJ5 A;  1IN4 A;  4HLQ A;  4DR7 M;  1OJL A;  3PVS A;  2H5X A;  1GJS A;  3M0E A;  2KEB A;  5KQ8 A;  2DAE A;  1T3T A;  3H4J A;  3KP0 E;  1PRB A;  3CF2 A;  3KS4 A;  3AOE A;  1QDT A;  3HJQ A;  3K2L A;  2GNO A;  1H6U A;  4A3V B;  1OAI A;  1TR8 A;  1VEJ A;  1IN5 A;  2A5Y B;  1NV9 A;  4OW0 A;  4LZJ A;  4DR5 M;  3JAM S;  4FWH A;  2WZJ A;  3GLG B;  2OPF A;  1NHG C;  4PD2 A;  5EXS A;  3B7Q A;  5IRE B;  1WGL A;  4B7H A;  5L8R F;  2R65 A;  2L7H A;  2F5S A;  2L2D A;  3HHY A;  4F2L A;  4QOZ C;  3FKE A;  3GQ4 A;  1N75 A;  2JXN A;  4Z6Y A;  2XGN A;  4D81 A;  2K0B X;  5KPR A;  4DV3 M;  3U60 A;  5FSW A;  3ZCB B;  2D7G A;  3AOE C;  3VFD A;  2UXB M;  1NY5 A;  5GKN A;  1YE9 A;  2D7E A;  3KSX A;  4G4R A;  5DNY A;  1N36 M;  3I04 M;  4Z8X A;  4MH0 E;  4NXN M;  2GQF A;  1QUS A;  2V1U A;  5DFL A;  3EIE A;  1K82 A;  2J7O A;  3FRI A;  3LCU A;  4OU7 A;  2R62 A;  4AW4 A;  1QDR A;  2MJ5 B;  3HY5 A;  4KHP M;  1QAQ A;  2KXE A;  2ZAM A;  1L8Q A;  3FYC A;  5ITX E;  3C3D A;  4AQY M;  1GL6 A;  1HR0 M;  4GHL A;  2MH8 A;  2YR0 A;  2K6B A;  2XSZ A;  4AKH A;  2KHH A;  2JY5 A;  3J80 S;  4NOO B;  2VII A;  2JNH A;  1NNJ A;  3U6S A;  1Q3B A;  2NQ8 C;  1VDL A;  4OVZ B;  1OFH A;  1HNW M;  5DYI A;  4R71 A;  2FOI C;  5FTK A;  4BLC A;  5EP4 A;  3GLH E;  1LV7 A;  4FWG A;  1HNX M;  4JI0 M;  1YLA A;  3B7N A;  4QNR A;  3PNY A;  4DV0 M;  4FCV A;  3PFI A;  1OFI A;  4OVZ A;  4JI7 M;  3SMS A;  4LGM A;  4NSR A;  2QBY A;  1IY0 A;  2G5G X;  4RF1 A;  3SAU A;  4R3D A;  1T6O A;  1V92 A;  2R45 A;  3LCV B;  2BJV A;  3GRU A;  1J5E M;  1NV8 A;  2LHC A;  7CAT A;  2C99 A;  2DAG A;  3J7B A;  2APL A;  4B08 A;  2DAM A;  4MGI E;  2CHQ A;  2HKJ A;  1P3Q Q;  4WUR A;  2KZU A;  4EIW A;  2M60 A;  4JI8 M;  2JUJ A;  1X37 A;  1HQY E;  1QQW A;  2OOB A;  4IBE A;  4L8R C;  1CUK A;  1GJT A;  1Y8G A;  1T43 A;  3A98 B;  1PJS A;  5FTL A;  3U6Q A;  5IZ7 D;  1DGH B;  2QZ4 A;  4ITQ A;  1DV0 A;  3VK7 A;  4FCT A;  2QP9 X;  1G59 A;  1PJJ A;  3M7G A;  2HAK A;  4I81 A;  1Z5C A;  2KRU A;  3L2A