3KW6A

Crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S protease regulatory subunit 8
publication title Crystal Structure of a domain of 26S proteasome regulatory subunit 8 from homo sapiens. Northeast Structural Genomics Consortium target id HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kw6A01
1G3IA 2DZNB 2Z4SA 2C98A 3EIEA 3U60B 4FW9A 1IN4A 1FNNA 1NVMA 4KODA 3GLFA 2ZAOA 4KO8A 2CEAA 4Z8XA 1HQCA 2DVWB 2FNAA 3BOSA 1NY5A 3WHLA 4LRTA 2R65A 2C9CA 1IXZA 3HWSA 3PVSA 4JN6A 1QVRA 1IXSB 3GLGA 1IY2A 5JI2E 2DZOB 1R7RA 2CE7A 2XSZA 1SXJA 4LJ4A 4LJ8A 2QENA 4FWDA 1IN5A 3M0EA 1XXHA 3M6AA 1QZMA 1KYIA 1SXJC 5EXSA 1G41A 5FTKA 5DYIA 1IQPA 1DO0A 1S3SA 4QNRA 1HT2E 4LJAA 4GITA 3GLIA 1R6BX 2XSZD 1SXJD 5FTJA 2QP9X 3HU1A 3KDSE 1OFHA 4A3VB 2QBYB 4LJ5A 3CF2A 1IY1A 4D81A 3U61B 3HU2A 5FTLA 2ZAMA 1JQJC 3SYLA 5EP4A 1OFIA 2CHVA 2X8AA 1C1KA 1IN8A 1KSFX 1OJLA 3EIHA 4QHSA 3GLHB 3D8BA 1IN6A 1NJGA 3SC3A 3R8FA 1J7KA 3PXGA 5EXXA 2BJVA 1W5TA 2BJWA 2QZ4A 3UK6A 2RKOA 4FCVA 4FWGA 1IY0A 4D82A 1XWIA 1IM2A 3ZH9B 4L15A 4LZZA 2DWZB 1L8QA 3GLFB 4QNMA 1UM8A 2CHQA 1NY6A 3B9PA 2Z4RA 4WW0A 2VIIA 1HQYE 4EIWA 2QPAA 3MHVC 2R62A 3DZDA 5EXPA 4QHTA 4LCBA 4D80A 2V6ZM 3VFDA 2DHRA 3GLGB 1IXRC 3KW6A 1NJFA 4FWHA 3SYKA 4L4UA 4LJ7A 2C99A 1SXJB 5FTNA 5DYGA 3PFIA 4I4LA 3H4MA 3VLFB 1LV7A 2CHGA 1XXHB 1NSFA 3HU3A 3WHKA 3AJIB 1D2NA 3K1JA 5C1BA 5FTMA 5C18A 2C96A 4LJ6A 2V1UA 1IN7A 5EXTA 2QBYA 5EP3A 4L16A 5EP2A 1E94E 2KRKA 5EP1A 2ZANA 2C9OA 1G4AE 4ZPXA 3GLIB 1E32A 1JR3D 4FD2A 4LRSA 4FCWA 1W5SA 5EQTA 4QOSA 3GLHA 1DO2A 4KLNA 3U5ZB 1SXJE 1X37A 5JI3E 2HCBA 3CF0A 4LGMA 4LJ9A 1JR3A 4LY6A 4FCTA 4I81A 1HT1E
chains in the Genus database with same CATH superfamily
4UN2B 2L2DA 2Z4SA 2OQ4A 2C98A 2BNKA 3KSJA 3RE8A 3U6DA 4FW9A 1IN4A 1QAMA 4ITQA 1NVMA 5KQ8A 4IJEA 3U6LA 2OOBA 2L09A 4OX9M 3LCUA 3W0FA 2NQ8C 2F5PA 4DR2M 4LFCM 4LF4M 2LVAA 4YHHM 1H6UA 1QVRA 2UUAM 5ITYA 2HHHM 2XZFA 1N33M 3U6MA 2JZ0A 3T38A 1R7RA 2CE7A 5L8RF 2XSZA 1K3WA 4JI7M 4K0KM 2I7PA 4LJ8A 2F5NA 4LFBM 3LQQA 1N36M 3FUTA 4RNAA 1OAIA 3RFWA 3SMSA 1TDHA 3I04M 4QOZC 4KO8A 1SXJC 4JI5M 4DV4M 5F3WA 1E9RA 4G4NA 2DWMA 3KXEC 3QWLA 3DFZA 2F5SA 4KT0F 5DYIA 1DO0A 2DAIA 1WGNA 2DAEA 4CHTB 4DV6M 1OQYA 1EE8A 1N32M 4GITA 3T1YM 1VEGA 4REZA 2LNHC 3LCVB 2QP9X 5E6JA 3NBXX 2CP8A 4DV3M 2LHGA 3KS8A 2FFJA 3A98B 4OW0A 3U5ZA 3U61B 2W82A 5BPVA 5FTLA 2BWEA 1QAQA 5ITTA 3VKHA 1NHWC 1D0KA 1VEJA 2KZUA 2X8AA 1OJLA 1IN8A 3EIHA 3IG8A 1NJGA 1NV8A 3SC3A 4BBAA 3B89A 4HLQA 4NL4H 3TPZA 5EXXA 3QAUA 2BJWA 1OIZA 3KP0E 3UK6A 3AKZA 1PJQA 1GL7A 1Z6TA 2DNAA 4D82A 1F4IA 3HGIA 3HHWA 2XH9A 2JY5A 4GHLA 3GQ3A 4JI3M 3I51A 1PM5A 1NNJA 1NY6A 1Z5BA 3FUWA 2VQEM 4DR6M 3U6EA 4JI6M 3DZDA 4GHAA 4IIWA 4LCBA 5GKNA 1NHGC 3GRUA 4D80A 2UUCM 3AFHA 4L4UA 4LJ7A 1SXJB 3Q8XA 1GABA 4NSOB 3HY5A 4IBJA 3H4MA 2RGOA 3GQ4A 3TL4X 3U6CA 3SHFA 4M9SA 1WR1B 4NRWA 4X65M 3W0LB 3HU3A 5C1BA 3T1HM 5C18A 3L29A 3FRHA 1Z59A 2EO2A 2DWLA 1PJTA 5EP2A 3U61A 1RU3A 3ZCBB 4NC6A 3D8LA 1UFZA 4XK8F 4DV5M 3GLIB 4NXNM 4JI1M 4KHPM 4AKIA 2K6BA 2LVPC 4MH0E 2XFTA 3KSXA 2LXEA 1YSYA 3CGWA 1QQWA 4LF5M 3VK8A 1V34A 2KNAA 3E46A 1ORYB 3F92A 1X37A 3FYDA 4B3RM 2JP7A 3RGPA 1EIJA 4LJ9A 2JY6B 1QZEA 4IJFA 1PJSA 4LY6A 2G8LA 1QUSA 2MR9A 5KO3A 1FJGM 2KEBA 2DZNB 3J80S 4DR4M 3L25A 1XXHE 1DGHB 1TH2A 1I94M 4PCZA 5KPRA 1NV9A 2Y21A 4KODA 1TDZA 1J5EM 2F4VM 4GKJM 2J7NA 2ZAOA 2DAMA 2KRUA 2L6OA 2LHCA 3AV0A 1HQCA 2O01F 2DVWB 1WHCA 1YE9A 2EKKA 1ZV1A 2N35A 4Z8XA 2FNAA 3BOSA 1NY5A 3WHLA 5LMNM 3LW5F 2E5LM 3HJ8A 1IBKM 2L7HA 2VF7A 1HJPA 2DZOB 2XZUA 4MGHA 1SXJA 4LJ4A 1DGFA 2C5RA 4LF9M 2FH0A 1T3TA 3LVWA 4FWDA 3J27B 2XGNA 2EUCA 5EJCA 4RF1A 4G4RA 5EXSA 3J2PB 3M7GA 5KPTA 3VDUA 1G41A 2DHYA 3I4VA 5FTKA 4LF6M 4R3DA 1IQPA 4OVZB 4L8RC 4QNRA 3GPXA 3R9XB 1HT2E 3RGSA 7CATA 1K82A 3K2LA 2Y0TA 1TTEA 4HL4A 4IBEA 2JUJA 3C58A 4NOOB 1Q02A 3GLIA 2G5GX 1JB0F 2XSZD 3FUUA 4Y28F 3HU1A 1OFHA 2D7HA 4A3VB 3GO8A 2J5YA 2OO9A 3KOYE 1IY1A 1D0MA 3W67A 2R18A 4B7FA 5ITXE 