2JNHA

Solution structure of the uba domain from cbl-b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
ALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Differential ubiquitin binding of the UBA domains from human c-Cbl and Cbl-b: NMR structural and biochemical insights
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 8
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jnhA00
1XB2B 1F4IA 2LVPC 2H5XA 1P3QQ 1YLAA 1VEKA 2O25A 2K9DA 2ZTDA 1DV0A 1SG9A 1ZMVA 1R4GA 3IHPA 2DAIA 2DNAA 3E46A 1ZMWA 1Y8GA 1WIVA 1NV8A 2CP8A 2JY5A 1OKSA 1T43A 2G3QA 1EFUB 3GLFE 3K9PA 2DAEA 3FRIA 2BWEA 3T6PA 1CUKA 2MJ5B 2DKLA 1NV9A 2L4EA 2QSFX 2JNHA 4F2LA 2DAMA 5DFLA 1ZMUA 1VEJA 3LCUA 1MN3A 3E21A 2JY7A 2B3TA 2EJSA 1GO5A 4WP2A 2KHHA 2BWBA 1ZV1A 2KNAA 1TR8A 1T6OA 2JZ1A 1C7YA 2R0IA 1G3IA 2EKKA 2JUJA 1VG5A 5JI2E 4DBGB 2K0BX 2DZLA 1G41A 2DAGA 1BVSA 2DI0A 2DHYA 1DO0A 1TTEA 1WHCA 2DENA 1IFYA 3IECA 1G4AE 1A5TA 3H4JA 3GLIE 1OAIA 2JP7A 2JY6B 1UFZA 1HJPA 1AIPC 1IM2A 1WGNA 2JZ0A 3FE3A 4G3OA 1JR3E 1PGYA 1HT1E 2LVAA 4GEWA 2HWJA 2KNZA 2CWBA 2L4FA 4UN2B 1V92A 2LBCA 1XXHE 3MMPA 1OTRA 4HEOA 1IXSA 2L2DA 3LCVB 3GLHE 1HQYE 1VDLA 2LVNC 1QZEA 4F1IA 2QNJA 2OOAA 4R71A 2EKFA 2LTUA 1WGLA 3K9OA 1HT2E 2MGWA 2OOBA 2KNVA 2RRUA 3F92A 3BBZA 1WR1B 2HAKA 3B89A 2MR9A 3FRHA 2JY8A 2LVOC 1WJ7A 2OO9A 1VQ1A 1Q02A 1KYIA 2DAKA 2WZJA 2LVQD 2QHOB 2ZTCA 2MROB 3GLGE 1OQYA 1VEGA 4Q7JA 1E94E 1DO2A
chains in the Genus database with same CATH superfamily
4CGYB 2CHVA 4R7GA 3UZUA 1XHBA 2DZNB 2H5XA 2CV0A 1P3QQ 2HCBA 4MGZE 3M0EA 2XSZA 1HNXM 4L8RC 5KQ8A 3SYLA 3B7QA 3E9SA 1DV0A 2K9DA 3C3DA 1PJTA 4I5SA 1SG9A 1DGGA 1OIZA 2OPFA 4JI4M 4LJ9A 2M5ZA 5JI3E 1IY2A 3TPZA 4DR4M 2KXEA 4LF7M 4I4LA 2XFSA 3VK8A 3KOZE 4NL4H 3HJSA 3GQ3A 3GLGB 1WIVA 3JR4A 2FOIC 3U61B 3J80S 3LMMA 4X65M 2JY5A 2MH8A 2KEBA 2G3QA 4PDGA 3PXGA 3DOAA 1QANA 2Z4RA 4G4QA 3GP1A 5EJCA 1XMQM 2HHHM 4AKIA 1Z5AA 1H6UA 1MU5A 1RU3A 3I4VA 4PD2A 4AZFA 4DR2M 5FTKA 4GKJM 2QENA 2DWZB 3MJ5A 1QAOA 3T6PA 1CUKA 1GJTA 4QOSA 1NV9A 1IXZA 2XF3A 1NJGA 3GPYA 1N77A 3SAUA 5EP3A 2UXBM 1VEJA 1KFVA 1L2CA 3W68A 1T3TA 2UUAM 2JY7A 3U61A 1YE9A 4Z8XA 1KSFX 1ORYB 1SXJC 4DV3M 4G4RA 5IZ7D 1GKIA 3SAVA 4JI7M 1R2ZA 2Z3XA 1N34M 2R46A 1AUAA 3QWLA 1VG5A 4LJ4A 4AQYM 1N36M 5JI2E 4DV6M 1E9SA 2K0BX 3VDUA 4OVZA 5LMNM 2BJVA 2DHYA 3FUWA 4NC6A 1IFYA 1NHGC 1G4AE 3AOEA 2JA2A 1JR3A 1J7KA 3B74A 1A5TA 3GLIE 2JP7A 1AIPC 2VDBB 3FE3A 4G3OA 3VK7A 3U6LA 1LV7A 2VF8A 1JR3E 4LY6A 1HT1E 3PFIA 2Z8YM 1IBKM 2CV2A 4X62M 3UK6A 2OQ4A 1IN7A 2Z4SA 3QYEA 4AG6A 2UXDM 2JWSA 3KP0E 5EXPA 2BJWA 4GEWA 3KFUG 2K47A 2HWJA 3R9XB 2KNZA 2L4FA 4UN2B 1TDHA 1V92A 2LBCA 3TWLA 4YY3M 3DZDA 3R8FA 3MMPA 5C1BA 2F4VM 