3KW6A

Crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
b'PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S protease regulatory subunit 8
publication title Crystal Structure of a domain of 26S proteasome regulatory subunit 8 from homo sapiens. Northeast Structural Genomics Consortium target id HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kw6A01
3M6AA 4D81A 5EP1A 2DHRA 1NJGA 2C96A 4FCWA 1JR3D 1OFHA 2KRKA 4FD2A 2QPAA 3WHLA 1XWIA 4ZPXA 4L16A 5C1BA 2DVWB 3GLGA 2CEAA 3B9PA 1W5TA 4FWHA 2DWZB 3CF0A 1SXJA 4FCVA 4LGMA 1L8QA 1SXJD 1G41A 3HWSA 2QENA 5DYIA 1SXJE 3GLGB 4D80A 3MHVC 2VIIA 1S3SA 1SXJB 4JN6A 4LJAA 3AJIB 1NSFA 4LJ8A 3GLIA 3CF2A 2DZNB 1DO0A 3GLFA 1IN7A 2X8AA 3H4MA 2C9OA 3HU3A 3GLFB 1JR3A 1KYIA 2RKOA 4KLNA 1NY6A 2ZANA 1IY2A 1X37A 1J7KA 2BJWA 1NJFA 3WHKA 2C99A 5JI2E 4L4UA 2HCBA 1IQPA 1E94E 2ZAMA 4KODA 1JQJC 1D2NA 3KW6A 4LJ9A 4LZZA 4Z8XA 5EQTA 1HT2E 2ZAOA 4FCTA 3HU2A 2CHQA 1XXHB 3GLHB 4QHSA 4FW9A 4I81A 4LRSA 2V1UA 4D82A 1HT1E 2CHVA 1OFIA 2Z4SA 5EXSA 4GITA 3SYKA 1IN6A 3D8BA 4LCBA 1G4AE 2XSZA 3VFDA 1QVRA 4EIWA 2XSZD 5EP4A 3U60B 3EIEA 1IXRC 1LV7A 3ZH9B 2QP9X 1QZMA 2R65A 2C9CA 2FNAA 4LJ7A 1IN8A 3GLHA 1XXHA 2CE7A 1HQCA 5FTJA 1HQYE 4FWDA 3KDSE 2QZ4A 1DO2A 3HU1A 2V6ZM 2QBYA 1IXSB 1UM8A 3DZDA 3PVSA 2Z4RA 4LJ6A 5EP3A 5C18A 3PXGA 2BJVA 1OJLA 3EIHA 1KSFX 5DYGA 3R8FA 2R62A 3K1JA 5EXTA 2QBYB 3SC3A 3BOSA 1IY1A 1IN5A 5JI3E 5FTNA 5FTKA 3PFIA 1NVMA 4QHTA 2DZOB 4LY6A 4A3VB 4KO8A 3VLFB 3SYLA 1IY0A 3U61B 5EP2A 1IM2A 3U5ZB 4QOSA 3UK6A 1R7RA 2C98A 4L15A 5FTLA 4LJ4A 2CHGA 4I4LA 1NY5A 4LRTA 1R6BX 4WW0A 1IXZA 1C1KA 1IN4A 1W5SA 3M0EA 1E32A 4QNRA 1FNNA 5EXPA 4LJ5A 1SXJC 4QNMA 1G3IA 4FWGA 5EXXA 5FTMA 3GLIB
chains in the Genus database with same CATH superfamily
5KO3A 1T6OA 2O25A 4OVZA 4DR5M 4AKIA 1NJGA 1JR3D 1N77A 1T3TA 4M9SA 4DV1M 2R6FA 3IHPA 4I8OA 4OW0A 4RNAA 3KOXE 1XWIA 2YR0A 4ZPXA 2DWLA 2XEPA 3AFHA 1HR0M 3B9PA 1OKSA 4DBGB 1XNQM 4CHTB 1P3QQ 2JZ1A 2UXDM 1F4IA 3FUWA 1NV9A 4QOZC 2QENA 3BBZA 5DYIA 1UFZA 4MGIE 1BVSA 3J7BA 2FOIC 4NOOB 3SAWA 3HJQA 4JN6A 1K82A 4LJAA 3K2LA 1ZMVA 2DZNB 1D0KA 2Z7JA 3PNYA 3GLIE 3THGA 3H4MA 5BR8M 2ZTDA 5IWAM 2C9OA 4KHPM 4D80A 1YE9A 2K47A 1JR3A 1Z5CA 1R5LA 2R4EA 1ZQ9A 2XFTA 4KLNA 1IY2A 2I7NA 4KT0F 1VDLA 2XZFA 2D7HA 3AOGA 1QAOA 2F5SA 3UMMA 1JB0F 4KODA 4DV2M 3JR4A 3HHXA 3GLGE 4IBBA 1XXHB 4IBKA 2MH8A 4I81A 2L7HA 2D7EA 3U6LA 4D82A 4YHHM 4XK8F 3SYKA 1NO1A 3D8BA 4X66M 1G4AE 4JI4M 4LG2A 3U60B 2OOBA 2XSZD 4B3TM 4OX9M 1WR1B 2JA2A 3LMMA 4HLQA 1QZMA 3FYCA 4II7A 2DENA 3J80S 3GQ4A 4DV3M 1MN3A 3GLHA 3HX3A 5L8RF 4IBGA 2DWMA 3HHZA 3VK8A 4DR6M 2MR9A 2KA6B 3I4YA 3K9PA 3KDSE 2EKKA 3L26A 1XB2B 3HU1A 2V6ZM 4F2LA 1Z6TA 5H37D 1OTRA 1OAIA 3FD9A 2HAKA 2CV2A 3T15A 3FTEA 3VK7A 4DV0M 2RGOA 2KRUA 5DYGA 1QDTA 2LBCA 2R62A 4HL4A 3W67A 1VG5A 1PM5A 3I01M 3BOSA 1J09A 4JI1M 2JXNA 1WIVA 3PFIA 1WGNA 3TQSA 5A2QS 4AKHA 2K6BA 3KP0E 4X64M 2DZOB 3I4VA 2UUAM 4OVZB 1VQ1A 5ITYA 3ZCBB 3IECA 2LHCA 2DWNA 4LFCM 3GRVA 4GKKM 4NRWA 3RFWA 5FTLA 2WSEF 3A46A 2OPFA 3C3EA 3KS4A 2I7PA 1C1KA 2EA0A 3C3DA 1QDRA 2CWBA 3E46A 3ILKA 4DR1M 4DUYM 1YSYA 1I94M 3SBJA 4QNMA 4B3RM 1G3IA 2ZM6M 5EXXA 3E9SA 1PRBA 1QQWA 4D81A 2NQ8C 2BNKA 2C96A 4K0KM 4FCWA 3U61A 4PCZA 3U5ZA 2VDBB 1L2BA 3KS8A 4WP2A 3WHLA 4PDGA 2VQEM 1TR8A 4MGHA 3LCVB 3GLGA 1PJQA 2CEAA 2O01F 3CF0A 1SXJA 2QSFX 4FCVA 1L8QA 3LVVA 5ITQA 1I4WA 1G41A 1C7YA 4LF7M 3U6EA 3I04M 2YNMD 3C58A 1TDZA 1R4GA 2DI0A 3B89A 2G3QA 4JI0M 3K9OA 4PDIA 4OU7A 4JI7M 1GL6A 5ITXE 4RF0A 4DV5M 3CF2A 4ITQA 2X8AA 4CJ6A 1TGUA 3FUUA 2EUCA 4DR2M 3KOWE 2Z8YM 4YY3M 3GLFE 4AZFA 2R46A 1VEKA 2DHYA 4IBEA 3GLFB 1IBKM 2DKLA 4GH9A 4GKJM 2KZSA 1EFUB 1FJGM 1J7KA 3WHKA 3HHYA 5JI2E 4L4UA 1OQYA 3T1HM 3RGPA 1DGHA 4AG6A 3GQ5A 1JQJC 1SG9A 2BWBA 3HKPA 3TE6A 3IG8A 1IBLM 1IBMM 2ZAOA 4AW4A 3GLHB 1WJ7A 4XBOA 2DAEA 2G5GX 2DNAA 2CHVA 2JZ0A 2WZJA 1IFYA 2DAMA 1WXQA 2QNJA 4GITA 1RU3A 3Q8GA 3GPPA 3VFDA 3KXEC 4AQYM 2CV0A 1LV7A 3ZH9B 4P16A 2YQZA 4DR7M 