3KW6A

Crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a domain of 26S proteasome regulatory subunit 8 from homo sapiens. Northeast Structural Genomics Consortium target id HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords 26S protease regulatory subunit 8
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kw6A01
1HQCA 4FCVA 1IY0A 1KYIA 1NJGA 1W5SA 4I4LA 3ZH9B 4L16A 2Z4RA 3K1JA 3GLIA 1KSFX 2QP9X 1SXJA 4LY6A 2R65A 2DVWB 2QPAA 3MHVC 1IN7A 1IY1A 1IN4A 3HU2A 3KW6A 1IY2A 4JN6A 4KLNA 3HU3A 3M6AA 3GLGA 3PFIA 5FTKA 3WHLA 1IN6A 1NY6A 2BJWA 1G3IA 2CE7A 3HU1A 2DZNB 5EXTA 1E32A 3GLHA 4GITA 3UK6A 5JI2E 5DYGA 1JQJC 4LCBA 4LZZA 4QNRA 4ZPXA 3DZDA 4L15A 3WHKA 4QNMA 4Z8XA 3H4MA 1OJLA 3BOSA 1QVRA 1OFIA 2QZ4A 1HT2E 1UM8A 4LRSA 3U60B 2VIIA 1IXRC 1SXJB 1OFHA 2CHGA 5FTMA 3GLFA 5FTNA 4KO8A 5C1BA 2ZAOA 3M0EA 1D2NA 3U5ZB 2DZOB 4L4UA 3GLIB 1E94E 1HT1E 1NVMA 3VLFB 4FCTA 1C1KA 1IXSB 1DO0A 3GLGB 4D81A 1SXJC 4I81A 2ZAMA 1G4AE 3SYKA 5FTLA 1XWIA 1HQYE 4LGMA 4QHTA 3D8BA 2HCBA 1R6BX 4FCWA 1IQPA 4LJ6A 5JI3E 2C98A 1R7RA 1IM2A 3PVSA 4FD2A 4LJ4A 5EXSA 1QZMA 4LJ8A 1SXJD 1NJFA 4QHSA 5EP3A 3AJIB 5EXPA 4EIWA 3GLFB 2C9OA 3SC3A 2KRKA 2QBYB 2QBYA 1W5TA 2FNAA 2XSZA 4LJ9A 4LRTA 5EXXA 3U61B 1IN8A 1XXHB 2CHVA 3CF2A 3PXGA 3SYLA 2DWZB 2R62A 2CEAA 4D80A 1X37A 3EIEA 1IN5A 1DO2A 1JR3D 1G41A 3HWSA 3VFDA 3GLHB 3KDSE 4FWGA 4FWDA 4QOSA 1LV7A 4KODA 1IXZA 2C9CA 5DYIA 4LJAA 3CF0A 1FNNA 1S3SA 2C96A 3EIHA 5EP1A 4D82A 1JR3A 2QENA 4LJ7A 1NSFA 4WW0A 4A3VB 5EQTA 4FWHA 3R8FA 1SXJE 4FW9A 2V6ZM 1J7KA 5EP4A 5C18A 1L8QA 2C99A 2BJVA 5EP2A 2CHQA 2V1UA 2DHRA 5FTJA 2Z4SA 1XXHA 2ZANA 1NY5A 2RKOA 2XSZD 3B9PA 2X8AA 4LJ5A
chains in the Genus database with same CATH superfamily
1HQCA 2P5TA 1D0LA 2DAMA 3FTCA 4WURA 4JI3M 4JI6M 1Q3BA 2KA6B 3GLIA 1KSFX 3B7QA 3FE3A 4JI8M 2R65A 3MHVC 2CFOA 4DR4M 5BR8M 4DR1M 4AKHA 3HU2A 3KW6A 1IY2A 1DGHB 4GIPA 1H6UA 4GRIA 4JN6A 4Z6YA 2JNHA 3SFZA 3UGJA 1E9SA 1BVSA 3JAMS 3IG5A 3VDUA 2JXNA 2LVOC 2WSCF 3HU1A 2DZNB 3K92A 3T1YM 3SMPA 2AHMA 2CV2A 4ZPXA 1GO5A 2GQFA 1OIPA 3TPZA 4CGYB 1OJLA 4LF8M 2XF3A 3A98B 1QDTA 2QZ4A 2R44A 3FD9A 4NRVA 1T6OA 4R3DA 3GQ5A 1TTEA 4DUZM 1UM8A 4DV2M 1ZQ9A 3VK8A 1GVNA 2Y0QA 4NSOB 2QHOB 5BPVA 2KHHA 4G6ZA 5IT9S 4NL4H 2R46A 2KNVA 2KRUA 3GLFA 5FTNA 5EJCA 3T6PA 4LF5M 2HHHM 1RU3A 4IBJA 4MGKE 4LZJA 4OU7A 3FUXA 2DZOB 2MGWA 4L4UA 3GLIB 3LW5F 2YQZA 4GC9A 1HT1E 3VLFB 1NVMA 2OPFA 3PNYA 2G5GX 1QYRA 4FCTA 3B74A 1DO0A 3GLGB 2ZTCA 4D81A 1ZMWA 3LCVB 2J7NA 1JR3E 3KVWA 2H1RA 4F1IA 4GKJM 1V92A 2ZAMA 4B3SM 4HL4A 2K6BA 1XWIA 2I7NA 3AOGA 5A2QS 2X4AA 2VQEM 2CUZA 1R6BX 2HCBA 4X62M 4FCWA 4AKIA 3SASA 1IQPA 2MJ5B 3HJQA 3HHWA 5JI3E 3B89A 3U60A 3KOXE 4KT0F 3F92A 2HL7A 1JB0F 1TH4A 2K47A 3PNVA 4CHTB 2L6OA 3HJ8A 5EP3A 3KOWE 2F5SA 1L1ZA 4B3TM 4TUWA 2BWBA 5LMUM 4LG2A 2CV1A 4IBEA 3SC3A 4G4OA 4RF0A 3U6MA 2O5RA 1XNRM 1W5TA 1DGFA 2XSZA 1XNQM 5EXXA 2VF8A 3W68A 1IN8A 3PXGA 4YY3M 2UXCM 3QYEA 4IBIA 4DUYM 1DGGA 1YUBA 1TDHA 4M9SA 3A45A 2UU9M 4UN2B 1PJJA 4B3MM 4MGZE 2D7EA 1Z5CA 4IBBA 3D8LA 2JY6B 1PM5A 1QQWA 1QDRA 1WHCA 1G41A 2KW0A 3FUUA 3SHFA 2I7PA 4S12A 1LV7A 2HAKA 2J7OA 4IBGA 4B7GA 3T38A 2UUBM 3U6LA 4LJAA 4DR6M 1N33M 2DHYA 1OIZA 3FUVA 4B7FA 4NXMM 5EP1A 4D82A 2J5YA 1N77A 4I8OA 1NSFA 4WW0A 1WR1B 1L2DA 1XHBA 2L7HA 3KP0E 2EA0A 1NV8A 1XC8A 2DHRA 4LF4M 2FFJA 1XXHA 2Z4SA 1Y8GA 1G59A 1OQYA 3FTFA 2KEBA 3B9PA 1TR8A 4LJ5A 2K9DA 2YR0A 4FCVA 1R4GA 2E5LM 1IY0A 1KYIA 1NJGA 4I4LA 1N32M 1QZEA 3HHYA 4FVMA 5L8RF 2DVWB 5KPZA 1IN7A 3SHGB 1ZAEA 3RGPA 4DV4M 1VG5A 3IG8A 3M6AA 2X49A 3FRHA 3PFIA 1L1TA 3WHLA 3I04M 3ZQJA 3KSXA 2F5OA 2M5ZA 2Y20A 4L6V6 1G3IA 2CE7A 1E32A 3JR4A 4RKUF 2R4EA 1PJTA 3AOEA 4LZZA 4QNRA 1VEGA 3GQ3A 3KS8A 3MMPA 4LFAM 3DZDA 3WHKA 2LBCA 4L8RC 1FJGM 5KPRA 2LNHC 1Z59A 4DV7M 1EFUB 3K9OA 4GHAA 3NWLA 1QVRA 4DR3M 3J81S 1MU5A 2MR9A 2JY8A 1NHGC 3AV0A 2EO2A 2JWSA 3FUWA 3U60B 4XBOA 3TE6A 2W82A 4DR7M 1A5TA 1IXRC 1OFHA 1HR0M 1QAQA 1WJ7A 2JA2A 2V1CA 3SBJA 4RNAA 3A46A 