3KW6A

Crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords 26S protease regulatory subunit 8
publication title Crystal Structure of a domain of 26S proteasome regulatory subunit 8 from homo sapiens. Northeast Structural Genomics Consortium target id HR3102A
rcsb
source organism Homo sapiens
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kw6A01
3CF0A 3HWSA 4L4UA 1OFIA 3GLIB 4FCWA 1E32A 1IQPA 1G3IA 3AJIB 5FTLA 3GLHB 2ZAMA 3PXGA 2V6ZM 2XSZA 1S3SA 1IN6A 1NY5A 1IN7A 1C1KA 4LRSA 3SYLA 1NVMA 4Z8XA 2CE7A 3M0EA 1W5SA 3CF2A 4D80A 1NSFA 3WHLA 2V1UA 1IXRC 4WW0A 3KW6A 2C98A 1NJGA 4FD2A 5EXPA 1HT1E 5JI3E 3VFDA 3U60B 2R62A 2KRKA 4LJAA 1R6BX 4L16A 4QNMA 4LZZA 5JI2E 3HU1A 3H4MA 1SXJE 1IN5A 1SXJB 1W5TA 3SC3A 3GLIA 5EP3A 4GITA 3VLFB 2C99A 2Z4SA 2C9OA 4EIWA 1IXSB 1OJLA 1JR3A 3HU2A 1QZMA 4FWGA 5EXXA 2QBYA 2HCBA 5EQTA 1G4AE 4FCTA 4LJ7A 4LJ8A 1SXJD 5EP4A 1IN8A 5DYIA 3GLFB 4LGMA 3WHKA 3PFIA 4KODA 2BJWA 1KSFX 2CEAA 2BJVA 1IN4A 1DO2A 3D8BA 2X8AA 5C18A 2ZAOA 3M6AA 2DZNB 5DYGA 1IY1A 3U5ZB 5C1BA 3HU3A 4LY6A 4L15A 1XXHA 1LV7A 5EXTA 4I4LA 3GLGB 2Z4RA 3BOSA 3KDSE 3R8FA 4LJ5A 1SXJC 4QHSA 4QNRA 3GLHA 1JQJC 1IXZA 1HQYE 1HQCA 1X37A 5FTMA 4A3VB 4FWHA 4D82A 3EIHA 3PVSA 4ZPXA 1J7KA 2C96A 1IY0A 2XSZD 2C9CA 5EXSA 4LJ9A 1OFHA 2DVWB 2QPAA 4D81A 2RKOA 4JN6A 2DZOB 2VIIA 3K1JA 4KO8A 4I81A 2DHRA 3ZH9B 5EP1A 5FTNA 5FTKA 2CHGA 3GLGA 1SXJA 2QZ4A 2QENA 5EP2A 3DZDA 3UK6A 4LRTA 4FCVA 5FTJA 2DWZB 1QVRA 1IY2A 4FW9A 1D2NA 1XWIA 2QP9X 2QBYB 1FNNA 1DO0A 3MHVC 1NJFA 1UM8A 3SYKA 2CHVA 4LJ4A 2FNAA 4LCBA 1HT2E 4LJ6A 4QOSA 3U61B 3GLFA 4KLNA 4FWDA 2R65A 1R7RA 1G41A 1JR3D 2ZANA 1IM2A 1NY6A 3EIEA 1KYIA 4QHTA 1L8QA 3B9PA 2CHQA 1E94E 1XXHB
chains in the Genus database with same CATH superfamily
1XNRM 2JXNA 4LF8M 3L26A 1G3IA 1IQPA 1OIPA 3AJIB 3TWLA 3W0LB 4LF6M 2E5LM 1WGLA 2CV1A 1GKIA 2XGNA 1NSFA 1Z5CA 2V1UA 1IXRC 2FH0A 5KPRA 2R4JA 1T6OA 4M9ZA 2L7IA 1XB2B 3U6EA 1HT1E 4NRVA 2DAGA 2OOAA 3U60B 2HAKA 2JZ0A 4MGKE 2F5PA 2KRKA 2VQFM 4L16A 3FUUA 2ZBKB 2XZUA 2DHYA 3W0FA 4NRWA 1WIVA 2Y21A 3U6CA 2O01F 1XMQM 4X66M 4DR4M 1YUBA 3AV0A 4RF1A 4DBGB 4JI1M 3GLIA 5KQ8A 4G6ZA 2VF7A 4MGHA 2UUAM 3DA1A 2F4VM 4NC6A 3LVVA 4GKKM 3HU2A 1QZMA 5EXXA 2HCBA 2XFTA 3LCUA 5FSWA 1N34M 2M5ZA 2JY6B 3BBZA 4B08A 4OVZB 2MR9A 4KODA 1D0KA 2BJWA 3C3EA 4RKUF 2XLJA 4ANRA 1LTMA 2BJVA 2QHOB 1TH2A 3RGPA 4DV3M 2DAIA 1DO2A 5LMUM 3FTEA 4DR6M 1IFYA 1OTRA 1VEJA 1QUSA 2DZNB 2LHGA 2R0IA 2ZAOA 4DV5M 4DR3M 1IY1A 2B3TA 4PD2A 4B3SM 4LY6A 4L15A 1XXHA 5EXTA 3VDPA 1FJGM 2UXDM 2AHMA 1OIZA 1ZAEA 1ZMVA 2L4EA 3BOSA 3D8LA 3FUTA 3A45A 1QAMA 2QSFX 4LJ5A 4PDIA 1G8PA 4BB9A 3LQRA 5DNYA 3OTOM 1N32M 2F5QA 1IXZA 1IXSA 2I7NA 3C58A 3RE8A 4GKJM 2MROB 1N75A 3I51A 4RNAA 3J80S 3PNYA 3VKHA 3J27B 3VDUA 1QZEA 4AG5A 2OO9A 4RF0A 4D82A 2CRUA 4ZPXA 2G5GX 3GQ4A 3KS8A 1N78A 2C9CA 4IBEA 1GLNA 4IJFA 4LJ9A 5ITUA 4NSRA 3GRYA 3L28A 1YLAA 2DZOB 2ERCA 2DAEA 3B7QA 1ZQ9A 1DGHB 3FRHA 1MX0A 2EJSA 5IREB 2KHHA 3FRIA 4IBFA 3SARA 4NXMM 2A5YB 2L6OA 1SXJA 3T1HM 4B3MM 2QZ4A 2QENA 4IBIA 4DV1M 3DZDA 2N35A 4FCVA 4AQYM 2WZJA 4LF4M 2Y20A 3J2PB 1D2NA 1GJTA 1MN3A 2EA0A 1NJFA 3E4RA 3K8ZA 2CHVA 2DWMA 2VF8A 2MGWA 1E9SA 4B3RM 2UXBM 4QOSA 1Q02A 4CIZA 3U61B 1SG9A 1J5EM 1I94M 4GIPA 1G71A 3W67A 1A5TA 3B89A 1IBMM 1NY6A 1ZMUA 2V1CA 4MM3B 1KYIA 4QHTA 2EUCA 2BNKA 3AOEA 4AKHA 1L1TA 3FTDA 2KXEA 5ITRA 3GQ5A 1XMOM 4L4UA 1OFIA 2CV0A 4FCWA 3AOEC 5FTLA 3K9OA 2ZAMA 2V6ZM 1D0MA 3LCVB 1NHWC 2CUZA 1IN7A 1TDHA 4BLCA 1PM5A 1WJ7A 3L29A 1NVMA 4Z8XA 4JXJA 3M0EA 5KPZA 3VK7A 4GHAA 1NNUC 4YHHM 2XF3A 3WHLA 4D80A 5EJCA 2C98A 1NJGA 1QANA 4FD2A 4GH9A 4R3DA 4AZFA 4HLQA 4Z6YA 1TH4A 3VFDA 1OQYA 1WR1B 1WGNA 2P5TA 1DGBA 4S12A 3HHYA 4I5SA 1ZMWA 4P16A 5JI2E 1EFUB 3DOAA 3U6DA 3FYCA 4DV4M 3KS4A 4IBDA 4NXNM 3SC3A 2QQ8A 2J7OA 5EP3A 4GITA 1N33M 4CGYB 3PNVA 3F92A 3TWMA 2LHCA 4JI8M 4L6V6 1K82A 1IBLM 4IBGA 2DWNA 3NBXX 4M0DA 4FCTA 1SXJD 1VEKA 2KA6B 1PJQA 5DYIA 1TF0B 3E21A 2KNVA 4OX9M 2GQFA 1HJPA 3KXEC 3KOZE 