3VKGA 1V33A 2F5QA 1JQJC 5DFLA 3SMPA 4CIZA 1E9SA 3JR4A 3NWLA 1ZMUA 3UJNA 1OFIA 2H1RA 2CHVA 3FRIA 2ERCA 1DGHA 4QHSA 3SASA 3FTDA 3PNYA 1N34M 2YQZA 2LVQD 3D8BA 4WURA 2JZ1A 2I7NA 3R8FA 1LTMA 1W5TA 1T6OA 4DV0M 2LBCA 2K47A 4FCVA 4GEWA 2LWXA 3NBIA 3SAUA 2F5OA 2FE8A 2K0BX 5KPZA 1IBLM 4L15A 2OOAA 1R4GA 4LZZA 2DWZB 3GLFB 5DNYA 4QNMA 5E26A 1UM8A 4M9XA 4JI8M 1PJJA 3B9PA 3OTOM 1R5LA 2DKLA 1XMQM 1J09A 4MM3B 2B3TA 2WSCF 3J7AS 3VFDA 3H4JA 3GLGB 2LVNC 2JNHA 2X4AA 3HHXA 4JYAM 1G71A 2C99A 4AQYM 3GLHE 3K92A 5FTNA 4OVZA 1TR8A 1LV7A 2LTUA 1R2YA 4HEOA 2EJSA 1Y8GA 2R6FA 1QYRA 1HR0M 2UU9M 2JY8A 5IT9S 3AJIB 1D2NA 1TH4A 1A5TA 2KW0A 2C96A 1OTRA 4IBGA 3KOWE 5EXTA 3SAWA 4L78A 3GRVA 2LVOC 3HKPA 4L16A 5LMUM 5ITRA 1E94E 3TWLA 2ZANA 3MK6A 2DAGA 2R4EA 1N75A 4R7GA 1K3XA 2CFOA 5IZ7D 4FD2A 4G4QA 4FCWA 2UUBM 4QOSA 2DXIA 4KLNA 4JI4M 2O5RA 1HNXM 5KQDA 4JI2M 2HCBA 2QNJA 3CF0A 1MX0A 1ZMVA 4YY3M 3SAVA 1R2ZA 3A42A 1L2DA 3EIEA 3U60B 3ZC7B 3GLFA 3W68A 1Q39A 3C3DA 1Q3BA 3KS4A 5IREB 4AI6A 4Z6YA 1ZMWA 2WSEF 1MU5A 4B08A 1L2BA 2X49A 4MB7A 4LRTA 2R65A 2C9CA 4GKKM 3HWSA 4M9ZA 1HNWM 1CUKA 4Q7JA 1IXSB 3DA1A 3THGA 3GRYA 3TWKA 4P16A 4B7HA 3UGJA 1IY2A 5JI2E 3FTCA 3GLGA 3C3EA 1HNZM 4LGYA 2GQFA 1Z5AA 2APLA 1DGGA 2QENA 3IECA 4W5WA 2DZLA 1IN5A 2M60A 2XEPA 3M0EA 4NRVA 5ITQA 1OAOC 1KYIA 1QZMA 2KHHA 4ANRA 1XHBA 2MROB 1ZAEA 4AG5A 1TGUA 3I01M 4MGZE 2D7EA 1IFYA 2FOIC 1S3SA 4M0DA 1XB2B 5BR8M 3LVVA 4G6ZA 2UXDM 1BVSA 1SXJD 4PDIA 1EFUB 4LZJA 4LJ5A 4XBOA 2L4FA 2WSFF 3CF2A 2CRUA 3C9PA 1MN3A 3U6PA 1ZQ9A 3HU2A 2ZAMA 2HL7A 2AHMA 2MGWA 1XNQM 5EP4A 3HHYA 3V76A 4X66M 3BBZA 2OPFA 4M0WA 3U60A 4DR7M 1DV0A 3CF6E 1KFVA 1IN6A 2CWBA 2G3QA 1J7KA 4NSRA 3SHGB 3PXGA 1DGBA 2BJVA 2R45A 2A5YB 3JR5A 4DV2M 2KNZA 2R0IA 2Q2EB 2RKOA 4FWGA 3FTEA 1XWIA 1IM2A 3AOEC 1IXSA 1V92A 2QCUA 1QANA 3ZH9B 3FYCA 1YLAA 2EKFA 2HKJA 2MJ5B 2ZTDA 2CHQA 2VDBB 4WW0A 4LG2A 1HQYE 2R4JA 4EIWA 2QPAA 3MHVC 3GPYA 4B3TM 2R62A 4QHTA 1OIPA 1L1ZA 4GRIA 2V6ZM 1Q3CA 2DHRA 3E4RA 2KZSA 1IXRC 4X62M 4LF8M 4FWHA 3SYKA 1I4WA 4CJ6A 3L27A 1PRBA 3B74A 4MGKE 1QAOA 3PFIA 4I4LA 2DWNA 3GPUA 4IBIA 3VLFB 4G4OA 2CHGA 4S12A 4LF7M 1VDDA 2L7IA 1XXHB 2J7OA 2RGHA 4BLCA 3MJ5A 4RKUF 4IBFA 3WHKA 3U6QA 4B7GA 2P5TA 3LQRA 5FTMA 4X64M 4LJ6A 1IN7A 4WP2A 2DAKA 3K8ZA 3KP1E 5EP3A 2Y0QA 4B3SM 2QHOB 3PNVA 3UMMA 3U6SA 4DUZM 1QUTA 3U6OA 4CISA 1G4AE 2YR0A 2UXBM 1E32A 1JR3D 2R44A 4LRSA 4PT5A 1XMOM 2EA0A 3HJQA 3L26A 2HWJA 4F1IA 2JA2A 1DO2A 3FD9A 2Z3XA 3GRRA 2KDLA 1SXJE 4DR1M 4G3OA 1QDTA 1JR3A 1AIPC 2V1CA 4FCTA 2O25A 4I81A 4F2LA 1G3IA 2FS1A 1L2CA 3E21A 4I8OA 1YUBA 1FNNA 4IBBA 2KA6B 2K9DA 1OKSA 2YNMD 4OU7A 3SBJA 3FE3A 4DUYM 1N78A 3SATA 1D0LA 3QYBA 2XFSA 3A45A 2WZJA 2CEAA 2CV2A 2JY7A 3HZJA 4AZFA 4AKGA 4GMQA 1XNRM 4AG6A 3VDPA 3IG5A 4AKHA 1G8PA 1IXZA 3PVSA 4JN6A 1MJGM 3GQ5A 3GLIE 1WGLA 1WJ7A 1VDLA 4DBGB 2L4EA 4GH9A 4LFAM 4XGIA 2R46A 1G59A 1VQ1A 2BWBA 3KOZE 3I4YA 2H5XA 2Z7JA 1VG5A 1XXHA 3B7QA 3M6AA 3FUXA 4JXJA 1NNUC 2MH8A 3JAMS 4PD2A 3AOGA 1GLNA 4LJAA 1TH3A 3ILKA 1GJSA 2ZBKB 1R6BX 3TQSA 2JXNA 5FTJA 4AW4A 3Q8GA 4II7A 3KDSE 3L28A 4IBDA 3CTWB 2QBYB 3VK7A 4R71A 4DV7M 5A2QS 4D81A 1NO1A 4PDGA 2DENA 3SYLA 3K9OA 3KOXE 3B7NA 3A46A 1C1KA 1KSFX 3GLHB 1TF0B 2YFQA 3AOEA 2JWSA 1AUAA 2CV0A 1JR3E 2CUZA 4GC5A 2ZTCA 5H37D 3T6PA 2QZ4A 3J7BA 3HJSA 4DV1M 1IY0A 3BXWA 2HAKA 1VEKA 1IBMM 1PGYA 3IHPA 1L8QA 2GNOA 2VQFM 2CV1A 3TE6A 3L2AA 5ITXA 3SFZA 4IBKA 2Z4RA 2LH0A 2VIIA 1SG9A 2XF3A 3GP1A 4DR3M 3QYEA 2UXCM 2XLJA 2DI0A 8CATA 5EXPA 2ZM6M 2Z8YM 3SARA 3KW6A 3J81S 1NJFA 1GL6A 1L1TA 4RF0A 4B3MM 3HHZA 4FVMA 5FLXS 2D7GA 5DYGA 2Y20A 4L6V6 1WXQA 3KFUG 4JV5M 1T43A 4MGYE 1NSFA 2VF8A 1C7YA 2KNVA 1GKIA 3MMPA 5FSWA 3K1JA 3ZQJA 2V1UA 3TWMA 1XC8A 1GO5A 2QBYA 1GJTA 3UZUA 1N77A 4CGYB 4I5SA 3FKEA 3K9PA 5ITUA 1Z5CA 2KRKA 2RRUA 3KVWA 4P17A 5EP1A 3GLFE 3HX3A 4DR5M 2C9OA 4ZPXA 4BB9A 3FTFA 1PJIA 2KXEA 2QSFX 4IBCA 1QDRA 1W5SA 5EQTA 3GPPA 3B7ZA 3DOAA 3E9SA 3LMMA 4JI0M 1P3QQ 2QQ8A 3GLHA 3GLGE 1WIVA 4GC9A 4NXMM 3U5ZB 5IWAM 5JI3E 3FUVA 4MGIE 3T15A 3AL0C 4TUWA 1GVNA 4LGMA 2M5ZA 4GIPA 1HT1E
