2JNHA

Solution structure of the uba domain from cbl-b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
ALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential ubiquitin binding of the UBA domains from human c-Cbl and Cbl-b: NMR structural and biochemical insights
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
total genus 8
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jnhA00
2EJSA 1OTRA 2DENA 1GO5A 1IFYA 3K9PA 1IM2A 1DV0A 1WGLA 1ZMUA 1E94E 2LTUA 2MGWA 2LVPC 2DAMA 3GLHE 2CWBA 1HJPA 2QSFX 3IHPA 1OKSA 2DNAA 1VQ1A 1R4GA 5JI2E 1TR8A 1NV8A 3BBZA 3E21A 2DAKA 1OAIA 2L4EA 1HT2E 1C7YA 1VG5A 4GEWA 1OQYA 2LVAA 1UFZA 1BVSA 1XXHE 2LVQD 2KNZA 2K0BX 2ZTDA 1G3IA 3FRHA 2JUJA 3H4JA 1XB2B 2OO9A 2JNHA 1MN3A 1ZMVA 1VEKA 1ZV1A 2DAIA 3T6PA 3FRIA 1NV9A 2JP7A 1EFUB 1CUKA 2DHYA 3GLGE 1JR3E 3E46A 1Q02A 3FE3A 4UN2B 1VEJA 5DFLA 2R0IA 4R71A 2HAKA 2BWEA 3GLIE 1TTEA 3F92A 1T43A 1WJ7A 2RRUA 2LBCA 2DAEA 1DO2A 2HWJA 3K9OA 1HT1E 1VEGA 1G41A 1HQYE 2DAGA 2JZ0A 3LCUA 2OOBA 1WIVA 2H5XA 2JY8A 4DBGB 2DI0A 1WHCA 3GLFE 2QHOB 1AIPC 2JY5A 1SG9A 2MR9A 1P3QQ 1PGYA 1V92A 1ZMWA 2OOAA 3MMPA 1IXSA 1QZEA 2JY7A 2MROB 2DKLA 4Q7JA 4F1IA 1WGNA 2KHHA 3B89A 3LCVB 2O25A 2LVOC 4F2LA 1DO0A 1A5TA 1WR1B 2L4FA 2WZJA 2QNJA 1T6OA 3IECA 4WP2A 2JZ1A 1VDLA 2G3QA 1KYIA 4G3OA 2JY6B 1F4IA 2L2DA 2ZTCA 2BWBA 2EKFA 4HEOA 1YLAA 2K9DA 2DZLA 2KNVA 2B3TA 2CP8A 2KNAA 1G4AE 2MJ5B 2EKKA 1Y8GA 2LVNC
chains in the Genus database with same CATH superfamily
2Z7JA 2EJSA 2R6FA 4IBBA 3PXGA 1PJIA 2BJWA 4LJ9A 4CHTB 3SC3A 1DV0A 1ZMUA 4ITQA 2J7NA 4DR6M 4ANRA 1XMOM 2DAMA 5EP4A 4BBAA 2QSFX 4I8OA 1XHBA 5EXTA 3RFWA 4REZA 3KP1E 1VQ1A 4W5WA 2F5OA 1R4GA 1IY2A 5LMNM 3HHYA 1YSYA 1NV8A 4CISA 1IXZA 2KZSA 3E21A 2L4EA 1NJGA 1XC8A 1HT2E 4MB7A 3NBXX 1C7YA 1PJJA 4IBEA 1XXHE 3FUVA 1OIPA 1KSFX 2ERCA 2ZBKB 3TWMA 3WHKA 5A2QS 3GPUA 3GQ5A 4LJ6A 3GPXA 1ZMVA 4IBKA 2DAIA 3L27A 2UUBM 3SAVA 4X62M 3FRIA 5EQTA 3RGPA 2JP7A 3LVVA 3UGJA 4I4LA 4P17A 1CUKA 2R44A 2CV2A 3HHXA 1PJTA 3E46A 4UN2B 3FE3A 2R0IA 1OFHA 1T3TA 2XF3A 3JR5A 4FWDA 5FTLA 1G71A 2V1UA 5IT9S 1TDZA 3TQSA 2BWEA 3SATA 2VDBB 4LFBM 1TTEA 3GRVA 3GLHB 5LMUM 3VDUA 2CHQA 2QZ4A 1FJGM 1NSFA 2LBCA 1DO2A 1XXHB 1EE8A 2HKJA 2JA2A 1MX0A 1IY0A 3GQ4A 2ZANA 3VLFB 2JZ0A 1QUSA 1HNWM 2OOBA 1WIVA 3L28A 3B74A 5FTMA 4DBGB 2DI0A 3C3EA 5EXPA 3HJ8A 3I01M 4DR5M 3ZH9B 4FVMA 2BJVA 2QHOB 2JY5A 2RGOA 4DV4M 2YNMD 3DA1A 1V92A 2P5TA 2OOAA 4X66M 5H37D 4Z6YA 1IXRC 3HHWA 4X64M 3FUUA 1FNNA 4DV7M 1IY1A 1SXJC 1GVNA 3VDPA 4F1IA 2QBYA 3SAWA 1QDRA 1WGNA 2QQ8A 4I5SA 3TWLA 5EP3A 3U6CA 3L25A 4NXNM 4F2LA 1N77A 2L6OA 2CFOA 2VQFM 2WZJA 1N34M 2CE7A 3GPPA 3QWLA 1LV7A 3KFUG 4TUWA 4AI6A 8CATA 2EO2A 