4DR3M 2XZUA 3AOEC 3VLFB 1R6BX 5FSWA 3HHYA 3GLHE 2DVWB 3GRUA 1VDLA 2G8LA 4P16A 4QNMA 3EIEA 1L8QA 4REZA 1QDTA 4MGYE 1XNRM 5IT9S 1J09A 5EXSA 2MGWA 2RRUA 3TQSA 4M9SA 2C99A 3ZH9B 3BBZA 3BXWA 3D8LA 3HU3A 5EP1A 3HZJA 3FKEA 2F5OA 1XXHB 5KPRA 2YQZA 4LZJA 4GHAA 2WZJA 3HJQA 4LRSA 1IBLM 3SMSA 3Q8XA 2I7PA 3KP1E 1NNUC 3TWKA 3KOXE 2VIIA 4IJEA 4LRTA 3VDPA 2VQEM 1TDZA 1GABA 3KOWE 1J5EM 1F4IA 3E4RA 2LVPC 5E26A 3C58A 3SC3A 5KPTA 4OU7A 3HX3A 1JB0F 3KOYE 1K82A 4OW0A 4QOZC 1VEKA 3GQ5A 1IXRC 3L29A 5ITRA 4NXMM 4DV0M 3OTOM 5DNYA 3Q8GA 1W5SA 3JR5A 1PJIA 4MGIE 3TE6A 5EXTA 4LF4M 4B3SM 3GO8A 4GMQA 4LJ8A 3V76A 3E46A 4KHPM 1Z5BA 1TH2A 2R18A 2QZ4A 4BLCA 2KZUA 3DA1A 3FTCA 2DXIA 1PJJA 1IN6A 3HU1A 3KSXA 4DV4M 4JYAM 3B7NA 4D80A 1EFUB 3GLFE 1NY5A 1YUBA 4FWDA 2DAEA 1D0KA 1DGBA 2BWEA 2N35A 3CF6E 1HQCA 4HLQA 3W0FA 4NOOB 1Q3BA 3SARA 4M9ZA 2DKLA 2ZANA 2EA0A 3U6CA 2L4EA 3HU2A 2XGNA 2QPAA 2V6ZM 3RGSA 8CATA 4F2LA 3HHWA 2F5SA 3LVWA 3IG8A 1ZMUA 3LCUA 4LF9M 3KS8A 2KA6B 1QUSA 2B3TA 2O01F 3EIHA 4WP2A 3U6QA 5FTJA 2CV1A 4LFCM 3KXEC 2C96A 2LHGA 3HWSA 3ZC7B 1IY1A 2R0IA 4RKUF 2UUBM 3KW6A 2O5RA 5BR8M 3FUTA 1ZQ9A 1SXJA 4BBAA 1QUTA 4K0KM 2DZLA 2DAGA 4R3DA 2LH0A 2R45A 2X4AA 1SXJE 4AKGA 1IN8A 1GJSA 2JY6B 4FW9A 2CUZA 4M0WA 2JZ0A 3U6MA 1S3SA 4IBFA 1IY0A 4EIWA 3U60B 1K3XA 3FTDA 1V34A 5C18A 4LJ5A 3HY5A 2EUCA 3KSJA 4FWHA 4PT5A 1E9RA 4DV1M 3UMMA 3GLGA 4CISA 3U5ZB 2XSZD 4NSOB 4GKKM 2WSEF 2LVAA 4DR5M 3GPXA 3RFWA 3LQQA 2CWBA 2Y21A 1QQWA 5FTMA 4TUWA 3HHXA 5EP2A 3NBIA 2VF7A 4HEOA 2Y0QA 3GLIB 5DYGA 2QBYB 5GKNA 2W82A 4GC5A 2H1RA 2LVNC 3PNVA 4CIZA 4JV5M 1L1TA 3FYDA 2KZSA 2RKOA 2EKFA 2ERCA 3J27B 3M6AA 3U60A 2E5LM 3K9OA 4NXNM 3F92A 2FE8A 2OOBA 2I7NA 3SHGB 1N75A 1IN5A 2HAKA 1OAOC 1VDDA 3B89A 2FNAA 3I04M 3M7GA 3FUXA 4OX9M 3MHVC 2R44A 1WJ7A 2OO9A 5KPZA 4MGHA 4DUYM 3LVVA 1VQ1A 3BOSA 4A3VB 3I51A 3GLHB 3KS4A 1L2DA 1G59A 1W5TA 2ZTCA 3THGA 1LTMA 2XH9A 4LF6M 2QBYA 2R65A 3SYKA 1JQJC 1N33M 1R7RA 1E94E 2QP9X 1EE8A 4YHHM 5FLXS 4DR7M 1TF0B 2CEAA 1YLAA 2ZTDA 2XLJA 3H4MA 1Z6TA 4W5WA 3QAUA 1ZMVA 4FCTA 1OJLA 4QNRA 2X8AA 1R4GA 4JI6M 1HR0M 2DNAA 4Z6YA 3RE8A 1DGHB 2R6FA 1Y8GA 1JR3D 2CP8A 2AHMA 4JN6A 1OKSA 4MH0E 1L1ZA 2A5YB 3AL0C 2G5GX 4NSRA 2L6OA 4JI5M 1XMOM 4L16A 1Q39A 1D0MA 2Z7JA 4M9XA 4II7A 1I94M 1PJQA 4RNAA 3GRYA 1QAQA 1QAMA 1Z59A 4JI2M 5DYIA 2FFJA 2DWNA 1OFHA 4DR6M 4XGIA 2R4JA 1HNWM 3HGIA 1UM8A 5KO3A 2UU9M 5BPVA 5DFLA 3ZCBB 4CJ6A 3FUUA 1DGHA 3KDSE 1Z5CA 3GRVA 1XXHA 4LF8M 3E21A 3VKGA 1G8PA 2EJSA 3A46A 1GO5A 2ZBKB 1L2BA 2BWBA 4IBGA 4GRIA 3GLFB 4GITA 1YSYA 2JZ1A 4IIWA 4JI8M 1D2NA 1TH3A 4MGKE 2APLA 2DWMA 1N32M 5IWAM 5KQDA 4XBOA 2F5NA 2QCUA 3SATA 1X37A 1G71A 2J7NA 3L27A 4B3RM 5ITXA 1G41A 3L2AA 1BVSA 