2JNHA

Solution structure of the uba domain from cbl-b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
ALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Differential ubiquitin binding of the UBA domains from human c-Cbl and Cbl-b: NMR structural and biochemical insights
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jnhA00
1HJPA 1OKSA 2JY5A 2OOAA 2K9DA 2JY8A 4F1IA 2MROB 2ZTDA 1QZEA 1DV0A 3GLGE 2JNHA 2DAMA 1PGYA 2KHHA 2LVNC 1NV8A 2HAKA 3K9PA 1Q02A 2LTUA 2KNZA 2HWJA 1EFUB 1GO5A 2K0BX 2OOBA 2R0IA 1DO0A 2DENA 1WIVA 2JZ0A 2EKKA 1T43A 4Q7JA 1OAIA 2G3QA 2QNJA 2WZJA 1IM2A 2B3TA 3FRHA 1TR8A 2LVQD 3F92A 3BBZA 1MN3A 4R71A 2MJ5B 1OTRA 3LCUA 1TTEA 3E46A 1ZMWA 1VEJA 1YLAA 1G4AE 2DAEA 1VEGA 1JR3E 1XXHE 2L4FA 2O25A 1Y8GA 1AIPC 1WJ7A 4DBGB 4G3OA 1IXSA 1CUKA 2LVPC 3FRIA 2MGWA 2DZLA 2JP7A 2EKFA 1ZMVA 2JY6B 1DO2A 2DKLA 2CWBA 2MR9A 1VDLA 1G41A 3GLHE 1R4GA 1VG5A 5DFLA 4GEWA 2OO9A 3E21A 3GLIE 1F4IA 2JZ1A 1SG9A 1XB2B 4HEOA 3GLFE 1E94E 1HQYE 1G3IA 1P3QQ 3LCVB 2EJSA 2DAIA 1V92A 1ZV1A 1OQYA 2JUJA 2QSFX 4UN2B 3K9OA 1A5TA 1WR1B 4F2LA 2KNAA 1KYIA 3FE3A 1WHCA 1HT1E 2BWEA 1ZMUA 1T6OA 2DHYA 3IHPA 1IFYA 5JI2E 3MMPA 1UFZA 3B89A 2DAGA 2QHOB 2KNVA 2DI0A 1C7YA 1VEKA 2L2DA 2DNAA 2LBCA 1NV9A 2ZTCA 1HT2E 1VQ1A 2L4EA 1WGLA 2JY7A 2RRUA 3IECA 2LVOC 2H5XA 1BVSA 2DAKA 2BWBA 3H4JA 2LVAA 4WP2A 3T6PA 1WGNA 2CP8A
chains in the Genus database with same CATH superfamily
3L29A 3RGPA 3ZC7B 3GPYA 3U6MA 1Q3BA 3UJNA 4M0WA 1IY1A 3FUTA 4P17A 2A5YB 4QOSA 4F1IA 4LF7M 3GRRA 2XH9A 1S3SA 3D8LA 3OTOM 4B3RM 4L16A 1DV0A 3E4RA 3I4VA 4JV5M 2UXDM 3DFZA 2LVNC 5EXTA 1QDRA 4L6V6 2C9CA 3K9PA 2UUBM 2LTUA 3RFWA 3AV0A 2HWJA 4GC9A 4JXJA 3MK6A 4MH0E 4EIWA 4GMQA 4M0DA 3U6QA 5FTLA 2R0IA 1DO0A 1QAOA 1WIVA 2DENA 2JZ0A 2QP9X 3TWLA 3UZUA 4Q7JA 4G4QA 1OAIA 1TGUA 4Z6YA 1GLNA 2G3QA 1NY6A 2O01F 2QNJA 2YNMD 2LXEA 3KOZE 2XZFA 4LJ4A 3PNYA 4AKIA 1XMOM 1IBLM 2Y21A 4JI4M 2B3TA 4K0KM 1FNNA 3AKZA 3J27B 4PCZA 2WSEF 3KOYE 2Z4SA 4X65M 1N32M 3W68A 4LF6M 1GKIA 2KZUA 2CHVA 2HL7A 1D0KA 3HHXA 3KOWE 5FTKA 4LJ6A 2FOIC 2D7EA 4LCBA 3VDUA 5IT9S 2NQ8C 3GO8A 2CUZA 2FH0A 3LCUA 4NSOB 3I01M 3FUUA 1ZMWA 2V1CA 3CF6E 4I4LA 1YLAA 2VDBB 2CV0A 1SXJC 3QYEA 1G4AE 2DAEA 2HHHM 3SATA 1JR3E 1XXHE 2L4FA 1XC8A 2RGHA 1L2CA 3NBIA 1AIPC 1QVRA 4LJ7A 1N77A 2YQZA 2QBYA 3KP0E 3GP1A 2L7HA 1L2BA 2UUCM 4CISA 1EE8A 2R18A 2Y20A 1OIPA 2VF8A 3KS8A 3JR4A 1OFHA 2CE7A 2DZLA 3EIEA 2JP7A 3J7BA 4IIWA 1ZMVA 5EQTA 5ITTA 3HKPA 1K3WA 3GLGA 4B3SM 3K8ZA 4IBGA 2VQEM 2JY6B 5EXXA 3SFZA 2DKLA 1NY5A 2MR9A 1D0MA 1VDLA 3GLHE 2F5PA 3B74A 4A3VB 4DV7M 1D2NA 2XF3A 4IBCA 4DV2M 4Y28F 5KPZA 1TF0B 2JZ1A 1SG9A 1HQYE 3LCVB 2CV2A 2AHMA 4LF9M 1V92A 1TH3A 