1EE8A 1YUBA 2JY6B 3GRUA 2KNVA 1TF0B 2EJSA 4GC9A 4G4RA 4LFAM 4RKUF 3UJNA 4LJ7A 3HJSA 4L78A 3TWLA 3SAVA 4JXJA 1IXSA 2JWSA 1HQCA 5FLXS 4MGZE 5FTJA 1GO5A 1XXHE 4FWDA 4Y28F 3HY5A 3LCUA 2QQ8A 2UXBM 2KHHA 3KSXA 1DO2A 1Q3CA 1OIPA 1T43A 2DAKA 3CF6E 1UM8A 4G3OA 3DZDA 4M0WA 4RF1A 1L1TA 3PVSA 1XMQM 2HWJA 4LJ6A 5EP3A 1KSFX 1HNXM 3R8FA 2QBYB 1N34M 3SC3A 1DV0A 4X62M 2UXCM 1PGYA 5FTNA 1YLAA 2EO2A 2X4AA 5IZ7D 4L6V6 1Z5AA 3KSJA 2LHGA 2MROB 3SYLA 3LW5F 3U61B 5EP2A 1IM2A 2J7OA 3U5ZB 4LF8M 2A5YB 3W0LB 4GHAA 2L4FA 2Y0TA 4LZJA 2LVAA 1XHBA 1NY5A 4LRTA 3L25A 3TWMA 1N78A 3LQRA 2KNAA 2CFOA 4WW0A 4NC6A 7CATA 1XNRM 2Y21A 4X65M 2EKFA 4AI6A 1ZV1A 1E32A 4QNRA 4HEOA 2HHHM 1SXJC 3SAUA 1WHCA 4FWGA 4NXMM 1V33A 2XGNA 3E21A 3L2AA 1LTMA 1TTEA 2O5RA 5DNYA 5EP1A 2DHRA 1N75A 4MM3B 2KRKA 4FD2A 2QPAA 4PD2A 2L7IA 2KXEA 1PJSA 1PJIA 5C1BA 2WSCF 4BBAA 2DVWB 4W5WA 2LWXA 2KW0A 1GVNA 3FTCA 2B3TA 4S12A 4LGMA 4GC5A 1SXJD 2R4JA 3HWSA 4MB7A 2MGWA 1DGHB 2W82A 2KEBA 3CGWA 3MHVC 4B7FA 1TH4A 1S3SA 4GIPA 3TWKA 1Q39A 1H6UA 2VF7A 3AJIB 1NSFA 4LJ8A 3FTDA 3GLIA 1G71A 3K8ZA 4G4OA 1DO0A 3FUVA 4G4QA 3J81S 1N36M 3U6SA 2F5OA 2LVOC 1AUAA 1ZAEA 5ITUA 3HU3A 3GPXA 3A42A 1QANA 2RKOA 3MK6A 3NBXX 1NY6A 3IG5A 5GKNA 1JR3E 3HHWA 2K0BX 3KVWA 5IT9S 1WGLA 3L27A 1IQPA 2ZAMA 4LZZA 3KW6A 5EQTA 1HT2E 3GP1A 1ZMUA 1MX0A 3HU2A 2K9DA 4FCTA 2F5PA 3LQQA 4GHLA 2GQFA 5KPTA 2KZUA 1N33M 4FW9A 2Z3XA 1V92A 3AV0A 1GJTA 4I5SA 5BPVA 4LRSA 2OOAA 4F1IA 1R2ZA 2P5TA 3D8LA 1OFIA 4DV6M 2Z4SA 4WURA 3A45A 4Z6YA 3HGIA 4PT5A 4LCBA 1QVRA 4IIWA 2CUZA 5EP4A 3EIEA 3VDPA 1IXRC 3U6DA 2QP9X 4L8RC 4AKGA 1VEJA 3FRIA 3W0FA 2LVPC 2H1RA 2R65A 1G8PA 3RE8A 2JUJA 2C9CA 1QAMA 1IN8A 1Z5BA 3F92A 1NNJA 2N35A 2CE7A 3NWLA 3QYEA 5F3WA 1HNZM 3T38A 3GLHE 2M5ZA 3U6QA 4IJFA 4IBJA 3B7NA 1NV8A 1E9SA 2R44A 3TPZA 5E6JA 1E9RA 1DGFA 5C18A 3PXGA 5KPZA 1OJLA 1OIZA 4JI8M 3DOAA 5EXTA 3K92A 4GMQA 4M9XA 1Z59A 5JI3E 2QHOB 1HJPA 4DUZM 1NVMA 3B7ZA 3OTOM 2UUCM 3VKGA 4GRIA 3T1YM 4LY6A 4KO8A 3VLFB 1GJSA 3FRHA 1IY0A 1DGBA 4G4NA 2BWEA 5KQDA 2OO9A 3UK6A 3T6PA 1R7RA 2FH0A 4B7GA 2FS1A 3KFUG 4LFBM 4LJ4A 3KP1E 4I4LA 4DV7M 3RGSA 2CRUA 1NHWC 1R6BX 1IN4A 2G8LA 4BLCA 3GPUA 4MGKE 2AHMA 1L2DA 3J7AS 2RGHA 4TUWA 3FUXA 3JR5A 1Q3BA 2FFJA 4FVMA 3VKHA 4CIZA 3JAMS 4LJ5A 2F4VM 4DR4M 4B3SM 1KFVA 3UGJA 4JV5M 2H5XA 1XC8A 1DGGA 1TH2A 3GLIB 3J2PB 2C5RA 3M6AA 4CGYB 2DXIA 4LGYA 1OFHA 3AOEC 2Q2EB 2RRUA 3HJ8A 4GEWA 4P17A 2JY8A 4L16A 2L09A 3MJ5A 2MJ5B 1W5TA 1QZEA 1Q02A 4REZA 4DR3M 4FWHA 3DFZA 2DWZB 4JI5M 4B08A 3GRRA 3A98B 3I51A 2M60A 4M9ZA 3UZUA 1SXJE 4BB9A 5FSWA 3GLGB 1XMOM 2R0IA 3CTWB 2JY5A 5ITXA 2FE8A 2ERCA 2LVQD 3FE3A 1GL7A 2VIIA 1SXJB 3QYBA 4UN2B 4IBDA 1J5EM 2F5QA 3L29A 1VDDA 4XGIA 1QAQA 1D0LA 4Q7JA 3GLFA 1IN7A 3AL0C 5IREB 4JI2M 3QAUA 4IBFA 1Y8GA 5KQ8A 1GLNA 1MJGM 4M0DA 3GRYA 2L6OA 3KOZE 1V34A 1G59A 1KYIA 3J27B 4LF9M 2ZANA 1X37A 4IBCA 2VF8A 2BJWA 3SFZA 1QUTA 1NJFA 2L2DA 3VDUA 2C99A 1R2YA 4NL4H 2HCBA 2V1CA 1E94E 2KNZA 3U6CA 1QUSA 1D2NA 4LJ9A 2R45A 4MH0E 2JNHA 4Z8XA 2X49A 4NSOB 4LF4M 2CHQA 4QHSA 4AG5A 3Q8XA 2CV1A 3SARA 1VEGA 3SHFA 3FYDA 3MMPA 2LNHC 2V1UA 2DAGA 3AOEA 1HT1E 4G6ZA 4LF5M 2D7GA 8CATA 4CISA 5EXSA 2UU9M 1IN6A 4LF6M 3BXWA 2XSZA 1ZMWA 3LVWA 4EIWA 3GO8A 1K3WA 2DAIA 2J7NA 5KPRA 2DZLA 2E5LM 3FTFA 3U6PA 3R9XB 4NRVA 1QYRA 1NNUC 3U6MA 1AIPC 1GABA 3NBIA 5EJCA 1CUKA 2L4EA 2FNAA 3TL4X 3C9PA 2YFQA 2XF3A 4JYAM 5LMNM 1GKIA 3SMSA 3E4RA 1XXHA 2JP7A 2HKJA 3KOYE 2LXEA 1HQYE 3DA1A 1ORYB 2QZ4A 4MGYE 2XLJA 1K3XA 2LVNC 5ITRA 3GPYA 2QBYA 4NSRA 1IXSB 3SATA 3M7GA 3AKZA 3SASA 1HNWM 2LH0A 2Z4RA 3SMPA 3U60A 2Y0QA 2BJVA 3FKEA 3EIHA 4JI6M 3HZJA 2APLA 2R18A 2WSFF 3K1JA 4ANRA 1IY1A 1IN5A 2J5YA 2JY7A 4R3DA 4NXNM 3W68A 5FTKA 2VQFM 1NHGC 4IJEA 5LMUM 3L28A 4R71A 3H4JA 4QHTA 4A3VB 2ZTCA 2XFSA 3B7QA 4B3MM 1TDHA 1OAOC 1L2CA 2F5NA 3QWLA 4JI3M 4R7GA 4QOSA 3FUTA 4B7HA 2XH9A 5E26A 1L1ZA 2C98A 2HL7A 4L15A 5DFLA 3GQ3A 2CHGA 2QCUA 3PNVA 3SHGB 3U6OA 1PJJA 2ZBKB 1IXZA 4DV4M 1TH3A 1W5SA 2UUBM 3M0EA 1MU5A 1PJTA 1D0MA 2GNOA 3ZQJA 1EIJA 2LTUA 2Y20A 2CP8A 3ZC7B 3B74A 2KDLA 2XZUA 1A5TA 1N32M 1FNNA 5EXPA 3V76A 5FTMA 2OQ4A 5ITTA 4IBIA
