2LVNC

Structure of the gp78 cue domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase AMFR
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvnC00
1VG5A 2LTUA 3GLFE 2QHOB 1JR3E 2JZ0A 1ZMVA 1ZMUA 2KNVA 2DZLA 1YLAA 3LCVB 1C7YA 1DO0A 2G3QA 1ZMWA 1TR8A 2RRUA 1BVSA 2KNAA 2JY6B 3K9OA 1HT1E 1VEJA 1WR1B 2JP7A 2HWJA 2LVOC 1A5TA 2JUJA 2DAEA 2JY8A 2JY7A 3H4JA 1XB2B 2JZ1A 2LVAA 4F1IA 4Q7JA 2K0BX 1SG9A 1WGNA 1HT2E 2LBCA 1AIPC 2EJSA 2BWBA 2L4FA 1PGYA 4G3OA 2WZJA 3B89A 1Y8GA 1TTEA 2ZTCA 2DAGA 1T6OA 1V92A 1XXHE 1DV0A 1VDLA 5DFLA 2DAMA 4F2LA 4UN2B 2K9DA 1UFZA 2L2DA 2KHHA 1GO5A 4GEWA 1G41A 2MROB 2EKKA 1Q02A 3E21A 1WGLA 2B3TA 2LVNC 3FRHA 3E46A 2R0IA 1NV9A 3GLIE 1IXSA 2O25A 2MGWA 3FE3A 1HJPA 2ZTDA 2DAKA 2H5XA 3FRIA 2MR9A 1KYIA 1OTRA 2L4EA 2BWEA 1T43A 3F92A 4R71A 1IFYA 3T6PA 1E94E 2CWBA 2CP8A 1HQYE 2EKFA 3LCUA 2DI0A 2MJ5B 4WP2A 2DKLA 2OO9A 4DBGB 1WJ7A 1EFUB 2KNZA 1QZEA 2JY5A 2LVQD 1NV8A 1ZV1A 2DENA 2OOBA 1WHCA 1OQYA 3K9PA 3MMPA 2LVPC 3IECA 3GLGE 2DAIA 1G3IA 1IM2A 1F4IA 2HAKA 1OAIA 3IHPA 1MN3A 2QSFX 1R4GA 4HEOA 2DNAA 3GLHE 1VQ1A 5JI2E 1OKSA 2DHYA 1DO2A 1P3QQ 1VEGA 1G4AE 2QNJA 3BBZA 1CUKA 2JNHA 1WIVA 2OOAA 1VEKA
chains in the Genus database with same CATH superfamily
3GLIA 1NNJA 4IBJA 3GLFE 1GJSA 1ORYB 1XXHB 2KRUA 2LHCA 2KNVA 1G8PA 2LXEA 3AOEA 1DO0A 2H1RA 3GRYA 5EP3A 3SBJA 2CE7A 1NHGC 4CHTB 2KNAA 3CGWA 3K9OA 1WR1B 1N33M 1AUAA 2JP7A 1GL6A 1J09A 2WSCF 3PNVA 3W68A 1K3XA 1IBMM 2JY8A 2JY7A 4L16A 4B08A 1XB2B 2DXIA 2JZ1A 4X62M 2LVAA 1W5TA 3FTFA 2K0BX 1SG9A 3VK8A 4LFCM 2Y0TA 2EJSA 4IBKA 3HHWA 2WZJA 4LRTA 4AW4A 5EP2A 5EQTA 1TTEA 2F5SA 3VKGA 2DVWB 3AOGA 1V92A 3FTCA 3NWLA 4JXJA 5FLXS 3CF6E 3HU3A 2V6ZM 4GHAA 1OIPA 2C9CA 4DUZM 1DV0A 1NO1A 1XHBA 4YHHM 2ZAMA 3VDUA 3LVWA 3PVSA 3QAUA 4TUWA 3BOSA 1I94M 2WSFF 1FNNA 4OVZB 5DYGA 3L26A 3JR4A 3HGIA 3ZCBB 1C1KA 4NC6A 3GPPA 4DV7M 3SYLA 3LMMA 2EKKA 4QHSA 4X66M 3FUVA 1Z6TA 4MGKE 4LJAA 3QYBA 3UMMA 3OTOM 3CF2A 2MGWA 3FE3A 1EIJA 4AI6A 4JI2M 1XMOM 3UGJA 2DAKA 1SXJE 4LY6A 4K0KM 2CFOA 4GKKM 4GH9A 5EXTA 1OTRA 3J7AS 5EXSA 4LZJA 4AG6A 1QUSA 4P16A 4CGYB 3DOAA 1KSFX 1OFHA 2CUZA 2WSEF 5F3WA 2YNMD 2GNOA 4AKGA 3B7NA 2R18A 2CWBA 1PJQA 2QQ8A 3HJ8A 4JYAM 1Q3BA 2XF3A 2F4VM 3C3EA 4RF1A 5IWAM 2V1UA 1WJ7A 4MGZE 3M6AA 4QNMA 3HHXA 5IZ7D 5FTJA 2JY5A 2K47A 4CIZA 4WW0A 4DV2M 5H37D 1DGBA 3HJSA 3U6QA 3B7ZA 1ZV1A 3CTWB 2YFQA 3AKZA 3NBXX 4AKHA 3SFZA 3HHYA 1WHCA 4L78A 1IN8A 2FFJA 3QWLA 4IBGA 4EIWA 3IECA 3AL0C 1W5SA 3GLGE 5ITUA 3KXEC 4LFBM 1JR3A 2J7OA 3HU1A 4CJ6A 2FS1A 2RKOA 3V76A 4I4LA 4BB9A 1N36M 1D2NA 2DZOB 1TH3A 2VF8A 3SAUA 4GC9A 4DR4M 2CHGA 1NSFA 1HNWM 3K2LA 3Q8GA 3SC3A 2DNAA 1R5LA 3GLHE 1OKSA 