2LVNC

Structure of the gp78 cue domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase AMFR
total genus 15
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvnC00
1T43A 1MN3A 4UN2B 3GLGE 1E94E 3K9PA 4WP2A 1C7YA 5DFLA 1F4IA 1WIVA 1OTRA 2DAEA 2L2DA 4HEOA 4Q7JA 2DENA 2HWJA 1IXSA 1OKSA 3MMPA 2L4FA 2DKLA 2LVNC 1OAIA 2BWBA 2JZ1A 1ZMUA 2LVAA 2LVOC 2DZLA 2KNZA 2JY8A 2JZ0A 1UFZA 1KYIA 1G41A 1V92A 2DI0A 2HAKA 1VEKA 4G3OA 1NV9A 2RRUA 1WHCA 1XXHE 5JI2E 4DBGB 2B3TA 3E46A 2G3QA 2K0BX 1HQYE 1BVSA 1Y8GA 3LCUA 1G3IA 2DAGA 3FRHA 1R4GA 1WGNA 2JNHA 2JY6B 1HJPA 2CP8A 2DNAA 2DHYA 1T6OA 3H4JA 1PGYA 4F2LA 2K9DA 2O25A 1ZV1A 1IM2A 1VEGA 2KHHA 2DAMA 4R71A 2QSFX 1QZEA 1DO2A 2H5XA 3FRIA 1JR3E 2LTUA 1WR1B 1CUKA 2R0IA 1IFYA 1ZMWA 1WGLA 1WJ7A 4F1IA 3T6PA 1EFUB 3GLIE 1AIPC 2WZJA 3E21A 2QNJA 2JY5A 1G4AE 1DO0A 1VDLA 1TR8A 2EKKA 1DV0A 1TTEA 1HT1E 2DAKA 1ZMVA 1XB2B 3LCVB 2KNAA 1Q02A 1VQ1A 1A5TA 3IECA 1VEJA 3BBZA 2ZTCA 2LVPC 3FE3A 3GLHE 1VG5A 2BWEA 2CWBA 2L4EA 2EJSA 2LBCA 2OO9A 2MR9A 1GO5A 1HT2E 2JP7A 3F92A 2ZTDA 2MGWA 2OOAA 2KNVA 3K9OA 3GLFE 2OOBA 3IHPA 1NV8A 2MJ5B 2QHOB 2EKFA 1OQYA 1P3QQ 2MROB 4GEWA 3B89A 2JUJA 2DAIA 1SG9A 1YLAA 2JY7A 2LVQD
chains in the Genus database with same CATH superfamily
1E9SA 1T43A 2LWXA 3GLGE 1NNJA 1XNRM 1N75A 4DR7M 1C7YA 4GKJM 5DFLA 4XK8F 4QOZC 2JWSA 4LZJA 2DWNA 4IBBA 3UGJA 5C18A 4OX9M 1ZAEA 1QYRA 2CV2A 1QAOA 3VKGA 3SYKA 5E26A 1N33M 1R7RA 3GO8A 5BPVA 4AKHA 5EXXA 1XWIA 2X4AA 2QBYB 1KYIA 2DI0A 1NV9A 1GJSA 3A46A 2APLA 1Q3BA 3K8ZA 1Q39A 3W0LB 5LMUM 3SMSA 3SAVA 2R4EA 1V33A 2K0BX 4KODA 2Q2EB 3HU1A 2CRUA 3LVWA 1BVSA 2R45A 3I4VA 4LJ8A 5KPRA 3AKZA 2D7GA 3U6QA 4DV3M 4B7HA 3DFZA 1G3IA 3T1HM 2V1UA 1TDZA 3B74A 4B7GA 5FTMA 2WSCF 2L6OA 1QVRA 4M9SA 1SXJD 1XMOM 2HHHM 1L2CA 4GRIA 1D0LA 1W5SA 3I01M 3KOZE 1YUBA 2DNAA 4IIWA 4DUZM 1L1ZA 3VK8A 1IN6A 1TDHA 1TH3A 1PGYA 3AV0A 3CF6E 5FTNA 4B08A 4KHPM 3VFDA 4F2LA 3SATA 1WXQA 3I51A 3L28A 1DGGA 3SFZA 3THGA 4LF7M 3K92A 4JI1M 2H5XA 5DYGA 2XGNA 1K3WA 3FRIA 3T38A 3GLIA 1IXRC 4MGKE 1HNZM 2UXBM 1CUKA 4CIZA 4PDGA 4LGYA 1IFYA 3LQRA 2XLJA 4LF8M 3A42A 4RF1A 3TL4X 1V34A 1WGLA 4B3TM 1K3XA 1NVMA 3C3DA 3U6MA 4MB7A 3T6PA 1HQCA 1GVNA 4NL4H 3GRYA 3GLIE 1AIPC 1KFVA 2WZJA 3HU3A 5KQDA 5EP3A 3RFWA 2JY5A 2GNOA 4B3RM 4DR6M 2V6ZM 1VDLA 2DZNB 5FTJA 3HWSA 1I94M 4PCZA 3M0EA 3J7AS 3K2LA 2XSZD 1DV0A 1GL6A 1DGBA 3W0FA 4MGYE 3U6LA 3ZC7B 4P17A 3FTDA 2GQFA 2YFQA 3KOYE 4P16A 4B7FA 3CF0A 4M0DA 1A5TA 4FD2A 4MGZE 1TH4A 1VEJA 1LTMA 4IBIA 3KFUG 2HKJA 3FE3A 4JI3M 5BR8M 2M5ZA 1VG5A 2R62A 1R6BX 4L15A 3U6OA 4I5SA 1X37A 2L4EA 2C9OA 2EJSA 5EJCA 2XZUA 3WHLA 2Y20A 4JI0M 3F92A 4GIPA 5KPZA 2FFJA 1G71A 3QYEA 