3KW6A

Crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a domain of 26S proteasome regulatory subunit 8 from homo sapiens. Northeast Structural Genomics Consortium target id HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords 26S protease regulatory subunit 8
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kw6A01
2CHGA 4LRSA 2QBYA 1SXJC 4L15A 4LJ6A 5JI3E 1HQCA 4FW9A 3DZDA 2R62A 3PVSA 1HQYE 2C98A 3GLGB 1HT1E 3PXGA 3ZH9B 3VLFB 4D81A 2C99A 1L8QA 5EP4A 1IXZA 1J7KA 3KDSE 2DVWB 3GLHA 5EQTA 3U5ZB 2V1UA 5DYGA 1W5SA 3GLHB 1XXHA 3M6AA 1DO0A 1QZMA 1IQPA 2CHVA 1G41A 2V6ZM 3GLFA 2DHRA 2QENA 5JI2E 4KODA 2DZNB 2QP9X 1E32A 5FTJA 4A3VB 2XSZD 4LJ8A 3GLIB 3SYLA 1IXRC 1JR3D 3CF0A 1W5TA 1JQJC 4GITA 4QNRA 3B9PA 5EP2A 2CHQA 1HT2E 1C1KA 4FD2A 5EXXA 3GLFB 3WHLA 1OFHA 2DZOB 2VIIA 1NSFA 4D80A 4LJ7A 4LGMA 3EIEA 3U60B 4FCVA 1QVRA 3SC3A 5C1BA 4QHTA 4L4UA 1KYIA 4ZPXA 1XXHB 1JR3A 3M0EA 4L16A 3KW6A 3EIHA 1D2NA 1NJFA 3UK6A 2XSZA 3CF2A 3H4MA 1IN5A 1NY6A 4WW0A 1IY2A 2BJWA 4LCBA 1XWIA 2CEAA 1IN4A 3MHVC 2CE7A 4LJ4A 2ZAOA 4KLNA 4EIWA 5EP3A 3K1JA 2C96A 5FTMA 4KO8A 1SXJB 1R7RA 1S3SA 5EXSA 2RKOA 4LZZA 2QPAA 4FCTA 5EP1A 4LRTA 1OJLA 5FTKA 1SXJE 4FWDA 3HU3A 4QNMA 5FTLA 4FWHA 3AJIB 1FNNA 1R6BX 2C9OA 1NJGA 1G4AE 2ZAMA 3HU1A 4Z8XA 4FCWA 2FNAA 1IN6A 2Z4SA 2X8AA 1DO2A 5FTNA 1NY5A 3WHKA 4QHSA 5EXTA 1LV7A 1IN7A 4LJ5A 4LJAA 3GLIA 3HU2A 4I4LA 2QZ4A 1E94E 1OFIA 1SXJA 4FWGA 2KRKA 2Z4RA 1G3IA 3HWSA 1IN8A 2QBYB 2DWZB 5DYIA 4D82A 3D8BA 4QOSA 5C18A 2C9CA 1SXJD 3BOSA 3PFIA 4JN6A 1IY0A 4LY6A 1KSFX 1IM2A 4LJ9A 1NVMA 1IXSB 2HCBA 3SYKA 5EXPA 3U61B 3R8FA 1IY1A 3GLGA 1UM8A 1X37A 2R65A 3VFDA 2BJVA 4I81A 2ZANA
chains in the Genus database with same CATH superfamily
1E9RA 2MJ5B 4LJ6A 1QUSA 3IHPA 4M9ZA 4NRVA 1HQCA 3TPZA 4JYAM 2UXCM 2R62A 2Z3XA 4B3SM 2C98A 4GRIA 1J5EM 1XB2B 1HT1E 3HZJA 2HHHM 3TWMA 3LQRA 1FJGM 2HWJA 1QAOA 3C58A 4RF1A 2KW0A 3SHFA 2DWMA 2DAEA 3AV0A 2G3QA 1GO5A 5DYGA 2XLJA 4S12A 1QZMA 1G41A 2YQZA 3LQQA 2L2DA 1OIPA 4OW0A 2LBCA 1V92A 4PDIA 2DZNB 4F1IA 2QP9X 1PJTA 1E32A 2DWNA 1RU3A 4AKGA 5LMUM 3T1YM 3HHXA 4DBGB 1VEGA 4MGZE 1TTEA 2B3TA 3AOGA 2R4JA 4AI6A 4JI2M 3I51A 1GABA 2JY8A 2JP7A 1PRBA 2JY7A 2NQ8C 2Z8YM 2LVQD 1NV9A 3W0FA 3UJNA 4DV0M 1OFHA 3U61A 2F5QA 2Q2EB 2JWSA 3HGIA 1P3QQ 2K47A 2JNHA 1QANA 3GPYA 3FTFA 3EIEA 1Q3CA 3SFZA 3TWKA 1OAOC 4QHTA 1T6OA 4ZPXA 1HJPA 3W0LB 3B89A 3KSJA 1PM5A 1L2DA 2ZTDA 3KW6A 2X4AA 3QWLA 4F2LA 1NJFA 3UK6A 1MJGM 1V34A 3CF2A 4DV3M 3FRIA 3E4RA 4IBGA 1IN5A 3NWLA 4GC9A 1IY2A 4LCBA 4IJFA 1ZQ9A 1GVNA 4GH9A 3SMSA 2MH8A 4ANRA 2F5SA 4LF5M 5ITYA 3THGA 4YY3M 5GKNA 2KA6B 2MROB 2FE8A 4OVZA 3SMPA 3K1JA 4CIZA 2RGOA 3LW5F 1N78A 3OTOM 1R7RA 1S3SA 2YR0A 4DV5M 4L78A 2YFQA 2L7HA 3Q8GA 4LRTA 3M7GA 2OOAA 2GQFA 3L26A 1DV0A 2KZSA 3LCUA 4XBOA 5FTLA 1FNNA 3BXWA 1NJGA 2ZAMA 1L2CA 3FTEA 4KT0F 4FCWA 4RKUF 4LG2A 1IN6A 3HJ8A 3L28A 1NY5A 3NBIA 1J09A 1OQYA 3HHWA 1IN7A 4LJ5A 1YSYA 1QAMA 3DOAA 2VDBB 4YHHM 3FUWA 4RF0A 3HU2A 3GLIA 2UUBM 4I4LA 3GRUA 4GMQA 2KDLA 2KRKA 2Z4RA 1KFVA 1XC8A 1G3IA 1NV8A 2EJSA 2L7IA 2QBYB 5DYIA 4D82A 3D8BA 1GJTA 1I94M 4MB7A 3L25A 2WZJA 3GO8A 3E21A 3U6SA 1JR3E 3LVVA 4IBIA 1SXJD 3PFIA 4JN6A 5L8RF 1IY0A 2K0BX 1HR0M 4AKHA 4LY6A 4B3MM 1IM2A 2HCBA 2WSCF 3U61B 4DR4M 2K6BA 2JZ1A 1UM8A 1X37A 3VFDA 4CJ6A 1IXSA 4MM3B 2ZANA 2CHGA 3GRVA 4CISA 4I5SA 2L09A 1YUBA 5JI3E 3LCVB 1YE9A 3CGWA 3DZDA 4GKKM 3SATA 3ZH9B 2ERCA 2ZBKB 2OO9A 3KP0E 3HX3A 5EP4A 2CV2A 3KS4A 3GP1A 1ZV1A 2F4VM 2W82A 2DVWB 2K9DA 3SAUA 1Z5CA 1D0KA 4R7GA 3JR4A 1W5SA 1T3TA 2R0IA 1XXHA 5KO3A 4DV2M 1WIVA 1IQPA 2CHVA 5IREB 2VF7A 5JI2E 3VK8A 4KODA 4LF4M 1R2YA 1HNWM 4IBDA 3T15A 1QAQA 4MGYE 1IXRC 3HY5A 3SYLA 3AL0C 3VKGA 5A2QS 5H37D 1W5TA 2XEPA 4P17A 4Z6YA 3U6DA 1VDLA 1IBMM 1N77A 1TH2A 2DAMA 2L4FA 3NBXX 4CHTB 2APLA 4DR2M 4NRWA 3E9SA 5EP2A 3GPUA 2CHQA 4Q7JA 4JI8M 2JUJA 3IG5A 4NXNM 2XF3A 5FSWA 5EXXA 5FLXS 3WHLA 3I4VA 2DZOB 1MX0A 2LXEA 4D80A 4JI7M 2HL7A 3K9PA 4DR7M 3J27B 1Q3BA 3U60B 