2JNHA

Solution structure of the uba domain from cbl-b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
b'ALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Differential ubiquitin binding of the UBA domains from human c-Cbl and Cbl-b: NMR structural and biochemical insights
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 8
structure length 44
sequence length 44
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jnhA00
1QZEA 2R0IA 2DAIA 3FRHA 2HWJA 1Q02A 2DAEA 2LVQD 2MGWA 3E21A 2EJSA 1G41A 1VG5A 1HT2E 1DO0A 1P3QQ 2B3TA 2L4EA 1WHCA 3LCUA 3IHPA 2DAMA 2EKKA 5DFLA 2RRUA 2JNHA 2CWBA 3K9OA 1NV8A 2WZJA 1WGLA 2DAGA 1IFYA 2QSFX 1ZV1A 3H4JA 2OO9A 1WR1B 2JY5A 1VQ1A 2DNAA 2MR9A 3LCVB 2DENA 5JI2E 1CUKA 1ZMUA 2BWEA 2H5XA 1GO5A 3FRIA 1VEKA 1PGYA 4F1IA 2JUJA 1R4GA 1WGNA 1VDLA 3GLGE 2DHYA 1WIVA 2JP7A 1DO2A 2K0BX 1G4AE 3B89A 1T43A 1BVSA 1T6OA 1V92A 1F4IA 1KYIA 2K9DA 4UN2B 1JR3E 1EFUB 1MN3A 3K9PA 2KHHA 2G3QA 3E46A 2DKLA 2LVPC 1AIPC 1IM2A 3IECA 2OOAA 1TR8A 1WJ7A 1A5TA 1Y8GA 1G3IA 3T6PA 3F92A 4G3OA 2ZTDA 2LBCA 1TTEA 2MJ5B 1OKSA 1OQYA 2LTUA 2DI0A 2KNVA 2ZTCA 2LVAA 1OTRA 2QNJA 1YLAA 2LVOC 1XB2B 1VEGA 2CP8A 2JY6B 2L2DA 1HJPA 2BWBA 2KNZA 1E94E 2EKFA 3GLFE 1IXSA 4R71A 4Q7JA 3MMPA 2JY7A 1XXHE 4GEWA 1ZMWA 2DAKA 3GLIE 1HT1E 2MROB 1ZMVA 2HAKA 2JZ1A 4DBGB 1C7YA 1NV9A 2KNAA 4HEOA 2L4FA 2QHOB 2OOBA 1UFZA 1HQYE 3GLHE 1DV0A 2O25A 1SG9A 3BBZA 2LVNC 1OAIA 1VEJA 2DZLA 2JY8A 2JZ0A 4WP2A 3FE3A 4F2LA
chains in the Genus database with same CATH superfamily
2CRUA 4QNMA 8CATA 3B7QA 3KXEC 4QHTA 4P17A 2EO2A 2F4VM 4NRVA 1X37A 2DAEA 4LRSA 2MGWA 5KPZA 3E21A 2QBYA 2EJSA 2FS1A 3NBIA 1HT2E 1L8QA 1DO0A 1P3QQ 3VLFB 3GLGB 1WHCA 3LCUA 3IHPA 4LZJA 5ITYA 4K0KM 2KDLA 2Z3XA 5ITRA 3HJ8A 2LXEA 4LJAA 2CWBA 1SXJB 2L7HA 3KFUG 5IWAM 3W0LB 4G4NA 1NY6A 1OFIA 2XEPA 2DAGA 3QAUA 4DV7M 3U6PA 3U60B 2QSFX 1ZV1A 1IFYA 1OIPA 3J81S 1W5TA 4CHTB 5KO3A 3H4JA 1QAQA 5FTNA 3JR5A 2V1UA 2JY5A 1VQ1A 5ITQA 4LJ8A 3AL0C 5KQ8A 4X64M 1DGBA 2KRKA 2CV2A 4JI7M 4KHPM 4I8OA 1VEKA 4L8RC 4F1IA 3LVVA 4OU7A 2CV0A 3BOSA 4XGIA 1NHGC 4DUZM 3AFHA 3KP0E 1GLNA 3W67A 1KFVA 2RGHA 4FW9A 2O5RA 3U5ZB 4W5WA 2JA2A 4KODA 1SXJD 4MGIE 1IY1A 1K82A 1T6OA 1AUAA 1V92A 2K9DA 4NSRA 4YY3M 1QAOA 2KHHA 3GLFB 3GP1A 2G3QA 4IBDA 1IXSB 5EJCA 4AKHA 2QCUA 4XBOA 3U61B 1OIZA 4B3SM 4PCZA 4BB9A 5LMUM 1Y8GA 2CHQA 3MJ5A 2Y0QA 4LGYA 1XC8A 1RU3A 3L26A 3UMMA 4EIWA 2C9OA 3SMPA 1N75A 2CE7A 2J7NA 2LTUA 4AG5A 1IN8A 4JI8M 4B3TM 4JI3M 2DI0A 4L6V6 3IG5A 4D81A 4IJEA 1GL6A 3DOAA 2KW0A 2HKJA 1L2BA 4DR4M 1NVMA 1MJGM 3FD9A 3HHZA 4G4QA 3HHXA 4M9SA 4RNAA 5EP1A 3NWLA 3HY5A 3WHKA 2KNZA 4A3VB 4NRWA 3TWKA 3MMPA 5EXSA 2XSZD 5EXXA 5FLXS 3GRRA 3Q8XA 1XXHE 