chains in the Genus database with same CATH topology
2OQ4A 2Z4SA 2C98A 2BNKA 3KSJA 3RE8A 3U6DA 4FW9A 1IN4A 1QAMA 4ITQA 1NVMA 5KQ8A 4IJEA 3U6LA 2L09A 4OX9M 3W0FA 2NQ8C 2F5PA 4DR2M 4LFCM 4LF4M 4YHHM 1H6UA 1QVRA 2UUAM 5ITYA 2HHHM 2XZFA 1N33M 3U6MA 3T38A 1R7RA 2CE7A 1K3WA 2XSZA 4JI7M 4K0KM 2I7PA 4LJ8A 2F5NA 4LFBM 3LQQA 1N36M 3FUTA 4RNAA 3RFWA 3SMSA 1TDHA 4QOZC 1SXJC 4JI5M 4DV4M 5F3WA 1E9RA 4G4NA 2DWMA 3KXEC 3QWLA 3DFZA 2F5SA 5DYIA 1DO0A 4DV6M 4CHTB 1EE8A 1N32M 4GITA 3T1YM 4REZA 2LNHC 2QP9X 5E6JA 4DV3M 3KS8A 2FFJA 3A98B 4OW0A 3U5ZA 3U61B 2W82A 5BPVA 5FTLA 1QAQA 5ITTA 3VKHA 1NHWC 2KZUA 2X8AA 1OJLA 1IN8A 3EIHA 3IG8A 1NJGA 3SC3A 4BBAA 4HLQA 4NL4H 3TPZA 5EXXA 3QAUA 2BJWA 3KP0E 3UK6A 3AKZA 1GL7A 1Z6TA 4D82A 3HGIA 3HHWA 2XH9A 4GHLA 3GQ3A 4JI3M 3I51A 1PM5A 1NNJA 1NY6A 1Z5BA 3FUWA 2VQEM 4DR6M 3U6EA 4JI6M 3DZDA 4GHAA 4IIWA 4LCBA 5GKNA 1NHGC 3GRUA 4D80A 2UUCM 3AFHA 4L4UA 4LJ7A 1SXJB 3Q8XA 4NSOB 4IBJA 3H4MA 2RGOA 3GQ4A 3TL4X 3U6CA 3SHFA 4M9SA 4NRWA 4X65M 3W0LB 3HU3A 5C1BA 3T1HM 5C18A 3L29A 1Z59A 2EO2A 2DWLA 5EP2A 3U61A 3ZCBB 3D8LA 4DV5M 3GLIB 4NXNM 4JI1M 4KHPM 4AKIA 4MH0E 2XFTA 3KSXA 2LXEA 1YSYA 1QQWA 4LF5M 3VK8A 1ORYB 1X37A 3FYDA 4B3RM 3RGPA 4LJ9A 4LY6A 4IJFA 5KO3A 2G8LA 1FJGM 2KEBA 2DZNB 3J80S 4DR4M 3L25A 1DGHB 1TH2A 1I94M 4PCZA 5KPRA 2Y21A 4KODA 1J5EM 1TDZA 2F4VM 4GKJM 2J7NA 2ZAOA 4KO8A 2KRUA 2L6OA 3AV0A 4Z8XA 1HQCA 2DVWB 1YE9A 5LMNM 2FNAA 3BOSA 1NY5A 3WHLA 2E5LM 3HJ8A 1IBKM 2L7HA 2DZOB 2XZUA 4MGHA 1SXJA 4LJ4A 1DGFA 2C5RA 4LF9M 1T3TA 3LVWA 4FWDA 3J27B 2XGNA 2EUCA 5EJCA 4RF1A 4G4RA 5EXSA 3J2PB 3M7GA 5KPTA 3VDUA 1G41A 3I4VA 5FTKA 4LF6M 4R3DA 1IQPA 4OVZB 4L8RC 4QNRA 3GPXA 3R9XB 1HT2E 3RGSA 7CATA 1K82A 3K2LA 2Y0TA 3C58A 4HL4A 4IBEA 4NOOB 3GLIA 2G5GX 2XSZD 3FUUA 3HU1A 1OFHA 2D7HA 4A3VB 3GO8A 3KOYE 1IY1A 2R18A 4B7FA 5ITXE 3VKGA 2F5QA 1JQJC 3SMPA 1E9SA 3JR4A 3NWLA 3UJNA 1OFIA 2H1RA 2CHVA 2ERCA 1DGHA 4QHSA 3SASA 3FTDA 3PNYA 1N34M 2YQZA 3D8BA 4WURA 2I7NA 3R8FA 1W5TA 4DV0M 4FCVA 2K47A 3SAUA 2F5OA 2LWXA 3NBIA 2FE8A 5KPZA 1IBLM 4L15A 4LZZA 2DWZB 3GLFB 5DNYA 4QNMA 5E26A 1UM8A 4M9XA 4JI8M 1PJJA 3B9PA 3OTOM 1XMQM 1J09A 4MM3B 3J7AS 3VFDA 3GLGB 2X4AA 3HHXA 4JYAM 2C99A 4AQYM 3K92A 5FTNA 4OVZA 1LV7A 1R2YA 1HR0M 1QYRA 2UU9M 5IT9S 3AJIB 1D2NA 1TH4A 2KW0A 2C96A 4IBGA 3KOWE 5EXTA 4L78A 3GRVA 3HKPA 4L16A 5LMUM 5ITRA 1E94E 3TWLA 2ZANA 3MK6A 2R4EA 1N75A 4R7GA 1K3XA 2CFOA 5IZ7D 4FD2A 4G4QA 4FCWA 2UUBM 4QOSA 2DXIA 4KLNA 4JI4M 2O5RA 1HNXM 5KQDA 4JI2M 2HCBA 3CF0A 1MX0A 3SAVA 4YY3M 1R2ZA 3A42A 1L2DA 3EIEA 3U60B 3ZC7B 3GLFA 1Q39A 1Q3BA 3KS4A 5IREB 4AI6A 4Z6YA 1L2BA 1MU5A 4B08A 2X49A 4MB7A 4LRTA 2R65A 2C9CA 4GKKM 3HWSA 4M9ZA 1HNWM 1IXSB 3DA1A 3THGA 3GRYA 3TWKA 4P16A 4B7HA 3UGJA 1IY2A 5JI2E 3FTCA 3GLGA 1HNZM 4LGYA 1Z5AA 1DGGA 2QENA 4W5WA 1IN5A 2M60A 2XEPA 3M0EA 4NRVA 5ITQA 1KYIA 1QZMA 1XHBA 1ZAEA 4AG5A 1TGUA 4MGZE 2D7EA 2FOIC 1S3SA 4M0DA 5BR8M 3LVVA 4G6ZA 2UXDM 1SXJD 4PDIA 4LZJA 4LJ5A 4XBOA 3CF2A 3U6PA 1ZQ9A 3HU2A 2ZAMA 2HL7A 2AHMA 1XNQM 5EP4A 3HHYA 4X66M 2OPFA 4M0WA 3U60A 4DR7M 3CF6E 1KFVA 1IN6A 3SHGB 1J7KA 4NSRA 3PXGA 1DGBA 2BJVA 2R45A 2A5YB 3JR5A 4DV2M 2RKOA 2Q2EB 4FWGA 3FTEA 1XWIA 1IM2A 3AOEC 2QCUA 1QANA 3ZH9B 3FYCA 2HKJA 2CHQA 4WW0A 4LG2A 1HQYE 2R4JA 4EIWA 2QPAA 3MHVC 3GPYA 4B3TM 2R62A 4QHTA 1L1ZA 4GRIA 2V6ZM 1Q3CA 2DHRA 3E4RA 2KZSA 1IXRC 4X62M 4LF8M 4FWHA 3SYKA 1I4WA 3L27A 4MGKE 1XNRM 1QAOA 3PFIA 4I4LA 2DWNA 3GPUA 4IBIA 3VLFB 4G4OA 2CHGA 4S12A 4LF7M 1VDDA 2L7IA 1XXHB 2J7OA 2RGHA 4BLCA 3MJ5A 4IBFA 3WHKA 3U6QA 4B7GA 2P5TA 3LQRA 5FTMA 4X64M 4LJ6A 1IN7A 3K8ZA 3KP1E 5EP3A 2Y0QA 4B3SM 3PNVA 3UMMA 3U6SA 4CISA 4DUZM 3U6OA 1G4AE 2YR0A 2UXBM 1E32A 1JR3D 4LRSA 4PT5A 1XMOM 2EA0A 3HJQA 3L26A 2JA2A 1DO2A 3FD9A 2Z3XA 3GRRA 4DR1M 1SXJE 1JR3A 2V1CA 4FCTA 4I81A 1G3IA 1L2CA 4I8OA 1YUBA 1FNNA 4IBBA 2KA6B 1N78A 2YNMD 4OU7A 3SBJA 4DUYM 3SATA 2XFSA 3A45A 2CEAA 2CV2A 