1P3QQ 5L8RF 3I04M 5DNYA 2UUBM 1R7RA 2DZNB 4XGIA 3U6CA 3U6PA 4GKJM 2ERCA 1VG5A 2LTUA 5FTNA 4FWHA 3WHLA 2XZFA 1HR0M 3KP0E 2Z4RA 2YQZA 3FTDA 4M0WA 5A2QS 2JZ0A 2QENA 1ZMVA 1T3TA 4DV5M 2Z8YM 1SXJA 3I4VA 1IY0A 2DZLA 3LCVB 2HHHM 5ITXE 2F5NA 1TR8A 2RRUA 3GPUA 3VDPA 1Z5BA 2JY6B 1PJJA 3LVVA 3TQSA 2HKJA 1XWIA 4HL4A 3W0FA 4JI6M 3C9PA 4L4UA 2UXCM 2R4JA 1Z5CA 4R3DA 3AJIB 4B7GA 1DGFA 2CRUA 4L8RC 1WGNA 1HT2E 2LBCA 1XC8A 1AIPC 4IBBA 2BWBA 2HL7A 2L4FA 1RU3A 4OU7A 2R45A 4QOZC 2ZTCA 2CV1A 4G4NA 1GABA 2J7NA 3J2PB 4JI1M 1FJGM 1XXHE 1VDLA 3H4MA 3VKHA 3BXWA 5DFLA 4FWDA 4B3TM 3W0LB 3GQ4A 4REZA 4KO8A 4LJ8A 1UFZA 3SYKA 3I01M 2L2DA 4MGIE 5FTMA 2BJWA 4W5WA 4ZPXA 1GO5A 2V1CA 2HCBA 1GVNA 4XBOA 1JB0F 2LVNC 2XSZA 2R0IA 3Q8XA 8CATA 5KQ8A 2KEBA 1NJFA 3B9PA 2QZ4A 2K6BA 1IXSA 2O25A 3DZDA 3GLHA 3KW6A 2H5XA 2MR9A 3GRUA 2L4EA 5DYIA 1NHWC 1T43A 3T1HM 1QAQA 4R71A 2QBYB 3T6PA 3HZJA 5JI3E 3U6EA 1DGHA 1I4WA 3UZUA 3FUTA 4DR3M 3ZH9B 1E9SA 1SXJC 2APLA 3LCUA 1GLNA 4MM3B 5ITXA 5KO3A 3EIHA 4DR5M 1L1ZA 3QYEA 4LJ6A 2RGHA 2DKLA 2R46A 4ITQA 3NBIA 4GIPA 4DV6M 1PJTA 1QZEA 2QP9X 3I4YA 3RGPA 1KFVA 4A3VB 2LVQD 3ZQJA 3U5ZA 3SATA 1E9RA 2D7EA 3SARA 4OX9M 1Z5AA 2G5GX 3U61B 2RGOA 2R65A 4DR7M 2KDLA 3U6OA 3KDSE 2DENA 3MJ5A 2O5RA 4B7FA 2L09A 4FVMA 4R7GA 3THGA 3FYDA 2LVPC 2CV0A 3UJNA 2EA0A 4PDIA 1IM2A 1F4IA 2C96A 3GLFA 3L28A 3U6SA 3U60A 3U6MA 2DWZB 1JQJC 1XXHA 2LH0A 4JN6A 5IREB 5KPZA 5ITTA 4HLQA 1OAIA 4AG5A 3IHPA 4B3MM 1MN3A 4LCBA 4NRWA 2QSFX 3J27B 1HNZM 1YUBA 4ANRA 4HEOA 4IIWA 2UXDM 1VQ1A 4XK8F 1VDDA 4LF8M 5ITQA 3MK6A 1G4AE 4OW0A 1QANA 2C98A 3E4RA 3PNYA 3J80S 4Z6YA 3GQ3A 2JNHA 3DA1A 2ZM6M 4JI4M 1WIVA 5E26A 2OOAA 1K82A 2Y21A 3E9SA 4L15A 2QHOB 4LF5M 5EXPA 3ZC7B 3R9XB 4AZFA 2ZAOA 1C7YA 2G3QA 2XGNA 2UUAM 3TPZA 2XFSA 4BBAA 3SASA 1HT1E 2UXBM 1MJGM 2QCUA 2HWJA 2FE8A 1A5TA 2DAEA 3SHGB 2OQ4A 3K92A 1N32M 2VQEM 4S12A 1WXQA 1TGUA 2XEPA 3H4JA 1PM5A 1QAMA 3D8LA 4Q7JA 3GLIB 3HKPA 1TF0B 4PCZA 1L2DA 1S3SA 3M7GA 1PGYA 3HU2A 4FCTA 4G3OA 3PXGA 3JR5A 3B89A 2KXEA 3TWLA 3JAMS 1QQWA 2DAGA 1T6OA 2YR0A 2XH9A 3L27A 1PRBA 1GJTA 2DAMA 1HQCA 2M60A 5FSWA 3TWKA 2XLJA 2F5PA 2N35A 4G4QA 5FTLA 5ITYA 4D80A 4UN2B 2G8LA 2Q2EB 3TWMA 4DR6M 1OIZA 4LF6M 2KHHA 4GEWA 4IBFA 3U6LA 1G41A 3FUXA 2VIIA 4FWGA 2JWSA 3EIEA 1Q02A 2KZUA 1WGLA 2B3TA 3C3DA 1QDRA 3LQQA 3M0EA 3J81S 1PJIA 1QDTA 4LG2A 2R62A 2AHMA 3C58A 1N34M 2C99A 3ILKA 5ITRA 1L8QA 1ZAEA 4JI8M 3A98B 2VQFM 4MGHA 1HJPA 1QVRA 2ZTDA 4JI3M 2XFTA 3FYCA 1N78A 5EP4A 3FRIA 1IBKM 2EUCA 4KT0F 1E32A 1XNQM 5C1BA 1IFYA 2LNHC 2DWMA 3GRVA 4Y28F 3RFWA 1MU5A 2P5TA 3DFZA 1OFIA 4DR1M 1V33A 1IN5A 4PD2A 2FNAA 4GRIA 4Z8XA 4DR2M 1D0KA 1HQYE 2EKFA 1EE8A 4IBCA 