2LVNC

Structure of the gp78 cue domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase AMFR
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvnC00
1ZMUA 2R0IA 3BBZA 3FRIA 2BWEA 2QHOB 2DAEA 2JUJA 2QNJA 3B89A 1OKSA 1VEGA 3FE3A 2O25A 2DAMA 3LCUA 2K0BX 2B3TA 2L2DA 1Y8GA 1OTRA 2JY8A 1WR1B 2LVNC 4DBGB 1HJPA 2DAGA 1WJ7A 1CUKA 1WGNA 2H5XA 4F1IA 3GLIE 3LCVB 2QSFX 1XB2B 2ZTDA 1VEKA 2L4FA 1EFUB 1R4GA 2LBCA 1OAIA 2LVQD 2OOAA 2EKKA 2HWJA 1WGLA 3K9PA 1T43A 2CP8A 1KYIA 1JR3E 1IM2A 1QZEA 1V92A 1G41A 1DV0A 2MR9A 1WIVA 2DHYA 1C7YA 2JY6B 1TR8A 1WHCA 2LTUA 2LVAA 4GEWA 2KNVA 1NV9A 1UFZA 1HT1E 2DKLA 2MROB 4R71A 1VEJA 5JI2E 4G3OA 1E94E 1HQYE 2DENA 2EJSA 1G3IA 1NV8A 3GLHE 3GLFE 3E21A 2OO9A 1VDLA 1XXHE 1ZV1A 5DFLA 1VG5A 3IECA 1HT2E 1YLAA 2OOBA 1DO0A 2KHHA 1SG9A 1PGYA 1T6OA 1MN3A 1P3QQ 1ZMVA 2DAKA 1OQYA 3K9OA 3T6PA 2KNAA 1F4IA 2BWBA 1A5TA 4WP2A 2EKFA 2KNZA 3FRHA 1ZMWA 2RRUA 2LVPC 1VQ1A 2DI0A 2L4EA 4UN2B 1Q02A 1AIPC 1IXSA 2G3QA 3H4JA 2JZ0A 2WZJA 3MMPA 2CWBA 2JNHA 1TTEA 4HEOA 1G4AE 2HAKA 2JY5A 4Q7JA 3GLGE 1GO5A 2JY7A 2MJ5B 3E46A 3IHPA 4F2LA 2DZLA 2DNAA 2LVOC 1IFYA 2JP7A 3F92A 2JZ1A 2K9DA 2ZTCA 1DO2A 2MGWA 2DAIA 1BVSA
chains in the Genus database with same CATH superfamily
2RGOA 4LJ9A 3V76A 3VK7A 3R8FA 1HQCA 3FRIA 1IBKM 4AKIA 2QHOB 3L27A 2DAEA 2JUJA 3B7ZA 3HWSA 3GQ5A 3B89A 4XK8F 5ITYA 1C1KA 1OFIA 2O25A 1SXJE 2K0BX 4LF9M 2L2DA 3E9SA 1OTRA 1GABA 4L15A 3FD9A 3GPYA 4NXMM 4B08A 1HJPA 2DAGA 2AHMA 1GL6A 3AFHA 5FTJA 1QAOA 2BJWA 3U6QA 4AW4A 4GKJM 4QNRA 4CGYB 3JR4A 4OVZB 5DYIA 3SYLA 3FTEA 2R65A 3GLIE 1J7KA 1QQWA 2XF3A 2Z4SA 1IY1A 3QYBA 4M9SA 4AI6A 2ZTDA 3CF6E 4LF6M 4A3VB 2LHCA 3UJNA 1R4GA 2LVQD 1OAIA 2CV1A 2Y21A 3AOEC 5ITRA 3U5ZB 3DFZA 5KPZA 3HZJA 1ZQ9A 2HWJA 4LJ6A 5FTMA 4X62M 1XC8A 4JI7M 3VKGA 2H1RA 3D8LA 1N33M 3MJ5A 4CISA 3B7NA 1J5EM 4LRTA 4KLNA 2LHGA 4YHHM 3OTOM 1G41A 3BXWA 3DOAA 2XSZD 4IBDA 2MR9A 5EXSA 1DV0A 2DHYA 1PJSA 2CFOA 1R5LA 4G4OA 1NNJA 2JY6B 3SHFA 5FTKA 5BR8M 3J80S 1XMQM 4DR4M 3FUVA 3A98B 1YE9A 2FS1A 2J7OA 4PD2A 1R6BX 4I81A 4BBAA 3FTFA 3A45A 4IBBA 1QYRA 4M9ZA 2F5PA 1OAOC 3PNVA 4JN6A 4B7GA 3GRUA 5KQDA 1Z5BA 2L6OA 1D0KA 5L8RF 3SATA 3R9XB 1SXJC 3GRVA 2KDLA 4LJ7A 4NL4H 4X64M 1I94M 2UXBM 1GVNA 1UM8A 3HHYA 1D0MA 3GLFA 2C99A 3GLHB 3NWLA 1TH2A 3U61A 2DENA 4QOSA 2F4VM 3KS8A 1XXHB 3C3EA 2ZBKB 2O5RA 3E21A 3RGPA 1Z6TA 5IZ7D 1DGHA 4Y28F 4DV4M 1QUSA 1HT2E 3L28A 5BPVA 2Z7JA 2R44A 1YLAA 2OOBA 5ITXE 4QNMA 1PGYA 1Q3CA 2QP9X 4L8RC 1X37A 1T6OA 3I51A 3A42A 1MN3A 4LGYA 4KT0F 1NVMA 1P3QQ 1OQYA 2BJVA 1T3TA 4XGIA 1IN6A 2G8LA 2XFTA 1F4IA 4TUWA 2V1CA 4WP2A 3HHZA 3PFIA 1L1ZA 2R62A 3B7QA 1ZMWA 3FRHA 3HGIA 4IJFA 2UU9M 4DUYM 