4AZFA 4AKGA 4GMQA 4AG6A 3VDPA 3IG5A 4AKHA 1G8PA 1IXZA 3PVSA 4JN6A 3GQ5A 4GH9A 4LFAM 4XGIA 2R46A 1G59A 3KOZE 3I4YA 2Z7JA 1XXHA 3M6AA 3FUXA 4JXJA 1NNUC 3JAMS 4PD2A 3AOGA 1GLNA 4LJAA 1TH3A 3ILKA 2ZBKB 1R6BX 3TQSA 5FTJA 4AW4A 4II7A 3KDSE 3L28A 4IBDA 3CTWB 2QBYB 3VK7A 4DV7M 5A2QS 4D81A 4PDGA 3SYLA 3KOXE 3A46A 1C1KA 1KSFX 3GLHB 2YFQA 3AOEA 2CV0A 2CUZA 4GC5A 5H37D 2QZ4A 3J7BA 3HJSA 4DV1M 1IY0A 1IBMM 2CV1A 1L8QA 2VQFM 3TE6A 3L2AA 5ITXA 3SFZA 4IBKA 2Z4RA 2LH0A 2VIIA 2XF3A 4DR3M 3GP1A 2UXCM 2XLJA 8CATA 5EXPA 2ZM6M 3SARA 3KW6A 3J81S 1NJFA 1GL6A 1L1TA 4RF0A 4B3MM 3HHZA 4FVMA 5FLXS 2D7GA 5DYGA 2Y20A 1WXQA 3KFUG 4JV5M 4MGYE 1NSFA 1GKIA 5FSWA 3K1JA 2V1UA 1XC8A 2QBYA 3UZUA 1N77A 4CGYB 4I5SA 3FKEA 3TWMA 5ITUA 1Z5CA 2KRKA 3KVWA 5EP1A 4DR5M 3SAWA 2C9OA 4ZPXA 4BB9A 3FTFA 1PJIA 2KXEA 4IBCA 1W5SA 5EQTA 3GPPA 3DOAA 3E9SA 3LMMA 4JI0M 3GLHA 4GC9A 4NXMM 3U5ZB 5IWAM 5JI3E 3FUVA 4MGIE 3T15A 3AL0C 4TUWA 1GVNA 4LGMA 2M5ZA 4GIPA 1HT1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3I A;  2DZN B;  2Z4S A;  2C98 A;  3EIE A;  3U60 B;  4FW9 A;  1IN4 A;  1FNN A;  1NVM A;  4KOD A;  3GLF A;  2ZAO A;  4KO8 A;  2CEA A;  4Z8X A;  1HQC A;  2DVW B;  2FNA A;  3BOS A;  1NY5 A;  3WHL A;  4LRT A;  2R65 A;  2C9C A;  1IXZ A;  3HWS A;  3PVS A;  4JN6 A;  1QVR A;  1IXS B;  3GLG A;  1IY2 A;  5JI2 E;  2DZO B;  1R7R A;  2CE7 A;  2XSZ A;  1SXJ A;  4LJ4 A;  4LJ8 A;  2QEN A;  4FWD A;  1IN5 A;  3M0E A;  1XXH A;  3M6A A;  1QZM A;  1KYI A;  1SXJ C;  5EXS A;  1G41 A;  5FTK A;  5DYI A;  1IQP A;  1DO0 A;  1S3S A;  4QNR A;  1HT2 E;  4LJA A;  4GIT A;  3GLI A;  1R6B X;  2XSZ D;  1SXJ D;  5FTJ A;  2QP9 X;  3HU1 A;  3KDS E;  1OFH A;  4A3V B;  2QBY B;  4LJ5 A;  3CF2 A;  1IY1 A;  4D81 A;  3U61 B;  3HU2 A;  5FTL A;  2ZAM A;  1JQJ C;  3SYL A;  5EP4 A;  1OFI A;  2CHV A;  2X8A A;  1C1K A;  1IN8 A;  1KSF X;  1OJL A;  3EIH A;  4QHS A;  3GLH B;  3D8B A;  1IN6 A;  1NJG A;  3SC3 A;  3R8F A;  1J7K A;  3PXG A;  5EXX A;  2BJV A;  1W5T A;  2BJW A;  2QZ4 A;  3UK6 A;  2RKO A;  4FCV A;  4FWG A;  1IY0 A;  4D82 A;  1XWI A;  1IM2 A;  3ZH9 B;  4L15 A;  4LZZ A;  2DWZ B;  1L8Q A;  3GLF B;  4QNM A;  1UM8 A;  2CHQ A;  1NY6 A;  3B9P A;  2Z4R A;  4WW0 A;  2VII A;  1HQY E;  4EIW A;  2QPA A;  3MHV C;  2R62 A;  3DZD A;  5EXP A;  4QHT A;  4LCB A;  4D80 A;  2V6Z M;  3VFD A;  2DHR A;  3GLG B;  1IXR C;  3KW6 A;  1NJF A;  4FWH A;  3SYK A;  4L4U A;  4LJ7 A;  2C99 A;  1SXJ B;  5FTN A;  5DYG A;  3PFI A;  4I4L A;  3H4M A;  3VLF B;  1LV7 A;  2CHG A;  1XXH B;  1NSF A;  3HU3 A;  3WHK A;  3AJI B;  1D2N A;  3K1J A;  5C1B A;  5FTM A;  5C18 A;  2C96 A;  4LJ6 A;  2V1U A;  1IN7 A;  5EXT A;  2QBY A;  5EP3 A;  4L16 A;  5EP2 A;  1E94 E;  2KRK A;  5EP1 A;  2ZAN A;  2C9O A;  1G4A E;  4ZPX A;  3GLI B;  1E32 A;  1JR3 D;  4FD2 A;  4LRS A;  4FCW A;  1W5S A;  5EQT A;  4QOS A;  3GLH A;  1DO2 A;  4KLN A;  3U5Z B;  1SXJ E;  1X37 A;  5JI3 E;  2HCB A;  3CF0 A;  4LGM A;  4LJ9 A;  1JR3 A;  4LY6 A;  4FCT A;  4I81 A;  1HT1 E; 
#chains in the Genus database with same CATH topology
 4UN2 B;  2L2D A;  2Z4S A;  2OQ4 A;  2C98 A;  2BNK A;  3KSJ A;  3RE8 A;  3U6D A;  4FW9 A;  1IN4 A;  1QAM A;  4ITQ A;  1NVM A;  5KQ8 A;  4IJE A;  3U6L A;  2OOB A;  2L09 A;  4OX9 M;  3LCU A;  3W0F A;  2NQ8 C;  2F5P A;  4DR2 M;  4LFC M;  4LF4 M;  2LVA A;  4YHH M;  1H6U A;  1QVR A;  2UUA M;  5ITY A;  2HHH M;  2XZF A;  1N33 M;  3U6M A;  2JZ0 A;  3T38 A;  1R7R A;  2CE7 A;  5L8R F;  2XSZ A;  1K3W A;  4JI7 M;  4K0K M;  2I7P A;  4LJ8 A;  2F5N A;  4LFB M;  3LQQ A;  1N36 M;  3FUT A;  4RNA A;  1OAI A;  3RFW A;  3SMS A;  1TDH A;  3I04 M;  4QOZ C;  4KO8 A;  1SXJ C;  4JI5 M;  4DV4 M;  5F3W A;  1E9R A;  4G4N A;  2DWM A;  3KXE C;  3QWL A;  3DFZ A;  2F5S A;  4KT0 F;  5DYI A;  1DO0 A;  2DAI A;  1WGN A;  2DAE A;  4CHT B;  4DV6 M;  1OQY A;  1EE8 A;  1N32 M;  4GIT A;  3T1Y M;  1VEG A;  4REZ A;  2LNH C;  3LCV B;  2QP9 X;  5E6J A;  3NBX X;  2CP8 A;  4DV3 M;  