4X62M 2R18A 4W5WA 3T6PA 2LVAA 4CHTB 3IHPA 2GNOA 3A42A 2D7EA 2EKFA 4II7A 1HR0M 3QAUA 2LVOC 4I4LA 1V34A 1YSYA 3KDSE 1DGFA 1MU5A 2YFQA 2FS1A 3GLHA 2R45A 3FUWA 3HY5A 2DNAA 1HQCA 3SAUA 2OOBA 1HNWM 1ORYB 5FTMA 3TQSA 4NOOB 2HKJA 2APLA 2D7GA 1Z59A 4FWHA 3L27A 3GRUA 1Q39A 4AKGA 5ITXA 4DUYM 1Z5BA 4D81A 3GPUA 1AUAA 3KOWE 1KFVA 4LF5M 3KFUG 5IWAM 4IBBA 1K3XA 1YE9A 4CISA 2Q2EB 4KO8A 1JB0F 3QYBA 2C5RA 1Q3BA 3ZH9B 1Z6TA 5BPVA 2NQ8C 3QYEA 3ZC7B 4AG6A 7CATA 3UMMA 1HNZM 3UK6A 3CGWA 4LRTA 4FW9A 2QP9X 3FYDA 4K0KM 1DO0A 3UJNA 1L2BA 2CV2A 4LZJA 2O5RA 3IG5A 2OPFA 4DV7M 3R8FA 2KW0A 4M9SA 5KQDA 3GLFA 2XEPA 3FKEA 2R65A 3ZQJA 4MB7A 2J5YA 4JI3M 3GO8A 3HZJA 3ILKA 3I04M 4LFBM 3HHZA 3C9PA 2DKLA 3EIEA 2BWBA 2WSEF 5IZ7D 2DAKA 1XXHE 4GEWA 3B9PA 3U5ZA 1E94E 1XXHB 1EE8A 3DFZA 3CF0A 3HWSA 3BXWA 1QQWA 1E32A 5GKNA 3VK8A 3K92A 2RGHA 1GABA 2KZSA 3CF6E 4X65M 2XSZA 3H4JA 1NY5A 3RFWA 3TL4X 4F1IA 2KEBA 4LRSA 2JY5A 1QAOA 3AFHA 5DFLA 1QDTA 2HL7A 2ZTCA 4Y28F 1C7YA 3SATA 1NNJA 2DXIA 1OAIA 5EXPA 3U61A 5F3WA 5JI3E 2JWSA 2Y0QA 4AI6A 2BWEA 4L8RC 4LJAA 2JA2A 5E6JA 1UFZA 3C3DA 2FOIC 2ZTDA 3K2LA 4LZZA 2UU9M 3HU1A 4LFCM 4GMQA 3NWLA 4B7GA 4GC5A 3HHWA 4DR1M 2F5NA 4JI6M 1SXJE 2UUCM 1R4GA 2RRUA 3TE6A 1SXJB 1T3TA 1E9RA 3B7NA 3HJQA 2WSFF 3HHXA 3SFZA 3J7AS 2C99A 1XNQM 1VDDA 4DUZM 3U6MA 3B74A 1N36M 2C9OA 3A46A 1QDRA 4NSOB 2YQZA 2L7HA 3Q8GA 4EIWA 2ZM6M 3U6PA 1JR3A 2QBYA 1D0LA 2CP8A 5EQTA 4R7GA 2JNHA 4LJ7A 2XH9A 5EP4A 1IN8A 4B3TM 2Z3XA 1NO1A 3JAMS 4DV2M 4LGMA 3WHKA 4WP2A 5ITTA 3KOYE 2R4EA 1IN4A 2X8AA 2X4AA 3M6AA 5C18A 3GPXA 5ITQA 1CUKA 1OKSA 5DYGA 4JI2M 3GLGE 4JI5M 3HU3A 3GLGB 1LV7A 1P3QQ 5KPTA 2Z4RA 2VDBB 2LH0A 4JI4M 4HL4A 4MGYE 4NL4H 4B7FA 1HQYE 3SBJA 3THGA 4GHLA 1X37A 1QYRA 4JI7M 3LMMA 3UZUA 3FD9A 3FUXA 4B7HA 4KHPM 4G3OA 1PJJA 2LVPC 3PVSA 4I8OA 1L1ZA 1IY0A 2XSZD 3U60A 1OFHA 2DVWB 2X49A 2Z7JA 3GQ3A 4OW0A 1QUTA 3GRRA 4ITQA 3K1JA 3ZCBB 4F2LA 1R5LA 2DHRA 2OQ4A 4TUWA 4GRIA 5EP1A 3AKZA 1F4IA 2CHGA 5KO3A 1MJGM 5IT9S 4LFAM 4MH0E 2DI0A 1NHGC 1VG5A 4DV0M 3MK6A 3NBIA 3Q8XA 3I01M 5LMNM 2DWZB 1IY2A 1XWIA 5L8RF 4LG2A 2KDLA 5BR8M 2CWBA 3I4VA 1UM8A 3U6SA 3L2AA 4MGZE 1H6UA 1GJSA 2FNAA 1PGYA 4LCBA 3MJ5A 3R9XB 4OVZA 3TPZA 2KNAA 2JP7A 3GPYA 1XC8A 3IG8A 3SHGB 1I4WA 4FWDA 3SMPA 1G41A 2L09A 3VKGA 2R44A 1JR3D 4LF9M 8CATA 1GO5A 4M0WA 2R6FA 1GL6A 3HJSA 1IM2A 3UGJA 1HNXM 4DR2M 2WSCF 1NV8A 2G8LA 1VQ1A 2HWJA 3SAWA 4JV5M 2CHQA 1WXQA 4XBOA 2KZUA 4REZA 3GLIE 1TDZA 3SASA 2Y0TA 3GLIB 2KRUA 3GLHE 3GLHB 2QCUA 2K9DA 3PXGA 4XK8F 2I7PA 3HJ8A 4R71A 1S3SA 2EO2A 1IN6A 3HGIA 5ITYA 3JR5A 3T15A 1C1KA 2L4FA 1TTEA 3SYLA 2CE7A 1TR8A 1W5SA 2JUJA 3CF2A 2F5SA 2RGOA 4BBAA 4PDGA 5ITXE 2J7NA 4WW0A 4M9XA 3KW6A 1V33A 3RGSA 4QOZC 3V76A 2R62A 3FE3A 3E46A 1R6BX 4QNMA 2K6BA 1OAOC 3H4MA 2F5OA 3GRVA 4IBKA 3QWLA 3KSXA 2JZ1A 2H1RA 3SMSA 5A2QS 1DGHA 2EKKA 2MH8A 3L25A 3U6LA 1EIJA 1IN5A 4AKIA 2YNMD 1R2YA 1W5TA 3W68A 1PJSA 3LVWA 2LNHC 2FFJA 2Z4SA 3VLFB 1VEGA 2KNZA 4L78A 4WURA 2K0BX 2R46A 3K9PA 1IXSB 4LGYA 3JR4A 4LF7M 2DAMA 3HX3A 1OJLA 1WHCA 1BVSA 3KVWA 4FWGA 3U6QA 3FTCA 1DV0A 4DR5M 3AL0C 1G4AE 4LJ8A 4G4OA 4UN2B 4X64M 3GLFE 3T1YM 3SAVA 3GLFB 4HEOA 3PFIA 4MGIE 4G4NA 4JYAM 1GL7A 3J81S 4DV6M 1KSFX 3U6OA 2XZFA 5E26A 1IBKM 3HKPA 2CEAA 3GPPA 2YR0A 2H5XA 3D8BA 3J7BA 2L2DA 1L2DA 4AW4A 3U5ZB 5C1BA 2LVNC 1TGUA 1Y8GA 2CFOA 1L2CA 3AOGA 3I4YA 4PCZA 3IECA 3KP0E 1SXJC 3LW5F 4QHSA 4QNRA 2MJ5B 1JQJC 2LVQD 4JI0M 1RU3A 4XGIA 1ZV1A 3FUVA 2M60A 2LTUA 2D7HA 4A3VB 1K3WA 2G3QA 4KT0F 3EIHA 1NV9A 1J7KA 2C96A 2DZLA 3CTWB 5EXSA 5H37D 3KSJA 2QPAA 3B7ZA 4IIWA 1GVNA 2RKOA 4CJ6A 1T43A 4G4QA 1Q3CA 4JN6A 4G4RA 1J09A 2VIIA 4P17A 4I81A 3TWKA 4PT5A 4IJEA 3FTFA 5FTNA 3E9SA 2XFSA 5FTKA 3GLGA 2FE8A 1PJTA 3T38A 3GP1A 5EP2A 3MMPA 1PRBA 3M7GA 1N77A 4FVMA 2O25A 5FTJA 3KP1E 1JR3E 1QVRA 1VDLA 1G59A 1Z5AA 2UXCM 3LQQA 2QBYB 2LXEA 1FNNA 2JY7A 3KOXE 5FLXS 3MHVC 1PJIA 4IBJA 3SYKA 1AIPC 2QNJA 4LJ4A 2VQEM 4DR7M 4OU7A 1HT2E 1DGGA 4LJ6A 2JY8A 3SHFA 2LWXA 2K47A 4KLNA 2HHHM 2Z8YM 2DENA 1R7RA 2LBCA 2W82A 2ZANA 2UUBM 2DWLA 4IBCA 4GC9A 4Q7JA 1R2ZA 3A98B 1QAQA 4YY3M 1L8QA 1V92A 1XHBA 1TH3A