4FCVA 3J80S 4WURA 5ITQA 3SC3A 4IBCA 5C1BA 2R46A 4L4UA 4L16A 3MK6A 3RFWA 3L2AA 3UZUA 1N32M 1Q02A 2G8LA 2V1CA 2C5RA 1AUAA 1K82A 3H4MA 1D0MA 1ZMWA 3CF6E 1QZEA 4WW0A 2BJWA 1IFYA 3MHVC 3FUUA 3QYBA 4LJ4A 3I04M 4P16A 5KPZA 1Z5BA 4XK8F 4G4NA 1GJSA 3PNVA 1GKIA 1CUKA 3D8LA 5FTMA 4BLCA 2XZUA 4JI1M 1F4IA 1ORYB 4JI4M 2DHYA 1WJ7A 4LZZA 2QPAA 1XNRM 1WHCA 1TDZA 1AIPC 1OJLA 4ITQA 3HJQA 4FWDA 4AG5A 4AZFA 2OQ4A 4DV4M 2XFTA 4FWHA 5BR8M 4B7FA 3U60A 3HU1A 3FTDA 4Z8XA 3FYDA 4OU7A 2FS1A 2Z4SA 5FTNA 3GQ4A 4G3OA 4QHSA 2JZ0A 3KOXE 3A45A 5E26A 5EXTA 1QQWA 4LJAA 2DENA 1OAIA 5KQDA 4B3TM 2EO2A 2Z7JA 1E94E 1OFIA 4DV7M 1XMOM 2WSFF 4IBEA 1G59A 1SXJA 4FWGA 2WSEF 2QHOB 2QNJA 4L8RC 3RGSA 4DUZM 2MGWA 3AFHA 1R2ZA 3B7QA 2HAKA 2FOIC 1DGHB 4JI5M 4DR6M 4QOSA 4GHLA 8CATA 3GRRA 1LTMA 1TGUA 3ZCBB 3BOSA 4M9SA 4L6V6 4GC5A 1DGGA 1DGHA 1NVMA 3R8FA 1IY1A 3LMMA 3T6PA 3C9PA 3GLGA 3ILKA 4BB9A 4NC6A 4I81A 1OKSA 4LRSA 1TH4A 3FUVA 2D7EA 2QBYA 4L15A 4M0WA 1TDHA 1IBKM 4HL4A 3KXEC 1R4GA 2JY6B 2LH0A 4NSRA 3GLGB 3VLFB 2CV1A 1T43A 4W5WA 2RRUA 4LFBM 4D81A 3FTCA 1SG9A 1GL6A 1L8QA 4WP2A 4IIWA 1VEKA 1J7KA 2H1RA 3FUTA 2OOBA 3T38A 2JY5A 2LVAA 3KDSE 4JXJA 1Y8GA 2ZTCA 2UUAM 2JA2A 2V1UA 1ZMVA 4LF9M 2M60A 3KOZE 3GLHB 4AG6A 3M6AA 5KPTA 1DO0A 2GNOA 1NHWC 2V6ZM 1OTRA 2CWBA 2L4EA 2QENA 2QSFX 5ITTA 2DAIA 1K3WA 4A3VB 4LJ8A 1NHGC 2UU9M 1E9SA 2H5XA 2DXIA 3K92A 4I8OA 3KP1E 1JR3D 3CF0A 1WR1B 1N34M 3AOEC 5IZ7D 2J7NA 4GITA 1Q39A 2D7GA 2KNAA 3FRHA 3L27A 2AHMA 3B9PA 3MMPA 3PNYA 4QNRA 3A98B 3RGPA 4B3RM 1HT2E 1WGNA 2Y20A 3GPPA 2RGHA 3TWLA 3GLFB 2LVOC 1I4WA 3FE3A 1G8PA 1NSFA 4LJ7A 4LGMA 4AQYM 3KFUG 2MR9A 4NL4H 2BWEA 3C3EA 4DR3M 3U6EA 1QVRA 3H4JA 2R6FA 1NNUC 3SARA 1D0LA 4LGYA 3M0EA 2HKJA 2XSZA 1EFUB 3VKHA 2O25A 2CFOA 4JI6M 2LHGA 2VF8A 2EUCA 1Z6TA 2CEAA 2UXBM 3GRYA 4HEOA 4MH0E 5EP3A 4UN2B 2C96A 7CATA 4X62M 3GPXA 1SXJB 3L29A 5DNYA 3SAWA 1HNXM 1HNZM 2JXNA 2RKOA 5F3WA 5ITRA 4FCTA 5EP1A 4R3DA 1SXJE 2F5NA 1BVSA 2QCUA 2I7NA 3HU3A 4G4QA 1QYRA 4QNMA 3R9XB 3U6OA 3AJIB 2R4EA 3TQSA 3CTWB 3HHZA 4QOZC 4K0KM 1TR8A 2A5YB 3KOWE 4NSOB 2FNAA 2KHHA 2DZLA 3U6QA 3VDPA 1L1ZA 5IWAM 3WHKA 1NNJA 4MGHA 1PJQA 3I4YA 2XZFA 3FUXA 3KS8A 3GLGE 3HHYA 3BBZA 1TH3A 2M5ZA 3JR5A 3ZC7B 2YNMD 2QZ4A 3IG8A 4G4OA 3SBJA 4TUWA 2BWBA 3V76A 1DGFA 3B7ZA 5ITXA 4X66M 4MGKE 4DR5M 2KRUA 2LHCA 1IN8A 3HWSA 2DWZB 4IBKA 5C18A 2C9CA 1GLNA 1TF0B 2LNHC 3UMMA 2DWLA 2DAKA 2DKLA 2CP8A 3ZQJA 4CGYB 5KQ8A 2R44A 4Y28F 4XGIA 2BNKA 4B08A 2VQFM 1KSFX 4DV1M 4JI3M 4PD2A 1VG5A 3U6CA 4LJ9A 2DAGA 3SYKA 1QDTA 3I01M 4LFAM 2Y0QA 1GL7A 1PJIA 2BJVA 1N33M 1NO1A 1YLAA 1ZMUA 4JI0M 1SXJC 1WGLA 3LVWA 3UGJA 3W68A 4FW9A 4BBAA 3J7AS 3PVSA 1HQYE 3DA1A 2LWXA 2N35A 4MGIE 3PXGA 4GIPA 1L1TA 4LZJA 2C99A 3B7NA 3RE8A 1IXZA 4FVMA 4IBFA 2UUCM 2LVNC 1VEJA 1R5LA 5EQTA 3GLHA 3FD9A 2KZUA 3U5ZB 2LTUA 2X49A 5BPVA 4OX9M 2J5YA 3SAVA 3Q8XA 5KPRA 1V33A 3J7BA 1XNQM 3GLFA 3U6LA 2DHRA 1XHBA 1G71A 1OIZA 2LVPC 3TL4X 5LMNM 2UXDM 4OVZB 5FTJA 1EIJA 2L6OA 2XSZD 3AOEA 4X64M 3GLIB 2VQEM 3MJ5A 4RNAA 4PCZA 1H6UA 1JQJC 4IBJA 3HJSA 2XH9A 2O01F 1UFZA 5IT9S 2FFJA 4M9XA 3B74A 3TE6A 2F5PA 1C1KA 4KHPM 2R18A 4FD2A 2P5TA 5DFLA 1Z5AA 2F5OA 1XMQM 3AKZA 2VIIA 2J7OA 2E5LM 1WXQA 2KNZA 5ITXE 4IJEA 1N75A 2XFSA 2D7HA 3SASA 1MU5A 1KYIA 1VQ1A 4LF7M 1XXHB 1JR3A 4HLQA 2Y0TA 5EJCA 3EIHA 1D2NA 4JV5M 3T1HM 1C7YA 4PT5A 1NY6A 4DUYM 1XWIA 4PDGA 1IN4A 1PGYA 2CE7A 1XXHE 4LFCM 2ZAOA 4KLNA 2EA0A 1ZAEA 4EIWA 2KNVA 3HKPA 2KXEA 3J2PB 3KOYE 4KO8A 3C3DA 5EXSA 3K9OA 4LF8M 3FYCA 3U6PA 2G5GX 2DI0A 4IBBA 4AKIA 5FTKA 1JB0F 2CUZA 2I7PA 3GQ3A 3F92A 1L2BA 2QQ8A 4B7HA 2XGNA 3GQ5A 2CRUA 1R6BX 1VDDA 2C9OA 1G4AE 4G6ZA 1IBLM 3E46A 4LF6M 4II7A 3VK7A 1PJJA 2O5RA 2OPFA 1N36M 2EKKA 2X8AA 3KVWA 1DO2A 3K2LA 3J81S 3FKEA 2FH0A 3K8ZA 3KSXA 5E6JA 2DNAA 1LV7A 1QDRA 3QAUA 1EE8A 1MN3A 4AW4A 1DGBA 4M0DA 4R71A 2Y21A 2KEBA 2CV0A 4NXMM 2R45A 1Z59A 4REZA 3U6MA 4X65M 2ZM6M 4GKJM 1QUTA 3A42A 4B7GA 3JAMS 5ITUA 3SHGB 3W67A 1K3XA 1PJSA 1A5TA 3DFZA 4GEWA 4G4RA 4DR1M 3QYEA 3IECA 3U5ZA 2EKFA 3A46A 3GLFE 1IXSB 3GLIE 4NOOB 5EXPA 4DV6M 3GLHE 3VDUA 2R65A 4GHAA
