3KW6A

Crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a domain of 26S proteasome regulatory subunit 8 from homo sapiens. Northeast Structural Genomics Consortium target id HR3102A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords 26S protease regulatory subunit 8
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kw6A01
3U61B 2X8AA 5FTKA 2CHVA 1LV7A 1D2NA 4FW9A 4QOSA 4LJ7A 3HU1A 2RKOA 2HCBA 3CF2A 4FWGA 1W5SA 3AJIB 3SC3A 4LCBA 3GLIB 1NJFA 1X37A 4L15A 2QP9X 3VFDA 1UM8A 1XXHB 1FNNA 4FCTA 4LRTA 4LJ6A 3ZH9B 1IY2A 4LJ9A 1IM2A 3DZDA 5EXXA 5FTLA 4KODA 5JI3E 2CHGA 5EP1A 3BOSA 3GLGA 1G3IA 1XWIA 1IY0A 3HU2A 3PFIA 1JQJC 4A3VB 1OFIA 5FTNA 3GLFB 2QPAA 2QBYB 2C96A 1IXSB 1G41A 1IN7A 1E94E 1R6BX 1QVRA 4FWHA 2CE7A 2CEAA 1HQCA 3MHVC 2V6ZM 4QHTA 2BJWA 4D81A 1SXJB 3GLIA 3GLGB 4KLNA 4JN6A 4LZZA 3CF0A 1NY5A 4LGMA 2DHRA 2QBYA 5FTJA 2R62A 1IY1A 2C9OA 1NVMA 1SXJE 4LJAA 2Z4RA 4FD2A 1G4AE 1OJLA 4QNRA 5EP2A 1IN6A 1SXJC 2DZNB 3GLHB 5C18A 3EIEA 1IN8A 2R65A 5DYIA 5EXSA 3D8BA 4GITA 4Z8XA 3KW6A 3GLFA 1QZMA 2VIIA 1OFHA 4LJ4A 1IQPA 1HT2E 5FTMA 2ZANA 1IXRC 3EIHA 3U60B 4EIWA 2CHQA 4ZPXA 2FNAA 4LJ5A 5EP3A 2ZAMA 1NY6A 2ZAOA 1IXZA 3VLFB 4KO8A 1HQYE 3PXGA 4L16A 1S3SA 1XXHA 5EXPA 1SXJA 2BJVA 5EXTA 3GLHA 2C99A 2QENA 3WHKA 4LJ8A 4WW0A 4QHSA 3K1JA 4FCWA 3SYKA 1DO2A 4QNMA 3HWSA 3UK6A 3H4MA 5JI2E 1KYIA 1HT1E 4FWDA 5DYGA 1J7KA 1JR3A 5EP4A 2V1UA 3PVSA 3HU3A 2Z4SA 4FCVA 1IN5A 1NSFA 2XSZD 3SYLA 4D80A 1KSFX 3WHLA 1IN4A 2DVWB 4I81A 2C9CA 1E32A 2DZOB 2C98A 4LY6A 5EQTA 1DO0A 1NJGA 2KRKA 4I4LA 2XSZA 3M6AA 1JR3D 1W5TA 1C1KA 1R7RA 2DWZB 3KDSE 4D82A 3B9PA 4LRSA 1SXJD 3R8FA 3M0EA 1L8QA 5C1BA 2QZ4A 4L4UA 3U5ZB
chains in the Genus database with same CATH superfamily
2X8AA 1Z59A 2JY6B 4IBCA 2OQ4A 4DR5M 2UXDM 4JI8M 3GPXA 3HU1A 3CF2A 3HGIA 2J7NA 4OVZA 4AZFA 1IFYA 1VQ1A 1NJFA 2EUCA 4M9SA 3VFDA 2RGOA 1YUBA 3FKEA 4B08A 3FUWA 2Z7JA 2Y21A 3K9PA 3W0FA 2V1CA 3SFZA 1IY2A 3HX3A 3NWLA 3TPZA 3UGJA 4X62M 1Q3BA 2LVPC 1NHWC 4KODA 2CHGA 3GLIE 5A2QS 3B7NA 4S12A 5ITYA 1N32M 4LFAM 1IBLM 1Z5BA 2MJ5B 2R46A 3BOSA 1G71A 4HL4A 1IY0A 3T15A 2O25A 4XGIA 2P5TA 3UMMA 1IXSB 2DHYA 4IBGA 4MGYE 1L1ZA 4Z6YA 2CE7A 4R7GA 3MHVC 3GQ5A 4G3OA 3C58A 3U6QA 4QHTA 2FH0A 4W5WA 3TWLA 4M0DA 3GLFE 1TTEA 2WSCF 2J5YA 3A45A 3FUUA 3VDPA 4DR7M 1A5TA 1NV8A 2JXNA 4KLNA 3HJQA 2WSEF 1TR8A 2XF3A 5IWAM 1VDLA 2DWNA 4NSRA 2DHRA 3C3DA 3FUTA 2W82A 3UJNA 2QBYA 4LF4M 3RE8A 1TH2A 4B3RM 1IY1A 1ZV1A 3I01M 1NVMA 3IHPA 2JUJA 3AOEC 1G4AE 1XHBA 4MGKE 2DXIA 4P17A 1IN6A 2J7OA 3FTDA 3RGSA 3THGA 3F92A 5DYIA 3LVVA 2D7EA 4GITA 2JP7A 3J7BA 5FTMA 1QAMA 1E9RA 3FRIA 2HAKA 3U60B 4G4NA 4NSOB 4WURA 4ZPXA 3VK8A 4B3MM 3IG5A 4IBDA 4MB7A 3Q8XA 4LFBM 2WSFF 2X4AA 2WZJA 2LBCA 2QNJA 1V33A 3TL4X 3A46A 1XXHA 4IBEA 1Y8GA 4G6ZA 3KS8A 1SXJA 5EXTA 2KNZA 3K8ZA 4HEOA 4B7GA 1Z5CA 4WW0A 1SG9A 2R6FA 4QHSA 2ZM6M 3K1JA 4FCWA 4CHTB 2XZFA 2DAIA 3HWSA 4QNMA 2CWBA 3UK6A 3H4MA 7CATA 1PM5A 5JI2E 4FWDA 1HT1E 2HHHM 1NNUC 5DYGA 1JR3A 1I4WA 5EP4A 4G4QA 1L2CA 2LVOC 2M5ZA 2QQ8A 1IN5A 1NSFA 2XZUA 1DGHB 1KSFX 1OAIA 5E6JA 4DR3M 1KFVA 5LMNM 2F5NA 3KFUG 2C98A 3J7AS 4YY3M 4DV2M 1D0LA 3L25A 3LMMA 4MGZE 2NQ8C 2MR9A 2LVQD 2KZSA 4AG6A 1K3WA 1WXQA 3M6AA 3U6DA 1W5TA 1N75A 3HHZA 1IBMM 3KDSE 1FJGM 1R4GA 3R8FA 1MN3A 1WR1B 2JY5A 2ERCA 3RGPA 2DENA 3H4JA 3LQRA 1LTMA 4JI1M 4DV3M 4DV1M 2Y0TA 2QCUA 3I04M 1D2NA 3L27A 2L4FA 3PNVA 1PJIA 1ZMUA 4LJ7A 1WGNA 1TH4A 3SC3A 3U5ZA 2EKFA 4JI5M 2XEPA 4L15A 5DFLA 1XXHE 3HJ8A 4FCTA 4IBFA 2OO9A 2Y0QA 4LJ6A 2JY7A 4OVZB 2G3QA 3A98B 4LJ9A 1IM2A 2AHMA 1V34A 3MK6A 4JV5M 2EKKA 5EP1A 1XNQM 2FFJA 4HLQA 1L2BA 2JZ1A 2KZUA 3KP0E 1R2ZA 3GLGA 1K3XA 4JI7M 1G3IA 1XWIA 1XB2B 3C3EA 3HU2A 3L28A 3PFIA 4A3VB 1R2YA 3TQSA 2KEBA 1D0MA 2KW0A 3DFZA 1XMQM 2DWLA 2QBYB 3MJ5A 2C96A 1G41A 1MJGM 1IN7A 1E94E 1R6BX 4RNAA 4AKGA 1YE9A 4JI0M 4IIWA 3CF6E 3KOZE 2JA2A 2L6OA 3TWMA 1HQCA 3ILKA 4DR6M 2V6ZM 1AUAA 4PDGA 2R45A 4LF5M 1OQYA 3KP1E 3B89A 2DAEA 4TUWA 2CUZA 2MGWA 3HHWA 