chains in the Genus database with same CATH topology
1XNRM 4LF8M 3L26A 1G3IA 1IQPA 3AJIB 3TWLA 3W0LB 4LF6M 2E5LM 2CV1A 1GKIA 2XGNA 1NSFA 1Z5CA 2V1UA 1IXRC 5KPRA 2R4JA 4M9ZA 2L7IA 3U6EA 1HT1E 4NRVA 3U60B 4MGKE 2F5PA 2KRKA 2VQFM 4L16A 3FUUA 2ZBKB 2XZUA 3W0FA 4NRWA 2Y21A 3U6CA 1XMQM 4X66M 4DR4M 1YUBA 3AV0A 4RF1A 4JI1M 3GLIA 5KQ8A 4G6ZA 4MGHA 2UUAM 3DA1A 2F4VM 3LVVA 4GKKM 3HU2A 1QZMA 5EXXA 2HCBA 2XFTA 5FSWA 1N34M 2M5ZA 4B08A 4OVZB 4KODA 2BJWA 2XLJA 2BJVA 1TH2A 3RGPA 4DV3M 5LMUM 1DO2A 3FTEA 4DR6M 2ZAOA 4DR3M 2DZNB 4DV5M 1IY1A 4PD2A 4B3SM 4LY6A 4L15A 1XXHA 5EXTA 3VDPA 1FJGM 2UXDM 2AHMA 3D8LA 1ZAEA 4PDIA 3BOSA 3R8FA 3KS8A 3FUTA 3A45A 1QAMA 4LJ5A 5DNYA 1G8PA 4BB9A 3LQRA 3OTOM 1N32M 2F5QA 1IXZA 2I7NA 3C58A 3RE8A 4GKJM 1N75A 3I51A 4RNAA 3J80S 3PNYA 3VKHA 3J27B 3VDUA 4AG5A 4RF0A 4D82A 4ZPXA 2G5GX 3GQ4A 1N78A 2C9CA 4IBEA 1GLNA 4IJFA 4LJ9A 5ITUA 4NSRA 3GRYA 3L28A 2DZOB 2ERCA 1ZQ9A 1DGHB 1MX0A 5IREB 3SARA 4IBFA 4NXMM 2A5YB 2L6OA 1SXJA 3T1HM 4B3MM 2QZ4A 2QENA 4IBIA 4DV1M 3DZDA 4LF4M 4FCVA 4AQYM 2Y20A 3J2PB 1D2NA 2EA0A 1NJFA 3E4RA 3K8ZA 2CHVA 2DWMA 1E9SA 4B3RM 2UXBM 4QOSA 3U61B 1J5EM 1I94M 4GIPA 1IBMM 1NY6A 2V1CA 4MM3B 1KYIA 4QHTA 2EUCA 2BNKA 3AOEA 4AKHA 1L1TA 3FTDA 2KXEA 5ITRA 3GQ5A 1XMOM 4L4UA 1OFIA 2CV0A 4FCWA 3AOEC 5FTLA 2ZAMA 2V6ZM 1NHWC 2CUZA 1IN7A 1TDHA 4BLCA 1PM5A 3L29A 1NVMA 4Z8XA 4JXJA 3M0EA 5KPZA 3VK7A 4GHAA 1NNUC 4YHHM 2XF3A 3WHLA 4D80A 5EJCA 2C98A 1NJGA 1QANA 4FD2A 4GH9A 4R3DA 4AZFA 4HLQA 4Z6YA 1TH4A 3VFDA 2P5TA 3HHYA 1DGBA 4S12A 4I5SA 4P16A 5JI2E 3DOAA 3U6DA 3FYCA 4DV4M 3KS4A 4IBDA 4NXNM 3SC3A 2J7OA 5EP3A 4GITA 1N33M 4CGYB 3PNVA 3TWMA 4JI8M 1K82A 1IBLM 4IBGA 2DWNA 4M0DA 4FCTA 1SXJD 2KA6B 5DYIA 4OX9M 3KXEC 3KOZE 4X62M 2R18A 4W5WA 4CHTB 3A42A 4II7A 2D7EA 1HR0M 3QAUA 4I4LA 1YSYA 3KDSE 1DGFA 1MU5A 2YFQA 3GLHA 2R45A 3FUWA 1HQCA 3SAUA 1HNWM 1ORYB 5FTMA 3TQSA 4NOOB 2HKJA 2D7GA 1Z59A 4FWHA 3L27A 3GRUA 1Q39A 4AKGA 5ITXA 4DUYM 1Z5BA 4D81A 3GPUA 3KOWE 1KFVA 4LF5M 3KFUG 5IWAM 4IBBA 1K3XA 1YE9A 4CISA 2Q2EB 4KO8A 2C5RA 1Q3BA 3ZH9B 1Z6TA 5BPVA 2NQ8C 3ZC7B 4AG6A 7CATA 3UMMA 1HNZM 3UK6A 4LRTA 4FW9A 2QP9X 3FYDA 4K0KM 1DO0A 3UJNA 1L2BA 2CV2A 4LZJA 2O5RA 3IG5A 2OPFA 4DV7M 2KW0A 4M9SA 5KQDA 3GLFA 2XEPA 3FKEA 2R65A 4MB7A 4JI3M 3GO8A 3ILKA 4LFBM 3HHZA 3EIEA 5IZ7D 3B9PA 3U5ZA 3DFZA 1XXHB 1E94E 1EE8A 3CF0A 3HWSA 1QQWA 1E32A 5GKNA 3VK8A 3K92A 2RGHA 2KZSA 3CF6E 4X65M 2XSZA 1NY5A 3RFWA 3TL4X 2KEBA 4LRSA 1QAOA 3AFHA 2HL7A 3SATA 1NNJA 2DXIA 3U61A 5EXPA 5F3WA 5JI3E 2Y0QA 4AI6A 4L8RC 4LJAA 2JA2A 5E6JA 2FOIC 3K2LA 4LZZA 2UU9M 3HU1A 4LFCM 4GMQA 3NWLA 4B7GA 4GC5A 3HHWA 4DR1M 2F5NA 4JI6M 1SXJE 2UUCM 3TE6A 1SXJB 1T3TA 1E9RA 3HJQA 3HHXA 3SFZA 3J7AS 2C99A 1XNQM 1VDDA 4DUZM 3U6MA 1N36M 2C9OA 3A46A 4NSOB 4EIWA 2YQZA 2L7HA 2ZM6M 3U6PA 1JR3A 2QBYA 5EQTA 4R7GA 4LJ7A 2XH9A 5EP4A 1IN8A 4B3TM 2Z3XA 3JAMS 4DV2M 4LGMA 3WHKA 5ITTA 3KOYE 2R4EA 1IN4A 2X8AA 2X4AA 3M6AA 5C18A 3GPXA 5ITQA 5DYGA 4JI5M 4JI2M 3HU3A 3GLGB 1LV7A 5KPTA 2Z4RA 2LH0A 4JI4M 4HL4A 4MGYE 4NL4H 4B7FA 1HQYE 3SBJA 3THGA 4GHLA 1X37A 1QYRA 4JI7M 3LMMA 3UZUA 3FD9A 3FUXA 4B7HA 4KHPM 1PJJA 3PVSA 4I8OA 1L1ZA 1IY0A 2XSZD 3U60A 1OFHA 2DVWB 2X49A 2Z7JA 3GQ3A 4OW0A 3GRRA 4ITQA 3K1JA 3ZCBB 2OQ4A 2DHRA 4TUWA 4GRIA 5EP1A 3AKZA 2CHGA 5KO3A 5IT9S 4LFAM 4MH0E 1NHGC 4DV0M 3MK6A 3NBIA 3Q8XA 5LMNM 2DWZB 1IY2A 1XWIA 4LG2A 5BR8M 3I4VA 1UM8A 3U6SA 3L2AA 4MGZE 1H6UA 2FNAA 4LCBA 3MJ5A 3R9XB 4OVZA 3TPZA 3GPYA 1XC8A 3IG8A 3SHGB 1I4WA 4FWDA 3SMPA 1G41A 2L09A 3VKGA 1JR3D 4LF9M 8CATA 4M0WA 1GL6A 3HJSA 1IM2A 3UGJA 1HNXM 4DR2M 2G8LA 3SAWA 4JV5M 2CHQA 1WXQA 4XBOA 2KZUA 4REZA 3SASA 1TDZA 2Y0TA 3GLIB 2KRUA 3GLHB 2QCUA 3PXGA 2I7PA 3HJ8A 1S3SA 2EO2A 1IN6A 3HGIA 5ITYA 3JR5A 3T15A 1C1KA 3SYLA 2CE7A 1W5SA 3CF2A 2F5SA 2RGOA 4BBAA 4PDGA 5ITXE 2J7NA 4WW0A 4M9XA 3KW6A 3RGSA 4QOZC 2R62A 1R6BX 4QNMA 3H4MA 