3ILKA 4IBBA 3SHGB 3HX3A 4HL4A 3C9PA 3AL0C 1WR1B 4P16A 2K6BA 4QHTA 3TL4X 1KYIA 4WW0A 3W67A 4QOZC 3SAUA 2CEAA 1QAMA 1ZMUA 1SXJE 2BWEA 3A98B 1T6OA 5E6JA 4PDIA 5JI2E 5EXPA 4PDGA 2QQ8A 1UFZA 3B89A 2O5RA 2DZOB 3U6OA 3HGIA 3L28A 3C58A 2DNAA 1XHBA 1GL6A 3AOEA 4FCVA 4PT5A 4B7HA 3J2PB 2C5RA 1QYRA 1JR3D 4B3MM 1N78A 3R9XB 3VKHA 1V33A 2JY7A 2H5XA 1BVSA 3HJSA 3GQ4A 3MJ5A 3SHFA 1RU3A 1WGNA 3SC3A 2UUAM 1HJPA 1WXQA 4DR4M 2OOAA 4X64M 2GNOA 3R8FA 2APLA 2K9DA 4KO8A 4NC6A 4JI5M 4LF5M 1ZAEA 2MROB 4M9SA 4L4UA 3AOEC 3FTDA 1NVMA 3GLGE 2EA0A 3U6PA 2G8LA 2JNHA 4QHSA 4MGYE 2FS1A 2DAMA 2DVWB 1PGYA 4FCTA 4XK8F 3RE8A 1OAOC 3ZH9B 4MGKE 4G4RA 2HAKA 4NL4H 2J7NA 4OX9M 1IN5A 1Q02A 2L09A 1GJTA 2KNZA 3SARA 3U60A 2QZ4A 3VKGA 3T15A 1XXHB 2K0BX 4L78A 4DR5M 1IN4A 4FD2A 1UM8A 2EKKA 2KRUA 1T43A 5IWAM 4L8RC 3SMSA 4CHTB 3TWKA 3UK6A 3M6AA 5E26A 1TH4A 1IM2A 2J5YA 2R62A 3KSJA 3SYKA 4LF4M 1GVNA 3WHKA 1TDHA 4AKGA 3C3EA 2ERCA 3GLHA 2LVQD 3GLHB 3U6CA 3F92A 4I81A 1MN3A 3KS4A 3FUXA 3BOSA 2LNHC 3FTEA 3B7ZA 5C1BA 1L1ZA 2R4JA 3PFIA 1OTRA 3GQ3A 2DZNB 1TTEA 2ZAOA 3E46A 3KVWA 1QQWA 3CF2A 1I4WA 2Z7JA 3FYCA 2YFQA 3GPPA 2CHQA 1R5LA 4GKJM 1ZQ9A 5H37D 1Y8GA 4W5WA 1H6UA 3LQQA 1SXJA 2ZM6M 1WJ7A 2F4VM 5ITXE 1SXJB 1Z5CA 4G3OA 1NHGC 1IY0A 7CATA 3VK8A 2Z3XA 4YY3M 1IXSA 1IN8A 1IXSB 3FRIA 4B7FA 2D7GA 5KO3A 2KXEA 3I4YA 4TUWA 3LVVA 1DO2A 3Q8XA 4L15A 5DFLA 1G59A 4II7A 1R4GA 4AKHA 4KODA 3DOAA 4GEWA 1QUSA 2RGOA 1HNXM 5ITQA 4CGYB 1C1KA 4HEOA 3U61A 1P3QQ 2R4EA 3U61B 4GITA 3SMPA 1IY2A 1PJJA 2J7OA 1ZV1A 2JUJA 2CHGA 2CRUA 2V6ZM 1A5TA 3FUVA 4DV0M 1GABA 2OQ4A 1V34A 1HT1E 1HNZM 3U6EA 3C3DA 1E9SA 2QBYB 2DHYA 2ZAMA 3IHPA 1NNJA 5JI3E 1IBMM 2F5QA 5DNYA 1IFYA 3L26A 4LRSA 3KFUG 4GKKM 2QHOB 2XLJA 3FTCA 4AW4A 3VFDA 5FLXS 3GLGB 3U6DA 4KHPM 4G4NA 3VDPA 2LWXA 1X37A 2M5ZA 1HT2E 5IREB 2X49A 3SAVA 3WHLA 3U6SA 2XSZA 1WGLA 4LFBM 4LRTA 2LVOC 3KW6A 4ITQA 1R2ZA 2DAKA 1IBKM 2R65A 5BPVA 2XEPA 2LHGA 1PM5A 3EIHA 3T6PA 4DR6M 1PJSA 2Y0TA 5EXSA 1OKSA 4DV3M 3TE6A 3JAMS 2DXIA 2JY8A 4LGYA 4FWHA 1N33M 3SASA 4FWDA 3W0FA 5EP2A 2ZTDA 2C99A 1NJGA 5C18A 4DUZM 4R7GA 2V1UA 3HU3A 3GLFA 5ITYA 5IZ7D 2BJWA 1NV8A 4MGIE 4BB9A 4DR2M 1LTMA 1IN6A 4JI3M 4JN6A 1N34M 4FW9A 3HZJA 2W82A 4KT0F 2BJVA 4LJ9A 3VLFB 2VF7A 4NOOB 3ZQJA 5ITXA 3THGA 1QANA 3A46A 5DYGA 1D0LA 2L6OA 2L7IA 2LH0A 4LFCM 2KEBA 2WZJA 4PD2A 1DGHA 4DR3M 2DWLA 4MM3B 4IBDA 1PJIA 2KDLA 2UXCM 4DR1M 3GPXA 2JA2A 4JI6M 3PNVA 5A2QS 4JYAM 1OJLA 2C9OA 5DYIA 4DV5M 3W0LB 1DGBA 4IBFA 4AI6A 2MJ5B 1Z5BA 3CF0A 4AQYM 3GRYA 4LJAA 4OVZA 3GRVA 3J80S 4FCWA 4OVZB 1L2DA 4LGMA 4GRIA 2DWNA 2XGNA 3KDSE 3U60B 2O25A 1HQCA 2F5OA 3HHYA 1SXJD 2G5GX 1NNUC 1J7KA 2XFSA 2R6FA 4DV6M 1Q3CA 3HU1A 4OU7A 1CUKA 