3UZUA 1OJLA 3GLIA 1QYRA 2DAKA 1DGHA 3K8ZA 1IQPA 1XHBA 3FYDA 3VKHA 2DHRA 4M0WA 1D0LA 1GVNA 3HZJA 3UGJA 1E32A 2F5SA 3VDUA 4HEOA 1SXJC 4S12A 1PJIA 1NHWC 3FTCA 3I4YA 1DGGA 4IBIA 1Z6TA 1HQYE 2R44A 3L27A 4X66M 3GLHE 3ZQJA 3PXGA 1L1TA 3GPUA 3DZDA 2ZAOA 3TWMA 2DZLA 1Z59A 2FFJA 3HU1A 1XWIA 4F2LA 1QZEA 3QYEA 3LW5F 3SHGB 3KDSE 5IREB 4JYAM 4D82A 2HWJA 2Q2EB 1Q02A 5EXTA 3J27B 4LRTA 4LCBA 5EP4A 1QUSA 2L4EA 3U6SA 4FCVA 4IBGA 2VQFM 4DV6M 4CIZA 2RRUA 3KVWA 3HU3A 3R8FA 2JNHA 3VDPA 2KA6B 3I4VA 4L78A 2JWSA 2CHGA 3THGA 4Y28F 3K9OA 1NV8A 2WZJA 4IBKA 3QYBA 2I7PA 3ILKA 3GO8A 2VQEM 4AQYM 2OO9A 1HQCA 4Z8XA 3T1YM 3GRUA 4NSOB 1C1KA 1G8PA 2C99A 4NC6A 3RFWA 4DV3M 3Q8GA 3LQRA 4Z6YA 1VDDA 3LVWA 1HR0M 1TGUA 1EIJA 1GO5A 3D8BA 4CISA 3AJIB 1ORYB 1PJQA 3MK6A 4LJ4A 2D7HA 4CGYB 3FUUA 3FYCA 1IN7A 1VDLA 2DWLA 3A98B 3VK7A 2DHYA 5ITXE 2M5ZA 3E9SA 3E4RA 1MX0A 3HKPA 1DO2A 2WSFF 1L1ZA 2C96A 2G5GX 2HL7A 3WHLA 4FWDA 4KT0F 1T43A 4M9XA 3SAUA 1IY2A 2DVWB 3C58A 5F3WA 3SFZA 4LF8M 2A5YB 1LV7A 1JR3E 2LH0A 3B74A 4DV4M 2V1CA 3K9PA 3V76A 3JR4A 1NJGA 4DV1M 3E46A 4FCTA 1PRBA 7CATA 3K1JA 5E6JA 3HWSA 2F5OA 5EXPA 2R65A 3AOEC 1A5TA 4WW0A 3GLIB 2XFTA 3LQQA 1IY0A 5DYGA 1DGHB 1G3IA 3F92A 1GJSA 3C9PA 4DR6M 1TTEA 2MJ5B 1I4WA 3I04M 1OQYA 3GPXA 2ZM6M 2Y20A 3SAVA 4KLNA 1QQWA 2VF8A 4HL4A 2ZTCA 5JI3E 4PD2A 5L8RF 3GQ3A 1DGFA 2LVAA 1HNXM 4DV2M 2F5PA 4GKKM 2ERCA 5BPVA 4M9ZA 2J7OA 1XB2B 4ITQA 3AV0A 4MM3B 1TF0B 1VEGA 2JY6B 4GITA 4G4OA 1G59A 2BWBA 4GH9A 5DNYA 5EP3A 1K3WA 2Y21A 2CFOA 1LTMA 1XXHA 4Q7JA 3PVSA 4RKUF 3J7AS 1NNUC 4GEWA 4LGMA 2X49A 1HT1E 1ZQ9A 3U6CA 2UUAM 3ZC7B 2JZ1A 3KS8A 3GQ4A 1E9SA 4IBEA 4DBGB 4B3RM 3IG8A 2L09A 2NQ8C 1JQJC 2KNAA 1C7YA 4L16A 5EQTA 2Y0TA 3GLHA 2OOBA 2WSEF 3CGWA 1DV0A 2ZAMA 4GIPA 4HLQA 1TH2A 3HX3A 1V33A 4FD2A 4GMQA 3BBZA 3J7BA 2VIIA 4QHSA 2EA0A 4LF5M 4B3MM 2KEBA 4MGKE 4ZPXA 3DA1A 1QDRA 2R0IA 5DYIA 1R2ZA 3TE6A 1Q39A 2DZNB 1GJTA 2DAIA 3FRHA 3FUVA 4IBJA 4NXNM 1XNQM 2DWMA 3PNVA 4G4RA 2LVQD 1FNNA 2D7EA 2JXNA 3SYKA 1NO1A 3CF2A 4OW0A 5DFLA 2Z4RA 4JXJA 3VKGA 1IN5A 1KSFX 4JI5M 1XNRM 1IXRC 1QVRA 4MGYE 4JI6M 1S3SA 2G8LA 4MGHA 3A46A 2DWZB 4II7A 5KQDA 2N35A 3TWLA 3KOXE 4QOZC 2Z4SA 3RE8A 1R5LA 5FTMA 1WR1B 4XK8F 1QDTA 2MH8A 2DENA 5KPRA 5JI2E 1NNJA 3L28A 1IN6A 4X62M 1ZMUA 4NOOB 2BWEA 1L2DA 2H5XA 2X4AA 4AI6A 4R3DA 2C5RA 3W0FA 3B7NA 1PGYA 1WXQA 2QQ8A 4LY6A 4G6ZA 2KZUA 4AW4A 5ITXA 1OFHA 4IBFA 3SBJA 3GLGE 2BNKA 1WIVA 1YSYA 1G4AE 4DUYM 3CTWB 2YR0A 4JV5M 3HJSA 4CJ6A 1SXJE 3LMMA 3UK6A 2CUZA 1GABA 1D0KA 1R6BX 1JR3A 2BJWA 4DV0M 3QWLA 1KYIA 1Q3CA 1F4IA 4DR1M 1MN3A 1L2CA 2QENA 1MU5A 1T3TA 3CF6E 2DKLA 2LVPC 3TL4X 1XXHB 2OOAA 1TR8A 2UU9M 2H1RA 1Z5CA 3L29A 4LFAM 1YUBA 2HCBA 3TQSA 3KOZE 3R9XB 