A;  2DAK A;  3MJ5 A;  3SC3 A;  3SAV A;  3AJI B;  3HU2 A;  2DKL A;  2VQF M;  1ZAE A;  4KOD A;  4UN2 B;  4X66 M;  5ITR A;  3SBJ A;  2I7P A;  2O25 A;  2UXD M;  3L29 A;  4DUY M;  2DVW B;  4G4N A;  5KO3 A;  4DR2 M;  2QHO B;  4MGZ E;  2YQZ A;  2RGH A;  3TPZ A;  4JI3 M;  4CHT B;  2DXI A;  1IY2 A;  3GLF B;  2YNM D;  3V76 A;  1QVR A;  4OX9 M;  1VEK A;  3K9O A;  4ANR A;  2N35 A;  3K8Z A;  2R0I A;  3VK8 A;  3KOX E;  4QHS A;  3DOA A;  3T15 A;  5IT9 S;  1XB2 B;  2JY6 B;  2XLJ A;  3GQ3 A;  1SXJ A;  4LZZ A;  3SFZ A;  2K47 A;  1IN8 A;  1WXQ A;  5IWA M;  3U5Z A;  4GEW A;  4LF7 M;  1OKS A;  1G4A E;  1TH3 A;  1XXH A;  4IBJ A;  4M0W A;  2F5P A;  1VDD A;  1R5L A;  3H4M A;  2L7I A;  3HU3 A;  3B7Z A;  3RFW A;  4L16 A;  1OIZ A;  1Q3C A;  2QPA A;  2DI0 A;  4L78 A;  1L2C A;  3QYE A;  2Z4S A;  2CUZ A;  3M6A A;  3GLI B;  1MU5 A;  2XF3 A;  3D8L A;  2L09 A;  3A45 A;  4IBC A;  2WSF F;  1MN3 A;  1G41 A;  3HWS A;  4LRT A;  3HHZ A;  4G4O A;  1XNR M;  3AV0 A;  3DFZ A;  3SAT A;  1JR3 A;  4JN6 A;  4LFC M;  2W82 A;  4GIT A;  5C1B A;  3T38 A;  1E9R A;  4MGY E;  3C3E A;  4P17 A;  1IBM M;  4I5S A;  3A46 A;  4RKU F;  2V6Z M;  2EKF A;  3NWL A;  3KW6 A;  1W5T A;  1GO5 A;  3WHK A;  2ZBK B;  3KS8 A;  1V34 A;  4KLN A;  1PJQ A;  2WSC F;  4AG5 A;  4LY6 A;  1IBK M;  4CIZ A;  1SXJ B;  3PXG A;  1SXJ E;  4CIS A;  5EJC A;  4IBK A;  5LMN M;  1D0K A;  1TGU A;  1FJG M;  3DZD A;  3HHW A;  1DGF A;  2Y0Q A;  1HQC A;  2OOA A;  3K9P A;  2R44 A;  3BOS A;  2H1R A;  4IJF A;  4PDG A;  1D0L A;  5E6J A;  3UJN A;  3GPY A;  1QAO A;  1Z6T A;  2DEN A;  3U6D A;  4NC6 A;  3KOW E;  2XZF A;  1E9S A;  4TUW A;  4IBI A;  1TH4 A;  3GPX A;  1J09 A;  3HZJ A;  4LJ6 A;  4KO8 A;  3SHG B;  3FD9 A;  4AKG A;  3QAU A;  2FS1 A;  3TQS A;  3IEC A;  2X49 A;  3CF6 E;  1QUT A;  2QSF X;  4RF0 A;  2FFJ A;  3FUV A;  5KQD A;  2LVP C;  1OQY A;  1DO2 A;  2P5T A;  2LH0 A;  4IBG A;  4DV6 M;  4NXM M;  4LGY A;  2QEN A;  4CGY B;  4BBA A;  1G8P A;  2Z7J A;  1N34 M;  1QAM A;  1PGY A;  5BR8 M;  1I94 