1GL7A 3M6AA 1JB0F 1H6UA 2CRUA 4P17A 4WURA 2K47A 4G4RA 2O01F 2QQ8A 3GLGB 1AUAA 1IN8A 1PJQA 2HAKA 4NC6A 2V1UA 1R2ZA 2NQ8C 4LRSA 2FH0A 2DWMA 2HHHM 1G8PA 4G6ZA 5FTNA 5FTLA 3GRYA 4OVZA 4LFCM 1QZMA 4DV7M 1HNWM 3U6EA 2Z8YM 4K0KM 3AL0C 2LVOC 3K8ZA 4RKUF 1G71A 5E6JA 3U6SA 4IBKA 4DR5M 4AKHA 2X49A 4FCWA 1Q3BA 2K9DA 4AG5A 3U5ZA 4MGHA 5EXTA 3HHWA 3I01M 2UUBM 2J7NA 3CF0A 2Y20A 2KEBA 4LJ4A 1JR3A 1WXQA 3FUWA 3U6OA 4ZPXA 3JR5A 2E5LM 2DVWB 1OKSA 2C98A 2R46A 3FE3A 3HU2A 2X8AA 2DAMA 3LCUA 4D82A 4M0DA 2B3TA 4D80A 1NY5A 3L26A 3J2PB 3T1HM 2JY8A 4W5WA 1IBLM 1FJGM 2KZSA 4GHLA 4NSOB 1WJ7A 4LJ8A 4IBCA 1WGNA 4OX9M 3TWMA 4LY6A 3SAWA 1NHWC 4DUZM 1E9SA 1Q39A 2ZANA 1R7RA 1EE8A 2ZM6M 3IG5A 3Q8XA 3K1JA 1VEKA 2D7EA 2L4FA 2MH8A 2OOAA 3GLHA 2EKKA 1Z59A 4S12A 4LFBM 3FUXA 1T43A 3H4MA 5KQ8A 2DWLA 2CP8A 3VDPA 3ZH9B 3U6LA 4IBEA 5LMNM 3LVVA 3UK6A 1PJJA 1JR3E 1IM2A 1QZEA 1V92A 4KO8A 3SMSA 2Q2EB 1WIVA 3KOYE 1C7YA 3EIEA 5DYGA 3GRRA 4NOOB 2FFJA 4LCBA 3TPZA 3UZUA 2LWXA 2C9OA 2LVAA 3NBXX 5C1BA 1KFVA 1IXRC 2EO2A 3KOZE 3J81S 2WSFF 4B7HA 4DV1M 1N34M 2CV0A 3K92A 2XZUA 3D8BA 4DV5M 3QAUA 1HT1E 3M7GA 4B7FA 3HJSA 2M60A 4DV3M 2Z3XA 4DV6M 5IREB 1YUBA 1QVRA 2LH0A 1IY2A 3KSXA 4G3OA 3KSJA 4LJAA 2APLA 3K2LA 3LQQA 4GH9A 2XSZA 4GHAA 2EJSA 1W5SA 2L7IA 3GLGA 3ZC7B 4YY3M 3FYDA 3GLHE 3HX3A 3U60A 4WW0A 2OO9A 4B3MM 3MK6A 2CE7A 1XXHE 3RGSA 5ITXA 1ZV1A 2FOIC 4GRIA 4JI6M 1VG5A 3IECA 4JXJA 1GKIA 1GJTA 2DHRA 4MM3B 2YFQA 1MX0A 3SBJA 2C5RA 1IBMM 3HJ8A 3VLFB 3FTDA 2KW0A 3AKZA 4R3DA 1HNXM 3BOSA 3QWLA 5EQTA 2KNAA 4JI5M 2BWBA 1OFHA 4CHTB 3TQSA 3VFDA 1A5TA 1XNQM 2L7HA 4MH0E 1YSYA 2HCBA 1MJGM 2DI0A 3U6PA 1Q02A 4M9XA 3GQ4A 1OJLA 2JZ0A 2Y0QA 3DZDA 3E4RA 5KPTA 3GP1A 4D81A 2JNHA 3L2AA 4HEOA 1G4AE 3C9PA 4BB9A 3GLGE 1GO5A 2ZAOA 2MJ5B 3E46A 8CATA 1TDZA 3KOXE 5E26A 4F2LA 4PCZA 1K3WA 3RFWA 2UXCM 3L25A 4JI1M 3PXGA 1N36M 4PT5A 1RU3A 2JWSA 2ZAMA 3HY5A 1IFYA 2L09A 4DR7M 3CTWB 2JZ1A 4NSRA 2F5SA 2ZTCA 3VKHA 2KXEA 1NO1A 4B3TM 2DAIA 2A5YB 1BVSA 1ZMUA 4MGYE 3TWKA 4FCVA 2VF7A 2OQ4A 3KOWE 4AQYM 4GKKM 2QNJA 4JI8M 1GJSA 1E9RA 2R18A 4GMQA 5GKNA 3W0LB 1Y8GA 2XLJA 1WR1B 2I7PA 4FWGA 4JI3M 3T1YM 2XZFA 4ITQA 2XEPA 1CUKA 4KODA 5EXPA 3U6DA 4JI0M 2QBYB 2W82A 1IY0A 4FD2A 5IT9S 1XB2B 1NNUC 2RKOA 4PDGA 2LBCA 1EFUB 2EUCA 3J7BA 4GC9A 3KP1E 3AOEA 3GPXA 5EP4A 1WGLA 1PJTA 3PVSA 1TGUA 1XWIA 4L78A 2RGHA 4LF4M 2VF8A 4LJ5A 1OIZA 3MHVC 1TDHA 1HNZM 4L16A 4AKGA 2GQFA 1I4WA 1TR8A 3L29A 2CHVA 3M0EA 3KS4A 5FLXS 4GITA 4I8OA 5KPRA 4LF8M 4BLCA 2FE8A 4CIZA 1UFZA 4IBFA 1L2CA 1V34A 3SARA 3SAVA 5ITUA 2J5YA 3J27B 2KRKA 4HLQA 3I04M 1VEJA 1W5TA 5FSWA 2LXEA 5JI2E 1J09A 1N32M 2R45A 2I7NA 1XHBA 3LVWA 1E94E 3GLFB 1HQYE 