chains in the Genus database with same CATH topology
1E9RA 4LJ6A 4NRVA 4M9ZA 4JYAM 2UXCM 1HQCA 3TPZA 2R62A 2Z3XA 4B3SM 2C98A 4GRIA 1J5EM 1HT1E 2HHHM 3TWMA 3LQRA 1FJGM 1QAOA 3C58A 4RF1A 2KW0A 3SHFA 2DWMA 3AV0A 5DYGA 2XLJA 4S12A 1QZMA 1G41A 2YQZA 3LQQA 4OW0A 4PDIA 2DZNB 2QP9X 1E32A 2DWNA 4AKGA 5LMUM 3T1YM 3HHXA 4MGZE 3AOGA 2R4JA 4AI6A 4JI2M 3I51A 2NQ8C 3W0FA 3UJNA 4DV0M 1OFHA 3U61A 2F5QA 2Q2EB 3HGIA 2K47A 3GPYA 1QANA 3FTFA 3EIEA 1Q3CA 3SFZA 3TWKA 4QHTA 4ZPXA 3W0LB 3KSJA 1PM5A 1L2DA 3KW6A 2X4AA 3QWLA 1NJFA 3UK6A 3CF2A 4DV3M 3E4RA 4IBGA 1IN5A 3NWLA 4GC9A 1IY2A 4LCBA 4IJFA 1ZQ9A 1GVNA 4GH9A 3SMSA 2F5SA 4LF5M 5ITYA 3THGA 4YY3M 5GKNA 2KA6B 4OVZA 2FE8A 3SMPA 3K1JA 2RGOA 1N78A 3OTOM 1R7RA 1S3SA 2YR0A 4DV5M 4L78A 2YFQA 2L7HA 4LRTA 3M7GA 3L26A 2KZSA 4XBOA 5FTLA 1FNNA 1NJGA 2ZAMA 1L2CA 3FTEA 4FCWA 4LG2A 1IN6A 3HJ8A 3L28A 1NY5A 3NBIA 1J09A 3HHWA 1IN7A 4LJ5A 1YSYA 1QAMA 3DOAA 4YHHM 3GLIA 3FUWA 4RF0A 3HU2A 2UUBM 4I4LA 3GRUA 4GMQA 2KRKA 2Z4RA 1KFVA 1XC8A 1G3IA 2L7IA 2QBYB 5DYIA 4D82A 3D8BA 1I94M 4MB7A 3GO8A 3U6SA 4IBIA 3LVVA 1SXJD 3PFIA 4JN6A 1IY0A 1HR0M 4AKHA 4LY6A 4B3MM 1IM2A 2HCBA 4DR4M 3U61B 1UM8A 1X37A 3VFDA 4MM3B 2ZANA 2CHGA 3GRVA 4CISA 4I5SA 2L09A 1YUBA 5JI3E 1YE9A 3DZDA 4GKKM 3SATA 3ZH9B 2ERCA 2ZBKB 3KP0E 5EP4A 2CV2A 3KS4A 3GP1A 2F4VM 2W82A 2DVWB 3SAUA 1Z5CA 4R7GA 3JR4A 1W5SA 1T3TA 5KO3A 1XXHA 4DV2M 2CHVA 1IQPA 5IREB 3VK8A 5JI2E 4KODA 4LF4M 1R2YA 1HNWM 4IBDA 3T15A 1QAQA 4MGYE 1IXRC 3SYLA 3AL0C 3VKGA 5A2QS 5H37D 1W5TA 2XEPA 1IBMM 4Z6YA 3U6DA 1N77A 1TH2A 4CHTB 4DR2M 4NRWA 3E9SA 5EP2A 3GPUA 2CHQA 4JI8M 3IG5A 4NXNM 2XF3A 5FSWA 5EXXA 5FLXS 3WHLA 3I4VA 2DZOB 1MX0A 2LXEA 4D80A 4JI7M 2HL7A 4DR7M 3J27B 1Q3BA 3U60B 4FCVA 3J80S 4WURA 5ITQA 3SC3A 4IBCA 5C1BA 2R46A 4L4UA 4L16A 3MK6A 3RFWA 3L2AA 3UZUA 1N32M 2G8LA 2V1CA 2C5RA 1K82A 3H4MA 3CF6E 4WW0A 2BJWA 3MHVC 3FUUA 4LJ4A 4P16A 4G4NA 5KPZA 1Z5BA 3PNVA 1GKIA 3D8LA 5FTMA 4BLCA 2XZUA 4JI1M 1ORYB 4JI4M 4LZZA 2QPAA 1XNRM 4ITQA 1TDZA 1OJLA 3HJQA 4FWDA 4AG5A 4AZFA 2OQ4A 4DV4M 2XFTA 4FWHA 5BR8M 4B7FA 3U60A 3HU1A 3FTDA 4Z8XA 3FYDA 4OU7A 2Z4SA 5FTNA 3GQ4A 4QHSA 3KOXE 3A45A 5E26A 5EXTA 1QQWA 4LJAA 5KQDA 4B3TM 2EO2A 2Z7JA 1E94E 1OFIA 4DV7M 1XMOM 1G59A 4IBEA 1SXJA 4FWGA 4L8RC 3RGSA 4DUZM 3AFHA 1R2ZA 2FOIC 1DGHB 4JI5M 4DR6M 4QOSA 4GHLA 8CATA 3GRRA 1TGUA 3ZCBB 3BOSA 4M9SA 4GC5A 1DGGA 1DGHA 1NVMA 3R8FA 1IY1A 3LMMA 3GLGA 3ILKA 4BB9A 4I81A 4LRSA 1TH4A 3FUVA 2D7EA 2QBYA 4L15A 4M0WA 1TDHA 1IBKM 4HL4A 3KXEC 2LH0A 4NSRA 3GLGB 3VLFB 2CV1A 4LFBM 4W5WA 4D81A 3FTCA 1GL6A 1L8QA 4IIWA 1J7KA 2H1RA 3FUTA 3T38A 3KDSE 4JXJA 2UUAM 2JA2A 2V1UA 4LF9M 2M60A 3KOZE 3GLHB 4AG6A 3M6AA 5KPTA 1DO0A 2V6ZM 1NHWC 2QENA 5ITTA 1K3WA 4A3VB 4LJ8A 1NHGC 2UU9M 1E9SA 2DXIA 3K92A 4I8OA 3KP1E 1JR3D 3CF0A 1N34M 3AOEC 5IZ7D 2J7NA 4GITA 1Q39A 2D7GA 3L27A 3L25A 3PNYA 2AHMA 3B9PA 4QNRA 3RGPA 3A98B 4B3RM 1HT2E 2Y20A 3GPPA 2RGHA 3TWLA 3GLFB 1I4WA 1G8PA 1NSFA 4LJ7A 4LGMA 4AQYM 3KFUG 4NL4H 4DR3M 3U6EA 1QVRA 1NNUC 3SARA 4LGYA 3M0EA 2HKJA 2XSZA 3VKHA 2CFOA 4JI6M 2EUCA 1Z6TA 2CEAA 2UXBM 3GRYA 4MH0E 5EP3A 4X62M 2C96A 7CATA 3GPXA 1SXJB 3L29A 5DNYA 3SAWA 1HNXM 1HNZM 2RKOA 5F3WA 5ITRA 4FCTA 5EP1A 4R3DA 1SXJE 2F5NA 2QCUA 2I7NA 3HU3A 4G4QA 1QYRA 4QNMA 3R9XB 3U6OA 3AJIB 2R4EA 3TQSA 3CTWB 3HHZA 4QOZC 4K0KM 3KOWE 2A5YB 4NSOB 2FNAA 3U6QA 3VDPA 1L1ZA 5IWAM 3WHKA 1NNJA 4MGHA 3I4YA 2XZFA 3FUXA 3KS8A 3HHYA 1TH3A 2M5ZA 3JR5A 3ZC7B 2YNMD 2QZ4A 3IG8A 4G4OA 3SBJA 4TUWA 1DGFA 5ITXA 4X66M 4MGKE 4DR5M 2KRUA 3HWSA 1IN8A 2DWZB 4IBKA 5C18A 2C9CA 1GLNA 2LNHC 3UMMA 2DWLA 4CGYB 5KQ8A 4XGIA 2BNKA 4B08A 2VQFM 1KSFX 4DV1M 4JI3M 4PD2A 3U6CA 4LJ9A 3SYKA 4LFAM 2Y0QA 1GL7A 1PJIA 2BJVA 1N33M 4JI0M 1SXJC 3LVWA 3UGJA 4BBAA 4FW9A 3J7AS 3PVSA 1HQYE 3DA1A 2LWXA 4MGIE 3PXGA 4GIPA 1L1TA 4LZJA 2C99A 3RE8A 1IXZA 4FVMA 4IBFA 2UUCM 5EQTA 3GLHA 3FD9A 2KZUA 3U5ZB 2X49A 5BPVA 