M;  5EP2 A;  1R4G A;  2CV1 A;  2RKO A;  1GKI A;  2Q2E B;  3FUW A;  3HHX A;  3NBX X;  5KPT A;  4LFB M;  2VF7 A;  3CF0 A;  3FUU A;  1KFV A;  1PM5 A;  3WHL A;  1ORY B;  5DYG A;  2ZAN A;  1D2N A;  3L25 A;  3PNV A;  3IG5 A;  1JR3 E;  4M0D A;  4PCZ A;  3GLI A;  3B9P A;  4DUZ M;  4P16 A;  2KNA A;  2L6O A;  4WW0 A;  3GLG E;  3UZU A;  1ZMW A;  1DGG A;  3MMP A;  3T6P A;  3AL0 C;  4NSO B;  4LF4 M;  1I4W A;  3E9S A;  1QYR A;  2HL7 A;  2QNJ A;  2DZO B;  1V33 A;  5FTN A;  1HT2 E;  3L27 A;  4D82 A;  1AUA A;  2DHR A;  3SAW A;  1YSY A;  2J7N A;  2Y20 A;  3GLF E;  3U60 B;  1TDH A;  3B89 A;  4AI6 A;  2D7H A;  3MK6 A;  3LQR A;  2YFQ A;  3KFU G;  2HHH M;  4B7F A;  3I4Y A;  3UK6 A;  3GLI E;  3UMM A;  4LRS A;  1HNZ M;  2QQ8 A;  4FW9 A;  2R4E A;  5FTM A;  3VKG A;  2KNV A;  1G3I A;  4GKJ M;  4YHH M;  5FLX S;  2C5R A;  3T1H M;  2QCU A;  4YY3 M;  2E5L M;  2EJS A;  3FTE A;  5ITQ A;  4M9S A;  4XBO A;  4IBF A;  1C7Y A;  1XC8 A;  3GO8 A;  2LVA A;  4M9Z A;  3HGI A;  1Z59 A;  2R18 A;  1W5S A;  3QWL A;  3SAR A;  1YUB A;  1IXS A;  4QNM A;  2BWB A;  5LMU M;  2CP8 A;  4IJE A;  3E4R A;  4FCW A;  3LVW A;  1ZMU A;  1L2B A;  1NJF A;  3ZC7 B;  1JR3 D;  1R2Y A;  1RU3 A;  4NRW A;  4CJ6 A;  2XEP A;  3W67 A;  2UUB M;  4G4Q A;  1IXS B;  2EA0 A;  3OTO M;  4B3M M;  3CGW A;  8CAT A;  4DV7 M;  4B3T M;  3DA1 A;  2F5N A;  2X8A A;  2C9C A;  2KRK A;  3GRV A;  1E32 A;  3E46 A;  2O5R A;  5BPV A;  3U6O A;  3U6L A;  3AOG A;  2ERC A;  1WJ7 A;  3JR4 A;  4DV2 M;  1TF0 B;  3U61 B;  4JI2 M;  3K92 A;  1NHW C;  2DNA A;  2MR9 A;  3E21 A;  2JY7 A;  4Q7J A;  3MHV C;  4JI5 M;  4LJ9 A;  5FTJ A;  1BVS A;  3W0F A;  5ITX A;  2DZL A;  4PT5 A;  4DR3 M;  1IXZ A;  1N77 A;  2LHG A;  1WIV A;  5EP1 A;  1D0M A;  1KYI A;  2CV2 A;  2G8L A;  1WGN A;  2M5Z A;  4AZF A;  4K0K M;  4JV5 M;  5EXT A;  5F3W A;  2F4V M;  4X64 M;  2QBY B;  3GRR A;  4S12 A;  3TE6 A;  1QZE A;  3KVW A;  4G3O A;  3SYL A;  4GHA A;  4L6V 6;  3GPP A;  1Z5A A;  3JR5 A;  3EIH A;  4HEO A;  3LW5 F;  4R7G A;  3HJS