2LHG A;  3KS8 A;  2FFJ A;  3A98 B;  4OW0 A;  3U5Z A;  3U61 B;  2W82 A;  5BPV A;  5FTL A;  2BWE A;  1QAQ A;  5ITT A;  3VKH A;  1NHW C;  1D0K A;  1VEJ A;  2KZU A;  2X8A A;  1OJL A;  1IN8 A;  3EIH A;  3IG8 A;  1NJG A;  1NV8 A;  3SC3 A;  4BBA A;  3B89 A;  4HLQ A;  4NL4 H;  3TPZ A;  5EXX A;  3QAU A;  2BJW A;  1OIZ A;  3KP0 E;  3UK6 A;  3AKZ A;  1PJQ A;  1GL7 A;  1Z6T A;  2DNA A;  4D82 A;  1F4I A;  3HGI A;  3HHW A;  2XH9 A;  2JY5 A;  4GHL A;  3GQ3 A;  4JI3 M;  3I51 A;  1PM5 A;  1NNJ A;  1NY6 A;  1Z5B A;  3FUW A;  2VQE M;  4DR6 M;  3U6E A;  4JI6 M;  3DZD A;  4GHA A;  4IIW A;  4LCB A;  5GKN A;  1NHG C;  3GRU A;  4D80 A;  2UUC M;  3AFH A;  4L4U A;  4LJ7 A;  1SXJ B;  3Q8X A;  1GAB A;  4NSO B;  3HY5 A;  4IBJ A;  3H4M A;  2RGO A;  3GQ4 A;  3TL4 X;  3U6C A;  3SHF A;  4M9S A;  1WR1 B;  4NRW A;  4X65 M;  3W0L B;  3HU3 A;  5C1B A;  3T1H M;  5C18 A;  3L29 A;  3FRH A;  1Z59 A;  2EO2 A;  2DWL A;  1PJT A;  5EP2 A;  3U61 A;  1RU3 A;  3ZCB B;  4NC6 A;  3D8L A;  1UFZ A;  4XK8 F;  4DV5 M;  3GLI B;  4NXN M;  4JI1 M;  4KHP M;  4AKI A;  2K6B A;  2LVP C;  4MH0 E;  2XFT A;  3KSX A;  2LXE A;  1YSY A;  3CGW A;  1QQW A;  4LF5 M;  3VK8 A;  1V34 A;  2KNA A;  3E46 A;  1ORY B;  3F92 A;  1X37 A;  3FYD A;  4B3R M;  2JP7 A;  3RGP A;  1EIJ A;  4LJ9 A;  2JY6 B;  1QZE A;  4IJF A;  1PJS A;  4LY6 A;  2G8L A;  1QUS A;  2MR9 A;  5KO3 A;  1FJG M;  2KEB A;  2DZN B;  3J80 S;  4DR4 M;  3L25 A;  1XXH E;  1DGH B;  1TH2 A;  1I94 M;  4PCZ A;  5KPR A;  1NV9 A;  2Y21 A;  4KOD A;  1TDZ A;  1J5E M;  2F4V M;  4GKJ M;  2J7N A;  2ZAO A;  2DAM A;  2KRU A;  2L6O A;  2LHC A;  3AV0 A;  1HQC A;  2O01 F;  2DVW B;  1WHC A;  1YE9 A;  2EKK A;  1ZV1 A;  2N35 A;  4Z8X A;  2FNA A;  3BOS A;  1NY5 A;  3WHL A;  5LMN M;  3LW5 F;  2E5L M;  3HJ8 A;  1IBK M;  2L7H A;  2VF7 A;  1HJP A;  2DZO B;  2XZU A;  4MGH A;  1SXJ A;  4LJ4 A;  1DGF A;  2C5R A;  4LF9 M;  2FH0 A;  1T3T A;  3LVW A;  4FWD A;  3J27 B;  2XGN A;  2EUC A;  5EJC A;  4RF1 A;  4G4R A;  5EXS A;  3J2P B;  3M7G A;  5KPT A;  3VDU A;  1G41 A;  2DHY A;  3I4V A;  5FTK A;  4LF6 M;  4R3D A;  1IQP A;  4OVZ B;  4L8R C;  4QNR A;  3GPX A;  3R9X B;  1HT2 E;  3RGS A;  7CAT A;  1K82 A;  3K2L A;  2Y0T A;  1TTE A;  4HL4 A;  4IBE A;  2JUJ A;  3C58 A;  4NOO B;  1Q02 A;  3GLI A;  2G5G X;  1JB0 F;  2XSZ D;  3FUU A;  4Y28 F;  3HU1 A;  1OFH A;  2D7H A;  4A3V B;  3GO8 A;  2J5Y A;  2OO9 A;  3KOY E;  1IY1 A;  1D0M A;  3W67 A;  2R18 A;  4B7F A;  5ITX E;  3VKG A;  1V33 A;  2F5Q A;  1JQJ C;  5DFL A;  3SMP A;  4CIZ A;  1E9S A;  3JR4 A;  3NWL A;  1ZMU A;  3UJN A;  1OFI A;  2H1R A;  2CHV A;  3FRI A;  2ERC A;  1DGH A;  4QHS A;  3SAS A;  3FTD A;  3PNY A;  1N34 M;  2YQZ A;  2LVQ D;  3D8B A;  4WUR A;  2JZ1 A;  2I7N A;  3R8F A;  1LTM A;  1W5T A;  1T6O A;  4DV0 M;  2LBC A;  2K47 A;  4FCV A;  4GEW A;  2LWX A;  3NBI A;  3SAU A;  2F5O A;  2FE8 A;  2K0B X;  5KPZ A;  1IBL M;  4L15 A;  2OOA A;  1R4G A;  4LZZ A;  2DWZ B;  3GLF B;  5DNY A;  4QNM A;  5E26 A;  1UM8 A;  4M9X A;  4JI8 M;  1PJJ A;  3B9P A;  3OTO M;  1R5L A;  2DKL A;  1XMQ M;  1J09 A;  4MM3 B;  2B3T A;  2WSC F;  3J7A S;  3VFD A;  3H4J A;  3GLG B;  2LVN C;  2JNH A;  2X4A A;  3HHX A;  4JYA M;  1G71 A;  2C99 A;  4AQY M;  3GLH E;  3K92 A;  5FTN A;  4OVZ A;  1TR8 A;  1LV7 A;  2LTU A;  1R2Y A;  4HEO A;  2EJS A;  1Y8G A;  2R6F A;  1QYR A;  1HR0 M;  2UU9 M;  2JY8 A;  5IT9 S;  3AJI B;  1D2N A;  1TH4 A;  1A5T A;  2KW0 A;  2C96 A;  1OTR A;  4IBG A;  3KOW E;  5EXT A;  3SAW A;  4L78 A;  3GRV A;  2LVO C;  3HKP A;  4L16 A;  5LMU M;  5ITR A;  1E94 E;  3TWL A;  2ZAN A;  3MK6 A;  2DAG A;  2R4E A;  1N75 A;  4R7G A;  1K3X A;  2CFO A;  5IZ7 D;  4FD2 A;  4G4Q A;  4FCW A;  2UUB M;  4QOS A;  2DXI A;  4KLN A;  4JI4 M;  2O5R A;  1HNX M;  5KQD A;  4JI2 M;  2HCB A;  2QNJ A;  3CF0 A;  1MX0 A;  1ZMV A;  4YY3 M;  3SAV A;  1R2Z A;  3A42 A;  1L2D A;  3EIE A;  3U60 B;  3ZC7 B;  3GLF A;  3W68 A;  1Q39 A;  3C3D A;  1Q3B