4OX9M 3SAVA 3Q8XA 5KPRA 3J7BA 1XNQM 3GLFA 3U6LA 2DHRA 1XHBA 3TL4X 5LMNM 2UXDM 4OVZB 5FTJA 2L6OA 2XSZD 3AOEA 4X64M 3GLIB 2VQEM 3MJ5A 4RNAA 4PCZA 1H6UA 1JQJC 4IBJA 3HJSA 2XH9A 5IT9S 2FFJA 4M9XA 3TE6A 2F5PA 4KHPM 1C1KA 2R18A 4FD2A 2P5TA 2F5OA 1Z5AA 1XMQM 3AKZA 2VIIA 2J7OA 2E5LM 1WXQA 5ITXE 4IJEA 1N75A 2XFSA 2D7HA 3SASA 1MU5A 1KYIA 4LF7M 1XXHB 1JR3A 4HLQA 2Y0TA 5EJCA 3EIHA 1D2NA 4JV5M 3T1HM 4PT5A 1NY6A 4DUYM 1XWIA 4PDGA 1IN4A 2CE7A 4LFCM 2ZAOA 4KLNA 2EA0A 1ZAEA 4EIWA 3HKPA 2KXEA 3J2PB 3KOYE 4KO8A 5EXSA 4LF8M 3FYCA 3U6PA 2G5GX 4IBBA 4AKIA 5FTKA 2I7PA 2CUZA 3GQ3A 1L2BA 4B7HA 2XGNA 3GQ5A 1R6BX 1VDDA 2C9OA 1G4AE 4G6ZA 1IBLM 4LF6M 4II7A 3VK7A 1PJJA 2O5RA 2OPFA 1N36M 2X8AA 3KVWA 1DO2A 3K2LA 3J81S 3FKEA 3K8ZA 3KSXA 5E6JA 3QAUA 1LV7A 1EE8A 4AW4A 1DGBA 4M0DA 2Y21A 2KEBA 2CV0A 4NXMM 2R45A 1Z59A 4REZA 3U6MA 4X65M 2ZM6M 4GKJM 3A42A 4B7GA 3JAMS 5ITUA 3SHGB 1K3XA 3DFZA 4DR1M 4G4RA 3U5ZA 3A46A 1IXSB 4DV6M 4NOOB 5EXPA 3VDUA 2R65A 4GHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHG A;  4LRS A;  2QBY A;  1SXJ C;  4L15 A;  4LJ6 A;  5JI3 E;  1HQC A;  4FW9 A;  3DZD A;  2R62 A;  3PVS A;  1HQY E;  2C98 A;  3GLG B;  1HT1 E;  3PXG A;  3ZH9 B;  3VLF B;  4D81 A;  2C99 A;  1L8Q A;  5EP4 A;  1IXZ A;  1J7K A;  3KDS E;  2DVW B;  3GLH A;  5EQT A;  3U5Z B;  2V1U A;  5DYG A;  1W5S A;  3GLH B;  1XXH A;  3M6A A;  1DO0 A;  1QZM A;  1IQP A;  2CHV A;  1G41 A;  2V6Z M;  3GLF A;  2DHR A;  2QEN A;  5JI2 E;  4KOD A;  2DZN B;  2QP9 X;  1E32 A;  5FTJ A;  4A3V B;  2XSZ D;  4LJ8 A;  3GLI B;  3SYL A;  1IXR C;  1JR3 D;  3CF0 A;  1W5T A;  1JQJ C;  4GIT A;  4QNR A;  3B9P A;  5EP2 A;  2CHQ A;  1HT2 E;  1C1K A;  4FD2 A;  5EXX A;  3GLF B;  3WHL A;  1OFH A;  2DZO B;  2VII A;  1NSF A;  4D80 A;  4LJ7 A;  4LGM A;  3EIE A;  3U60 B;  4FCV A;  1QVR A;  3SC3 A;  5C1B A;  4QHT A;  4L4U A;  1KYI A;  4ZPX A;  1XXH B;  1JR3 A;  3M0E A;  4L16 A;  3KW6 A;  3EIH A;  1D2N A;  1NJF A;  3UK6 A;  2XSZ A;  3CF2 A;  3H4M A;  1IN5 A;  1NY6 A;  4WW0 A;  1IY2 A;  2BJW A;  4LCB A;  1XWI A;  2CEA A;  1IN4 A;  3MHV C;  2CE7 A;  4LJ4 A;  2ZAO A;  4KLN A;  4EIW A;  5EP3 A;  3K1J A;  2C96 A;  5FTM A;  4KO8 A;  1SXJ B;  1R7R A;  1S3S A;  5EXS A;  2RKO A;  4LZZ A;  2QPA A;  4FCT A;  5EP1 A;  4LRT A;  1OJL A;  5FTK A;  1SXJ E;  4FWD A;  3HU3 A;  4QNM A;  5FTL A;  4FWH A;  3AJI B;  1FNN A;  1R6B X;  2C9O A;  1NJG A;  1G4A E;  2ZAM A;  3HU1 A;  4Z8X A;  4FCW A;  2FNA A;  1IN6 A;  2Z4S A;  2X8A A;  1DO2 A;  5FTN A;  1NY5 A;  3WHK A;  4QHS A;  5EXT A;  1LV7 A;  1IN7 A;  4LJ5 A;  4LJA A;  3GLI A;  3HU2 A;  4I4L A;  2QZ4 A;  1E94 E;  1OFI A;  1SXJ A;  4FWG A;  2KRK A;  2Z4R A;  1G3I A;  3HWS A;  1IN8 A;  2QBY B;  2DWZ B;  5DYI A;  4D82 A;  3D8B A;  4QOS A;  5C18 A;  2C9C A;  1SXJ D;  3BOS A;  3PFI A;  4JN6 A;  1IY0 A;  4LY6 A;  1KSF X;  1IM2 A;  4LJ9 A;  1NVM A;  1IXS B;  2HCB A;  3SYK A;  5EXP A;  3U61 B;  3R8F A;  1IY1 A;  3GLG A;  1UM8 A;  1X37 A;  2R65 A;  3VFD A;  2BJV A;  4I81 A;  2ZAN A; 
#chains in the Genus database with same CATH topology
 1E9R A;  2MJ5 B;  4LJ6 A;  1QUS A;  3IHP A;  4M9Z A;  4NRV A;  1HQC A;  3TPZ A;  4JYA M;  2UXC M;  2R62 A;  2Z3X A;  4B3S M;  2C98 A;  4GRI A;  1J5E M;  1XB2 B;  1HT1 E;  3HZJ A;  2HHH M;  3TWM A;  3LQR A;  1FJG M;  2HWJ A;  1QAO A;  3C58 A;  4RF1 A;  2KW0 A;  3SHF A;  2DWM A;  2DAE A;  3AV0 A;  2G3Q A;  1GO5 A;  5DYG A;  2XLJ A;  4S12 A;  1QZM A;  1G41 A;  2YQZ A;  3LQQ A;  2L2D A;  1OIP A;  4OW0 A;  2LBC A;  1V92 A;  4PDI A;  2DZN B;  4F1I A;  2QP9 X;  1PJT A;  1E32 A;  2DWN A;  1RU3 A;  4AKG A;  5LMU M;  3T1Y M;  3HHX A;  4DBG B;  1VEG A;  4MGZ E;  1TTE A;  2B3T A;  3AOG A;  2R4J A;  4AI6 A;  4JI2 M;  3I51 A;  1GAB A;  2JY8 A;  2JP7 A;  1PRB A;  2JY7 A;  2NQ8 C;  2Z8Y M;  2LVQ D;  1NV9 A;  3W0F A;  3UJN A;  4DV0 M;  1OFH A;  3U61 A;  2F5Q A;  2Q2E B;  2JWS A;  3HGI A;  1P3Q Q;  2K47 A;  2JNH A;  1QAN A;  3GPY A;  3FTF A;  