A;  1AIP C;  1A5T A;  4MM3 B;  3TWL A;  3FTF A;  1R7R A;  4MB7 A;  2BWE A;  1ZV1 A;  1DGB A;  4DV4 M;  3AFH A;  4DR4 M;  4FD2 A;  4PDI A;  2EUC A;  3D8B A;  2UXC M;  1Q39 A;  3C58 A;  2C9O A;  1PJT A;  3QYB A;  3GP1 A;  4LJ4 A;  2F5Q A;  2LNH C;  5EXX A;  1NJG A;  3J2P B;  5ITT A;  3J27 B;  1OTR A;  4JYA M;  2O01 F;  2FH0 A;  2LVQ D;  5KPZ A;  3SYK A;  4JI6 M;  1N78 A;  4IBD A;  4II7 A;  2XSZ D;  3UGJ A;  4DV5 M;  1G71 A;  2MGW A;  2EO2 A;  4IBB A;  1JQJ C;  2VQE M;  3THG A;  2CRU A;  2JZ0 A;  3SMP A;  4G6Z A;  4GKK M;  3KP1 E;  2XFS A;  3VLF B;  2MRO B;  4AG6 A;  2KA6 B;  2HCB A;  4AKI A;  2DAI A;  5EQT A;  4GIP A;  4JI4 M;  4W5W A;  2CV0 A;  3FE3 A;  3SHF A;  2DZN B;  4Y28 F;  3U6E A;  1IFY A;  2L4F A;  4GH9 A;  3NBI A;  3LMM A;  2ZAO A;  3GLF A;  1NVM A;  4LF6 M;  4B7G A;  2L4E A; 
#chains in the Genus database with same CATH homology
 3R9X B;  4LFA M;  4I4L A;  1R2Z A;  3KOY E;  2JA2 A;  3AKZ A;  1KSF X;  4QHT A;  1IBL M;  1TH2 A;  4DR1 M;  4LF8 M;  3VDP A;  1SXJ C;  2AHM A;  3HU1 A;  3FTD A;  1DGH A;  3I51 A;  5JI3 E;  1GL7 A;  2KZS A;  3GLH B;  2Z4R A;  3LVV A;  2CHV A;  2R4J A;  2Y0T A;  5A2Q S;  1K3W A;  2C98 A;  4JXJ A;  2BNK A;  2BJW A;  3W0L B;  1GLN A;  3KSJ A;  1IN7 A;  3T1Y M;  1UM8 A;  1EE8 A;  4I8O A;  1NY6 A;  3FUX A;  2R46 A;  1ZQ9 A;  1IXR C;  2XH9 A;  1C1K A;  3L28 A;  2UU9 M;  5ITY A;  4L4U A;  4LF5 M;  1QZM A;  2CE7 A;  1IY1 A;  3TWM A;  4FVM A;  1IQP A;  4REZ A;  1S3S A;  1Z5B A;  3U6C A;  4LG2 A;  4IIW A;  3ZH9 B;  3FUT A;  4JI1 M;  2C96 A;  4HL4 A;  3VDU A;  1XHB A;  3FYD A;  3LQQ A;  2F5O A;  3GLH A;  4QOS A;  3GLG A;  2DWM A;  4RNA A;  1TDZ A;  2XFT A;  3KDS E;  3GQ5 A;  2XZU A;  4GRI A;  2DWN A;  3TL4 X;  5C18 A;  3Q8X A;  3L26 A;  5E26 A;  3J81 S;  3U6P A;  5JI2 E;  3RGS A;  1L2D A;  2ZM6 M;  1XXH B;  1PJI A;  3J7A S;  1SXJ D;  1R6B X;  4MGH A;  2CEA A;  3IG8 A;  3RE8 A;  1NNU C;  4GC5 A;  2CFO A;  3U6M A;  2V1C A;  3GRY A;  3HKP A;  3U61 A;  1QAN A;  3K1J A;  2OQ4 