chains in the Genus database with same CATH topology
5KO3A 4OVZA 4DR5M 4AKIA 1NJGA 1JR3D 1N77A 1T3TA 4M9SA 4DV1M 4I8OA 4OW0A 4RNAA 3KOXE 1XWIA 2YR0A 4ZPXA 2DWLA 2XEPA 3AFHA 1HR0M 3B9PA 1XNQM 4CHTB 2UXDM 3FUWA 4QOZC 2QENA 5DYIA 4MGIE 3J7BA 2FOIC 4NOOB 3SAWA 3HJQA 4JN6A 1K82A 4LJAA 3K2LA 2DZNB 2Z7JA 3PNYA 3THGA 3H4MA 5BR8M 5IWAM 2C9OA 4KHPM 1YE9A 2K47A 1JR3A 1Z5CA 4KLNA 2R4EA 1ZQ9A 2XFTA 1IY2A 2I7NA 2XZFA 2D7HA 3AOGA 1QAOA 2F5SA 3UMMA 4KODA 4DV2M 3JR4A 3HHXA 4IBBA 1XXHB 4IBKA 4I81A 2L7HA 2D7EA 3U6LA 4D82A 4YHHM 3SYKA 4X66M 3D8BA 1G4AE 4JI4M 4LG2A 3U60B 2XSZD 4B3TM 4OX9M 2JA2A 3LMMA 4HLQA 1QZMA 3FYCA 4II7A 3J80S 3GQ4A 4DV3M 3GLHA 4IBGA 2DWMA 3HHZA 3VK8A 4DR6M 2KA6B 3I4YA 3KDSE 3L26A 3HU1A 2V6ZM 1Z6TA 5H37D 3FD9A 2CV2A 3FTEA 3VK7A 4DV0M 2RGOA 2KRUA 5DYGA 2R62A 4HL4A 1PM5A 3BOSA 1J09A 4JI1M 4AKHA 3PFIA 5A2QS 3TQSA 3KP0E 4X64M 2DZOB 3I4VA 2UUAM 4OVZB 5ITYA 3ZCBB 2DWNA 4LFCM 3GRVA 4GKKM 4NRWA 3RFWA 5FTLA 3A46A 2OPFA 3KS4A 2I7PA 1C1KA 2EA0A 3ILKA 4DR1M 4DUYM 1YSYA 1I94M 3SBJA 4QNMA 4B3RM 1G3IA 2ZM6M 5EXXA 3E9SA 1QQWA 4D81A 2NQ8C 2BNKA 2C96A 4K0KM 4FCWA 3U61A 4PCZA 3U5ZA 1L2BA 3KS8A 3WHLA 4PDGA 2VQEM 4MGHA 3GLGA 2CEAA 3CF0A 1SXJA 4FCVA 5ITQA 1L8QA 3LVVA 4LF7M 1I4WA 1G41A 3U6EA 2YNMD 3C58A 1TDZA 4JI0M 4PDIA 4OU7A 4JI7M 1GL6A 5ITXE 4RF0A 4DV5M 3CF2A 4ITQA 2X8AA 1TGUA 3FUUA 2EUCA 4DR2M 3KOWE 4YY3M 4AZFA 2R46A 4IBEA 3GLFB 1IBKM 4GKJM 4GH9A 2KZSA 1FJGM 1J7KA 3WHKA 3HHYA 5JI2E 4L4UA 3T1HM 3RGPA 1DGHA 4AG6A 3GQ5A 1JQJC 3TE6A 3HKPA 3IG8A 1IBLM 1IBMM 2ZAOA 4AW4A 3GLHB 4XBOA 2G5GX 2CHVA 4GITA 1WXQA 3GPPA 3VFDA 3KXEC 4AQYM 2CV0A 1LV7A 3ZH9B 4P16A 2YQZA 4DR7M 1EE8A 1YUBA 4GC9A 3GRUA 4G4RA 4LFAM 3UJNA 4LJ7A 3HJSA 4L78A 3TWLA 3SAVA 4JXJA 1HQCA 5FLXS 4MGZE 5FTJA 4FWDA 2UXBM 3KSXA 3T15A 1DO2A 1Q3CA 2HHHM 3CF6E 4RF1A 1UM8A 4M0WA 3DZDA 1L1TA 3PVSA 1XMQM 4LJ6A 5EP3A 1KSFX 1HNXM 3R8FA 2QBYB 1N34M 3SC3A 4X62M 2UXCM 5FTNA 2EO2A 2X4AA 5IZ7D 1Z5AA 3KSJA 3SYLA 3U61B 5EP2A 1IM2A 2J7OA 3U5ZB 4LF8M 2A5YB 3W0LB 4GHAA 2Y0TA 4LZJA 1XHBA 1NY5A 4LRTA 3L25A 3TWMA 1N78A 3LQRA 4WW0A 2CFOA 7CATA 1XNRM 2Y21A 4X65M 4AI6A 1E32A 4QNRA 1SXJC 3SAUA 4FWGA 4NXMM 3L2AA 2XGNA 2O5RA 5DNYA 5EP1A 2DHRA 1N75A 4MM3B 2KRKA 4FD2A 2QPAA 4PD2A 2L7IA 2KXEA 1PJIA 5C1BA 4BBAA 2DVWB 4W5WA 2LWXA 2KW0A 1GVNA 3FTCA 4S12A 4LGMA 4GC5A 1SXJD 2R4JA 3HWSA 4MB7A 1DGHB 2W82A 2KEBA 3MHVC 4B7FA 1TH4A 1S3SA 4GIPA 3TWKA 1Q39A 1H6UA 3AJIB 1NSFA 4LJ8A 3FTDA 3GLIA 4G4OA 3K8ZA 1DO0A 3FUVA 4G4QA 3J81S 1N36M 3U6SA 2F5OA 1ZAEA 5ITUA 3HU3A 3GPXA 3A42A 1QANA 2RKOA 3MK6A 1NY6A 3IG5A 5GKNA 3HHWA 3KVWA 5IT9S 3L27A 1IQPA 2ZAMA 4LZZA 3KW6A 5EQTA 1HT2E 3GP1A 1MX0A 3HU2A 4FCTA 2F5PA 3LQQA 4GHLA 5KPTA 2KZUA 1N33M 4FW9A 2Z3XA 3AV0A 4I5SA 5BPVA 4LRSA 1R2ZA 2P5TA 3D8LA 1OFIA 4DV6M 2Z4SA 4WURA 3A45A 4Z6YA 3HGIA 4PT5A 4LCBA 1QVRA 4IIWA 2CUZA 5EP4A 3EIEA 3VDPA 1IXRC 3U6DA 2QP9X 4L8RC 4AKGA 3W0FA 2H1RA 2R65A 1G8PA 3RE8A 2C9CA 1QAMA 1IN8A 1Z5BA 1NNJA 2CE7A 3NWLA 5F3WA 1HNZM 3T38A 2M5ZA 3U6QA 4IJFA 4IBJA 1E9SA 3TPZA 5E6JA 1E9RA 1DGFA 5C18A 3PXGA 5KPZA 1OJLA 4JI8M 3DOAA 5EXTA 3K92A 4GMQA 4M9XA 1Z59A 5JI3E 4DUZM 1NVMA 3OTOM 2UUCM 3VKGA 4GRIA 3T1YM 4LY6A 4KO8A 3VLFB 1IY0A 1DGBA 4G4NA 5KQDA 3UK6A 1R7RA 4B7GA 3KFUG 4LFBM 4LJ4A 3KP1E 4I4LA 4DV7M 3RGSA 1NHWC 1R6BX 1IN4A 2G8LA 4BLCA 3GPUA 4MGKE 2AHMA 1L2DA 3J7AS 2RGHA 4TUWA 3FUXA 3JR5A 1Q3BA 2FFJA 4FVMA 3VKHA 3JAMS 4LJ5A 2F4VM 4DR4M 4B3SM 1KFVA 3UGJA 4JV5M 1XC8A 1DGGA 1TH2A 3GLIB 3J2PB 2C5RA 3M6AA 4CGYB 2DXIA 4LGYA 1OFHA 3AOEC 2Q2EB 3HJ8A 4L16A 2L09A 3MJ5A 1W5TA 4REZA 4DR3M 4FWHA 3DFZA 2DWZB 4JI5M 4B08A 3GRRA 3A98B 3I51A 2M60A 4M9ZA 3UZUA 1SXJE 3GLGB 1XMOM 5ITXA 3CTWB 4BB9A 4D80A 2FE8A 2ERCA 5FSWA 1GL7A 2VIIA 1SXJB 1J5EM 4IBDA 2F5QA 3L29A 1VDDA 4XGIA 1QAQA 3GLFA 1IN7A 3AL0C 5IREB 4JI2M 3QAUA 4IBFA 5KQ8A 1GLNA 4M0DA 3GRYA 2L6OA 3KOZE 