1VDLA 2LHCA 5C1BA 3LVWA 2MH8A 2NQ8C 3U5ZB 3B7ZA 5ITUA 2JP7A 3Q8XA 1E94E 2L09A 1TH2A 2XH9A 3U6QA 2EUCA 3GLIE 3GPYA 1NNUC 2UUAM 3DA1A 4I81A 1Z5AA 1G4AE 3R9XB 2F5PA 4AKGA 1WGLA 3SYKA 8CATA 3FYCA 3KOYE 4IBDA 2JY5A 1DV0A 4G3OA 2UXBM 2DAIA 3J27B 3I51A 4LFCM 1L2CA 2C98A 2RRUA 4Q7JA 3HJSA 2WZJA 4LF6M 1VEKA 4JV5M 2EJSA 1SXJD 4MH0E 1NJFA 4QHSA 2DAKA 4EIWA 1F4IA 3HHZA 2C9OA 3LMMA 2QSFX 2QBYB 5KQDA 3E21A 2KNZA 2QCUA 2LWXA 3THGA 4LRTA 3SATA 2DI0A 3DOAA 3L29A 2CHVA 4GMQA 2YNMD 4IBKA 1V34A 2DWZB 3SYLA 3W67A 4P17A 2LXEA 4DV5M 1IFYA 4B7HA 4D80A 4LF9M 1UFZA 1XMOM 1X37A 3W0FA 3EIEA 1JR3D 3LVVA 2ZM6M 2ZTDA 3BBZA 3ILKA 2JY7A 3C3DA 3HWSA 3KDSE 4FWGA 5KO3A 2DWNA 3MJ5A 3KOZE 3BXWA 2LTUA 3KSJA 3K2LA 2DENA 3ZC7B 2C96A 4IJFA 2QENA 1Z6TA 4LJ7A 1GJSA 4X65M 5EQTA 3R8FA 1R2YA 1T43A 1J7KA 4DV3M 2C99A 1ZMUA 2LVAA 3LQRA 1ZV1A 2OQ4A 5FTJA 1AUAA 3I4VA 2VDBB 3HKPA 4B08A 3HHXA 2Y21A 2RKOA 4LJ8A 3I01M 2XZFA 2L7IA 3GRUA 2R4JA 1Q3CA 2RGHA 1T3TA 3TQSA 4LGYA 4BBAA 1W5SA 3H4JA 1HJPA 2L4EA 4L16A 3TWKA 3K1JA 3U6CA 4LY6A 3RE8A 1E9RA 1IY1A 3L28A 1IN4A 4M0WA 4DR2M 2CWBA 4MGIE 4M9ZA 1VEJA 2F5NA 3GQ4A 4KLNA 3GLGA 3HU3A 5FTKA 3K9PA 4GHLA 1AIPC 1Q39A 5KPTA 4JI2M 2FS1A 4GEWA 4I5SA 2BJWA 3GRVA 4MB7A 5IZ7D 2Q2EB 1V33A 1HNXM 2M60A 3NBIA 1OAIA 3GLHA 4GITA 3UK6A 2DWMA 4LCBA 4JI5M 4DV6M 4AZFA 2O25A 4QNMA 4Z8XA 4YHHM 1PRBA 2MROB 3H4MA 5LMNM 1XB2B 3LCUA 1OFIA 2O01F 1HNZM 3GLGE 3QAUA 4QOZC 3UMMA 2G8LA 2VIIA 3A42A 1SXJB 2CHGA 3GO8A 5E26A 4LF7M 3HGIA 5FTMA 1L2BA 4MM3B 4RF1A 1HNWM 1VDDA 4KHPM 3Q8GA 4HEOA 4P16A 5FSWA 5FLXS 1D2NA 3GPPA 5ITQA 4X64M 2Z3XA 2ERCA 1NV9A 2JZ1A 1TF0B 4MGYE 3SAUA 3KS4A 4F2LA 1J5EM 1NO1A 3HZJA 3SAWA 2RGOA 3IHPA 4REZA 1WIVA 3GPUA 2EKKA 3L26A 1HQYE 5ITTA 4ITQA 3D8BA 5GKNA 3SAVA 1GL7A 2DKLA 2B3TA 2QNJA 3FTEA 1R7RA 3SMSA 4FD2A 5EXSA 1NHWC 1QZMA 3QYBA 1DGBA 2XLJA 5EXPA 1I4WA 2G3QA 5F3WA 3AL0C 3LQQA 4BB9A 1EE8A 2KRKA 3U5ZA 1IBLM 4GKKM 2FE8A 3TL4X 3CF6E 2KZSA 1R5LA 4LJ9A 3U61B 3VKHA 3L25A 4CISA 1IXSA 4M9XA 3J7AS 4DV1M 3U6SA 3SARA 2FH0A 2F4VM 4R7GA 2CEAA 3GP1A 2DAGA 3FUTA 4WP2A 4XGIA 4PDGA 5ITXE 4L78A 2K0BX 1IN5A 3GLHE 1NNJA 1MN3A 4GH9A 2DXIA 3OTOM 1Q02A 1QANA 4MGHA 1GKIA 1GABA 2LHGA 4G4QA 3UZUA 4KODA 1TDZA 1IXZA 1CUKA 1Z5BA 2C9CA 3I4YA 3QWLA 5DYIA 4JYAM 3CF0A 3HX3A 3U6EA 1JR3A 3VDPA 3FYDA 3KFUG 1XXHE 1C7YA 4FWHA 1WXQA 1SXJE 4FW9A 3RGSA 1P3QQ 5EP4A 5C18A 1L8QA 4LFBM 1GLNA 2OOAA 5EP2A 2V1UA 4AI6A 1PJSA 4W5WA 2ZANA 3NBXX 3VK7A 1N36M 2X8AA 4PDIA 2Z8YM 4NC6A 2D7HA 4Y28F 3T1HM 2HWJA 4X66M 2L4FA 3ZH9B 4M0DA 2Z4RA 2EKFA 3IECA 1TGUA 1SXJA 2LH0A 2QP9X 4OVZB 3CGWA 2QPAA 2KXEA 4JI4M 4CJ6A 1TH3A 2BNKA 2XFSA 4K0KM 1KFVA 3KP1E 1EIJA 4ANRA 3U6OA 1IN6A 1QUSA 1NY6A 5IREB 4OW0A 1MJGM 2FOIC 1N75A 3AOEC 1WGNA 3HY5A 5EXTA 2C5RA 1MX0A 4NRWA 5JI2E 1IBMM 1JQJC 3J80S 4L15A 1GJTA 3L27A 3BOSA 2KNAA 1QUTA 4HLQA 1D0MA 4DV0M 1HT2E 2DAEA 2DZLA 4B3RM 4LRSA 1I94M 2UUCM 5DFLA 1J09A 4JI0M 1OKSA 2WSEF 4PT5A 1G71A 4IIWA 3W0LB 3T15A 3U6DA 2VF7A 3MK6A 4KO8A 3KXEC 4AG5A 5H37D 2ZAOA 1ZMVA 5DNYA 2R6FA 2JZ0A 3M0EA 1K3WA 4NSRA 2XZUA 1XMQM 5KQ8A 4OVZA 2ZBKB 4II7A 1C1KA 1LTMA 4AQYM 2QQ8A 1IXSB 3ZCBB 2F5QA 5ITRA 2VQFM 3DFZA 1SXJC 2XEPA 4JI1M 3TWLA 4AW4A 5FTLA 1N34M 3RFWA 1D0KA 4LGMA 4QHTA 4OX9M 2XSZD 4NXNM 3CTWB 3GRYA 3V76A 3JR5A 1PGYA 4AG6A 1GL6A 4LJ6A 1OAOC 2OOBA 3E4RA 3K8ZA 4G4NA 1IM2A 3PVSA 5E6JA 4LJ4A 5IWAM 3AKZA 1K3XA 1PJQA 2R18A 5ITXA 4CIZA 4PD2A 3AJIB 4DBGB 3GLFB 4R71A 3GPXA 3FRIA 4G4RA 2OO9A 2CV0A 1OTRA 2QBYA 1ORYB 1YE9A 2FNAA 2XGNA 2CRUA 1PJIA 1XXHB 2D7GA 3CF2A 2LVQD 1K82A 3M7GA 1VQ1A 3C3EA 1DGHA 1QAOA 2KDLA 4PCZA 3GLFE 2R62A 3E46A 3B7NA 4IBFA 3VKGA 2H5XA 3FTDA 2HKJA 2R45A 2R0IA 3U61A 1DO2A 2N35A 4BLCA 4XK8F 2DNAA 3VFDA 3GLHB 1QAMA 2LVNC 3L2AA 4FWDA 4QOSA 3C9PA 2KZUA 4GC5A 3AFHA 4IBCA 2UXDM 2DWLA 2YFQA 3UJNA 2LVPC 2XFTA 2GNOA 3FKEA 4JXJA 1FNNA 1S3SA 3E9SA 1YLAA 3EIHA 1IBKM 4IJEA 5ITYA 4A3VB 4DR5M 3C58A 3U6PA 1N78A 2JUJA 2A5YB 2V6ZM 2WSFF 3J2PB 1R2ZA 7CATA 3J7BA 4NOOB 2BJVA 2CHQA 2CP8A 2BWEA 1SG9A 1YSYA 2APLA 2Y0TA 2Z7JA 3TWMA 1NY5A 2L2DA 5DYGA 1G8PA 4JI7M 3GRRA