A;  3KS4 A;  5IRE B;  4AI6 A;  4Z6Y A;  1ZMW A;  2WSE F;  1MU5 A;  4B08 A;  1L2B A;  2X49 A;  4MB7 A;  4LRT A;  2R65 A;  2C9C A;  4GKK M;  3HWS A;  4M9Z A;  1HNW M;  1CUK A;  4Q7J A;  1IXS B;  3DA1 A;  3THG A;  3GRY A;  3TWK A;  4P16 A;  4B7H A;  3UGJ A;  1IY2 A;  5JI2 E;  3FTC A;  3GLG A;  3C3E A;  1HNZ M;  4LGY A;  2GQF A;  1Z5A A;  2APL A;  1DGG A;  2QEN A;  3IEC A;  4W5W A;  2DZL A;  1IN5 A;  2M60 A;  2XEP A;  3M0E A;  4NRV A;  5ITQ A;  1OAO C;  1KYI A;  1QZM A;  2KHH A;  4ANR A;  1XHB A;  2MRO B;  1ZAE A;  4AG5 A;  1TGU A;  3I01 M;  4MGZ E;  2D7E A;  1IFY A;  2FOI C;  1S3S A;  4M0D A;  1XB2 B;  5BR8 M;  3LVV A;  4G6Z A;  2UXD M;  1BVS A;  1SXJ D;  4PDI A;  1EFU B;  4LZJ A;  4LJ5 A;  4XBO A;  2L4F A;  2WSF F;  3CF2 A;  2CRU A;  3C9P A;  1MN3 A;  3U6P A;  1ZQ9 A;  3HU2 A;  2ZAM A;  2HL7 A;  2AHM A;  2MGW A;  1XNQ M;  5EP4 A;  3HHY A;  3V76 A;  4X66 M;  3BBZ A;  2OPF A;  4M0W A;  3U60 A;  4DR7 M;  1DV0 A;  3CF6 E;  1KFV A;  1IN6 A;  2CWB A;  2G3Q A;  1J7K A;  4NSR A;  3SHG B;  3PXG A;  1DGB A;  2BJV A;  2R45 A;  2A5Y B;  3JR5 A;  4DV2 M;  2KNZ A;  2R0I A;  2Q2E B;  2RKO A;  4FWG A;  3FTE A;  1XWI A;  1IM2 A;  3AOE C;  1IXS A;  1V92 A;  2QCU A;  1QAN A;  3ZH9 B;  3FYC A;  1YLA A;  2EKF A;  2HKJ A;  2MJ5 B;  2ZTD A;  2CHQ A;  2VDB B;  4WW0 A;  4LG2 A;  1HQY E;  2R4J A;  4EIW A;  2QPA A;  3MHV C;  3GPY A;  4B3T M;  2R62 A;  4QHT A;  1OIP A;  1L1Z A;  4GRI A;  2V6Z M;  1Q3C A;  2DHR A;  3E4R A;  2KZS A;  1IXR C;  4X62 M;  4LF8 M;  4FWH A;  3SYK A;  1I4W A;  4CJ6 A;  3L27 A;  1PRB A;  3B74 A;  4MGK E;  1QAO A;  3PFI A;  4I4L A;  2DWN A;  3GPU A;  4IBI A;  3VLF B;  4G4O A;  2CHG A;  4S12 A;  4LF7 M;  1VDD A;  2L7I A;  1XXH B;  2J7O A;  2RGH A;  4BLC A;  3MJ5 A;  4RKU F;  4IBF A;  3WHK A;  3U6Q A;  4B7G A;  2P5T A;  3LQR A;  5FTM A;  4X64 M;  4LJ6 A;  1IN7 A;  4WP2 A;  2DAK A;  3K8Z A;  3KP1 E;  5EP3 A;  2Y0Q A;  4B3S M;  2QHO B;  3PNV A;  3UMM A;  3U6S A;  4DUZ M;  1QUT A;  3U6O A;  4CIS A;  1G4A E;  2YR0 A;  2UXB M;  1E32 A;  1JR3 D;  2R44 A;  4LRS A;  4PT5 A;  1XMO M;  2EA0 A;  3HJQ A;  3L26 A;  2HWJ A;  4F1I A;  2JA2 A;  1DO2 A;  3FD9 A;  2Z3X A;  3GRR A;  2KDL A;  1SXJ E;  4DR1 M;  4G3O A;  1QDT A;  1JR3 A;  1AIP C;  2V1C A;  4FCT A;  2O25 A;  4I81 A;  4F2L A;  1G3I A;  2FS1 A;  1L2C A;  3E21 A;  4I8O A;  1YUB A;  1FNN A;  4IBB A;  2KA6 B;  2K9D A;  1OKS A;  2YNM D;  4OU7 A;  3SBJ A;  3FE3 A;  4DUY M;  1N78 A;  3SAT A;  1D0L A;  3QYB A;  2XFS A;  3A45 A;  2WZJ A;  2CEA A;  2CV2 A;  2JY7 A;  3HZJ A;  4AZF A;  4AKG A;  4GMQ A;  1XNR M;  4AG6 A;  3VDP A;  3IG5 A;  4AKH A;  1G8P A;  1IXZ A;  3PVS A;  4JN6 A;  1MJG M;  3GQ5 A;  3GLI E;  1WGL A;  1WJ7 A;  1VDL A;  4DBG B;  2L4E A;  4GH9 A;  4LFA M;  4XGI A;  2R46 A;  1G59 A;  1VQ1 A;  2BWB A;  3KOZ E;  3I4Y A;  2H5X A;  2Z7J A;  1VG5 A;  1XXH A;  3B7Q A;  3M6A A;  3FUX A;  4JXJ A;  1NNU C;  2MH8 A;  3JAM S;  4PD2 A;  3AOG A;  1GLN A;  4LJA A;  1TH3 A;  3ILK A;  1GJS A;  2ZBK B;  1R6B X;  3TQS A;  2JXN A;  5FTJ A;  4AW4 A;  3Q8G A;  4II7 A;  3KDS E;  3L28 A;  4IBD A;  3CTW B;  2QBY B;  3VK7 A;  4R71 A;  4DV7 M;  5A2Q S;  4D81 A;  1NO1 A;  4PDG A;  2DEN A;  3SYL A;  3K9O A;  3KOX E;  3B7N A;  3A46 A;  1C1K A;  1KSF X;  3GLH B;  1TF0 B;  2YFQ A;  3AOE A;  2JWS A;  1AUA A;  2CV0 A;  1JR3 E;  2CUZ A;  4GC5 A;  2ZTC A;  5H37 D;  3T6P A;  2QZ4 A;  3J7B A;  3HJS A;  4DV1 M;  1IY0 A;  3BXW A;  2HAK A;  1VEK A;  1IBM M;  1PGY A;  3IHP A;  1L8Q A;  2GNO A;  2VQF M;  2CV1 A;  3TE6 A;  3L2A A;  5ITX A;  3SFZ A;  4IBK A;  2Z4R A;  2LH0 A;  2VII A;  1SG9 A;  2XF3 A;  3GP1 A;  4DR3 M;  3QYE A;  2UXC M;  2XLJ A;  2DI0 A;  8CAT A;  5EXP A;  2ZM6 M;  2Z8Y M;  3SAR A;  3KW6 A;  3J81 S;  1NJF A;  1GL6 A;  1L1T A;  4RF0 A;  4B3M M;  3HHZ A;  4FVM A;  5FLX S;  2D7G A;  5DYG A;  2Y20 A;  4L6V 6;  1WXQ A;  3KFU G;  4JV5 M;  1T43 A;  4MGY E;  1NSF A;  2VF8 A;  1C7Y