1G59A 1KYIA 3J27B 4LF9M 2ZANA 1X37A 4IBCA 3SFZA 2BJWA 3VDUA 1NJFA 2C99A 1R2YA 4NL4H 2HCBA 2V1CA 1E94E 3U6CA 1D2NA 4LJ9A 2R45A 4MH0E 4Z8XA 2X49A 4NSOB 4LF4M 2CHQA 4QHSA 4AG5A 3Q8XA 2CV1A 3SARA 3SHFA 3FYDA 2LNHC 2V1UA 3AOEA 1HT1E 4G6ZA 4LF5M 2D7GA 8CATA 4CISA 5EXSA 2UU9M 1IN6A 4LF6M 2XSZA 3LVWA 4EIWA 3GO8A 1K3WA 2J7NA 5KPRA 2E5LM 3FTFA 3R9XB 3U6PA 4NRVA 1QYRA 1NNUC 3U6MA 3NBIA 5EJCA 2FNAA 3TL4X 2YFQA 2XF3A 4JYAM 5LMNM 1GKIA 3SMSA 3E4RA 1XXHA 2HKJA 3KOYE 2LXEA 1HQYE 3DA1A 1ORYB 2QZ4A 4MGYE 2XLJA 1K3XA 3SATA 5ITRA 3GPYA 2QBYA 4NSRA 1IXSB 3SASA 3M7GA 3AKZA 1HNWM 2LH0A 2Z4RA 3SMPA 3U60A 2Y0QA 2BJVA 3FKEA 3EIHA 4JI6M 2R18A 3K1JA 1IY1A 1IN5A 4R3DA 2VQFM 4NXNM 5FTKA 1NHGC 4IJEA 5LMUM 3L28A 4QHTA 4A3VB 2XFSA 4B3MM 1TDHA 1L2CA 2F5NA 3QWLA 4JI3M 4R7GA 4QOSA 3FUTA 4B7HA 2XH9A 5E26A 1L1ZA 2C98A 2HL7A 4L15A 3GQ3A 2CHGA 2QCUA 3PNVA 3SHGB 3U6OA 1PJJA 2ZBKB 1IXZA 4DV4M 1TH3A 1W5SA 2UUBM 3M0EA 1MU5A 2Y20A 3ZC7B 2XZUA 1N32M 1FNNA 5EXPA 5FTMA 2OQ4A 5ITTA 4IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6A A;  4D81 A;  5EP1 A;  2DHR A;  1NJG A;  2C96 A;  4FCW A;  1JR3 D;  1OFH A;  2KRK A;  4FD2 A;  2QPA A;  3WHL A;  1XWI A;  4ZPX A;  4L16 A;  5C1B A;  2DVW B;  3GLG A;  2CEA A;  3B9P A;  1W5T A;  4FWH A;  2DWZ B;  3CF0 A;  1SXJ A;  4FCV A;  4LGM A;  1L8Q A;  1SXJ D;  1G41 A;  3HWS A;  2QEN A;  5DYI A;  1SXJ E;  3GLG B;  4D80 A;  3MHV C;  2VII A;  1S3S A;  1SXJ B;  4JN6 A;  4LJA A;  3AJI B;  1NSF A;  4LJ8 A;  3GLI A;  3CF2 A;  2DZN B;  1DO0 A;  3GLF A;  1IN7 A;  2X8A A;  3H4M A;  2C9O A;  3HU3 A;  3GLF B;  1JR3 A;  1KYI A;  2RKO A;  4KLN A;  1NY6 A;  2ZAN A;  1IY2 A;  1X37 A;  1J7K A;  2BJW A;  1NJF A;  3WHK A;  2C99 A;  5JI2 E;  4L4U A;  2HCB A;  1IQP A;  1E94 E;  2ZAM A;  4KOD A;  1JQJ C;  1D2N A;  3KW6 A;  4LJ9 A;  4LZZ A;  4Z8X A;  5EQT A;  1HT2 E;  2ZAO A;  4FCT A;  3HU2 A;  2CHQ A;  1XXH B;  3GLH B;  4QHS A;  4FW9 A;  4I81 A;  4LRS A;  2V1U A;  4D82 A;  1HT1 E;  2CHV A;  1OFI A;  2Z4S A;  5EXS A;  4GIT A;  3SYK A;  1IN6 A;  3D8B A;  4LCB A;  1G4A E;  2XSZ A;  3VFD A;  1QVR A;  4EIW A;  2XSZ D;  5EP4 A;  3U60 B;  3EIE A;  1IXR C;  1LV7 A;  3ZH9 B;  2QP9 X;  1QZM A;  2R65 A;  2C9C A;  2FNA A;  4LJ7 A;  1IN8 A;  3GLH A;  1XXH A;  2CE7 A;  1HQC A;  5FTJ A;  1HQY E;  4FWD A;  3KDS E;  2QZ4 A;  1DO2 A;  3HU1 A;  2V6Z M;  2QBY A;  1IXS B;  1UM8 A;  3DZD A;  3PVS A;  2Z4R A;  4LJ6 A;  5EP3 A;  5C18 A;  3PXG A;  2BJV A;  1OJL A;  3EIH A;  1KSF X;  5DYG A;  3R8F A;  2R62 A;  3K1J A;  5EXT A;  2QBY B;  3SC3 A;  3BOS A;  1IY1 A;  1IN5 A;  5JI3 E;  5FTN A;  5FTK A;  3PFI A;  1NVM A;  4QHT A;  2DZO B;  4LY6 A;  4A3V B;  4KO8 A;  3VLF B;  3SYL A;  1IY0 A;  3U61 B;  5EP2 A;  1IM2 A;  3U5Z B;  4QOS A;  3UK6 A;  1R7R A;  2C98 A;  4L15 A;  5FTL A;  4LJ4 A;  2CHG A;  4I4L A;  1NY5 A;  4LRT A;  1R6B X;  4WW0 A;  1IXZ A;  1C1K A;  1IN4 A;  1W5S A;  3M0E A;  1E32 A;  4QNR A;  1FNN A;  5EXP A;  4LJ5 A;  1SXJ C;  4QNM A;  1G3I A;  4FWG A;  5EXX A;  5FTM A;  3GLI B; 
#chains in the Genus database with same CATH topology
 5KO3 A;  1T6O A;  2O25 A;  4OVZ A;  4DR5 M;  4AKI A;  1NJG A;  1JR3 D;  1N77 A;  1T3T A;  4M9S A;  4DV1 M;  2R6F A;  3IHP A;  4I8O A;  4OW0 A;  4RNA A;  3KOX E;  1XWI A;  2YR0 A;  4ZPX A;  2DWL A;  2XEP A;  3AFH A;  1HR0 M;  3B9P A;  1OKS A;  4DBG B;  1XNQ M;  4CHT B;  1P3Q Q;  2JZ1 A;  2UXD M;  1F4I A;  3FUW A;  1NV9 A;  4QOZ C;  2QEN A;  3BBZ A;  5DYI A;  1UFZ A;  4MGI E;  1BVS A;  3J7B A;  2FOI C;  4NOO B;  3SAW A;  3HJQ A;  4JN6 A;  1K82 A;  4LJA A;  3K2L A;  1ZMV A;  2DZN B;  1D0K A;  2Z7J A;  3PNY A;  3GLI E;  3THG A;  3H4M A;  5BR8 M;  2ZTD A;  5IWA M;  2C9O A;  4KHP M;  4D80 A;  1YE9 A;  2K47 A;  1JR3 A;  1Z5C A;  1R5L A;  2R4E A;  1ZQ9 A;  2XFT A;  4KLN A;  1IY2 A;  2I7N A;  4KT0 F;  1VDL A;  2XZF A;  2D7H A;  3AOG A;  1QAO A;  2F5S A;  3UMM A;  1JB0 F;  4KOD A;  4DV2 M;  3JR4 A;  3HHX A;  3GLG E;  