1XXHA 5EJCA 3SC3A 1G3IA 3HU1A 4FCTA 4FWHA 3GQ3A 1R2YA 1SXJD 3SHGB 5LMUM 4M0WA 5ITQA 2BNKA 5EP3A 3GO8A 5DFLA 3NBIA 4DR2M 5F3WA 4G4QA 3WHLA 1DO0A 1QUTA 4LFAM 2KHHA 2R4EA 1SG9A 4CJ6A 3B9PA 4QHSA 4MGZE 4NXNM 1PJIA 4LGMA 4NRWA 1ZMVA 1ORYB 5C18A 3K9OA 3VDUA 1KSFX 3AOGA 3C58A 4RF0A 4DR1M 4XBOA 3SAUA 2LNHC 3QYEA 2VIIA 2EKFA 2KNZA 1IN7A 2OPFA 2QZ4A 2RRUA 1N75A 2LVPC 2UUCM 4LF7M 2L4EA 2QENA 2N35A 2GNOA 4GIPA 1XMOM 2XFSA 3KVWA 1PM5A 1N77A 1K3XA 3WHKA 2QPAA 1MU5A 2JY5A 4R7GA 3W67A 3Q8GA 4X66M 2UUAM 1HR0M 3UMMA 1Z5AA 1FNNA 3HKPA 2JY7A 4Z6YA 1QAMA 2CHGA 3FUUA 3CGWA 4FWDA 2DNAA 2QBYA 2DZNB 3EIHA 4EIWA 2C9CA 5EP2A 3W0FA 5KO3A 3F92A 2WSEF 3KW6A 4HL4A 4RNAA 2UXDM 5DNYA 1D2NA 1DO2A 2MGWA 1IN4A 2WSCF 2CHQA 3TE6A 2R0IA 3BBZA 2BWEA 4IBGA 4IIWA 3CF2A 2K6BA 4Z8XA 4LF5M 1SXJB 5H37D 1IXSB 1VEGA 2KZUA 4OW0A 3T38A 3SMPA 4LZJA 3LMMA 2VQFM 4I5SA 5EXXA 2V6ZM 1PRBA 3AJIB 4IBJA 1XNRM 2LVNC 3AV0A 4DBGB 5A2QS 4AZFA 2YQZA 3LQRA 1TF0B 3JAMS 3HJQA 3GLIB 2H5XA 2DWNA 2VDBB 1L8QA 4F1IA 3FYCA 3KXEC 3I4YA 3LCVB 4RF1A 4FVMA 2R6FA 2QSFX 2D7GA 2Z4RA 1TH4A 2HL7A 2C96A 3TWLA 4GC5A 1EIJA 1QDRA 3K9PA 4QOZC 2DWZB 1KYIA 4PDIA 1TH3A 4IJEA 4REZA 1NHGC 4JYAM 4L6V6 3GPPA 1VDDA 3SFZA 1DGFA 1NJFA 3ILKA 3SYKA 4ANRA 3KP0E 3PNYA 5IWAM 4B3SM 1WHCA 3HHXA 1L1TA 2LTUA 3DA1A 3HU3A 2CV2A 2G5GX 3I4VA 2CEAA 3FUTA 4GEWA 2YNMD 2P5TA 2YR0A 1OIPA 1NV9A 2KNVA 2KA6B 4JI4M 1NSFA 4KHPM 2KRUA 2CUZA 3VK8A 1DGGA 2DKLA 3ZCBB 2MROB 4R71A 4JI2M 3C3DA 2VQEM 4NRVA 3B74A 5EP1A 3W68A 4JV5M 1S3SA 2JXNA 2XH9A 3U6MA 3SASA 1ZAEA 3GPUA 1NV8A 2R4JA 3LW5F 1NY6A 3THGA 3GLFE 1QDTA 3RE8A 2EA0A 1VDLA 3U60B 3TL4X 5JI3E 4G4NA 4MB7A 4MGIE 4QHTA 2F5QA 4P16A 4L4UA 2FNAA 4IBIA 1E32A 3FTCA 3KDSE 4I4LA 3U6CA 1G59A 2DAKA 4FW9A 4LG2A 3T6PA 4AG6A 1D0LA 3J7AS 2QCUA 3IG8A 2M5ZA 2Y0TA 1IXZA 4LZZA 2DZOB 2F5OA 1LTMA 1SXJA 1VQ1A 4UN2B 2HKJA 1AIPC 1IXSA 2G3QA 3H4JA 4MGKE 4OU7A 2XGNA 1DGBA 2WZJA 3MMPA 2CWBA 3T15A 4DV0M 3U61B 1JR3D 1L2BA 2JA2A 1IQPA 1TTEA 4Q7JA 1N78A 1GLNA 1IN5A 1JQJC 3IHPA 1DGHB 1QAQA 3GLIA 4DR3M 2DXIA 2DZLA 4II7A 4DV2M 3A46A 3KFUG 4B3RM 2JP7A 2X4AA 7CATA 3ZQJA 1L2DA 3FKEA 1K82A 1LV7A 5ITTA 2F5NA 2ERCA 4DR6M 1QANA 2D7HA 1NJGA 4X65M 3UGJA 1V33A 1Z5CA
chains in the Genus database with same CATH topology