1AIPC 4R71A 5FSWA 1R5LA 1WHCA 5ITRA 3AKZA 2EJSA 3ZQJA 1HNXM 4II7A 2CFOA 1DGFA 2R62A 3TE6A 1CUKA 4F1IA 2EA0A 2YR0A 3M7GA 2R4EA 3FD9A 2APLA 1MX0A 1ZQ9A 3AOGA 3LCUA 4QNRA 1GJTA 1SXJC 1VEGA 3GRYA 5C18A 3GPUA 1IN8A 2OOBA 3HHYA 1PJTA 3D8BA 1QDRA 2L7IA 3RFWA 3FYDA 3J80S 2LWXA 1HJPA 1HT2E 3NBIA 5F3WA 1Q39A 4F2LA 4NRWA 1N33M 2CHQA 3SHFA 2FNAA 1BVSA 4ITQA 1NY6A 1QZEA 1E9SA 1IXZA 4IBJA 4CJ6A 3JAMS 1HQYE 4LF8M 4L16A 5DNYA 2E5LM 2DI0A 2BWBA 3B7QA 2CV1A 3J81S 2CP8A 2F5SA 2DZLA 4LJ8A 4I8OA 3Q8GA 3SYKA 1ZMVA 5BPVA 3KSJA 2JZ0A 2VQEM 1KYIA 2XGNA 2KNVA 1J7KA 2DWMA 1N77A 3CGWA 3ZCBB 4GH9A 3E46A 2JNHA 1Q02A 1IN4A 2DVWB 4I81A 4P16A 2K6BA 3U6LA 4CGYB 2MH8A 2G8LA 1DO0A 2QSFX 1EFUB 4GEWA 1NJGA 4AW4A 2VQFM 1JR3D 4ANRA 3I51A 3I4YA 1R7RA 2DWZB 4D82A 2F4VM 3KOWE 1VEJA 4LRSA 1SXJD 4X66M 1L8QA 2F5OA 3W68A 1VEKA 2K0BX 2QZ4A 3U61B 1I94M 2CHVA 4DV0M 4DR1M 1PJSA 2RKOA 2HCBA 4FWGA 3U60A 5IZ7D 2DNAA 2HWJA 4BBAA 1L1TA 2ZTDA 4JYAM 3SAUA 1K82A 1GLNA 3FE3A 1X37A 4CIZA 1XC8A 2L09A 1N78A 2GQFA 3GO8A 1FNNA 2DAGA 3K92A 2CRUA 5KPTA 2LVAA 3SHGB 2XH9A 4JXJA 1PJJA 3SBJA 5KPZA 2UUBM 3NBXX 5JI3E 3JR4A 4CISA 3KVWA 2I7PA 2RRUA 4MH0E 4GHAA 4R3DA 3E9SA 4LF7M 1ZAEA 1Q3CA 2GNOA 2XFTA 3A42A 1OTRA 1JQJC 3OTOM 4MGHA 3R9XB 3KXEC 5KQ8A 2QPAA 4K0KM 3SAWA 4M9XA 4OX9M 1V92A 3K2LA 3GRUA 2CV2A 4JI6M 4FWHA 2G5GX 3HJSA 1EIJA 4L8RC 1GJSA 2RGHA 1NO1A 3T1HM 5GKNA 2LHCA 4DR2M 2BJWA 4BB9A 4D81A 4FVMA 1SXJB 1RU3A 3AFHA 4GMQA 4UN2B 4QOZC 4B7FA 4PCZA 5KQDA 3GLIA 1DV0A 1NV9A 3FRHA 2X49A 3U6CA 3FTCA 2QHOB 2XLJA 1HNWM 4AI6A 4OU7A 1NY5A 1OIZA 2HL7A 4LGMA 5E26A 1XMOM 4LG2A 4L78A 4NL4H 5BR8M 3KOYE 5FTJA 3D8LA 1IXSA 2C9OA 3CTWB 4LF9M 3GRVA 4LJAA 3LVWA 2Z4RA 3FUXA 2KRUA 1UFZA 4FD2A 1OJLA 1OIPA 5EP2A 5ITXE 1G8PA 1HNZM 3EIEA 4RF0A 2R4JA 3SASA 2R65A 2CV0A 2H5XA 2YNMD 3FUVA 5EJCA 1GKIA 2O5RA 4GC5A 3GP1A 2C5RA 3KW6A 4B7HA 4RKUF 1QZMA 3GLFA 1OFHA 2JY8A 1IQPA 2LHGA 4LJ4A 1G59A 1T6OA 4DR4M 4M0WA 3J2PB 2M60A 2ZANA 3QYBA 3W0LB 1IXRC 4X65M 1C7YA 1GABA 5EP3A 2UU9M 2ZAOA 4OW0A 1N36M 3VLFB 3HY5A 4KO8A 2DAMA 1P3QQ 3GPYA 4NRVA 2ZTCA 3KS4A 2EO2A 3U6SA 2BJVA 3B7ZA 4GKKM 2LH0A 3GLHA 2FOIC 3IG8A 4MM3B 3WHKA 2Z8YM 5ITTA 4IBKA 3IECA 2YQZA 1J5EM 2L7HA 4PD2A 1JR3E 2LNHC 5ITQA 3T1YM 3KSXA 4FCVA 2O01F 2UUAM 2XSZD 3SYLA 1OAOC 4D80A 2JWSA 1PGYA 3J27B 3T6PA 2UXCM 2OOAA 2C9CA 3QWLA 1WJ7A 4XK8F 4DBGB 5IT9S 2DZOB 4WP2A 2A5YB 4LY6A 3SATA 3SMSA 2VDBB 3AV0A 4RF1A 2LTUA 2Z3XA 4I4LA 4DUZM 1MU5A 2XSZA 4IBBA 1GL6A 1VDDA 2F5QA 1QUSA 3GQ3A 4GRIA 3GLGE 3M0EA 3GQ4A 5C1BA 4IBIA 4DV4M 1HR0M 2Q2EB 1WIVA 4IJEA 5FTKA 3B74A 1LV7A 4NC6A 3U6OA 4DV6M 2MROB 4FW9A 4QOSA 5KPRA 2UXBM 1W5SA 3AJIB 1L2DA 5H37D 4LCBA 1JB0F 3GLIB 4AKHA 4B3SM 3E4RA 2QP9X 4AG5A 4DUYM 1UM8A 1XXHB 1OKSA 5LMUM 4LRTA 3JR5A 3VDUA 3ZH9B 1DGHA 2DAKA 1N34M 3DZDA 5EXXA 5FTLA 4BLCA 4I5SA 3C9PA 2XFSA 4KT0F 1GVNA 1T3TA 1OFIA 3SMPA 3SARA 3V76A 1D0KA 5FTNA 4GKJM 1TGUA 3GLFB 2FE8A 3BXWA 3L26A 1TDHA 3DOAA 4G4RA 1IBKM 2VF8A 3HHXA 1QVRA 3L2AA 5KO3A 4AKIA 4REZA 2BWEA 2CEAA 4LF6M 3U6PA 1Z6TA 1QYRA 2KXEA 3E21A 4MGIE 4Y28F 4M9ZA 4LZJA 3BBZA 1QAOA 1NNJA 1YSYA 3U6EA 3T38A 1YLAA 4LFCM 3GLGB 2ZBKB 4JN6A 4LZZA 1PRBA 3CF0A 1QANA 3VK7A 2UUCM 1QDTA 4JI2M 4IJFA 4PT5A 1TDZA 1ZMWA 3AOEA 2F5PA 2D7HA 4L6V6 1SXJE 4B3TM 1H6UA 3UZUA 3VKHA 1QAQA 4NOOB 3FTFA 1DGGA 2DZNB 3GLHB 1F4IA 4JI3M 8CATA 1DGBA 4GHLA 1WGLA 2I7NA 1XNRM 5EXSA 2HKJA 4Z8XA 3U61A 2D7GA 2VIIA 3GRRA 2KHHA 3MMPA 2LVNC 4NXNM 4XBOA 2K47A 3EIHA 3U6MA 4EIWA 4LJ5A 2ZAMA 4GIPA 2DKLA 3PXGA 3I4VA 1NHGC 1S3SA 2KA6B 5ITXA 4DV7M 5ITUA 5EXPA 4G4OA 1T43A 1QQWA 2B3TA 1TH3A 2LXEA 2YFQA 3GLHE 5FLXS 2C99A 2QENA 1Z5AA 3LW5F 2OPFA 2K9DA 3K9OA 1DO2A 1ORYB 2R0IA 1J09A 4GC9A 1GL7A 3DA1A 4X64M 4DV5M 4AQYM 3AL0C 3HZJA 2V1UA 3PVSA 1QUTA 3SAVA 1GO5A 2FS1A 3HU3A 4NXMM 2Z4SA 4LGYA 2BNKA 2N35A 3TWKA 3FYCA 2KNAA 3LCVB 3WHLA 4PDIA 2L4EA 3VKGA 1E32A 4Q7JA 5L8RF 2Y20A 3PNYA 4JI4M 3GPPA 1TF0B 2KDLA 2L2DA 5EQTA 3W67A 2R18A 3LQQA 4KHPM 2KRKA 1EE8A 3L29A 3HKPA 1VG5A 2H1RA 1C1KA 3ZC7B 3QYEA 2VF7A 3B9PA 3QAUA 3FTEA 5IREB 2R44A 3KOXE 4YHHM 1PJQA 4L4UA 3U5ZB