4IBB A;  1XXH B;  4IBK A;  2MH8 A;  4I81 A;  2L7H A;  2D7E A;  3U6L A;  4D82 A;  4YHH M;  4XK8 F;  3SYK A;  1NO1 A;  3D8B A;  4X66 M;  1G4A E;  4JI4 M;  4LG2 A;  3U60 B;  2OOB A;  2XSZ D;  4B3T M;  4OX9 M;  1WR1 B;  2JA2 A;  3LMM A;  4HLQ A;  1QZM A;  3FYC A;  4II7 A;  2DEN A;  3J80 S;  3GQ4 A;  4DV3 M;  1MN3 A;  3GLH A;  3HX3 A;  5L8R F;  4IBG A;  2DWM A;  3HHZ A;  3VK8 A;  4DR6 M;  2MR9 A;  2KA6 B;  3I4Y A;  3K9P A;  3KDS E;  2EKK A;  3L26 A;  1XB2 B;  3HU1 A;  2V6Z M;  4F2L A;  1Z6T A;  5H37 D;  1OTR A;  1OAI A;  3FD9 A;  2HAK A;  2CV2 A;  3T15 A;  3FTE A;  3VK7 A;  4DV0 M;  2RGO A;  2KRU A;  5DYG A;  1QDT A;  2LBC A;  2R62 A;  4HL4 A;  3W67 A;  1VG5 A;  1PM5 A;  3I01 M;  3BOS A;  1J09 A;  4JI1 M;  2JXN A;  1WIV A;  3PFI A;  1WGN A;  3TQS A;  5A2Q S;  4AKH A;  2K6B A;  3KP0 E;  4X64 M;  2DZO B;  3I4V A;  2UUA M;  4OVZ B;  1VQ1 A;  5ITY A;  3ZCB B;  3IEC A;  2LHC A;  2DWN A;  4LFC M;  3GRV A;  4GKK M;  4NRW A;  3RFW A;  5FTL A;  2WSE F;  3A46 A;  2OPF A;  3C3E A;  3KS4 A;  2I7P A;  1C1K A;  2EA0 A;  3C3D A;  1QDR A;  2CWB A;  3E46 A;  3ILK A;  4DR1 M;  4DUY M;  1YSY A;  1I94 M;  3SBJ A;  4QNM A;  4B3R M;  1G3I A;  2ZM6 M;  5EXX A;  3E9S A;  1PRB A;  1QQW A;  4D81 A;  2NQ8 C;  2BNK A;  2C96 A;  4K0K M;  4FCW A;  3U61 A;  4PCZ A;  3U5Z A;  2VDB B;  1L2B A;  3KS8 A;  4WP2 A;  3WHL A;  4PDG A;  2VQE M;  1TR8 A;  4MGH A;  3LCV B;  3GLG A;  1PJQ A;  2CEA A;  2O01 F;  3CF0 A;  1SXJ A;  2QSF X;  4FCV A;  1L8Q A;  3LVV A;  5ITQ A;  1I4W A;  1G41 A;  1C7Y A;  4LF7 M;  3U6E A;  3I04 M;  2YNM D;  3C58 A;  1TDZ A;  1R4G A;  2DI0 A;  3B89 A;  2G3Q A;  4JI0 M;  3K9O A;  4PDI A;  4OU7 A;  4JI7 M;  1GL6 A;  5ITX E;  4RF0 A;  4DV5 M;  3CF2 A;  4ITQ A;  2X8A A;  4CJ6 A;  1TGU A;  3FUU A;  2EUC A;  4DR2 M;  3KOW E;  2Z8Y M;  4YY3 M;  3GLF E;  4AZF A;  2R46 A;  1VEK A;  2DHY A;  4IBE A;  3GLF B;  1IBK M;  2DKL A;  4GH9 A;  4GKJ M;  2KZS A;  1EFU B;  1FJG M;  1J7K A;  3WHK A;  3HHY A;  5JI2 E;  4L4U A;  1OQY A;  3T1H M;  3RGP A;  1DGH A;  4AG6 A;  3GQ5 A;  1JQJ C;  1SG9 A;  2BWB A;  3HKP A;  3TE6 A;  3IG8 A;  1IBL M;  1IBM M;  2ZAO A;  4AW4 A;  3GLH B;  1WJ7 A;  4XBO A;  2DAE A;  2G5G X;  2DNA A;  2CHV A;  2JZ0 A;  2WZJ A;  1IFY A;  2DAM A;  1WXQ A;  2QNJ A;  4GIT A;  1RU3 A;  3Q8G A;  3GPP A;  3VFD A;  3KXE C;  4AQY M;  2CV0 A;  1LV7 A;  3ZH9 B;  4P16 A;  2YQZ A;  4DR7 M;  1EE8 A;  1YUB A;  2JY6 B;  3GRU A;  2KNV A;  1TF0 B;  2EJS A;  4GC9 A;  4G4R A;  4LFA M;  4RKU F;  3UJN A;  4LJ7 A;  3HJS A;  4L78 A;  3TWL A;  3SAV A;  4JXJ A;  1IXS A;  2JWS A;  1HQC A;  5FLX S;  4MGZ E;  5FTJ A;  1GO5 A;  1XXH E;  4FWD A;  4Y28 F;  3HY5 A;  3LCU A;  2QQ8 A;  2UXB M;  2KHH A;  3KSX A;  1DO2 A;  1Q3C A;  1OIP A;  1T43 A;  2DAK A;  3CF6 E;  1UM8 A;  4G3O A;  3DZD A;  4M0W A;  4RF1 A;  1L1T A;  3PVS A;  1XMQ M;  2HWJ A;  4LJ6 A;  5EP3 A;  1KSF X;  1HNX M;  3R8F A;  2QBY B;  1N34 M;  3SC3 A;  1DV0 A;  4X62 M;  2UXC M;  1PGY A;  5FTN A;  1YLA A;  2EO2 A;  2X4A A;  5IZ7 D;  4L6V 6;  1Z5A A;  3KSJ A;  2LHG A;  2MRO B;  3SYL A;  3LW5 F;  3U61 B;  5EP2 A;  1IM2 A;  2J7O A;  3U5Z B;  4LF8 M;  2A5Y B;  3W0L B;  4GHA A;  2L4F A;  2Y0T A;  4LZJ A;  2LVA A;  1XHB A;  1NY5 A;  4LRT A;  3L25 A;  3TWM A;  1N78 A;  3LQR A;  2KNA A;  2CFO A;  4WW0 A;  4NC6 A;  7CAT A;  1XNR M;  2Y21 A;  4X65 M;  2EKF A;  4AI6 A;  1ZV1 A;  1E32 A;  4QNR A;  4HEO A;  2HHH M;  1SXJ C;  3SAU A;  1WHC A;  4FWG A;  4NXM M;  1V33 A;  2XGN A;  3E21 A;  3L2A A;  1LTM A;  1TTE A;  2O5R A;  5DNY A;  5EP1 A;  2DHR A;  1N75 A;  4MM3 B;  2KRK A;  4FD2 A;  2QPA A;  4PD2 A;  2L7I A;  2KXE A;  1PJS A;  1PJI A;  5C1B A;  2WSC F;  4BBA A;  2DVW B;  4W5W A;  2LWX A;  2KW0 A;  1GVN A;  3FTC A;  2B3T A;  4S12 A;  4LGM A;  4GC5 A;  1SXJ D;  2R4J A;  3HWS A;  4MB7 A;  2MGW A;  1DGH B;  2W82 A;  2KEB A;  3CGW A;  3MHV C;  4B7F A;  1TH4 A;  1S3S A;  4GIP A;  3TWK A;  1Q39 A;  1H6U