3GLFE 1XMQM 2D7HA 2Z4SA 5FTKA 5A2QS 4PT5A 1D0MA 3KP1E 4Z8XA 1P3QQ 2MROB 2QCUA 1Z5CA 3B89A 2Z4RA 3LVVA 3KSXA 2DAIA 3SMPA 1GLNA 3TE6A 3OTOM 2P5TA 4NRWA 1I4WA 3J7BA 1IN8A 4WW0A 3FD9A 4UN2B 4G4RA 1E94E 3HX3A 3K9PA 1QAMA 1IBLM 1EIJA 1F4IA 4FWGA 2QP9X 1WIVA 3TPZA 3GP1A 1IY0A 4RF0A 4HEOA 4I8OA 1NJFA 4G4OA 2DENA 1EE8A 4ZPXA 2YNMD 4LJ7A 4R7GA 2FE8A 3ZQJA 3KSJA 2BWBA 4JI7M 4D80A 2LVOC 3ZH9B 3EIHA 3U5ZB 4IBDA 2KNZA 4DUYM 3QWLA 2LHGA 1N36M 4AG6A 1UFZA 1V92A 1J5EM 3AJIB 2HAKA 2ZAMA 2XH9A 5FTLA 1MX0A 3L25A 3L26A 4NC6A 4Z6YA 4NSOB 2F4VM 1WHCA 3HKPA 4QHTA 4FW9A 4TUWA 3R8FA 5JI2E 1S3SA 1UM8A 1QAQA 3A45A 3DA1A 2G3QA 1IY1A 4GHLA 2XEPA 1HQYE 3GQ5A 1PM5A 3KS4A 2BJVA 2Y0TA 3VDUA 3RGPA 3GPXA 1NY6A 4AG5A 3SC3A 3B9PA 3RE8A 2R65A 3U60A 5FSWA 2BJWA 3GLHA 3IG8A 3E9SA 5EP4A 3FRHA 1R2YA 1R4GA 1XHBA 1N32M 3D8LA 2JNHA 3SAUA 3HGIA 4LF6M 4FWDA 1QQWA 4ITQA 2QBYA 2DHYA 2UUCM 3U5ZA 2A5YB 3JR4A 3VDPA 2J5YA 4EIWA 4IBCA 4DR5M 3VKHA 2O25A 1ZV1A 2L7IA 2KHHA 3SASA 2DAMA 4JN6A 1MJGM 2LNHC 2LHCA 1QZEA 4JI8M 1JR3E 2LTUA 1Z5AA 3MK6A 2JA2A 2EUCA 5ITXA 2MH8A 4JI4M 8CATA 4LZZA 7CATA 3J81S 1GKIA 4NXMM 4D81A 4L8RC 5LMNM 2RGOA 3SAWA 4DV0M 1IQPA 1L8QA 3SBJA 2G5GX 2CFOA 1G8PA 2ZM6M 1HR0M 2Y21A 1NNUC 4HLQA 3CF2A 3GPPA 2ERCA 2QNJA 5ITXE 3QYBA 3M6AA 3W67A 2F5NA 1TR8A 3PVSA 4S12A 4KO8A 4G6ZA 1QUTA 4CJ6A 1PJTA 4KT0F 3GPYA 3AFHA 2DAKA 3UK6A 2VF7A 2L7HA 4FCVA 1VQ1A 1D2NA 4RNAA 1PJIA 1R2ZA 3GLHE 1NSFA 2CE7A 2XZFA 2K6BA 1OIZA 3FYDA 2Z7JA 4QNMA 4LFAM 2LBCA 3E4RA 2MR9A 4PD2A 1J09A 2JP7A 3LW5F 5DYIA 5EP2A 2F5SA 2OPFA 1XC8A 2FS1A 3PNYA 3FUUA 4B3SM 2QHOB 4CHTB 3U6EA 2KZUA 4YHHM 1GL7A 3HHZA 4X64M 4LJ9A 1JR3D 2WSEF 4LRSA 1SG9A 1QANA 1JR3A 4AW4A 1YLAA 2EA0A 3U61B 3IG5A 2DWLA 3B7ZA 2UXCM 4BBAA 2F5QA 3LQQA 4NSRA 3U6DA 1OJLA 2W82A 2KEBA 3TQSA 4DV6M 4LF4M 1E32A 2L2DA 4GC9A 2QENA 3SHGB 3MJ5A 4MGHA 2HWJA 3B7QA 2C9CA 1IXSA 4IBJA 3HHXA 2LVNC 3FUVA 3KVWA 3MMPA 2XFSA 2LVAA 2QZ4A 3U6PA 2DWMA 4W5WA 2DZLA 2KRKA 4ANRA 3DOAA 3GQ4A 5L8RF 3L29A 3R9XB 2JY8A 2JZ0A 4II7A 4IBFA 1L1TA 1G41A 4KLNA 4R3DA 2DXIA 1VEKA 3TWKA 4GITA 2D7EA 1PJSA 2C99A 4JV5M 3UMMA 1ZQ9A 4X65M 3GLFA 2UUAM 4NXNM 1KSFX 4GC5A 3VLFB 1NY5A 2B3TA 2KXEA 1HNXM 5EP1A 2C96A 1RU3A 3GLIB 1YE9A 1DGHB 2C98A 3PFIA 3Q8GA 1Y8GA 5KO3A 2UXDM 1N78A 3VK7A 2F5OA 4IJEA 2LH0A 2YR0A 2KW0A 1FJGM 4NRVA 1QUSA 3JAMS 5GKNA 3U6CA 4JYAM 2JY6B 1QDRA 4M9ZA 4AKIA 1HJPA 1IXZA 2CP8A 5IREB 4K0KM 2VQEM 3I04M 3GRUA 1J7KA 2Y0QA 3L2AA 1T6OA 3H4MA 2UUBM 1HNWM 2LXEA 2OQ4A 2J7OA 4R71A 3LMMA 5IWAM 2QSFX 1OFHA 2DHRA 4DV2M 2Z3XA 2UU9M 1GJTA 3ILKA 2X49A 4FCWA 1VDDA 1IN5A 1WR1B 3HY5A 4QOSA 3W68A 3J80S 5H37D 4NOOB 2VQFM 1GABA 3MHVC 4L6V6 3U61A 