4S12A 4LFAM 3BXWA 4NRWA 2EKFA 1EIJA 2I7PA 3HY5A 1Z59A 1IN7A 2KW0A 2CWBA 3V76A 3TWMA 1TDZA 1YUBA 1VG5A 1IXZA 4XGIA 2F5NA 3U5ZA 2OO9A 2EO2A 3GLIE 3U5ZB 1HNWM 1J5EM 4Z8XA 3GLFE 1XB2B 2FE8A 2ZANA 3FD9A 4DR7M 1QDTA 1G3IA 5EP1A 4JI8M 2DAIA 1OFIA 4MGHA 1OQYA 2H1RA 4REZA 3KOXE 2I7NA 4FWGA 1XMQM 3K9OA 4NXMM 4F2LA 1N36M 3FE3A 3T1YM 3B7QA 3T1HM 3AFHA 4LZJA 3K92A 4M9XA 2DWZB 4DV1M 1MJGM 3CTWB 4AG5A 3GPUA 1XNRM 2R46A 3IG5A 3MMPA 1MX0A 3CGWA 3Q8GA 1GJSA 3UGJA 2KNVA 1G71A 1E32A 2QCUA 5EP4A 4XBOA 1YE9A 4LY6A 1Z6TA 3LW5F 4MB7A 2C96A 1NV9A 2LBCA 3GRUA 3MHVC 4AZFA 2ZTCA 3I51A 1AUAA 2UU9M 4B3TM 2JXNA 4RF0A 2HCBA 4D81A 1I94M 2M60A 2XSZD 3E9SA 4JI2M 2RRUA 3FUWA 2FFJA 3IECA 2LHCA 1NSFA 2BWBA 4LJ8A 2Q2EB 4RF1A 5F3WA 4WP2A 3D8BA 5LMUM 5KQ8A 1QUTA 2CP8A 3TQSA 1LV7A 2JY5A 1VDDA 5FTJA 2ZBKB 1E9RA 1ORYB 4D80A 4BBAA 3J81S 4G4OA 1QZEA 4HLQA 4JI1M 5FTMA 4R3DA 3AOGA 1YSYA 2EUCA 4MGZE 3TPZA 2KHHA 4B7GA 1MU5A 1K82A 2F5SA 4RNAA 4LF8M 4NRVA 4IBKA 2Z8YM 4CJ6A 3A45A 5ITRA 5LMNM 1EFUB 3M7GA 5EP3A 1PJTA 3QWLA 4CIZA 4GHAA 3DA1A 2Y0QA 3SAWA 1HR0M 2CV1A 4QNRA 1GO5A 5KPTA 1W5SA 2OOBA 1NJFA 4JI0M 3VK7A 4LJ5A 2DWMA 4IBEA 4M9ZA 3K2LA 2R44A 1QZMA 1J09A 3PVSA 1N75A 3JR5A 3HU2A 1IXRC 3FRHA 1TR8A 4NXNM 2D7HA 1NHWC 4LG2A 1R6BX 3BBZA 3KP1E 4G6ZA 4I5SA 3GLIA 3IG8A 3J7AS 3GLIB 4IBJA 1R7RA 4R71A 1DGGA 3GLFB 5EJCA 3QAUA 2XFTA 8CATA 4GC5A 2OPFA 3DZDA 1VEJA 2GQFA 2QPAA 3L27A 4FVMA 2KZSA 3ZCBB 5KQDA 2Z4RA 1VEGA 2BNKA 4RKUF 1W5TA 4YHHM 1T3TA 4D82A 3HWSA 4QNMA 3L2AA 3RGSA 4GH9A 4X62M 4DBGB 4KLNA 2FNAA 2VQFM 2N35A 4DUYM 4WURA 2LVPC 3QYBA 5GKNA 2MGWA 4OW0A 4B08A 1DGHB 4IBIA 3LQRA 2P5TA 2UXBM 2YR0A 3LMMA 3HHWA 4LZZA 2MH8A 1L1TA 2JWSA 4IJFA 1G41A 1GL7A 2R45A 3B9PA 5FTNA 2CFOA 3E21A 3AJIB 3LVWA 4IJEA 1NO1A 1Q39A 4X66M 4BLCA 3SBJA 1F4IA 3M0EA 1E94E 3PXGA 1JB0F 2EJSA 2E5LM 2KA6B 3KSXA 1PRBA 3U6LA 2DHRA 3NWLA 4DV4M 1QAQA 2QSFX 2K47A 4UN2B 1FJGM 4GHLA 2KNAA 5KPRA 1TH2A 3KXEC 1WHCA 3K1JA 3NBXX 1R2YA 2WSCF 3UMMA 2RKOA 1JQJC 1XNQM 3HJQA 5ITUA 3H4MA 3FTFA 5L8RF 2X4AA 1KFVA 2DAGA 2KRKA 3GQ5A 1K3XA 3B7NA 4AG6A 2C98A 2DI0A 4NSRA 3T38A 1IQPA 4ANRA 1VEKA 2L2DA 2HKJA 2VIIA 3FYDA 3HJ8A 1C7YA 1Z5AA 4I8OA 4GIPA 3I04M 1XWIA 3HHZA 2WSFF 4JI7M 1VQ1A 3FKEA 1JR3A 1XXHA 1DGFA 5BR8M 2L4EA 2XZUA 4ZPXA 3L25A 5FSWA 1OIZA 3H4JA 2LVAA 3SYLA 2QENA 1KSFX 3A42A 1L8QA 1G8PA 2X8AA 1PJQA
chains in the Genus database with same CATH topology