3RGSA 1IN6A 3GLGA 3VLFB 3U6DA 1XNRM 4WP2A 5KPTA 1LTMA 2OO9A 2VDBB 1V34A 4MH0E 3HX3A 4NXNM 3FUUA 1NJGA 1QAOA 4LF7M 1EFUB 2KNZA 2X49A 2KRKA 2DWLA 1UM8A 7CATA 1NV8A 2R44A 3A46A 4FW9A 1D0LA 1R6BX 1IQPA 3KSJA 4AKIA 3KOZE 1H6UA 2ZANA 3GLFB 3U60B 3KFUG 1TH4A 4RNAA 1NNUC 4G6ZA 2Y20A 3FUWA 3MMPA 2KZSA 1PJSA 1YSYA 3R8FA 3KOXE 2DAIA 4FCVA 1NVMA 4IBEA 2C9OA 4M9SA 3A45A 4P17A 1JR3D 2Y0QA 4RF0A 2BJVA 2X4AA 2L6OA 2F5QA 3W67A 3KS8A 2QPAA 2Z7JA 3AFHA 3SMPA 2E5LM 1OJLA 3L25A 4GMQA 4L6V6 1Q39A 1X37A 3CF0A 5JI2E 5BR8M 5E6JA 1DO2A 2CV2A 4LRSA 1VEGA 2A5YB 4NL4H 1TDHA 4X64M 5FTKA 3BBZA 1CUKA 1HNXM 2MROB 3HWSA 4NSRA 1VEKA 2F5OA 3GRRA 2UUCM 2OPFA 2JXNA 4JI5M 1JR3E 4M9XA 4LGMA 1R2YA 1SXJD 2L7HA 1ZMUA 3IG5A 1YLAA 1Q3CA 4NSOB 1ZMWA 1BVSA 3TL4X 4KODA 4LJ7A 3PFIA 4NXMM 4FD2A 1VEJA 4IBIA 5EJCA 2GQFA 5EP1A 1ZQ9A 1QZMA 4B7HA 2CEAA 2O01F 1IN4A 3D8BA 1IXZA 2LVOC 2J5YA 2JUJA 4QOSA 2VF7A 3SMSA 3L29A 3FTEA 3I51A 4JI0M 1Z59A 4CISA 1R2ZA 1J7KA 3VFDA 4GC5A 4F1IA 1K3WA 3SAWA 4I81A 4IBDA 5C18A 2LWXA 2KW0A 1GL7A 4M9ZA 5BPVA 1Y8GA 3HHZA 1SXJB 4LFAM 2W82A 5EXXA 4II7A 3FKEA 1YE9A 3GPYA 1G71A 1IBLM 2ZBKB 2KA6B 2CHQA 3A42A 3B7QA 2R4EA 1G59A 1N75A 1QYRA 4F2LA 4QHTA 1IXRC 1L2CA 2QBYA 4YY3M 3KP1E 3AOEC 2K9DA 2CHVA 1LV7A 2L7IA 3UK6A 3GO8A 4JV5M 4LZZA 4D81A 2XSZD 3E21A 3FRHA 4OVZA 5LMUM 3E46A 4B3SM 4BLCA 1TH2A 3KVWA 3K1JA 3T15A 1NV9A 2M5ZA 3GLIE 4JI7M 1D0MA 3IG8A 4DV4M 1IY1A 4WURA 5LMNM 2D7HA 3SAVA 2D7GA 2I7NA 5KPRA 2MH8A 1XMQM 5KQDA 3WHKA 4I5SA 1IY2A 3U61A 1KYIA 1N77A 2BWEA 2XZUA 2Z3XA 2EO2A 3B74A 3MHVC 3F92A 3GLGB 3HJQA 4X65M 3L2AA 1E94E 2CP8A 3KS4A 2DHRA 4DV0M 2DI0A 3KOYE 1MX0A 2MJ5B 4FCWA 4I8OA 4MB7A 4NOOB 4MGYE 4DUYM 3LW5F 1J5EM 3T38A 1IN7A 4DBGB 4B3RM 1IXSB 3GLHB 5IT9S 4LF9M 4DV3M 3T1YM 2DWNA 1TDZA 3K8ZA 3KOWE 4GITA 2X8AA 4M0DA 4G4RA 3KSXA 2I7PA 2FOIC 1NY5A 1NY6A 2OOBA 2NQ8C 2R6FA 4NRVA 3FD9A 1DGHB 1OQYA 3K9PA 2C5RA 1L1TA 3SHFA 4PDGA 2UU9M 1L2BA 1G3IA 2BNKA 3HY5A 4IJEA 4LF4M 2FH0A 3LQRA 2HAKA 3GQ5A 3RE8A 4IJFA 4KHPM 4LJ4A 1GKIA 4LJ9A 1R4GA 3TE6A 3GP1A 3AV0A 3GPXA 4AQYM 3U5ZB 2JA2A 4G4OA 4GHLA 4DV1M 2LHGA 2DHYA 3J7BA 4QNRA 4RKUF 4LGYA 4PT5A 2QNJA 1OAOC 2Z4SA 4KLNA 4D82A 3VK7A 5GKNA 1QUTA 4LJ5A 1DGGA
chains in the Genus database with same CATH topology
1VG5A 2LTUA 3GLFE 2QHOB 1JR3E 2JZ0A 1ZMVA 1ZMUA 2KNVA 2DZLA 1YLAA 3LCVB 1C7YA 1DO0A 2G3QA 1ZMWA 1TR8A 2RRUA 1BVSA 2KNAA 2JY6B 3K9OA 1HT1E 1VEJA 1WR1B 2JP7A 2HWJA 2LVOC 1A5TA 2JUJA 2DAEA 2JY8A 2JY7A 3H4JA 1XB2B 2JZ1A 2LVAA 4F1IA 4Q7JA 2K0BX 1SG9A 1WGNA 1HT2E 2LBCA 1AIPC 2EJSA 2BWBA 2L4FA 1PGYA 4G3OA 2WZJA 3B89A 1Y8GA 1TTEA 2ZTCA 2DAGA 1T6OA 1V92A 1XXHE 1DV0A 1VDLA 5DFLA 2DAMA 