A;  2KNV A;  1GKI A;  3MMP A;  5FSW A;  3K1J A;  3ZQJ A;  2V1U A;  3TWM A;  1XC8 A;  1GO5 A;  2QBY A;  1GJT A;  3UZU A;  1N77 A;  4CGY B;  4I5S A;  3FKE A;  3K9P A;  5ITU A;  1Z5C A;  2KRK A;  2RRU A;  3KVW A;  4P17 A;  5EP1 A;  3GLF E;  3HX3 A;  4DR5 M;  2C9O A;  4ZPX A;  4BB9 A;  3FTF A;  1PJI A;  2KXE A;  2QSF X;  4IBC A;  1QDR A;  1W5S A;  5EQT A;  3GPP A;  3B7Z A;  3DOA A;  3E9S A;  3LMM A;  4JI0 M;  1P3Q Q;  2QQ8 A;  3GLH A;  3GLG E;  1WIV A;  4GC9 A;  4NXM M;  3U5Z B;  5IWA M;  5JI3 E;  3FUV A;  4MGI E;  3T15 A;  3AL0 C;  4TUW A;  1GVN A;  4LGM A;  2M5Z A;  4GIP A;  1HT1 E; 
#chains in the Genus database with same CATH homology
 2OQ4 A;  2Z4S A;  2C98 A;  2BNK A;  3KSJ A;  3RE8 A;  3U6D A;  4FW9 A;  1IN4 A;  1QAM A;  4ITQ A;  1NVM A;  5KQ8 A;  4IJE A;  3U6L A;  2L09 A;  4OX9 M;  3W0F A;  2NQ8 C;  2F5P A;  4DR2 M;  4LFC M;  4LF4 M;  4YHH M;  1H6U A;  1QVR A;  2UUA M;  5ITY A;  2HHH M;  2XZF A;  1N33 M;  3U6M A;  3T38 A;  1R7R A;  2CE7 A;  1K3W A;  2XSZ A;  4JI7 M;  4K0K M;  2I7P A;  4LJ8 A;  2F5N A;  4LFB M;  3LQQ A;  1N36 M;  3FUT A;  4RNA A;  3RFW A;  3SMS A;  1TDH A;  4QOZ C;  1SXJ C;  4JI5 M;  4DV4 M;  5F3W A;  1E9R A;  4G4N A;  2DWM A;  3KXE C;  3QWL A;  3DFZ A;  2F5S A;  5DYI A;  1DO0 A;  4DV6 M;  4CHT B;  1EE8 A;  1N32 M;  4GIT A;  3T1Y M;  4REZ A;  2LNH C;  2QP9 X;  5E6J A;  4DV3 M;  3KS8 A;  2FFJ A;  3A98 B;  4OW0 A;  3U5Z A;  3U61 B;  2W82 A;  5BPV A;  5FTL A;  1QAQ A;  5ITT A;  3VKH A;  1NHW C;  2KZU A;  2X8A A;  1OJL A;  1IN8 A;  3EIH A;  3IG8 A;  1NJG A;  3SC3 A;  4BBA A;  4HLQ A;  4NL4 H;  3TPZ A;  5EXX A;  3QAU A;  2BJW A;  3KP0 E;  3UK6 A;  3AKZ A;  1GL7 A;  1Z6T A;  4D82 A;  3HGI A;  3HHW A;  2XH9 A;  4GHL A;  3GQ3 A;  4JI3 M;  3I51 A;  1PM5 A;  1NNJ A;  1NY6 A;  1Z5B A;  3FUW A;  2VQE M;  4DR6 M;  3U6E A;  4JI6 M;  3DZD A;  4GHA A;  4IIW A;  4LCB A;  5GKN A;  1NHG C;  3GRU A;  4D80 A;  2UUC M;  3AFH A;  4L4U A;  4LJ7 A;  1SXJ B;  3Q8X A;  4NSO B;  4IBJ A;  3H4M A;  2RGO A;  3GQ4 A;  3TL4 X;  3U6C A;  3SHF A;  4M9S A;  4NRW A;  4X65 M;  3W0L B;  3HU3 A;  5C1B A;  3T1H M;  5C18 A;  3L29 A;  1Z59 A;  2EO2 A;  2DWL A;  5EP2 A;  3U61 A;  3ZCB B;  3D8L A;  4DV5 M;  3GLI B;  4NXN M;  4JI1 M;  4KHP M;  4AKI A;  4MH0 E;  2XFT A;  3KSX A;  2LXE A;  1YSY A;  1QQW A;  4LF5 M;  3VK8 A;  1ORY B;  1X37 A;  3FYD A;  4B3R M;  3RGP A;  4LJ9 A;  4LY6 A;  4IJF A;  5KO3 A;  2G8L A;  1FJG M;  2KEB A;  2DZN B;  3J80 S;  4DR4 M;  3L25 A;  1DGH B;  1TH2 A;  1I94 M;  4PCZ A;  5KPR A;  2Y21 A;  4KOD A;  1J5E M;  1TDZ A;  2F4V M;  4GKJ M;  2J7N A;  2ZAO A;  4KO8 A;  2KRU A;  2L6O A;  3AV0 A;  4Z8X A;  1HQC A;  2DVW B;  1YE9 A;  5LMN M;  2FNA A;  3BOS A;  1NY5 A;  3WHL A;  2E5L M;  3HJ8 A;  1IBK M;  2L7H A;  2DZO B;  2XZU A;  4MGH A;  1SXJ A;  4LJ4 A;  1DGF A;  2C5R A;  4LF9 M;  1T3T A;  3LVW A;  4FWD A;  3J27 B;  2XGN A;  2EUC A;  5EJC A;  4RF1 A;  4G4R A;  5EXS A;  3J2P B;  3M7G A;  5KPT A;  3VDU A;  1G41 A;  3I4V A;  5FTK A;  4LF6 M;  4R3D A;  1IQP A;  4OVZ B;  4L8R C;  4QNR A;  3GPX A;  3R9X B;  1HT2 E;  3RGS A;  7CAT A;  1K82 A;  3K2L A;  2Y0T A;  3C58 A;  4HL4 A;  4IBE A;  4NOO B;  3GLI A;  2G5G X;  2XSZ D;  3FUU A;  3HU1 A;  1OFH A;  2D7H A;  4A3V B;  3GO8 A;  3KOY E;  1IY1 A;  2R18 A;  4B7F A;  5ITX E;  3VKG A;  2F5Q A;  1JQJ C;  3SMP A;  1E9S A;  3JR4 A;  3NWL A;  3UJN A;  1OFI A;  2H1R A;  2CHV A;  2ERC A;  1DGH A;  4QHS A;  3SAS A;  3FTD A;  3PNY A;  1N34 M;  2YQZ A;  3D8B A;  4WUR A;  2I7N A;  3R8F A;  1W5T A;  4DV0 M;  4FCV A;  2K47 A;  3SAU A;  2F5O A;  2LWX A;  3NBI A;  2FE8 A;  5KPZ A;  1IBL M;  4L15 A;  4LZZ A;  2DWZ B;  3GLF B;  5DNY A;  4QNM A;  5E26 A;  1UM8 A;  4M9X A;  4JI8 M;  1PJJ A;  3B9P A;  3OTO M;  1XMQ M;  1J09 A;  4MM3 B;  3J7A S;  3VFD A;  3GLG B;  2X4A A;  3HHX A;  4JYA M;  2C99 A;  4AQY M;  3K92 A;  5FTN A;  4OVZ A;  1LV7 A;  1R2Y A;  1HR0 M;  1QYR A;  