1ZMUA 2R0IA 3BBZA 3FRIA 2BWEA 2QHOB 2DAEA 2JUJA 2QNJA 3B89A 1OKSA 1VEGA 3FE3A 2O25A 2DAMA 3LCUA 2K0BX 2B3TA 2L2DA 1Y8GA 1OTRA 2JY8A 1WR1B 2LVNC 4DBGB 1HJPA 2DAGA 1WJ7A 1CUKA 1WGNA 2H5XA 4F1IA 3GLIE 3LCVB 2QSFX 1XB2B 2ZTDA 1VEKA 2L4FA 1EFUB 1R4GA 2LBCA 1OAIA 2LVQD 2OOAA 2EKKA 2HWJA 1WGLA 3K9PA 1T43A 2CP8A 1KYIA 1JR3E 1IM2A 1QZEA 1V92A 1G41A 1DV0A 2MR9A 1WIVA 2DHYA 1C7YA 2JY6B 1TR8A 1WHCA 2LTUA 2LVAA 4GEWA 2KNVA 1NV9A 1UFZA 1HT1E 2DKLA 2MROB 4R71A 1VEJA 5JI2E 4G3OA 1E94E 1HQYE 2DENA 2EJSA 1G3IA 1NV8A 3GLHE 3GLFE 3E21A 2OO9A 1VDLA 1XXHE 1ZV1A 5DFLA 1VG5A 3IECA 1HT2E 1YLAA 2OOBA 1DO0A 2KHHA 1SG9A 1PGYA 1T6OA 1MN3A 1P3QQ 1ZMVA 2DAKA 1OQYA 3K9OA 3T6PA 2KNAA 1F4IA 2BWBA 1A5TA 4WP2A 2EKFA 2KNZA 3FRHA 1ZMWA 2RRUA 2LVPC 1VQ1A 2DI0A 2L4EA 4UN2B 1Q02A 1AIPC 1IXSA 2G3QA 3H4JA 2JZ0A 2WZJA 3MMPA 2CWBA 2JNHA 1TTEA 4HEOA 1G4AE 2HAKA 2JY5A 4Q7JA 3GLGE 1GO5A 2JY7A 2MJ5B 3E46A 3IHPA 4F2LA 2DZLA 2DNAA 2LVOC 1IFYA 2JP7A 3F92A 2JZ1A 2K9DA 2ZTCA 1DO2A 2MGWA 2DAIA 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMU A;  2R0I A;  3BBZ A;  3FRI A;  2BWE A;  2QHO B;  2DAE A;  2JUJ A;  2QNJ A;  3B89 A;  1OKS A;  1VEG A;  3FE3 A;  2O25 A;  2DAM A;  3LCU A;  2K0B X;  2B3T A;  2L2D A;  1Y8G A;  1OTR A;  2JY8 A;  1WR1 B;  2LVN C;  4DBG B;  1HJP A;  2DAG A;  1WJ7 A;  1CUK A;  1WGN A;  2H5X A;  4F1I A;  3GLI E;  3LCV B;  2QSF X;  1XB2 B;  2ZTD A;  1VEK A;  2L4F A;  1EFU B;  1R4G A;  2LBC A;  1OAI A;  2LVQ D;  2OOA A;  2EKK A;  2HWJ A;  1WGL A;  3K9P A;  1T43 A;  2CP8 A;  1KYI A;  1JR3 E;  1IM2 A;  1QZE A;  1V92 A;  1G41 A;  1DV0 A;  2MR9 A;  1WIV A;  2DHY A;  1C7Y A;  2JY6 B;  1TR8 A;  1WHC A;  2LTU A;  2LVA A;  4GEW A;  2KNV A;  1NV9 A;  1UFZ A;  1HT1 E;  2DKL A;  2MRO B;  4R71 A;  1VEJ A;  5JI2 E;  4G3O A;  1E94 E;  1HQY E;  2DEN A;  2EJS A;  1G3I A;  1NV8 A;  3GLH E;  3GLF E;  3E21 A;  2OO9 A;  1VDL A;  1XXH E;  1ZV1 A;  5DFL A;  1VG5 A;  3IEC A;  1HT2 E;  1YLA A;  2OOB A;  1DO0 A;  2KHH A;  1SG9 A;  1PGY A;  1T6O A;  1MN3 A;  1P3Q Q;  1ZMV A;  2DAK A;  1OQY A;  3K9O A;  3T6P A;  2KNA A;  1F4I A;  2BWB A;  1A5T A;  4WP2 A;  2EKF A;  2KNZ A;  3FRH A;  1ZMW A;  2RRU A;  2LVP C;  1VQ1 A;  2DI0 A;  2L4E A;  4UN2 B;  1Q02 A;  1AIP C;  1IXS A;  2G3Q A;  3H4J A;  2JZ0 A;  2WZJ A;  3MMP A;  2CWB A;  2JNH A;  1TTE A;  4HEO A;  1G4A E;  2HAK A;  2JY5 A;  4Q7J A;  3GLG E;  1GO5 A;  2JY7 A;  2MJ5 B;  3E46 A;  3IHP A;  4F2L A;  2DZL A;  2DNA A;  2LVO C;  1IFY A;  2JP7 A;  3F92 A;  2JZ1 A;  2K9D A;  2ZTC A;  1DO2 A;  2MGW A;  2DAI A;  1BVS A; 
#chains in the Genus database with same CATH topology
 2RGO A;  4LJ9 A;  3V76 A;  3VK7 A;  3R8F A;  1HQC A;  3FRI A;  1IBK M;  4AKI A;  2QHO B;  3L27 A;  2DAE A;  2JUJ A;  3B7Z A;  3HWS A;  3GQ5 A;  3B89 A;  4XK8 F;  5ITY A;  1C1K A;  1OFI A;  2O25 A;  1SXJ E;  2K0B X;  4LF9 M;  2L2D A;  3E9S A;  1OTR A;  1GAB A;  4L15 A;  3FD9 A;  3GPY A;  4NXM M;  4B08 A;  1HJP A;  2DAG A;  2AHM A;  1GL6 A;  3AFH A;  5FTJ A;  1QAO A;  2BJW A;  3U6Q A;  4AW4 A;  