A;  4GMQ A;  3RGP A;  3HJ8 A;  4NL4 H;  1N32 M;  4M9X A;  5ITU A;  1XMQ M;  2LXE A;  3A42 A;  1DO0 A;  3KOZ E;  2DWZ B;  2X4A A;  5EXP A;  4B3S M;  4LJ8 A;  3GPU A;  4X62 M;  4XGI A;  2LWX A;  3R8F A;  3U5Z B;  1IM2 A;  2UUA M;  3VKH A;  4LCB A;  4BB9 A;  2Z3X A;  4X65 M;  2Y21 A;  3ILK A;  1XWI A;  1XNQ M;  4LJA A;  1L1Z A;  1N33 M;  2FNA A;  4L15 A;  4NRV A;  2UUC M;  3SAS A;  1IN6 A;  5H37 D;  4D80 A;  4LF9 M;  1J7K A;  4ZPX A;  3I4V A;  4LJ7 A;  1HT1 E;  4DV1 M;  1L1T A;  2DWL A;  1GVN A;  1MX0 A;  3TWK A;  4DR6 M;  2CHG A;  2I7N A;  3KXE C;  2FE8 A;  2RGO A;  4B3R M;  1FNN A;  4FWD A;  1K3X A;  1E94 E;  1NSF A;  3CTW B;  3FTC A;  4MGK E;  5EP3 A;  2KW0 A;  4GC9 A;  1XMO M;  4DR7 M;  4LJ5 A;  1IN4 A;  4HLQ A;  1OJL A;  3PVS A;  3M0E A;  2KEB A;  5KQ8 A;  1T3T A;  3KP0 E;  3CF2 A;  3KS4 A;  3AOE A;  3HJQ A;  3K2L A;  4A3V B;  1H6U A;  1IN5 A;  2A5Y B;  4OW0 A;  4LZJ A;  4DR5 M;  3JAM S;  4FWH A;  3GLG B;  2OPF A;  1NHG C;  4PD2 A;  5EXS A;  5IRE B;  4B7H A;  2R65 A;  2L7H A;  2F5S A;  3HHY A;  4QOZ C;  3FKE A;  3GQ4 A;  1N75 A;  4Z6Y A;  2XGN A;  4D81 A;  5KPR A;  4DV3 M;  3U60 A;  5FSW A;  3ZCB B;  2D7G A;  3AOE C;  3VFD A;  2UXB M;  1NY5 A;  5GKN A;  1YE9 A;  2D7E A;  3KSX A;  4G4R A;  5DNY A;  1N36 M;  4Z8X A;  4MH0 E;  4NXN M;  2V1U A;  3EIE A;  1K82 A;  2J7O A;  4OU7 A;  2R62 A;  4AW4 A;  4KHP M;  1QAQ A;  2KXE A;  2ZAM A;  1L8Q A;  3FYC A;  5ITX E;  4AQY M;  1GL6 A;  1HR0 M;  4GHL A;  2YR0 A;  2XSZ A;  4AKH A;  3J80 S;  4NOO B;  2VII A;  1NNJ A;  3U6S A;  1Q3B A;  2NQ8 C;  4OVZ B;  1OFH A;  1HNW M;  5DYI A;  2FOI C;  5FTK A;  4BLC A;  5EP4 A;  1LV7 A;  4FWG A;  1HNX M;  4JI0 M;  4DV0 M;  4QNR A;  3PNY A;  4FCV A;  3PFI A;  1OFI A;  4OVZ A;  4JI7 M;  3SMS A;  4LGM A;  4NSR A;  2QBY A;  1IY0 A;  2G5G X;  4RF1 A;  3SAU A;  4R3D A;  2R45 A;  2BJV A;  3GRU A;  1J5E M;  7CAT A;  2C99 A;  3J7B A;  4B08 A;  4MGI E;  2CHQ A;  2HKJ A;  4WUR A;  2KZU A;  4EIW A;  2M60 A;  4JI8 M;  1X37 A;  1HQY