2C98A 3K92A 1VDLA 3J7BA 4M9SA 4G4NA 1L8QA 1E32A 2W82A 4LJ5A 1KYIA 3R8FA 1L1ZA 1NHGC 1QVRA 4WURA 4B3SM 3LMMA 2RKOA 3E9SA 2M5ZA 2VQEM 3AOEA 4LRSA 2LHGA 4L6V6 2X49A 3GRUA 4LRTA 1D0LA 1G4AE 2CHGA 4RKUF 4M9ZA 4IBJA 1R6BX 3AKZA 1IN5A 3W68A 4IBCA 3W0LB 3SARA 1IBLM 1JR3A 2FH0A 1OFIA 3VFDA 3W67A 3GLGA 2DXIA 4PD2A 2UUAM 2DZNB 2WSCF 1E94E 1R5LA 3FUTA 4EIWA 4L4UA 3H4MA 2OQ4A 4NL4H 3GLHE 2UUCM 1Q3CA 4NRVA 1OKSA 4AW4A 1GLNA 5EXXA 4ZPXA 4JI1M 2XZFA 1W5SA 1UM8A 1ZAEA 4OVZB 3U6DA 3U61A 2DWNA 4RF0A 4GHAA 1N78A 3MJ5A 1X37A 4LF4M 1TR8A 3NWLA 4AG5A 4PDIA 4LF9M 3C3DA 2XFTA 3BBZA 3KVWA 4QNRA 2LNHC 4G6ZA 3ZCBB 4NOOB 4G4QA 3HU3A 4GEWA 2LVAA 4KLNA 3MK6A 1IBMM 3AFHA 3FTFA 4K0KM 2KNZA 2VF8A 2ZTDA 3FRHA 3VK8A 3H4JA 2NQ8C 1XB2B 3GLIB 2JNHA 3J80S 1MN3A 5IWAM 3BOSA 3U6MA 3B7NA 1L2BA 3PNVA 2J5YA 3U6QA 2ZM6M 2UXBM 2KRUA 1EFUB 2I7NA 2C96A 3GRRA 4GITA 3KOZE 1R2YA 4HLQA 1SXJD 1NO1A 1Q02A 2KW0A 2R4EA 3AOGA 4XK8F 2Z8YM 4M9XA 4NXMM 1L2DA 2DZOB 3MHVC 2QBYB 3L26A 3GQ3A 2HAKA 4JI8M 1XNQM 4CIZA 4L78A 4LJ4A 1R7RA 4L8RC 3FTEA 3UZUA 1T43A 2Q2EB 3HU2A 4MM3B 4QHTA 2DAEA 3SYLA 4DR7M 1Z59A 1J5EM 3DFZA 3E4RA 1HT1E 1VEGA 2KDLA 1HQYE 1H6UA 1K3WA 4R3DA 2CHVA 2JY8A 1E9RA 5EJCA 5BR8M 3GLFA 3AV0A 5ITYA 1SXJB 2J7OA 5ITXA 1WHCA 1AUAA 2VF7A 4JXJA 2DHRA 3I04M 4M0DA 2MR9A 1PGYA 1ZMWA 1HNXM 1XMQM 2FNAA 4NC6A 1IXSA 3HZJA 5DYIA 3D8BA 1DGBA 1HR0M 1QZEA 3QYEA 2APLA 2MROB 1SXJA 2DWLA 3VKHA 1TDHA 3C9PA 3AJIB 2LH0A 3T38A 3CF6E 4IJEA 2D7HA 4D80A 2KHHA 3B89A 2ZAMA 1OJLA 3LCVB 3UJNA 1IN7A 3U6EA 5FSWA 1NNJA 2Y20A 3LW5F 5F3WA 2A5YB 3HY5A 2D7EA 4NRWA 4B3MM 2G8LA 4AKHA 4IIWA 3TWKA 4GKJM 7CATA 3J27B 4JI3M 2UXCM 5BPVA 4MGZE 4YHHM 4DV2M 3B7ZA 3KS8A 2HL7A 2C9OA 3CF0A 1F4IA 1YUBA 3U60A 2YR0A 4DR1M 2L2DA 3W0FA 5JI3E 2Y0TA 4PCZA 1G59A 4HEOA 4BLCA 3R9XB 2K9DA 3FKEA 2FFJA 3FTDA 1D0MA 2KNVA 3PVSA 2B3TA 3KP0E 2CP8A 2KNAA 3D8LA 5E26A 3T1YM 2EKKA 2X4AA 2R46A 1DGHB 1IN6A 3I4YA 5FTKA 4DV6M 4FD2A 2FS1A 1K82A 1WXQA 3SMSA 1OTRA 5KPRA 4DV0M 1Z5CA 1GO5A 1S3SA 4QOSA 1Z5BA 1IM2A 3K9PA 3M0EA 5ITXE 1WGLA 4CJ6A 3J2PB 4CGYB 4D81A 3SFZA 3GLFB 3U5ZA 1HJPA 3IHPA 3J7AS 3U60B 2F5QA 2L7IA 5GKNA 1KFVA 4FCWA 4DUZM 4B3TM 4GRIA 1QANA 5JI2E 4R7GA 5L8RF 4LJ7A 3THGA 1NHWC 2DAKA 3A42A 2F5SA 2D7GA 1PM5A 3M6AA 4JI4M 1VG5A 2FOIC 2XGNA 3DZDA 4LJAA 4G4OA 2O5RA 1TH3A 2N35A 1PJQA 3GP1A 3B9PA 3A45A 5E6JA 1NNUC 4JYAM 4AG6A 2QENA 2JWSA 1G3IA 2KRKA 3U5ZB 2OO9A 5EP1A 3U6OA 4LF8M 2R62A 1IN4A 4L15A 1GL7A 2QPAA 4XGIA 4JV5M 3IG5A 1L1TA 1C1KA 2XZUA 2DHYA 3KSJA 1RU3A 1VEJA 3UMMA 3SBJA 3Q8XA 4DR4M 4GC9A 4NSRA 2DWZB 1J7KA 5DYGA 4IBDA 1Z6TA 3L2AA 4OX9M 2CV0A 3F92A 2EA0A 3FUWA 4B7HA 1DGGA 1QAMA 3K1JA 2Z4SA 2RRUA 4JI5M 1R2ZA 3WHLA 2F5NA 4L16A 