2UU9 M;  5IT9 S;  3AJI B;  1D2N A;  1TH4 A;  2KW0 A;  2C96 A;  4IBG A;  3KOW E;  5EXT A;  4L78 A;  3GRV A;  3HKP A;  4L16 A;  5LMU M;  5ITR A;  1E94 E;  3TWL A;  2ZAN A;  3MK6 A;  2R4E A;  1N75 A;  4R7G A;  1K3X A;  2CFO A;  5IZ7 D;  4FD2 A;  4G4Q A;  4FCW A;  2UUB M;  4QOS A;  2DXI A;  4KLN A;  4JI4 M;  2O5R A;  1HNX M;  5KQD A;  4JI2 M;  2HCB A;  3CF0 A;  1MX0 A;  3SAV A;  4YY3 M;  1R2Z A;  3A42 A;  1L2D A;  3EIE A;  3U60 B;  3ZC7 B;  3GLF A;  1Q39 A;  1Q3B A;  3KS4 A;  5IRE B;  4AI6 A;  4Z6Y A;  1L2B A;  1MU5 A;  4B08 A;  2X49 A;  4MB7 A;  4LRT A;  2R65 A;  2C9C A;  4GKK M;  3HWS A;  4M9Z A;  1HNW M;  1IXS B;  3DA1 A;  3THG A;  3GRY A;  3TWK A;  4P16 A;  4B7H A;  3UGJ A;  1IY2 A;  5JI2 E;  3FTC A;  3GLG A;  1HNZ M;  4LGY A;  1Z5A A;  1DGG A;  2QEN A;  4W5W A;  1IN5 A;  2M60 A;  2XEP A;  3M0E A;  4NRV A;  5ITQ A;  1KYI A;  1QZM A;  1XHB A;  1ZAE A;  4AG5 A;  1TGU A;  4MGZ E;  2D7E A;  2FOI C;  1S3S A;  4M0D A;  5BR8 M;  3LVV A;  4G6Z A;  2UXD M;  1SXJ D;  4PDI A;  4LZJ A;  4LJ5 A;  4XBO A;  3CF2 A;  3U6P A;  1ZQ9 A;  3HU2 A;  2ZAM A;  2HL7 A;  2AHM A;  1XNQ M;  5EP4 A;  3HHY A;  4X66 M;  2OPF A;  4M0W A;  3U60 A;  4DR7 M;  3CF6 E;  1KFV A;  1IN6 A;  3SHG B;  1J7K A;  4NSR A;  3PXG A;  1DGB A;  2BJV A;  2R45 A;  2A5Y B;  3JR5 A;  4DV2 M;  2RKO A;  2Q2E B;  4FWG A;  3FTE A;  1XWI A;  1IM2 A;  3AOE C;  2QCU A;  1QAN A;  3ZH9 B;  3FYC A;  2HKJ A;  2CHQ A;  4WW0 A;  4LG2 A;  1HQY E;  2R4J A;  4EIW A;  2QPA A;  3MHV C;  3GPY A;  4B3T M;  2R62 A;  4QHT A;  1L1Z A;  4GRI A;  2V6Z M;  1Q3C A;  2DHR A;  3E4R A;  2KZS A;  1IXR C;  4X62 M;  4LF8 M;  4FWH A;  3SYK A;  1I4W A;  3L27 A;  4MGK E;  1XNR M;  1QAO A;  3PFI A;  4I4L A;  2DWN A;  3GPU A;  4IBI A;  3VLF B;  4G4O A;  2CHG A;  4S12 A;  4LF7 M;  1VDD A;  2L7I A;  1XXH B;  2J7O A;  2RGH A;  4BLC A;  3MJ5 A;  4IBF A;  3WHK A;  3U6Q A;  4B7G A;  2P5T A;  3LQR A;  5FTM A;  4X64 M;  4LJ6 A;  1IN7 A;  3K8Z A;  3KP1 E;  5EP3 A;  2Y0Q A;  4B3S M;  3PNV A;  3UMM A;  3U6S A;  4CIS A;  4DUZ M;  3U6O A;  1G4A E;  2YR0 A;  2UXB M;  1E32 A;  1JR3 D;  4LRS A;  4PT5 A;  1XMO M;  2EA0 A;  3HJQ A;  3L26 A;  2JA2 A;  1DO2 A;  3FD9 A;  2Z3X A;  3GRR A;  4DR1 M;  1SXJ E;  1JR3 A;  2V1C A;  4FCT A;  4I81 A;  1G3I A;  1L2C A;  4I8O A;  1YUB A;  1FNN A;  4IBB A;  2KA6 B;  1N78 A;  2YNM D;  4OU7 A;  3SBJ A;  4DUY M;  3SAT A;  2XFS A;  3A45 A;  2CEA A;  2CV2 A;  4AZF A;  4AKG A;  4GMQ A;  4AG6 A;  3VDP A;  3IG5 A;  4AKH A;  1G8P A;  1IXZ A;  3PVS A;  4JN6 A;  3GQ5 A;  4GH9 A;  4LFA M;  4XGI A;  2R46 A;  1G59 A;  3KOZ E;  3I4Y A;  2Z7J A;  1XXH A;  3M6A A;  3FUX A;  4JXJ A;  1NNU C;  3JAM S;  4PD2 A;  3AOG A;  1GLN A;  4LJA A;  1TH3 A;  3ILK A;  2ZBK B;  1R6B X;  3TQS A;  5FTJ A;  4AW4 A;  4II7 A;  3KDS E;  3L28 A;  4IBD A;  3CTW B;  2QBY B;  3VK7 A;  4DV7 M;  5A2Q S;  4D81 A;  4PDG A;  3SYL A;  3KOX E;  3A46 A;  1C1K A;  1KSF X;  3GLH B;  2YFQ A;  3AOE A;  2CV0 A;  2CUZ A;  4GC5 A;  5H37 D;  2QZ4 A;  3J7B A;  3HJS A;  4DV1 M;  1IY0 A;  1IBM M;  2CV1 A;  1L8Q A;  2VQF M;  3TE6 A;  3L2A A;  5ITX A;  3SFZ A;  4IBK A;  2Z4R A;  2LH0 A;  2VII A;  2XF3 A;  4DR3 M;  3GP1 A;  2UXC M;  2XLJ A;  8CAT A;  5EXP A;  2ZM6 M;  3SAR A;  3KW6 A;  3J81 S;  1NJF A;  1GL6 A;  1L1T A;  4RF0 A;  4B3M M;  3HHZ A;  4FVM A;  5FLX S;  2D7G A;  5DYG A;  2Y20 A;  1WXQ A;  3KFU G;  4JV5 M;  4MGY E;  1NSF A;  1GKI A;  5FSW A;  3K1J A;  2V1U A;  1XC8 A;  2QBY A;  3UZU A;  1N77 A;  4CGY B;  4I5S A;  3FKE A;  3TWM A;  5ITU A;  1Z5C A;  2KRK A;  3KVW A;  5EP1 A;  4DR5 M;  3SAW A;  2C9O A;  4ZPX A;  4BB9 A;  3FTF A;  1PJI A;  2KXE A;  4IBC A;  1W5S A;  5EQT A;  3GPP A;  3DOA A;  3E9S A;  3LMM A;  4JI0 M;  3GLH A;  4GC9 A;  4NXM M;  3U5Z B;  5IWA M;  5JI3 E;  3FUV A;  4MGI E;  3T15 A;  3AL0 C;  4TUW A;  1GVN A;  4LGM A;  2M5Z A;  4GIP A;  1HT1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...