E;  1QQW A;  4IBE A;  4L8R C;  3A98 B;  5FTL A;  3U6Q A;  5IZ7 D;  1DGH B;  2QZ4 A;  4ITQ A;  3VK7 A;  4FCT A;  2QP9 X;  1G59 A;  1PJJ A;  3M7G A;  4I81 A;  1Z5C A;  2KRU A;  3L2A A;  3MJ5 A;  3SC3 A;  3SAV A;  3AJI B;  3HU2 A;  2VQF M;  1ZAE A;  4KOD A;  5ITR A;  4X66 M;  3SBJ A;  2I7P A;  2UXD M;  3L29 A;  4DUY M;  2DVW B;  4G4N A;  5KO3 A;  4DR2 M;  4MGZ E;  2YQZ A;  2RGH A;  3TPZ A;  4JI3 M;  4CHT B;  2DXI A;  1IY2 A;  3GLF B;  2YNM D;  1QVR A;  4OX9 M;  3K8Z A;  3VK8 A;  3KOX E;  4QHS A;  3DOA A;  3T15 A;  5IT9 S;  2XLJ A;  3GQ3 A;  1SXJ A;  4LZZ A;  3SFZ A;  2K47 A;  1IN8 A;  1WXQ A;  5IWA M;  3U5Z A;  4LF7 M;  1XXH A;  1G4A E;  1TH3 A;  4IBJ A;  4M0W A;  2F5P A;  1VDD A;  3H4M A;  3HU3 A;  2L7I A;  3RFW A;  4L16 A;  1Q3C A;  2QPA A;  4L78 A;  1L2C A;  2Z4S A;  2CUZ A;  3M6A A;  3GLI B;  1MU5 A;  2XF3 A;  3D8L A;  2L09 A;  3A45 A;  4IBC A;  4LRT A;  3HWS A;  1G41 A;  3HHZ A;  4G4O A;  1XNR M;  3AV0 A;  3DFZ A;  3SAT A;  1JR3 A;  4JN6 A;  4LFC M;  2W82 A;  4GIT A;  5C1B A;  3T38 A;  1E9R A;  4MGY E;  1IBM M;  4I5S A;  3A46 A;  2V6Z M;  3NWL A;  3KW6 A;  1W5T A;  3WHK A;  2ZBK B;  3KS8 A;  4KLN A;  4AG5 A;  4LY6 A;  1IBK M;  1SXJ B;  3PXG A;  1SXJ E;  4CIS A;  5EJC A;  4IBK A;  5LMN M;  1TGU A;  1FJG M;  3DZD A;  3HHW A;  1DGF A;  2Y0Q A;  1HQC A;  3BOS A;  2H1R A;  4IJF A;  4PDG A;  5E6J A;  3UJN A;  3GPY A;  1QAO A;  1Z6T A;  3U6D A;  3KOW E;  2XZF A;  1E9S A;  4TUW A;  4IBI A;  1TH4 A;  3GPX A;  1J09 A;  4LJ6 A;  4KO8 A;  3SHG B;  3FD9 A;  4AKG A;  3QAU A;  3TQS A;  2X49 A;  3CF6 E;  4RF0 A;  2FFJ A;  3FUV A;  5KQD A;  1DO2 A;  2LH0 A;  2P5T A;  4IBG A;  4DV6 M;  4NXM M;  4LGY A;  2QEN A;  4CGY B;  4BBA A;  1G8P A;  2Z7J A;  1N34 M;  1QAM A;  5BR8 M;  1I94 M;  5EP2 A;  2CV1 A;  2RKO A;  1GKI A;  2Q2E B;  3FUW A;  3HHX A;  5KPT A;  4LFB M;  3CF0 A;  3FUU A;  1KFV A;  1PM5 A;  3WHL A;  1ORY B;  5DYG A;  2ZAN A;  1D2N A;  3L25 A;  3PNV A;  3IG5 A;  3GLI A;  4M0D A;  4PCZ A;  4DUZ M;  3B9P