5IT9S

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 24
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5it9S01
1L1TA 1I94M 2UXBM 1N34M 4PDGA 2F5SA 1XNRM 4NXNM 4YHHM 1L2BA 3GPYA 2UUAM 3GPXA 1L1ZA 4LF5M 2VQEM 2ZM6M 2XZUA 4B3MM 3GPPA 3GQ5A 1R2ZA 4DV7M 4LF9M 4DV2M 1Z5AA 1K3XA 5LMNM 1PJIA 4OX9M 2UXCM 3SASA 1HNWM 2OPFA 5ITUA 1MU5A 4LFAM 1Z5BA 1TDHA 4PD2A 1L2DA 1IBKM 3J80S 1IBLM 4GKJM 1Z59A 1PM5A 3GQ4A 3A46A 4JI8M 1Q39A 5ITXA 2F4VM 4MB7A 5ITYA 2F5NA 4DUZM 4JI4M 4DR6M 3GPUA 3SAUA 4PCZA 4K0KM 4DR1M 3SATA 4B3TM 4LFBM 1N36M 3J7AS 4G4NA 1Q3CA 2UU9M 3U6MA 1IBMM 2VQFM 4DR3M 4DV1M 3A42A 2F5PA 4NRVA 1MX0A 3T1HM 4KHPM 1Q3BA 5FLXS 3U6LA 4LF8M 4JI5M 1K3WA 4B3SM 3DOAA 4G4RA 4LF6M 3W0FA 5IWAM 3T1YM 4GKKM 1EE8A 2UUBM 1XC8A 1K82A 4DR5M 3J81S 3GO8A 3TWMA 1HNXM 1XNQM 4NRWA 2XZFA 2Q2EB 4JI1M 3VK8A 3U6EA 5ITQA 3U6QA 1KFVA 4X62M 1XMOM 4DV5M 3GP1A 2UUCM 4DR4M 4DR7M 3TWLA 1L2CA 5BR8M 1J5EM 4G4OA 3OTOM 1R2YA 3GQ3A 4JI7M 1Z5CA 4NXMM 3SAWA 1HNZM 4LF4M 4X64M 3C58A 4YY3M 4JI3M 5A2QS 4DV0M 4X66M 2OQ4A 1NNJA 4JV5M 1N33M 5IT9S 2HHHM 4G4QA 1FJGM 4LF7M 2ZBKB 3JR4A 3TWKA 4B3RM 5LMUM 4AQYM 3JAMS 3SARA 4X65M 4DV6M 3A45A 3U6OA 3U6CA 4CISA 1HR0M 4PDIA 4DV4M 4JYAM 2HKJA 3SBJA 5ITXE 3U6PA 4ITQA 1XMQM 2F5QA 1N32M 4DR2M 2UXDM 1PJJA 3JR5A 2EA0A 3U6DA 4DUYM 4JI0M 1TDZA 2F5OA 3SAVA 4JI2M 4JI6M 5ITTA 3U6SA 4LFCM 2E5LM 5ITRA 3VK7A 4DV3M
chains in the Genus database with same CATH superfamily
3AOGA 1A5TA 2UXBM 1JQJC 1CUKA 1HT2E 3KOYE 3LQQA 1N34M 4NXNM 1L2BA 3TPZA 3GPYA 2UUAM 4FVMA 2L2DA 2R44A 1XXHA 1J09A 3FE3A 2VQEM 2ZM6M 3FTFA 1SXJE 2D7HA 3E4RA 1SXJC 2O01F 3CF2A 1Z6TA 1NJGA 4LF9M 1OTRA 3QYEA 4M9SA 4DV2M 4KODA 4HL4A 3T15A 2DWLA 4MGKE 1WIVA 2J7OA 2HL7A 3WHKA 3UZUA 4BBAA 2JP7A 2UXCM 2JXNA 4OX9M 4WP2A 3RGPA 4L6V6 2FOIC 2OOBA 3RGSA 2CHQA 2JY7A 1T6OA 1OAOC 4Z6YA 3FRHA 5JI3E 4QOZC 1Z5BA 5E26A 4CJ6A 1N77A 3FKEA 1GJSA 4PD2A 