A;  2VF7 A;  3AJI B;  1NSF A;  4LJ8 A;  3FTD A;  3GLI A;  1G71 A;  3K8Z A;  4G4O A;  1DO0 A;  3FUV A;  4G4Q A;  3J81 S;  1N36 M;  3U6S A;  2F5O A;  2LVO C;  1AUA A;  1ZAE A;  5ITU A;  3HU3 A;  3GPX A;  3A42 A;  1QAN A;  2RKO A;  3MK6 A;  3NBX X;  1NY6 A;  3IG5 A;  5GKN A;  1JR3 E;  3HHW A;  2K0B X;  3KVW A;  5IT9 S;  1WGL A;  3L27 A;  1IQP A;  2ZAM A;  4LZZ A;  3KW6 A;  5EQT A;  1HT2 E;  3GP1 A;  1ZMU A;  1MX0 A;  3HU2 A;  2K9D A;  4FCT A;  2F5P A;  3LQQ A;  4GHL A;  2GQF A;  5KPT A;  2KZU A;  1N33 M;  4FW9 A;  2Z3X A;  1V92 A;  3AV0 A;  1GJT A;  4I5S A;  5BPV A;  4LRS A;  2OOA A;  4F1I A;  1R2Z A;  2P5T A;  3D8L A;  1OFI A;  4DV6 M;  2Z4S A;  4WUR A;  3A45 A;  4Z6Y A;  3HGI A;  4PT5 A;  4LCB A;  1QVR A;  4IIW A;  2CUZ A;  5EP4 A;  3EIE A;  3VDP A;  1IXR C;  3U6D A;  2QP9 X;  4L8R C;  4AKG A;  1VEJ A;  3FRI A;  3W0F A;  2LVP C;  2H1R A;  2R65 A;  1G8P A;  3RE8 A;  2JUJ A;  2C9C A;  1QAM A;  1IN8 A;  1Z5B A;  3F92 A;  1NNJ A;  2N35 A;  2CE7 A;  3NWL A;  3QYE A;  5F3W A;  1HNZ M;  3T38 A;  3GLH E;  2M5Z A;  3U6Q A;  4IJF A;  4IBJ A;  3B7N A;  1NV8 A;  1E9S A;  2R44 A;  3TPZ A;  5E6J A;  1E9R A;  1DGF A;  5C18 A;  3PXG A;  5KPZ A;  1OJL A;  1OIZ A;  4JI8 M;  3DOA A;  5EXT A;  3K92 A;  4GMQ A;  4M9X A;  1Z59 A;  5JI3 E;  2QHO B;  1HJP A;  4DUZ M;  1NVM A;  3B7Z A;  3OTO M;  2UUC M;  3VKG A;  4GRI A;  3T1Y M;  4LY6 A;  4KO8 A;  3VLF B;  1GJS A;  3FRH A;  1IY0 A;  1DGB A;  4G4N A;  2BWE A;  5KQD A;  2OO9 A;  3UK6 A;  3T6P A;  1R7R A;  2FH0 A;  4B7G A;  2FS1 A;  3KFU G;  4LFB M;  4LJ4 A;  3KP1 E;  4I4L A;  4DV7 M;  3RGS A;  2CRU A;  1NHW C;  1R6B X;  1IN4 A;  2G8L A;  4BLC A;  3GPU A;  4MGK E;  2AHM A;  1L2D A;  3J7A S;  2RGH A;  4TUW A;  3FUX A;  3JR5 A;  1Q3B A;  2FFJ A;  4FVM A;  3VKH A;  4CIZ A;  3JAM S;  4LJ5 A;  2F4V M;  4DR4 M;  4B3S M;  1KFV A;  3UGJ A;  4JV5 M;  2H5X A;  1XC8 A;  1DGG A;  1TH2 A;  3GLI B;  3J2P B;  2C5R A;  3M6A A;  4CGY B;  2DXI A;  4LGY A;  1OFH A;  3AOE C;  2Q2E B;  2RRU A;  3HJ8 A;  4GEW A;  4P17 A;  2JY8 A;  4L16 A;  2L09 A;  3MJ5 A;  2MJ5 B;  1W5T A;  1QZE A;  1Q02 A;  4REZ A;  4DR3 M;  4FWH A;  3DFZ A;  2DWZ B;  4JI5 M;  4B08 A;  3GRR A;  3A98 B;  3I51 A;  2M60 A;  4M9Z A;  3UZU A;  1SXJ E;  4BB9 A;  5FSW A;  3GLG B;  1XMO M;  2R0I A;  3CTW B;  2JY5 A;  5ITX A;  2FE8 A;  2ERC A;  2LVQ D;  3FE3 A;  1GL7 A;  2VII A;  1SXJ B;  3QYB A;  4UN2 B;  4IBD A;  1J5E M;  2F5Q A;  3L29 A;  1VDD A;  4XGI A;  1QAQ A;  1D0L A;  4Q7J A;  3GLF A;  1IN7 A;  3AL0 C;  5IRE B;  4JI2 M;  3QAU A;  4IBF A;  1Y8G A;  5KQ8 A;  1GLN A;  1MJG M;  4M0D A;  3GRY A;  2L6O A;  3KOZ E;  1V34 A;  1G59 A;  1KYI A;  3J27 B;  4LF9 M;  2ZAN A;  1X37 A;  4IBC A;  2VF8 A;  2BJW A;  3SFZ A;  1QUT A;  1NJF A;  2L2D A;  3VDU A;  2C99 A;  1R2Y A;  4NL4 H;  2HCB A;  2V1C A;  1E94 E;  2KNZ A;  3U6C A;  1QUS A;  1D2N A;  4LJ9 A;  2R45 A;  4MH0 E;  2JNH A;  4Z8X A;  2X49 A;  4NSO B;  4LF4 M;  2CHQ A;  4QHS A;  4AG5 A;  3Q8X A;  2CV1 A;  3SAR A;  1VEG A;  3SHF A;  3FYD A;  3MMP A;  2LNH C;  2V1U A;  2DAG A;  3AOE A;  1HT1 E;  4G6Z A;  4LF5 M;  2D7G A;  8CAT A;  4CIS A;  5EXS A;  2UU9 M;  1IN6 A;  4LF6 M;  3BXW A;  2XSZ A;  1ZMW A;  3LVW A;  4EIW A;  3GO8 A;  1K3W A;  2DAI A;  2J7N A;  5KPR A;  2DZL A;  2E5L M;  3FTF A;  3U6P A;  3R9X B;  4NRV A;  1QYR A;  1NNU C;  3U6M A;  1AIP C;  1GAB A;  3NBI A;  5EJC A;  1CUK A;  2L4E A;  2FNA A;  3TL4 X;  3C9P A;  2YFQ A;  2XF3 A;  4JYA M;  5LMN M;  1GKI A;  3SMS A;  3E4R A;  1XXH A;  2JP7 A;  2HKJ A;  3KOY E;  2LXE A;  1HQY E;  3DA1 A;  1ORY B;  2QZ4 A;  4MGY E;  2XLJ A;  1K3X A;  2LVN C;  5ITR A;  3GPY A;  2QBY A;  4NSR A;  1IXS B;  3SAT A;  3M7G A;  3AKZ A;  3SAS A;  1HNW M;  2LH0 A;  2Z4R A;  3SMP A;  3U60 A;  2Y0Q A;  2BJV A;  3FKE A;  3EIH A;  4JI6 M;  3HZJ A;  2APL A;  2R18 A;  2WSF F;  3K1J A;  4ANR A;  1IY1 A;  1IN5 A;  2J5Y A;  2JY7 A;  4R3D A;  4NXN M;  3W68 