chains in the Genus database with same CATH topology
2X8AA 1Z59A 4IBCA 2OQ4A 4DR5M 2UXDM 4JI8M 3GPXA 3HU1A 3CF2A 3HGIA 2J7NA 4OVZA 4AZFA 1NJFA 2EUCA 4M9SA 3VFDA 2RGOA 1YUBA 3FKEA 4B08A 3FUWA 2Z7JA 2Y21A 3W0FA 2V1CA 3SFZA 1IY2A 3NWLA 3TPZA 3UGJA 4X62M 1Q3BA 1NHWC 4KODA 2CHGA 5A2QS 1N32M 4S12A 5ITYA 4LFAM 1IBLM 1Z5BA 3BOSA 2R46A 4HL4A 1IY0A 3T15A 4XGIA 2P5TA 3UMMA 1IXSB 4IBGA 4MGYE 1L1ZA 4Z6YA 2CE7A 4R7GA 3MHVC 3GQ5A 3C58A 3U6QA 4QHTA 4W5WA 3TWLA 4M0DA 3A45A 3FUUA 3VDPA 4DR7M 4KLNA 3HJQA 2XF3A 5IWAM 2DWNA 4NSRA 2DHRA 3FUTA 2W82A 3UJNA 2QBYA 4LF4M 3RE8A 1TH2A 4B3RM 1IY1A 1NVMA 3AOEC 1G4AE 1XHBA 4MGKE 2DXIA 1IN6A 2J7OA 3FTDA 3RGSA 3THGA 5DYIA 3LVVA 2D7EA 4GITA 3J7BA 5FTMA 1QAMA 1E9RA 3U60B 4G4NA 4NSOB 4WURA 4ZPXA 3VK8A 4B3MM 3IG5A 4IBDA 4MB7A 3Q8XA 4LFBM 2X4AA 3A46A 3TL4X 1XXHA 4IBEA 3KS8A 4G6ZA 1SXJA 5EXTA 3K8ZA 4B7GA 1Z5CA 4WW0A 2ZM6M 4QHSA 3K1JA 4FCWA 4CHTB 2XZFA 4QNMA 3HWSA 3UK6A 1PM5A 3H4MA 7CATA 5JI2E 4FWDA 1HT1E 2HHHM 1NNUC 5DYGA 1JR3A 1I4WA 5EP4A 4G4QA 1L2CA 2M5ZA 1IN5A 1NSFA 2XZUA 1DGHB 1KSFX 5E6JA 4DR3M 1KFVA 5LMNM 2F5NA 3KFUG 2C98A 3J7AS 4YY3M 4DV2M 3L25A 3LMMA 4MGZE 2NQ8C 4AG6A 2KZSA 1K3WA 3M6AA 1WXQA 3U6DA 1W5TA 1N75A 3HHZA 1IBMM 3KDSE 1FJGM 3R8FA 3RGPA 2ERCA 3LQRA 4JI1M 4DV3M 4DV1M 2Y0TA 2QCUA 1D2NA 3L27A 3PNVA 1PJIA 4LJ7A 1TH4A 3SC3A 3U5ZA 4JI5M 2XEPA 4L15A 3HJ8A 4FCTA 4IBFA 4LJ6A 2Y0QA 4OVZB 3A98B 4LJ9A 1IM2A 2AHMA 3MK6A 4JV5M 5EP1A 1XNQM 2FFJA 4HLQA 1L2BA 2KZUA 3KP0E 1R2ZA 3GLGA 1K3XA 4JI7M 1G3IA 3L28A 1XWIA 3HU2A 3PFIA 1R2YA 4A3VB 3TQSA 2KEBA 2KW0A 3DFZA 1XMQM 2DWLA 2QBYB 3MJ5A 2C96A 1G41A 4RNAA 1IN7A 1E94E 1R6BX 4AKGA 1YE9A 4JI0M 4IIWA 3CF6E 3KOZE 2JA2A 2L6OA 3TWMA 1HQCA 3ILKA 4DR6M 2V6ZM 4PDGA 2R45A 4LF5M 3KP1E 4TUWA 2CUZA 3HHWA 5FSWA 5ITRA 3AKZA 1HNXM 4II7A 2CFOA 1DGFA 2R62A 3TE6A 2EA0A 2YR0A 3M7GA 2R4EA 3FD9A 1MX0A 1ZQ9A 3AOGA 4QNRA 1SXJC 3GRYA 5C18A 3GPUA 1IN8A 3HHYA 3D8BA 3RFWA 2L7IA 3FYDA 3J80S 2LWXA 1HT2E 3NBIA 5F3WA 1Q39A 4NRWA 1N33M 2CHQA 3SHFA 2FNAA 4ITQA 1NY6A 1E9SA 1IXZA 4IBJA 3JAMS 4LF8M 1HQYE 4L16A 5DNYA 2E5LM 2CV1A 3J81S 2F5SA 4LJ8A 4I8OA 3SYKA 5BPVA 3KSJA 2VQEM 1KYIA 2XGNA 2DWMA 1J7KA 1N77A 3ZCBB 4GH9A 1IN4A 2DVWB 4I81A 4P16A 3U6LA 4CGYB 2G8LA 1DO0A 1NJGA 4AW4A 2VQFM 1JR3D 3I51A 3I4YA 1R7RA 2DWZB 4D82A 2F4VM 3KOWE 4LRSA 1SXJD 4X66M 1L8QA 2F5OA 2QZ4A 3U61B 1I94M 2CHVA 4DV0M 4DR1M 4FWGA 2RKOA 2HCBA 3U60A 5IZ7D 4BBAA 1L1TA 4JYAM 3SAUA 1K82A 1GLNA 1XC8A 1X37A 2L09A 1N78A 3GO8A 1FNNA 3K92A 5KPTA 3SHGB 2XH9A 4JXJA 1PJJA 3SBJA 5KPZA 2UUBM 5JI3E 3JR4A 4CISA 3KVWA 2I7PA 4MH0E 4GHAA 4R3DA 3E9SA 4LF7M 1ZAEA 1Q3CA 2XFTA 3A42A 3R9XB 3OTOM 1JQJC 4MGHA 3KXEC 5KQ8A 2QPAA 4K0KM 3SAWA 4M9XA 4OX9M 3K2LA 3GRUA 2CV2A 4JI6M 4FWHA 2G5GX 3HJSA 4L8RC 2RGHA 3T1HM 5GKNA 4DR2M 2BJWA 4BB9A 4D81A 4FVMA 1SXJB 4GMQA 3AFHA 4QOZC 4B7FA 4PCZA 5KQDA 3GLIA 3U6CA 2X49A 3FTCA 2XLJA 1HNWM 4AI6A 4OU7A 1NY5A 2HL7A 4LGMA 5E26A 1XMOM 4LG2A 4L78A 4NL4H 5BR8M 3KOYE 5FTJA 3D8LA 2C9OA 3CTWB 4LF9M 3GRVA 4LJAA 3LVWA 2Z4RA 3FUXA 4FD2A 2KRUA 1OJLA 5EP2A 5ITXE 1G8PA 1HNZM 3EIEA 4RF0A 2R4JA 3SASA 2R65A 2CV0A 3FUVA 2YNMD 5EJCA 1GKIA 2O5RA 4GC5A 3GP1A 2C5RA 3KW6A 4B7HA 3GLFA 1QZMA 4DR4M 1OFHA 4LJ4A 1IQPA 1G59A 4M0WA 3J2PB 2M60A 2ZANA 3W0LB 4X65M 1IXRC 5EP3A 2UU9M 2ZAOA 4OW0A 1N36M 3VLFB 4KO8A 3GPYA 4NRVA 3KS4A 2EO2A 3U6SA 2BJVA 4GKKM 2LH0A 3GLHA 2FOIC 3IG8A 4MM3B 3WHKA 5ITTA 4IBKA 2YQZA 1J5EM 2L7HA 4PD2A 2LNHC 5ITQA 3T1YM 3KSXA 4FCVA 2UUAM 2XSZD 3SYLA 4D80A 3J27B 2UXCM 2C9CA 3QWLA 5IT9S 2DZOB 2A5YB 4LY6A 3SATA 3SMSA 3AV0A 4RF1A 4I4LA 4DUZM 2XSZA 1MU5A 4IBBA 1GL6A 1VDDA 2F5QA 3GQ3A 4GRIA 3M0EA 3GQ4A 5C1BA 4IBIA 4DV4M 1HR0M 2Q2EB 4IJEA 5FTKA 1LV7A 3U6OA 4DV6M 4FW9A 4QOSA 5KPRA 2UXBM 1W5SA 3AJIB 1L2DA 5H37D 4LCBA 3GLIB 4AKHA 3E4RA 2QP9X 4AG5A 4DUYM 1UM8A 1XXHB 5LMUM 4LRTA 3JR5A 3VDUA 3ZH9B 1DGHA 1N34M 3DZDA 5EXXA 