4F2LA 4UN2B 2K9DA 1UFZA 2L2DA 2KHHA 1GO5A 4GEWA 1G41A 2MROB 2EKKA 1Q02A 3E21A 1WGLA 2B3TA 2LVNC 3FRHA 3E46A 2R0IA 1NV9A 3GLIE 1IXSA 2O25A 2MGWA 3FE3A 1HJPA 2ZTDA 2DAKA 2H5XA 3FRIA 2MR9A 1KYIA 1OTRA 2L4EA 2BWEA 1T43A 3F92A 4R71A 1IFYA 3T6PA 1E94E 2CWBA 2CP8A 1HQYE 2EKFA 3LCUA 2DI0A 2MJ5B 4WP2A 2DKLA 2OO9A 4DBGB 1WJ7A 1EFUB 2KNZA 1QZEA 2JY5A 2LVQD 1NV8A 1ZV1A 2DENA 2OOBA 1WHCA 1OQYA 3K9PA 3MMPA 2LVPC 3IECA 3GLGE 2DAIA 1G3IA 1IM2A 1F4IA 2HAKA 1OAIA 3IHPA 1MN3A 2QSFX 1R4GA 4HEOA 2DNAA 3GLHE 1VQ1A 5JI2E 1OKSA 2DHYA 1DO2A 1P3QQ 1VEGA 1G4AE 2QNJA 3BBZA 1CUKA 2JNHA 1WIVA 2OOAA 1VEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG5 A;  2LTU A;  3GLF E;  2QHO B;  1JR3 E;  2JZ0 A;  1ZMV A;  1ZMU A;  2KNV A;  2DZL A;  1YLA A;  3LCV B;  1C7Y A;  1DO0 A;  2G3Q A;  1ZMW A;  1TR8 A;  2RRU A;  1BVS A;  2KNA A;  2JY6 B;  3K9O A;  1HT1 E;  1VEJ A;  1WR1 B;  2JP7 A;  2HWJ A;  2LVO C;  1A5T A;  2JUJ A;  2DAE A;  2JY8 A;  2JY7 A;  3H4J A;  1XB2 B;  2JZ1 A;  2LVA A;  4F1I A;  4Q7J A;  2K0B X;  1SG9 A;  1WGN A;  1HT2 E;  2LBC A;  1AIP C;  2EJS A;  2BWB A;  2L4F A;  1PGY A;  4G3O A;  2WZJ A;  3B89 A;  1Y8G A;  1TTE A;  2ZTC A;  2DAG A;  1T6O A;  1V92 A;  1XXH E;  1DV0 A;  1VDL A;  5DFL A;  2DAM A;  4F2L A;  4UN2 B;  2K9D A;  1UFZ A;  2L2D A;  2KHH A;  1GO5 A;  4GEW A;  1G41 A;  2MRO B;  2EKK A;  1Q02 A;  3E21 A;  1WGL A;  2B3T A;  2LVN C;  3FRH A;  3E46 A;  2R0I A;  1NV9 A;  3GLI E;  1IXS A;  2O25 A;  2MGW A;  3FE3 A;  1HJP A;  2ZTD A;  2DAK A;  2H5X A;  3FRI A;  2MR9 A;  1KYI A;  1OTR A;  2L4E A;  2BWE A;  1T43 A;  3F92 A;  4R71 A;  1IFY A;  3T6P A;  1E94 E;  2CWB A;  2CP8 A;  1HQY E;  2EKF A;  3LCU A;  2DI0 A;  2MJ5 B;  4WP2 A;  2DKL A;  2OO9 A;  4DBG B;  1WJ7 A;  1EFU B;  2KNZ A;  1QZE A;  2JY5 A;  2LVQ D;  1NV8 A;  1ZV1 A;  2DEN A;  2OOB A;  1WHC A;  1OQY A;  3K9P A;  3MMP A;  2LVP C;  3IEC A;  3GLG E;  2DAI A;  1G3I A;  1IM2 A;  1F4I A;  2HAK A;  1OAI A;  3IHP A;  1MN3 A;  2QSF X;  1R4G A;  4HEO A;  2DNA A;  3GLH E;  1VQ1 A;  5JI2 E;  1OKS A;  2DHY A;  1DO2 A;  1P3Q Q;  1VEG A;  1G4A E;  2QNJ A;  3BBZ A;  1CUK A;  2JNH A;  1WIV A;  2OOA A;  1VEK A; 
#chains in the Genus database with same CATH topology
 3GLI A;  1NNJ A;  4IBJ A;  3GLF E;  1GJS A;  1ORY B;  1XXH B;  2KRU A;  2LHC A;  2KNV A;  1G8P A;  2LXE A;  3AOE A;  1DO0 A;  2H1R A;  3GRY A;  5EP3 A;  3SBJ A;  2CE7 A;  1NHG C;  4CHT B;  2KNA A;  3CGW A;  3K9O A;  1WR1 B;  1N33 M;  1AUA A;  2JP7 A;  1GL6 A;  1J09 A;  2WSC F;  3PNV A;  3W68 A;  1K3X A;  1IBM M;  2JY8 A;  2JY7 A;  4L16 A;  4B08 A;  1XB2 B;  2DXI A;  2JZ1 A;  4X62 M;  2LVA A;  