A;  5FTK A;  2VQF M;  1NHG C;  4IJE A;  5LMU M;  3L28 A;  4R71 A;  3H4J A;  4QHT A;  4A3V B;  2ZTC A;  2XFS A;  3B7Q A;  4B3M M;  1TDH A;  1OAO C;  1L2C A;  2F5N A;  3QWL A;  4JI3 M;  4R7G A;  4QOS A;  3FUT A;  4B7H A;  2XH9 A;  5E26 A;  1L1Z A;  2C98 A;  2HL7 A;  4L15 A;  5DFL A;  3GQ3 A;  2CHG A;  2QCU A;  3PNV A;  3SHG B;  3U6O A;  1PJJ A;  2ZBK B;  1IXZ A;  4DV4 M;  1TH3 A;  1W5S A;  2UUB M;  3M0E A;  1MU5 A;  1PJT A;  1D0M A;  2GNO A;  3ZQJ A;  1EIJ A;  2LTU A;  2Y20 A;  2CP8 A;  3ZC7 B;  3B74 A;  2KDL A;  2XZU A;  1A5T A;  1N32 M;  1FNN A;  5EXP A;  3V76 A;  5FTM A;  2OQ4 A;  5ITT A;  4IBI A; 
#chains in the Genus database with same CATH homology
 5KO3 A;  4OVZ A;  4DR5 M;  4AKI A;  1NJG A;  1JR3 D;  1N77 A;  1T3T A;  4M9S A;  4DV1 M;  4I8O A;  4OW0 A;  4RNA A;  3KOX E;  1XWI A;  2YR0 A;  4ZPX A;  2DWL A;  2XEP A;  3AFH A;  1HR0 M;  3B9P A;  1XNQ M;  4CHT B;  2UXD M;  3FUW A;  4QOZ C;  2QEN A;  5DYI A;  4MGI E;  3J7B A;  2FOI C;  4NOO B;  3SAW A;  3HJQ A;  4JN6 A;  1K82 A;  4LJA A;  3K2L A;  2DZN B;  2Z7J A;  3PNY A;  3THG A;  3H4M A;  5BR8 M;  5IWA M;  2C9O A;  4KHP M;  1YE9 A;  2K47 A;  1JR3 A;  1Z5C A;  4KLN A;  2R4E A;  1ZQ9 A;  2XFT A;  1IY2 A;  2I7N A;  2XZF A;  2D7H A;  3AOG A;  1QAO A;  2F5S A;  3UMM A;  4KOD A;  4DV2 M;  3JR4 A;  3HHX A;  4IBB A;  1XXH B;  4IBK A;  4I81 A;  2L7H A;  2D7E A;  3U6L A;  4D82 A;  4YHH M;  3SYK A;  4X66 M;  3D8B A;  1G4A E;  4JI4 M;  4LG2 A;  3U60 B;  2XSZ D;  4B3T M;  4OX9 M;  2JA2 A;  3LMM A;  4HLQ A;  1QZM A;  3FYC A;  4II7 A;  3J80 S;  3GQ4 A;  4DV3 M;  3GLH A;  4IBG A;  2DWM A;  3HHZ A;  3VK8 A;  4DR6 M;  2KA6 B;  3I4Y A;  3KDS E;  3L26 A;  3HU1 A;  2V6Z M;  1Z6T A;  5H37 D;  3FD9 A;  2CV2 A;  3FTE A;  3VK7 A;  4DV0 M;  2RGO A;  2KRU A;  5DYG A;  2R62 A;  4HL4 A;  1PM5 A;  3BOS A;  1J09 A;  4JI1 M;  4AKH A;  3PFI A;  5A2Q S;  3TQS A;  3KP0 E;  4X64 M;  2DZO B;  3I4V A;  2UUA M;  4OVZ B;  5ITY A;  3ZCB B;  2DWN A;  4LFC M;  3GRV A;  4GKK M;  4NRW A;  3RFW A;  5FTL A;  3A46 A;  2OPF A;  3KS4 A;  2I7P A;  1C1K A;  2EA0 A;  3ILK A;  4DR1 M;  4DUY M;  1YSY A;  1I94 M;  3SBJ A;  4QNM A;  4B3R M;  1G3I A;  2ZM6 M;  5EXX A;  3E9S A;  1QQW A;  4D81 A;  2NQ8 C;  2BNK A;  2C96 A;  4K0K M;  4FCW A;  3U61 A;  4PCZ A;  3U5Z A;  1L2B A;  3KS8 A;  3WHL A;  4PDG A;  2VQE M;  4MGH A;  3GLG A;  2CEA A;  3CF0 A;  1SXJ A;  4FCV A;  5ITQ A;  1L8Q A;  3LVV A;  4LF7 M;  1I4W A;  1G41 A;  3U6E A;  2YNM D;  3C58 A;  1TDZ A;  4JI0 M;  4PDI A;  4OU7 A;  4JI7 M;  1GL6 A;  5ITX E;  4RF0 A;  4DV5 M;  3CF2 A;  4ITQ A;  2X8A A;  1TGU A;  3FUU A;  2EUC A;  4DR2 M;  3KOW E;  4YY3 M;  4AZF A;  2R46 A;  4IBE A;  3GLF B;  1IBK M;  4GKJ M;  4GH9 A;  2KZS A;  1FJG M;  1J7K A;  3WHK A;  3HHY A;  5JI2 E;  4L4U A;  3T1H M;  3RGP A;  1DGH A;  4AG6 A;  3GQ5 A;  1JQJ C;  3TE6 A;  3HKP A;  3IG8 A;  1IBL M;  1IBM M;  2ZAO A;  4AW4 A;  3GLH B;  4XBO A;  2G5G X;  2CHV A;  4GIT A;  1WXQ A;  3GPP A;  3VFD A;  3KXE C;  4AQY M;  2CV0 A;  1LV7 A;  3ZH9 B;  4P16 A;  2YQZ A;  4DR7 M;  1EE8 A;  1YUB A;  4GC9 A;  3GRU A;  4G4R A;  4LFA M;  3UJN A;  4LJ7 A;  3HJS A;  4L78 A;  3TWL A;  3SAV A;  4JXJ A;  1HQC A;  5FLX S;  4MGZ E;  5FTJ A;  4FWD A;  2UXB M;  3KSX A;  3T15 A;  1DO2 A;  1Q3C A;  2HHH M;  3CF6 E;  4RF1 A;  1UM8 A;  4M0W A;  3DZD A;  1L1T A;  3PVS A;  1XMQ M;  4LJ6 A;  5EP3 A;  1KSF X;  1HNX M;  3R8F A;  2QBY B;  1N34 M;  3SC3 A;  4X62 M;  2UXC M;  5FTN A;  2EO2 A;  2X4A A;  5IZ7 D;  1Z5A A;  3KSJ A;  3SYL A;  3U61 B;  5EP2 A;  1IM2 A;  2J7O A;  3U5Z B;  4LF8 M;  2A5Y B;  3W0L B;  4GHA A;  2Y0T A;  4LZJ A;  1XHB A;  1NY5 A;  4LRT A;  3L25 A;  3TWM A;  1N78 A;  3LQR A;  4WW0 A;  2CFO A;  7CAT A;  1XNR M;  2Y21 A;  4X65 M;  4AI6 A;  1E32 A;  4QNR A;  1SXJ C;  3SAU A;  4FWG A;  4NXM M;  3L2A A;  2XGN A;  2O5R A;  5DNY A;  5EP1 A;  2DHR A;  1N75 A;  4MM3 B;  2KRK A;  4FD2 A;  2QPA A;  4PD2 A;  