4JXJA 3B7NA 3QWLA 4GKJM 3U61B 2DAMA 2L7HA 4JI8M 3BXWA 2WSCF 3GLIA 2F5NA 4XGIA 2YFQA 2O25A 4DUZM 1QZEA 2CV2A 1G8PA 2CUZA 4MM3B 2Z4SA 4TUWA 2B3TA 3LW5F 2P5TA 3SFZA 4B3TM 3J7AS 3UJNA 1T43A 3M6AA 2X4AA 4OVZB 4S12A 1XHBA 4MGZE 3A42A 3LQRA 2MGWA 4KO8A 3K9OA 4FW9A 5F3WA 2RKOA 3MK6A 4NRVA 1Q3BA 4CGYB 3GRUA 5FLXS 3AKZA 4NSOB 3EIEA 4LF8M 2QHOB 2QSFX 3IG8A 5DNYA 3DOAA 4UN2B 2I7PA 4IBKA 1QUTA 4GC5A 3B74A 4LJ7A 5DFLA 2CV1A 1EE8A 2DAEA 3D8LA 4FWDA 3UK6A 3ZQJA 5JI2E 3TQSA 2C9OA 2HCBA 3TWMA 2DZOB 2MROB 4W5WA 1I4WA 1QQWA 1IY1A 3HU1A 2OOAA 3VK8A 3GLFE 4RNAA 3GLHE 3R9XB 2C5RA 1XMOM 1IM2A 1E32A 3MMPA 4IJEA 3J27B 2UUCM 3B7ZA 2DHYA 3ILKA 1VEKA 5EP3A 2XH9A 4I5SA 3OTOM 2YR0A 4I4LA 2R62A 5GKNA 2JY6B 1HQCA 3GQ3A 4GHLA 1E94E 2VF7A 4LJAA 4B08A 3UMMA 5A2QS 2Z3XA 1YE9A 2LVOC 1N33M 4G4QA 2G5GX 4B7GA 2FE8A 2ZBKB 2QCUA 4AKHA 3KP1E 4X65M 3KS8A 3HJSA 1OJLA 1R5LA 4LCBA 3T6PA 1OIZA 4DV4M 4REZA 2X49A 2CWBA 4IBDA 2HKJA 4LZJA 1VDDA 5ITXE 3U6PA 3SBJA 4IJFA 3GLGA 4ITQA 5FTKA 4L78A 2C98A 1QAOA 2VF8A 1R4GA 3KDSE 3PFIA 2UXDM 1PJJA 2ZTCA 1DGHB 1TTEA 1L8QA 2EKKA 4Q7JA 4MGIE 1WR1B 3HU3A 4PT5A 2R65A 3LVWA 4Z8XA 3U6SA 1IN4A 4HLQA 2L4FA 3V76A 3VK7A 3MHVC 5EQTA 2LVQD 3VDUA 3GLHA 3ZCBB 1L1TA 2JY8A 2F5SA 1UFZA 4YHHM 3L26A 2LNHC 3CTWB 1L1ZA 3TL4X 2XFTA 2JZ1A 4D80A 2XSZA 5EXPA 4B3MM 4I81A 1QYRA 4RKUF 5EXTA 5EP1A 4B7HA 1D0LA 1NVMA 4OU7A 1IY2A 1Z5AA 2V6ZM 3MJ5A 1K3XA 1WXQA 3SASA 1G3IA 2GQFA 4IBEA 4AKIA 5ITUA 4IIWA 4RF0A 1WGLA 4BB9A 2K0BX 1IN5A 1D0MA 1L2DA 1ZMVA 2DAGA 2DENA 3J80S 1IBLM 4GC9A 1PM5A 3B89A 1Q39A 5ITXA 2JY5A 2W82A 5ITYA 4DR6M 3VDPA 3GPUA 3FD9A 3GLHB 4P17A 4DR1M 2D7EA 3SATA 1VQ1A 2APLA 2BWEA 1N36M 3KFUG 3K92A 1SXJD 4LFBM 3HU2A 3FUWA 1NY6A 1PJTA 2DHRA 1DGGA 3HY5A 1PJSA 5EXXA 3U6MA 1IBMM 2XFSA 4CIZA 1XXHE 2LBCA 2DVWB 2F5PA 4M0WA 3LVVA 2YQZA 2KW0A 3U6LA 2QENA 5EXSA 3GRYA 4JI5M 1K3WA 3U61A 3F92A 4LJ5A 2DXIA 5DYGA 4DR5M 3KSJA 