4GKJ M;  4QNR A;  4CGY B;  3JR4 A;  4OVZ B;  5DYI A;  3SYL A;  3FTE A;  2R65 A;  3GLI E;  1J7K A;  1QQW A;  2XF3 A;  2Z4S A;  1IY1 A;  3QYB A;  4M9S A;  4AI6 A;  2ZTD A;  3CF6 E;  4LF6 M;  4A3V B;  2LHC A;  3UJN A;  1R4G A;  2LVQ D;  1OAI A;  2CV1 A;  2Y21 A;  3AOE C;  5ITR A;  3U5Z B;  3DFZ A;  5KPZ A;  3HZJ A;  1ZQ9 A;  2HWJ A;  4LJ6 A;  5FTM A;  4X62 M;  1XC8 A;  4JI7 M;  3VKG A;  2H1R A;  3D8L A;  1N33 M;  3MJ5 A;  4CIS A;  3B7N A;  1J5E M;  4LRT A;  4KLN A;  2LHG A;  4YHH M;  3OTO M;  1G41 A;  3BXW A;  3DOA A;  2XSZ D;  4IBD A;  2MR9 A;  5EXS A;  1DV0 A;  2DHY A;  1PJS A;  2CFO A;  1R5L A;  4G4O A;  1NNJ A;  2JY6 B;  3SHF A;  5FTK A;  5BR8 M;  3J80 S;  1XMQ M;  4DR4 M;  3FUV A;  3A98 B;  1YE9 A;  2FS1 A;  2J7O A;  4PD2 A;  1R6B X;  4I81 A;  4BBA A;  3FTF A;  3A45 A;  4IBB A;  1QYR A;  4M9Z A;  2F5P A;  1OAO C;  3PNV A;  4JN6 A;  4B7G A;  3GRU A;  5KQD A;  1Z5B A;  2L6O A;  1D0K A;  5L8R F;  3SAT A;  3R9X B;  1SXJ C;  3GRV A;  2KDL A;  4LJ7 A;  4NL4 H;  4X64 M;  1I94 M;  2UXB M;  1GVN A;  1UM8 A;  3HHY A;  1D0M A;  3GLF A;  2C99 A;  3GLH B;  3NWL A;  1TH2 A;  3U61 A;  2DEN A;  4QOS A;  2F4V M;  3KS8 A;  1XXH B;  3C3E A;  2ZBK B;  2O5R A;  3E21 A;  3RGP A;  1Z6T A;  5IZ7 D;  1DGH A;  4Y28 F;  4DV4 M;  1QUS A;  1HT2 E;  3L28 A;  5BPV A;  2Z7J A;  2R44 A;  1YLA A;  2OOB A;  5ITX E;  4QNM A;  1PGY A;  1Q3C A;  2QP9 X;  4L8R C;  1X37 A;  1T6O A;  3I51 A;  3A42 A;  1MN3 A;  4LGY A;  4KT0 F;  1NVM A;  1P3Q Q;  1OQY A;  2BJV A;  1T3T A;  4XGI A;  1IN6 A;  2G8L A;  2XFT A;  1F4I A;  4TUW A;  2V1C A;  4WP2 A;  3HHZ A;  3PFI A;  1L1Z A;  2R62 A;  3B7Q A;  1ZMW A;  3FRH A;  3HGI A;  4IJF A;  2UU9 M;  4DUY M;  1GL7 A;  3M6A A;  1JB0 F;  1H6U A;  2CRU A;  4P17 A;  4WUR A;  2K47 A;  4G4R A;  2O01 F;  2QQ8 A;  3GLG B;  1AUA A;  1IN8 A;  1PJQ A;  2HAK A;  4NC6 A;  2V1U A;  1R2Z A;  2NQ8 C;  4LRS A;  2FH0 A;  2DWM A;  2HHH M;  1G8P A;  4G6Z A;  5FTN A;  5FTL A;  3GRY A;  4OVZ A;  4LFC M;  1QZM A;  4DV7 M;  1HNW M;  3U6E A;  2Z8Y M;  4K0K M;  3AL0 C;  2LVO C;  3K8Z A;  4RKU F;  1G71 A;  5E6J A;  3U6S A;  4IBK A;  4DR5 M;  4AKH A;  2X49 A;  4FCW A;  1Q3B A;  2K9D A;  4AG5 A;  3U5Z A;  4MGH A;  5EXT A;  3HHW A;  3I01 M;  2UUB M;  2J7N A;  3CF0 A;  2Y20 A;  2KEB A;  4LJ4 A;  1JR3 A;  1WXQ A;  3FUW A;  3U6O A;  4ZPX A;  3JR5 A;  2E5L M;  2DVW B;  1OKS A;  2C98 A;  2R46 A;  3FE3 A;  3HU2 A;  2X8A A;  2DAM A;  3LCU A;  4D82 A;  4M0D A;  2B3T A;  4D80 A;  1NY5 A;  3L26 A;  3J2P B;  3T1H M;  2JY8 A;  4W5W A;  1IBL M;  1FJG M;  2KZS A;  4GHL A;  4NSO B;  1WJ7 A;  4LJ8 A;  4IBC A;  1WGN A;  4OX9 M;  