1QDTA 2HWJA 3K9OA 4KODA 4II7A 1IQPA 1GL6A 1E9SA 3LCUA 1G41A 1XWIA 4MGYE 2XEPA 4YY3M 2H5XA 5C18A 1ZQ9A 3PNYA 3KS4A 4KHPM 1IN8A 2WSFF 3OTOM 1DGFA 1Q3BA 3KOYE 1N36M 2GQFA 2KZUA 4AQYM 2F4VM 4KT0F 2DVWB 1P3QQ 3JR4A 5C1BA 3U6PA 2R45A 3DOAA 3HJSA 3RGSA 2C5RA 3EIEA 1NY5A 4LGMA 2DKLA 5KQ8A 4GC5A 4Q7JA 4IBIA 3L29A 4RNAA 2FE8A 5KQDA 4GKKM 2HCBA 1W5TA 2K47A 1GKIA 3KDSE 3K2LA 1MJGM 3U61B 2OPFA 2KA6B 1G8PA 1YE9A 2LVOC 4I81A 1K3XA 3HWSA 1DO0A 1A5TA 1WR1B 3HX3A 2L4FA 2M60A 3U6SA 2QNJA 3TL4X 3IECA 3PFIA 1ORYB 4WP2A 4B7FA 3SHGB 3GO8A 2JZ1A 3U6LA 2G3QA 2HHHM 2ZAOA 2Z4RA 1D2NA 4FWHA 3LQQA 2EKFA 1YLAA 4G4RA 1Z5AA 2R4JA 2XLJA 4LG2A 1N75A 2DZLA 4KO8A 3SYKA 1OIZA 4OU7A 1NY6A 1V34A 4M0WA 1QZMA 2Y0QA 3JAMS 5ITTA 3CTWB 5IZ7D 3UK6A 4LGYA 2XSZD 1Y8GA 4LF5M 1IFYA 5FTJA 3FUXA 2LHCA 4MGHA 3ILKA 1QUTA 3HU1A 2BNKA 1GJTA 2DENA 4GMQA 4S12A 3RE8A 4FW9A 3NBIA 1QAOA 2YFQA 4B3RM 4DR2M 4QOZC 3J81S 3VKGA 2LTUA 2MGWA 2RGHA 4GIPA 4JI0M 5ITQA 2LVPC 2VIIA 1JQJC 2CWBA 4LZZA 3M7GA 3C58A 2UU9M 5EXSA 2DNAA 3FYCA 3FTCA 2KEBA 4QHSA 5KPZA 2Y21A 2H1RA 4X65M 3V76A 4DV1M 5ITRA 2CUZA 4LF6M 2C9CA 3ZQJA 1OAIA 1IBKM 1OQYA 3CGWA 1UFZA 1BVSA 4FCTA 4LY6A 2L09A 4OVZA 1QYRA 2LVQD 4WW0A 3SMPA 2CV1A 3AL0C 3BXWA 2UXDM 2K0BX 3IG8A 3QYBA 1TH2A 4D82A 2JUJA 2QCUA 3I4VA 2WSEF 5ITUA 1VDDA 5KPTA 2EUCA 4P16A 1JR3D 3Q8GA 2XSZA 4HL4A 1I4WA 1VEKA 1SXJE 1ZV1A 3CF2A 3T6PA 4BB9A 1QQWA 1NV9A 3QAUA 3T1HM 1GJSA 4IJFA 4LCBA 4B7GA 1GABA 4B08A 4RF1A 3GLGE 1EIJA 1JR3E 4GHLA 1LTMA 2C99A 1I94M 5DFLA 3K8ZA 3FYDA 3KOWE 4IBGA 4LZJA 4R71A 1L2CA 1PRBA 4GH9A 1QAQA 3KXEC 3GLIE 2AHMA 2MH8A 3HJQA 4DR3M 1MU5A 4LFAM 2XH9A 2V6ZM 1WJ7A 3I51A 1XNRM 1V33A 3GRYA 1XXHA 3TE6A 4AKGA 2F5PA 3HKPA 2DAGA 4AZFA 1Q39A 2CEAA 1NVMA 4OW0A 4XBOA 2CRUA 3GLFE 3VK7A 1AIPC 3ZC7B 1SG9A 1OAOC 4MGKE 3KSXA 2JXNA 2K6BA 2QP9X 4JI6M 5IREB 3MMPA 2O01F 3SHFA 3SASA 4JI2M 1TGUA 4FWGA 3T15A 4LF7M 2LXEA 2DWMA 4PT5A 2JY7A 4LJ8A 3TPZA 1J09A 2L7HA 4MH0E 3GLIA 3A46A 3EIHA 4JN6A 5FTNA 3LQRA 3LVWA 1TF0B 3GLGB 2GNOA 1IXSB 3HGIA 2V1CA 4A3VB 2KXEA 2O25A 4DUYM 1DGHA 1D0KA 3B7QA 3KW6A 2YQZA 5FLXS 2G5GX 1HQCA 2R18A 2I7PA 1T6OA 4Y28F 2Z3XA 3KOXE 5EP2A 4LFCM 4NSOB 5KO3A 3HHZA 4DV3M 5DNYA 2X8AA 1NJFA 4PDGA 4G3OA 2JY6B 1TH4A 3FD9A 1N33M 1HNZM 4QNMA 2ZTCA 2BWBA 4FCVA 3GLHA 1PJSA 4DV5M 2R65A 2LWXA 2XFSA 1N32M 3AOEC 4JI7M 3A98B 4IBFA 4AKIA 2MJ5B 2E5LM 3SAUA 3GPYA 4Z8XA 1JB0F 4MGIE 2LVNC
chains in the Genus database with same CATH topology