2F5OA 3GRVA 4IBKA 3QWLA 3KSXA 2H1RA 3SMSA 5A2QS 1DGHA 3L25A 4AKIA 3U6LA 1IN5A 2YNMD 1R2YA 1W5TA 3LVWA 2LNHC 2FFJA 2Z4SA 3VLFB 4L78A 4WURA 2R46A 1IXSB 4LGYA 3JR4A 4LF7M 1OJLA 3KVWA 4FWGA 3U6QA 3FTCA 4DR5M 3AL0C 1G4AE 4LJ8A 4G4OA 4X64M 3T1YM 3SAVA 3GLFB 3PFIA 4MGIE 4G4NA 4JYAM 1GL7A 3J81S 4DV6M 1KSFX 3U6OA 2XZFA 5E26A 1IBKM 3HKPA 2CEAA 3GPPA 2YR0A 3D8BA 3J7BA 1L2DA 4AW4A 3U5ZB 5C1BA 1TGUA 2CFOA 1L2CA 3AOGA 3I4YA 4PCZA 3KP0E 1SXJC 4QHSA 4QNRA 1JQJC 4JI0M 4XGIA 3FUVA 2M60A 2D7HA 4A3VB 1K3WA 3EIHA 1J7KA 2C96A 3CTWB 5EXSA 5H37D 3KSJA 2QPAA 4IIWA 1GVNA 2RKOA 4G4QA 1Q3CA 4JN6A 4G4RA 1J09A 2VIIA 4I81A 3TWKA 4PT5A 4IJEA 3FTFA 5FTNA 3E9SA 2XFSA 5FTKA 3GLGA 2FE8A 3T38A 3GP1A 5EP2A 3M7GA 1N77A 4FVMA 5FTJA 3KP1E 1QVRA 1G59A 1Z5AA 2UXCM 3LQQA 2QBYB 2LXEA 1FNNA 3KOXE 5FLXS 1PJIA 3MHVC 4IBJA 3SYKA 4DR7M 4LJ4A 2VQEM 4OU7A 1HT2E 1DGGA 4LJ6A 3SHFA 2LWXA 2K47A 4KLNA 2HHHM 1R7RA 2W82A 2ZANA 2UUBM 2DWLA 4IBCA 4GC9A 1R2ZA 3A98B 1QAQA 4YY3M 1L8QA 1XHBA 1TH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF0 A;  3HWS A;  4L4U A;  1OFI A;  3GLI B;  4FCW A;  1E32 A;  1IQP A;  1G3I A;  3AJI B;  5FTL A;  3GLH B;  2ZAM A;  3PXG A;  2V6Z M;  2XSZ A;  1S3S A;  1IN6 A;  1NY5 A;  1IN7 A;  1C1K A;  4LRS A;  3SYL A;  1NVM A;  4Z8X A;  2CE7 A;  3M0E A;  1W5S A;  3CF2 A;  4D80 A;  1NSF A;  3WHL A;  2V1U A;  1IXR C;  4WW0 A;  3KW6 A;  2C98 A;  1NJG A;  4FD2 A;  5EXP A;  1HT1 E;  5JI3 E;  3VFD A;  3U60 B;  2R62 A;  2KRK A;  4LJA A;  1R6B X;  4L16 A;  4QNM A;  4LZZ A;  5JI2 E;  3HU1 A;  3H4M A;  1SXJ E;  1IN5 A;  1SXJ B;  1W5T A;  3SC3 A;  3GLI A;  5EP3 A;  4GIT A;  3VLF B;  2C99 A;  2Z4S A;  2C9O A;  4EIW A;  1IXS B;  1OJL A;  1JR3 A;  3HU2 A;  1QZM A;  4FWG A;  5EXX A;  2QBY A;  2HCB A;  5EQT A;  1G4A E;  4FCT A;  4LJ7 A;  4LJ8 A;  1SXJ D;  5EP4 A;  1IN8 A;  5DYI A;  3GLF B;  4LGM A;  3WHK A;  3PFI A;  4KOD A;  2BJW A;  1KSF X;  2CEA A;  2BJV A;  1IN4 A;  1DO2 A;  3D8B A;  2X8A A;  5C18 A;  2ZAO A;  3M6A A;  2DZN B;  5DYG A;  1IY1 A;  3U5Z B;  5C1B A;  3HU3 A;  4LY6 A;  4L15 A;  1XXH A;  1LV7 A;  5EXT A;  4I4L A;  3GLG B;  2Z4R A;  3BOS A;  3KDS E;  3R8F A;  4LJ5 A;  1SXJ C;  4QHS A;  4QNR A;  3GLH A;  1JQJ C;  1IXZ A;  1HQY E;  1HQC A;  1X37 A;  5FTM A;  4A3V B;  4FWH A;  4D82 A;  3EIH A;  3PVS A;  4ZPX A;  1J7K A;  2C96 A;  1IY0 A;  2XSZ D;  2C9C A;  5EXS A;  4LJ9 A;  1OFH A;  2DVW B;  2QPA A;  4D81 A;  2RKO A;  4JN6 A;  2DZO B;  2VII A;  3K1J A;  4KO8 A;  4I81 A;  2DHR A;  3ZH9 B;  5EP1 A;  5FTN A;  5FTK A;  2CHG A;  3GLG A;  1SXJ A;  2QZ4 A;  2QEN A;  5EP2 A;  3DZD A;  3UK6 A;  4LRT A;  4FCV A;  5FTJ A;  2DWZ B;  1QVR A;  1IY2 A;  4FW9 A;  1D2N A;  1XWI A;  2QP9 X;  2QBY B;  1FNN A;  1DO0 A;  3MHV C;  1NJF A;  1UM8 A;  3SYK A;  2CHV A;  4LJ4 A;  2FNA A;  4LCB A;  1HT2 E;  4LJ6 A;  4QOS A;  3U61 B;  3GLF A;  4KLN A;  4FWD A;  2R65 A;  1R7R A;  1G41 A;  1JR3 D;  2ZAN A;  1IM2 A;  1NY6 A;  3EIE A;  1KYI A;  4QHT A;  1L8Q A;  3B9P A;  2CHQ A;  1E94 E;  1XXH B; 
#chains in the Genus database with same CATH topology
 1XNR M;  2JXN A;  4LF8 M;  3L26 A;  1G3I A;  1IQP A;  1OIP A;  3AJI B;  3TWL A;  3W0L B;  4LF6 M;  2E5L M;  1WGL A;  2CV1 A;  1GKI A;  2XGN A;  1NSF A;  1Z5C A;  2V1U A;  1IXR C;  2FH0 A;  5KPR A;  2R4J A;  1T6O A;  4M9Z A;  2L7I A;  1XB2 B;  3U6E A;  1HT1 E;  4NRV A;  2DAG A;  2OOA A;  3U60 B;  2HAK A;  2JZ0 A;  4MGK E;  2F5P A;  2KRK A;  2VQF M;  4L16 A;  3FUU A;  2ZBK B;  2XZU A;  2DHY A;  3W0F A;  4NRW A;  1WIV A;  2Y21 A;  3U6C A;  2O01 F;  1XMQ M;  4X66 M;  4DR4 M;  1YUB A;  3AV0 A;  4RF1 A;  4DBG B;  4JI1 M;  3GLI A;  5KQ8 A;  4G6Z A;  2VF7 A;  4MGH A;  2UUA M;  3DA1 A;  2F4V M;  4NC6 A;  3LVV A;  4GKK M;  3HU2 A;  1QZM A;  5EXX A;  2HCB A;  2XFT A;  3LCU A;  5FSW A;  1N34 M;  2M5Z A;  2JY6 B;  3BBZ A;  4B08 A;  4OVZ B;  2MR9 A;  4KOD A;  1D0K A;  2BJW A;  3C3E A;  4RKU F;  2XLJ A;  4ANR A;  1LTM A;  2BJV