2CP8A 2DZLA 4LRSA 1RU3A 3SMSA 1TF0B 3KS4A 1ZQ9A 1XNQM 1IQPA 3KOXE 2HWJA 2Q2EB 2DWNA 4NL4H 3SHFA 3B7QA 3LMMA 5ITQA 1HT1E 2FH0A 3FUVA 4L15A 2BNKA 4X62M 1KFVA 3T38A 3HWSA 2N35A 3GRVA 4QNMA 2LXEA 4F1IA 3A98B 3TWLA 5KO3A 4XK8F 1XXHB 1TH3A 4L16A 2LWXA 2HAKA 1TR8A 2MJ5B 3IHPA 3BBZA 3I4VA 1R2YA 4GHAA 1R6BX 1Z5CA 3H4JA 2LVPC 3C58A 4AZFA 2LTUA 2Z4RA 2KRKA 1DV0A 3NWLA 3ZC7B 1FJGM 4F2LA 1KSFX 3SC3A 2RGHA 1IN6A 3TWKA 2KDLA 4AQYM 4M9XA 3HHZA 4DV6M 2O5RA 3U6OA 2DWZB 4CISA 2J5YA 2M60A 2Z7JA 1HR0M 1Q02A 4PDIA 4JYAM 4R7GA 3HGIA 3HHXA 3GPPA 1KYIA 2J7NA 3GLFB 3KSXA 3AOEA 4NC6A 2KZSA 1AUAA 3HZJA 5FTJA 4HEOA 2F5QA 1PRBA 4L8RC 2Y21A 2QBYA 4DR2M 2DNAA 2I7NA 3H4MA 2DWMA 2VDBB 3JR5A 1HQYE 8CATA 3U6DA 1D0KA 2F5OA 2KHHA 3SYLA 3SAVA 3HJQA 5ITTA 4JI6M 1X37A 2E5LM 2MR9A 1S3SA 1PGYA 4AG6A 3K9PA 3NBIA 4PDGA 1XNRM 1DO2A 1JR3A 2EO2A 1VEGA 2FNAA 3RFWA 4LF5M 2CV0A 2KZUA 2DAIA 3CF6E 3SHGB 1NJFA 3AL0C 4G6ZA 1NY5A 2V1CA 3GQ5A 1XB2B 5FTNA 1E9RA 4DV7M 4LZZA 1DGBA 3UGJA 1HJPA 1IFYA 3C3EA 4FCWA 1OKSA 5C1BA 1XWIA 1GKIA 4II7A 1HNWM 3W68A 1QZMA 3KVWA 1JR3D 2FS1A 1TDHA 4FD2A 2LH0A 2WSEF 3WHLA 1IBKM 4KLNA 1LTMA 3FTEA 3A46A 3I4YA 1Y8GA 4AKGA 3HKPA 4MB7A 4JI4M 4GMQA 4CHTB 1OFIA 4R3DA 3SAUA 1C1KA 2Y0TA 4K0KM 3IG5A 1IXZA 4OVZA 1QAQA 2KNVA 5FSWA 4G4NA 1ZV1A 1Q3CA 2LVAA 1GL6A 1NSFA 2LHGA 4A3VB 4DR3M 3J7BA 1G4AE 2DKLA 1J7KA 3CF0A 2KNAA 1IN8A 3I04M 3T1HM 3W67A 4KHPM 3GLGB 1NHWC 2R46A 2G3QA 2ZTDA 4NOOB 4AI6A 1DO0A 4D81A 1IXSB 1JB0F 1E9SA 1YLAA 4B3SM 1W5SA 1QDTA 4G4RA 1GL7A 3W0FA 1GVNA 4FCTA 1MN3A 2KEBA 2Y20A 5KPTA 1W5TA 4GKKM 2QZ4A 3PVSA 4GIPA 4FWHA 2BWBA 3GRRA 4LJ6A 4MH0E 4EIWA 1K82A 2UUBM 3J81S 3GO8A 2X8AA 2XEPA 2KA6B 4NRWA 3I01M 2QP9X 4NSRA 1VG5A 3K1JA 2XZFA 2JWSA 4LJ8A 4JI1M 3FUTA 4IBGA 3IECA 4M9ZA 3L27A 3FTCA 2DI0A 2K6BA 3U6QA 1QAMA 3SMPA 4Y28F 4DR4M 2QPAA 4DR7M 3PNVA 1IXSA 3HHYA 3J2PB 5BR8M 3GLFA 1J5EM 4G4OA 1EFUB 2L6OA 2ERCA 