2EJSA 1OTRA 2DENA 1GO5A 1IFYA 3K9PA 1IM2A 1DV0A 1WGLA 1ZMUA 1E94E 2LTUA 2MGWA 2LVPC 2DAMA 3GLHE 2CWBA 1HJPA 2QSFX 3IHPA 1OKSA 2DNAA 1VQ1A 1R4GA 5JI2E 1TR8A 1NV8A 3BBZA 3E21A 2DAKA 1OAIA 2L4EA 1HT2E 1C7YA 1VG5A 4GEWA 1OQYA 2LVAA 1UFZA 1BVSA 1XXHE 2LVQD 2KNZA 2K0BX 2ZTDA 1G3IA 3FRHA 2JUJA 3H4JA 1XB2B 2OO9A 2JNHA 1MN3A 1ZMVA 1VEKA 1ZV1A 2DAIA 3T6PA 3FRIA 1NV9A 2JP7A 1EFUB 1CUKA 2DHYA 3GLGE 1JR3E 3E46A 1Q02A 3FE3A 4UN2B 1VEJA 5DFLA 2R0IA 4R71A 2HAKA 2BWEA 3GLIE 1TTEA 3F92A 1T43A 1WJ7A 2RRUA 2LBCA 2DAEA 1DO2A 2HWJA 3K9OA 1HT1E 1VEGA 1G41A 1HQYE 2DAGA 2JZ0A 3LCUA 2OOBA 1WIVA 2H5XA 2JY8A 4DBGB 2DI0A 1WHCA 3GLFE 2QHOB 1AIPC 2JY5A 1SG9A 2MR9A 1P3QQ 1PGYA 1V92A 1ZMWA 2OOAA 3MMPA 1IXSA 1QZEA 2JY7A 2MROB 2DKLA 4Q7JA 4F1IA 1WGNA 2KHHA 3B89A 3LCVB 2O25A 2LVOC 4F2LA 1DO0A 1A5TA 1WR1B 2L4FA 2WZJA 2QNJA 1T6OA 3IECA 4WP2A 2JZ1A 1VDLA 2G3QA 1KYIA 4G3OA 2JY6B 1F4IA 2L2DA 2ZTCA 2BWBA 2EKFA 4HEOA 1YLAA 2K9DA 2DZLA 2KNVA 2B3TA 2CP8A 2KNAA 1G4AE 2MJ5B 2EKKA 1Y8GA 2LVNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJS A;  1OTR A;  2DEN A;  1GO5 A;  1IFY A;  3K9P A;  1IM2 A;  1DV0 A;  1WGL A;  1ZMU A;  1E94 E;  2LTU A;  2MGW A;  2LVP C;  2DAM A;  3GLH E;  2CWB A;  1HJP A;  2QSF X;  3IHP A;  1OKS A;  2DNA A;  1VQ1 A;  1R4G A;  5JI2 E;  1TR8 A;  1NV8 A;  3BBZ A;  3E21 A;  2DAK A;  1OAI A;  2L4E A;  1HT2 E;  1C7Y A;  1VG5 A;  4GEW A;  1OQY A;  2LVA A;  1UFZ A;  1BVS A;  1XXH E;  2LVQ D;  2KNZ A;  2K0B X;  2ZTD A;  1G3I A;  3FRH A;  2JUJ A;  3H4J A;  1XB2 B;  2OO9 A;  2JNH A;  1MN3 A;  1ZMV A;  1VEK A;  1ZV1 A;  2DAI A;  3T6P A;  3FRI A;  1NV9 A;  2JP7 A;  1EFU B;  1CUK A;  2DHY A;  3GLG E;  1JR3 E;  3E46 A;  1Q02 A;  3FE3 A;  4UN2 B;  1VEJ A;  5DFL A;  2R0I A;  4R71 A;  2HAK A;  2BWE A;  3GLI E;  1TTE A;  3F92 A;  1T43 A;  1WJ7 A;  2RRU A;  2LBC A;  2DAE A;  1DO2 A;  2HWJ A;  3K9O A;  1HT1 E;  1VEG A;  1G41 A;  1HQY E;  2DAG A;  2JZ0 A;  3LCU A;  2OOB A;  1WIV A;  2H5X A;  2JY8 A;  4DBG B;  2DI0 A;  1WHC A;  3GLF E;  2QHO B;  1AIP C;  2JY5 A;  1SG9 A;  2MR9 A;  1P3Q Q;  1PGY A;  1V92 A;  1ZMW A;  2OOA A;  3MMP A;  1IXS A;  1QZE A;  2JY7 A;  2MRO B;  2DKL A;  4Q7J A;  4F1I A;  1WGN A;  2KHH A;  3B89 A;  3LCV B;  2O25 A;  2LVO C;  4F2L A;  1DO0 A;  1A5T A;  1WR1 B;  2L4F A;  2WZJ A;  2QNJ A;  1T6O A;  3IEC A;  4WP2 A;  2JZ1 A;  1VDL A;  2G3Q A;  1KYI A;  4G3O A;  2JY6 B;  1F4I A;  2L2D A;  2ZTC A;  2BWB A;  2EKF A;  4HEO A;  1YLA A;  2K9D A;  2DZL A;  2KNV A;  2B3T A;  2CP8 A;  2KNA A;  1G4A E;  2MJ5 B;  2EKK A;  1Y8G A;  2LVN C; 
#chains in the Genus database with same CATH topology