A;  2QHO B;  1TH2 A;  3RGP A;  4DV3 M;  2DAI A;  1DO2 A;  5LMU M;  3FTE A;  4DR6 M;  1IFY A;  1OTR A;  1VEJ A;  1QUS A;  2DZN B;  2LHG A;  2R0I A;  2ZAO A;  4DV5 M;  4DR3 M;  1IY1 A;  2B3T A;  4PD2 A;  4B3S M;  4LY6 A;  4L15 A;  1XXH A;  5EXT A;  3VDP A;  1FJG M;  2UXD M;  2AHM A;  1OIZ A;  1ZAE A;  1ZMV A;  2L4E A;  3BOS A;  3D8L A;  3FUT A;  3A45 A;  1QAM A;  2QSF X;  4LJ5 A;  4PDI A;  1G8P A;  4BB9 A;  3LQR A;  5DNY A;  3OTO M;  1N32 M;  2F5Q A;  1IXZ A;  1IXS A;  2I7N A;  3C58 A;  3RE8 A;  4GKJ M;  2MRO B;  1N75 A;  3I51 A;  4RNA A;  3J80 S;  3PNY A;  3VKH A;  3J27 B;  3VDU A;  1QZE A;  4AG5 A;  2OO9 A;  4RF0 A;  4D82 A;  2CRU A;  4ZPX A;  2G5G X;  3GQ4 A;  3KS8 A;  1N78 A;  2C9C A;  4IBE A;  1GLN A;  4IJF A;  4LJ9 A;  5ITU A;  4NSR A;  3GRY A;  3L28 A;  1YLA A;  2DZO B;  2ERC A;  2DAE A;  3B7Q A;  1ZQ9 A;  1DGH B;  3FRH A;  1MX0 A;  2EJS A;  5IRE B;  2KHH A;  3FRI A;  4IBF A;  3SAR A;  4NXM M;  2A5Y B;  2L6O A;  1SXJ A;  3T1H M;  4B3M M;  2QZ4 A;  2QEN A;  4IBI A;  4DV1 M;  3DZD A;  2N35 A;  4FCV A;  4AQY M;  2WZJ A;  4LF4 M;  2Y20 A;  3J2P B;  1D2N A;  1GJT A;  1MN3 A;  2EA0 A;  1NJF A;  3E4R A;  3K8Z A;  2CHV A;  2DWM A;  2VF8 A;  2MGW A;  1E9S A;  4B3R M;  2UXB M;  4QOS A;  1Q02 A;  4CIZ A;  3U61 B;  1SG9 A;  1J5E M;  1I94 M;  4GIP A;  1G71 A;  3W67 A;  1A5T A;  3B89 A;  1IBM M;  1NY6 A;  1ZMU A;  2V1C A;  4MM3 B;  1KYI A;  4QHT A;  2EUC A;  2BNK A;  3AOE A;  4AKH A;  1L1T A;  3FTD A;  2KXE A;  5ITR A;  3GQ5 A;  1XMO M;  4L4U A;  1OFI A;  2CV0 A;  4FCW A;  3AOE C;  5FTL A;  3K9O A;  2ZAM A;  2V6Z M;  1D0M A;  3LCV B;  1NHW C;  2CUZ A;  1IN7 A;  1TDH A;  4BLC A;  1PM5 A;  1WJ7 A;  3L29 A;  1NVM A;  4Z8X A;  4JXJ A;  3M0E A;  5KPZ A;  3VK7 A;  4GHA A;  1NNU C;  4YHH M;  2XF3 A;  3WHL A;  4D80 A;  5EJC A;  2C98 A;  1NJG A;  1QAN A;  4FD2 A;  4GH9 A;  4R3D A;  4AZF A;  4HLQ A;  4Z6Y A;  1TH4 A;  3VFD A;  1OQY A;  1WR1 B;  1WGN A;  2P5T A;  1DGB A;  4S12 A;  3HHY A;  4I5S A;  1ZMW A;  4P16 A;  5JI2 E;  1EFU B;  3DOA A;  3U6D A;  3FYC A;  4DV4 M;  3KS4 A;  4IBD A;  4NXN M;  3SC3 A;  2QQ8 A;  2J7O A;  5EP3 A;  4GIT A;  1N33 M;  4CGY B;  3PNV A;  3F92 A;  3TWM A;  2LHC A;  4JI8 M;  4L6V 6;  1K82 A;  1IBL M;  4IBG A;  2DWN A;  3NBX X;  4M0D A;  4FCT A;  1SXJ D;  1VEK A;  2KA6 B;  1PJQ A;  5DYI A;  1TF0 B;  3E21 A;  2KNV A;  4OX9 M;  2GQF A;  1HJP A;  3KXE C;  3KOZ E;  4X62 M;  2R18 A;  4W5W A;  3T6P A;  2LVA A;  4CHT B;  3IHP A;  2GNO A;  3A42 A;  2D7E A;  2EKF A;  4II7 A;  1HR0 M;  3QAU A;  2LVO C;  4I4L A;  1V34 A;  1YSY A;  3KDS E;  1DGF A;  1MU5 A;  2YFQ A;  2FS1 A;  3GLH A;  2R45 A;  3FUW A;  3HY5 A;  2DNA A;  1HQC A;  3SAU A;  2OOB A;  1HNW M;  1ORY B;  5FTM A;  3TQS A;  4NOO B;  2HKJ A;  2APL A;  2D7G A;  1Z59 A;  4FWH A;  3L27 A;  3GRU A;  1Q39 A;  4AKG A;  5ITX A;  4DUY M;  1Z5B A;  4D81 A;  3GPU A;  1AUA A;  3KOW E;  1KFV A;  4LF5 M;  3KFU G;  5IWA M;  4IBB A;  1K3X A;  1YE9 A;  4CIS A;  2Q2E B;  4KO8 A;  1JB0 F;  3QYB A;  2C5R A;  1Q3B A;  3ZH9 B;  1Z6T A;  5BPV A;  2NQ8 C;  3QYE A;  3ZC7 B;  4AG6 A;  7CAT A;  3UMM A;  1HNZ M;  3UK6 A;  3CGW A;  4LRT A;  4FW9 A;  2QP9 X;  3FYD A;  4K0K M;  1DO0 A;  3UJN A;  1L2B A;  2CV2 A;  4LZJ A;  2O5R A;  3IG5 A;  2OPF A;  4DV7 M;  3R8F A;  2KW0 A;  4M9S A;  5KQD A;  3GLF A;  2XEP A;  3FKE A;  2R65 A;  3ZQJ A;  4MB7 A;  2J5Y A;  4JI3 M;  3GO8 A;  3HZJ A;  3ILK A;  3I04 M;  4LFB M;  3HHZ A;  3C9P A;  2DKL A;  3EIE A;  2BWB A;  2WSE F;  5IZ7 D;  2DAK A;  1XXH E;  4GEW A;  3B9P A;  3U5Z A;  1E94 E;  1XXH B;  1EE8 A;  3DFZ A;  3CF0 A;  3HWS A;  3BXW A;  1QQW A;  1E32 A;  5GKN A;  3VK8 A;  3K92 A;  2RGH A;  1GAB A;  2KZS A;  3CF6 E;  4X65 M;  2XSZ A;  3H4J A;  1NY5 A;  3RFW A;  3TL4 X;  4F1I A;  2KEB A;  4LRS A;  2JY5 A;  1QAO A;  3AFH A;  5DFL A;  1QDT A;  2HL7 A;  2ZTC A;  4Y28 F;  1C7Y A;  3SAT A;  1NNJ A;  2DXI A;  1OAI A;  5EXP A;  3U61 