5FTLA 4BLCA 4I5SA 2XFSA 1GVNA 1T3TA 1OFIA 3SMPA 3SARA 5FTNA 4GKJM 1TGUA 3GLFB 2FE8A 3L26A 4G4RA 1TDHA 3DOAA 1IBKM 3HHXA 1QVRA 3L2AA 5KO3A 4AKIA 4REZA 2CEAA 4LF6M 3U6PA 1Z6TA 1QYRA 2KXEA 4MGIE 4M9ZA 4LZJA 1QAOA 1NNJA 1YSYA 3U6EA 3T38A 4LFCM 3GLGB 2ZBKB 4JN6A 4LZZA 3CF0A 1QANA 3VK7A 2UUCM 4JI2M 4IJFA 4PT5A 1TDZA 3AOEA 2F5PA 2D7HA 1SXJE 4B3TM 1H6UA 3UZUA 3VKHA 1QAQA 4NOOB 3FTFA 1DGGA 2DZNB 3GLHB 4JI3M 8CATA 1DGBA 4GHLA 2I7NA 1XNRM 5EXSA 2HKJA 4Z8XA 3U61A 2D7GA 2VIIA 3GRRA 4NXNM 4XBOA 2K47A 3EIHA 3U6MA 4EIWA 4LJ5A 2ZAMA 4GIPA 3PXGA 3I4VA 1NHGC 1S3SA 2KA6B 5ITXA 4DV7M 5ITUA 5EXPA 4G4OA 1QQWA 2LXEA 1TH3A 2YFQA 5FLXS 2C99A 2QENA 1Z5AA 2OPFA 1DO2A 1ORYB 1J09A 4GC9A 1GL7A 3DA1A 4X64M 4DV5M 4AQYM 3AL0C 2V1UA 3PVSA 3SAVA 3HU3A 4NXMM 2Z4SA 4LGYA 2BNKA 3TWKA 3FYCA 3WHLA 4PDIA 3VKGA 1E32A 2Y20A 3PNYA 4JI4M 3GPPA 5EQTA 2R18A 3LQQA 4KHPM 2KRKA 1EE8A 3L29A 3HKPA 2H1RA 1C1KA 3ZC7B 3QAUA 3B9PA 3FTEA 5IREB 4YHHM 3KOXE 2Z3XA 4B3SM 4L4UA 3U5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 B;  2X8A A;  5FTK A;  2CHV A;  1LV7 A;  1D2N A;  4FW9 A;  4QOS A;  4LJ7 A;  3HU1 A;  2RKO A;  2HCB A;  3CF2 A;  4FWG A;  1W5S A;  3AJI B;  3SC3 A;  4LCB A;  3GLI B;  1NJF A;  1X37 A;  4L15 A;  2QP9 X;  3VFD A;  1UM8 A;  1XXH B;  1FNN A;  4FCT A;  4LRT A;  4LJ6 A;  3ZH9 B;  1IY2 A;  4LJ9 A;  1IM2 A;  3DZD A;  5EXX A;  5FTL A;  4KOD A;  5JI3 E;  2CHG A;  5EP1 A;  3BOS A;  3GLG A;  1G3I A;  1XWI A;  1IY0 A;  3HU2 A;  3PFI A;  1JQJ C;  4A3V B;  1OFI A;  5FTN A;  3GLF B;  2QPA A;  2QBY B;  2C96 A;  1IXS B;  1G41 A;  1IN7 A;  1E94 E;  1R6B X;  1QVR A;  4FWH A;  2CE7 A;  2CEA A;  1HQC A;  3MHV C;  2V6Z M;  4QHT A;  2BJW A;  4D81 A;  1SXJ B;  3GLI A;  3GLG B;  4KLN A;  4JN6 A;  4LZZ A;  3CF0 A;  1NY5 A;  4LGM A;  2DHR A;  2QBY A;  5FTJ A;  2R62 A;  1IY1 A;  2C9O A;  1NVM A;  1SXJ E;  4LJA A;  2Z4R A;  4FD2 A;  1G4A E;  1OJL A;  4QNR A;  5EP2 A;  1IN6 A;  1SXJ C;  2DZN B;  3GLH B;  5C18 A;  3EIE A;  1IN8 A;  2R65 A;  5DYI A;  5EXS A;  3D8B A;  4GIT A;  4Z8X A;  3KW6 A;  3GLF A;  1QZM A;  2VII A;  1OFH A;  4LJ4 A;  1IQP A;  1HT2 E;  5FTM A;  2ZAN A;  1IXR C;  3EIH A;  3U60 B;  4EIW A;  2CHQ A;  4ZPX A;  2FNA A;  4LJ5 A;  5EP3 A;  2ZAM A;  1NY6 A;  2ZAO A;  1IXZ A;  3VLF B;  4KO8 A;  1HQY E;  3PXG A;  4L16 A;  1S3S A;  1XXH A;  5EXP A;  1SXJ A;  2BJV A;  5EXT A;  3GLH A;  2C99 A;  2QEN A;  3WHK A;  4LJ8 A;  4WW0 A;  4QHS A;  3K1J A;  4FCW A;  3SYK A;  1DO2 A;  4QNM A;  3HWS A;  3UK6 A;  3H4M A;  5JI2 E;  1KYI A;  1HT1 E;  4FWD A;  5DYG A;  1J7K A;  1JR3 A;  5EP4 A;  2V1U A;  3PVS A;  3HU3 A;  2Z4S A;  4FCV A;  1IN5 A;  1NSF A;  2XSZ D;  3SYL A;  4D80 A;  1KSF X;  3WHL A;  1IN4 A;  2DVW B;  4I81 A;  2C9C A;  1E32 A;  2DZO B;  2C98 A;  4LY6 A;  5EQT A;  1DO0 A;  1NJG A;  2KRK A;  4I4L A;  2XSZ A;  3M6A A;  1JR3 D;  1W5T A;  1C1K A;  1R7R A;  2DWZ B;  3KDS E;  4D82 A;  3B9P A;  4LRS A;  1SXJ D;  3R8F A;  3M0E A;  1L8Q A;  5C1B A;  2QZ4 A;  4L4U A;  3U5Z B; 
#chains in the Genus database with same CATH topology
 2X8A A;  1Z59 A;  2JY6 B;  4IBC A;  2OQ4 A;  4DR5 M;  2UXD M;  4JI8 M;  3GPX A;  3HU1 A;  3CF2 A;  3HGI A;  2J7N A;  4OVZ A;  4AZF A;  1IFY A;  1VQ1 A;  1NJF A;  2EUC A;  4M9S A;  3VFD A;  2RGO A;  1YUB A;  3FKE A;  4B08 A;  3FUW A;  2Z7J A;  2Y21 A;  3K9P A;  3W0F A;  2V1C A;  3SFZ A;  1IY2 A;  3HX3 A;  3NWL A;  3TPZ A;  3UGJ A;  4X62 M;  1Q3B A;  2LVP C;  1NHW C;  4KOD A;  2CHG A;  3GLI E;  5A2Q S;  3B7N A;  4S12 A;  5ITY A;  1N32 M;  4LFA M;  1IBL M;  1Z5B A;  2MJ5 B;  2R46 A;  3BOS A;  1G71 A;  4HL4 A;  1IY0 A;  3T15 A;  2O25 A;  4XGI A;  2P5T A;  3UMM A;  1IXS B;  2DHY A;  4IBG A;  4MGY E;  1L1Z A;  4Z6Y A;  2CE7 A;  4R7G A;  3MHV C;  3GQ5 A;  4G3O A;  3C58 A;  3U6Q A;  4QHT A;  2FH0 A;  4W5W A;  3TWL A;  4M0D A;  3GLF E;  1TTE A;  2WSC F;  2J5Y A;  3A45 A;  3FUU A;  3VDP A;  4DR7 M;  1A5T A;  1NV8 A;  2JXN A;  4KLN