1HJPA 1OKSA 2JY5A 2OOAA 2K9DA 2JY8A 4F1IA 2MROB 2ZTDA 1QZEA 1DV0A 3GLGE 2JNHA 2DAMA 1PGYA 2KHHA 2LVNC 1NV8A 2HAKA 3K9PA 1Q02A 2LTUA 2KNZA 2HWJA 1EFUB 1GO5A 2K0BX 2OOBA 2R0IA 1DO0A 2DENA 1WIVA 2JZ0A 2EKKA 1T43A 4Q7JA 1OAIA 2G3QA 2QNJA 2WZJA 1IM2A 2B3TA 3FRHA 1TR8A 2LVQD 3F92A 3BBZA 1MN3A 4R71A 2MJ5B 1OTRA 3LCUA 1TTEA 3E46A 1ZMWA 1VEJA 1YLAA 1G4AE 2DAEA 1VEGA 1JR3E 1XXHE 2L4FA 2O25A 1Y8GA 1AIPC 1WJ7A 4DBGB 4G3OA 1IXSA 1CUKA 2LVPC 3FRIA 2MGWA 2DZLA 2JP7A 2EKFA 1ZMVA 2JY6B 1DO2A 2DKLA 2CWBA 2MR9A 1VDLA 1G41A 3GLHE 1R4GA 1VG5A 5DFLA 4GEWA 2OO9A 3E21A 3GLIE 1F4IA 2JZ1A 1SG9A 1XB2B 4HEOA 3GLFE 1E94E 1HQYE 1G3IA 1P3QQ 3LCVB 2EJSA 2DAIA 1V92A 1ZV1A 1OQYA 2JUJA 2QSFX 4UN2B 3K9OA 1A5TA 1WR1B 4F2LA 2KNAA 1KYIA 3FE3A 1WHCA 1HT1E 2BWEA 1ZMUA 1T6OA 2DHYA 3IHPA 1IFYA 5JI2E 3MMPA 1UFZA 3B89A 2DAGA 2QHOB 2KNVA 2DI0A 1C7YA 1VEKA 2L2DA 2DNAA 2LBCA 1NV9A 2ZTCA 1HT2E 1VQ1A 2L4EA 1WGLA 2JY7A 2RRUA 3IECA 2LVOC 2H5XA 1BVSA 2DAKA 2BWBA 3H4JA 2LVAA 4WP2A 3T6PA 1WGNA 2CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJP A;  1OKS A;  2JY5 A;  2OOA A;  2K9D A;  2JY8 A;  4F1I A;  2MRO B;  2ZTD A;  1QZE A;  1DV0 A;  3GLG E;  2JNH A;  2DAM A;  1PGY A;  2KHH A;  2LVN C;  1NV8 A;  2HAK A;  3K9P A;  1Q02 A;  2LTU A;  2KNZ A;  2HWJ A;  1EFU B;  1GO5 A;  2K0B X;  2OOB A;  2R0I A;  1DO0 A;  2DEN A;  1WIV A;  2JZ0 A;  2EKK A;  1T43 A;  4Q7J A;  1OAI A;  2G3Q A;  2QNJ A;  2WZJ A;  1IM2 A;  2B3T A;  3FRH A;  1TR8 A;  2LVQ D;  3F92 A;  3BBZ A;  1MN3 A;  4R71 A;  2MJ5 B;  1OTR A;  3LCU A;  1TTE A;  3E46 A;  1ZMW A;  1VEJ A;  1YLA A;  1G4A E;  2DAE A;  1VEG A;  1JR3 E;  1XXH E;  2L4F A;  2O25 A;  1Y8G A;  1AIP C;  1WJ7 A;  4DBG B;  4G3O A;  1IXS A;  1CUK A;  2LVP C;  3FRI A;  2MGW A;  2DZL A;  2JP7 A;  2EKF A;  1ZMV A;  2JY6 B;  1DO2 A;  2DKL A;  2CWB A;  2MR9 A;  1VDL A;  1G41 A;  3GLH E;  1R4G A;  1VG5 A;  5DFL A;  4GEW A;  2OO9 A;  3E21 A;  3GLI E;  1F4I A;  2JZ1 A;  1SG9 A;  1XB2 B;  4HEO A;  3GLF E;  1E94 E;  1HQY E;  1G3I A;  1P3Q Q;  3LCV B;  2EJS A;  2DAI A;  1V92 A;  1ZV1 A;  1OQY A;  2JUJ A;  2QSF X;  4UN2 B;  3K9O A;  1A5T A;  1WR1 B;  4F2L A;  2KNA A;  1KYI A;  3FE3 A;  1WHC A;  1HT1 E;  2BWE A;  1ZMU A;  1T6O A;  2DHY A;  3IHP A;  1IFY A;  5JI2 E;  3MMP A;  1UFZ A;  3B89 A;  2DAG A;  2QHO B;  2KNV A;  2DI0 A;  1C7Y A;  1VEK A;  2L2D A;  2DNA A;  2LBC A;  1NV9 A;  2ZTC A;  1HT2 E;  1VQ1 A;  2L4E A;  1WGL A;  2JY7 A;  2RRU A;  3IEC A;  2LVO C;  2H5X A;  1BVS A;  2DAK A;  2BWB A;  3H4J A;  2LVA A;  4WP2 A;  3T6P A;  1WGN A;  2CP8 A; 
#chains in the Genus database with same CATH topology