 2Z7J A;  2EJS A;  2R6F A;  4IBB A;  3PXG A;  1PJI A;  2BJW A;  4LJ9 A;  4CHT B;  3SC3 A;  1DV0 A;  1ZMU A;  4ITQ A;  2J7N A;  4DR6 M;  4ANR A;  1XMO M;  2DAM A;  5EP4 A;  4BBA A;  2QSF X;  4I8O A;  1XHB A;  5EXT A;  3RFW A;  4REZ A;  3KP1 E;  1VQ1 A;  4W5W A;  2F5O A;  1R4G A;  1IY2 A;  5LMN M;  3HHY A;  1YSY A;  1NV8 A;  4CIS A;  1IXZ A;  2KZS A;  3E21 A;  2L4E A;  1NJG A;  1XC8 A;  1HT2 E;  4MB7 A;  3NBX X;  1C7Y A;  1PJJ A;  4IBE A;  1XXH E;  3FUV A;  1OIP A;  1KSF X;  2ERC A;  2ZBK B;  3TWM A;  3WHK A;  5A2Q S;  3GPU A;  3GQ5 A;  4LJ6 A;  3GPX A;  1ZMV A;  4IBK A;  2DAI A;  3L27 A;  2UUB M;  3SAV A;  4X62 M;  3FRI A;  5EQT A;  3RGP A;  2JP7 A;  3LVV A;  3UGJ A;  4I4L A;  4P17 A;  1CUK A;  2R44 A;  2CV2 A;  3HHX A;  1PJT A;  3E46 A;  4UN2 B;  3FE3 A;  2R0I A;  1OFH A;  1T3T A;  2XF3 A;  3JR5 A;  4FWD A;  5FTL A;  1G71 A;  2V1U A;  5IT9 S;  1TDZ A;  3TQS A;  2BWE A;  3SAT A;  2VDB B;  4LFB M;  1TTE A;  3GRV A;  3GLH B;  5LMU M;  3VDU A;  2CHQ A;  2QZ4 A;  1FJG M;  1NSF A;  2LBC A;  1DO2 A;  1XXH B;  1EE8 A;  2HKJ A;  2JA2 A;  1MX0 A;  1IY0 A;  3GQ4 A;  2ZAN A;  3VLF B;  2JZ0 A;  1QUS A;  1HNW M;  2OOB A;  1WIV A;  3L28 A;  3B74 A;  5FTM A;  4DBG B;  2DI0 A;  3C3E A;  5EXP A;  3HJ8 A;  3I01 M;  4DR5 M;  3ZH9 B;  4FVM A;  2BJV A;  2QHO B;  2JY5 A;  2RGO A;  4DV4 M;  2YNM D;  3DA1 A;  1V92 A;  2P5T A;  2OOA A;  4X66 M;  5H37 D;  4Z6Y A;  1IXR C;  3HHW A;  4X64 M;  3FUU A;  1FNN A;  4DV7 M;  1IY1 A;  1SXJ C;  1GVN A;  3VDP A;  4F1I A;  2QBY A;  3SAW A;  1QDR A;  1WGN A;  2QQ8 A;  4I5S A;  3TWL A;  5EP3 A;  3U6C A;  3L25 A;  4NXN M;  4F2L A;  1N77 A;  2L6O A;  2CFO A;  2VQF M;  2WZJ A;  1N34 M;  2CE7 A;  3GPP A;  3QWL A;  1LV7 A;  3KFU G;  4TUW A;  4AI6 A;  8CAT A;  2EO2 A;  2C98 A;  3K92 A;  1VDL A;  3J7B A;  4M9S A;  4G4N A;  1L8Q A;  1E32 A;  2W82 A;  4LJ5 A;  1KYI A;  3R8F A;  1L1Z A;  1NHG C;  1QVR A;  4WUR A;  4B3S M;  3LMM A;  2RKO A;  3E9S A;  2M5Z A;  2VQE M;  3AOE A;  4LRS A;  2LHG A;  4L6V 6;  2X49 A;  3GRU A;  4LRT A;  1D0L A;  1G4A E;  2CHG A;  4RKU F;  4M9Z A;  4IBJ A;  1R6B X;  3AKZ A;  1IN5 A;  3W68 A;  4IBC A;  3W0L B;  3SAR A;  1IBL M;  1JR3 A;  2FH0 A;  1OFI A;  3VFD A;  3W67 A;  3GLG A;  2DXI A;  4PD2 A;  2UUA M;  2DZN B;  2WSC F;  1E94 E;  1R5L A;  3FUT A;  4EIW A;  4L4U A;  3H4M A;  2OQ4 A;  4NL4 H;  3GLH E;  2UUC M;  1Q3C A;  4NRV A;  1OKS A;  4AW4 A;  1GLN A;  5EXX A;  4ZPX A;  4JI1 M;  2XZF A;  1W5S A;  1UM8 A;  1ZAE A;  4OVZ B;  3U6D A;  3U61 A;  2DWN A;  4RF0 A;  4GHA A;  1N78 A;  3MJ5 A;  1X37 A;  4LF4 M;  1TR8 A;  3NWL A;  4AG5 A;  4PDI A;  4LF9 M;  3C3D A;  2XFT A;  3BBZ A;  3KVW A;  4QNR A;  2LNH C;  4G6Z A;  3ZCB B;  4NOO B;  4G4Q A;  3HU3 A;  4GEW A;  2LVA A;  4KLN A;  3MK6 A;  1IBM M;  3AFH A;  3FTF A;  4K0K M;  2KNZ A;  2VF8 A;  2ZTD A;  3FRH A;  3VK8 A;  3H4J A;  2NQ8 C;  1XB2 B;  3GLI B;  2JNH A;  3J80 S;  1MN3 A;  5IWA M;  3BOS A;  3U6M A;  