A;  3HJQ A;  2WSE F;  1TR8 A;  2XF3 A;  5IWA M;  1VDL A;  2DWN A;  4NSR A;  2DHR A;  3C3D A;  3FUT A;  2W82 A;  3UJN A;  2QBY A;  4LF4 M;  3RE8 A;  1TH2 A;  4B3R M;  1IY1 A;  1ZV1 A;  3I01 M;  1NVM A;  3IHP A;  2JUJ A;  3AOE C;  1G4A E;  1XHB A;  4MGK E;  2DXI A;  4P17 A;  1IN6 A;  2J7O A;  3FTD A;  3RGS A;  3THG A;  3F92 A;  5DYI A;  3LVV A;  2D7E A;  4GIT A;  2JP7 A;  3J7B A;  5FTM A;  1QAM A;  1E9R A;  3FRI A;  2HAK A;  3U60 B;  4G4N A;  4NSO B;  4WUR A;  4ZPX A;  3VK8 A;  4B3M M;  3IG5 A;  4IBD A;  4MB7 A;  3Q8X A;  4LFB M;  2WSF F;  2X4A A;  2WZJ A;  2LBC A;  2QNJ A;  1V33 A;  3TL4 X;  3A46 A;  1XXH A;  4IBE A;  1Y8G A;  4G6Z A;  3KS8 A;  1SXJ A;  5EXT A;  2KNZ A;  3K8Z A;  4HEO A;  4B7G A;  1Z5C A;  4WW0 A;  1SG9 A;  2R6F A;  4QHS A;  2ZM6 M;  3K1J A;  4FCW A;  4CHT B;  2XZF A;  2DAI A;  3HWS A;  4QNM A;  2CWB A;  3UK6 A;  3H4M A;  7CAT A;  1PM5 A;  5JI2 E;  4FWD A;  1HT1 E;  2HHH M;  1NNU C;  5DYG A;  1JR3 A;  1I4W A;  5EP4 A;  4G4Q A;  1L2C A;  2LVO C;  2M5Z A;  2QQ8 A;  1IN5 A;  1NSF A;  2XZU A;  1DGH B;  1KSF X;  1OAI A;  5E6J A;  4DR3 M;  1KFV A;  5LMN M;  2F5N A;  3KFU G;  2C98 A;  3J7A S;  4YY3 M;  4DV2 M;  1D0L A;  3L25 A;  3LMM A;  4MGZ E;  2NQ8 C;  2MR9 A;  2LVQ D;  2KZS A;  4AG6 A;  1K3W A;  1WXQ A;  3M6A A;  3U6D A;  1W5T A;  1N75 A;  3HHZ A;  1IBM M;  3KDS E;  1FJG M;  1R4G A;  3R8F A;  1MN3 A;  1WR1 B;  2JY5 A;  2ERC A;  3RGP A;  2DEN A;  3H4J A;  3LQR A;  1LTM A;  4JI1 M;  4DV3 M;  4DV1 M;  2Y0T A;  2QCU A;  3I04 M;  1D2N A;  3L27 A;  2L4F A;  3PNV A;  1PJI A;  1ZMU A;  4LJ7 A;  1WGN A;  1TH4 A;  3SC3 A;  3U5Z A;  2EKF A;  4JI5 M;  2XEP A;  4L15 A;  5DFL A;  1XXH E;  3HJ8 A;  4FCT A;  4IBF A;  2OO9 A;  2Y0Q A;  4LJ6 A;  2JY7 A;  4OVZ B;  2G3Q A;  3A98 B;  4LJ9 A;  1IM2 A;  2AHM A;  1V34 A;  3MK6 A;  4JV5 M;  2EKK A;  5EP1 A;  1XNQ M;  2FFJ A;  4HLQ A;  1L2B A;  2JZ1 A;  2KZU A;  3KP0 E;  1R2Z A;  3GLG A;  1K3X A;  4JI7 M;  1G3I A;  1XWI A;  1XB2 B;  3C3E A;  3HU2 A;  3L28 A;  3PFI A;  4A3V B;  1R2Y A;  3TQS A;  2KEB A;  1D0M A;  2KW0 A;  3DFZ A;  1XMQ M;  2DWL A;  2QBY B;  3MJ5 A;  2C96 A;  1G41 A;  1MJG M;  1IN7 A;  1E94 E;  1R6B X;  4RNA A;  4AKG A;  1YE9 A;  4JI0 M;  4IIW A;  3CF6 E;  3KOZ E;  2JA2 A;  2L6O A;  3TWM A;  1HQC A;  3ILK A;  4DR6 M;  2V6Z M;  1AUA A;  4PDG A;  2R45 A;  4LF5 M;  1OQY A;  3KP1 E;  3B89 A;  2DAE A;  4TUW A;  2CUZ A;  2MGW A;  3HHW A;  1AIP C;  4R71 A;  5FSW A;  1R5L A;  1WHC A;  5ITR A;  3AKZ A;  2EJS A;  3ZQJ A;  1HNX M;  4II7 A;  2CFO A;  1DGF A;  2R62 A;  3TE6 A;  1CUK A;  4F1I A;  2EA0 A;  2YR0 A;  3M7G A;  2R4E A;  3FD9 A;  2APL A;  1MX0 A;  1ZQ9 A;  3AOG A;  3LCU A;  4QNR A;  1GJT A;  1SXJ C;  1VEG A;  3GRY A;  5C18 A;  3GPU A;  1IN8 A;  2OOB A;  3HHY A;  1PJT A;  3D8B A;  1QDR A;  2L7I A;  3RFW A;  3FYD A;  3J80 S;  2LWX A;  1HJP A;  1HT2 E;  3NBI A;  5F3W A;  1Q39 A;  4F2L A;  4NRW A;  1N33 M;  2CHQ A;  3SHF A;  2FNA A;  1BVS A;  4ITQ A;  1NY6 A;  1QZE A;  1E9S A;  1IXZ A;  4IBJ A;  4CJ6 A;  3JAM S;  1HQY E;  4LF8 M;  4L16 A;  5DNY A;  2E5L M;  2DI0 A;  2BWB A;  3B7Q A;  2CV1 A;  3J81 S;  2CP8 A;  2F5S A;  2DZL A;  4LJ8 A;  4I8O A;  3Q8G A;  3SYK A;  1ZMV A;  5BPV A;  3KSJ A;  2JZ0 A;  2VQE M;  1KYI A;  2XGN A;  2KNV A;  1J7K A;  2DWM A;  1N77 A;  3CGW A;  3ZCB B;  4GH9 A;  3E46 A;  2JNH A;  1Q02 A;  1IN4 A;  2DVW B;  4I81 A;  4P16 A;  2K6B A;  3U6L A;  4CGY B;  2MH8 A;  2G8L A;  1DO0 A;  2QSF X;  1EFU B;  4GEW A;  1NJG A;  4AW4 A;  2VQF M;  1JR3 D;  4ANR A;  3I51 A;  3I4Y A;  1R7R A;  2DWZ B;  4D82 A;  2F4V M;  3KOW E;  1VEJ A;  4LRS A;  1SXJ D;  4X66 M;  1L8Q A;  2F5O A;  3W68 A;  1VEK A;  2K0B X;  2QZ4 A;  3U61 B;  1I94 M;  2CHV A;  4DV0 M;  4DR1 M;  1PJS A;  2RKO A;  2HCB A;  4FWG A;  3U60 A;  5IZ7 D;  2DNA A;  2HWJ A;  4BBA A;  1L1T A;  2ZTD A;  4JYA M;  3SAU A;  1K82 A;  1GLN A;  3FE3 A;  1X37 A;  4CIZ A;  1XC8 A;  2L09 