4MM3B 4GIPA 1IXSB 1DO0A 4IBDA 3WHLA 2CE7A 2DENA 3FD9A 4I81A 2LXEA 3U6PA 2WSFF 1QDRA 4LFBM 4X66M 4DV7M 2UXCM 3T38A 1NJFA 3A98B 3ZQJA 3AV0A 4B7HA 3I01M 1NNJA 1GVNA 1PJSA 2Q2EB 5EXXA 4IBEA 4LJ6A 2KRUA 4LGMA 2YNMD 3AFHA 3J81S 2ZM6M 3U6SA 1R2YA 1MX0A 2KDLA 2RGHA 2V1CA 2CFOA 2J7OA 4S12A 4I8OA 3A45A 4DV5M 3FUVA 5FTNA 1IXSA 2R62A 1GLNA 3LCVB 3WHKA 2LWXA 3I4YA 3AKZA 3FYCA 3W0LB 4F1IA 5IREB 4PCZA 3GQ4A 2D7HA 1MJGM 4KT0F 3U6OA 4QHTA 1WGLA 2D7EA 3QYBA 2DZOB 2KNVA 4FCVA 3SBJA 5EP4A 5ITTA 1WR1B 2J5YA 5ITQA 3GPUA 2VQFM 3HJ8A 4WW0A 4ITQA 3FTEA 1QYRA 1QZMA 4AKHA 2LVOC 2HL7A 2XEPA 2KW0A 2ZAMA 1KYIA 2QQ8A 2LVQD 3K1JA 4LZZA 4WURA 2UUCM 4DR1M 2MROB 2LHCA 3GLGE 4DUZM 4G4OA 4JI3M 1VEGA 1OFIA 1NY6A 1HT2E 1DO2A 3K92A 1XB2B 3GRRA 3SFZA 3A42A 1GL7A 4OVZB 4B08A 3T1YM 2JXNA 4B3MM 2M60A 3K8ZA 2O25A 4D82A 2HKJA 3B7ZA 1D0LA 5A2QS 1SXJD 2CHGA 3FTFA 4ZPXA 3IHPA 2Y0TA 3GPPA 2DAIA 4LCBA 4LJAA 3U5ZA 1ZMWA 3J2PB 1I4WA 3L28A 3NWLA 4Y28F 4GC9A 1NV8A 4IJFA 4XK8F 3SMPA 1FJGM 4AW4A 3ILKA 3LQRA 1T43A 2WSCF 1PM5A 3K9PA 3GLIA 5F3WA 3L26A 2L09A 2FS1A 3T1HM 3T15A 3RGPA 4BB9A 3FRIA 4FVMA 3CF0A 1DGFA 3SASA 3J7AS 2YR0A 3UJNA 4G6ZA 4IBKA 2MJ5B 5ITUA 4JXJA 2QSFX 4P17A 3CTWB 1XNQM 2JNHA 3NBXX 1HNZM 1TH4A 2YFQA 2DAMA 2L7IA 4FWGA 3DFZA 4RF1A 2L7HA 3VKHA 1MN3A 4MB7A 1FNNA 1Q3CA 1OIPA 2LNHC 2KHHA 2KNAA 1ZV1A 4LGYA 1TR8A 1R5LA 1T6OA 4M0DA 3GLHA 1C7YA 4AG5A 2ZAOA 1G3IA 2EKKA 3MK6A 2JUJA 4IBIA 3IG5A 4KODA 4L4UA 4Q7JA 5L8RF 3J7BA 3HKPA 2Y20A 4DBGB 5LMUM 3SAWA 1TGUA 2K6BA 1IN4A 2DI0A 4LJ7A 3SHFA 3C9PA 4FCWA 4RF0A 1TTEA 1WHCA 1XC8A 1V33A 3IECA 3PNYA 2CRUA 4CHTB 3H4JA 1OAIA 2CHQA 4LF5M 1UFZA 1HJPA 1IM2A 1WGNA 2DHRA 3AJIB 2F5QA 3D8BA 5FTLA 3PVSA 1NHWC 2C98A 1GL6A 4NRWA 1PGYA 3TWMA 3L25A 2KRKA 4DV2M 1WXQA 3U6EA 1NVMA 4B7GA 1E32A 4L6V6 3B9PA 1NO1A 3JAMS 3HHZA 4GHLA 2V1UA 1K3WA 3CGWA 4IBJA 4B3TM 1XXHE 5E6JA 3W67A 4G4NA 1IBMM 1EIJA 4L15A 1OTRA 1NSFA 2L2DA 1C1KA 5EQTA 2XZFA 2F5PA 3K2LA 1HQYE 2D7GA 1ZAEA 2P5TA 4NRVA 2XFTA 1QZEA 2EO2A 1QVRA 2QNJA 3AOGA 4D81A 2OOAA 2R4EA 3TL4X 4R71A 3UGJA 2LTUA 1N78A 2FH0A 4JI0M 3U6DA 1XWIA 5ITXE 4JI1M 4HL4A 2X49A 4AI6A 3LW5F 3KVWA 5ITYA 3VFDA 4GH9A 4ANRA 4KLNA 2MR9A 3FRHA 4KO8A 2BNKA 2DWLA 2C9CA 2JY8A 4IBCA 2GNOA 4QHSA 3GLFA 3C3EA 5H37D 4X64M 1Q02A 2DAKA 1IQPA 4B7FA 4PDIA 2C5RA 3CF2A 2QHOB 4IBBA 2NQ8C 4L78A 4LG2A 1OQYA 1PRBA 4FD2A 2GQFA 7CATA 4LFAM 1SXJB 2RGOA 2C9OA
chains in the Genus database with same CATH topology