3B7N A;  1L2B A;  3PNV A;  2J5Y A;  3U6Q A;  2ZM6 M;  2UXB M;  2KRU A;  1EFU B;  2I7N A;  2C96 A;  3GRR A;  4GIT A;  3KOZ E;  1R2Y A;  4HLQ A;  1SXJ D;  1NO1 A;  1Q02 A;  2KW0 A;  2R4E A;  3AOG A;  4XK8 F;  2Z8Y M;  4M9X A;  4NXM M;  1L2D A;  2DZO B;  3MHV C;  2QBY B;  3L26 A;  3GQ3 A;  2HAK A;  4JI8 M;  1XNQ M;  4CIZ A;  4L78 A;  4LJ4 A;  1R7R A;  4L8R C;  3FTE A;  3UZU A;  1T43 A;  2Q2E B;  3HU2 A;  4MM3 B;  4QHT A;  2DAE A;  3SYL A;  4DR7 M;  1Z59 A;  1J5E M;  3DFZ A;  3E4R A;  1HT1 E;  1VEG A;  2KDL A;  1HQY E;  1H6U A;  1K3W A;  4R3D A;  2CHV A;  2JY8 A;  1E9R A;  5EJC A;  5BR8 M;  3GLF A;  3AV0 A;  5ITY A;  1SXJ B;  2J7O A;  5ITX A;  1WHC A;  1AUA A;  2VF7 A;  4JXJ A;  2DHR A;  3I04 M;  4M0D A;  2MR9 A;  1PGY A;  1ZMW A;  1HNX M;  1XMQ M;  2FNA A;  4NC6 A;  1IXS A;  3HZJ A;  5DYI A;  3D8B A;  1DGB A;  1HR0 M;  1QZE A;  3QYE A;  2APL A;  2MRO B;  1SXJ A;  2DWL A;  3VKH A;  1TDH A;  3C9P A;  3AJI B;  2LH0 A;  3T38 A;  3CF6 E;  4IJE A;  2D7H A;  4D80 A;  2KHH A;  3B89 A;  2ZAM A;  1OJL A;  3LCV B;  3UJN A;  1IN7 A;  3U6E A;  5FSW A;  1NNJ A;  2Y20 A;  3LW5 F;  5F3W A;  2A5Y B;  3HY5 A;  2D7E A;  4NRW A;  4B3M M;  2G8L A;  4AKH A;  4IIW A;  3TWK A;  4GKJ M;  7CAT A;  3J27 B;  4JI3 M;  2UXC M;  5BPV A;  4MGZ E;  4YHH M;  4DV2 M;  3B7Z A;  3KS8 A;  2HL7 A;  2C9O A;  3CF0 A;  1F4I A;  1YUB A;  3U60 A;  2YR0 A;  4DR1 M;  2L2D A;  3W0F A;  5JI3 E;  2Y0T A;  4PCZ A;  1G59 A;  4HEO A;  4BLC A;  3R9X B;  2K9D A;  3FKE A;  2FFJ A;  3FTD A;  1D0M A;  2KNV A;  3PVS A;  2B3T A;  3KP0 E;  2CP8 A;  2KNA A;  3D8L A;  5E26 A;  3T1Y M;  2EKK A;  2X4A A;  2R46 A;  1DGH B;  1IN6 A;  3I4Y A;  5FTK A;  4DV6 M;  4FD2 A;  2FS1 A;  1K82 A;  1WXQ A;  3SMS A;  1OTR A;  5KPR A;  4DV0 M;  1Z5C A;  1GO5 A;  1S3S A;  4QOS A;  1Z5B A;  1IM2 A;  3K9P A;  3M0E A;  5ITX E;  1WGL A;  4CJ6 A;  3J2P B;  4CGY B;  4D81 A;  3SFZ A;  3GLF B;  3U5Z A;  1HJP A;  3IHP A;  3J7A S;  3U60 B;  2F5Q A;  2L7I A;  5GKN A;  1KFV A;  4FCW A;  4DUZ M;  4B3T M;  4GRI A;  1QAN A;  5JI2 E;  4R7G A;  5L8R F;  4LJ7 A;  3THG A;  1NHW C;  2DAK A;  3A42 A;  2F5S A;  2D7G A;  1PM5 A;  3M6A A;  4JI4 M;  1VG5 A;  2FOI C;  2XGN A;  3DZD A;  4LJA A;  4G4O A;  2O5R A;  1TH3 A;  2N35 A;  1PJQ A;  3GP1 A;  3B9P A;  3A45 A;  5E6J A;  1NNU C;  4JYA M;  4AG6 A;  2QEN A;  2JWS A;  1G3I A;  2KRK A;  3U5Z B;  2OO9 A;  5EP1 A;  3U6O A;  4LF8 M;  2R62 A;  1IN4 A;  4L15 A;  1GL7 A;  2QPA A;  4XGI A;  4JV5 M;  3IG5 A;  1L1T A;  1C1K A;  2XZU A;  2DHY A;  3KSJ A;  1RU3 A;  1VEJ A;  3UMM A;  3SBJ A;  3Q8X A;  4DR4 M;  4GC9 A;  4NSR A;  2DWZ B;  1J7K A;  5DYG A;  4IBD A;  1Z6T A;  3L2A