1W5T A;  3FTF A;  2K0B X;  1SG9 A;  3VK8 A;  4LFC M;  2Y0T A;  2EJS A;  4IBK A;  3HHW A;  2WZJ A;  4LRT A;  4AW4 A;  5EP2 A;  5EQT A;  1TTE A;  2F5S A;  3VKG A;  2DVW B;  3AOG A;  1V92 A;  3FTC A;  3NWL A;  4JXJ A;  5FLX S;  3CF6 E;  3HU3 A;  2V6Z M;  4GHA A;  1OIP A;  2C9C A;  4DUZ M;  1DV0 A;  1NO1 A;  1XHB A;  4YHH M;  2ZAM A;  3VDU A;  3LVW A;  3PVS A;  3QAU A;  4TUW A;  3BOS A;  1I94 M;  2WSF F;  1FNN A;  4OVZ B;  5DYG A;  3L26 A;  3JR4 A;  3HGI A;  3ZCB B;  1C1K A;  4NC6 A;  3GPP A;  4DV7 M;  3SYL A;  3LMM A;  2EKK A;  4QHS A;  4X66 M;  3FUV A;  1Z6T A;  4MGK E;  4LJA A;  3QYB A;  3UMM A;  3OTO M;  3CF2 A;  2MGW A;  3FE3 A;  1EIJ A;  4AI6 A;  4JI2 M;  1XMO M;  3UGJ A;  2DAK A;  1SXJ E;  4LY6 A;  4K0K M;  2CFO A;  4GKK M;  4GH9 A;  5EXT A;  1OTR A;  3J7A S;  5EXS A;  4LZJ A;  4AG6 A;  1QUS A;  4P16 A;  4CGY B;  3DOA A;  1KSF X;  1OFH A;  2CUZ A;  2WSE F;  5F3W A;  2YNM D;  2GNO A;  4AKG A;  3B7N A;  2R18 A;  2CWB A;  1PJQ A;  2QQ8 A;  3HJ8 A;  4JYA M;  1Q3B A;  2XF3 A;  2F4V M;  3C3E A;  4RF1 A;  5IWA M;  2V1U A;  1WJ7 A;  4MGZ E;  3M6A A;  4QNM A;  3HHX A;  5IZ7 D;  5FTJ A;  2JY5 A;  2K47 A;  4CIZ A;  4WW0 A;  4DV2 M;  5H37 D;  1DGB A;  3HJS A;  3U6Q A;  3B7Z A;  1ZV1 A;  3CTW B;  2YFQ A;  3AKZ A;  3NBX X;  4AKH A;  3SFZ A;  3HHY A;  1WHC A;  4L78 A;  1IN8 A;  2FFJ A;  3QWL A;  4IBG A;  4EIW A;  3IEC A;  3AL0 C;  1W5S A;  3GLG E;  5ITU A;  3KXE C;  4LFB M;  1JR3 A;  2J7O A;  3HU1 A;  4CJ6 A;  2FS1 A;  2RKO A;  3V76 A;  4I4L A;  4BB9 A;  1N36 M;  1D2N A;  2DZO B;  1TH3 A;  2VF8 A;  3SAU A;  4GC9 A;  4DR4 M;  2CHG A;  1NSF A;  1HNW M;  3K2L A;  3Q8G A;  3SC3 A;  2DNA A;  1R5L A;  3GLH E;  1OKS A;  1P3Q Q;  5L8R F;  3I04 M;  5DNY A;  2UUB M;  1R7R A;  2DZN B;  4XGI A;  3U6C A;  3U6P A;  4GKJ M;  2ERC A;  1VG5 A;  2LTU A;  5FTN A;  4FWH A;  3WHL A;  2XZF A;  1HR0 M;  3KP0 E;  2Z4R A;  2YQZ A;  3FTD A;  4M0W A;  5A2Q S;  2JZ0 A;  2QEN A;  1ZMV A;  1T3T A;  4DV5 M;  2Z8Y M;  1SXJ A;  3I4V A;  1IY0 A;  2DZL A;  3LCV B;  2HHH M;  5ITX E;  2F5N A;  1TR8 A;  2RRU A;  3GPU A;  3VDP A;  1Z5B A;  2JY6 B;  1PJJ A;  3LVV A;  3TQS A;  2HKJ A;  1XWI A;  4HL4 A;  3W0F A;  4JI6 M;  3C9P A;  4L4U A;  2UXC M;  2R4J A;  1Z5C A;  4R3D A;  3AJI B;  4B7G A;  1DGF A;  2CRU A;  4L8R C;  1WGN A;  1HT2 E;  2LBC A;  1XC8 A;  1AIP C;  4IBB A;  2BWB A;  2HL7 A;  2L4F A;  1RU3 A;  4OU7 A;  2R45 A;  4QOZ C;  2ZTC A;  2CV1 A;  4G4N A;  1GAB A;  2J7N A;  3J2P B;  4JI1 M;  1FJG M;  1XXH E;  1VDL A;  3H4M A;  3VKH A;  3BXW A;  5DFL A;  4FWD A;  4B3T M;  3W0L B;  3GQ4 A;  4REZ A;  4KO8 A;  4LJ8 A;  1UFZ A;  3SYK