1XB2B 1F4IA 2LVPC 2H5XA 1P3QQ 1YLAA 1VEKA 2O25A 2K9DA 2ZTDA 1DV0A 1SG9A 1ZMVA 1R4GA 3IHPA 2DAIA 2DNAA 3E46A 1ZMWA 1Y8GA 1WIVA 1NV8A 2CP8A 2JY5A 1OKSA 1T43A 2G3QA 1EFUB 3GLFE 3K9PA 2DAEA 3FRIA 2BWEA 3T6PA 1CUKA 2MJ5B 2DKLA 1NV9A 2L4EA 2QSFX 2JNHA 4F2LA 2DAMA 5DFLA 1ZMUA 1VEJA 3LCUA 1MN3A 3E21A 2JY7A 2B3TA 2EJSA 1GO5A 4WP2A 2KHHA 2BWBA 1ZV1A 2KNAA 1TR8A 1T6OA 2JZ1A 1C7YA 2R0IA 1G3IA 2EKKA 2JUJA 1VG5A 5JI2E 4DBGB 2K0BX 2DZLA 1G41A 2DAGA 1BVSA 2DI0A 2DHYA 1DO0A 1TTEA 1WHCA 2DENA 1IFYA 3IECA 1G4AE 1A5TA 3H4JA 3GLIE 1OAIA 2JP7A 2JY6B 1UFZA 1HJPA 1AIPC 1IM2A 1WGNA 2JZ0A 3FE3A 4G3OA 1JR3E 1PGYA 1HT1E 2LVAA 4GEWA 2HWJA 2KNZA 2CWBA 2L4FA 4UN2B 1V92A 2LBCA 1XXHE 3MMPA 1OTRA 4HEOA 1IXSA 2L2DA 3LCVB 3GLHE 1HQYE 1VDLA 2LVNC 1QZEA 4F1IA 2QNJA 2OOAA 4R71A 2EKFA 2LTUA 1WGLA 3K9OA 1HT2E 2MGWA 2OOBA 2KNVA 2RRUA 3F92A 3BBZA 1WR1B 2HAKA 3B89A 2MR9A 3FRHA 2JY8A 2LVOC 1WJ7A 2OO9A 1VQ1A 1Q02A 1KYIA 2DAKA 2WZJA 2LVQD 2QHOB 2ZTCA 2MROB 3GLGE 1OQYA 1VEGA 4Q7JA 1E94E 1DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XB2 B;  1F4I A;  2LVP C;  2H5X A;  1P3Q Q;  1YLA A;  1VEK A;  2O25 A;  2K9D A;  2ZTD A;  1DV0 A;  1SG9 A;  1ZMV A;  1R4G A;  3IHP A;  2DAI A;  2DNA A;  3E46 A;  1ZMW A;  1Y8G A;  1WIV A;  1NV8 A;  2CP8 A;  2JY5 A;  1OKS A;  1T43 A;  2G3Q A;  1EFU B;  3GLF E;  3K9P A;  2DAE A;  3FRI A;  2BWE A;  3T6P A;  1CUK A;  2MJ5 B;  2DKL A;  1NV9 A;  2L4E A;  2QSF X;  2JNH A;  4F2L A;  2DAM A;  5DFL A;  1ZMU A;  1VEJ A;  3LCU A;  1MN3 A;  3E21 A;  2JY7 A;  2B3T A;  2EJS A;  1GO5 A;  4WP2 A;  2KHH A;  2BWB A;  1ZV1 A;  2KNA A;  1TR8 A;  1T6O A;  2JZ1 A;  1C7Y A;  2R0I A;  1G3I A;  2EKK A;  2JUJ A;  1VG5 A;  5JI2 E;  4DBG B;  2K0B X;  2DZL A;  1G41 A;  2DAG A;  1BVS A;  2DI0 A;  2DHY A;  1DO0 A;  1TTE A;  1WHC A;  2DEN A;  1IFY A;  3IEC A;  1G4A E;  1A5T A;  3H4J A;  3GLI E;  1OAI A;  2JP7 A;  2JY6 B;  1UFZ A;  1HJP A;  1AIP C;  1IM2 A;  1WGN A;  2JZ0 A;  3FE3 A;  4G3O A;  1JR3 E;  1PGY A;  1HT1 E;  2LVA A;  4GEW A;  2HWJ A;  2KNZ A;  2CWB A;  2L4F A;  4UN2 B;  1V92 A;  2LBC A;  1XXH E;  3MMP A;  1OTR A;  4HEO A;  1IXS A;  2L2D A;  3LCV B;  3GLH E;  1HQY E;  1VDL A;  2LVN C;  1QZE A;  4F1I A;  2QNJ A;  2OOA A;  4R71 A;  2EKF A;  2LTU A;  1WGL A;  3K9O A;  1HT2 E;  2MGW A;  2OOB A;  2KNV A;  2RRU A;  3F92 A;  3BBZ A;  1WR1 B;  2HAK A;  3B89 A;  2MR9 A;  3FRH A;  2JY8 A;  2LVO C;  1WJ7 A;  2OO9 A;  1VQ1 A;  1Q02 A;  1KYI A;  2DAK A;  2WZJ A;  2LVQ D;  2QHO B;  2ZTC A;  2MRO B;  3GLG E;  1OQY A;  1VEG A;  4Q7J A;  1E94 E;  1DO2 A; 
#chains in the Genus database with same CATH topology