3EIE A;  1Q3C A;  3SFZ A;  3TWK A;  1OAO C;  4QHT A;  1T6O A;  4ZPX A;  1HJP A;  3W0L B;  3B89 A;  3KSJ A;  1PM5 A;  1L2D A;  2ZTD A;  3KW6 A;  2X4A A;  3QWL A;  4F2L A;  1NJF A;  3UK6 A;  1MJG M;  1V34 A;  3CF2 A;  4DV3 M;  3FRI A;  3E4R A;  4IBG A;  1IN5 A;  3NWL A;  4GC9 A;  1IY2 A;  4LCB A;  4IJF A;  1ZQ9 A;  1GVN A;  4GH9 A;  3SMS A;  2MH8 A;  4ANR A;  2F5S A;  4LF5 M;  5ITY A;  3THG A;  4YY3 M;  5GKN A;  2KA6 B;  2MRO B;  2FE8 A;  4OVZ A;  3SMP A;  3K1J A;  4CIZ A;  2RGO A;  3LW5 F;  1N78 A;  3OTO M;  1R7R A;  1S3S A;  2YR0 A;  4DV5 M;  4L78 A;  2YFQ A;  2L7H A;  3Q8G A;  4LRT A;  3M7G A;  2OOA A;  2GQF A;  3L26 A;  1DV0 A;  2KZS A;  3LCU A;  4XBO A;  5FTL A;  1FNN A;  3BXW A;  1NJG A;  2ZAM A;  1L2C A;  3FTE A;  4KT0 F;  4FCW A;  4RKU F;  4LG2 A;  1IN6 A;  3HJ8 A;  3L28 A;  1NY5 A;  3NBI A;  1J09 A;  1OQY A;  3HHW A;  1IN7 A;  4LJ5 A;  1YSY A;  1QAM A;  3DOA A;  2VDB B;  4YHH M;  3FUW A;  4RF0 A;  3HU2 A;  3GLI A;  2UUB M;  4I4L A;  3GRU A;  4GMQ A;  2KDL A;  2KRK A;  2Z4R A;  1KFV A;  1XC8 A;  1G3I A;  1NV8 A;  2EJS A;  2L7I A;  2QBY B;  5DYI A;  4D82 A;  3D8B A;  1GJT A;  1I94 M;  4MB7 A;  3L25 A;  2WZJ A;  3GO8 A;  3E21 A;  3U6S A;  1JR3 E;  3LVV A;  4IBI A;  1SXJ D;  3PFI A;  4JN6 A;  5L8R F;  1IY0 A;  2K0B X;  1HR0 M;  4AKH A;  4LY6 A;  4B3M M;  1IM2 A;  2HCB A;  2WSC F;  3U61 B;  4DR4 M;  2K6B A;  2JZ1 A;  1UM8 A;  1X37 A;  3VFD A;  4CJ6 A;  1IXS A;  4MM3 B;  2ZAN A;  2CHG A;  3GRV A;  4CIS A;  4I5S A;  2L09 A;  1YUB A;  5JI3 E;  3LCV B;  1YE9 A;  3CGW A;  3DZD A;  4GKK M;  3SAT A;  3ZH9 B;  2ERC A;  2ZBK B;  2OO9 A;  3KP0 E;  3HX3 A;  5EP4 A;  2CV2 A;  3KS4 A;  3GP1 A;  1ZV1 A;  2F4V M;  2W82 A;  2DVW B;  2K9D A;  3SAU A;  1Z5C A;  1D0K A;  4R7G A;  3JR4 A;  1W5S A;  1T3T A;  2R0I A;  1XXH A;  5KO3 A;  4DV2 M;  1WIV A;  1IQP A;  2CHV A;  5IRE B;  2VF7 A;  5JI2 E;  3VK8 A;  4KOD A;  4LF4 M;  1R2Y A;  1HNW M;  4IBD A;  3T15 A;  1QAQ A;  4MGY E;  1IXR C;  3HY5 A;  3SYL A;  3AL0 C;  3VKG A;  5A2Q S;  5H37 D;  1W5T A;  2XEP A;  4P17 A;  4Z6Y A;  3U6D A;  1VDL A;  1IBM M;  1N77 A;  1TH2 A;  2DAM A;  2L4F A;  3NBX X;  4CHT B;  2APL A;  4DR2 M;  4NRW A;  3E9S A;  5EP2 A;  3GPU A;  2CHQ A;  4Q7J A;  4JI8 M;  2JUJ A;  3IG5 A;  4NXN M;  2XF3 A;  5FSW A;  5EXX A;  5FLX S;  3WHL A;  3I4V A;  2DZO B;  1MX0 A;  2LXE A;  4D80 A;  4JI7 M;  2HL7 A;  3K9P A;  4DR7 M;  3J27 B;  1Q3B A;  3U60 B;  4FCV A;  3J80 S;  4WUR A;  5ITQ A;  3SC3 A;  4IBC A;  5C1B A;  2R46 A;  4L4U A;  4L16 A;  3MK6 A;  3RFW A;  3L2A A;  3UZU A;  1N32 M;  1Q02 A;  2G8L A;  2V1C A;  2C5R A;  1AUA A;  1K82 A;  3H4M A;  1D0M A;  1ZMW A;  3CF6 E;  1QZE A;  4WW0 A;  2BJW A;  1IFY A;  3MHV C;  3FUU A;  3QYB A;  4LJ4 A;  3I04 M;  4P16 A;  5KPZ A;  1Z5B A;  4XK8 F;  4G4N A;  1GJS A;  3PNV A;  1GKI A;  1CUK A;  3D8L A;  5FTM A;  4BLC A;  2XZU A;  4JI1 M;  1F4I A;  1ORY B;  4JI4 M;  2DHY A;  1WJ7 A;  4LZZ A;  2QPA A;  1XNR M;  1WHC A;  1TDZ A;  1AIP C;  1OJL A;  4ITQ A;  3HJQ A;  4FWD A;  4AG5 A;  4AZF A;  2OQ4 A;  4DV4 M;  2XFT A;  4FWH A;  5BR8 M;  4B7F A;  3U60 A;  3HU1 A;  3FTD A;  4Z8X A;  3FYD A;  4OU7 A;  2FS1 A;  2Z4S A;  5FTN A;  3GQ4 A;  4G3O A;  4QHS A;  2JZ0 A;  3KOX E;  3A45 A;  5E26 A;  5EXT A;  1QQW A;  4LJA A;  2DEN A;  1OAI A;  5KQD A;  4B3T M;  2EO2 A;  2Z7J A;  1E94 E;  1OFI A;  4DV7 M;  1XMO M;  2WSF F;  4IBE A;  1G59 A;  1SXJ A;  4FWG A;  2WSE F;  2QHO B;  2QNJ A;  4L8R C;  3RGS A;  4DUZ M;  2MGW A;  3AFH A;  1R2Z A;  3B7Q A;  2HAK A;  2FOI C;  1DGH B;  4JI5 M;  4DR6 M;  4QOS A;  4GHL A;  8CAT A;  3GRR A;  1LTM A;  1TGU A;  3ZCB B;  3BOS A;  4M9S A;  4L6V 6;  4GC5 A;  1DGG A;  1DGH A;  1NVM A;  3R8F A;  1IY1 A;  3LMM A;  3T6P A;  3C9P A;  3GLG A;  3ILK A;  4BB9 A;  4NC6 A;  4I81 A;  1OKS A;  4LRS A;  1TH4 A;  3FUV A;  2D7E A;  2QBY A;  4L15 A;  4M0W A;  1TDH A;  1IBK M;  4HL4 A;  3KXE C;  1R4G A;  2JY6 B;  