chains in the Genus database with same CATH topology
1HQCA 2P5TA 3FTCA 4WURA 4JI3M 4JI6M 1Q3BA 2KA6B 3GLIA 1KSFX 4JI8M 2R65A 3MHVC 2CFOA 4DR4M 5BR8M 4DR1M 4AKHA 3HU2A 3KW6A 1IY2A 1DGHB 4GIPA 1H6UA 4GRIA 4JN6A 4Z6YA 3SFZA 3UGJA 1E9SA 3JAMS 3IG5A 3VDUA 3HU1A 2DZNB 3K92A 3T1YM 3SMPA 2AHMA 2CV2A 4ZPXA 3TPZA 4CGYB 1OJLA 4LF8M 2XF3A 3A98B 3FD9A 2QZ4A 4NRVA 3GQ5A 4R3DA 4DUZM 1UM8A 4DV2M 1ZQ9A 3VK8A 1GVNA 2Y0QA 4NSOB 5BPVA 4G6ZA 5IT9S 4NL4H 2R46A 2KRUA 3GLFA 5FTNA 5EJCA 4LF5M 2HHHM 4IBJA 4MGKE 4LZJA 4OU7A 3FUXA 2DZOB 4L4UA 3GLIB 2YQZA 4GC9A 1HT1E 3VLFB 1NVMA 2OPFA 3PNYA 2G5GX 1QYRA 4FCTA 1DO0A 3GLGB 4D81A 2J7NA 3KVWA 2H1RA 4GKJM 2ZAMA 4B3SM 4HL4A 1XWIA 2I7NA 3AOGA 5A2QS 2X4AA 2VQEM 2CUZA 1R6BX 2HCBA 4X62M 4FCWA 4AKIA 3SASA 1IQPA 3U60A 3HJQA 3HHWA 5JI3E 3KOXE 2HL7A 1TH4A 2K47A 3PNVA 4CHTB 2L6OA 3HJ8A 5EP3A 3KOWE 2F5SA 1L1ZA 4B3TM 4TUWA 5LMUM 4LG2A 2CV1A 4IBEA 3SC3A 4G4OA 4RF0A 3U6MA 2O5RA 1XNRM 1W5TA 1DGFA 2XSZA 1XNQM 5EXXA 1IN8A 3PXGA 4YY3M 2UXCM 4IBIA 4DUYM 1DGGA 1YUBA 1TDHA 4M9SA 3A45A 2UU9M 1PJJA 4B3MM 4MGZE 2D7EA 1Z5CA 4IBBA 3D8LA 1PM5A 1QQWA 1G41A 2KW0A 3FUUA 3SHFA 2I7PA 4S12A 1LV7A 2J7OA 4IBGA 4B7GA 3T38A 2UUBM 3U6LA 4LJAA 4DR6M 1N33M 4NXMM 3FUVA 4B7FA 5EP1A 4D82A 1N77A 4I8OA 1NSFA 4WW0A 1L2DA 1XHBA 2L7HA 3KP0E 2EA0A 1XC8A 4LF4M 2DHRA 2FFJA 1XXHA 2Z4SA 1G59A 3FTFA 2KEBA 3B9PA 4LJ5A 2YR0A 4FCVA 2E5LM 1IY0A 1KYIA 1NJGA 4I4LA 1N32M 3HHYA 4FVMA 2DVWB 5KPZA 1IN7A 3SHGB 1ZAEA 3RGPA 4DV4M 3IG8A 3M6AA 2X49A 3PFIA 1L1TA 3WHLA 3KSXA 2F5OA 2M5ZA 2Y20A 1G3IA 2CE7A 1E32A 3JR4A 2R4EA 3AOEA 4LZZA 4QNRA 3GQ3A 3KS8A 4LFAM 3DZDA 3WHKA 1FJGM 4L8RC 5KPRA 2LNHC 1Z59A 4DV7M 4GHAA 3NWLA 1QVRA 4DR3M 3J81S 1MU5A 1NHGC 3AV0A 2EO2A 3FUWA 3U60B 4DR7M 4XBOA 3TE6A 2W82A 1IXRC 1OFHA 1HR0M 1QAQA 2JA2A 2V1CA 3SBJA 4RNAA 3A46A 5C1BA 3LVWA 2NQ8C 3U5ZB 5ITUA 3Q8XA 1E94E 2L09A 1TH2A 2XH9A 3U6QA 2EUCA 3GPYA 1NNUC 2UUAM 3DA1A 4I81A 1Z5AA 1G4AE 3R9XB 2F5PA 4AKGA 3SYKA 8CATA 3FYCA 3KOYE 4IBDA 2UXBM 3J27B 3I51A 4LFCM 1L2CA 2C98A 3HJSA 4LF6M 4JV5M 1SXJD 4MH0E 1NJFA 4QHSA 4EIWA 3HHZA 2C9OA 3LMMA 2QBYB 5KQDA 2QCUA 2LWXA 3THGA 4LRTA 3SATA 3DOAA 3L29A 4IBKA 2CHVA 4GMQA 2YNMD 3SYLA 2DWZB 2LXEA 4DV5M 4B7HA 4D80A 4LF9M 1XMOM 1X37A 3W0FA 3EIEA 1JR3D 3LVVA 2ZM6M 5KO3A 3ILKA 3HWSA 2DWNA 3KDSE 4FWGA 3MJ5A 3KOZE 3KSJA 3K2LA 3ZC7B 2C96A 4IJFA 2QENA 1Z6TA 4LJ7A 4X65M 5EQTA 3R8FA 1R2YA 1J7KA 4DV3M 2C99A 3LQRA 2OQ4A 5FTJA 4B08A 3I4VA 3HKPA 3HHXA 2Y21A 2RKOA 4LJ8A 2XZFA 2L7IA 3GRUA 2R4JA 1Q3CA 2RGHA 1T3TA 3TQSA 4LGYA 4BBAA 1W5SA 3TWKA 4L16A 3K1JA 3U6CA 4LY6A 3RE8A 1E9RA 1IY1A 3L28A 1IN4A 4M0WA 4DR2M 4MGIE 4M9ZA 2F5NA 3GQ4A 4KLNA 3GLGA 3HU3A 5FTKA 4GHLA 1Q39A 5KPTA 4JI2M 4I5SA 2BJWA 3GRVA 4MB7A 5IZ7D 2Q2EB 1HNXM 2M60A 3NBIA 3GLHA 4GITA 3UK6A 2DWMA 4LCBA 4JI5M 4DV6M 4AZFA 4QNMA 4Z8XA 4YHHM 3H4MA 5LMNM 1OFIA 1HNZM 3QAUA 4QOZC 3UMMA 2G8LA 2VIIA 3A42A 1SXJB 2CHGA 3GO8A 5E26A 4LF7M 3HGIA 5FTMA 1L2BA 4MM3B 4RF1A 1HNWM 1VDDA 4KHPM 4P16A 5FSWA 5FLXS 1D2NA 3GPPA 5ITQA 4X64M 2Z3XA 2ERCA 4MGYE 3SAUA 3KS4A 1J5EM 3SAWA 2RGOA 3GPUA 4REZA 3L26A 1HQYE 5ITTA 4ITQA 3D8BA 5GKNA 3SAVA 1GL7A 3FTEA 1R7RA 3SMSA 4FD2A 5EXSA 1NHWC 1QZMA 1DGBA 2XLJA 5EXPA 1I4WA 5F3WA 3AL0C 3LQQA 4BB9A 1EE8A 2KRKA 3U5ZA 1IBLM 4GKKM 2FE8A 3TL4X 3CF6E 2KZSA 4LJ9A 3U61B 3VKHA 3L25A 4CISA 4M9XA 3J7AS 4DV1M 3U6SA 3SARA 2F4VM 4R7GA 2CEAA 3GP1A 4XGIA 3FUTA 4PDGA 5ITXE 4L78A 1NNJA 1IN5A 4GH9A 2DXIA 3OTOM 1QANA 4MGHA 1GKIA 4G4QA 3UZUA 4KODA 1TDZA 1IXZA 1Z5BA 2C9CA 3I4YA 3QWLA 5DYIA 4JYAM 3CF0A 3U6EA 1JR3A 3VDPA 3FYDA 3KFUG 4FWHA 1WXQA 1SXJE 4FW9A 3RGSA 5EP4A 5C18A 1L8QA 4LFBM 1GLNA 5EP2A 2V1UA 4AI6A 4W5WA 2ZANA 3VK7A 1N36M 2X8AA 4PDIA 2D7HA 3T1HM 4X66M 3ZH9B 4M0DA 2Z4RA 1TGUA 1SXJA 2LH0A 2QP9X 4OVZB 2QPAA 2KXEA 4JI4M 1TH3A 2BNKA 2XFSA 4K0KM 1KFVA 3KP1E 3U6OA 1IN6A 1NY6A 5IREB 4OW0A 2FOIC 1N75A 3AOEC 5EXTA 