3U6SA 5KQ8A 5FLXS 3FKEA 4F1IA 3GLFB 4AQYM 4MGIE 1EFUB 2DVWB 1NHWC 4XGIA 3GRVA 2O01F 3TWMA 1H6UA 2G8LA 2O5RA 3E21A 3J27B 4WURA 1DO0A 2F5PA 3WHKA 4BB9A 2YQZA 5F3WA 2DWZB 3HJSA 4JI6M 2EKKA 2L09A 1IXSB 3HHYA 3NWLA 1XB2B 1TGUA 3C58A 1XXHA 2KNAA 1Q02A 4LJ5A 4OVZA 1PRBA 1N77A 4RKUF 4LFCM 4GH9A 2CEAA 2CUZA 3KW6A 3NBXX 5E6JA 2ZTCA 3L27A 2BWEA 2ZAOA 5ITYA 4I81A 2WSFF 2X8AA 2OO9A 1GO5A 3SHFA 2ZTDA 2MGWA 2KNVA 2R6FA 3TWLA 3HZJA 2OOBA 1Z6TA 2KDLA 4I4LA 1L2BA 1OQYA 4CGYB 5EXPA 3FUTA 4DR3M 3CTWB 4JI2M 1R5LA 4D82A 3GPUA 1FNNA 4X62M 4GKKM 4FWHA 1SXJA 4DR2M 4LRTA 1MN3A 3AOEC 1PJJA 2R4JA 4WP2A 4REZA 4OVZB 1OTRA 1XXHB 3M7GA 2DAEA 5ITTA 3NBIA 3KDSE 4Q7JA 1SXJE 3T1YM 1XNQM 3RGSA 1OKSA 2L4FA 2DKLA 1C1KA 3I4YA 1OAIA 4LF5M 2JZ1A 1ZMUA 2Z8YM 4LY6A 1OAOC 3K1JA 2XFTA 3FTCA 2KA6B 5JI3E 2FOIC 2XF3A 3KS8A 1G59A 3SYLA 3A98B 4LG2A 2N35A 2CHQA 3AOGA 1E9RA 1MU5A 4M0WA 4LGMA 2M60A 1Z5BA 4AZFA 3PXGA 5DNYA 4G3OA 2RRUA 1DGFA 1Q3CA 1XXHE 2DZOB 1IBKM 4LJAA 4DBGB 3U60B 2HCBA 4L78A 3E46A 2VF8A 2HL7A 4Y28F 3HJ8A 4IBKA 4LF9M 1JQJC 1OIPA 4PDIA 3GLGB 4DV7M 2R44A 2RGHA 1L2DA 4B3MM 4JXJA 5ITRA 3C3EA 3KOWE 3LCUA 1JB0F 1K82A 3SARA 2DAGA 1LV7A 3PNVA 3ZCBB 3GQ3A 1W5TA 1T3TA 4QNRA 2FH0A 2ZANA 1WGNA 2V1CA 5IZ7D 2KZSA 1IY2A 2ZBKB 5ITQA 4OU7A 1IN7A 4LJ6A 3H4JA 3KXEC 1PJQA 4MH0E 5EXTA 3FUXA 2K9DA 1IM2A 1VEGA 2R46A 4IBGA 4M9XA 2C5RA 1QZMA 3KP0E 3GLHB 2I7NA 1DO2A 2AHMA 2XSZA 5IT9S 2CV1A 4HL4A 1DGHA 1QDTA 1ORYB 4X66M 2K47A 3GLGA 5EXSA 2R0IA 4DV1M 3HHWA 2BNKA 4IBEA 2VDBB 4GMQA 5KPTA 3CGWA 1ZMWA 4CISA 1WJ7A 3JR5A 3DZDA 1D0KA 3Q8XA 2J7NA 5EQTA 4G4QA 4LCBA 1NO1A 4DR1M 1NHGC 3AL0C 4DR4M 2CHVA 3V76A 3UJNA 1G4AE 3BOSA 3T15A 2QQ8A 1SXJC 2FNAA 2VIIA 3BXWA 1IBMM 2RKOA 3AOEA 3EIEA 3HJQA 4L16A 4GHAA 3D8BA 1TTEA 1HT1E 4QHSA 4LJ4A 1ZMVA 3LCVB 2NQ8C 4JI5M 1OFIA 4L4UA 2JXNA 4LFBM 3UZUA 3IECA 4FVMA 3BBZA 3B7NA 4AI6A 4DV4M 1TH2A 2LVPC 1YSYA 2EO2A 4OW0A 1AUAA 1SXJB 3GRRA 2QPAA 2CWBA 1TF0B 2E5LM 2H1RA 4XBOA 5C1BA 1HT2E 1NJGA 3C9PA 3QAUA 4IJFA 1N34M 2OOAA 2I7PA 3K9OA 1IN4A 4MM3B 3IHPA 4FCTA 2CHGA 1NV8A 2MJ5B 2EKFA 4AKGA 2CV0A 3HU2A 4A3VB 4BLCA 3FYCA 2R18A 4GEWA 1Z59A 2JUJA 3FTEA 3FTFA 4G4NA 4DV5M 2KRUA 3FUWA 3J2PB 4YY3M 3KOXE 2JY7A 5ITUA 2LVQD
chains in the Genus database with same CATH topology