 3L29 A;  3RGP A;  3ZC7 B;  3GPY A;  3U6M A;  1Q3B A;  3UJN A;  4M0W A;  1IY1 A;  3FUT A;  4P17 A;  2A5Y B;  4QOS A;  4F1I A;  4LF7 M;  3GRR A;  2XH9 A;  1S3S A;  3D8L A;  3OTO M;  4B3R M;  4L16 A;  1DV0 A;  3E4R A;  3I4V A;  4JV5 M;  2UXD M;  3DFZ A;  2LVN C;  5EXT A;  1QDR A;  4L6V 6;  2C9C A;  3K9P A;  2UUB M;  2LTU A;  3RFW A;  3AV0 A;  2HWJ A;  4GC9 A;  4JXJ A;  3MK6 A;  4MH0 E;  4EIW A;  4GMQ A;  4M0D A;  3U6Q A;  5FTL A;  2R0I A;  1DO0 A;  1QAO A;  1WIV A;  2DEN A;  2JZ0 A;  2QP9 X;  3TWL A;  3UZU A;  4Q7J A;  4G4Q A;  1OAI A;  1TGU A;  4Z6Y A;  1GLN A;  2G3Q A;  1NY6 A;  2O01 F;  2QNJ A;  2YNM D;  2LXE A;  3KOZ E;  2XZF A;  4LJ4 A;  3PNY A;  4AKI A;  1XMO M;  1IBL M;  2Y21 A;  4JI4 M;  2B3T A;  4K0K M;  1FNN A;  3AKZ A;  3J27 B;  4PCZ A;  2WSE F;  3KOY E;  2Z4S A;  4X65 M;  1N32 M;  3W68 A;  4LF6 M;  1GKI A;  2KZU A;  2CHV A;  2HL7 A;  1D0K A;  3HHX A;  3KOW E;  5FTK A;  4LJ6 A;  2FOI C;  2D7E A;  4LCB A;  3VDU A;  5IT9 S;  2NQ8 C;  3GO8 A;  2CUZ A;  2FH0 A;  3LCU A;  4NSO B;  3I01 M;  3FUU A;  1ZMW A;  2V1C A;  3CF6 E;  4I4L A;  1YLA A;  2VDB B;  2CV0 A;  1SXJ C;  3QYE A;  1G4A E;  2DAE A;  2HHH M;  3SAT A;  1JR3 E;  1XXH E;  2L4F A;  1XC8 A;  2RGH A;  1L2C A;  3NBI A;  1AIP C;  1QVR A;  4LJ7 A;  1N77 A;  2YQZ A;  2QBY A;  3KP0 E;  3GP1 A;  2L7H A;  1L2B A;  2UUC M;  4CIS A;  1EE8 A;  2R18 A;  2Y20 A;  1OIP A;  2VF8 A;  3KS8 A;  3JR4 A;  1OFH A;  2CE7 A;  2DZL A;  3EIE A;  2JP7 A;  3J7B A;  4IIW A;  1ZMV A;  5EQT A;  5ITT A;  3HKP A;  1K3W A;  3GLG A;  4B3S M;  3K8Z A;  4IBG A;  2VQE M;  2JY6 B;  5EXX A;  3SFZ A;  2DKL A;  1NY5 A;  2MR9 A;  1D0M A;  1VDL A;  3GLH E;  2F5P A;  3B74 A;  4A3V B;  4DV7 M;  1D2N A;  2XF3 A;  4IBC A;  4DV2 M;  4Y28 F;  5KPZ A;  1TF0 B;  2JZ1 A;  1SG9 A;  1HQY E;  3LCV B;  2CV2 A;  2AHM A;  4LF9 M;  1V92 A;  1TH3 A;  3ILK A;  4IBB A;  3SHG B;  3HX3 A;  4HL4 A;  3C9P A;  3AL0 C;  1WR1 B;  4P16 A;  2K6B A;  4QHT A;  3TL4 X;  1KYI A;  4WW0 A;  3W67 A;  4QOZ C;  3SAU A;  2CEA A;  1QAM A;  1ZMU A;  1SXJ E;  2BWE A;  3A98 B;  1T6O A;  5E6J A;  4PDI A;  5JI2 E;  5EXP A;  4PDG A;  2QQ8 A;  1UFZ A;  3B89 A;  2O5R A;  2DZO B;  3U6O A;  3HGI A;  3L28 A;  3C58 A;  2DNA A;  1XHB A;  1GL6 A;  3AOE A;  4FCV A;  4PT5 A;  4B7H A;  3J2P B;  2C5R A;  1QYR A;  1JR3 D;  4B3M M;  1N78 A;  3R9X B;  3VKH A;  1V33 A;  2JY7 A;  2H5X A;  1BVS A;  3HJS A;  3GQ4 A;  3MJ5 A;  3SHF A;  1RU3 A;  1WGN A;  3SC3 A;  2UUA M;  1HJP A;  1WXQ A;  4DR4 M;  2OOA A;  4X64 M;  2GNO A;  3R8F A;  2APL A;  2K9D A;  4KO8 A;  4NC6 A;  4JI5 M;  4LF5 M;  1ZAE A;  2MRO B;  4M9S A;  4L4U A;  3AOE C;  3FTD A;  1NVM A;  3GLG E;  2EA0 A;  3U6P A;  2G8L A;  2JNH A;  4QHS A;  4MGY E;  2FS1 A;  2DAM A;  2DVW B;  1PGY A;  4FCT A;  4XK8 F;  3RE8 A;  1OAO C;  3ZH9 B;  4MGK E;  4G4R A;  2HAK A;  4NL4 H;  2J7N A;  4OX9 M;  1IN5 A;  1Q02 A;  2L09 A;  1GJT A;  2KNZ A;  3SAR A;  3U60 A;  2QZ4 A;  3VKG A;  3T15 A;  1XXH B;  2K0B