A;  4OX9 M;  2CV0 A;  3F92 A;  2EA0 A;  3FUW A;  4B7H A;  1DGG A;  1QAM A;  3K1J A;  2Z4S A;  2RRU A;  4JI5 M;  1R2Z A;  3WHL A;  2F5N A;  4L16 A;  1QDT A;  2HWJ A;  3K9O A;  4KOD A;  4II7 A;  1IQP A;  1GL6 A;  1E9S A;  3LCU A;  1G41 A;  1XWI A;  4MGY E;  2XEP A;  4YY3 M;  2H5X A;  5C18 A;  1ZQ9 A;  3PNY A;  3KS4 A;  4KHP M;  1IN8 A;  2WSF F;  3OTO M;  1DGF A;  1Q3B A;  3KOY E;  1N36 M;  2GQF A;  2KZU A;  4AQY M;  2F4V M;  4KT0 F;  2DVW B;  1P3Q Q;  3JR4 A;  5C1B A;  3U6P A;  2R45 A;  3DOA A;  3HJS A;  3RGS A;  2C5R A;  3EIE A;  1NY5 A;  4LGM A;  2DKL A;  5KQ8 A;  4GC5 A;  4Q7J A;  4IBI A;  3L29 A;  4RNA A;  2FE8 A;  5KQD A;  4GKK M;  2HCB A;  1W5T A;  2K47 A;  1GKI A;  3KDS E;  3K2L A;  1MJG M;  3U61 B;  2OPF A;  2KA6 B;  1G8P A;  1YE9 A;  2LVO C;  4I81 A;  1K3X A;  3HWS A;  1DO0 A;  1A5T A;  1WR1 B;  3HX3 A;  2L4F A;  2M60 A;  3U6S A;  2QNJ A;  3TL4 X;  3IEC A;  3PFI A;  1ORY B;  4WP2 A;  4B7F A;  3SHG B;  3GO8 A;  2JZ1 A;  3U6L A;  2G3Q A;  2HHH M;  2ZAO A;  2Z4R A;  1D2N A;  4FWH A;  3LQQ A;  2EKF A;  1YLA A;  4G4R A;  1Z5A A;  2R4J A;  2XLJ A;  4LG2 A;  1N75 A;  2DZL A;  4KO8 A;  3SYK A;  1OIZ A;  4OU7 A;  1NY6 A;  1V34 A;  4M0W A;  1QZM A;  2Y0Q A;  3JAM S;  5ITT A;  3CTW B;  5IZ7 D;  3UK6 A;  4LGY A;  2XSZ D;  1Y8G A;  4LF5 M;  1IFY A;  5FTJ A;  3FUX A;  2LHC A;  4MGH A;  3ILK A;  1QUT A;  3HU1 A;  2BNK A;  1GJT A;  2DEN A;  4GMQ A;  4S12 A;  3RE8 A;  4FW9 A;  3NBI A;  1QAO A;  2YFQ A;  4B3R M;  4DR2 M;  4QOZ C;  3J81 S;  3VKG A;  2LTU A;  2MGW A;  2RGH A;  4GIP A;  4JI0 M;  5ITQ A;  2LVP C;  2VII A;  1JQJ C;  2CWB A;  4LZZ A;  3M7G A;  3C58 A;  2UU9 M;  5EXS A;  2DNA A;  3FYC A;  3FTC A;  2KEB A;  4QHS A;  5KPZ A;  2Y21 A;  2H1R A;  4X65 M;  3V76 A;  4DV1 M;  5ITR A;  2CUZ A;  4LF6 M;  2C9C A;  3ZQJ A;  1OAI A;  1IBK M;  1OQY A;  3CGW A;  1UFZ A;  1BVS A;  4FCT A;  4LY6 A;  2L09 A;  4OVZ A;  1QYR A;  2LVQ D;  4WW0 A;  3SMP A;  2CV1 A;  3AL0 C;  3BXW A;  2UXD M;  2K0B X;  3IG8 A;  3QYB A;  1TH2 A;  4D82 A;  2JUJ A;  2QCU A;  3I4V A;  2WSE F;  5ITU A;  1VDD A;  5KPT A;  2EUC A;  4P16 A;  1JR3 D;  3Q8G A;  2XSZ A;  4HL4 A;  1I4W A;  1VEK A;  1SXJ E;  1ZV1 A;  3CF2 A;  3T6P A;  4BB9 A;  1QQW A;  1NV9 A;  3QAU A;  3T1H M;  1GJS A;  4IJF A;  4LCB A;  4B7G A;  1GAB A;  4B08 A;  4RF1 A;  3GLG E;  1EIJ A;  1JR3 E;  4GHL A;  1LTM A;  2C99 A;  1I94 M;  5DFL A;  3K8Z A;  3FYD A;  3KOW E;  4IBG A;  4LZJ A;  4R71 A;  1L2C A;  1PRB A;  4GH9 A;  1QAQ A;  3KXE C;  3GLI E;  2AHM A;  2MH8 A;  3HJQ A;  4DR3 M;  1MU5 A;  4LFA M;  2XH9 A;  2V6Z M;  1WJ7 A;  3I51 A;  1XNR M;  1V33 A;  3GRY A;  1XXH A;  3TE6 A;  4AKG A;  