3SC3A 3T6PA 4G3OA 2XGNA 2XH9A 2LBCA 3HHWA 3KP1E 2UUCM 2I7NA 3GRVA 5ITUA 4LF4M 4TUWA 1Z5BA 1N77A 4OX9M 4REZA 2KNVA 3GLHB 2DZOB 4FVMA 2OPFA 1NSFA 2FOIC 2W82A 4LF9M 2R18A 3SMSA 4RF0A 2RKOA 3GPPA 2J5YA 2LVOC 3M0EA 4MB7A 2CP8A 2GQFA 2L2DA 1H6UA 4QNRA 4D80A 4JI4M 1E94E 2EKFA 3GLFE 2EUCA 4R71A 5ITTA 2JY7A 3KOYE 1I94M 2ZBKB 1OAOC 2KXEA 4NXMM 3AOEA 3EIEA 2ZANA 4MGZE 1ZMWA 3KS4A 1TH3A 2R6FA 2V6ZM 3C3EA 1J7KA 3B9PA 4L4UA 1ZMVA 2HAKA 2KRUA 4P16A 4BBAA 1D2NA 4OVZA 2UXBM 4DR2M 4GRIA 4I4LA 3ZH9B 4DV5M 4IIWA 2QHOB 5FSWA 3B7ZA 1V34A 3BXWA 3PNYA 2CV1A 2KZSA 2UXCM 3M6AA 1N78A 2R4EA 4I5SA 4M0DA 3KSXA 2VDBB 2QP9X 4IBBA 1G71A 2R62A 4AG6A 2O01F 2LVNC 2C9CA 1OAIA 3DFZA 3FTFA 2L7IA 2XZUA 3M7GA 2JZ0A 3L2AA 4WP2A 3VFDA 4BLCA 1PJJA 1IBKM 1QANA 3KOWE 5E26A 4B7HA 2FNAA 3GQ5A 3CF0A 2XZFA 3HU2A 4KO8A 1Z5AA 4JI2M 1NY5A 1TH4A 1G41A 1VG5A 2P5TA 3C3DA 1TDHA 2B3TA 3U6EA 3FUTA 2DAMA 2EKKA 4GKJM 3GRYA 2OQ4A 2QZ4A 2HHHM 1N32M 2L6OA 3GPYA 3U6OA 2YQZA 3SYLA 3A42A 1WGLA 1J5EM 1IXZA 2K6BA 2XF3A 3FUXA 4FCWA 4LJ5A 3U6MA 2RGOA 1IBLM 4WURA 3SASA 4L15A 2MR9A 2DNAA 1HNZM 1N33M 3LCVB 4FWGA 4LZZA 1FJGM 5IT9S 1K3XA 4LG2A 1CUKA 3U6DA 4JN6A 3HGIA 2UUBM 3FRIA 2LNHC 2Z8YM 2JUJA 4R7GA 1R4GA 3SARA 3UJNA 3GLGA 1WGNA 2XFSA 2D7GA 4B08A 3U6QA 4AZFA 4IBCA 4FWHA 3K2LA 2JP7A 2K0BX 2YFQA 3AOGA 3HHYA 1QUTA 1SXJA 4X65M 3J80S 4NL4H 5GKNA 3B89A 4LJ6A 5C18A 4DR3M 3SAWA 3U60A 3VK8A 5C1BA 1JB0F 5FTLA 1BVSA 1GL7A 2R45A 3W68A 1TDZA 1EE8A 4JI0M 3U6LA 4UN2B 1EFUB 3HJQA 1JR3D 5IZ7D 3FKEA 2X8AA 1D0MA 1E9RA 1QZMA 3T38A 2CHVA 3I51A 1AIPC 1IM2A 1UM8A 3IECA 2DWNA 3TPZA 2R4JA 4LJ7A 1WJ7A 1R2YA 4GHAA 1IN4A 2GNOA 2Z7JA 1ZAEA 1XMQM 3I01M 2M60A 1N36M 2QBYB 2CEAA 2LWXA 4DR7M 2FH0A 2ZTDA 3KW6A 4YHHM 3OTOM 2C98A 3SHFA 3H4MA 4OVZB 1OKSA 2YNMD 5EP2A 1HNWM 4GC9A 4B7FA 3U5ZA 3T15A 1J09A 4B7GA 2K47A 1OTRA 2E5LM 2BJVA 3AKZA 2XLJA 4PDGA 2QNJA 3FUWA 4DR5M 4LF6M 4QOSA 1YLAA 4PDIA 1QAMA 3GLFA 4I81A 3NBXX 5FTKA 3K92A 1HJPA 2XSZA 3KSJA 1XMOM 1IXSA 3T1HM 1NJFA 3U61A 5LMNM 2R46A 5FTJA 3RGSA 5A2QS 3ZCBB 3PFIA 3GLIE 2MROB 3A45A 3FTDA 4LFCM 3SATA 4PT5A 3D8LA 2VF7A 3MHVC 3JAMS 2WSCF 1R7RA 1NV9A 5BR8M 1PM5A 4LJ9A 2F5NA 2F5QA 2QPAA 3RGPA 4IJFA 4AKIA 2L4FA 3EIHA 2DXIA 4LF7M 1UFZA 1PJTA 2FE8A 5KPTA 2O25A 1SG9A 4GC5A 3FTEA 2UXDM 4RF1A 1Q3BA 1N34M 2AHMA 1PJSA 4LFBM 3L25A 4GHLA 1GKIA 1W5SA 1VEJA 1YE9A 2JY8A 2LHCA 4ANRA 5H37D 4MH0E 2APLA 1IBMM 4JI1M 2LHGA 3J2PB 4AKGA 3FE3A
chains in the Genus database with same CATH topology