2C5RA 1MX0A 4NRWA 5JI2E 1IBMM 1JQJC 3J80S 4L15A 3L27A 3BOSA 4HLQA 4DV0M 1HT2E 4B3RM 4LRSA 1I94M 2UUCM 1J09A 4JI0M 4PT5A 4IIWA 3W0LB 3T15A 3U6DA 3MK6A 4KO8A 3KXEC 4AG5A 5H37D 2ZAOA 5DNYA 3M0EA 1K3WA 4NSRA 2XZUA 1XMQM 5KQ8A 4OVZA 2ZBKB 4II7A 1C1KA 2F5QA 4AQYM 1IXSB 3ZCBB 5ITRA 2VQFM 3DFZA 1SXJC 2XEPA 4JI1M 3TWLA 4AW4A 5FTLA 1N34M 3RFWA 4LGMA 4QHTA 4OX9M 4NXNM 3CTWB 3GRYA 3JR5A 4AG6A 1GL6A 4LJ6A 4G4NA 3E4RA 3K8ZA 1IM2A 3PVSA 5E6JA 4LJ4A 5IWAM 3AKZA 1K3XA 2R18A 5ITXA 4PD2A 3AJIB 3GLFB 3GPXA 4G4RA 2CV0A 2QBYA 1ORYB 1YE9A 2FNAA 2XGNA 1PJIA 1XXHB 2D7GA 3CF2A 1K82A 3M7GA 1QAOA 1DGHA 4PCZA 2R62A 4IBFA 3VKGA 3FTDA 2HKJA 2R45A 3U61A 1DO2A 4BLCA 3VFDA 3GLHB 1QAMA 3L2AA 4FWDA 4QOSA 2KZUA 4GC5A 3AFHA 4IBCA 2UXDM 2DWLA 2YFQA 3UJNA 2XFTA 3FKEA 4JXJA 1FNNA 1S3SA 3E9SA 3EIHA 1IBKM 4IJEA 5ITYA 4A3VB 4DR5M 3C58A 3U6PA 1N78A 2A5YB 2V6ZM 3J2PB 1R2ZA 7CATA 3J7BA 4NOOB 2BJVA 2CHQA 2Z7JA 1YSYA 2Y0TA 3TWMA 1NY5A 2XSZD 5DYGA 1G8PA 4JI7M 3GRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQC A;  4FCV A;  1IY0 A;  1KYI A;  1NJG A;  1W5S A;  4I4L A;  3ZH9 B;  4L16 A;  2Z4R A;  3K1J A;  3GLI A;  1KSF X;  2QP9 X;  1SXJ A;  4LY6 A;  2R65 A;  2DVW B;  2QPA A;  3MHV C;  1IN7 A;  1IY1 A;  1IN4 A;  3HU2 A;  3KW6 A;  1IY2 A;  4JN6 A;  4KLN A;  3HU3 A;  3M6A A;  3GLG A;  3PFI A;  5FTK A;  3WHL A;  1IN6 A;  1NY6 A;  2BJW A;  1G3I A;  2CE7 A;  3HU1 A;  2DZN B;  5EXT A;  1E32 A;  3GLH A;  4GIT A;  3UK6 A;  5JI2 E;  5DYG A;  1JQJ C;  4LCB A;  4LZZ A;  4QNR A;  4ZPX A;  3DZD A;  4L15 A;  3WHK A;  4QNM A;  4Z8X A;  3H4M A;  1OJL A;  3BOS A;  1QVR A;  1OFI A;  2QZ4 A;  1HT2 E;  1UM8 A;  4LRS A;  3U60 B;  2VII A;  1IXR C;  1SXJ B;  1OFH A;  2CHG A;  5FTM A;  3GLF A;  5FTN A;  4KO8 A;  5C1B A;  2ZAO A;  3M0E A;  1D2N A;  3U5Z B;  2DZO B;  4L4U A;  3GLI B;  1E94 E;  1HT1 E;  1NVM A;  3VLF B;  4FCT A;  1C1K A;  1IXS B;  1DO0 A;  3GLG B;  4D81 A;  1SXJ C;  4I81 A;  2ZAM A;  1G4A E;  3SYK A;  5FTL A;  1XWI A;  1HQY E;  4LGM A;  4QHT A;  3D8B A;  2HCB A;  1R6B X;  4FCW A;  1IQP A;  4LJ6 A;  5JI3 E;  2C98 A;  1R7R A;  1IM2 A;  3PVS A;  4FD2 A;  4LJ4 A;  5EXS A;  1QZM A;  4LJ8 A;  1SXJ D;  1NJF A;  4QHS A;  5EP3 A;  3AJI B;  5EXP A;  4EIW A;  3GLF B;  2C9O A;  3SC3 A;  2KRK A;  2QBY B;  2QBY A;  1W5T A;  2FNA A;  2XSZ A;  4LJ9 A;  4LRT A;  5EXX A;  3U61 B;  1IN8 A;  1XXH B;  2CHV A;  3CF2 A;  3PXG A;  3SYL A;  2DWZ B;  2R62 A;  2CEA A;  4D80 A;  1X37 A;  3EIE A;  1IN5 A;  1DO2 A;  1JR3 D;  1G41 A;  3HWS A;  3VFD A;  3GLH B;  3KDS E;  4FWG A;  4FWD A;  4QOS A;  1LV7 A;  4KOD A;  1IXZ A;  2C9C A;  5DYI A;  4LJA A;  3CF0 A;  1FNN A;  1S3S A;  2C96 A;  3EIH A;  5EP1 A;  4D82 A;  1JR3 A;  2QEN A;  4LJ7 A;  1NSF A;  4WW0 A;  4A3V B;  5EQT A;  4FWH A;  3R8F A;  1SXJ E;  4FW9 A;  2V6Z M;  1J7K A;  5EP4 A;  5C18 A;  1L8Q A;  2C99 A;  2BJV A;  5EP2 A;  2CHQ A;  2V1U A;  2DHR A;  5FTJ A;  2Z4S A;  1XXH A;  2ZAN A;  1NY5 A;  2RKO A;  2XSZ D;  3B9P A;  2X8A A;  4LJ5 A; 
#chains in the Genus database with same CATH topology
 1HQC A;  2P5T A;  1D0L A;  2DAM A;  3FTC A;  4WUR A;  4JI3 M;  4JI6 M;  1Q3B A;  2KA6 B;  3GLI A;  1KSF X;  3B7Q A;  3FE3 A;  4JI8 M;  2R65 A;  3MHV C;  2CFO A;  4DR4 M;  5BR8 M;  4DR1 M;  4AKH A;  3HU2 A;  3KW6 A;  1IY2 A;  1DGH B;  4GIP A;  1H6U A;  4GRI A;  4JN6 A;  4Z6Y A;  2JNH A;  3SFZ A;  3UGJ A;  1E9S A;  1BVS A;  3JAM S;  3IG5 A;  3VDU A;  2JXN A;  2LVO C;  2WSC F;  3HU1 A;  2DZN B;  3K92 A;  3T1Y M;  3SMP A;  2AHM A;  2CV2 A;  4ZPX A;  1GO5 A;  2GQF A;  1OIP A;  3TPZ A;  4CGY B;  1OJL A;  4LF8 M;  2XF3 A;  3A98 B;  1QDT A;  2QZ4 A;  2R44 A;  3FD9 A;  4NRV A;  1T6O A;  4R3D A;  3GQ5 A;  1TTE A;  4DUZ M;  1UM8 A;  4DV2 M;  1ZQ9 A;  3VK8 A;  1GVN A;  2Y0Q A;  4NSO B;  2QHO B;  5BPV A;  2KHH A;  4G6Z A;  5IT9 S;  4NL4 H;  2R46 A;  2KNV A;  2KRU A;  3GLF A;  5FTN A;  5EJC A;  3T6P A;  4LF5 M;  2HHH M;  1RU3 A;  4IBJ A;  