2LH0 A;  4NSR A;  3GLG B;  3VLF B;  2CV1 A;  1T43 A;  4W5W A;  2RRU A;  4LFB M;  4D81 A;  3FTC A;  1SG9 A;  1GL6 A;  1L8Q A;  4WP2 A;  4IIW A;  1VEK A;  1J7K A;  2H1R A;  3FUT A;  2OOB A;  3T38 A;  2JY5 A;  2LVA A;  3KDS E;  4JXJ A;  1Y8G A;  2ZTC A;  2UUA M;  2JA2 A;  2V1U A;  1ZMV A;  4LF9 M;  2M60 A;  3KOZ E;  3GLH B;  4AG6 A;  3M6A A;  5KPT A;  1DO0 A;  2GNO A;  1NHW C;  2V6Z M;  1OTR A;  2CWB A;  2L4E A;  2QEN A;  2QSF X;  5ITT A;  2DAI A;  1K3W A;  4A3V B;  4LJ8 A;  1NHG C;  2UU9 M;  1E9S A;  2H5X A;  2DXI A;  3K92 A;  4I8O A;  3KP1 E;  1JR3 D;  3CF0 A;  1WR1 B;  1N34 M;  3AOE C;  5IZ7 D;  2J7N A;  4GIT A;  1Q39 A;  2D7G A;  2KNA A;  3FRH A;  3L27 A;  2AHM A;  3B9P A;  3MMP A;  3PNY A;  4QNR A;  3A98 B;  3RGP A;  4B3R M;  1HT2 E;  1WGN A;  2Y20 A;  3GPP A;  2RGH A;  3TWL A;  3GLF B;  2LVO C;  1I4W A;  3FE3 A;  1G8P A;  1NSF A;  4LJ7 A;  4LGM A;  4AQY M;  3KFU G;  2MR9 A;  4NL4 H;  2BWE A;  3C3E A;  4DR3 M;  3U6E A;  1QVR A;  3H4J A;  2R6F A;  1NNU C;  3SAR A;  1D0L A;  4LGY A;  3M0E A;  2HKJ A;  2XSZ A;  1EFU B;  3VKH A;  2O25 A;  2CFO A;  4JI6 M;  2LHG A;  2VF8 A;  2EUC A;  1Z6T A;  2CEA A;  2UXB M;  3GRY A;  4HEO A;  4MH0 E;  5EP3 A;  4UN2 B;  2C96 A;  7CAT A;  4X62 M;  3GPX A;  1SXJ B;  3L29 A;  5DNY A;  3SAW A;  1HNX M;  1HNZ M;  2JXN A;  2RKO A;  5F3W A;  5ITR A;  4FCT A;  5EP1 A;  4R3D A;  1SXJ E;  2F5N A;  1BVS A;  2QCU A;  2I7N A;  3HU3 A;  4G4Q A;  1QYR A;  4QNM A;  3R9X B;  3U6O A;  3AJI B;  2R4E A;  3TQS A;  3CTW B;  3HHZ A;  4QOZ C;  4K0K M;  1TR8 A;  2A5Y B;  3KOW E;  4NSO B;  2FNA A;  2KHH A;  2DZL A;  3U6Q A;  3VDP A;  1L1Z A;  5IWA M;  3WHK A;  1NNJ A;  4MGH A;  1PJQ A;  3I4Y A;  2XZF A;  3FUX A;  3KS8 A;  3GLG E;  3HHY A;  3BBZ A;  1TH3 A;  2M5Z A;  3JR5 A;  3ZC7 B;  2YNM D;  2QZ4 A;  3IG8 A;  4G4O A;  3SBJ A;  4TUW A;  2BWB A;  3V76 A;  1DGF A;  3B7Z A;  5ITX A;  4X66 M;  4MGK E;  4DR5 M;  2KRU A;  2LHC A;  1IN8 A;  3HWS A;  2DWZ B;  4IBK A;  5C18 A;  2C9C A;  1GLN A;  1TF0 B;  2LNH C;  3UMM A;  2DWL A;  2DAK A;  2DKL A;  2CP8 A;  3ZQJ A;  4CGY B;  5KQ8 A;  2R44 A;  4Y28 F;  4XGI A;  2BNK A;  4B08 A;  2VQF M;  1KSF X;  4DV1 M;  4JI3 M;  4PD2 A;  1VG5 A;  3U6C A;  4LJ9 A;  2DAG A;  3SYK A;  1QDT A;  3I01 M;  4LFA M;  2Y0Q A;  1GL7 A;  1PJI A;  2BJV A;  1N33 M;  1NO1 A;  1YLA A;  1ZMU A;  4JI0 M;  1SXJ C;  1WGL A;  3LVW A;  3UGJ A;  3W68 A;  4FW9 A;  4BBA A;  3J7A S;  3PVS A;  1HQY E;  3DA1 A;  2LWX A;  2N35 A;  4MGI E;  3PXG A;  4GIP A;  1L1T A;  4LZJ A;  2C99 A;  3B7N A;  3RE8 A;  1IXZ A;  4FVM A;  4IBF A;  2UUC M;  2LVN C;  1VEJ A;  1R5L A;  5EQT A;  3GLH A;  3FD9 A;  2KZU A;  3U5Z B;  2LTU A;  2X49 A;  5BPV A;  4OX9 M;  2J5Y A;  3SAV A;  3Q8X A;  5KPR A;  1V33 A;  3J7B A;  1XNQ M;  3GLF A;  3U6L A;  2DHR A;  1XHB A;  1G71 A;  1OIZ A;  2LVP C;  3TL4 X;  5LMN M;  2UXD M;  4OVZ B;  5FTJ A;  1EIJ A;  2L6O A;  2XSZ D;  3AOE A;  4X64 M;  3GLI B;  2VQE M;  3MJ5 A;  4RNA A;  4PCZ A;  1H6U A;  1JQJ C;  4IBJ A;  3HJS A;  2XH9 A;  2O01 F;  1UFZ A;  5IT9 S;  2FFJ A;  4M9X A;  3B74 A;  3TE6 A;  2F5P A;  1C1K A;  4KHP M;  2R18 A;  4FD2 A;  2P5T A;  5DFL A;  1Z5A A;  2F5O A;  1XMQ M;  3AKZ A;  2VII A;  2J7O A;  2E5L M;  1WXQ A;  2KNZ A;  5ITX E;  4IJE A;  1N75 A;  2XFS A;  2D7H A;  3SAS A;  1MU5 A;  1KYI A;  1VQ1 A;  4LF7 M;  1XXH B;  1JR3 A;  4HLQ A;  2Y0T A;  5EJC A;  3EIH A;  1D2N A;  4JV5 M;  3T1H M;  1C7Y A;  4PT5 A;  1NY6 A;  4DUY M;  1XWI A;  4PDG A;  1IN4 A;  1PGY A;  2CE7 A;  1XXH E;  4LFC M;  2ZAO A;  4KLN A;  2EA0 A;  1ZAE A;  4EIW A;  2KNV A;  3HKP A;  2KXE A;  3J2P B;  3KOY E;  4KO8 A;  3C3D A;  5EXS A;  3K9O A;  4LF8 M;  3FYC A;  3U6P A;  2G5G X;  2DI0 A;  4IBB A;  4AKI A;  5FTK A;  1JB0 F;  2CUZ A;  2I7P A;  3GQ3 A;  3F92 A;  1L2B A;  2QQ8 A;  4B7H A;  2XGN A;  3GQ5 A;  2CRU A;  1R6B X;  1VDD A;  2C9O A;  1G4A E;  4G6Z A;  1IBL M;  3E46 A;  4LF6 M;  4II7 