1QZEA 2R0IA 2DAIA 3FRHA 2HWJA 1Q02A 2DAEA 2LVQD 2MGWA 3E21A 2EJSA 1G41A 1VG5A 1HT2E 1DO0A 1P3QQ 2B3TA 2L4EA 1WHCA 3LCUA 3IHPA 2DAMA 2EKKA 5DFLA 2RRUA 2JNHA 2CWBA 3K9OA 1NV8A 2WZJA 1WGLA 2DAGA 1IFYA 2QSFX 1ZV1A 3H4JA 2OO9A 1WR1B 2JY5A 1VQ1A 2DNAA 2MR9A 3LCVB 2DENA 5JI2E 1CUKA 1ZMUA 2BWEA 2H5XA 1GO5A 3FRIA 1VEKA 1PGYA 4F1IA 2JUJA 1R4GA 1WGNA 1VDLA 3GLGE 2DHYA 1WIVA 2JP7A 1DO2A 2K0BX 1G4AE 3B89A 1T43A 1BVSA 1T6OA 1V92A 1F4IA 1KYIA 2K9DA 4UN2B 1JR3E 1EFUB 1MN3A 3K9PA 2KHHA 2G3QA 3E46A 2DKLA 2LVPC 1AIPC 1IM2A 3IECA 2OOAA 1TR8A 1WJ7A 1A5TA 1Y8GA 1G3IA 3T6PA 3F92A 4G3OA 2ZTDA 2LBCA 1TTEA 2MJ5B 1OKSA 1OQYA 2LTUA 2DI0A 2KNVA 2ZTCA 2LVAA 1OTRA 2QNJA 1YLAA 2LVOC 1XB2B 1VEGA 2CP8A 2JY6B 2L2DA 1HJPA 2BWBA 2KNZA 1E94E 2EKFA 3GLFE 1IXSA 4R71A 4Q7JA 3MMPA 2JY7A 1XXHE 4GEWA 1ZMWA 2DAKA 3GLIE 1HT1E 2MROB 1ZMVA 2HAKA 2JZ1A 4DBGB 1C7YA 1NV9A 2KNAA 4HEOA 2L4FA 2QHOB 2OOBA 1UFZA 1HQYE 3GLHE 1DV0A 2O25A 1SG9A 3BBZA 2LVNC 1OAIA 1VEJA 2DZLA 2JY8A 2JZ0A 4WP2A 3FE3A 4F2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZE A;  2R0I A;  2DAI A;  3FRH A;  2HWJ A;  1Q02 A;  2DAE A;  2LVQ D;  2MGW A;  3E21 A;  2EJS A;  1G41 A;  1VG5 A;  1HT2 E;  1DO0 A;  1P3Q Q;  2B3T A;  2L4E A;  1WHC A;  3LCU A;  3IHP A;  2DAM A;  2EKK A;  5DFL A;  2RRU A;  2JNH A;  2CWB A;  3K9O A;  1NV8 A;  2WZJ A;  1WGL A;  2DAG A;  1IFY A;  2QSF X;  1ZV1 A;  3H4J A;  2OO9 A;  1WR1 B;  2JY5 A;  1VQ1 A;  2DNA A;  2MR9 A;  3LCV B;  2DEN A;  5JI2 E;  1CUK A;  1ZMU A;  2BWE A;  2H5X A;  1GO5 A;  3FRI A;  1VEK A;  1PGY A;  4F1I A;  2JUJ A;  1R4G A;  1WGN A;  1VDL A;  3GLG E;  2DHY A;  1WIV A;  2JP7 A;  1DO2 A;  2K0B X;  1G4A E;  3B89 A;  1T43 A;  1BVS A;  1T6O A;  1V92 A;  1F4I A;  1KYI A;  2K9D A;  4UN2 B;  1JR3 E;  1EFU B;  1MN3 A;  3K9P A;  2KHH A;  2G3Q A;  3E46 A;  2DKL A;  2LVP C;  1AIP C;  1IM2 A;  3IEC A;  2OOA A;  1TR8 A;  1WJ7 A;  1A5T A;  1Y8G A;  1G3I A;  3T6P A;  3F92 A;  4G3O A;  2ZTD A;  2LBC A;  1TTE A;  2MJ5 B;  1OKS A;  1OQY A;  2LTU A;  2DI0 A;  2KNV A;  2ZTC A;  2LVA A;  1OTR A;  2QNJ A;  1YLA A;  2LVO C;  1XB2 B;  1VEG A;  2CP8 A;  2JY6 B;  2L2D A;  1HJP A;  2BWB A;  2KNZ A;  1E94 E;  2EKF A;  3GLF E;  1IXS A;  4R71 A;  4Q7J A;  3MMP A;  2JY7 A;  1XXH E;  4GEW A;  1ZMW A;  2DAK A;  3GLI E;  1HT1 E;  2MRO B;  1ZMV A;  2HAK A;  2JZ1 A;  4DBG B;  1C7Y A;  1NV9 A;  2KNA A;  4HEO A;  2L4F A;  2QHO B;  2OOB A;  1UFZ A;  1HQY E;  3GLH E;  1DV0 A;  2O25 A;  1SG9 A;  3BBZ A;  2LVN C;  1OAI A;  1VEJ A;  2DZL A;  2JY8 A;  2JZ0 A;  4WP2 A;  3FE3 A;  4F2L A; 
#chains in the Genus database with same CATH topology