A;  1N78 A;  2GQF A;  3GO8 A;  1FNN A;  2DAG A;  3K92 A;  2CRU A;  5KPT A;  2LVA A;  3SHG B;  2XH9 A;  4JXJ A;  1PJJ A;  3SBJ A;  5KPZ A;  2UUB M;  3NBX X;  5JI3 E;  3JR4 A;  4CIS A;  3KVW A;  2I7P A;  2RRU A;  4MH0 E;  4GHA A;  4R3D A;  3E9S A;  4LF7 M;  1ZAE A;  1Q3C A;  2GNO A;  2XFT A;  3A42 A;  1OTR A;  1JQJ C;  3OTO M;  4MGH A;  3R9X B;  3KXE C;  5KQ8 A;  2QPA A;  4K0K M;  3SAW A;  4M9X A;  4OX9 M;  1V92 A;  3K2L A;  3GRU A;  2CV2 A;  4JI6 M;  4FWH A;  2G5G X;  3HJS A;  1EIJ A;  4L8R C;  1GJS A;  2RGH A;  1NO1 A;  3T1H M;  5GKN A;  2LHC A;  4DR2 M;  2BJW A;  4BB9 A;  4D81 A;  4FVM A;  1SXJ B;  1RU3 A;  3AFH A;  4GMQ A;  4UN2 B;  4QOZ C;  4B7F A;  4PCZ A;  5KQD A;  3GLI A;  1DV0 A;  1NV9 A;  3FRH A;  2X49 A;  3U6C A;  3FTC A;  2QHO B;  2XLJ A;  1HNW M;  4AI6 A;  4OU7 A;  1NY5 A;  1OIZ A;  2HL7 A;  4LGM A;  5E26 A;  1XMO M;  4LG2 A;  4L78 A;  4NL4 H;  5BR8 M;  3KOY E;  5FTJ A;  3D8L A;  1IXS A;  2C9O A;  3CTW B;  4LF9 M;  3GRV A;  4LJA A;  3LVW A;  2Z4R A;  3FUX A;  2KRU A;  1UFZ A;  4FD2 A;  1OJL A;  1OIP A;  5EP2 A;  5ITX E;  1G8P A;  1HNZ M;  3EIE A;  4RF0 A;  2R4J A;  3SAS A;  2R65 A;  2CV0 A;  2H5X A;  2YNM D;  3FUV A;  5EJC A;  1GKI A;  2O5R A;  4GC5 A;  3GP1 A;  2C5R A;  3KW6 A;  4B7H A;  4RKU F;  1QZM A;  3GLF A;  1OFH A;  2JY8 A;  1IQP A;  2LHG A;  4LJ4 A;  1G59 A;  1T6O A;  4DR4 M;  4M0W A;  3J2P B;  2M60 A;  2ZAN A;  3QYB A;  3W0L B;  1IXR C;  4X65 M;  1C7Y A;  1GAB A;  5EP3 A;  2UU9 M;  2ZAO A;  4OW0 A;  1N36 M;  3VLF B;  3HY5 A;  4KO8 A;  2DAM A;  1P3Q Q;  3GPY A;  4NRV A;  2ZTC A;  3KS4 A;  2EO2 A;  3U6S A;  2BJV A;  3B7Z A;  4GKK M;  2LH0 A;  3GLH A;  2FOI C;  3IG8 A;  4MM3 B;  3WHK A;  2Z8Y M;  5ITT A;  4IBK A;  3IEC A;  2YQZ A;  1J5E M;  2L7H A;  4PD2 A;  1JR3 E;  2LNH C;  5ITQ A;  3T1Y M;  3KSX A;  4FCV A;  2O01 F;  2UUA M;  2XSZ D;  3SYL A;  1OAO C;  4D80 A;  2JWS A;  1PGY A;  3J27 B;  3T6P A;  2UXC M;  2OOA A;  2C9C A;  3QWL A;  1WJ7 A;  4XK8 F;  4DBG B;  5IT9 S;  2DZO B;  4WP2 A;  2A5Y B;  4LY6 A;  3SAT A;  3SMS A;  2VDB B;  3AV0 A;  4RF1 A;  2LTU A;  2Z3X A;  4I4L A;  4DUZ M;  1MU5 A;  2XSZ A;  4IBB A;  1GL6 A;  1VDD A;  2F5Q A;  1QUS A;  3GQ3 A;  4GRI A;  3GLG E;  3M0E A;  3GQ4 A;  5C1B A;  4IBI A;  4DV4 M;  1HR0 M;  2Q2E B;  1WIV A;  4IJE A;  5FTK A;  3B74 A;  1LV7 A;  4NC6 A;  3U6O A;  4DV6 M;  2MRO B;  4FW9 A;  4QOS A;  5KPR A;  2UXB M;  1W5S A;  3AJI B;  1L2D A;  5H37 D;  4LCB A;  1JB0 F;  3GLI B;  4AKH A;  4B3S M;  3E4R A;  2QP9 X;  4AG5 A;  4DUY M;  1UM8 A;  1XXH B;  1OKS A;  5LMU M;  4LRT A;  3JR5 A;  3VDU A;  3ZH9 B;  1DGH A;  2DAK A;  1N34 M;  3DZD A;  5EXX A;  5FTL A;  4BLC A;  4I5S A;  3C9P A;  2XFS A;  4KT0 F;  1GVN A;  1T3T A;  1OFI A;  3SMP A;  3SAR A;  3V76 A;  1D0K A;  5FTN A;  4GKJ M;  1TGU A;  3GLF B;  2FE8 A;  3BXW A;  3L26 A;  1TDH A;  3DOA A;  4G4R A;  1IBK M;  2VF8 A;  3HHX A;  1QVR A;  3L2A A;  5KO3 A;  4AKI A;  4REZ A;  2BWE A;  2CEA A;  4LF6 M;  3U6P A;  1Z6T A;  1QYR A;  2KXE A;  3E21 A;  4MGI E;  4Y28 F;  4M9Z A;  4LZJ A;  3BBZ A;  1QAO A;  1NNJ A;  1YSY A;  3U6E A;  3T38 A;  1YLA A;  4LFC M;  3GLG B;  2ZBK B;  4JN6 A;  4LZZ A;  1PRB A;  3CF0 A;  1QAN A;  3VK7 A;  2UUC M;  1QDT A;  4JI2 M;  4IJF A;  4PT5 A;  1TDZ A;  1ZMW A;  3AOE A;  2F5P A;  2D7H A;  4L6V 6;  1SXJ E;  4B3T M;  1H6U A;  3UZU A;  3VKH A;  1QAQ A;  4NOO B;  3FTF A;  1DGG A;  2DZN B;  3GLH B;  1F4I A;  4JI3 M;  8CAT A;  1DGB A;  4GHL A;  1WGL A;  2I7N A;  1XNR M;  5EXS A;  2HKJ A;  4Z8X A;  3U61 A;  2D7G A;  2VII A;  3GRR A;  2KHH A;  3MMP A;  2LVN C;  4NXN M;  4XBO A;  2K47 A;  3EIH A;  3U6M A;  4EIW A;  4LJ5 A;  2ZAM A;  4GIP A;  2DKL A;  3PXG A;  3I4V A;  1NHG C;  1S3S A;  2KA6 B;  5ITX A;  4DV7 M;  5ITU A;  5EXP A;  4G4O A;  1T43 A;  1QQW A;  2B3T A;  1TH3 A;  2LXE A;  2YFQ A;  3GLH E;  5FLX S;  2C99 A;  2QEN A;  1Z5A A;  3LW5 F;  2OPF A;  2K9D A;  3K9O A;  1DO2 