X;  4L78 A;  4DR5 M;  1IN4 A;  4FD2 A;  1UM8 A;  2EKK A;  2KRU A;  1T43 A;  5IWA M;  4L8R C;  3SMS A;  4CHT B;  3TWK A;  3UK6 A;  3M6A A;  5E26 A;  1TH4 A;  1IM2 A;  2J5Y A;  2R62 A;  3KSJ A;  3SYK A;  4LF4 M;  1GVN A;  3WHK A;  1TDH A;  4AKG A;  3C3E A;  2ERC A;  3GLH A;  2LVQ D;  3GLH B;  3U6C A;  3F92 A;  4I81 A;  1MN3 A;  3KS4 A;  3FUX A;  3BOS A;  2LNH C;  3FTE A;  3B7Z A;  5C1B A;  1L1Z A;  2R4J A;  3PFI A;  1OTR A;  3GQ3 A;  2DZN B;  1TTE A;  2ZAO A;  3E46 A;  3KVW A;  1QQW A;  3CF2 A;  1I4W A;  2Z7J A;  3FYC A;  2YFQ A;  3GPP A;  2CHQ A;  1R5L A;  4GKJ M;  1ZQ9 A;  5H37 D;  1Y8G A;  4W5W A;  1H6U A;  3LQQ A;  1SXJ A;  2ZM6 M;  1WJ7 A;  2F4V M;  5ITX E;  1SXJ B;  1Z5C A;  4G3O A;  1NHG C;  1IY0 A;  7CAT A;  3VK8 A;  2Z3X A;  4YY3 M;  1IXS A;  1IN8 A;  1IXS B;  3FRI A;  4B7F A;  2D7G A;  5KO3 A;  2KXE A;  3I4Y A;  4TUW A;  3LVV A;  1DO2 A;  3Q8X A;  4L15 A;  5DFL A;  1G59 A;  4II7 A;  1R4G A;  4AKH A;  4KOD A;  3DOA A;  4GEW A;  1QUS A;  2RGO A;  1HNX M;  5ITQ A;  4CGY B;  1C1K A;  4HEO A;  3U61 A;  1P3Q Q;  2R4E A;  3U61 B;  4GIT A;  3SMP A;  1IY2 A;  1PJJ A;  2J7O A;  1ZV1 A;  2JUJ A;  2CHG A;  2CRU A;  2V6Z M;  1A5T A;  3FUV A;  4DV0 M;  1GAB A;  2OQ4 A;  1V34 A;  1HT1 E;  1HNZ M;  3U6E A;  3C3D A;  1E9S A;  2QBY B;  2DHY A;  2ZAM A;  3IHP A;  1NNJ A;  5JI3 E;  1IBM M;  2F5Q A;  5DNY A;  1IFY A;  3L26 A;  4LRS A;  3KFU G;  4GKK M;  2QHO B;  2XLJ A;  3FTC A;  4AW4 A;  3VFD A;  5FLX S;  3GLG B;  3U6D A;  4KHP M;  4G4N A;  3VDP A;  2LWX A;  1X37 A;  2M5Z A;  1HT2 E;  5IRE B;  2X49 A;  3SAV A;  3WHL A;  3U6S A;  2XSZ A;  1WGL A;  4LFB M;  4LRT A;  2LVO C;  3KW6 A;  4ITQ A;  1R2Z A;  2DAK A;  1IBK M;  2R65 A;  5BPV A;  2XEP A;  2LHG A;  1PM5 A;  3EIH A;  3T6P A;  4DR6 M;  1PJS A;  2Y0T A;  5EXS A;  1OKS A;  4DV3 M;  3TE6 A;  3JAM S;  2DXI A;  2JY8 A;  4LGY A;  4FWH A;  1N33 M;  3SAS A;  4FWD A;  3W0F A;  5EP2 A;  2ZTD A;  2C99 A;  1NJG A;  5C18 A;  4DUZ M;  4R7G A;  2V1U A;  3HU3 A;  3GLF A;  5ITY A;  5IZ7 D;  2BJW A;  1NV8 A;  4MGI E;  4BB9 A;  4DR2 M;  1LTM A;  1IN6 A;  4JI3 M;  4JN6 A;  1N34 M;  4FW9 A;  3HZJ A;  2W82 A;  4KT0 F;  2BJV A;  4LJ9 A;  3VLF B;  2VF7 A;  4NOO B;  3ZQJ A;  5ITX A;  3THG A;  1QAN A;  3A46 A;  5DYG A;  1D0L A;  2L6O A;  2L7I A;  2LH0 A;  4LFC M;  2KEB A;  2WZJ A;  4PD2 A;  1DGH A;  4DR3 M;  2DWL A;  4MM3 B;  4IBD A;  1PJI A;  2KDL A;  2UXC M;  4DR1 M;  3GPX A;  2JA2 A;  4JI6 M;  3PNV A;  5A2Q S;  4JYA M;  1OJL A;  2C9O A;  5DYI A;  4DV5 M;  3W0L B;  1DGB A;  4IBF A;  4AI6 A;  2MJ5 B;  1Z5B A;  3CF0 A;  4AQY M;  3GRY A;  4LJA A;  4OVZ A;  3GRV A;  3J80 S;  4FCW A;  