 2CRU A;  4QNM A;  8CAT A;  3B7Q A;  3KXE C;  4QHT A;  4P17 A;  2EO2 A;  2F4V M;  4NRV A;  1X37 A;  2DAE A;  4LRS A;  2MGW A;  5KPZ A;  3E21 A;  2QBY A;  2EJS A;  2FS1 A;  3NBI A;  1HT2 E;  1L8Q A;  1DO0 A;  1P3Q Q;  3VLF B;  3GLG B;  1WHC A;  3LCU A;  3IHP A;  4LZJ A;  5ITY A;  4K0K M;  2KDL A;  2Z3X A;  5ITR A;  3HJ8 A;  2LXE A;  4LJA A;  2CWB A;  1SXJ B;  2L7H A;  3KFU G;  5IWA M;  3W0L B;  4G4N A;  1NY6 A;  1OFI A;  2XEP A;  2DAG A;  3QAU A;  4DV7 M;  3U6P A;  3U60 B;  2QSF X;  1ZV1 A;  1IFY A;  1OIP A;  3J81 S;  1W5T A;  4CHT B;  5KO3 A;  3H4J A;  1QAQ A;  5FTN A;  3JR5 A;  2V1U A;  2JY5 A;  1VQ1 A;  5ITQ A;  4LJ8 A;  3AL0 C;  5KQ8 A;  4X64 M;  1DGB A;  2KRK A;  2CV2 A;  4JI7 M;  4KHP M;  4I8O A;  1VEK A;  4L8R C;  4F1I A;  3LVV A;  4OU7 A;  2CV0 A;  3BOS A;  4XGI A;  1NHG C;  4DUZ M;  3AFH A;  3KP0 E;  1GLN A;  3W67 A;  1KFV A;  2RGH A;  4FW9 A;  2O5R A;  3U5Z B;  4W5W A;  2JA2 A;  4KOD A;  1SXJ D;  4MGI E;  1IY1 A;  1K82 A;  1T6O A;  1AUA A;  1V92 A;  2K9D A;  4NSR A;  4YY3 M;  1QAO A;  2KHH A;  3GLF B;  3GP1 A;  2G3Q A;  4IBD A;  1IXS B;  5EJC A;  4AKH A;  2QCU A;  4XBO A;  3U61 B;  1OIZ A;  4B3S M;  4PCZ A;  4BB9 A;  5LMU M;  1Y8G A;  2CHQ A;  3MJ5 A;  2Y0Q A;  4LGY A;  1XC8 A;  1RU3 A;  3L26 A;  3UMM A;  4EIW A;  2C9O A;  3SMP A;  1N75 A;  2CE7 A;  2J7N A;  2LTU A;  4AG5 A;  1IN8 A;  4JI8 M;  4B3T M;  4JI3 M;  2DI0 A;  4L6V 6;  3IG5 A;  4D81 A;  4IJE A;  1GL6 A;  3DOA A;  2KW0 A;  2HKJ A;  1L2B A;  4DR4 M;  1NVM A;  1MJG M;  3FD9 A;  3HHZ A;  4G4Q A;  3HHX A;  4M9S A;  4RNA A;  5EP1 A;  3NWL A;  3HY5 A;  3WHK A;  2KNZ A;  4A3V B;  4NRW A;  3TWK A;  3MMP A;  5EXS A;  2XSZ D;  5EXX A;  5FLX S;  3GRR A;  3Q8X A;  1XXH E;  3UZU A;  1OJL A;  3GLI A;  1QYR A;  2DAK A;  1DGH A;  3K8Z A;  1IQP A;  1XHB A;  3FYD A;  3VKH A;  2DHR A;  4M0W A;  1D0L A;  1GVN A;  3HZJ A;  3UGJ A;  1E32 A;  2F5S A;  3VDU A;  4HEO A;  1SXJ C;  4S12 A;  1PJI A;  1NHW C;  3FTC A;  3I4Y A;  1DGG A;  4IBI A;  1Z6T A;  1HQY E;  2R44 A;  3L27 A;  4X66 M;  3GLH E;  3ZQJ A;  3PXG A;  1L1T A;  3GPU A;  3DZD A;  2ZAO A;  3TWM A;  2DZL A;  1Z59 A;  2FFJ A;  3HU1 A;  1XWI A;  4F2L A;  1QZE A;  3QYE A;  3LW5 F;  3SHG B;  3KDS E;  5IRE B;  4JYA M;  4D82 A;  2HWJ A;  2Q2E B;  1Q02 A;  5EXT A;  3J27 B;  4LRT A;  4LCB A;  5EP4 A;  1QUS A;  2L4E A;  3U6S A;  4FCV A;  4IBG A;  2VQF M;  4DV6 M;  4CIZ A;  2RRU A;  3KVW A;  3HU3 A;  3R8F A;  2JNH A;  3VDP A;  2KA6 B;  3I4V A;  4L78 A;  2JWS A;  2CHG A;  3THG A;  4Y28 F;  3K9O A;  1NV8 A;  2WZJ A;  4IBK A;  3QYB A;  2I7P A;  3ILK A;  3GO8 A;  2VQE M;  4AQY M;  2OO9 A;  1HQC A;  4Z8X A;  3T1Y M;  3GRU A;  4NSO B;  1C1K A;  1G8P A;  2C99 A;  4NC6 A;  3RFW A;  4DV3 M;  3Q8G A;  3LQR A;  4Z6Y A;  1VDD A;  3LVW A;  1HR0 M;  1TGU A;  1EIJ A;  1GO5 A;  3D8B A;  4CIS A;  3AJI B;  1ORY B;  1PJQ A;  3MK6 A;  4LJ4 A;  2D7H A;  4CGY B;  3FUU A;  3FYC A;  1IN7 A;  1VDL