A;  3I01 M;  2L2D A;  4MGI E;  5FTM A;  2BJW A;  4W5W A;  4ZPX A;  1GO5 A;  2V1C A;  2HCB A;  1GVN A;  4XBO A;  1JB0 F;  2LVN C;  2XSZ A;  2R0I A;  3Q8X A;  8CAT A;  5KQ8 A;  2KEB A;  1NJF A;  3B9P A;  2QZ4 A;  2K6B A;  1IXS A;  2O25 A;  3DZD A;  3GLH A;  3KW6 A;  2H5X A;  2MR9 A;  3GRU A;  2L4E A;  5DYI A;  1NHW C;  1T43 A;  3T1H M;  1QAQ A;  4R71 A;  2QBY B;  3T6P A;  3HZJ A;  5JI3 E;  3U6E A;  1DGH A;  1I4W A;  3UZU A;  3FUT A;  4DR3 M;  3ZH9 B;  1E9S A;  1SXJ C;  2APL A;  3LCU A;  1GLN A;  4MM3 B;  5ITX A;  5KO3 A;  3EIH A;  4DR5 M;  1L1Z A;  3QYE A;  4LJ6 A;  2RGH A;  2DKL A;  2R46 A;  4ITQ A;  3NBI A;  4GIP A;  4DV6 M;  1PJT A;  1QZE A;  2QP9 X;  3I4Y A;  3RGP A;  1KFV A;  4A3V B;  2LVQ D;  3ZQJ A;  3U5Z A;  3SAT A;  1E9R A;  2D7E A;  3SAR A;  4OX9 M;  1Z5A A;  2G5G X;  3U61 B;  2RGO A;  2R65 A;  4DR7 M;  2KDL A;  3U6O A;  3KDS E;  2DEN A;  3MJ5 A;  2O5R A;  4B7F A;  2L09 A;  4FVM A;  4R7G A;  3THG A;  3FYD A;  2LVP C;  2CV0 A;  3UJN A;  2EA0 A;  4PDI A;  1IM2 A;  1F4I A;  2C96 A;  3GLF A;  3L28 A;  3U6S A;  3U60 A;  3U6M A;  2DWZ B;  1JQJ C;  1XXH A;  2LH0 A;  4JN6 A;  5IRE B;  5KPZ A;  5ITT A;  4HLQ A;  1OAI A;  4AG5 A;  3IHP A;  4B3M M;  1MN3 A;  4LCB A;  4NRW A;  2QSF X;  3J27 B;  1HNZ M;  1YUB A;  4ANR A;  4HEO A;  4IIW A;  2UXD M;  1VQ1 A;  4XK8 F;  1VDD A;  4LF8 M;  5ITQ A;  3MK6 A;  1G4A E;  4OW0 A;  1QAN A;  2C98 A;  3E4R A;  3PNY A;  3J80 S;  4Z6Y A;  3GQ3 A;  2JNH A;  3DA1 A;  2ZM6 M;  4JI4 M;  1WIV A;  5E26 A;  2OOA A;  1K82 A;  2Y21 A;  3E9S A;  4L15 A;  2QHO B;  4LF5 M;  5EXP A;  3ZC7 B;  3R9X B;  4AZF A;  2ZAO A;  1C7Y A;  2G3Q A;  2XGN A;  2UUA M;  3TPZ A;  2XFS A;  4BBA A;  3SAS A;  1HT1 E;  2UXB M;  1MJG M;  2QCU A;  2HWJ A;  2FE8 A;  1A5T A;  2DAE A;  3SHG B;  2OQ4 A;  3K92 A;  1N32 M;  2VQE M;  4S12 A;  1WXQ A;  1TGU A;  2XEP A;  3H4J A;  1PM5 A;  1QAM A;  3D8L A;  4Q7J A;  3GLI B;  3HKP A;  1TF0 B;  4PCZ A;  1L2D A;  1S3S A;  3M7G A;  1PGY A;  3HU2 A;  4FCT A;  4G3O A;  3PXG A;  3JR5 A;  3B89 A;  2KXE A;  3TWL A;  3JAM S;  1QQW A;  2DAG A;  1T6O A;  2YR0 A;  2XH9 A;  3L27 A;  1PRB A;  1GJT A;  2DAM A;  1HQC A;  2M60 A;  5FSW A;  3TWK A;  2XLJ A;  2F5P A;  2N35 A;  4G4Q A;  5FTL A;  5ITY A;  4D80 A;  4UN2 B;  2G8L A;  2Q2E B;  3TWM A;  4DR6 M;  1OIZ A;  4LF6 M;  2KHH A;  4GEW A;  4IBF A;  3U6L A;  1G41 A;  3FUX A;  2VII A;  4FWG A;  2JWS A;  3EIE A;  1Q02 A;  2KZU A;  1WGL A;  2B3T A;  3C3D A;  1QDR A;  3LQQ A;  3M0E A;  3J81 S;  1PJI A;  1QDT A;  4LG2 A;  2R62 A;  2AHM A;  3C58 A;  1N34 M;  2C99 A;  3ILK A;  5ITR A;  1L8Q A;  1ZAE A;  4JI8 M;  3A98 