A;  5F3W A;  5JI3 E;  2JWS A;  2Y0Q A;  4AI6 A;  2BWE A;  4L8R C;  4LJA A;  2JA2 A;  5E6J A;  1UFZ A;  3C3D A;  2FOI C;  2ZTD A;  3K2L A;  4LZZ A;  2UU9 M;  3HU1 A;  4LFC M;  4GMQ A;  3NWL A;  4B7G A;  4GC5 A;  3HHW A;  4DR1 M;  2F5N A;  4JI6 M;  1SXJ E;  2UUC M;  1R4G A;  2RRU A;  3TE6 A;  1SXJ B;  1T3T A;  1E9R A;  3B7N A;  3HJQ A;  2WSF F;  3HHX A;  3SFZ A;  3J7A S;  2C99 A;  1XNQ M;  1VDD A;  4DUZ M;  3U6M A;  3B74 A;  1N36 M;  2C9O A;  3A46 A;  1QDR A;  4NSO B;  2YQZ A;  2L7H A;  3Q8G A;  4EIW A;  2ZM6 M;  3U6P A;  1JR3 A;  2QBY A;  1D0L A;  2CP8 A;  5EQT A;  4R7G A;  2JNH A;  4LJ7 A;  2XH9 A;  5EP4 A;  1IN8 A;  4B3T M;  2Z3X A;  1NO1 A;  3JAM S;  4DV2 M;  4LGM A;  3WHK A;  4WP2 A;  5ITT A;  3KOY E;  2R4E A;  1IN4 A;  2X8A A;  2X4A A;  3M6A A;  5C18 A;  3GPX A;  5ITQ A;  1CUK A;  1OKS A;  5DYG A;  4JI2 M;  3GLG E;  4JI5 M;  3HU3 A;  3GLG B;  1LV7 A;  1P3Q Q;  5KPT A;  2Z4R A;  2VDB B;  2LH0 A;  4JI4 M;  4HL4 A;  4MGY E;  4NL4 H;  4B7F A;  1HQY E;  3SBJ A;  3THG A;  4GHL A;  1X37 A;  1QYR A;  4JI7 M;  3LMM A;  3UZU A;  3FD9 A;  3FUX A;  4B7H A;  4KHP M;  4G3O A;  1PJJ A;  2LVP C;  3PVS A;  4I8O A;  1L1Z A;  1IY0 A;  2XSZ D;  3U60 A;  1OFH A;  2DVW B;  2X49 A;  2Z7J A;  3GQ3 A;  4OW0 A;  1QUT A;  3GRR A;  4ITQ A;  3K1J A;  3ZCB B;  4F2L A;  1R5L A;  2DHR A;  2OQ4 A;  4TUW A;  4GRI A;  5EP1 A;  3AKZ A;  1F4I A;  2CHG A;  5KO3 A;  1MJG M;  5IT9 S;  4LFA M;  4MH0 E;  2DI0 A;  1NHG C;  1VG5 A;  4DV0 M;  3MK6 A;  3NBI A;  3Q8X A;  3I01 M;  5LMN M;  2DWZ B;  1IY2 A;  1XWI A;  5L8R F;  4LG2 A;  2KDL A;  5BR8 M;  2CWB A;  3I4V A;  1UM8 A;  3U6S A;  3L2A A;  4MGZ E;  1H6U A;  1GJS A;  2FNA A;  1PGY A;  4LCB A;  3MJ5 A;  3R9X B;  4OVZ A;  3TPZ A;  2KNA A;  2JP7 A;  3GPY A;  1XC8 A;  3IG8 A;  3SHG B;  1I4W A;  4FWD A;  3SMP A;  1G41 A;  2L09 A;  3VKG A;  2R44 A;  1JR3 D;  4LF9 M;  8CAT A;  1GO5 A;  4M0W A;  2R6F A;  1GL6 A;  3HJS A;  1IM2 A;  3UGJ A;  1HNX M;  4DR2 M;  2WSC F;  1NV8 A;  2G8L A;  1VQ1 A;  2HWJ A;  3SAW A;  4JV5 M;  2CHQ A;  1WXQ A;  4XBO A;  2KZU A;  4REZ A;  3GLI E;  1TDZ A;  3SAS A;  2Y0T A;  3GLI B;  2KRU A;  3GLH E;  3GLH B;  2QCU A;  2K9D A;  3PXG A;  4XK8 F;  2I7P A;  3HJ8 A;  4R71 A;  1S3S A;  2EO2 A;  1IN6 A;  3HGI A;  5ITY A;  3JR5 A;  3T15 A;  1C1K A;  2L4F A;  1TTE A;  3SYL A;  2CE7 A;  1TR8 A;  1W5S A;  2JUJ A;  3CF2 A;  2F5S A;  2RGO A;  4BBA A;  4PDG A;  5ITX E;  2J7N A;  4WW0 A;  4M9X A;  3KW6 A;  1V33 A;  3RGS A;  4QOZ C;  3V76 A;  2R62 A;  3FE3 A;  3E46 A;  1R6B X;  4QNM A;  2K6B A;  1OAO C;  3H4M A;  2F5O A;  3GRV A;  4IBK A;  3QWL A;  3KSX A;  2JZ1 A;  2H1R A;  3SMS A;  5A2Q S;  1DGH A;  2EKK A;  2MH8 A;  3L25 A;  3U6L A;  1EIJ A;  1IN5 A;  4AKI A;  2YNM D;  1R2Y A;  1W5T A;  3W68 A;  1PJS A;  3LVW A;  2LNH C;  2FFJ A;  2Z4S A;  3VLF B;  1VEG A;  2KNZ A;  4L78 A;  4WUR A;  2K0B X;  2R46 A;  3K9P A;  1IXS B;  4LGY A;  3JR4 A;  4LF7 M;  2DAM A;  3HX3 A;  1OJL A;  1WHC A;  1BVS A;  3KVW A;  4FWG A;  3U6Q A;  3FTC A;  1DV0 A;  4DR5 M;  3AL0 C;  1G4A E;  4LJ8 A;  4G4O A;  4UN2 B;  4X64 M;  3GLF E;  3T1Y M;  3SAV A;  3GLF B;  4HEO A;  3PFI A;  4MGI E;  4G4N A;  4JYA M;  1GL7 A;  3J81 S;  4DV6 M;  1KSF X;  3U6O A;  2XZF A;  5E26 A;  1IBK M;  3HKP A;  2CEA A;  3GPP A;  2YR0 A;  2H5X A;  3D8B A;  3J7B A;  2L2D A;  1L2D A;  4AW4 A;  3U5Z B;  5C1B A;  2LVN C;  1TGU A;  1Y8G A;  2CFO A;  1L2C A;  3AOG A;  3I4Y A;  4PCZ A;  3IEC A;  3KP0 E;  1SXJ C;  3LW5 F;  4QHS A;  4QNR A;  2MJ5 B;  1JQJ C;  2LVQ D;  4JI0 M;  1RU3 A;  4XGI A;  1ZV1 A;  3FUV A;  2M60 A;  2LTU A;  2D7H A;  4A3V B;  1K3W A;  2G3Q A;  4KT0 F;  3EIH A;  1NV9 A;  1J7K A;  2C96 A;  2DZL A;  3CTW B;  5EXS A;  5H37 D;  3KSJ A;  2QPA A;  3B7Z A;  4IIW A;  1GVN A;  2RKO A;  4CJ6 A;  1T43 A;  4G4Q A;  1Q3C A;  4JN6 A;  4G4R A;  1J09 A;  2VII A;  4P17 A;  4I81 A;  3TWK A;  4PT5 A;  4IJE A;  3FTF A;  5FTN A;  3E9S A;  