1T43A 1MN3A 4UN2B 3GLGE 1E94E 3K9PA 4WP2A 1C7YA 5DFLA 1F4IA 1WIVA 1OTRA 2DAEA 2L2DA 4HEOA 4Q7JA 2DENA 2HWJA 1IXSA 1OKSA 3MMPA 2L4FA 2DKLA 2LVNC 1OAIA 2BWBA 2JZ1A 1ZMUA 2LVAA 2LVOC 2DZLA 2KNZA 2JY8A 2JZ0A 1UFZA 1KYIA 1G41A 1V92A 2DI0A 2HAKA 1VEKA 4G3OA 1NV9A 2RRUA 1WHCA 1XXHE 5JI2E 4DBGB 2B3TA 3E46A 2G3QA 2K0BX 1HQYE 1BVSA 1Y8GA 3LCUA 1G3IA 2DAGA 3FRHA 1R4GA 1WGNA 2JNHA 2JY6B 1HJPA 2CP8A 2DNAA 2DHYA 1T6OA 3H4JA 1PGYA 4F2LA 2K9DA 2O25A 1ZV1A 1IM2A 1VEGA 2KHHA 2DAMA 4R71A 2QSFX 1QZEA 1DO2A 2H5XA 3FRIA 1JR3E 2LTUA 1WR1B 1CUKA 2R0IA 1IFYA 1ZMWA 1WGLA 1WJ7A 4F1IA 3T6PA 1EFUB 3GLIE 1AIPC 2WZJA 3E21A 2QNJA 2JY5A 1G4AE 1DO0A 1VDLA 1TR8A 2EKKA 1DV0A 1TTEA 1HT1E 2DAKA 1ZMVA 1XB2B 3LCVB 2KNAA 1Q02A 1VQ1A 1A5TA 3IECA 1VEJA 3BBZA 2ZTCA 2LVPC 3FE3A 3GLHE 1VG5A 2BWEA 2CWBA 2L4EA 2EJSA 2LBCA 2OO9A 2MR9A 1GO5A 1HT2E 2JP7A 3F92A 2ZTDA 2MGWA 2OOAA 2KNVA 3K9OA 3GLFE 2OOBA 3IHPA 1NV8A 2MJ5B 2QHOB 2EKFA 1OQYA 1P3QQ 2MROB 4GEWA 3B89A 2JUJA 2DAIA 1SG9A 1YLAA 2JY7A 2LVQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T43 A;  1MN3 A;  4UN2 B;  3GLG E;  1E94 E;  3K9P A;  4WP2 A;  1C7Y A;  5DFL A;  1F4I A;  1WIV A;  1OTR A;  2DAE A;  2L2D A;  4HEO A;  4Q7J A;  2DEN A;  2HWJ A;  1IXS A;  1OKS A;  3MMP A;  2L4F A;  2DKL A;  2LVN C;  1OAI A;  2BWB A;  2JZ1 A;  1ZMU A;  2LVA A;  2LVO C;  2DZL A;  2KNZ A;  2JY8 A;  2JZ0 A;  1UFZ A;  1KYI A;  1G41 A;  1V92 A;  2DI0 A;  2HAK A;  1VEK A;  4G3O A;  1NV9 A;  2RRU A;  1WHC A;  1XXH E;  5JI2 E;  4DBG B;  2B3T A;  3E46 A;  2G3Q A;  2K0B X;  1HQY E;  1BVS A;  1Y8G A;  3LCU A;  1G3I A;  2DAG A;  3FRH A;  1R4G A;  1WGN A;  2JNH A;  2JY6 B;  1HJP A;  2CP8 A;  2DNA A;  2DHY A;  1T6O A;  3H4J A;  1PGY A;  4F2L A;  2K9D A;  2O25 A;  1ZV1 A;  1IM2 A;  1VEG A;  2KHH A;  2DAM A;  4R71 A;  2QSF X;  1QZE A;  1DO2 A;  2H5X A;  3FRI A;  1JR3 E;  2LTU A;  1WR1 B;  1CUK A;  2R0I A;  1IFY A;  1ZMW A;  1WGL A;  1WJ7 A;  4F1I A;  3T6P A;  1EFU B;  3GLI E;  1AIP C;  2WZJ A;  3E21 A;  2QNJ A;  2JY5 A;  1G4A E;  1DO0 A;  1VDL A;  1TR8 A;  2EKK A;  1DV0 A;  1TTE A;  1HT1 E;  2DAK A;  1ZMV A;  1XB2 B;  3LCV B;  2KNA A;  1Q02 A;  1VQ1 A;  1A5T A;  3IEC A;  1VEJ A;  3BBZ A;  2ZTC A;  2LVP C;  3FE3 A;  3GLH E;  1VG5 A;  2BWE A;  2CWB A;  2L4E A;  2EJS A;  2LBC A;  2OO9 A;  2MR9 A;  1GO5 A;  1HT2 E;  2JP7 A;  3F92 A;  2ZTD A;  2MGW A;  2OOA A;  2KNV A;  3K9O A;  3GLF E;  2OOB A;  3IHP A;  1NV8 A;  2MJ5 B;  2QHO B;  2EKF A;  1OQY A;  1P3Q Q;  2MRO B;  4GEW A;  3B89 A;  2JUJ A;  2DAI A;  1SG9 A;  1YLA A;  2JY7 A;  2LVQ D; 
#chains in the Genus database with same CATH topology
 1E9S A;  1T43 A;  2LWX A;  3GLG E;  1NNJ A;  1XNR M;  1N75 A;  4DR7 M;  1C7Y A;  4GKJ M;  5DFL A;  4XK8 F;  4QOZ C;  2JWS A;  4LZJ A;  2DWN A;  4IBB A;  3UGJ A;  5C18 A;  4OX9 M;  1ZAE A;  1QYR A;  2CV2 A;  1QAO A;  3VKG A;  3SYK A;  5E26 A;  1N33 M;  1R7R A;  3GO8 A;  5BPV A;  4AKH A;  5EXX A;  1XWI A;  2X4A A;  2QBY B;  1KYI A;  2DI0 A;  1NV9 A;  1GJS A;  3A46 A;  2APL A;  1Q3B A;  