4MGK E;  4LZJ A;  4OU7 A;  3FUX A;  2DZO B;  2MGW A;  4L4U A;  3GLI B;  3LW5 F;  2YQZ A;  4GC9 A;  1HT1 E;  3VLF B;  1NVM A;  2OPF A;  3PNY A;  2G5G X;  1QYR A;  4FCT A;  3B74 A;  1DO0 A;  3GLG B;  2ZTC A;  4D81 A;  1ZMW A;  3LCV B;  2J7N A;  1JR3 E;  3KVW A;  2H1R A;  4F1I A;  4GKJ M;  1V92 A;  2ZAM A;  4B3S M;  4HL4 A;  2K6B A;  1XWI A;  2I7N A;  3AOG A;  5A2Q S;  2X4A A;  2VQE M;  2CUZ A;  1R6B X;  2HCB A;  4X62 M;  4FCW A;  4AKI A;  3SAS A;  1IQP A;  2MJ5 B;  3HJQ A;  3HHW A;  5JI3 E;  3B89 A;  3U60 A;  3KOX E;  4KT0 F;  3F92 A;  2HL7 A;  1JB0 F;  1TH4 A;  2K47 A;  3PNV A;  4CHT B;  2L6O A;  3HJ8 A;  5EP3 A;  3KOW E;  2F5S A;  1L1Z A;  4B3T M;  4TUW A;  2BWB A;  5LMU M;  4LG2 A;  2CV1 A;  4IBE A;  3SC3 A;  4G4O A;  4RF0 A;  3U6M A;  2O5R A;  1XNR M;  1W5T A;  1DGF A;  2XSZ A;  1XNQ M;  5EXX A;  2VF8 A;  3W68 A;  1IN8 A;  3PXG A;  4YY3 M;  2UXC M;  3QYE A;  4IBI A;  4DUY M;  1DGG A;  1YUB A;  1TDH A;  4M9S A;  3A45 A;  2UU9 M;  4UN2 B;  1PJJ A;  4B3M M;  4MGZ E;  2D7E A;  1Z5C A;  4IBB A;  3D8L A;  2JY6 B;  1PM5 A;  1QQW A;  1QDR A;  1WHC A;  1G41 A;  2KW0 A;  3FUU A;  3SHF A;  2I7P A;  4S12 A;  1LV7 A;  2HAK A;  2J7O A;  4IBG A;  4B7G A;  3T38 A;  2UUB M;  3U6L A;  4LJA A;  4DR6 M;  1N33 M;  2DHY A;  1OIZ A;  3FUV A;  4B7F A;  4NXM M;  5EP1 A;  4D82 A;  2J5Y A;  1N77 A;  4I8O A;  1NSF A;  4WW0 A;  1WR1 B;  1L2D A;  1XHB A;  2L7H A;  3KP0 E;  2EA0 A;  1NV8 A;  1XC8 A;  2DHR A;  4LF4 M;  2FFJ A;  1XXH A;  2Z4S A;  1Y8G A;  1G59 A;  1OQY A;  3FTF A;  2KEB A;  3B9P A;  1TR8 A;  4LJ5 A;  2K9D A;  2YR0 A;  4FCV A;  1R4G A;  2E5L M;  1IY0 A;  1KYI A;  1NJG A;  4I4L A;  1N32 M;  1QZE A;  3HHY A;  4FVM A;  5L8R F;  2DVW B;  5KPZ A;  1IN7 A;  3SHG B;  1ZAE A;  3RGP A;  4DV4 M;  1VG5 A;  3IG8 A;  3M6A A;  2X49 A;  3FRH A;  3PFI A;  1L1T A;  3WHL A;  3I04 M;  3ZQJ A;  3KSX A;  2F5O A;  2M5Z A;  2Y20 A;  4L6V 6;  1G3I A;  2CE7 A;  1E32 A;  3JR4 A;  4RKU F;  2R4E A;  1PJT A;  3AOE A;  4LZZ A;  4QNR A;  1VEG A;  3GQ3 A;  3KS8 A;  3MMP A;  4LFA M;  3DZD A;  3WHK A;  2LBC A;  4L8R C;  1FJG M;  5KPR A;  2LNH C;  1Z59 A;  4DV7 M;  1EFU B;  3K9O A;  4GHA A;  3NWL A;  1QVR A;  4DR3 M;  3J81 S;  1MU5 A;  2MR9 A;  2JY8 A;  1NHG C;  3AV0 A;  2EO2 A;  2JWS A;  3FUW A;  3U60 B;  4XBO A;  3TE6 A;  2W82 A;  4DR7 M;  1A5T A;  1IXR C;  1OFH A;  1HR0 M;  1QAQ A;  1WJ7 A;  2JA2 A;  2V1C A;  3SBJ A;  4RNA A;  3A46 A;  1VDL A;  2LHC A;  5C1B A;  3LVW A;  2MH8 A;  2NQ8 C;  3U5Z B;  3B7Z A;  5ITU A;  2JP7 A;  3Q8X A;  1E94 E;  2L09 A;  1TH2 A;  2XH9 A;  3U6Q A;  2EUC A;  3GLI E;  3GPY A;  1NNU C;  2UUA M;  3DA1 A;  4I81 A;  1Z5A A;  1G4A E;  3R9X B;  2F5P A;  4AKG A;  1WGL A;  3SYK A;  8CAT A;  3FYC A;  3KOY E;  4IBD A;  2JY5 A;  1DV0 A;  4G3O A;  2UXB M;  2DAI A;  3J27 B;  3I51 A;  4LFC M;  1L2C A;  2C98 A;  2RRU A;  4Q7J A;  3HJS A;  2WZJ A;  4LF6 M;  1VEK A;  4JV5 M;  2EJS A;  1SXJ D;  4MH0 E;  1NJF A;  4QHS A;  2DAK A;  4EIW A;  1F4I A;  3HHZ A;  2C9O A;  3LMM A;  2QSF X;  2QBY B;  5KQD A;  3E21 A;  2KNZ A;  2QCU A;  2LWX A;  3THG A;  4LRT A;  3SAT A;  2DI0 A;  3DOA A;  3L29 A;  2CHV A;  4GMQ A;  2YNM D;  4IBK A;  1V34 A;  2DWZ B;  3SYL A;  3W67 A;  4P17 A;  2LXE A;  4DV5 M;  1IFY A;  4B7H A;  4D80 A;  4LF9 M;  1UFZ A;  1XMO M;  1X37 A;  3W0F A;  3EIE A;  1JR3 D;  3LVV A;  2ZM6 M;  2ZTD A;  3BBZ A;  3ILK A;  2JY7 A;  3C3D A;  3HWS A;  3KDS E;  4FWG A;  5KO3 A;  2DWN A;  3MJ5 A;  3KOZ E;  3BXW A;  2LTU A;  3KSJ A;  3K2L A;  2DEN A;  3ZC7 B;  2C96 A;  4IJF A;  2QEN A;  1Z6T A;  4LJ7 A;  1GJS A;  4X65 M;  5EQT A;  3R8F A;  1R2Y A;  1T43 A;  1J7K A;  4DV3 M;  2C99 A;  1ZMU A;  2LVA A;  3LQR A;  1ZV1 A;  2OQ4 A;  5FTJ A;  1AUA A;  3I4V A;  2VDB B;  3HKP A;  4B08 A;  3HHX A;  2Y21 A;  2RKO A;  4LJ8 A;  3I01 M;  2XZF A;  2L7I A;  3GRU A;  2R4J A;  1Q3C A;  2RGH A;  1T3T A;  3TQS A;  4LGY A;  4BBA A;  1W5S A;  3H4J A;  