2XFS A;  5FTK A;  3GLG A;  2FE8 A;  1PJT A;  3T38 A;  3GP1 A;  5EP2 A;  3MMP A;  1PRB A;  3M7G A;  1N77 A;  4FVM A;  2O25 A;  5FTJ A;  3KP1 E;  1JR3 E;  1QVR A;  1VDL A;  1G59 A;  1Z5A A;  2UXC M;  3LQQ A;  2QBY B;  2LXE A;  1FNN A;  2JY7 A;  3KOX E;  5FLX S;  3MHV C;  1PJI A;  4IBJ A;  3SYK A;  1AIP C;  2QNJ A;  4LJ4 A;  2VQE M;  4DR7 M;  4OU7 A;  1HT2 E;  1DGG A;  4LJ6 A;  2JY8 A;  3SHF A;  2LWX A;  2K47 A;  4KLN A;  2HHH M;  2Z8Y M;  2DEN A;  1R7R A;  2LBC A;  2W82 A;  2ZAN A;  2UUB M;  2DWL A;  4IBC A;  4GC9 A;  4Q7J A;  1R2Z A;  3A98 B;  1QAQ A;  4YY3 M;  1L8Q A;  1V92 A;  1XHB A;  1TH3 A; 
#chains in the Genus database with same CATH homology
 1XNR M;  4LF8 M;  3L26 A;  1G3I A;  1IQP A;  3AJI B;  3TWL A;  3W0L B;  4LF6 M;  2E5L M;  2CV1 A;  1GKI A;  2XGN A;  1NSF A;  1Z5C A;  2V1U A;  1IXR C;  5KPR A;  2R4J A;  4M9Z A;  2L7I A;  3U6E A;  1HT1 E;  4NRV A;  3U60 B;  4MGK E;  2F5P A;  2KRK A;  2VQF M;  4L16 A;  3FUU A;  2ZBK B;  2XZU A;  3W0F A;  4NRW A;  2Y21 A;  3U6C A;  1XMQ M;  4X66 M;  4DR4 M;  1YUB A;  3AV0 A;  4RF1 A;  4JI1 M;  3GLI A;  5KQ8 A;  4G6Z A;  4MGH A;  2UUA M;  3DA1 A;  2F4V M;  3LVV A;  4GKK M;  3HU2 A;  1QZM A;  5EXX A;  2HCB A;  2XFT A;  5FSW A;  1N34 M;  2M5Z A;  4B08 A;  4OVZ B;  4KOD A;  2BJW A;  2XLJ A;  2BJV A;  1TH2 A;  3RGP A;  4DV3 M;  5LMU M;  1DO2 A;  3FTE A;  4DR6 M;  2ZAO A;  4DR3 M;  2DZN B;  4DV5 M;  1IY1 A;  4PD2 A;  4B3S M;  4LY6 A;  4L15 A;  1XXH A;  5EXT A;  3VDP A;  1FJG M;  2UXD M;  2AHM A;  3D8L A;  1ZAE A;  4PDI A;  3BOS A;  3R8F A;  3KS8 A;  3FUT A;  3A45 A;  1QAM A;  4LJ5 A;  5DNY A;  1G8P A;  4BB9 A;  3LQR A;  3OTO M;  1N32 M;  2F5Q A;  1IXZ A;  2I7N A;  3C58 A;  3RE8 A;  4GKJ M;  1N75 A;  3I51 A;  4RNA A;  3J80 S;  3PNY A;  3VKH A;  3J27 B;  3VDU A;  4AG5 A;  4RF0 A;  4D82 A;  4ZPX A;  2G5G X;  3GQ4 A;  1N78 A;  2C9C A;  4IBE A;  1GLN A;  4IJF A;  4LJ9 A;  5ITU A;  4NSR A;  3GRY A;  3L28 A;  2DZO B;  2ERC A;  1ZQ9 A;  1DGH B;  1MX0 A;  5IRE B;  3SAR A;  4IBF A;  4NXM M;  2A5Y B;  2L6O A;  1SXJ A;  3T1H M;  4B3M M;  2QZ4 A;  2QEN A;  4IBI A;  4DV1 M;  3DZD A;  4LF4 M;  4FCV A;  4AQY M;  2Y20 A;  3J2P B;  1D2N A;  2EA0 A;  1NJF A;  3E4R A;  3K8Z A;  2CHV A;  2DWM A;  1E9S A;  4B3R M;  2UXB M;  4QOS A;  3U61 B;  1J5E M;  1I94 M;  4GIP A;  1IBM M;  1NY6 A;  2V1C A;  4MM3 B;  1KYI A;  4QHT A;  2EUC A;  2BNK A;  3AOE A;  4AKH A;  1L1T A;  3FTD A;  2KXE A;  5ITR A;  3GQ5 A;  1XMO M;  4L4U A;  1OFI A;  2CV0 A;  4FCW A;  3AOE C;  5FTL A;  2ZAM A;  2V6Z M;  1NHW C;  2CUZ A;  1IN7 A;  1TDH A;  4BLC A;  1PM5 A;  3L29 A;  1NVM A;  4Z8X A;  4JXJ A;  3M0E A;  5KPZ A;  3VK7 A;  4GHA A;  1NNU C;  4YHH M;  2XF3 A;  3WHL A;  4D80 A;  5EJC A;  2C98 A;  1NJG A;  1QAN A;  4FD2 A;  4GH9 A;  4R3D A;  4AZF A;  4HLQ A;  4Z6Y A;  1TH4 A;  3VFD A;  2P5T A;  3HHY A;  1DGB A;  4S12 A;  4I5S A;  4P16 A;  5JI2 E;  3DOA A;  3U6D A;  3FYC A;  4DV4 M;  3KS4 A;  4IBD A;  4NXN M;  3SC3 A;  2J7O A;  5EP3 A;  4GIT A;  1N33 M;  4CGY B;  3PNV A;  3TWM A;  4JI8 M;  1K82 A;  1IBL M;  4IBG A;  2DWN A;  4M0D A;  4FCT A;  1SXJ D;  2KA6 B;  5DYI A;  4OX9 M;  3KXE C;  3KOZ E;  4X62 M;  2R18 A;  4W5W A;  4CHT B;  3A42 A;  4II7 A;  2D7E A;  1HR0 M;  3QAU A;  4I4L A;  1YSY A;  3KDS E;  1DGF A;  1MU5 A;  2YFQ A;  3GLH A;  2R45 A;  3FUW A;  1HQC A;  3SAU A;  1HNW M;  1ORY B;  5FTM A;  3TQS A;  4NOO B;  2HKJ A;  2D7G A;  1Z59 A;  4FWH A;  3L27 A;  3GRU A;  1Q39 A;  4AKG A;  5ITX A;  4DUY M;  1Z5B A;  4D81 A;  3GPU A;  3KOW E;  1KFV A;  4LF5 M;  3KFU G;  5IWA M;  4IBB A;  1K3X A;  1YE9 A;  4CIS A;  2Q2E B;  4KO8 A;  2C5R A;  1Q3B A;  3ZH9 B;  1Z6T A;  5BPV A;  2NQ8 C;  3ZC7 B;  4AG6 A;  7CAT A;  3UMM A;  1HNZ M;  3UK6 A;  4LRT A;  4FW9 A;  2QP9 X;  3FYD A;  4K0K M;  1DO0 A;  3UJN A;  1L2B A;  2CV2 A;  4LZJ A;  2O5R A;  3IG5 A;  2OPF A;  4DV7 M;  2KW0 A;  4M9S A;  5KQD A;  3GLF A;  2XEP A;  