B;  2VQF M;  4MGH A;  1HJP A;  1QVR A;  2ZTD A;  4JI3 M;  2XFT A;  3FYC A;  1N78 A;  5EP4 A;  3FRI A;  1IBK M;  2EUC A;  4KT0 F;  1E32 A;  1XNQ M;  5C1B A;  1IFY A;  2LNH C;  2DWM A;  3GRV A;  4Y28 F;  3RFW A;  1MU5 A;  2P5T A;  3DFZ A;  1OFI A;  4DR1 M;  1V33 A;  1IN5 A;  4PD2 A;  2FNA A;  4GRI A;  4Z8X A;  4DR2 M;  1D0K A;  1HQY E;  2EKF A;  1EE8 A;  4IBC A;  3RGS A;  1IN6 A;  3GLG A;  3VLF B;  3U6D A;  1XNR M;  4WP2 A;  5KPT A;  1LTM A;  2OO9 A;  2VDB B;  1V34 A;  4MH0 E;  3HX3 A;  4NXN M;  3FUU A;  1NJG A;  1QAO A;  4LF7 M;  1EFU B;  2KNZ A;  2X49 A;  2KRK A;  2DWL A;  1UM8 A;  7CAT A;  1NV8 A;  2R44 A;  3A46 A;  4FW9 A;  1D0L A;  1R6B X;  1IQP A;  3KSJ A;  4AKI A;  3KOZ E;  1H6U A;  2ZAN A;  3GLF B;  3U60 B;  3KFU G;  1TH4 A;  4RNA A;  1NNU C;  4G6Z A;  2Y20 A;  3FUW A;  3MMP A;  2KZS A;  1PJS A;  1YSY A;  3R8F A;  3KOX E;  2DAI A;  4FCV A;  1NVM A;  4IBE A;  2C9O A;  4M9S A;  3A45 A;  4P17 A;  1JR3 D;  2Y0Q A;  4RF0 A;  2BJV A;  2X4A A;  2L6O A;  2F5Q A;  3W67 A;  3KS8 A;  2QPA A;  2Z7J A;  3AFH A;  3SMP A;  2E5L M;  1OJL A;  3L25 A;  4GMQ A;  4L6V 6;  1Q39 A;  1X37 A;  3CF0 A;  5JI2 E;  5BR8 M;  5E6J A;  1DO2 A;  2CV2 A;  4LRS A;  1VEG A;  2A5Y B;  4NL4 H;  1TDH A;  4X64 M;  5FTK A;  3BBZ A;  1CUK A;  1HNX M;  2MRO B;  3HWS A;  4NSR A;  1VEK A;  2F5O A;  3GRR A;  2UUC M;  2OPF A;  2JXN A;  4JI5 M;  1JR3 E;  4M9X A;  4LGM A;  1R2Y A;  1SXJ D;  2L7H A;  1ZMU A;  3IG5 A;  1YLA A;  1Q3C A;  4NSO B;  1ZMW A;  1BVS A;  3TL4 X;  4KOD A;  4LJ7 A;  3PFI A;  4NXM M;  4FD2 A;  1VEJ A;  4IBI A;  5EJC A;  2GQF A;  5EP1 A;  1ZQ9 A;  1QZM A;  4B7H A;  2CEA A;  2O01 F;  1IN4 A;  3D8B A;  1IXZ A;  2LVO C;  2J5Y A;  2JUJ A;  4QOS A;  2VF7 A;  3SMS A;  3L29 A;  3FTE A;  3I51 A;  4JI0 M;  1Z59 A;  4CIS A;  1R2Z A;  1J7K A;  3VFD A;  4GC5 A;  4F1I A;  1K3W A;  3SAW A;  4I81 A;  4IBD A;  5C18 A;  2LWX A;  2KW0 A;  1GL7 A;  4M9Z A;  5BPV A;  1Y8G A;  3HHZ A;  1SXJ B;  4LFA M;  2W82 A;  5EXX A;  4II7 A;  3FKE A;  1YE9 A;  3GPY A;  1G71 A;  1IBL M;  2ZBK B;  2KA6 B;  2CHQ A;  3A42 A;  3B7Q A;  2R4E A;  1G59 A;  1N75 A;  1QYR A;  4F2L A;  4QHT A;  1IXR C;  1L2C A;  2QBY A;  4YY3 M;  3KP1 E;  3AOE C;  2K9D A;  2CHV A;  1LV7 A;  2L7I A;  3UK6 A;  3GO8 A;  4JV5 M;  4LZZ A;  4D81 A;  2XSZ D;  3E21 A;  3FRH A;  4OVZ A;  5LMU M;  3E46 A;  4B3S M;  4BLC A;  1TH2 A;  3KVW A;  3K1J A;  3T15 A;  1NV9 A;  2M5Z A;  3GLI E;  4JI7 M;  1D0M A;  3IG8 A;  4DV4 M;  1IY1 A;  4WUR A;  5LMN M;  2D7H A;  3SAV A;  2D7G A;  2I7N A;  5KPR A;  2MH8 A;  1XMQ M;  5KQD A;  3WHK A;  4I5S A;  1IY2 A;  3U61 A;  1KYI A;  1N77 