1HJP A;  2L4E A;  4L16 A;  3TWK A;  3K1J A;  3U6C A;  4LY6 A;  3RE8 A;  1E9R A;  1IY1 A;  3L28 A;  1IN4 A;  4M0W A;  4DR2 M;  2CWB A;  4MGI E;  4M9Z A;  1VEJ A;  2F5N A;  3GQ4 A;  4KLN A;  3GLG A;  3HU3 A;  5FTK A;  3K9P A;  4GHL A;  1AIP C;  1Q39 A;  5KPT A;  4JI2 M;  2FS1 A;  4GEW A;  4I5S A;  2BJW A;  3GRV A;  4MB7 A;  5IZ7 D;  2Q2E B;  1V33 A;  1HNX M;  2M60 A;  3NBI A;  1OAI A;  3GLH A;  4GIT A;  3UK6 A;  2DWM A;  4LCB A;  4JI5 M;  4DV6 M;  4AZF A;  2O25 A;  4QNM A;  4Z8X A;  4YHH M;  1PRB A;  2MRO B;  3H4M A;  5LMN M;  1XB2 B;  3LCU A;  1OFI A;  2O01 F;  1HNZ M;  3GLG E;  3QAU A;  4QOZ C;  3UMM A;  2G8L A;  2VII A;  3A42 A;  1SXJ B;  2CHG A;  3GO8 A;  5E26 A;  4LF7 M;  3HGI A;  5FTM A;  1L2B A;  4MM3 B;  4RF1 A;  1HNW M;  1VDD A;  4KHP M;  3Q8G A;  4HEO A;  4P16 A;  5FSW A;  5FLX S;  1D2N A;  3GPP A;  5ITQ A;  4X64 M;  2Z3X A;  2ERC A;  1NV9 A;  2JZ1 A;  1TF0 B;  4MGY E;  3SAU A;  3KS4 A;  4F2L A;  1J5E M;  1NO1 A;  3HZJ A;  3SAW A;  2RGO A;  3IHP A;  4REZ A;  1WIV A;  3GPU A;  2EKK A;  3L26 A;  1HQY E;  5ITT A;  4ITQ A;  3D8B A;  5GKN A;  3SAV A;  1GL7 A;  2DKL A;  2B3T A;  2QNJ A;  3FTE A;  1R7R A;  3SMS A;  4FD2 A;  5EXS A;  1NHW C;  1QZM A;  3QYB A;  1DGB A;  2XLJ A;  5EXP A;  1I4W A;  2G3Q A;  5F3W A;  3AL0 C;  3LQQ A;  4BB9 A;  1EE8 A;  2KRK A;  3U5Z A;  1IBL M;  4GKK M;  2FE8 A;  3TL4 X;  3CF6 E;  2KZS A;  1R5L A;  4LJ9 A;  3U61 B;  3VKH A;  3L25 A;  4CIS A;  1IXS A;  4M9X A;  3J7A S;  4DV1 M;  3U6S A;  3SAR A;  2FH0 A;  2F4V M;  4R7G A;  2CEA A;  3GP1 A;  2DAG A;  3FUT A;  4WP2 A;  4XGI A;  4PDG A;  5ITX E;  4L78 A;  2K0B X;  1IN5 A;  3GLH E;  1NNJ A;  1MN3 A;  4GH9 A;  2DXI A;  3OTO M;  1Q02 A;  1QAN A;  4MGH A;  1GKI A;  1GAB A;  2LHG A;  4G4Q A;  3UZU A;  4KOD A;  1TDZ A;  1IXZ A;  1CUK A;  1Z5B A;  2C9C A;  3I4Y A;  3QWL A;  5DYI A;  4JYA M;  3CF0 A;  3HX3 A;  3U6E A;  1JR3 A;  3VDP A;  3FYD A;  3KFU G;  1XXH E;  1C7Y A;  4FWH A;  1WXQ A;  1SXJ E;  4FW9 A;  3RGS A;  1P3Q Q;  5EP4 A;  5C18 A;  1L8Q A;  4LFB M;  1GLN A;  2OOA A;  5EP2 A;  2V1U A;  4AI6 A;  1PJS A;  4W5W A;  2ZAN A;  3NBX X;  3VK7 A;  1N36 M;  2X8A A;  4PDI A;  2Z8Y M;  4NC6 A;  2D7H A;  4Y28 F;  3T1H M;  2HWJ A;  4X66 M;  2L4F A;  3ZH9 B;  4M0D A;  2Z4R A;  2EKF A;  3IEC A;  1TGU A;  1SXJ A;  2LH0 A;  2QP9 X;  4OVZ B;  3CGW A;  2QPA A;  2KXE A;  4JI4 M;  4CJ6 A;  1TH3 A;  2BNK A;  2XFS A;  4K0K M;  1KFV A;  3KP1 E;  1EIJ A;  4ANR A;  3U6O A;  1IN6 A;  1QUS A;  1NY6 A;  5IRE B;  4OW0 A;  1MJG M;  2FOI C;  1N75 A;  3AOE C;  1WGN A;  3HY5 A;  5EXT A;  2C5R A;  1MX0 A;  4NRW A;  5JI2 E;  1IBM M;  1JQJ C;  3J80 S;  4L15 A;  1GJT A;  3L27 A;  3BOS A;  2KNA A;  1QUT A;  4HLQ A;  1D0M A;  4DV0 M;  1HT2 E;  2DAE A;  2DZL A;  4B3R M;  4LRS A;  1I94 M;  2UUC M;  5DFL A;  1J09 A;  4JI0 M;  1OKS A;  2WSE F;  4PT5 A;  1G71 A;  4IIW A;  3W0L B;  3T15 A;  3U6D A;  2VF7 A;  3MK6 A;  4KO8 A;  3KXE C;  4AG5 A;  5H37 D;  2ZAO A;  1ZMV A;  5DNY A;  2R6F A;  2JZ0 A;  3M0E A;  1K3W A;  4NSR A;  2XZU A;  1XMQ M;  5KQ8 A;  4OVZ A;  2ZBK B;  4II7 A;  1C1K A;  1LTM A;  4AQY M;  2QQ8 A;  1IXS B;  3ZCB B;  2F5Q A;  5ITR A;  2VQF M;  3DFZ A;  1SXJ C;  2XEP A;  4JI1 M;  3TWL A;  4AW4 A;  5FTL A;  1N34 M;  3RFW A;  1D0K A;  4LGM A;  4QHT A;  4OX9 M;  2XSZ D;  4NXN M;  3CTW B;  3GRY A;  3V76 A;  3JR5 A;  1PGY A;  4AG6 A;  1GL6 A;  4LJ6 A;  1OAO C;  2OOB A;  3E4R A;  3K8Z A;  4G4N A;  1IM2 A;  3PVS A;  5E6J A;  4LJ4 A;  5IWA M;  3AKZ A;  1K3X A;  1PJQ A;  2R18 A;  5ITX A;  4CIZ A;  4PD2 A;  3AJI B;  4DBG B;  3GLF B;  4R71 A;  3GPX A;  3FRI A;  4G4R A;  2OO9 A;  2CV0 A;  1OTR A;  2QBY A;  1ORY B;  1YE9 A;  2FNA A;  2XGN A;  2CRU A;  1PJI A;  1XXH B;  2D7G A;  3CF2 A;  2LVQ D;  1K82 A;  3M7G A;  1VQ1 A;  3C3E A;  1DGH A;  1QAO A;  2KDL A;  4PCZ A;  3GLF E;  2R62 A;  3E46 A;  3B7N A;  4IBF A;  3VKG A;  2H5X A;  3FTD A;  2HKJ A;  2R45 