A;  2DWL A;  3A98 B;  3VK7 A;  2DHY A;  5ITX E;  2M5Z A;  3E9S A;  3E4R A;  1MX0 A;  3HKP A;  1DO2 A;  2WSF F;  1L1Z A;  2C96 A;  2G5G X;  2HL7 A;  3WHL A;  4FWD A;  4KT0 F;  1T43 A;  4M9X A;  3SAU A;  1IY2 A;  2DVW B;  3C58 A;  5F3W A;  3SFZ A;  4LF8 M;  2A5Y B;  1LV7 A;  1JR3 E;  2LH0 A;  3B74 A;  4DV4 M;  2V1C A;  3K9P A;  3V76 A;  3JR4 A;  1NJG A;  4DV1 M;  3E46 A;  4FCT A;  1PRB A;  7CAT A;  3K1J A;  5E6J A;  3HWS A;  2F5O A;  5EXP A;  2R65 A;  3AOE C;  1A5T A;  4WW0 A;  3GLI B;  2XFT A;  3LQQ A;  1IY0 A;  5DYG A;  1DGH B;  1G3I A;  3F92 A;  1GJS A;  3C9P A;  4DR6 M;  1TTE A;  2MJ5 B;  1I4W A;  3I04 M;  1OQY A;  3GPX A;  2ZM6 M;  2Y20 A;  3SAV A;  4KLN A;  1QQW A;  2VF8 A;  4HL4 A;  2ZTC A;  5JI3 E;  4PD2 A;  5L8R F;  3GQ3 A;  1DGF A;  2LVA A;  1HNX M;  4DV2 M;  2F5P A;  4GKK M;  2ERC A;  5BPV A;  4M9Z A;  2J7O A;  1XB2 B;  4ITQ A;  3AV0 A;  4MM3 B;  1TF0 B;  1VEG A;  2JY6 B;  4GIT A;  4G4O A;  1G59 A;  2BWB A;  4GH9 A;  5DNY A;  5EP3 A;  1K3W A;  2Y21 A;  2CFO A;  1LTM A;  1XXH A;  4Q7J A;  3PVS A;  4RKU F;  3J7A S;  1NNU C;  4GEW A;  4LGM A;  2X49 A;  1HT1 E;  1ZQ9 A;  3U6C A;  2UUA M;  3ZC7 B;  2JZ1 A;  3KS8 A;  3GQ4 A;  1E9S A;  4IBE A;  4DBG B;  4B3R M;  3IG8 A;  2L09 A;  2NQ8 C;  1JQJ C;  2KNA A;  1C7Y A;  4L16 A;  5EQT A;  2Y0T A;  3GLH A;  2OOB A;  2WSE F;  3CGW A;  1DV0 A;  2ZAM A;  4GIP A;  4HLQ A;  1TH2 A;  3HX3 A;  1V33 A;  4FD2 A;  4GMQ A;  3BBZ A;  3J7B A;  2VII A;  4QHS A;  2EA0 A;  4LF5 M;  4B3M M;  2KEB A;  4MGK E;  4ZPX A;  3DA1 A;  1QDR A;  2R0I A;  5DYI A;  1R2Z A;  3TE6 A;  1Q39 A;  2DZN B;  1GJT A;  2DAI A;  3FRH A;  3FUV A;  4IBJ A;  4NXN M;  1XNQ M;  2DWM A;  3PNV A;  4G4R A;  2LVQ D;  1FNN A;  2D7E A;  2JXN A;  3SYK A;  1NO1 A;  3CF2 A;  4OW0 A;  5DFL A;  2Z4R A;  4JXJ A;  3VKG A;  1IN5 A;  1KSF X;  4JI5 M;  1XNR M;  1IXR C;  1QVR A;  4MGY E;  4JI6 M;  1S3S A;  2G8L A;  4MGH A;  3A46 A;  2DWZ B;  4II7 A;  5KQD A;  2N35 A;  3TWL A;  3KOX E;  4QOZ C;  2Z4S A;  3RE8 A;  1R5L A;  5FTM A;  1WR1 B;  4XK8 F;  1QDT A;  2MH8 A;  2DEN A;  5KPR A;  5JI2 E;  1NNJ A;  3L28 A;  1IN6 A;  4X62 M;  1ZMU A;  4NOO B;  2BWE A;  1L2D A;  2H5X A;  2X4A A;  4AI6 A;  4R3D A;  2C5R A;  3W0F A;  3B7N A;  1PGY A;  1WXQ A;  2QQ8 A;  4LY6 A;  4G6Z A;  2KZU A;  4AW4 A;  5ITX A;  1OFH A;  4IBF A;  3SBJ A;  3GLG E;  2BNK A;  1WIV A;  1YSY A;  1G4A E;  4DUY M;  3CTW B;  2YR0 A;  4JV5 M;  3HJS A;  4CJ6 A;  1SXJ E;  3LMM A;  3UK6 A;  2CUZ A;  1GAB A;  1D0K A;  1R6B X;  1JR3 A;  2BJW A;  4DV0 M;  3QWL A;  1KYI A;  1Q3C A;  1F4I A;  4DR1 M;  1MN3 A;  1L2C A;  2QEN A;  1MU5 A;  1T3T A;  3CF6 E;  2DKL A;  2LVP C;  3TL4 