3TWM A;  4LY6 A;  3SAW A;  1NHW C;  4DUZ M;  1E9S A;  1Q39 A;  2ZAN A;  1R7R A;  1EE8 A;  2ZM6 M;  3IG5 A;  3Q8X A;  3K1J A;  1VEK A;  2D7E A;  2L4F A;  2MH8 A;  2OOA A;  3GLH A;  2EKK A;  1Z59 A;  4S12 A;  4LFB M;  3FUX A;  1T43 A;  3H4M A;  5KQ8 A;  2DWL A;  2CP8 A;  3VDP A;  3ZH9 B;  3U6L A;  4IBE A;  5LMN M;  3LVV A;  3UK6 A;  1PJJ A;  1JR3 E;  1IM2 A;  1QZE A;  1V92 A;  4KO8 A;  3SMS A;  2Q2E B;  1WIV A;  3KOY E;  1C7Y A;  3EIE A;  5DYG A;  3GRR A;  4NOO B;  2FFJ A;  4LCB A;  3TPZ A;  3UZU A;  2LWX A;  2C9O A;  2LVA A;  3NBX X;  5C1B A;  1KFV A;  1IXR C;  2EO2 A;  3KOZ E;  3J81 S;  2WSF F;  4B7H A;  4DV1 M;  1N34 M;  2CV0 A;  3K92 A;  2XZU A;  3D8B A;  4DV5 M;  3QAU A;  1HT1 E;  3M7G A;  4B7F A;  3HJS A;  2M60 A;  4DV3 M;  2Z3X A;  4DV6 M;  5IRE B;  1YUB A;  1QVR A;  2LH0 A;  1IY2 A;  3KSX A;  4G3O A;  3KSJ A;  4LJA A;  2APL A;  3K2L A;  3LQQ A;  4GH9 A;  2XSZ A;  4GHA A;  2EJS A;  1W5S A;  2L7I A;  3GLG A;  3ZC7 B;  4YY3 M;  3FYD A;  3GLH E;  3HX3 A;  3U60 A;  4WW0 A;  2OO9 A;  4B3M M;  3MK6 A;  2CE7 A;  1XXH E;  3RGS A;  5ITX A;  1ZV1 A;  2FOI C;  4GRI A;  4JI6 M;  1VG5 A;  3IEC A;  4JXJ A;  1GKI A;  1GJT A;  2DHR A;  4MM3 B;  2YFQ A;  1MX0 A;  3SBJ A;  2C5R A;  1IBM M;  3HJ8 A;  3VLF B;  3FTD A;  2KW0 A;  3AKZ A;  4R3D A;  1HNX M;  3BOS A;  3QWL A;  5EQT A;  2KNA A;  4JI5 M;  2BWB A;  1OFH A;  4CHT B;  3TQS A;  3VFD A;  1A5T A;  1XNQ M;  2L7H A;  4MH0 E;  1YSY A;  2HCB A;  1MJG M;  2DI0 A;  3U6P A;  1Q02 A;  4M9X A;  3GQ4 A;  1OJL A;  2JZ0 A;  2Y0Q A;  3DZD A;  3E4R A;  5KPT A;  3GP1 A;  4D81 A;  2JNH A;  3L2A A;  4HEO A;  1G4A E;  3C9P A;  4BB9 A;  3GLG E;  1GO5 A;  2ZAO A;  2MJ5 B;  3E46 A;  8CAT A;  1TDZ A;  3KOX E;  5E26 A;  4F2L A;  4PCZ A;  1K3W A;  3RFW A;  2UXC M;  3L25 A;  4JI1 M;  3PXG A;  1N36 M;  4PT5 A;  1RU3 A;  2JWS A;  2ZAM A;  3HY5 A;  1IFY A;  2L09 A;  4DR7 M;  3CTW B;  2JZ1 A;  4NSR A;  2F5S A;  2ZTC A;  3VKH A;  2KXE A;  1NO1 A;  4B3T M;  2DAI A;  2A5Y B;  1BVS A;  1ZMU A;  4MGY E;  3TWK A;  4FCV A;  2VF7 A;  2OQ4 A;  3KOW E;  4AQY M;  4GKK M;  2QNJ A;  4JI8 M;  1GJS A;  1E9R A;  2R18 A;  4GMQ A;  5GKN A;  3W0L B;  1Y8G A;  2XLJ A;  1WR1 B;  2I7P A;  4FWG A;  4JI3 M;  3T1Y M;  2XZF A;  4ITQ A;  2XEP A;  1CUK A;  4KOD A;  5EXP A;  3U6D A;  4JI0 M;  2QBY B;  2W82 A;  1IY0 A;  4FD2 A;  5IT9 S;  1XB2 B;  1NNU C;  2RKO A;  4PDG A;  2LBC A;  1EFU B;  2EUC A;  3J7B A;  4GC9 A;  3KP1 E;  3AOE A;  3GPX A;  5EP4 A;  1WGL A;  1PJT A;  3PVS A;  1TGU A;  1XWI A;  4L78 A;  2RGH A;  4LF4 M;  2VF8 A;  4LJ5 A;  1OIZ A;  3MHV C;  1TDH A;  1HNZ M;  4L16 A;  4AKG A;  