A;  2R0I A;  3U61 A;  1DO2 A;  2N35 A;  4BLC A;  4XK8 F;  2DNA A;  3VFD A;  3GLH B;  1QAM A;  2LVN C;  3L2A A;  4FWD A;  4QOS A;  3C9P A;  2KZU A;  4GC5 A;  3AFH A;  4IBC A;  2UXD M;  2DWL A;  2YFQ A;  3UJN A;  2LVP C;  2XFT A;  2GNO A;  3FKE A;  4JXJ A;  1FNN A;  1S3S A;  3E9S A;  1YLA A;  3EIH A;  1IBK M;  4IJE A;  5ITY A;  4A3V B;  4DR5 M;  3C58 A;  3U6P A;  1N78 A;  2JUJ A;  2A5Y B;  2V6Z M;  2WSF F;  3J2P B;  1R2Z A;  7CAT A;  3J7B A;  4NOO B;  2BJV A;  2CHQ A;  2CP8 A;  2BWE A;  1SG9 A;  1YSY A;  2APL A;  2Y0T A;  2Z7J A;  3TWM A;  1NY5 A;  2L2D A;  5DYG A;  1G8P A;  4JI7 M;  3GRR A; 
#chains in the Genus database with same CATH homology
 1HQC A;  2P5T A;  3FTC A;  4WUR A;  4JI3 M;  4JI6 M;  1Q3B A;  2KA6 B;  3GLI A;  1KSF X;  4JI8 M;  2R65 A;  3MHV C;  2CFO A;  4DR4 M;  5BR8 M;  4DR1 M;  4AKH A;  3HU2 A;  3KW6 A;  1IY2 A;  1DGH B;  4GIP A;  1H6U A;  4GRI A;  4JN6 A;  4Z6Y A;  3SFZ A;  3UGJ A;  1E9S A;  3JAM S;  3IG5 A;  3VDU A;  3HU1 A;  2DZN B;  3K92 A;  3T1Y M;  3SMP A;  2AHM A;  2CV2 A;  4ZPX A;  3TPZ A;  4CGY B;  1OJL A;  4LF8 M;  2XF3 A;  3A98 B;  3FD9 A;  2QZ4 A;  4NRV A;  3GQ5 A;  4R3D A;  4DUZ M;  1UM8 A;  4DV2 M;  1ZQ9 A;  3VK8 A;  1GVN A;  2Y0Q A;  4NSO B;  5BPV A;  4G6Z A;  5IT9 S;  4NL4 H;  2R46 A;  2KRU A;  3GLF A;  5FTN A;  5EJC A;  4LF5 M;  2HHH M;  4IBJ A;  4MGK E;  4LZJ A;  4OU7 A;  3FUX A;  2DZO B;  4L4U A;  3GLI B;  2YQZ A;  4GC9 A;  1HT1 E;  3VLF B;  1NVM A;  2OPF A;  3PNY A;  2G5G X;  1QYR A;  4FCT A;  1DO0 A;  3GLG B;  4D81 A;  2J7N A;  3KVW A;  2H1R A;  4GKJ M;  2ZAM A;  4B3S M;  4HL4 A;  1XWI A;  2I7N A;  3AOG A;  5A2Q S;  2X4A A;  2VQE M;  2CUZ A;  1R6B X;  2HCB A;  4X62 M;  4FCW A;  4AKI A;  3SAS A;  1IQP A;  3U60 A;  3HJQ A;  3HHW A;  5JI3 E;  3KOX E;  2HL7 A;  1TH4 A;  2K47 A;  3PNV A;  4CHT B;  2L6O A;  3HJ8 A;  5EP3 A;  3KOW E;  2F5S A;  1L1Z A;  4B3T M;  4TUW A;  5LMU M;  4LG2 A;  2CV1 A;  4IBE A;  3SC3 A;  4G4O A;  4RF0 A;  3U6M A;  2O5R A;  1XNR M;  1W5T A;  1DGF A;  2XSZ A;  1XNQ M;  5EXX A;  1IN8 A;  3PXG A;  4YY3 M;  2UXC M;  4IBI A;  4DUY M;  1DGG A;  1YUB A;  1TDH A;  4M9S A;  3A45 A;  2UU9 M;  1PJJ A;  4B3M M;  4MGZ E;  2D7E A;  1Z5C A;  4IBB A;  3D8L A;  1PM5 A;  1QQW A;  1G41 A;  2KW0 A;  3FUU A;  3SHF A;  2I7P A;  4S12 A;  1LV7 A;  2J7O A;  4IBG A;  4B7G A;  3T38 A;  2UUB M;  3U6L A;  4LJA A;  4DR6 M;  1N33 M;  4NXM M;  3FUV A;  4B7F A;  5EP1 A;  4D82 A;  1N77 A;  4I8O A;  1NSF A;  4WW0 A;  1L2D A;  1XHB A;  2L7H A;  3KP0 E;  2EA0 A;  1XC8 A;  4LF4 M;  2DHR A;  2FFJ A;  1XXH A;  2Z4S A;  1G59 A;  3FTF A;  2KEB A;  3B9P A;  4LJ5 A;  2YR0 A;  4FCV A;  2E5L M;  1IY0 A;  1KYI A;  1NJG A;  4I4L A;  1N32 M;  3HHY A;  4FVM A;  2DVW B;  5KPZ A;  1IN7 A;  3SHG B;  1ZAE A;  3RGP A;  4DV4 M;  3IG8 A;  3M6A A;  2X49 A;  3PFI A;  1L1T A;  3WHL A;  3KSX A;  2F5O A;  2M5Z A;  2Y20 A;  1G3I A;  2CE7 A;  1E32 A;  3JR4 A;  2R4E A;  3AOE A;  4LZZ A;  4QNR A;  3GQ3 A;  3KS8 A;  4LFA M;  3DZD A;  3WHK A;  1FJG M;  4L8R C;  5KPR A;  2LNH C;  1Z59 A;  4DV7 M;  4GHA A;  3NWL A;  1QVR A;  4DR3 M;  3J81 S;  1MU5 A;  1NHG C;  3AV0 A;  2EO2 A;  3FUW A;  3U60 B;  4DR7 M;  4XBO A;  3TE6 A;  2W82 A;  1IXR C;  1OFH A;  1HR0 M;  1QAQ A;  2JA2 A;  2V1C A;  3SBJ A;  4RNA A;  3A46 A;  5C1B A;  3LVW A;  2NQ8 C;  3U5Z B;  5ITU A;  3Q8X A;  1E94 E;  2L09 A;  1TH2 A;  2XH9 A;  3U6Q A;  2EUC A;  3GPY A;  1NNU C;  2UUA M;  3DA1 A;  4I81 A;  1Z5A A;  1G4A E;  3R9X B;  2F5P A;  4AKG A;  3SYK A;  8CAT A;  3FYC A;  3KOY E;  4IBD A;  2UXB M;  3J27 B;  3I51 A;  4LFC M;  1L2C A;  2C98 A;  3HJS A;  4LF6 M;  4JV5 M;  1SXJ D;  4MH0 E;  1NJF A;  4QHS A;  4EIW A;  3HHZ A;  2C9O A;  3LMM A;  2QBY B;  5KQD A;  2QCU A;  2LWX A;  3THG A;  4LRT A;  3SAT A;  3DOA A;  3L29 A;  4IBK A;  2CHV A;  4GMQ A;  2YNM D;  3SYL A;  2DWZ B;  2LXE A;  4DV5 M;  4B7H A;  4D80 A;  4LF9 M;  1XMO M;  1X37 A;  3W0F