2F5P A;  3HKP A;  2DAG A;  4AZF A;  1Q39 A;  2CEA A;  1NVM A;  4OW0 A;  4XBO A;  2CRU A;  3GLF E;  3VK7 A;  1AIP C;  3ZC7 B;  1SG9 A;  1OAO C;  4MGK E;  3KSX A;  2JXN A;  2K6B A;  2QP9 X;  4JI6 M;  5IRE B;  3MMP A;  2O01 F;  3SHF A;  3SAS A;  4JI2 M;  1TGU A;  4FWG A;  3T15 A;  4LF7 M;  2LXE A;  2DWM A;  4PT5 A;  2JY7 A;  4LJ8 A;  3TPZ A;  1J09 A;  2L7H A;  4MH0 E;  3GLI A;  3A46 A;  3EIH A;  4JN6 A;  5FTN A;  3LQR A;  3LVW A;  1TF0 B;  3GLG B;  2GNO A;  1IXS B;  3HGI A;  2V1C A;  4A3V B;  2KXE A;  2O25 A;  4DUY M;  1DGH A;  1D0K A;  3B7Q A;  3KW6 A;  2YQZ A;  5FLX S;  2G5G X;  1HQC A;  2R18 A;  2I7P A;  1T6O A;  4Y28 F;  2Z3X A;  3KOX E;  5EP2 A;  4LFC M;  4NSO B;  5KO3 A;  3HHZ A;  4DV3 M;  5DNY A;  2X8A A;  1NJF A;  4PDG A;  4G3O A;  2JY6 B;  1TH4 A;  3FD9 A;  1N33 M;  1HNZ M;  4QNM A;  2ZTC A;  2BWB A;  4FCV A;  3GLH A;  1PJS A;  4DV5 M;  2R65 A;  2LWX A;  2XFS A;  1N32 M;  3AOE C;  4JI7 M;  3A98 B;  4IBF A;  4AKI A;  2MJ5 B;  2E5L M;  3SAU A;  3GPY A;  4Z8X A;  1JB0 F;  4MGI E;  2LVN C; 
#chains in the Genus database with same CATH homology
 2EJS A;  1OTR A;  2DEN A;  1GO5 A;  1IFY A;  3K9P A;  1IM2 A;  1DV0 A;  1WGL A;  1ZMU A;  1E94 E;  2LTU A;  2MGW A;  2LVP C;  2DAM A;  3GLH E;  2CWB A;  1HJP A;  2QSF X;  3IHP A;  1OKS A;  2DNA A;  1VQ1 A;  1R4G A;  5JI2 E;  1TR8 A;  1NV8 A;  3BBZ A;  3E21 A;  2DAK A;  1OAI A;  2L4E A;  1HT2 E;  1C7Y A;  1VG5 A;  4GEW A;  1OQY A;  2LVA A;  1UFZ A;  1BVS A;  1XXH E;  2LVQ D;  2KNZ A;  2K0B X;  2ZTD A;  1G3I A;  3FRH A;  2JUJ A;  3H4J A;  1XB2 B;  2OO9 A;  2JNH A;  1MN3 A;  1ZMV A;  1VEK A;  1ZV1 A;  2DAI A;  3T6P A;  3FRI A;  1NV9 A;  2JP7 A;  1EFU B;  1CUK A;  2DHY A;  3GLG E;  1JR3 E;  3E46 A;  1Q02 A;  3FE3 A;  4UN2 B;  1VEJ A;  5DFL A;  2R0I A;  4R71 A;  2HAK A;  2BWE A;  3GLI E;  1TTE A;  3F92 A;  1T43 A;  1WJ7 A;  2RRU A;  2LBC A;  2DAE A;  1DO2 A;  2HWJ A;  3K9O A;  1HT1 E;  1VEG A;  1G41 A;  1HQY E;  2DAG A;  2JZ0 A;  3LCU A;  2OOB A;  1WIV A;  2H5X A;  2JY8 A;  4DBG B;  2DI0 A;  1WHC A;  3GLF E;  2QHO B;  1AIP C;  2JY5 A;  1SG9 A;  2MR9 A;  1P3Q Q;  1PGY A;  1V92 A;  1ZMW A;  2OOA A;  3MMP A;  1IXS A;  1QZE A;  2JY7 A;  2MRO B;  2DKL A;  4Q7J A;  4F1I A;  1WGN A;  2KHH A;  3B89 A;  3LCV B;  2O25 A;  2LVO C;  4F2L A;  1DO0 A;  1A5T A;  1WR1 B;  2L4F A;  2WZJ A;  2QNJ A;  1T6O A;  3IEC A;  4WP2 A;  2JZ1 A;  1VDL A;  2G3Q A;  1KYI A;  4G3O A;  2JY6 B;  1F4I A;  2L2D A;  2ZTC A;  2BWB A;  2EKF A;  4HEO A;  1YLA A;  2K9D A;  2DZL A;  2KNV A;  2B3T A;  2CP8 A;  2KNA A;  1G4A E;  2MJ5 B;  2EKK A;  1Y8G A;  2LVN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...