A;  3VK7 A;  1PJJ A;  2O5R A;  2OPF A;  1N36 M;  2EKK A;  2X8A A;  3KVW A;  1DO2 A;  3K2L A;  3J81 S;  3FKE A;  2FH0 A;  3K8Z A;  3KSX A;  5E6J A;  2DNA A;  1LV7 A;  1QDR A;  3QAU A;  1EE8 A;  1MN3 A;  4AW4 A;  1DGB A;  4M0D A;  4R71 A;  2Y21 A;  2KEB A;  2CV0 A;  4NXM M;  2R45 A;  1Z59 A;  4REZ A;  3U6M A;  4X65 M;  2ZM6 M;  4GKJ M;  1QUT A;  3A42 A;  4B7G A;  3JAM S;  5ITU A;  3SHG B;  3W67 A;  1K3X A;  1PJS A;  1A5T A;  3DFZ A;  4GEW A;  4G4R A;  4DR1 M;  3QYE A;  3IEC A;  3U5Z A;  2EKF A;  3A46 A;  3GLF E;  1IXS B;  3GLI E;  4NOO B;  5EXP A;  4DV6 M;  3GLH E;  3VDU A;  2R65 A;  4GHA A; 
#chains in the Genus database with same CATH homology
 1E9R A;  4LJ6 A;  4NRV A;  4M9Z A;  4JYA M;  2UXC M;  1HQC A;  3TPZ A;  2R62 A;  2Z3X A;  4B3S M;  2C98 A;  4GRI A;  1J5E M;  1HT1 E;  2HHH M;  3TWM A;  3LQR A;  1FJG M;  1QAO A;  3C58 A;  4RF1 A;  2KW0 A;  3SHF A;  2DWM A;  3AV0 A;  5DYG A;  2XLJ A;  4S12 A;  1QZM A;  1G41 A;  2YQZ A;  3LQQ A;  4OW0 A;  4PDI A;  2DZN B;  2QP9 X;  1E32 A;  2DWN A;  4AKG A;  5LMU M;  3T1Y M;  3HHX A;  4MGZ E;  3AOG A;  2R4J A;  4AI6 A;  4JI2 M;  3I51 A;  2NQ8 C;  3W0F A;  3UJN A;  4DV0 M;  1OFH A;  3U61 A;  2F5Q A;  2Q2E B;  3HGI A;  2K47 A;  3GPY A;  1QAN A;  3FTF A;  3EIE A;  1Q3C A;  3SFZ A;  3TWK A;  4QHT A;  4ZPX A;  3W0L B;  3KSJ A;  1PM5 A;  1L2D A;  3KW6 A;  2X4A A;  3QWL A;  1NJF A;  3UK6 A;  3CF2 A;  4DV3 M;  3E4R A;  4IBG A;  1IN5 A;  3NWL A;  4GC9 A;  1IY2 A;  4LCB A;  4IJF A;  1ZQ9 A;  1GVN A;  4GH9 A;  3SMS A;  2F5S A;  4LF5 M;  5ITY A;  3THG A;  4YY3 M;  5GKN A;  2KA6 B;  4OVZ A;  2FE8 A;  3SMP A;  3K1J A;  2RGO A;  1N78 A;  3OTO M;  1R7R A;  1S3S A;  2YR0 A;  4DV5 M;  4L78 A;  2YFQ A;  2L7H A;  4LRT A;  3M7G A;  3L26 A;  2KZS A;  4XBO A;  5FTL A;  1FNN A;  1NJG A;  2ZAM A;  1L2C A;  3FTE A;  4FCW A;  4LG2 A;  1IN6 A;  3HJ8 A;  3L28 A;  1NY5 A;  3NBI A;  1J09 A;  3HHW A;  1IN7 A;  4LJ5 A;  1YSY A;  1QAM A;  3DOA A;  4YHH M;  3GLI A;  3FUW A;  4RF0 A;  3HU2 A;  2UUB M;  4I4L A;  3GRU A;  4GMQ A;  2KRK A;  2Z4R A;  1KFV A;  1XC8 A;  1G3I A;  2L7I A;  2QBY B;  5DYI A;  4D82 A;  3D8B A;  1I94 M;  4MB7 A;  3GO8 A;  3U6S A;  4IBI A;  3LVV A;  1SXJ D;  3PFI A;  4JN6 A;  1IY0 A;  1HR0 M;  4AKH A;  4LY6 A;  4B3M M;  1IM2 A;  2HCB A;  4DR4 M;  3U61 B;  1UM8 A;  1X37 A;  3VFD A;  4MM3 B;  2ZAN A;  2CHG A;  3GRV A;  4CIS A;  4I5S A;  2L09 A;  1YUB A;  5JI3 E;  1YE9 A;  3DZD A;  4GKK M;  3SAT A;  3ZH9 B;  2ERC A;  2ZBK B;  3KP0 E;  5EP4 A;  2CV2 A;  3KS4 A;  3GP1 A;  2F4V M;  2W82 A;  2DVW B;  3SAU A;  1Z5C A;  4R7G A;  3JR4 A;  1W5S A;  1T3T A;  5KO3 A;  1XXH A;  4DV2 M;  2CHV A;  1IQP A;  5IRE B;  3VK8 A;  5JI2 E;  4KOD A;  4LF4 M;  1R2Y A;  1HNW M;  4IBD A;  3T15 A;  1QAQ A;  4MGY E;  1IXR C;  3SYL A;  3AL0 C;  3VKG A;  5A2Q S;  5H37 D;  1W5T A;  2XEP A;  1IBM M;  4Z6Y A;  3U6D A;  1N77 A;  1TH2 A;  4CHT B;  4DR2 M;  4NRW A;  3E9S A;  5EP2 A;  3GPU A;  2CHQ A;  4JI8 M;  3IG5 A;  4NXN M;  2XF3 A;  5FSW A;  5EXX A;  5FLX S;  3WHL A;  3I4V A;  2DZO B;  1MX0 A;  2LXE A;  4D80 A;  4JI7 M;  2HL7 A;  4DR7 M;  3J27 B;  1Q3B A;  3U60 B;  4FCV A;  3J80 S;  4WUR A;  5ITQ A;  3SC3 A;  4IBC A;  5C1B A;  2R46 A;  4L4U A;  4L16 A;  3MK6 A;  3RFW A;  3L2A A;  3UZU A;  1N32 M;  2G8L A;  2V1C A;  2C5R A;  1K82 A;  3H4M A;  3CF6 E;  4WW0 A;  2BJW A;  3MHV C;  3FUU A;  4LJ4 A;  4P16 A;  4G4N A;  5KPZ A;  1Z5B A;  3PNV A;  1GKI A;  3D8L A;  5FTM A;  4BLC A;  2XZU A;  4JI1 M;  1ORY B;  4JI4 M;  4LZZ A;  2QPA A;  1XNR M;  4ITQ A;  1TDZ A;  1OJL A;  3HJQ A;  4FWD A;  4AG5 A;  4AZF A;  2OQ4 A;  4DV4 M;  2XFT A;  4FWH A;  5BR8 M;  4B7F A;  3U60 A;  3HU1 A;  3FTD A;  4Z8X A;  3FYD A;  4OU7 A;  2Z4S A;  5FTN A;  3GQ4 A;  4QHS A;  3KOX E;  3A45 A;  5E26 A;  5EXT A;  1QQW A;  4LJA A;  5KQD A;  4B3T M;  2EO2 A;  2Z7J A;  1E94 E;  1OFI A;  4DV7 M;  1XMO M;  1G59 A;  4IBE A;  1SXJ A;  4FWG