2L7I A;  2KXE A;  1PJI A;  5C1B A;  4BBA A;  2DVW B;  4W5W A;  2LWX A;  2KW0 A;  1GVN A;  3FTC A;  4S12 A;  4LGM A;  4GC5 A;  1SXJ D;  2R4J A;  3HWS A;  4MB7 A;  1DGH B;  2W82 A;  2KEB A;  3MHV C;  4B7F A;  1TH4 A;  1S3S A;  4GIP A;  3TWK A;  1Q39 A;  1H6U A;  3AJI B;  1NSF A;  4LJ8 A;  3FTD A;  3GLI A;  4G4O A;  3K8Z A;  1DO0 A;  3FUV A;  4G4Q A;  3J81 S;  1N36 M;  3U6S A;  2F5O A;  1ZAE A;  5ITU A;  3HU3 A;  3GPX A;  3A42 A;  1QAN A;  2RKO A;  3MK6 A;  1NY6 A;  3IG5 A;  5GKN A;  3HHW A;  3KVW A;  5IT9 S;  3L27 A;  1IQP A;  2ZAM A;  4LZZ A;  3KW6 A;  5EQT A;  1HT2 E;  3GP1 A;  1MX0 A;  3HU2 A;  4FCT A;  2F5P A;  3LQQ A;  4GHL A;  5KPT A;  2KZU A;  1N33 M;  4FW9 A;  2Z3X A;  3AV0 A;  4I5S A;  5BPV A;  4LRS A;  1R2Z A;  2P5T A;  3D8L A;  1OFI A;  4DV6 M;  2Z4S A;  4WUR A;  3A45 A;  4Z6Y A;  3HGI A;  4PT5 A;  4LCB A;  1QVR A;  4IIW A;  2CUZ A;  5EP4 A;  3EIE A;  3VDP A;  1IXR C;  3U6D A;  2QP9 X;  4L8R C;  4AKG A;  3W0F A;  2H1R A;  2R65 A;  1G8P A;  3RE8 A;  2C9C A;  1QAM A;  1IN8 A;  1Z5B A;  1NNJ A;  2CE7 A;  3NWL A;  5F3W A;  1HNZ M;  3T38 A;  2M5Z A;  3U6Q A;  4IJF A;  4IBJ A;  1E9S A;  3TPZ A;  5E6J A;  1E9R A;  1DGF A;  5C18 A;  3PXG A;  5KPZ A;  1OJL A;  4JI8 M;  3DOA A;  5EXT A;  3K92 A;  4GMQ A;  4M9X A;  1Z59 A;  5JI3 E;  4DUZ M;  1NVM A;  3OTO M;  2UUC M;  3VKG A;  4GRI A;  3T1Y M;  4LY6 A;  4KO8 A;  3VLF B;  1IY0 A;  1DGB A;  4G4N A;  5KQD A;  3UK6 A;  1R7R A;  4B7G A;  3KFU G;  4LFB M;  4LJ4 A;  3KP1 E;  4I4L A;  4DV7 M;  3RGS A;  1NHW C;  1R6B X;  1IN4 A;  2G8L A;  4BLC A;  3GPU A;  4MGK E;  2AHM A;  1L2D A;  3J7A S;  2RGH A;  4TUW A;  3FUX A;  3JR5 A;  1Q3B A;  2FFJ A;  4FVM A;  3VKH A;  3JAM S;  4LJ5 A;  2F4V M;  4DR4 M;  4B3S M;  1KFV A;  3UGJ A;  4JV5 M;  1XC8 A;  1DGG A;  1TH2 A;  3GLI B;  3J2P B;  2C5R A;  3M6A A;  4CGY B;  2DXI A;  4LGY A;  1OFH A;  3AOE C;  2Q2E B;  3HJ8 A;  4L16 A;  2L09 A;  3MJ5 A;  1W5T A;  4REZ A;  4DR3 M;  4FWH A;  3DFZ A;  2DWZ B;  4JI5 M;  4B08 A;  3GRR A;  3A98 B;  3I51 A;  2M60 A;  4M9Z A;  3UZU A;  1SXJ E;  3GLG B;  1XMO M;  5ITX A;  3CTW B;  4BB9 A;  4D80 A;  2FE8 A;  2ERC A;  5FSW A;  1GL7 A;  2VII A;  1SXJ B;  1J5E M;  4IBD A;  2F5Q A;  3L29 A;  1VDD A;  4XGI A;  1QAQ A;  3GLF A;  1IN7 A;  3AL0 C;  5IRE B;  4JI2 M;  3QAU A;  4IBF A;  5KQ8 A;  1GLN A;  4M0D A;  3GRY A;  2L6O A;  3KOZ E;  1G59 A;  1KYI A;  3J27 B;  4LF9 M;  2ZAN A;  1X37 A;  4IBC A;  3SFZ A;  2BJW A;  3VDU A;  1NJF A;  2C99 A;  1R2Y A;  4NL4 H;  2HCB A;  2V1C A;  1E94 E;  3U6C A;  1D2N A;  4LJ9 A;  2R45 A;  4MH0 E;  4Z8X A;  2X49 A;  4NSO B;  4LF4 M;  2CHQ A;  4QHS A;  4AG5 A;  3Q8X A;  2CV1 A;  3SAR A;  3SHF A;  3FYD A;  2LNH C;  2V1U A;  3AOE A;  1HT1 E;  4G6Z A;  4LF5 M;  2D7G A;  8CAT A;  4CIS A;  5EXS A;  2UU9 M;  1IN6 A;  4LF6 M;  2XSZ A;  3LVW A;  4EIW A;  3GO8 A;  1K3W A;  2J7N A;  5KPR A;  2E5L M;  3FTF A;  3R9X B;  3U6P A;  4NRV A;  1QYR A;  1NNU C;  3U6M A;  3NBI A;  5EJC A;  2FNA A;  3TL4 X;  2YFQ A;  2XF3 A;  4JYA M;  5LMN M;  1GKI A;  3SMS A;  3E4R A;  1XXH A;  2HKJ A;  3KOY E;  2LXE A;  1HQY E;  3DA1 A;  1ORY B;  2QZ4 A;  4MGY E;  2XLJ A;  1K3X A;  3SAT A;  5ITR A;  3GPY A;  2QBY A;  4NSR A;  1IXS B;  3SAS A;  3M7G A;  3AKZ A;  1HNW M;  2LH0 A;  2Z4R A;  3SMP A;  3U60 A;  2Y0Q A;  2BJV A;  3FKE A;  3EIH A;  4JI6 M;  2R18 A;  3K1J A;  1IY1 A;  1IN5 A;  4R3D A;  2VQF M;  4NXN M;  5FTK A;  1NHG C;  4IJE A;  5LMU M;  3L28 A;  4QHT A;  4A3V B;  2XFS A;  4B3M M;  1TDH A;  1L2C A;  2F5N A;  3QWL A;  4JI3 M;  4R7G A;  4QOS A;  3FUT A;  4B7H A;  2XH9 A;  5E26 A;  1L1Z A;  2C98 A;  2HL7 A;  4L15 A;  3GQ3 A;  2CHG A;  2QCU A;  3PNV A;  3SHG B;  3U6O A;  1PJJ A;  2ZBK B;  1IXZ A;  4DV4 M;  1TH3 A;  1W5S A;  2UUB M;  3M0E A;  1MU5 A;  2Y20 A;  3ZC7 B;  2XZU A;  1N32 M;  1FNN A;  5EXP A;  5FTM A;  2OQ4 A;  5ITT A;  4IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...