4WW0A 3AV0A 2CHVA 2JZ0A 2D7GA 4QNRA 3SAWA 2OO9A 2ZAMA 4X64M 2R4JA 1HNZM 4LF4M 4JV5M 3FRIA 3VKGA 2RRUA 1GLNA 1YUBA 1SXJA 4LF7M 5LMUM 3JAMS 3M7GA 2WZJA 3L2AA 4BLCA 5H37D 4IBCA 3U6CA 3C3DA 1V34A 3U5ZB 2KNZA 3EIHA 4LGMA 2Z8YM 1LV7A 3AJIB 1EIJA 1XMQM 2EKFA 3B9PA 4RF1A 1WGNA 2WSFF 3QYBA 2BJVA 1R7RA 5FTMA 1IN7A 1P3QQ 1PJQA 3E46A 3Q8GA 2EA0A 3DFZA 2M5ZA 4I8OA 2EUCA 4JI0M 5BPVA 3QAUA 3DZDA 4IBIA 4JI2M 3K8ZA 3HJ8A 3THGA 2C9CA 3R8FA 1N75A 5KPZA 3L29A 4DV3M 4KT0F 2V1UA 1I94M 1QDRA 1GO5A 1N78A 2KRUA 1H6UA 1QANA 3KP0E 3GPXA 2QQ8A 4IBJA 4L4UA 5EP2A 2XZUA 2MH8A 3FYCA 2R0IA 1ORYB 2QNJA 3L28A 5EJCA 1OIPA 4M0DA 1SG9A 1TGUA 1OQYA 4GRIA 1R2ZA 7CATA 3GLIE 2JUJA 2Y0QA 3M0EA 3I51A 2YNMD 3LCUA 3D8BA 1YSYA 3E9SA 3BOSA 1ZAEA 3K2LA 3C9PA 4LJ4A 1G59A 5KPRA 2CFOA 4JN6A 4IBBA 5LMNM 1PJIA 1WJ7A 2H5XA 1T3TA 1ZMWA 2OPFA 1DGFA 1MU5A 1JR3E 4LFAM 3TE6A 3AOEC 3KOWE 2DAKA 2L7IA 1BVSA 2CHGA 2JNHA 2DZNB 4FCVA 1Z59A 3VLFB 5C18A 3VKHA 2CEAA 3GQ4A 1FNNA 3U60B 2F4VM 4QHSA 4LRTA 4PCZA 1AIPC 4GEWA 3KXEC 1SXJB 2UU9M 4ZPXA 3KW6A 3RE8A 2L09A 2VQFM 1F4IA 4DV1M 3GLIB 5IZ7D 1OAIA 3VFDA 2LVNC 5KQ8A 3Q8XA 1MX0A 4WURA 4IBFA 4DBGB 1NNUC 3U60A 4GH9A 5DYIA 3SYKA 1G41A 3HHWA 5E6JA 4R71A 4LF6M 5IWAM 3T1YM 4MGHA 2RGOA 2A5YB 5FTLA 3U5ZA 2GNOA 1G71A 1NV8A 2L4EA 1XC8A 1WHCA 3FYDA 3L25A 1IY0A 1MJGM 1TH4A 2JA2A 2KXEA 3DA1A 3HX3A 4LJ9A 1HNXM 2ZAOA 2AHMA 1DGHA 4P16A 3U6EA 4LY6A 4QOSA 5KQDA 2XF3A 3CGWA 2XLJA 4DV5M 1ZMUA 3GP1A 2EJSA 2VIIA 4OW0A 2K9DA 1IXRC 1NO1A 3FUXA 1L2CA 2CRUA 1QUSA 1QVRA 2XSZD 2LHCA 1D2NA 4MGYE 4JI7M 3ZH9B 4NXMM 3GLGE 2XGNA 1OFHA 4LGYA 4QHTA 4JI3M 4X66M 4YY3M 2OQ4A 4DV0M 1NNJA 1TH2A 1VEJA 2HHHM 5IT9S 4ANRA 3PXGA 2R6FA 3W0LB 4AG5A 1GJTA 2R4EA 2NQ8C 2H1RA 3JR4A 4B3RM 3FUUA 1VDLA 2C96A 3SARA 1V92A 3A45A 2QBYB 1NV9A 2FFJA 3KOZE 2CE7A 2C99A 3FTDA 4XBOA 2G8LA 4D82A 2R45A 1C7YA 1UM8A 4B7FA 1GABA 2ZANA 1N32M 3LCVB 1NHGC 5IREB 2K47A 3E21A 2R18A 4GITA 4DUYM 1TDZA 5L8RF 4AW4A 4LFCM 4LG2A 2BJWA 3NBXX 3PNYA 5ITRA 4G3OA 4FWGA 5EP4A 1V33A 3AFHA