 4CGY B;  2CHV A;  4R7G A;  3UZU A;  1XHB A;  2DZN B;  2H5X A;  2CV0 A;  1P3Q Q;  2HCB A;  4MGZ E;  3M0E A;  2XSZ A;  1HNX M;  4L8R C;  5KQ8 A;  3SYL A;  3B7Q A;  3E9S A;  1DV0 A;  2K9D A;  3C3D A;  1PJT A;  4I5S A;  1SG9 A;  1DGG A;  1OIZ A;  2OPF A;  4JI4 M;  4LJ9 A;  2M5Z A;  5JI3 E;  1IY2 A;  3TPZ A;  4DR4 M;  2KXE A;  4LF7 M;  4I4L A;  2XFS A;  3VK8 A;  3KOZ E;  4NL4 H;  3HJS A;  3GQ3 A;  3GLG B;  1WIV A;  3JR4 A;  2FOI C;  3U61 B;  3J80 S;  3LMM A;  4X65 M;  2JY5 A;  2MH8 A;  2KEB A;  2G3Q A;  4PDG A;  3PXG A;  3DOA A;  1QAN A;  2Z4R A;  4G4Q A;  3GP1 A;  5EJC A;  1XMQ M;  2HHH M;  4AKI A;  1Z5A A;  1H6U A;  1MU5 A;  1RU3 A;  3I4V A;  4PD2 A;  4AZF A;  4DR2 M;  5FTK A;  4GKJ M;  2QEN A;  2DWZ B;  3MJ5 A;  1QAO A;  3T6P A;  1CUK A;  1GJT A;  4QOS A;  1NV9 A;  1IXZ A;  2XF3 A;  1NJG A;  3GPY A;  1N77 A;  3SAU A;  5EP3 A;  2UXB M;  1VEJ A;  1KFV A;  1L2C A;  3W68 A;  1T3T A;  2UUA M;  2JY7 A;  3U61 A;  1YE9 A;  4Z8X A;  1KSF X;  1ORY B;  1SXJ C;  4DV3 M;  4G4R A;  5IZ7 D;  1GKI A;  3SAV A;  4JI7 M;  1R2Z A;  2Z3X A;  1N34 M;  2R46 A;  1AUA A;  3QWL A;  1VG5 A;  4LJ4 A;  4AQY M;  1N36 M;  5JI2 E;  4DV6 M;  1E9S A;  2K0B X;  3VDU A;  4OVZ A;  5LMN M;  2BJV A;  2DHY A;  3FUW A;  4NC6 A;  1IFY A;  1NHG C;  1G4A E;  3AOE A;  2JA2 A;  1JR3 A;  1J7K A;  3B74 A;  1A5T A;  3GLI E;  2JP7 A;  1AIP C;  2VDB B;  3FE3 A;  4G3O A;  3VK7 A;  3U6L A;  1LV7 A;  2VF8 A;  1JR3 E;  4LY6 A;  1HT1 E;  3PFI A;  2Z8Y M;  1IBK M;  2CV2 A;  4X62 M;  3UK6 A;  2OQ4 A;  1IN7 A;  2Z4S A;  3QYE A;  4AG6 A;  2UXD M;  2JWS A;  3KP0 E;  5EXP A;  2BJW A;  4GEW A;  3KFU G;  2K47 A;  2HWJ A;  3R9X B;  2KNZ A;  2L4F A;  4UN2 B;  1TDH A;  1V92 A;  2LBC A;  3TWL A;  4YY3 M;  3DZD A;  3R8F A;  3MMP A;  5C1B A;  2F4V M;  4DR3 M;  2XZU A;  3AOE C;  3VLF B;  1R6B X;  5FSW A;  3HHY A;  3GLH E;  2DVW B;  3GRU A;  1VDL A;  2G8L A;  4P16 A;  4QNM A;  3EIE A;  1L8Q A;  4REZ A;  1QDT A;  4MGY E;  1XNR M;  5IT9 S;  1J09 A;  5EXS A;  2MGW A;  2RRU A;  3TQS A;  4M9S A;  2C99 A;  3ZH9 B;  3BBZ A;  3BXW A;  3D8L A;  3HU3 A;  5EP1 A;  3HZJ A;  3FKE A;  2F5O A;  1XXH B;  5KPR A;  2YQZ A;  4LZJ A;  4GHA A;  2WZJ A;  3HJQ A;  4LRS A;  1IBL M;  3SMS A;  3Q8X A;  2I7P A;  3KP1 E;  1NNU C;  3TWK A;  3KOX E;  2VII A;  4IJE A;  4LRT A;  3VDP A;  2VQE M;  1TDZ A;  1GAB A;  3KOW E;  1J5E M;  1F4I A;  3E4R A;  2LVP C;  5E26 A;  3C58 A;  3SC3 A;  5KPT A;  4OU7 A;  3HX3 A;  1JB0 F;  3KOY E;  1K82 A;  4OW0 A;  4QOZ C;  1VEK A;  3GQ5 A;  1IXR C;  3L29 A;  5ITR A;  4NXM M;  4DV0 M;  3OTO M;  5DNY A;  3Q8G A;  1W5S A;  3JR5 A;  1PJI A;  4MGI E;  3TE6 A;  5EXT A;  4LF4 M;  4B3S M;  3GO8 A;  4GMQ A;  4LJ8 A;  3V76 A;  3E46 A;  4KHP M;  1Z5B A;  1TH2 A;  2R18 A;  2QZ4 A;  4BLC A;  2KZU A;  3DA1 A;  3FTC A;  2DXI A;  1PJJ A;  1IN6 A;  3HU1 A;  3KSX A;  4DV4 M;  4JYA M;  3B7N A;  4D80 A;  1EFU B;  3GLF E;  1NY5 A;  1YUB A;  4FWD A;  2DAE A;  1D0K A;  