2GQF A;  1I4W A;  1TR8 A;  3L29 A;  2CHV A;  3M0E A;  3KS4 A;  5FLX S;  4GIT A;  4I8O A;  5KPR A;  4LF8 M;  4BLC A;  2FE8 A;  4CIZ A;  1UFZ A;  4IBF A;  1L2C A;  1V34 A;  3SAR A;  3SAV A;  5ITU A;  2J5Y A;  3J27 B;  2KRK A;  4HLQ A;  3I04 M;  1VEJ A;  1W5T A;  5FSW A;  2LXE A;  5JI2 E;  1J09 A;  1N32 M;  2R45 A;  2I7N A;  1XHB A;  3LVW A;  1E94 E;  3GLF B;  1HQY E;  1XXH A;  5EJC A;  3SC3 A;  1G3I A;  3HU1 A;  4FCT A;  4FWH A;  3GQ3 A;  1R2Y A;  1SXJ D;  3SHG B;  5LMU M;  4M0W A;  5ITQ A;  2BNK A;  5EP3 A;  3GO8 A;  5DFL A;  3NBI A;  4DR2 M;  5F3W A;  4G4Q A;  3WHL A;  1DO0 A;  1QUT A;  4LFA M;  2KHH A;  2R4E A;  1SG9 A;  4CJ6 A;  3B9P A;  4QHS A;  4MGZ E;  4NXN M;  1PJI A;  4LGM A;  4NRW A;  1ZMV A;  1ORY B;  5C18 A;  3K9O A;  3VDU A;  1KSF X;  3AOG A;  3C58 A;  4RF0 A;  4DR1 M;  4XBO A;  3SAU A;  2LNH C;  3QYE A;  2VII A;  2EKF A;  2KNZ A;  1IN7 A;  2OPF A;  2QZ4 A;  2RRU A;  1N75 A;  2LVP C;  2UUC M;  4LF7 M;  2L4E A;  2QEN A;  2N35 A;  2GNO A;  4GIP A;  1XMO M;  2XFS A;  3KVW A;  1PM5 A;  1N77 A;  1K3X A;  3WHK A;  2QPA A;  1MU5 A;  2JY5 A;  4R7G A;  3W67 A;  3Q8G A;  4X66 M;  2UUA M;  1HR0 M;  3UMM A;  1Z5A A;  1FNN A;  3HKP A;  2JY7 A;  4Z6Y A;  1QAM A;  2CHG A;  3FUU A;  3CGW A;  4FWD A;  2DNA A;  2QBY A;  2DZN B;  3EIH A;  4EIW A;  2C9C A;  5EP2 A;  3W0F A;  5KO3 A;  3F92 A;  2WSE F;  3KW6 A;  4HL4 A;  4RNA A;  2UXD M;  5DNY A;  1D2N A;  1DO2 A;  2MGW A;  1IN4 A;  2WSC F;  2CHQ A;  3TE6 A;  2R0I A;  3BBZ A;  2BWE A;  4IBG A;  4IIW A;  3CF2 A;  2K6B A;  4Z8X A;  4LF5 M;  1SXJ B;  5H37 D;  1IXS B;  1VEG A;  2KZU A;  4OW0 A;  3T38 A;  3SMP A;  4LZJ A;  3LMM A;  2VQF M;  4I5S A;  5EXX A;  2V6Z M;  1PRB A;  3AJI B;  4IBJ A;  1XNR M;  2LVN C;  3AV0 A;  4DBG B;  5A2Q S;  4AZF A;  2YQZ A;  3LQR A;  1TF0 B;  3JAM S;  3HJQ A;  3GLI B;  2H5X A;  2DWN A;  2VDB B;  1L8Q A;  4F1I A;  3FYC A;  3KXE C;  3I4Y A;  3LCV B;  4RF1 A;  4FVM A;  2R6F A;  2QSF X;  2D7G A;  2Z4R A;  1TH4 A;  2HL7 A;  2C96 A;  3TWL A;  4GC5 A;  1EIJ A;  1QDR A;  3K9P A;  4QOZ C;  2DWZ B;  1KYI A;  4PDI A;  1TH3 A;  4IJE A;  4REZ A;  1NHG C;  4JYA M;  4L6V 6;  3GPP A;  1VDD A;  3SFZ A;  1DGF A;  1NJF A;  3ILK A;  3SYK A;  4ANR A;  3KP0 E;  3PNY A;  5IWA M;  4B3S M;  1WHC A;  3HHX A;  1L1T A;  2LTU A;  3DA1 A;  3HU3 A;  2CV2 A;  2G5G X;  3I4V A;  2CEA A;  3FUT A;  4GEW A;  2YNM D;  2P5T A;  2YR0 A;  1OIP A;  1NV9 A;  2KNV A;  2KA6 B;  4JI4 M;  1NSF A;  4KHP M;  2KRU A;  2CUZ A;  3VK8 A;  1DGG A;  2DKL A;  3ZCB B;  2MRO B;  4R71 A;  4JI2 M;  3C3D A;  2VQE M;  4NRV A;  3B74 A;  5EP1 A;  3W68 A;  4JV5 M;  1S3S A;  