chains in the Genus database with same CATH topology
3AOGA 2UXBM 1JQJC 1HT2E 3LQQA 3KOYE 1N34M 4NXNM 1L2BA 3TPZA 3GPYA 2UUAM 4FVMA 1XXHA 1J09A 2VQEM 3FTFA 2ZM6M 1SXJE 2D7HA 3E4RA 1SXJC 3CF2A 1Z6TA 1NJGA 4LF9M 4M9SA 4DV2M 4KODA 4HL4A 3T15A 2DWLA 4MGKE 2J7OA 2HL7A 3WHKA 3UZUA 4BBAA 2UXCM 4OX9M 3RGPA 2FOIC 3RGSA 2CHQA 4Z6YA 5JI3E 4QOZC 1Z5BA 5E26A 1N77A 3FKEA 4PD2A 4JXJA 3QWLA 4GKJM 3U61B 2L7HA 4JI8M 3GLIA 2F5NA 4XGIA 2YFQA 4DUZM 2CV2A 1G8PA 2CUZA 4MM3B 2Z4SA 4TUWA 2P5TA 3SFZA 4B3TM 3J7AS 3UJNA 3M6AA 2X4AA 4OVZB 4S12A 1XHBA 4MGZE 3A42A 3LQRA 4KO8A 5F3WA 4FW9A 2RKOA 3MK6A 4NRVA 1Q3BA 4CGYB 3GRUA 5FLXS 3AKZA 4NSOB 3EIEA 4LF8M 3IG8A 5DNYA 3DOAA 2I7PA 4IBKA 4GC5A 4LJ7A 2CV1A 1EE8A 3D8LA 4FWDA 3UK6A 5JI2E 3TQSA 2C9OA 2HCBA 3TWMA 2DZOB 4W5WA 1I4WA 1QQWA 1IY1A 3HU1A 3VK8A 4RNAA 3R9XB 2C5RA 1XMOM 1IM2A 1E32A 4IJEA 3J27B 2UUCM 3ILKA 5EP3A 2XH9A 4I5SA 3OTOM 2YR0A 4I4LA 2R62A 5GKNA 1HQCA 3GQ3A 4GHLA 1E94E 4LJAA 4B08A 3UMMA 5A2QS 2Z3XA 1YE9A 1N33M 4G4QA 2G5GX 4B7GA 2FE8A 2ZBKB 2QCUA 4AKHA 3KP1E 4X65M 3KS8A 3HJSA 1OJLA 4LCBA 4DV4M 4REZA 2X49A 4IBDA 4LZJA 2HKJA 3SBJA 1VDDA 5ITXE 3U6PA 4IJFA 3GLGA 4ITQA 5FTKA 4L78A 2C98A 1QAOA 3KDSE 3PFIA 2UXDM 1PJJA 1DGHB 1L8QA 4MGIE 3HU3A 4PT5A 2R65A 3LVWA 4Z8XA 3U6SA 1IN4A 4HLQA 3VK7A 3MHVC 5EQTA 3VDUA 3ZCBB 3GLHA 1L1TA 2F5SA 4YHHM 3L26A 2LNHC 3CTWB 1L1ZA 3TL4X 2XFTA 4D80A 2XSZA 5EXPA 4B3MM 4I81A 1QYRA 5EXTA 5EP1A 4B7HA 1NVMA 4OU7A 1IY2A 1Z5AA 2V6ZM 3MJ5A 1K3XA 1WXQA 3SASA 1G3IA 4IBEA 4AKIA 5ITUA 4IIWA 4RF0A 4BB9A 1IN5A 1L2DA 3J80S 1IBLM 4GC9A 1PM5A 1Q39A 5ITXA 2W82A 5ITYA 4DR6M 3VDPA 3GPUA 3FD9A 3GLHB 4DR1M 2D7EA 3SATA 3KFUG 4LFBM 1N36M 3K92A 1SXJD 3HU2A 3FUWA 1NY6A 2DHRA 5EXXA 1DGGA 3U6MA 1IBMM 2XFSA 2DVWB 2F5PA 4M0WA 3LVVA 2YQZA 2KW0A 3U6LA 2QENA 5EXSA 