1DGB A;  2BWE A;  2N35 A;  3CF6 E;  1HQC A;  4HLQ A;  3W0F A;  4NOO B;  1Q3B A;  3SAR A;  4M9Z A;  2DKL A;  2ZAN A;  2EA0 A;  3U6C A;  2L4E A;  3HU2 A;  2XGN A;  2QPA A;  2V6Z M;  3RGS A;  8CAT A;  4F2L A;  3HHW A;  2F5S A;  3LVW A;  3IG8 A;  1ZMU A;  3LCU A;  4LF9 M;  3KS8 A;  2KA6 B;  1QUS A;  2B3T A;  2O01 F;  3EIH A;  4WP2 A;  3U6Q A;  5FTJ A;  2CV1 A;  4LFC M;  3KXE C;  2C96 A;  2LHG A;  3HWS A;  3ZC7 B;  1IY1 A;  2R0I A;  4RKU F;  2UUB M;  3KW6 A;  2O5R A;  5BR8 M;  3FUT A;  1ZQ9 A;  1SXJ A;  4BBA A;  1QUT A;  4K0K M;  2DZL A;  2DAG A;  4R3D A;  2LH0 A;  2R45 A;  2X4A A;  1SXJ E;  4AKG A;  1IN8 A;  1GJS A;  2JY6 B;  4FW9 A;  2CUZ A;  4M0W A;  2JZ0 A;  3U6M A;  1S3S A;  4IBF A;  1IY0 A;  4EIW A;  3U60 B;  1K3X A;  3FTD A;  1V34 A;  5C18 A;  4LJ5 A;  3HY5 A;  2EUC A;  3KSJ A;  4FWH A;  4PT5 A;  1E9R A;  4DV1 M;  3UMM A;  3GLG A;  4CIS A;  3U5Z B;  2XSZ D;  4NSO B;  4GKK M;  2WSE F;  2LVA A;  4DR5 M;  3GPX A;  3RFW A;  3LQQ A;  2CWB A;  2Y21 A;  1QQW A;  5FTM A;  4TUW A;  3HHX A;  5EP2 A;  3NBI A;  2VF7 A;  4HEO A;  2Y0Q A;  3GLI B;  5DYG A;  2QBY B;  5GKN A;  2W82 A;  4GC5 A;  2H1R A;  2LVN C;  3PNV A;  4CIZ A;  4JV5 M;  1L1T A;  3FYD A;  2KZS A;  2RKO A;  2EKF A;  2ERC A;  3J27 B;  3M6A A;  3U60 A;  2E5L M;  3K9O A;  4NXN M;  3F92 A;  2FE8 A;  2OOB A;  2I7N A;  3SHG B;  1N75 A;  1IN5 A;  2HAK A;  1OAO C;  1VDD A;  3B89 A;  2FNA A;  3I04 M;  3M7G A;  3FUX A;  4OX9 M;  3MHV C;  2R44 A;  1WJ7 A;  2OO9 A;  5KPZ A;  4MGH A;  4DUY M;  3LVV A;  1VQ1 A;  3BOS A;  4A3V B;  3I51 A;  3GLH B;  3KS4 A;  1L2D A;  1G59 A;  1W5T A;  2ZTC A;  3THG A;  1LTM A;  2XH9 A;  4LF6 M;  2QBY A;  2R65 A;  3SYK A;  1JQJ C;  1N33 M;  1R7R A;  1E94 E;  2QP9 X;  1EE8 A;  4YHH M;  5FLX S;  4DR7 M;  1TF0 B;  2CEA A;  1YLA A;  2ZTD A;  2XLJ A;  3H4M A;  1Z6T A;  4W5W A;  3QAU A;  1ZMV A;  4FCT A;  1OJL A;  4QNR A;  2X8A A;  1R4G A;  4JI6 M;  1HR0 M;  2DNA A;  4Z6Y A;  3RE8 A;  1DGH B;  2R6F A;  1Y8G A;  1JR3 D;  2CP8 A;  2AHM A;  4JN6 A;  1OKS A;  4MH0 E;  1L1Z A;  2A5Y B;  3AL0 C;  2G5G X;  4NSR A;  2L6O A;  4JI5 M;  1XMO M;  4L16 A;  1Q39 A;  1D0M A;  2Z7J A;  4M9X A;  4II7 A;  1I94 M;  1PJQ A;  4RNA A;  3GRY A;  1QAQ A;  1QAM A;  1Z59 A;  4JI2 M;  5DYI A;  2FFJ A;  2DWN A;  1OFH A;  4DR6 M;  4XGI A;  2R4J A;  1HNW M;  3HGI A;  1UM8 A;  5KO3 A;  2UU9 M;  5BPV A;  5DFL A;  3ZCB B;  4CJ6 A;  3FUU A;  1DGH A;  3KDS E;  1Z5C A;  3GRV A;  1XXH A;  4LF8 M;  3E21 A;  3VKG A;  1G8P A;  2EJS A;  3A46 A;  1GO5 A;  2ZBK B;  1L2B A;  2BWB A;  4IBG A;  4GRI A;  3GLF B;  4GIT A;  1YSY A;  2JZ1 A;  4IIW A;  4JI8 M;  1D2N A;  1TH3 A;  4MGK E;  2APL