3K8Z A;  1Q39 A;  3W0L B;  5LMU M;  3SMS A;  3SAV A;  2R4E A;  1V33 A;  2K0B X;  4KOD A;  2Q2E B;  3HU1 A;  2CRU A;  3LVW A;  1BVS A;  2R45 A;  3I4V A;  4LJ8 A;  5KPR A;  3AKZ A;  2D7G A;  3U6Q A;  4DV3 M;  4B7H A;  3DFZ A;  1G3I A;  3T1H M;  2V1U A;  1TDZ A;  3B74 A;  4B7G A;  5FTM A;  2WSC F;  2L6O A;  1QVR A;  4M9S A;  1SXJ D;  1XMO M;  2HHH M;  1L2C A;  4GRI A;  1D0L A;  1W5S A;  3I01 M;  3KOZ E;  1YUB A;  2DNA A;  4IIW A;  4DUZ M;  1L1Z A;  3VK8 A;  1IN6 A;  1TDH A;  1TH3 A;  1PGY A;  3AV0 A;  3CF6 E;  5FTN A;  4B08 A;  4KHP M;  3VFD A;  4F2L A;  3SAT A;  1WXQ A;  3I51 A;  3L28 A;  1DGG A;  3SFZ A;  3THG A;  4LF7 M;  3K92 A;  4JI1 M;  2H5X A;  5DYG A;  2XGN A;  1K3W A;  3FRI A;  3T38 A;  3GLI A;  1IXR C;  4MGK E;  1HNZ M;  2UXB M;  1CUK A;  4CIZ A;  4PDG A;  4LGY A;  1IFY A;  3LQR A;  2XLJ A;  4LF8 M;  3A42 A;  4RF1 A;  3TL4 X;  1V34 A;  1WGL A;  4B3T M;  1K3X A;  1NVM A;  3C3D A;  3U6M A;  4MB7 A;  3T6P A;  1HQC A;  1GVN A;  4NL4 H;  3GRY A;  3GLI E;  1AIP C;  1KFV A;  2WZJ A;  3HU3 A;  5KQD A;  5EP3 A;  3RFW A;  2JY5 A;  2GNO A;  4B3R M;  4DR6 M;  2V6Z M;  1VDL A;  2DZN B;  5FTJ A;  3HWS A;  1I94 M;  4PCZ A;  3M0E A;  3J7A S;  3K2L A;  2XSZ D;  1DV0 A;  1GL6 A;  1DGB A;  3W0F A;  4MGY E;  3U6L A;  3ZC7 B;  4P17 A;  3FTD A;  2GQF A;  2YFQ A;  3KOY E;  4P16 A;  4B7F A;  3CF0 A;  4M0D A;  1A5T A;  4FD2 A;  4MGZ E;  1TH4 A;  1VEJ A;  1LTM A;  4IBI A;  3KFU G;  2HKJ A;  3FE3 A;  4JI3 M;  5BR8 M;  2M5Z A;  1VG5 A;  2R62 A;  1R6B X;  4L15 A;  3U6O A;  4I5S A;  1X37 A;  2L4E A;  2C9O A;  2EJS A;  5EJC A;  2XZU A;  3WHL A;  2Y20 A;  4JI0 M;  3F92 A;  4GIP A;  5KPZ A;  2FFJ A;  1G71 A;  3QYE A;  3GLF E;  1XMQ M;  2D7H A;  2Z4S A;  5FTK A;  5A2Q S;  4PT5 A;  1D0M A;  3KP1 E;  4Z8X A;  1P3Q Q;  2MRO B;  2QCU A;  1Z5C A;  3B89 A;  2Z4R A;  3LVV A;  3KSX A;  2DAI A;  3SMP A;  1GLN A;  3TE6 A;  3OTO M;  2P5T A;  4NRW A;  1I4W A;  3J7B A;  1IN8 A;  4WW0 A;  3FD9 A;  4UN2 B;  4G4R A;  1E94 E;  3HX3 A;  3K9P A;  1QAM A;  1IBL M;  1EIJ A;  1F4I A;  4FWG A;  2QP9 X;  1WIV A;  3TPZ A;  3GP1 A;  1IY0 A;  4RF0 A;  4HEO A;  4I8O A;  1NJF A;  4G4O A;  2DEN A;  1EE8 A;  4ZPX A;  2YNM D;  4LJ7 A;  4R7G A;  2FE8 A;  3ZQJ A;  3KSJ A;  2BWB A;  4JI7 M;  4D80 A;  2LVO C;  3ZH9 B;  3EIH A;  3U5Z B;  4IBD A;  2KNZ A;  4DUY M;  3QWL A;  2LHG A;  1N36 M;  4AG6 A;  1UFZ A;  1V92 A;  1J5E M;  3AJI B;  2HAK A;  2ZAM A;  2XH9 A;  5FTL A;  1MX0 A;  3L25 A;  3L26 A;  4NC6 A;  4Z6Y A;  4NSO B;  2F4V M;  1WHC A;  3HKP A;  4QHT A;  4FW9 A;  4TUW A;  3R8F A;  5JI2 E;  1S3S A;  1UM8 A;  1QAQ A;  3A45 A;  3DA1 A;  2G3Q