A;  4L8R C;  3RGS A;  4DUZ M;  3AFH A;  1R2Z A;  2FOI C;  1DGH B;  4JI5 M;  4DR6 M;  4QOS A;  4GHL A;  8CAT A;  3GRR A;  1TGU A;  3ZCB B;  3BOS A;  4M9S A;  4GC5 A;  1DGG A;  1DGH A;  1NVM A;  3R8F A;  1IY1 A;  3LMM A;  3GLG A;  3ILK A;  4BB9 A;  4I81 A;  4LRS A;  1TH4 A;  3FUV A;  2D7E A;  2QBY A;  4L15 A;  4M0W A;  1TDH A;  1IBK M;  4HL4 A;  3KXE C;  2LH0 A;  4NSR A;  3GLG B;  3VLF B;  2CV1 A;  4LFB M;  4W5W A;  4D81 A;  3FTC A;  1GL6 A;  1L8Q A;  4IIW A;  1J7K A;  2H1R A;  3FUT A;  3T38 A;  3KDS E;  4JXJ A;  2UUA M;  2JA2 A;  2V1U A;  4LF9 M;  2M60 A;  3KOZ E;  3GLH B;  4AG6 A;  3M6A A;  5KPT A;  1DO0 A;  2V6Z M;  1NHW C;  2QEN A;  5ITT A;  1K3W A;  4A3V B;  4LJ8 A;  1NHG C;  2UU9 M;  1E9S A;  2DXI A;  3K92 A;  4I8O A;  3KP1 E;  1JR3 D;  3CF0 A;  1N34 M;  3AOE C;  5IZ7 D;  2J7N A;  4GIT A;  1Q39 A;  2D7G A;  3L27 A;  3L25 A;  3PNY A;  2AHM A;  3B9P A;  4QNR A;  3RGP A;  3A98 B;  4B3R M;  1HT2 E;  2Y20 A;  3GPP A;  2RGH A;  3TWL A;  3GLF B;  1I4W A;  1G8P A;  1NSF A;  4LJ7 A;  4LGM A;  4AQY M;  3KFU G;  4NL4 H;  4DR3 M;  3U6E A;  1QVR A;  1NNU C;  3SAR A;  4LGY A;  3M0E A;  2HKJ A;  2XSZ A;  3VKH A;  2CFO A;  4JI6 M;  2EUC A;  1Z6T A;  2CEA A;  2UXB M;  3GRY A;  4MH0 E;  5EP3 A;  4X62 M;  2C96 A;  7CAT A;  3GPX A;  1SXJ B;  3L29 A;  5DNY A;  3SAW A;  1HNX M;  1HNZ M;  2RKO A;  5F3W A;  5ITR A;  4FCT A;  5EP1 A;  4R3D A;  1SXJ E;  2F5N A;  2QCU A;  2I7N A;  3HU3 A;  4G4Q A;  1QYR A;  4QNM A;  3R9X B;  3U6O A;  3AJI B;  2R4E A;  3TQS A;  3CTW B;  3HHZ A;  4QOZ C;  4K0K M;  3KOW E;  2A5Y B;  4NSO B;  2FNA A;  3U6Q A;  3VDP A;  1L1Z A;  5IWA M;  3WHK A;  1NNJ A;  4MGH A;  3I4Y A;  2XZF A;  3FUX A;  3KS8 A;  3HHY A;  1TH3 A;  2M5Z A;  3JR5 A;  3ZC7 B;  2YNM D;  2QZ4 A;  3IG8 A;  4G4O A;  3SBJ A;  4TUW A;  1DGF A;  5ITX A;  4X66 M;  4MGK E;  4DR5 M;  2KRU A;  3HWS A;  1IN8 A;  2DWZ B;  4IBK A;  5C18 A;  2C9C A;  1GLN A;  2LNH C;  3UMM A;  2DWL A;  4CGY B;  5KQ8 A;  4XGI A;  2BNK A;  4B08 A;  2VQF M;  1KSF X;  4DV1 M;  4JI3 M;  4PD2 A;  3U6C A;  4LJ9 A;  3SYK A;  4LFA M;  2Y0Q A;  1GL7 A;  1PJI A;  2BJV A;  1N33 M;  4JI0 M;  1SXJ C;  3LVW A;  3UGJ A;  4BBA A;  4FW9 A;  3J7A S;  3PVS A;  1HQY E;  3DA1 A;  2LWX A;  4MGI E;  3PXG A;  4GIP A;  1L1T A;  4LZJ A;  2C99 A;  3RE8 A;  1IXZ A;  4FVM A;  4IBF A;  2UUC M;  5EQT A;  3GLH A;  3FD9 A;  2KZU A;  3U5Z B;  2X49 A;  5BPV A;  4OX9 M;  3SAV A;  3Q8X A;  5KPR A;  3J7B A;  1XNQ M;  3GLF A;  3U6L A;  2DHR A;  1XHB A;  3TL4 X;  5LMN M;  2UXD M;  4OVZ B;  5FTJ A;  2L6O A;  2XSZ D;  3AOE A;  4X64 M;  3GLI B;  2VQE M;  3MJ5 A;  4RNA A;  4PCZ A;  1H6U A;  1JQJ C;  4IBJ A;  3HJS A;  2XH9 A;  5IT9 S;  2FFJ A;  4M9X A;  3TE6 A;  2F5P A;  4KHP M;  1C1K A;  2R18 A;  4FD2 A;  2P5T A;  2F5O A;  1Z5A A;  1XMQ M;  3AKZ A;  2VII A;  2J7O A;  2E5L M;  1WXQ A;  5ITX E;  4IJE A;  1N75 A;  2XFS A;  2D7H A;  3SAS A;  1MU5 A;  1KYI A;  4LF7 M;  1XXH B;  1JR3 A;  4HLQ A;  2Y0T A;  5EJC A;  3EIH A;  1D2N A;  4JV5 M;  3T1H M;  4PT5 A;  1NY6 A;  4DUY M;  1XWI A;  4PDG A;  1IN4 A;  2CE7 A;  4LFC M;  2ZAO A;  4KLN A;  2EA0 A;  1ZAE A;  4EIW A;  3HKP A;  2KXE A;  3J2P B;  3KOY E;  4KO8 A;  5EXS A;  4LF8 M;  3FYC A;  3U6P A;  2G5G X;  4IBB A;  4AKI A;  5FTK A;  2I7P A;  2CUZ A;  3GQ3 A;  1L2B A;  4B7H A;  2XGN A;  3GQ5 A;  1R6B X;  1VDD A;  2C9O A;  1G4A E;  4G6Z A;  1IBL M;  4LF6 M;  4II7 A;  3VK7 A;  1PJJ A;  2O5R A;  2OPF A;  1N36 M;  2X8A A;  3KVW A;  1DO2 A;  3K2L A;  3J81 S;  3FKE A;  3K8Z A;  3KSX A;  5E6J A;  3QAU A;  1LV7 A;  1EE8 A;  4AW4 A;  1DGB A;  4M0D A;  2Y21 A;  2KEB A;  2CV0 A;  4NXM M;  2R45 A;  1Z59 A;  4REZ A;  3U6M A;  4X65 M;  2ZM6 M;  4GKJ M;  3A42 A;  4B7G A;  3JAM S;  5ITU A;  3SHG B;  1K3X A;  3DFZ A;  4DR1 M;  4G4R A;  3U5Z A;  3A46 A;  1IXS B;  4DV6 M;  4NOO B;  5EXP A;  3VDU A;  2R65 A;  4GHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...