3GRYA 4JI5M 1K3WA 3U61A 4LJ5A 2DXIA 5DYGA 4DR5M 3KSJA 4LRSA 3SMSA 3KS4A 1ZQ9A 1XNQM 1IQPA 3KOXE 2Q2EB 2DWNA 4NL4H 3SHFA 3LMMA 5ITQA 1HT1E 4L15A 3FUVA 2BNKA 4X62M 1KFVA 3T38A 3HWSA 3GRVA 4QNMA 2LXEA 3A98B 3TWLA 5KO3A 1XXHB 1TH3A 4L16A 2LWXA 1R2YA 3I4VA 4GHAA 1R6BX 1Z5CA 3C58A 4AZFA 2Z4RA 2KRKA 3NWLA 3ZC7B 1FJGM 1KSFX 3SC3A 2RGHA 1IN6A 3TWKA 4AQYM 4M9XA 3HHZA 4DV6M 2O5RA 3U6OA 2DWZB 4CISA 2M60A 2Z7JA 1HR0M 4PDIA 4JYAM 4R7GA 3HGIA 3HHXA 1KYIA 2J7NA 3GLFB 3KSXA 3AOEA 2KZSA 5FTJA 2F5QA 4L8RC 2Y21A 2QBYA 4DR2M 2I7NA 3H4MA 2DWMA 3JR5A 1HQYE 8CATA 3U6DA 2F5OA 3SYLA 3SAVA 3HJQA 5ITTA 4JI6M 1X37A 2E5LM 1S3SA 4AG6A 3NBIA 4PDGA 1XNRM 1DO2A 1JR3A 2EO2A 2FNAA 3RFWA 4LF5M 2CV0A 2KZUA 3SHGB 3CF6E 1NJFA 3AL0C 4G6ZA 1NY5A 2V1CA 3GQ5A 5FTNA 1E9RA 4DV7M 4LZZA 1DGBA 3UGJA 4FCWA 5C1BA 1XWIA 1GKIA 4II7A 1HNWM 1QZMA 3KVWA 1JR3D 1TDHA 4FD2A 2LH0A 3WHLA 1IBKM 4KLNA 3FTEA 3A46A 3I4YA 4AKGA 3HKPA 4MB7A 4JI4M 4GMQA 4CHTB 1OFIA 4R3DA 3SAUA 1C1KA 2Y0TA 4K0KM 3IG5A 1IXZA 4OVZA 1QAQA 5FSWA 4G4NA 1Q3CA 1GL6A 1NSFA 4A3VB 4DR3M 3J7BA 1G4AE 1J7KA 3CF0A 1IN8A 3T1HM 4KHPM 3GLGB 1NHWC 2R46A 4NOOB 4AI6A 1DO0A 4D81A 1IXSB 1E9SA 4B3SM 1W5SA 4G4RA 1GL7A 3W0FA 1GVNA 4FCTA 2KEBA 2Y20A 5KPTA 4GKKM 1W5TA 2QZ4A 3PVSA 4GIPA 4FWHA 4LJ6A 3GRRA 4MH0E 4EIWA 1K82A 2UUBM 3J81S 3GO8A 2X8AA 2XEPA 2KA6B 4NRWA 4NSRA 2QP9X 2XZFA 3K1JA 4LJ8A 4JI1M 3FUTA 4IBGA 4M9ZA 3L27A 3FTCA 3U6QA 1QAMA 3SMPA 4DR4M 2QPAA 4DR7M 3PNVA 3HHYA 3J2PB 5BR8M 3GLFA 1J5EM 4G4OA 2L6OA 2ERCA 4WW0A 3AV0A 2CHVA 2D7GA 4QNRA 3SAWA 1HNZM 2ZAMA 4X64M 2R4JA 4LF4M 4JV5M 3VKGA 1GLNA 1YUBA 1SXJA 4LF7M 5LMUM 3JAMS 3M7GA 3L2AA 4BLCA 5H37D 4IBCA 3U6CA 3U5ZB 3EIHA 4LGMA 1LV7A 3AJIB 1XMQM 3B9PA 4RF1A 2BJVA 1R7RA 5FTMA 1IN7A 2EA0A 3DFZA 2M5ZA 4I8OA 2EUCA 4JI0M 5BPVA 3QAUA 3DZDA 4IBIA 4JI2M 3K8ZA 3HJ8A 3THGA 2C9CA 3R8FA 1N75A 5KPZA 3L29A 4DV3M 2V1UA 1I94M 1N78A 2KRUA 1H6UA 1QANA 