A;  1IY1 A;  4GHL A;  2XEP A;  1HQY E;  3GQ5 A;  1PM5 A;  3KS4 A;  2BJV A;  2Y0T A;  3VDU A;  3RGP A;  3GPX A;  1NY6 A;  4AG5 A;  3SC3 A;  3B9P A;  3RE8 A;  2R65 A;  3U60 A;  5FSW A;  2BJW A;  3GLH A;  3IG8 A;  3E9S A;  5EP4 A;  3FRH A;  1R2Y A;  1R4G A;  1XHB A;  1N32 M;  3D8L A;  2JNH A;  3SAU A;  3HGI A;  4LF6 M;  4FWD A;  1QQW A;  4ITQ A;  2QBY A;  2DHY A;  2UUC M;  3U5Z A;  2A5Y B;  3JR4 A;  3VDP A;  2J5Y A;  4EIW A;  4IBC A;  4DR5 M;  3VKH A;  2O25 A;  1ZV1 A;  2L7I A;  2KHH A;  3SAS A;  2DAM A;  4JN6 A;  1MJG M;  2LNH C;  2LHC A;  1QZE A;  4JI8 M;  1JR3 E;  2LTU A;  1Z5A A;  3MK6 A;  2JA2 A;  2EUC A;  5ITX A;  2MH8 A;  4JI4 M;  8CAT A;  4LZZ A;  7CAT A;  3J81 S;  1GKI A;  4NXM M;  4D81 A;  4L8R C;  5LMN M;  2RGO A;  3SAW A;  4DV0 M;  1IQP A;  1L8Q A;  3SBJ A;  2G5G X;  2CFO A;  1G8P A;  2ZM6 M;  1HR0 M;  2Y21 A;  1NNU C;  4HLQ A;  3CF2 A;  3GPP A;  2ERC A;  2QNJ A;  5ITX E;  3QYB A;  3M6A A;  3W67 A;  2F5N A;  1TR8 A;  3PVS A;  4S12 A;  4KO8 A;  4G6Z A;  1QUT A;  4CJ6 A;  1PJT A;  4KT0 F;  3GPY A;  3AFH A;  2DAK A;  3UK6 A;  2VF7 A;  2L7H A;  4FCV A;  1VQ1 A;  1D2N A;  4RNA A;  1PJI A;  1R2Z A;  3GLH E;  1NSF A;  2CE7 A;  2XZF A;  2K6B A;  1OIZ A;  3FYD A;  2Z7J A;  4QNM A;  4LFA M;  2LBC A;  3E4R A;  2MR9 A;  4PD2 A;  1J09 A;  2JP7 A;  3LW5 F;  5DYI A;  5EP2 A;  2F5S A;  2OPF A;  1XC8 A;  2FS1 A;  3PNY A;  3FUU A;  4B3S M;  2QHO B;  4CHT B;  3U6E A;  2KZU A;  4YHH M;  1GL7 A;  3HHZ A;  4X64 M;  4LJ9 A;  1JR3 D;  2WSE F;  4LRS A;  1SG9 A;  1QAN A;  1JR3 A;  4AW4 A;  1YLA A;  2EA0 A;  3U61 B;  3IG5 A;  2DWL A;  3B7Z A;  2UXC M;  4BBA A;  2F5Q A;  3LQQ A;  4NSR A;  3U6D A;  1OJL A;  2W82 A;  2KEB A;  3TQS A;  4DV6 M;  4LF4 M;  1E32 A;  2L2D A;  4GC9 A;  2QEN A;  3SHG B;  3MJ5 A;  4MGH A;  2HWJ A;  3B7Q A;  2C9C A;  1IXS A;  4IBJ A;  3HHX A;  2LVN C;  3FUV A;  3KVW A;  3MMP A;  2XFS A;  2LVA A;  2QZ4 A;  3U6P A;  2DWM A;  4W5W A;  2DZL A;  2KRK A;  4ANR A;  3DOA A;  3GQ4 A;  5L8R F;  3L29 A;  3R9X B;  2JY8 A;  2JZ0 A;  4II7 A;  4IBF A;  1L1T A;  1G41 A;  4KLN A;  4R3D A;  2DXI A;  1VEK A;  3TWK A;  4GIT A;  2D7E A;  1PJS A;  2C99 A;  4JV5 M;  3UMM A;  1ZQ9 A;  4X65 M;  3GLF A;  2UUA M;  4NXN M;  1KSF X;  4GC5 A;  3VLF B;  1NY5 A;  2B3T A;  2KXE A;  1HNX M;  5EP1 A;  2C96 A;  1RU3 A;  3GLI B;  1YE9 A;  1DGH B;  2C98 A;  3PFI A;  3Q8G A;  1Y8G A;  5KO3 A;  2UXD M;  1N78 A;  3VK7 A;  2F5O A;  4IJE A;  2LH0 A;  2YR0 A;  2KW0 A;  1FJG M;  4NRV A;  1QUS A;  3JAM S;  5GKN A;  3U6C A;  4JYA M;  2JY6 B;  1QDR A;  4M9Z A;  4AKI A;  1HJP A;  1IXZ A;  2CP8 A;  5IRE B;  4K0K M;  2VQE M;  