A;  2DWM A;  1N32 M;  5IWA M;  5KQD A;  4XBO A;  2F5N A;  2QCU A;  3SAT A;  1X37 A;  1G71 A;  2J7N A;  3L27 A;  4B3R M;  5ITX A;  1G41 A;  3L2A A;  1BVS A;  4MM3 B;  4GIP A;  1IXS B;  1DO0 A;  4IBD A;  3WHL A;  2CE7 A;  2DEN A;  3FD9 A;  4I81 A;  2LXE A;  3U6P A;  2WSF F;  1QDR A;  4LFB M;  4X66 M;  4DV7 M;  2UXC M;  3T38 A;  1NJF A;  3A98 B;  3ZQJ A;  3AV0 A;  4B7H A;  3I01 M;  1NNJ A;  1GVN A;  1PJS A;  2Q2E B;  5EXX A;  4IBE A;  4LJ6 A;  2KRU A;  4LGM A;  2YNM D;  3AFH A;  3J81 S;  2ZM6 M;  3U6S A;  1R2Y A;  1MX0 A;  2KDL A;  2RGH A;  2V1C A;  2CFO A;  2J7O A;  4S12 A;  4I8O A;  3A45 A;  4DV5 M;  3FUV A;  5FTN A;  1IXS A;  2R62 A;  1GLN A;  3LCV B;  3WHK A;  2LWX A;  3I4Y A;  3AKZ A;  3FYC A;  3W0L B;  4F1I A;  5IRE B;  4PCZ A;  3GQ4 A;  2D7H A;  1MJG M;  4KT0 F;  3U6O A;  4QHT A;  1WGL A;  2D7E A;  3QYB A;  2DZO B;  2KNV A;  4FCV A;  3SBJ A;  5EP4 A;  5ITT A;  1WR1 B;  2J5Y A;  5ITQ A;  3GPU A;  2VQF M;  3HJ8 A;  4WW0 A;  4ITQ A;  3FTE A;  1QYR A;  1QZM A;  4AKH A;  2LVO C;  2HL7 A;  2XEP A;  2KW0 A;  2ZAM A;  1KYI A;  2QQ8 A;  2LVQ D;  3K1J A;  4LZZ A;  4WUR A;  2UUC M;  4DR1 M;  2MRO B;  2LHC A;  3GLG E;  4DUZ M;  4G4O A;  4JI3 M;  1VEG A;  1OFI A;  1NY6 A;  1HT2 E;  1DO2 A;  3K92 A;  1XB2 B;  3GRR A;  3SFZ A;  3A42 A;  1GL7 A;  4OVZ B;  4B08 A;  3T1Y M;  2JXN A;  4B3M M;  2M60 A;  3K8Z A;  2O25 A;  4D82 A;  2HKJ A;  3B7Z A;  1D0L A;  5A2Q S;  1SXJ D;  2CHG A;  3FTF A;  4ZPX A;  3IHP A;  2Y0T A;  3GPP A;  2DAI A;  4LCB A;  4LJA A;  3U5Z A;  1ZMW A;  3J2P B;  1I4W A;  3L28 A;  3NWL A;  4Y28 F;  4GC9 A;  1NV8 A;  4IJF A;  4XK8 F;  3SMP A;  1FJG M;  4AW4 A;  3ILK A;  3LQR A;  1T43 A;  2WSC F;  1PM5 A;  3K9P A;  3GLI A;  5F3W A;  3L26 A;  2L09 A;  2FS1 A;  3T1H M;  3T15 A;  3RGP A;  4BB9 A;  3FRI A;  4FVM A;  3CF0 A;  1DGF A;  3SAS A;  3J7A S;  2YR0 A;  3UJN A;  4G6Z A;  4IBK A;  2MJ5 B;  5ITU A;  4JXJ A;  2QSF X;  4P17 A;  3CTW B;  1XNQ M;  2JNH A;  3NBX X;  1HNZ M;  1TH4 A;  2YFQ A;  2DAM A;  2L7I A;  4FWG A;  3DFZ A;  4RF1 A;  2L7H A;  3VKH A;  1MN3 A;  4MB7 A;  1FNN A;  1Q3C A;  1OIP A;  2LNH C;  2KHH A;  2KNA A;  1ZV1 A;  4LGY A;  1TR8 A;  1R5L A;  1T6O A;  4M0D A;  3GLH A;  1C7Y A;  4AG5 A;  2ZAO A;  1G3I A;  2EKK A;  3MK6 A;  2JUJ A;  4IBI A;  3IG5 A;  4KOD A;  4L4U A;  4Q7J A;  5L8R F;  3J7B A;  3HKP A;  2Y20 A;  4DBG B;  5LMU M;  3SAW A;  1TGU A;  2K6B A;  1IN4 A;  2DI0 A;  4LJ7 A;  3SHF A;  3C9P A;  4FCW A;  4RF0 A;  1TTE A;  1WHC A;  1XC8 A;  1V33 A;  3IEC A;  3PNY A;  2CRU A;  4CHT B;  3H4J A;  1OAI A;  2CHQ A;  4LF5 M;  1UFZ A;  1HJP A;  1IM2 A;  1WGN A;  2DHR A;  3AJI B;  2F5Q A;  3D8B A;  