X;  1XXH B;  2OOA A;  1TR8 A;  2UU9 M;  2H1R A;  1Z5C A;  3L29 A;  4LFA M;  1YUB A;  2HCB A;  3TQS A;  3KOZ E;  3R9X B;  3SC3 A;  3T6P A;  4G3O A;  2XGN A;  2XH9 A;  2LBC A;  3HHW A;  3KP1 E;  2UUC M;  2I7N A;  3GRV A;  5ITU A;  4LF4 M;  4TUW A;  1Z5B A;  1N77 A;  4OX9 M;  4REZ A;  2KNV A;  3GLH B;  2DZO B;  4FVM A;  2OPF A;  1NSF A;  2FOI C;  2W82 A;  4LF9 M;  2R18 A;  3SMS A;  4RF0 A;  2RKO A;  3GPP A;  2J5Y A;  2LVO C;  3M0E A;  4MB7 A;  2CP8 A;  2GQF A;  2L2D A;  1H6U A;  4QNR A;  4D80 A;  4JI4 M;  1E94 E;  2EKF A;  3GLF E;  2EUC A;  4R71 A;  5ITT A;  2JY7 A;  3KOY E;  1I94 M;  2ZBK B;  1OAO C;  2KXE A;  4NXM M;  3AOE A;  3EIE A;  2ZAN A;  4MGZ E;  1ZMW A;  3KS4 A;  1TH3 A;  2R6F A;  2V6Z M;  3C3E A;  1J7K A;  3B9P A;  4L4U A;  1ZMV A;  2HAK A;  2KRU A;  4P16 A;  4BBA A;  1D2N A;  4OVZ A;  2UXB M;  4DR2 M;  4GRI A;  4I4L A;  3ZH9 B;  4DV5 M;  4IIW A;  2QHO B;  5FSW A;  3B7Z A;  1V34 A;  3BXW A;  3PNY A;  2CV1 A;  2KZS A;  2UXC M;  3M6A A;  1N78 A;  2R4E A;  4I5S A;  4M0D A;  3KSX A;  2VDB B;  2QP9 X;  4IBB A;  1G71 A;  2R62 A;  4AG6 A;  2O01 F;  2LVN C;  2C9C A;  1OAI A;  3DFZ A;  3FTF A;  2L7I A;  2XZU A;  3M7G A;  2JZ0 A;  3L2A A;  4WP2 A;  3VFD A;  4BLC A;  1PJJ A;  1IBK M;  1QAN A;  3KOW E;  5E26 A;  4B7H A;  2FNA A;  3GQ5 A;  3CF0 A;  2XZF A;  3HU2 A;  4KO8 A;  1Z5A A;  4JI2 M;  1NY5 A;  1TH4 A;  1G41 A;  1VG5 A;  2P5T A;  3C3D A;  1TDH A;  2B3T A;  3U6E A;  3FUT A;  2DAM A;  2EKK A;  4GKJ M;  3GRY A;  2OQ4 A;  2QZ4 A;  2HHH M;  1N32 M;  2L6O A;  3GPY A;  3U6O A;  2YQZ A;  3SYL A;  3A42 A;  1WGL A;  1J5E M;  1IXZ A;  2K6B A;  2XF3 A;  3FUX A;  4FCW A;  4LJ5 A;  3U6M A;  2RGO A;  1IBL M;  4WUR A;  3SAS A;  4L15 A;  2MR9 A;  2DNA A;  1HNZ M;  1N33 M;  3LCV B;  4FWG A;  4LZZ A;  1FJG M;  5IT9 S;  1K3X A;  4LG2 A;  1CUK A;  3U6D A;  4JN6 A;  3HGI A;  2UUB M;  3FRI A;  2LNH C;  2Z8Y M;  2JUJ A;  4R7G A;  1R4G A;  3SAR A;  3UJN A;  3GLG A;  1WGN A;  2XFS A;  2D7G A;  4B08 A;  3U6Q A;  4AZF A;  4IBC A;  4FWH A;  3K2L A;  2JP7 A;  2K0B X;  2YFQ A;  3AOG A;  3HHY A;  1QUT A;  1SXJ A;  4X65 M;  3J80 S;  4NL4 H;  5GKN A;  3B89 A;  4LJ6 A;  5C18 A;  4DR3 M;  3SAW A;  3U60 A;  3VK8 A;  5C1B A;  1JB0 F;  5FTL A;  1BVS A;  1GL7 A;  2R45 A;  3W68 A;  1TDZ A;  1EE8 A;  4JI0 M;  3U6L A;  4UN2 B;  1EFU B;  3HJQ A;  1JR3 D;  5IZ7 D;  3FKE A;  2X8A A;  1D0M A;  1E9R A;  1QZM A;  3T38 A;  2CHV A;  3I51 A;  1AIP C;  1IM2 A;  1UM8 A;  3IEC A;  2DWN A;  3TPZ A;  2R4J A;  4LJ7 A;  1WJ7 A;  1R2Y A;  4GHA A;  1IN4 A;  2GNO A;  2Z7J A;  1ZAE A;  1XMQ M;  3I01 M;  2M60 A;  1N36 M;  2QBY B;  2CEA A;  2LWX A;  4DR7 M;  2FH0 A;  2ZTD