A;  3EIE A;  1JR3 D;  3LVV A;  2ZM6 M;  5KO3 A;  3ILK A;  3HWS A;  2DWN A;  3KDS E;  4FWG A;  3MJ5 A;  3KOZ E;  3KSJ A;  3K2L A;  3ZC7 B;  2C96 A;  4IJF A;  2QEN A;  1Z6T A;  4LJ7 A;  4X65 M;  5EQT A;  3R8F A;  1R2Y A;  1J7K A;  4DV3 M;  2C99 A;  3LQR A;  2OQ4 A;  5FTJ A;  4B08 A;  3I4V A;  3HKP A;  3HHX A;  2Y21 A;  2RKO A;  4LJ8 A;  2XZF A;  2L7I A;  3GRU A;  2R4J A;  1Q3C A;  2RGH A;  1T3T A;  3TQS A;  4LGY A;  4BBA A;  1W5S A;  3TWK A;  4L16 A;  3K1J A;  3U6C A;  4LY6 A;  3RE8 A;  1E9R A;  1IY1 A;  3L28 A;  1IN4 A;  4M0W A;  4DR2 M;  4MGI E;  4M9Z A;  2F5N A;  3GQ4 A;  4KLN A;  3GLG A;  3HU3 A;  5FTK A;  4GHL A;  1Q39 A;  5KPT A;  4JI2 M;  4I5S A;  2BJW A;  3GRV A;  4MB7 A;  5IZ7 D;  2Q2E B;  1HNX M;  2M60 A;  3NBI A;  3GLH A;  4GIT A;  3UK6 A;  2DWM A;  4LCB A;  4JI5 M;  4DV6 M;  4AZF A;  4QNM A;  4Z8X A;  4YHH M;  3H4M A;  5LMN M;  1OFI A;  1HNZ M;  3QAU A;  4QOZ C;  3UMM A;  2G8L A;  2VII A;  3A42 A;  1SXJ B;  2CHG A;  3GO8 A;  5E26 A;  4LF7 M;  3HGI A;  5FTM A;  1L2B A;  4MM3 B;  4RF1 A;  1HNW M;  1VDD A;  4KHP M;  4P16 A;  5FSW A;  5FLX S;  1D2N A;  3GPP A;  5ITQ A;  4X64 M;  2Z3X A;  2ERC A;  4MGY E;  3SAU A;  3KS4 A;  1J5E M;  3SAW A;  2RGO A;  3GPU A;  4REZ A;  3L26 A;  1HQY E;  5ITT A;  4ITQ A;  3D8B A;  5GKN A;  3SAV A;  1GL7 A;  3FTE A;  1R7R A;  3SMS A;  4FD2 A;  5EXS A;  1NHW C;  1QZM A;  1DGB A;  2XLJ A;  5EXP A;  1I4W A;  5F3W A;  3AL0 C;  3LQQ A;  4BB9 A;  1EE8 A;  2KRK A;  3U5Z A;  1IBL M;  4GKK M;  2FE8 A;  3TL4 X;  3CF6 E;  2KZS A;  4LJ9 A;  3U61 B;  3VKH A;  3L25 A;  4CIS A;  4M9X A;  3J7A S;  4DV1 M;  3U6S A;  3SAR A;  2F4V M;  4R7G A;  2CEA A;  3GP1 A;  4XGI A;  3FUT A;  4PDG A;  5ITX E;  4L78 A;  1NNJ A;  1IN5 A;  4GH9 A;  2DXI A;  3OTO M;  1QAN A;  4MGH A;  1GKI A;  4G4Q A;  3UZU A;  4KOD A;  1TDZ A;  1IXZ A;  1Z5B A;  2C9C A;  3I4Y A;  3QWL A;  5DYI A;  4JYA M;  3CF0 A;  3U6E A;  1JR3 A;  3VDP A;  3FYD A;  3KFU G;  4FWH A;  1WXQ A;  1SXJ E;  4FW9 A;  3RGS A;  5EP4 A;  5C18 A;  1L8Q A;  4LFB M;  1GLN A;  5EP2 A;  2V1U A;  4AI6 A;  4W5W A;  2ZAN A;  3VK7 A;  1N36 M;  2X8A A;  4PDI A;  2D7H A;  3T1H M;  4X66 M;  3ZH9 B;  4M0D A;  2Z4R A;  1TGU A;  1SXJ A;  2LH0 A;  2QP9 X;  4OVZ B;  2QPA A;  2KXE A;  4JI4 M;  1TH3 A;  2BNK A;  2XFS A;  4K0K M;  1KFV A;  3KP1 E;  3U6O A;  1IN6 A;  1NY6 A;  5IRE B;  4OW0 A;  2FOI C;  1N75 A;  3AOE C;  5EXT A;  2C5R A;  1MX0 A;  4NRW A;  5JI2 E;  1IBM M;  1JQJ C;  3J80 S;  4L15 A;  3L27 A;  3BOS A;  4HLQ A;  4DV0 M;  1HT2 E;  4B3R M;  4LRS A;  1I94 M;  2UUC M;  1J09 A;  4JI0 M;  4PT5 A;  4IIW A;  3W0L B;  3T15 A;  3U6D A;  3MK6 A;  4KO8 A;  3KXE C;  4AG5 A;  5H37 D;  2ZAO A;  5DNY A;  3M0E A;  1K3W A;  4NSR A;  2XZU A;  1XMQ M;  5KQ8 A;  4OVZ A;  2ZBK B;  4II7 A;  1C1K A;  2F5Q A;  4AQY M;  1IXS B;  3ZCB B;  5ITR A;  2VQF M;  3DFZ A;  1SXJ C;  2XEP A;  4JI1 M;  3TWL A;  4AW4 A;  5FTL A;  1N34 M;  3RFW A;  4LGM A;  4QHT A;  4OX9 M;  4NXN M;  3CTW B;  3GRY A;  3JR5 A;  4AG6 A;  1GL6 A;  4LJ6 A;  4G4N A;  3E4R A;  3K8Z A;  1IM2 A;  3PVS A;  5E6J A;  4LJ4 A;  5IWA M;  3AKZ A;  1K3X A;  2R18 A;  5ITX A;  4PD2 A;  3AJI B;  3GLF B;  3GPX A;  4G4R A;  2CV0 A;  2QBY A;  1ORY B;  1YE9 A;  2FNA A;  2XGN A;  1PJI A;  1XXH B;  2D7G A;  3CF2 A;  1K82 A;  3M7G A;  1QAO A;  1DGH A;  4PCZ A;  2R62 A;  4IBF A;  3VKG A;  3FTD A;  2HKJ A;  2R45 A;  3U61 A;  1DO2 A;  4BLC A;  3VFD A;  3GLH B;  1QAM A;  3L2A A;  4FWD A;  4QOS A;  2KZU A;  4GC5 A;  3AFH A;  4IBC A;  2UXD M;  2DWL A;  2YFQ A;  3UJN A;  2XFT A;  3FKE A;  4JXJ A;  1FNN A;  1S3S A;  3E9S A;  3EIH A;  1IBK M;  4IJE A;  5ITY A;  4A3V B;  4DR5 M;  3C58 A;  3U6P A;  1N78 A;  2A5Y B;  2V6Z M;  3J2P B;  1R2Z A;  7CAT A;  3J7B A;  4NOO B;  2BJV A;  2CHQ A;  2Z7J A;  1YSY A;  2Y0T A;  3TWM A;  1NY5 A;  2XSZ D;  5DYG A;  1G8P A;  4JI7 M;  3GRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...