5FTL A;  3PVS A;  1NHW C;  2C98 A;  1GL6 A;  4NRW A;  1PGY A;  3TWM A;  3L25 A;  2KRK A;  4DV2 M;  1WXQ A;  3U6E A;  1NVM A;  4B7G A;  1E32 A;  4L6V 6;  3B9P A;  1NO1 A;  3JAM S;  3HHZ A;  4GHL A;  2V1U A;  1K3W A;  3CGW A;  4IBJ A;  4B3T M;  1XXH E;  5E6J A;  3W67 A;  4G4N A;  1IBM M;  1EIJ A;  4L15 A;  1OTR A;  1NSF A;  2L2D A;  1C1K A;  5EQT A;  2XZF A;  2F5P A;  3K2L A;  1HQY E;  2D7G A;  1ZAE A;  2P5T A;  4NRV A;  2XFT A;  1QZE A;  2EO2 A;  1QVR A;  2QNJ A;  3AOG A;  4D81 A;  2OOA A;  2R4E A;  3TL4 X;  4R71 A;  3UGJ A;  2LTU A;  1N78 A;  2FH0 A;  4JI0 M;  3U6D A;  1XWI A;  5ITX E;  4JI1 M;  4HL4 A;  2X49 A;  4AI6 A;  3LW5 F;  3KVW A;  5ITY A;  3VFD A;  4GH9 A;  4ANR A;  4KLN A;  2MR9 A;  3FRH A;  4KO8 A;  2BNK A;  2DWL A;  2C9C A;  2JY8 A;  4IBC A;  2GNO A;  4QHS A;  3GLF A;  3C3E A;  5H37 D;  4X64 M;  1Q02 A;  2DAK A;  1IQP A;  4B7F A;  4PDI A;  2C5R A;  3CF2 A;  2QHO B;  4IBB A;  2NQ8 C;  4L78 A;  4LG2 A;  1OQY A;  1PRB A;  4FD2 A;  2GQF A;  7CAT A;  4LFA M;  1SXJ B;  2RGO A;  2C9O A; 
#chains in the Genus database with same CATH homology
 1XB2 B;  1F4I A;  2LVP C;  2H5X A;  1P3Q Q;  1YLA A;  1VEK A;  2O25 A;  2K9D A;  2ZTD A;  1DV0 A;  1SG9 A;  1ZMV A;  1R4G A;  3IHP A;  2DAI A;  2DNA A;  3E46 A;  1ZMW A;  1Y8G A;  1WIV A;  1NV8 A;  2CP8 A;  2JY5 A;  1OKS A;  1T43 A;  2G3Q A;  1EFU B;  3GLF E;  3K9P A;  2DAE A;  3FRI A;  2BWE A;  3T6P A;  1CUK A;  2MJ5 B;  2DKL A;  1NV9 A;  2L4E A;  2QSF X;  2JNH A;  4F2L A;  2DAM A;  5DFL A;  1ZMU A;  1VEJ A;  3LCU A;  1MN3 A;  3E21 A;  2JY7 A;  2B3T A;  2EJS A;  1GO5 A;  4WP2 A;  2KHH A;  2BWB A;  1ZV1 A;  2KNA A;  1TR8 A;  1T6O A;  2JZ1 A;  1C7Y A;  2R0I A;  1G3I A;  2EKK A;  2JUJ A;  1VG5 A;  5JI2 E;  4DBG B;  2K0B X;  2DZL A;  1G41 A;  2DAG A;  1BVS A;  2DI0 A;  2DHY A;  1DO0 A;  1TTE A;  1WHC A;  2DEN A;  1IFY A;  3IEC A;  1G4A E;  1A5T A;  3H4J A;  3GLI E;  1OAI A;  2JP7 A;  2JY6 B;  1UFZ A;  1HJP A;  1AIP C;  1IM2 A;  1WGN A;  2JZ0 A;  3FE3 A;  4G3O A;  1JR3 E;  1PGY A;  1HT1 E;  2LVA A;  4GEW A;  2HWJ A;  2KNZ A;  2CWB A;  2L4F A;  4UN2 B;  1V92 A;  2LBC A;  1XXH E;  3MMP A;  1OTR A;  4HEO A;  1IXS A;  2L2D A;  3LCV B;  3GLH E;  1HQY E;  1VDL A;  2LVN C;  1QZE A;  4F1I A;  2QNJ A;  2OOA A;  4R71 A;  2EKF A;  2LTU A;  1WGL A;  3K9O A;  1HT2 E;  2MGW A;  2OOB A;  2KNV A;  2RRU A;  3F92 A;  3BBZ A;  1WR1 B;  2HAK A;  3B89 A;  2MR9 A;  3FRH A;  2JY8 A;  2LVO C;  1WJ7 A;  2OO9 A;  1VQ1 A;  1Q02 A;  1KYI A;  2DAK A;  2WZJ A;  2LVQ D;  2QHO B;  2ZTC A;  2MRO B;  3GLG E;  1OQY A;  1VEG A;  4Q7J A;  1E94 E;  1DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...