4OVZ B;  1L2D A;  4LGM A;  4GRI A;  2DWN A;  2XGN A;  3KDS E;  3U60 B;  2O25 A;  1HQC A;  2F5O A;  3HHY A;  1SXJ D;  2G5G X;  1NNU C;  1J7K A;  2XFS A;  2R6F A;  4DV6 M;  1Q3C A;  3HU1 A;  4OU7 A;  1CUK A;  4S12 A;  4LFA M;  3BXW A;  4NRW A;  2EKF A;  1EIJ A;  2I7P A;  3HY5 A;  1Z59 A;  1IN7 A;  2KW0 A;  2CWB A;  3V76 A;  3TWM A;  1TDZ A;  1YUB A;  1VG5 A;  1IXZ A;  4XGI A;  2F5N A;  3U5Z A;  2OO9 A;  2EO2 A;  3GLI E;  3U5Z B;  1HNW M;  1J5E M;  4Z8X A;  3GLF E;  1XB2 B;  2FE8 A;  2ZAN A;  3FD9 A;  4DR7 M;  1QDT A;  1G3I A;  5EP1 A;  4JI8 M;  2DAI A;  1OFI A;  4MGH A;  1OQY A;  2H1R A;  4REZ A;  3KOX E;  2I7N A;  4FWG A;  1XMQ M;  3K9O A;  4NXM M;  4F2L A;  1N36 M;  3FE3 A;  3T1Y M;  3B7Q A;  3T1H M;  3AFH A;  4LZJ A;  3K92 A;  4M9X A;  2DWZ B;  4DV1 M;  1MJG M;  3CTW B;  4AG5 A;  3GPU A;  1XNR M;  2R46 A;  3IG5 A;  3MMP A;  1MX0 A;  3CGW A;  3Q8G A;  1GJS A;  3UGJ A;  2KNV A;  1G71 A;  1E32 A;  2QCU A;  5EP4 A;  4XBO A;  1YE9 A;  4LY6 A;  1Z6T A;  3LW5 F;  4MB7 A;  2C96 A;  1NV9 A;  2LBC A;  3GRU A;  3MHV C;  4AZF A;  2ZTC A;  3I51 A;  1AUA A;  2UU9 M;  4B3T M;  2JXN A;  4RF0 A;  2HCB A;  4D81 A;  1I94 M;  2M60 A;  2XSZ D;  3E9S A;  4JI2 M;  2RRU A;  3FUW A;  2FFJ A;  3IEC A;  2LHC A;  1NSF A;  2BWB A;  4LJ8 A;  2Q2E B;  4RF1 A;  5F3W A;  4WP2 A;  3D8B A;  5LMU M;  5KQ8 A;  1QUT A;  2CP8 A;  3TQS A;  1LV7 A;  2JY5 A;  1VDD A;  5FTJ A;  2ZBK B;  1E9R A;  1ORY B;  4D80 A;  4BBA A;  3J81 S;  4G4O A;  1QZE A;  4HLQ A;  4JI1 M;  5FTM A;  4R3D A;  3AOG A;  1YSY A;  2EUC A;  4MGZ E;  3TPZ A;  2KHH A;  4B7G A;  1MU5 A;  1K82 A;  2F5S A;  4RNA A;  4LF8 M;  4NRV A;  4IBK A;  2Z8Y M;  4CJ6 A;  3A45 A;  5ITR A;  5LMN M;  1EFU B;  3M7G A;  5EP3 A;  1PJT A;  3QWL A;  4CIZ A;  4GHA A;  3DA1 A;  2Y0Q A;  3SAW A;  1HR0 M;  2CV1 A;  4QNR A;  1GO5 A;  5KPT A;  1W5S A;  2OOB A;  1NJF A;  4JI0 M;  3VK7 A;  4LJ5 A;  2DWM A;  4IBE A;  4M9Z A;  3K2L A;  2R44 A;  1QZM A;  1J09 A;  3PVS A;  1N75 A;  3JR5 A;  3HU2 A;  1IXR C;  3FRH A;  1TR8 A;  4NXN M;  2D7H A;  1NHW C;  4LG2 A;  1R6B X;  3BBZ A;  3KP1 E;  4G6Z A;  4I5S A;  3GLI A;  3IG8 A;  3J7A S;  3GLI B;  4IBJ A;  1R7R A;  4R71 A;  1DGG A;  3GLF B;  5EJC A;  3QAU A;  2XFT A;  8CAT A;  4GC5 A;  2OPF A;  3DZD A;  1VEJ A;  2GQF A;  2QPA A;  3L27 A;  4FVM A;  2KZS A;  3ZCB B;  5KQD A;  2Z4R A;  1VEG A;  2BNK A;  4RKU F;  1W5T A;  4YHH M;  1T3T A;  4D82 A;  3HWS A;  4QNM A;  3L2A A;  3RGS A;  4GH9 A;  4X62 M;  4DBG B;  4KLN A;  2FNA A;  2VQF M;  2N35 A;  4DUY M;  4WUR A;  2LVP C;  3QYB A;  5GKN A;  2MGW A;  4OW0 A;  4B08 A;  1DGH B;  4IBI A;  3LQR A;  2P5T A;  2UXB M;  2YR0 A;  