3I04 M;  3GRU A;  1J7K A;  2Y0Q A;  3L2A A;  1T6O A;  3H4M A;  2UUB M;  1HNW M;  2LXE A;  2OQ4 A;  2J7O A;  4R71 A;  3LMM A;  5IWA M;  2QSF X;  1OFH A;  2DHR A;  4DV2 M;  2Z3X A;  2UU9 M;  1GJT A;  3ILK A;  2X49 A;  4FCW A;  1VDD A;  1IN5 A;  1WR1 B;  3HY5 A;  4QOS A;  3W68 A;  3J80 S;  5H37 D;  4NOO B;  2VQF M;  1GAB A;  3MHV C;  4L6V 6;  3U61 A;  3U6S A;  5KQ8 A;  5FLX S;  3FKE A;  4F1I A;  3GLF B;  4AQY M;  4MGI E;  1EFU B;  2DVW B;  1NHW C;  4XGI A;  3GRV A;  2O01 F;  3TWM A;  1H6U A;  2G8L A;  2O5R A;  3E21 A;  3J27 B;  4WUR A;  1DO0 A;  2F5P A;  3WHK A;  4BB9 A;  2YQZ A;  5F3W A;  2DWZ B;  3HJS A;  4JI6 M;  2EKK A;  2L09 A;  1IXS B;  3HHY A;  3NWL A;  1XB2 B;  1TGU A;  3C58 A;  1XXH A;  2KNA A;  1Q02 A;  4LJ5 A;  4OVZ A;  1PRB A;  1N77 A;  4RKU F;  4LFC M;  4GH9 A;  2CEA A;  2CUZ A;  3KW6 A;  3NBX X;  5E6J A;  2ZTC A;  3L27 A;  2BWE A;  2ZAO A;  5ITY A;  4I81 A;  2WSF F;  2X8A A;  2OO9 A;  1GO5 A;  3SHF A;  2ZTD A;  2MGW A;  2KNV A;  2R6F A;  3TWL A;  3HZJ A;  2OOB A;  1Z6T A;  2KDL A;  4I4L A;  1L2B A;  1OQY A;  4CGY B;  5EXP A;  3FUT A;  4DR3 M;  3CTW B;  4JI2 M;  1R5L A;  4D82 A;  3GPU A;  1FNN A;  4X62 M;  4GKK M;  4FWH A;  1SXJ A;  4DR2 M;  4LRT A;  1MN3 A;  3AOE C;  1PJJ A;  2R4J A;  4WP2 A;  4REZ A;  4OVZ B;  1OTR A;  1XXH B;  3M7G A;  2DAE A;  5ITT A;  3NBI A;  3KDS E;  4Q7J A;  1SXJ E;  3T1Y M;  1XNQ M;  3RGS A;  1OKS A;  2L4F A;  2DKL A;  1C1K A;  3I4Y A;  1OAI A;  4LF5 M;  2JZ1 A;  1ZMU A;  2Z8Y M;  4LY6 A;  1OAO C;  3K1J A;  2XFT A;  3FTC A;  2KA6 B;  5JI3 E;  2FOI C;  2XF3 A;  3KS8 A;  1G59 A;  3SYL A;  3A98 B;  4LG2 A;  2N35 A;  2CHQ A;  3AOG A;  1E9R A;  1MU5 A;  4M0W A;  4LGM A;  2M60 A;  1Z5B A;  4AZF A;  3PXG A;  5DNY A;  4G3O A;  2RRU A;  1DGF A;  1Q3C A;  1XXH E;  2DZO B;  1IBK M;  4LJA A;  4DBG B;  3U60 B;  2HCB A;  4L78 A;  3E46 A;  2VF8 A;  2HL7 A;  4Y28 F;  3HJ8 A;  4IBK A;  4LF9 M;  1JQJ C;  1OIP A;  4PDI A;  3GLG B;  4DV7 M;  2R44 A;  2RGH A;  1L2D A;  4B3M M;  4JXJ A;  5ITR A;  3C3E A;  3KOW E;  3LCU A;  1JB0 F;  1K82 A;  3SAR A;  2DAG A;  1LV7 A;  3PNV A;  3ZCB B;  3GQ3 A;  1W5T A;  1T3T A;  4QNR A;  2FH0 A;  2ZAN A;  1WGN A;  2V1C A;  5IZ7 D;  2KZS A;  1IY2 A;  2ZBK B;  5ITQ A;  4OU7 A;  1IN7 A;  4LJ6 A;  3H4J A;  3KXE C;  1PJQ A;  4MH0 E;  5EXT A;  3FUX A;  2K9D A;  1IM2 A;  1VEG A;  2R46 A;  4IBG A;  4M9X A;  2C5R A;  1QZM A;  3KP0 E;  3GLH B;  2I7N A;  1DO2 A;  2AHM A;  2XSZ A;  5IT9 S;  2CV1 A;  4HL4 A;  1DGH A;  1QDT A;  1ORY B;  4X66 M;  2K47 A;  3GLG A;  5EXS A;  2R0I A;  4DV1 M;  3HHW A;  2BNK A;  4IBE A;  2VDB B;  4GMQ A;  5KPT A;  3CGW