3KP0E 3GPXA 4IBJA 4L4UA 5EP2A 2XZUA 3FYCA 1ORYB 3GPPA 3L28A 5EJCA 4M0DA 1TGUA 4GRIA 1R2ZA 7CATA 2Y0QA 3M0EA 3I51A 2YNMD 3D8BA 1YSYA 3E9SA 3BOSA 1ZAEA 3K2LA 1G59A 4LJ4A 5KPRA 2CFOA 4JN6A 4IBBA 5LMNM 1PJIA 1T3TA 2OPFA 1DGFA 1MU5A 4LFAM 3TE6A 3AOEC 3KOWE 2L7IA 2CHGA 2DZNB 4FCVA 1Z59A 3VLFB 5C18A 3VKHA 2CEAA 3GQ4A 1FNNA 3U60B 2F4VM 4QHSA 4LRTA 4PCZA 3KXEC 1SXJB 2UU9M 4ZPXA 3KW6A 3RE8A 2L09A 2VQFM 4DV1M 3GLIB 5IZ7D 3VFDA 5KQ8A 3Q8XA 1MX0A 4WURA 4IBFA 3U60A 1NNUC 4GH9A 5DYIA 3SYKA 1G41A 3HHWA 5E6JA 4LF6M 5IWAM 3T1YM 4MGHA 2RGOA 2A5YB 5FTLA 3U5ZA 1XC8A 3FYDA 3L25A 1IY0A 1TH4A 2JA2A 3DA1A 2KXEA 4LJ9A 1HNXM 2ZAOA 2AHMA 1DGHA 4P16A 3U6EA 4LY6A 4QOSA 5KQDA 2XF3A 2XLJA 4DV5M 3GP1A 4OW0A 2VIIA 1IXRC 3FUXA 1L2CA 1QVRA 2XSZD 1D2NA 4MGYE 4JI7M 3ZH9B 4NXMM 2XGNA 1OFHA 4LGYA 4QHTA 4JI3M 4X66M 4YY3M 2OQ4A 4DV0M 1NNJA 1TH2A 2HHHM 5IT9S 3PXGA 3W0LB 4AG5A 2R4EA 2NQ8C 2H1RA 3JR4A 4B3RM 3FUUA 2C96A 3SARA 3A45A 2QBYB 2FFJA 3KOZE 2CE7A 2C99A 3FTDA 4XBOA 2G8LA 4D82A 2R45A 1UM8A 4B7FA 2ZANA 1N32M 1NHGC 5IREB 2K47A 2R18A 4GITA 4DUYM 1TDZA 4AW4A 4LFCM 4LG2A 2BJWA 3PNYA 5ITRA 4FWGA 5EP4A 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1T A;  1I94 M;  2UXB M;  1N34 M;  4PDG A;  2F5S A;  1XNR M;  4NXN M;  4YHH M;  1L2B A;  3GPY A;  2UUA M;  3GPX A;  1L1Z A;  4LF5 M;  2VQE M;  2ZM6 M;  2XZU A;  4B3M M;  3GPP A;  3GQ5 A;  1R2Z A;  4DV7 M;  4LF9 M;  4DV2 M;  1Z5A A;  1K3X A;  5LMN M;  1PJI A;  4OX9 M;  2UXC M;  3SAS A;  1HNW M;  2OPF A;  5ITU A;  1MU5 A;  4LFA M;  1Z5B A;  1TDH A;  4PD2 A;  1L2D A;  1IBK M;  3J80 S;  1IBL M;  4GKJ M;  1Z59 A;  1PM5 A;  3GQ4 A;  3A46 A;  4JI8 M;  1Q39 A;  5ITX A;  2F4V M;  4MB7 A;  5ITY A;  2F5N A;  4DUZ M;  4JI4 M;  4DR6 M;  3GPU A;  3SAU A;  4PCZ A;  4K0K M;  4DR1 M;  3SAT A;  4B3T M;  4LFB M;  1N36 M;  3J7A S;  4G4N A;  1Q3C A;  2UU9 M;  3U6M A;  1IBM M;  2VQF M;  4DR3 