A;  4P16 A;  2L6O A;  4WW0 A;  3UZU A;  1DGG A;  3AL0 C;  4NSO B;  4LF4 M;  1I4W A;  3E9S A;  1QYR A;  2HL7 A;  2DZO B;  5FTN A;  1HT2 E;  3L27 A;  4D82 A;  2DHR A;  3SAW A;  1YSY A;  2J7N A;  2Y20 A;  3U60 B;  1TDH A;  4AI6 A;  2D7H A;  3MK6 A;  3LQR A;  2YFQ A;  3KFU G;  2HHH M;  4B7F A;  3I4Y A;  3UK6 A;  3UMM A;  4LRS A;  1HNZ M;  4FW9 A;  2R4E A;  5FTM A;  3VKG A;  1G3I A;  4GKJ M;  4YHH M;  5FLX S;  2C5R A;  3T1H M;  2QCU A;  4YY3 M;  2E5L M;  3FTE A;  5ITQ A;  4M9S A;  4XBO A;  4IBF A;  1XC8 A;  3GO8 A;  4M9Z A;  3HGI A;  1Z59 A;  2R18 A;  1W5S A;  3QWL A;  3SAR A;  1YUB A;  4QNM A;  5LMU M;  4IJE A;  3E4R A;  4FCW A;  3LVW A;  1L2B A;  1NJF A;  3ZC7 B;  1JR3 D;  1R2Y A;  4NRW A;  2XEP A;  2UUB M;  4G4Q A;  1IXS B;  2EA0 A;  3OTO M;  4B3M M;  8CAT A;  4DV7 M;  4B3T M;  3DA1 A;  2F5N A;  2X8A A;  2C9C A;  2KRK A;  3GRV A;  1E32 A;  2O5R A;  5BPV A;  3U6O A;  3U6L A;  3AOG A;  2ERC A;  4DV2 M;  3JR4 A;  3U61 B;  4JI2 M;  3K92 A;  1NHW C;  3MHV C;  4JI5 M;  4LJ9 A;  5FTJ A;  3W0F A;  5ITX A;  4PT5 A;  4DR3 M;  1IXZ A;  1N77 A;  5EP1 A;  1KYI A;  2CV2 A;  2G8L A;  2M5Z A;  4AZF A;  4K0K M;  4JV5 M;  5EXT A;  5F3W A;  2F4V M;  4X64 M;  2QBY B;  3GRR A;  4S12 A;  3TE6 A;  3KVW A;  3SYL A;  4GHA A;  3GPP A;  1Z5A A;  3JR5 A;  3EIH A;  4R7G A;  3HJS A;  3TWL A;  4MM3 B;  3FTF A;  1R7R A;  4MB7 A;  1DGB A;  4DV4 M;  3AFH A;  4DR4 M;  4FD2 A;  4PDI A;  2EUC A;  3D8B A;  2UXC M;  1Q39 A;  3C58 A;  2C9O A;  3GP1 A;  4LJ4 A;  2F5Q A;  2LNH C;  5EXX A;  1NJG A;  3J2P B;  5ITT A;  3J27 B;  4JYA M;  5KPZ A;  3SYK A;  4JI6 M;  1N78 A;  4IBD A;  4II7 A;  2XSZ D;  3UGJ A;  4DV5 M;  2VQE M;  2EO2 A;  4IBB A;  1JQJ C;  4GKK M;  3THG A;  3SMP A;  4G6Z A;  3KP1 E;  2XFS A;  3VLF B;  4AG6 A;  2KA6 B;  2HCB A;  4AKI A;  5EQT A;  4GIP A;  4JI4 M;  4W5W A;  2CV0 A;  3SHF A;  3U6E A;  2DZN B;  4GH9 A;  3NBI A;  3LMM A;  2ZAO A;  3GLF A;  1NVM A;  4B7G A;  4LF6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...