A;  2BWE A;  2XZU A;  2Z3X A;  2EO2 A;  3B74 A;  3MHV C;  3F92 A;  3GLG B;  3HJQ A;  4X65 M;  3L2A A;  1E94 E;  2CP8 A;  3KS4 A;  2DHR A;  4DV0 M;  2DI0 A;  3KOY E;  1MX0 A;  2MJ5 B;  4FCW A;  4I8O A;  4MB7 A;  4NOO B;  4MGY E;  4DUY M;  3LW5 F;  1J5E M;  3T38 A;  1IN7 A;  4DBG B;  4B3R M;  1IXS B;  3GLH B;  5IT9 S;  4LF9 M;  4DV3 M;  3T1Y M;  2DWN A;  1TDZ A;  3K8Z A;  3KOW E;  4GIT A;  2X8A A;  4M0D A;  4G4R A;  3KSX A;  2I7P A;  2FOI C;  1NY5 A;  1NY6 A;  2OOB A;  2NQ8 C;  2R6F A;  4NRV A;  3FD9 A;  1DGH B;  1OQY A;  3K9P A;  2C5R A;  1L1T A;  3SHF A;  4PDG A;  2UU9 M;  1L2B A;  1G3I A;  2BNK A;  3HY5 A;  4IJE A;  4LF4 M;  2FH0 A;  3LQR A;  2HAK A;  3GQ5 A;  3RE8 A;  4IJF A;  4KHP M;  4LJ4 A;  1GKI A;  4LJ9 A;  1R4G A;  3TE6 A;  3GP1 A;  3AV0 A;  3GPX A;  4AQY M;  3U5Z B;  2JA2 A;  4G4O A;  4GHL A;  4DV1 M;  2LHG A;  2DHY A;  3J7B A;  4QNR A;  4RKU F;  4LGY A;  4PT5 A;  2QNJ A;  1OAO C;  2Z4S A;  4KLN A;  4D82 A;  3VK7 A;  5GKN A;  1QUT A;  4LJ5 A;  1DGG A; 
#chains in the Genus database with same CATH homology
 1VG5 A;  2LTU A;  3GLF E;  2QHO B;  1JR3 E;  2JZ0 A;  1ZMV A;  1ZMU A;  2KNV A;  2DZL A;  1YLA A;  3LCV B;  1C7Y A;  1DO0 A;  2G3Q A;  1ZMW A;  1TR8 A;  2RRU A;  1BVS A;  2KNA A;  2JY6 B;  3K9O A;  1HT1 E;  1VEJ A;  1WR1 B;  2JP7 A;  2HWJ A;  2LVO C;  1A5T A;  2JUJ A;  2DAE A;  2JY8 A;  2JY7 A;  3H4J A;  1XB2 B;  2JZ1 A;  2LVA A;  4F1I A;  4Q7J A;  2K0B X;  1SG9 A;  1WGN A;  1HT2 E;  2LBC A;  1AIP C;  2EJS A;  2BWB A;  2L4F A;  1PGY A;  4G3O A;  2WZJ A;  3B89 A;  1Y8G A;  1TTE A;  2ZTC A;  2DAG A;  1T6O A;  1V92 A;  1XXH E;  1DV0 A;  1VDL A;  5DFL A;  2DAM A;  4F2L A;  4UN2 B;  2K9D A;  1UFZ A;  2L2D A;  2KHH A;  1GO5 A;  4GEW A;  1G41 A;  2MRO B;  2EKK A;  1Q02 A;  3E21 A;  1WGL A;  2B3T A;  2LVN C;  3FRH A;  3E46 A;  2R0I A;  1NV9 A;  3GLI E;  1IXS A;  2O25 A;  2MGW A;  3FE3 A;  1HJP A;  2ZTD A;  2DAK A;  2H5X A;  3FRI A;  2MR9 A;  1KYI A;  1OTR A;  2L4E A;  2BWE A;  1T43 A;  3F92 A;  4R71 A;  1IFY A;  3T6P A;  1E94 E;  2CWB A;  2CP8 A;  1HQY E;  2EKF A;  3LCU A;  2DI0 A;  2MJ5 B;  4WP2 A;  2DKL A;  2OO9 A;  4DBG B;  1WJ7 A;  1EFU B;  2KNZ A;  1QZE A;  2JY5 A;  2LVQ D;  1NV8 A;  1ZV1 A;  2DEN A;  2OOB A;  1WHC A;  1OQY A;  3K9P A;  3MMP A;  2LVP C;  3IEC A;  3GLG E;  2DAI A;  1G3I A;  1IM2 A;  1F4I A;  2HAK A;  1OAI A;  3IHP A;  1MN3 A;  2QSF X;  1R4G A;  4HEO A;  2DNA A;  3GLH E;  1VQ1 A;  5JI2 E;  1OKS A;  2DHY A;  1DO2 A;  1P3Q Q;  1VEG A;  1G4A E;  2QNJ A;  3BBZ A;  1CUK A;  2JNH A;  1WIV A;  2OOA A;  1VEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...