A;  1ORY B;  2R0I A;  1J09 A;  4GC9 A;  1GL7 A;  3DA1 A;  4X64 M;  4DV5 M;  4AQY M;  3AL0 C;  3HZJ A;  2V1U A;  3PVS A;  1QUT A;  3SAV A;  1GO5 A;  2FS1 A;  3HU3 A;  4NXM M;  2Z4S A;  4LGY A;  2BNK A;  2N35 A;  3TWK A;  3FYC A;  2KNA A;  3LCV B;  3WHL A;  4PDI A;  2L4E A;  3VKG A;  1E32 A;  4Q7J A;  5L8R F;  2Y20 A;  3PNY A;  4JI4 M;  3GPP A;  1TF0 B;  2KDL A;  2L2D A;  5EQT A;  3W67 A;  2R18 A;  3LQQ A;  4KHP M;  2KRK A;  1EE8 A;  3L29 A;  3HKP A;  1VG5 A;  2H1R A;  1C1K A;  3ZC7 B;  3QYE A;  2VF7 A;  3B9P A;  3QAU A;  3FTE A;  5IRE B;  2R44 A;  3KOX E;  4YHH M;  1PJQ A;  4L4U A;  3U5Z B; 
#chains in the Genus database with same CATH homology
 2X8A A;  1Z59 A;  4IBC A;  2OQ4 A;  4DR5 M;  2UXD M;  4JI8 M;  3GPX A;  3HU1 A;  3CF2 A;  3HGI A;  2J7N A;  4OVZ A;  4AZF A;  1NJF A;  2EUC A;  4M9S A;  3VFD A;  2RGO A;  1YUB A;  3FKE A;  4B08 A;  3FUW A;  2Z7J A;  2Y21 A;  3W0F A;  2V1C A;  3SFZ A;  1IY2 A;  3NWL A;  3TPZ A;  3UGJ A;  4X62 M;  1Q3B A;  1NHW C;  4KOD A;  2CHG A;  5A2Q S;  1N32 M;  4S12 A;  5ITY A;  4LFA M;  1IBL M;  1Z5B A;  3BOS A;  2R46 A;  4HL4 A;  1IY0 A;  3T15 A;  4XGI A;  2P5T A;  3UMM A;  1IXS B;  4IBG A;  4MGY E;  1L1Z A;  4Z6Y A;  2CE7 A;  4R7G A;  3MHV C;  3GQ5 A;  3C58 A;  3U6Q A;  4QHT A;  4W5W A;  3TWL A;  4M0D A;  3A45 A;  3FUU A;  3VDP A;  4DR7 M;  4KLN A;  3HJQ A;  2XF3 A;  5IWA M;  2DWN A;  4NSR A;  2DHR A;  3FUT A;  2W82 A;  3UJN A;  2QBY A;  4LF4 M;  3RE8 A;  1TH2 A;  4B3R M;  1IY1 A;  1NVM A;  3AOE C;  1G4A E;  1XHB A;  4MGK E;  2DXI A;  1IN6 A;  2J7O A;  3FTD A;  3RGS A;  3THG A;  5DYI A;  3LVV A;  2D7E A;  4GIT A;  3J7B A;  5FTM A;  1QAM A;  1E9R A;  3U60 B;  4G4N A;  4NSO B;  4WUR A;  4ZPX A;  3VK8 A;  4B3M M;  3IG5 A;  4IBD A;  4MB7 A;  3Q8X A;  4LFB M;  2X4A A;  3A46 A;  3TL4 X;  1XXH A;  4IBE A;  3KS8 A;  4G6Z A;  1SXJ A;  5EXT A;  3K8Z A;  4B7G A;  1Z5C A;  4WW0 A;  2ZM6 M;  4QHS A;  3K1J A;  4FCW A;  4CHT B;  2XZF A;  4QNM A;  3HWS A;  3UK6 A;  1PM5 A;  3H4M A;  7CAT A;  5JI2 E;  4FWD A;  1HT1 E;  2HHH M;  1NNU C;  5DYG A;  1JR3 A;  1I4W A;  5EP4 A;  4G4Q A;  1L2C A;  2M5Z A;  1IN5 A;  1NSF A;  2XZU A;  1DGH B;  1KSF X;  5E6J A;  4DR3 M;  1KFV A;  5LMN M;  2F5N A;  3KFU G;  2C98 A;  3J7A S;  4YY3 M;  4DV2 M;  3L25 A;  3LMM A;  4MGZ E;  2NQ8 C;  4AG6 A;  2KZS A;  1K3W A;  3M6A A;  1WXQ A;  3U6D A;  1W5T A;  1N75 A;  3HHZ A;  1IBM M;  3KDS E;  1FJG M;  3R8F A;  3RGP A;  2ERC A;  3LQR A;  4JI1 M;  4DV3 M;  4DV1 M;  2Y0T A;  2QCU A;  1D2N A;  3L27 A;  3PNV A;  1PJI A;  4LJ7 A;  1TH4 A;  3SC3 A;  3U5Z A;  4JI5 M;  2XEP A;  4L15 A;  3HJ8 A;  4FCT A;  4IBF A;  4LJ6 A;  2Y0Q A;  4OVZ B;  3A98 B;  4LJ9 A;  1IM2 A;  2AHM A;  3MK6 A;  4JV5 M;  5EP1 A;  1XNQ M;  2FFJ A;  4HLQ A;  1L2B A;  2KZU A;  3KP0 E;  1R2Z A;  3GLG A;  1K3X A;  4JI7 M;  1G3I A;  3L28 A;  1XWI A;  3HU2 A;  3PFI A;  1R2Y A;  4A3V B;  3TQS A;  2KEB A;  2KW0 A;  3DFZ A;  1XMQ M;  2DWL A;  2QBY B;  3MJ5 A;  2C96 A;  1G41 A;  4RNA A;  1IN7 A;  1E94 E;  1R6B X;  4AKG A;  1YE9 A;  4JI0 M;  4IIW A;  3CF6 E;  3KOZ E;  2JA2 A;  2L6O A;  3TWM A;  1HQC A;  3ILK A;  4DR6 M;  2V6Z M;  4PDG A;  2R45 A;  4LF5 M;  3KP1 E;  4TUW A;  2CUZ A;  3HHW A;  5FSW A;  5ITR A;  3AKZ A;  1HNX M;  4II7 A;  2CFO A;  1DGF A;  2R62 A;  3TE6 A;  2EA0 A;  2YR0 A;  3M7G A;  2R4E A;  3FD9 A;  1MX0 A;  1ZQ9 A;  3AOG A;  4QNR A;  1SXJ C;  3GRY A;  5C18 A;  3GPU A;  1IN8 A;  3HHY A;  3D8B A;  3RFW A;  2L7I A;  3FYD A;  3J80 S;  2LWX A;  1HT2 E;  3NBI A;  5F3W A;  1Q39 A;  4NRW A;  1N33 M;  2CHQ A;  3SHF A;  2FNA A;  4ITQ A;  1NY6 A;  1E9S A;  1IXZ A;  4IBJ A;  3JAM S;  4LF8 M;  1HQY E;  4L16 A;  5DNY A;  2E5L M;  2CV1 A;  3J81 S;  2F5S A;  4LJ8 A;  4I8O A;  3SYK A;  5BPV A;  3KSJ A;  2VQE M;  1KYI A;  2XGN A;  2DWM A;  1J7K A;  1N77 A;  3ZCB B;  4GH9 A;  1IN4 A;  2DVW B;  4I81 A;  4P16 A;  3U6L A;  4CGY B;  2G8L A;  1DO0 A;  1NJG