3LMM A;  3HHW A;  4LZZ A;  2MH8 A;  1L1T A;  2JWS A;  4IJF A;  1G41 A;  1GL7 A;  2R45 A;  3B9P A;  5FTN A;  2CFO A;  3E21 A;  3AJI B;  3LVW A;  4IJE A;  1NO1 A;  1Q39 A;  4X66 M;  4BLC A;  3SBJ A;  1F4I A;  3M0E A;  1E94 E;  3PXG A;  1JB0 F;  2EJS A;  2E5L M;  2KA6 B;  3KSX A;  1PRB A;  3U6L A;  2DHR A;  3NWL A;  4DV4 M;  1QAQ A;  2QSF X;  2K47 A;  4UN2 B;  1FJG M;  4GHL A;  2KNA A;  5KPR A;  1TH2 A;  3KXE C;  1WHC A;  3K1J A;  3NBX X;  1R2Y A;  2WSC F;  3UMM A;  2RKO A;  1JQJ C;  1XNQ M;  3HJQ A;  5ITU A;  3H4M A;  3FTF A;  5L8R F;  2X4A A;  1KFV A;  2DAG A;  2KRK A;  3GQ5 A;  1K3X A;  3B7N A;  4AG6 A;  2C98 A;  2DI0 A;  4NSR A;  3T38 A;  1IQP A;  4ANR A;  1VEK A;  2L2D A;  2HKJ A;  2VII A;  3FYD A;  3HJ8 A;  1C7Y A;  1Z5A A;  4I8O A;  4GIP A;  3I04 M;  1XWI A;  3HHZ A;  2WSF F;  4JI7 M;  1VQ1 A;  3FKE A;  1JR3 A;  1XXH A;  1DGF A;  5BR8 M;  2L4E A;  2XZU A;  4ZPX A;  3L25 A;  5FSW A;  1OIZ A;  3H4J A;  2LVA A;  3SYL A;  2QEN A;  1KSF X;  3A42 A;  1L8Q A;  1G8P A;  2X8A A;  1PJQ A; 
#chains in the Genus database with same CATH homology
 1HJP A;  1OKS A;  2JY5 A;  2OOA A;  2K9D A;  2JY8 A;  4F1I A;  2MRO B;  2ZTD A;  1QZE A;  1DV0 A;  3GLG E;  2JNH A;  2DAM A;  1PGY A;  2KHH A;  2LVN C;  1NV8 A;  2HAK A;  3K9P A;  1Q02 A;  2LTU A;  2KNZ A;  2HWJ A;  1EFU B;  1GO5 A;  2K0B X;  2OOB A;  2R0I A;  1DO0 A;  2DEN A;  1WIV A;  2JZ0 A;  2EKK A;  1T43 A;  4Q7J A;  1OAI A;  2G3Q A;  2QNJ A;  2WZJ A;  1IM2 A;  2B3T A;  3FRH A;  1TR8 A;  2LVQ D;  3F92 A;  3BBZ A;  1MN3 A;  4R71 A;  2MJ5 B;  1OTR A;  3LCU A;  1TTE A;  3E46 A;  1ZMW A;  1VEJ A;  1YLA A;  1G4A E;  2DAE A;  1VEG A;  1JR3 E;  1XXH E;  2L4F A;  2O25 A;  1Y8G A;  1AIP C;  1WJ7 A;  4DBG B;  4G3O A;  1IXS A;  1CUK A;  2LVP C;  3FRI A;  2MGW A;  2DZL A;  2JP7 A;  2EKF A;  1ZMV A;  2JY6 B;  1DO2 A;  2DKL A;  2CWB A;  2MR9 A;  1VDL A;  1G41 A;  3GLH E;  1R4G A;  1VG5 A;  5DFL A;  4GEW A;  2OO9 A;  3E21 A;  3GLI E;  1F4I A;  2JZ1 A;  1SG9 A;  1XB2 B;  4HEO A;  3GLF E;  1E94 E;  1HQY E;  1G3I A;  1P3Q Q;  3LCV B;  2EJS A;  2DAI A;  1V92 A;  1ZV1 A;  1OQY A;  2JUJ A;  2QSF X;  4UN2 B;  3K9O A;  1A5T A;  1WR1 B;  4F2L A;  2KNA A;  1KYI A;  3FE3 A;  1WHC A;  1HT1 E;  2BWE A;  1ZMU A;  1T6O A;  2DHY A;  3IHP A;  1IFY A;  5JI2 E;  3MMP A;  1UFZ A;  3B89 A;  2DAG A;  2QHO B;  2KNV A;  2DI0 A;  1C7Y A;  1VEK A;  2L2D A;  2DNA A;  2LBC A;  1NV9 A;  2ZTC A;  1HT2 E;  1VQ1 A;  2L4E A;  1WGL A;  2JY7 A;  2RRU A;  3IEC A;  2LVO C;  2H5X A;  1BVS A;  2DAK A;  2BWB A;  3H4J A;  2LVA A;  4WP2 A;  3T6P A;  1WGN A;  2CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...