2JXN A;  2XH9 A;  3U6M A;  3SAS A;  1ZAE A;  3GPU A;  1NV8 A;  2R4J A;  3LW5 F;  1NY6 A;  3THG A;  3GLF E;  1QDT A;  3RE8 A;  2EA0 A;  1VDL A;  3U60 B;  3TL4 X;  5JI3 E;  4G4N A;  4MB7 A;  4MGI E;  4QHT A;  2F5Q A;  4P16 A;  4L4U A;  2FNA A;  4IBI A;  1E32 A;  3FTC A;  3KDS E;  4I4L A;  3U6C A;  1G59 A;  2DAK A;  4FW9 A;  4LG2 A;  3T6P A;  4AG6 A;  1D0L A;  3J7A S;  2QCU A;  3IG8 A;  2M5Z A;  2Y0T A;  1IXZ A;  4LZZ A;  2DZO B;  2F5O A;  1LTM A;  1SXJ A;  1VQ1 A;  4UN2 B;  2HKJ A;  1AIP C;  1IXS A;  2G3Q A;  3H4J A;  4MGK E;  4OU7 A;  2XGN A;  1DGB A;  2WZJ A;  3MMP A;  2CWB A;  3T15 A;  4DV0 M;  3U61 B;  1JR3 D;  1L2B A;  2JA2 A;  1IQP A;  1TTE A;  4Q7J A;  1N78 A;  1GLN A;  1IN5 A;  1JQJ C;  3IHP A;  1DGH B;  1QAQ A;  3GLI A;  4DR3 M;  2DXI A;  2DZL A;  4II7 A;  4DV2 M;  3A46 A;  3KFU G;  4B3R M;  2JP7 A;  2X4A A;  7CAT A;  3ZQJ A;  1L2D A;  3FKE A;  1K82 A;  1LV7 A;  5ITT A;  2F5N A;  2ERC A;  4DR6 M;  1QAN A;  2D7H A;  1NJG A;  4X65 M;  3UGJ A;  1V33 A;  1Z5C A; 
#chains in the Genus database with same CATH homology
 1ZMU A;  2R0I A;  3BBZ A;  3FRI A;  2BWE A;  2QHO B;  2DAE A;  2JUJ A;  2QNJ A;  3B89 A;  1OKS A;  1VEG A;  3FE3 A;  2O25 A;  2DAM A;  3LCU A;  2K0B X;  2B3T A;  2L2D A;  1Y8G A;  1OTR A;  2JY8 A;  1WR1 B;  2LVN C;  4DBG B;  1HJP A;  2DAG A;  1WJ7 A;  1CUK A;  1WGN A;  2H5X A;  4F1I A;  3GLI E;  3LCV B;  2QSF X;  1XB2 B;  2ZTD A;  1VEK A;  2L4F A;  1EFU B;  1R4G A;  2LBC A;  1OAI A;  2LVQ D;  2OOA A;  2EKK A;  2HWJ A;  1WGL A;  3K9P A;  1T43 A;  2CP8 A;  1KYI A;  1JR3 E;  1IM2 A;  1QZE A;  1V92 A;  1G41 A;  1DV0 A;  2MR9 A;  1WIV A;  2DHY A;  1C7Y A;  2JY6 B;  1TR8 A;  1WHC A;  2LTU A;  2LVA A;  4GEW A;  2KNV A;  1NV9 A;  1UFZ A;  1HT1 E;  2DKL A;  2MRO B;  4R71 A;  1VEJ A;  5JI2 E;  4G3O A;  1E94 E;  1HQY E;  2DEN A;  2EJS A;  1G3I A;  1NV8 A;  3GLH E;  3GLF E;  3E21 A;  2OO9 A;  1VDL A;  1XXH E;  1ZV1 A;  5DFL A;  1VG5 A;  3IEC A;  1HT2 E;  1YLA A;  2OOB A;  1DO0 A;  2KHH A;  1SG9 A;  1PGY A;  1T6O A;  1MN3 A;  1P3Q Q;  1ZMV A;  2DAK A;  1OQY A;  3K9O A;  3T6P A;  2KNA A;  1F4I A;  2BWB A;  1A5T A;  4WP2 A;  2EKF A;  2KNZ A;  3FRH A;  1ZMW A;  2RRU A;  2LVP C;  1VQ1 A;  2DI0 A;  2L4E A;  4UN2 B;  1Q02 A;  1AIP C;  1IXS A;  2G3Q A;  3H4J A;  2JZ0 A;  2WZJ A;  3MMP A;  2CWB A;  2JNH A;  1TTE A;  4HEO A;  1G4A E;  2HAK A;  2JY5 A;  4Q7J A;  3GLG E;  1GO5 A;  2JY7 A;  2MJ5 B;  3E46 A;  3IHP A;  4F2L A;  2DZL A;  2DNA A;  2LVO C;  1IFY A;  2JP7 A;  3F92 A;  2JZ1 A;  2K9D A;  2ZTC A;  1DO2 A;  2MGW A;  2DAI A;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...