A;  3KW6 A;  4YHH M;  3OTO M;  2C98 A;  3SHF A;  3H4M A;  4OVZ B;  1OKS A;  2YNM D;  5EP2 A;  1HNW M;  4GC9 A;  4B7F A;  3U5Z A;  3T15 A;  1J09 A;  4B7G A;  2K47 A;  1OTR A;  2E5L M;  2BJV A;  3AKZ A;  2XLJ A;  4PDG A;  2QNJ A;  3FUW A;  4DR5 M;  4LF6 M;  4QOS A;  1YLA A;  4PDI A;  1QAM A;  3GLF A;  4I81 A;  3NBX X;  5FTK A;  3K92 A;  1HJP A;  2XSZ A;  3KSJ A;  1XMO M;  1IXS A;  3T1H M;  1NJF A;  3U61 A;  5LMN M;  2R46 A;  5FTJ A;  3RGS A;  5A2Q S;  3ZCB B;  3PFI A;  3GLI E;  2MRO B;  3A45 A;  3FTD A;  4LFC M;  3SAT A;  4PT5 A;  3D8L A;  2VF7 A;  3MHV C;  3JAM S;  2WSC F;  1R7R A;  1NV9 A;  5BR8 M;  1PM5 A;  4LJ9 A;  2F5N A;  2F5Q A;  2QPA A;  3RGP A;  4IJF A;  4AKI A;  2L4F A;  3EIH A;  2DXI A;  4LF7 M;  1UFZ A;  1PJT A;  2FE8 A;  5KPT A;  2O25 A;  1SG9 A;  4GC5 A;  3FTE A;  2UXD M;  4RF1 A;  1Q3B A;  1N34 M;  2AHM A;  1PJS A;  4LFB M;  3L25 A;  4GHL A;  1GKI A;  1W5S A;  1VEJ A;  1YE9 A;  2JY8 A;  2LHC A;  4ANR A;  5H37 D;  4MH0 E;  2APL A;  1IBM M;  4JI1 M;  2LHG A;  3J2P B;  4AKG A;  3FE3 A; 
#chains in the Genus database with same CATH homology
 1QZE A;  2R0I A;  2DAI A;  3FRH A;  2HWJ A;  1Q02 A;  2DAE A;  2LVQ D;  2MGW A;  3E21 A;  2EJS A;  1G41 A;  1VG5 A;  1HT2 E;  1DO0 A;  1P3Q Q;  2B3T A;  2L4E A;  1WHC A;  3LCU A;  3IHP A;  2DAM A;  2EKK A;  5DFL A;  2RRU A;  2JNH A;  2CWB A;  3K9O A;  1NV8 A;  2WZJ A;  1WGL A;  2DAG A;  1IFY A;  2QSF X;  1ZV1 A;  3H4J A;  2OO9 A;  1WR1 B;  2JY5 A;  1VQ1 A;  2DNA A;  2MR9 A;  3LCV B;  2DEN A;  5JI2 E;  1CUK A;  1ZMU A;  2BWE A;  2H5X A;  1GO5 A;  3FRI A;  1VEK A;  1PGY A;  4F1I A;  2JUJ A;  1R4G A;  1WGN A;  1VDL A;  3GLG E;  2DHY A;  1WIV A;  2JP7 A;  1DO2 A;  2K0B X;  1G4A E;  3B89 A;  1T43 A;  1BVS A;  1T6O A;  1V92 A;  1F4I A;  1KYI A;  2K9D A;  4UN2 B;  1JR3 E;  1EFU B;  1MN3 A;  3K9P A;  2KHH A;  2G3Q A;  3E46 A;  2DKL A;  2LVP C;  1AIP C;  1IM2 A;  3IEC A;  2OOA A;  1TR8 A;  1WJ7 A;  1A5T A;  1Y8G A;  1G3I A;  3T6P A;  3F92 A;  4G3O A;  2ZTD A;  2LBC A;  1TTE A;  2MJ5 B;  1OKS A;  1OQY A;  2LTU A;  2DI0 A;  2KNV A;  2ZTC A;  2LVA A;  1OTR A;  2QNJ A;  1YLA A;  2LVO C;  1XB2 B;  1VEG A;  2CP8 A;  2JY6 B;  2L2D A;  1HJP A;  2BWB A;  2KNZ A;  1E94 E;  2EKF A;  3GLF E;  1IXS A;  4R71 A;  4Q7J A;  3MMP A;  2JY7 A;  1XXH E;  4GEW A;  1ZMW A;  2DAK A;  3GLI E;  1HT1 E;  2MRO B;  1ZMV A;  2HAK A;  2JZ1 A;  4DBG B;  1C7Y A;  1NV9 A;  2KNA A;  4HEO A;  2L4F A;  2QHO B;  2OOB A;  1UFZ A;  1HQY E;  3GLH E;  1DV0 A;  2O25 A;  1SG9 A;  3BBZ A;  2LVN C;  1OAI A;  1VEJ A;  2DZL A;  2JY8 A;  2JZ0 A;  4WP2 A;  3FE3 A;  4F2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...