A;  1ZMW A;  4CIS A;  1WJ7 A;  3JR5 A;  3DZD A;  1D0K A;  3Q8X A;  2J7N A;  5EQT A;  4G4Q A;  4LCB A;  1NO1 A;  4DR1 M;  1NHG C;  3AL0 C;  4DR4 M;  2CHV A;  3V76 A;  3UJN A;  1G4A E;  3BOS A;  3T15 A;  2QQ8 A;  1SXJ C;  2FNA A;  2VII A;  3BXW A;  1IBM M;  2RKO A;  3AOE A;  3EIE A;  3HJQ A;  4L16 A;  4GHA A;  3D8B A;  1TTE A;  1HT1 E;  4QHS A;  4LJ4 A;  1ZMV A;  3LCV B;  2NQ8 C;  4JI5 M;  1OFI A;  4L4U A;  2JXN A;  4LFB M;  3UZU A;  3IEC A;  4FVM A;  3BBZ A;  3B7N A;  4AI6 A;  4DV4 M;  1TH2 A;  2LVP C;  1YSY A;  2EO2 A;  4OW0 A;  1AUA A;  1SXJ B;  3GRR A;  2QPA A;  2CWB A;  1TF0 B;  2E5L M;  2H1R A;  4XBO A;  5C1B A;  1HT2 E;  1NJG A;  3C9P A;  3QAU A;  4IJF A;  1N34 M;  2OOA A;  2I7P A;  3K9O A;  1IN4 A;  4MM3 B;  3IHP A;  4FCT A;  2CHG A;  1NV8 A;  2MJ5 B;  2EKF A;  4AKG A;  2CV0 A;  3HU2 A;  4A3V B;  4BLC A;  3FYC A;  2R18 A;  4GEW A;  1Z59 A;  2JUJ A;  3FTE A;  3FTF A;  4G4N A;  4DV5 M;  2KRU A;  3FUW A;  3J2P B;  4YY3 M;  3KOX E;  2JY7 A;  5ITU A;  2LVQ D; 
#chains in the Genus database with same CATH homology
 1T43 A;  1MN3 A;  4UN2 B;  3GLG E;  1E94 E;  3K9P A;  4WP2 A;  1C7Y A;  5DFL A;  1F4I A;  1WIV A;  1OTR A;  2DAE A;  2L2D A;  4HEO A;  4Q7J A;  2DEN A;  2HWJ A;  1IXS A;  1OKS A;  3MMP A;  2L4F A;  2DKL A;  2LVN C;  1OAI A;  2BWB A;  2JZ1 A;  1ZMU A;  2LVA A;  2LVO C;  2DZL A;  2KNZ A;  2JY8 A;  2JZ0 A;  1UFZ A;  1KYI A;  1G41 A;  1V92 A;  2DI0 A;  2HAK A;  1VEK A;  4G3O A;  1NV9 A;  2RRU A;  1WHC A;  1XXH E;  5JI2 E;  4DBG B;  2B3T A;  3E46 A;  2G3Q A;  2K0B X;  1HQY E;  1BVS A;  1Y8G A;  3LCU A;  1G3I A;  2DAG A;  3FRH A;  1R4G A;  1WGN A;  2JNH A;  2JY6 B;  1HJP A;  2CP8 A;  2DNA A;  2DHY A;  1T6O A;  3H4J A;  1PGY A;  4F2L A;  2K9D A;  2O25 A;  1ZV1 A;  1IM2 A;  1VEG A;  2KHH A;  2DAM A;  4R71 A;  2QSF X;  1QZE A;  1DO2 A;  2H5X A;  3FRI A;  1JR3 E;  2LTU A;  1WR1 B;  1CUK A;  2R0I A;  1IFY A;  1ZMW A;  1WGL A;  1WJ7 A;  4F1I A;  3T6P A;  1EFU B;  3GLI E;  1AIP C;  2WZJ A;  3E21 A;  2QNJ A;  2JY5 A;  1G4A E;  1DO0 A;  1VDL A;  1TR8 A;  2EKK A;  1DV0 A;  1TTE A;  1HT1 E;  2DAK A;  1ZMV A;  1XB2 B;  3LCV B;  2KNA A;  1Q02 A;  1VQ1 A;  1A5T A;  3IEC A;  1VEJ A;  3BBZ A;  2ZTC A;  2LVP C;  3FE3 A;  3GLH E;  1VG5 A;  2BWE A;  2CWB A;  2L4E A;  2EJS A;  2LBC A;  2OO9 A;  2MR9 A;  1GO5 A;  1HT2 E;  2JP7 A;  3F92 A;  2ZTD A;  2MGW A;  2OOA A;  2KNV A;  3K9O A;  3GLF E;  2OOB A;  3IHP A;  1NV8 A;  2MJ5 B;  2QHO B;  2EKF A;  1OQY A;  1P3Q Q;  2MRO B;  4GEW A;  3B89 A;  2JUJ A;  2DAI A;  1SG9 A;  1YLA A;  2JY7 A;  2LVQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...