3FKE A;  2R65 A;  4MB7 A;  4JI3 M;  3GO8 A;  3ILK A;  4LFB M;  3HHZ A;  3EIE A;  5IZ7 D;  3B9P A;  3U5Z A;  3DFZ A;  1XXH B;  1E94 E;  1EE8 A;  3CF0 A;  3HWS A;  1QQW A;  1E32 A;  5GKN A;  3VK8 A;  3K92 A;  2RGH A;  2KZS A;  3CF6 E;  4X65 M;  2XSZ A;  1NY5 A;  3RFW A;  3TL4 X;  2KEB A;  4LRS A;  1QAO A;  3AFH A;  2HL7 A;  3SAT A;  1NNJ A;  2DXI A;  3U61 A;  5EXP A;  5F3W A;  5JI3 E;  2Y0Q A;  4AI6 A;  4L8R C;  4LJA A;  2JA2 A;  5E6J A;  2FOI C;  3K2L A;  4LZZ A;  2UU9 M;  3HU1 A;  4LFC M;  4GMQ A;  3NWL A;  4B7G A;  4GC5 A;  3HHW A;  4DR1 M;  2F5N A;  4JI6 M;  1SXJ E;  2UUC M;  3TE6 A;  1SXJ B;  1T3T A;  1E9R A;  3HJQ A;  3HHX A;  3SFZ A;  3J7A S;  2C99 A;  1XNQ M;  1VDD A;  4DUZ M;  3U6M A;  1N36 M;  2C9O A;  3A46 A;  4NSO B;  4EIW A;  2YQZ A;  2L7H A;  2ZM6 M;  3U6P A;  1JR3 A;  2QBY A;  5EQT A;  4R7G A;  4LJ7 A;  2XH9 A;  5EP4 A;  1IN8 A;  4B3T M;  2Z3X A;  3JAM S;  4DV2 M;  4LGM A;  3WHK A;  5ITT A;  3KOY E;  2R4E A;  1IN4 A;  2X8A A;  2X4A A;  3M6A A;  5C18 A;  3GPX A;  5ITQ A;  5DYG A;  4JI5 M;  4JI2 M;  3HU3 A;  3GLG B;  1LV7 A;  5KPT A;  2Z4R A;  2LH0 A;  4JI4 M;  4HL4 A;  4MGY E;  4NL4 H;  4B7F A;  1HQY E;  3SBJ A;  3THG A;  4GHL A;  1X37 A;  1QYR A;  4JI7 M;  3LMM A;  3UZU A;  3FD9 A;  3FUX A;  4B7H A;  4KHP M;  1PJJ A;  3PVS A;  4I8O A;  1L1Z A;  1IY0 A;  2XSZ D;  3U60 A;  1OFH A;  2DVW B;  2X49 A;  2Z7J A;  3GQ3 A;  4OW0 A;  3GRR A;  4ITQ A;  3K1J A;  3ZCB B;  2OQ4 A;  2DHR A;  4TUW A;  4GRI A;  5EP1 A;  3AKZ A;  2CHG A;  5KO3 A;  5IT9 S;  4LFA M;  4MH0 E;  1NHG C;  4DV0 M;  3MK6 A;  3NBI A;  3Q8X A;  5LMN M;  2DWZ B;  1IY2 A;  1XWI A;  4LG2 A;  5BR8 M;  3I4V A;  1UM8 A;  3U6S A;  3L2A A;  4MGZ E;  1H6U A;  2FNA A;  4LCB A;  3MJ5 A;  3R9X B;  4OVZ A;  3TPZ A;  3GPY A;  1XC8 A;  3IG8 A;  3SHG B;  1I4W A;  4FWD A;  3SMP A;  1G41 A;  2L09 A;  3VKG A;  1JR3 D;  4LF9 M;  8CAT A;  4M0W A;  1GL6 A;  3HJS A;  1IM2 A;  3UGJ A;  1HNX M;  4DR2 M;  2G8L A;  3SAW A;  4JV5 M;  2CHQ A;  1WXQ A;  4XBO A;  2KZU A;  4REZ A;  3SAS A;  1TDZ A;  2Y0T A;  3GLI B;  2KRU A;  3GLH B;  2QCU A;  3PXG A;  2I7P A;  3HJ8 A;  1S3S A;  2EO2 A;  1IN6 A;  3HGI A;  5ITY A;  3JR5 A;  3T15 A;  1C1K A;  3SYL A;  2CE7 A;  1W5S A;  3CF2 A;  2F5S A;  2RGO A;  4BBA A;  4PDG A;  5ITX E;  2J7N A;  4WW0 A;  4M9X A;  3KW6 A;  3RGS A;  4QOZ C;  2R62 A;  1R6B X;  4QNM A;  3H4M A;  2F5O A;  3GRV A;  4IBK A;  3QWL A;  3KSX A;  2H1R A;  3SMS A;  5A2Q S;  1DGH A;  3L25 A;  4AKI A;  3U6L A;  1IN5 A;  2YNM D;  1R2Y A;  1W5T A;  3LVW A;  2LNH C;  2FFJ A;  2Z4S A;  3VLF B;  4L78 A;  4WUR A;  2R46 A;  1IXS B;  4LGY A;  3JR4 A;  4LF7 M;  1OJL A;  3KVW A;  4FWG A;  3U6Q A;  3FTC A;  4DR5 M;  3AL0 C;  1G4A E;  4LJ8 A;  4G4O A;  4X64 M;  3T1Y M;  3SAV A;  3GLF B;  3PFI A;  4MGI E;  4G4N A;  4JYA M;  1GL7 A;  3J81 S;  4DV6 M;  1KSF X;  3U6O A;  2XZF A;  5E26 A;  1IBK M;  3HKP A;  2CEA A;  3GPP A;  2YR0 A;  3D8B A;  3J7B A;  1L2D A;  4AW4 A;  3U5Z B;  5C1B A;  1TGU A;  2CFO A;  1L2C A;  3AOG A;  3I4Y A;  4PCZ A;  3KP0 E;  1SXJ C;  4QHS A;  4QNR A;  1JQJ C;  4JI0 M;  4XGI A;  3FUV A;  2M60 A;  2D7H A;  4A3V B;  1K3W A;  3EIH A;  1J7K A;  2C96 A;  3CTW B;  5EXS A;  5H37 D;  3KSJ A;  2QPA A;  4IIW A;  1GVN A;  2RKO A;  4G4Q A;  1Q3C A;  4JN6 A;  4G4R A;  1J09 A;  2VII A;  4I81 A;  3TWK A;  4PT5 A;  4IJE A;  3FTF A;  5FTN A;  3E9S A;  2XFS A;  5FTK A;  3GLG A;  2FE8 A;  3T38 A;  3GP1 A;  5EP2 A;  3M7G A;  1N77 A;  4FVM A;  5FTJ A;  3KP1 E;  1QVR A;  1G59 A;  1Z5A A;  2UXC M;  3LQQ A;  2QBY B;  2LXE A;  1FNN A;  3KOX E;  5FLX S;  1PJI A;  3MHV C;  4IBJ A;  3SYK A;  4DR7 M;  4LJ4 A;  2VQE M;  4OU7 A;  1HT2 E;  1DGG A;  4LJ6 A;  3SHF A;  2LWX A;  2K47 A;  4KLN A;  2HHH M;  1R7R A;  2W82 A;  2ZAN A;  2UUB M;  2DWL A;  4IBC A;  4GC9 A;  1R2Z A;  3A98 B;  1QAQ A;  4YY3 M;  1L8Q A;  1XHB A;  1TH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...