A;  4AW4 A;  2VQF M;  1JR3 D;  3I51 A;  3I4Y A;  1R7R A;  2DWZ B;  4D82 A;  2F4V M;  3KOW E;  4LRS A;  1SXJ D;  4X66 M;  1L8Q A;  2F5O A;  2QZ4 A;  3U61 B;  1I94 M;  2CHV A;  4DV0 M;  4DR1 M;  4FWG A;  2RKO A;  2HCB A;  3U60 A;  5IZ7 D;  4BBA A;  1L1T A;  4JYA M;  3SAU A;  1K82 A;  1GLN A;  1XC8 A;  1X37 A;  2L09 A;  1N78 A;  3GO8 A;  1FNN A;  3K92 A;  5KPT A;  3SHG B;  2XH9 A;  4JXJ A;  1PJJ A;  3SBJ A;  5KPZ A;  2UUB M;  5JI3 E;  3JR4 A;  4CIS A;  3KVW A;  2I7P A;  4MH0 E;  4GHA A;  4R3D A;  3E9S A;  4LF7 M;  1ZAE A;  1Q3C A;  2XFT A;  3A42 A;  3R9X B;  3OTO M;  1JQJ C;  4MGH A;  3KXE C;  5KQ8 A;  2QPA A;  4K0K M;  3SAW A;  4M9X A;  4OX9 M;  3K2L A;  3GRU A;  2CV2 A;  4JI6 M;  4FWH A;  2G5G X;  3HJS A;  4L8R C;  2RGH A;  3T1H M;  5GKN A;  4DR2 M;  2BJW A;  4BB9 A;  4D81 A;  4FVM A;  1SXJ B;  4GMQ A;  3AFH A;  4QOZ C;  4B7F A;  4PCZ A;  5KQD A;  3GLI A;  3U6C A;  2X49 A;  3FTC A;  2XLJ A;  1HNW M;  4AI6 A;  4OU7 A;  1NY5 A;  2HL7 A;  4LGM A;  5E26 A;  1XMO M;  4LG2 A;  4L78 A;  4NL4 H;  5BR8 M;  3KOY E;  5FTJ A;  3D8L A;  2C9O A;  3CTW B;  4LF9 M;  3GRV A;  4LJA A;  3LVW A;  2Z4R A;  3FUX A;  4FD2 A;  2KRU A;  1OJL A;  5EP2 A;  5ITX E;  1G8P A;  1HNZ M;  3EIE A;  4RF0 A;  2R4J A;  3SAS A;  2R65 A;  2CV0 A;  3FUV A;  2YNM D;  5EJC A;  1GKI A;  2O5R A;  4GC5 A;  3GP1 A;  2C5R A;  3KW6 A;  4B7H A;  3GLF A;  1QZM A;  4DR4 M;  1OFH A;  4LJ4 A;  1IQP A;  1G59 A;  4M0W A;  3J2P B;  2M60 A;  2ZAN A;  3W0L B;  4X65 M;  1IXR C;  5EP3 A;  2UU9 M;  2ZAO A;  4OW0 A;  1N36 M;  3VLF B;  4KO8 A;  3GPY A;  4NRV A;  3KS4 A;  2EO2 A;  3U6S A;  2BJV A;  4GKK M;  2LH0 A;  3GLH A;  2FOI C;  3IG8 A;  4MM3 B;  3WHK A;  5ITT A;  4IBK A;  2YQZ A;  1J5E M;  2L7H A;  4PD2 A;  2LNH C;  5ITQ A;  3T1Y M;  3KSX A;  4FCV A;  2UUA M;  2XSZ D;  3SYL A;  4D80 A;  3J27 B;  2UXC M;  2C9C A;  3QWL A;  5IT9 S;  2DZO B;  2A5Y B;  4LY6 A;  3SAT A;  3SMS A;  3AV0 A;  4RF1 A;  4I4L A;  4DUZ M;  2XSZ A;  1MU5 A;  4IBB A;  1GL6 A;  1VDD A;  2F5Q A;  3GQ3 A;  4GRI A;  3M0E A;  3GQ4 A;  5C1B A;  4IBI A;  4DV4 M;  1HR0 M;  2Q2E B;  4IJE A;  5FTK A;  1LV7 A;  3U6O A;  4DV6 M;  4FW9 A;  4QOS A;  5KPR A;  2UXB M;  1W5S A;  3AJI B;  1L2D A;  5H37 D;  4LCB A;  3GLI B;  4AKH A;  3E4R A;  2QP9 X;  4AG5 A;  4DUY M;  1UM8 A;  1XXH B;  5LMU M;  4LRT A;  3JR5 A;  3VDU A;  3ZH9 B;  1DGH A;  1N34 M;  3DZD A;  5EXX A;  5FTL A;  4BLC A;  4I5S A;  2XFS A;  1GVN A;  1T3T A;  1OFI A;  3SMP A;  3SAR A;  5FTN A;  4GKJ M;  1TGU A;  3GLF B;  2FE8 A;  3L26 A;  4G4R A;  1TDH A;  3DOA A;  1IBK M;  3HHX A;  1QVR A;  3L2A A;  5KO3 A;  4AKI A;  4REZ A;  2CEA A;  4LF6 M;  3U6P A;  1Z6T A;  1QYR A;  2KXE A;  4MGI E;  4M9Z A;  4LZJ A;  1QAO A;  1NNJ A;  1YSY A;  3U6E A;  3T38 A;  4LFC M;  3GLG B;  2ZBK B;  4JN6 A;  4LZZ A;  3CF0 A;  1QAN A;  3VK7 A;  2UUC M;  4JI2 M;  4IJF A;  4PT5 A;  1TDZ A;  3AOE A;  2F5P A;  2D7H A;  1SXJ E;  4B3T M;  1H6U A;  3UZU A;  3VKH A;  1QAQ A;  4NOO B;  3FTF A;  1DGG A;  2DZN B;  3GLH B;  4JI3 M;  8CAT A;  1DGB A;  4GHL A;  2I7N A;  1XNR M;  5EXS A;  2HKJ A;  4Z8X A;  3U61 A;  2D7G A;  2VII A;  3GRR A;  4NXN M;  4XBO A;  2K47 A;  3EIH A;  3U6M A;  4EIW A;  4LJ5 A;  2ZAM A;  4GIP A;  3PXG A;  3I4V A;  1NHG C;  1S3S A;  2KA6 B;  5ITX A;  4DV7 M;  5ITU A;  5EXP A;  4G4O A;  1QQW A;  2LXE A;  1TH3 A;  2YFQ A;  5FLX S;  2C99 A;  2QEN A;  1Z5A A;  2OPF A;  1DO2 A;  1ORY B;  1J09 A;  4GC9 A;  1GL7 A;  3DA1 A;  4X64 M;  4DV5 M;  4AQY M;  3AL0 C;  2V1U A;  3PVS A;  3SAV A;  3HU3 A;  4NXM M;  2Z4S A;  4LGY A;  2BNK A;  3TWK A;  3FYC A;  3WHL A;  4PDI A;  3VKG A;  1E32 A;  2Y20 A;  3PNY A;  4JI4 M;  3GPP A;  5EQT A;  2R18 A;  3LQQ A;  4KHP M;  2KRK A;  1EE8 A;  3L29 A;  3HKP A;  2H1R A;  1C1K A;  3ZC7 B;  3QAU A;  3B9P A;  3FTE A;  5IRE B;  4YHH M;  3KOX E;  2Z3X A;  4B3S M;  4L4U A;  3U5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...