M;  4DV1 M;  3A42 A;  2F5P A;  4NRV A;  1MX0 A;  3T1H M;  4KHP M;  1Q3B A;  5FLX S;  3U6L A;  4LF8 M;  4JI5 M;  1K3W A;  4B3S M;  3DOA A;  4G4R A;  4LF6 M;  3W0F A;  5IWA M;  3T1Y M;  4GKK M;  1EE8 A;  2UUB M;  1XC8 A;  1K82 A;  4DR5 M;  3J81 S;  3GO8 A;  3TWM A;  1HNX M;  1XNQ M;  4NRW A;  2XZF A;  2Q2E B;  4JI1 M;  3VK8 A;  3U6E A;  5ITQ A;  3U6Q A;  1KFV A;  4X62 M;  1XMO M;  4DV5 M;  3GP1 A;  2UUC M;  4DR4 M;  4DR7 M;  3TWL A;  1L2C A;  5BR8 M;  1J5E M;  4G4O A;  3OTO M;  1R2Y A;  3GQ3 A;  4JI7 M;  1Z5C A;  4NXM M;  3SAW A;  1HNZ M;  4LF4 M;  4X64 M;  3C58 A;  4YY3 M;  4JI3 M;  5A2Q S;  4DV0 M;  4X66 M;  2OQ4 A;  1NNJ A;  4JV5 M;  1N33 M;  5IT9 S;  2HHH M;  4G4Q A;  1FJG M;  4LF7 M;  2ZBK B;  3JR4 A;  3TWK A;  4B3R M;  5LMU M;  4AQY M;  3JAM S;  3SAR A;  4X65 M;  4DV6 M;  3A45 A;  3U6O A;  3U6C A;  4CIS A;  1HR0 M;  4PDI A;  4DV4 M;  4JYA M;  2HKJ A;  3SBJ A;  5ITX E;  3U6P A;  4ITQ A;  1XMQ M;  2F5Q A;  1N32 M;  4DR2 M;  2UXD M;  1PJJ A;  3JR5 A;  2EA0 A;  3U6D A;  4DUY M;  4JI0 M;  1TDZ A;  2F5O A;  3SAV A;  4JI2 M;  4JI6 M;  5ITT A;  3U6S A;  4LFC M;  2E5L M;  5ITR A;  3VK7 A;  4DV3 M; 
#chains in the Genus database with same CATH topology
 3AOG A;  1A5T A;  2UXB M;  1JQJ C;  1CUK A;  1HT2 E;  3KOY E;  3LQQ A;  1N34 M;  4NXN M;  1L2B A;  3TPZ A;  3GPY A;  2UUA M;  4FVM A;  2L2D A;  2R44 A;  1XXH A;  1J09 A;  3FE3 A;  2VQE M;  2ZM6 M;  3FTF A;  1SXJ E;  2D7H A;  3E4R A;  1SXJ C;  2O01 F;  3CF2 A;  1Z6T A;  1NJG A;  4LF9 M;  1OTR A;  3QYE A;  4M9S A;  4DV2 M;  4KOD A;  4HL4 A;  3T15 A;  2DWL A;  4MGK E;  1WIV A;  2J7O A;  2HL7 A;  3WHK A;  3UZU A;  4BBA A;  2JP7 A;  2UXC M;  2JXN A;  4OX9 M;  4WP2 A;  3RGP A;  4L6V 6;  2FOI C;  2OOB A;  3RGS A;  2CHQ A;  2JY7 A;  1T6O A;  1OAO C;  4Z6Y A;  3FRH A;  5JI3 E;  4QOZ C;  1Z5B A;  5E26 A;  4CJ6 A;  1N77 A;  3FKE A;  1GJS A;  4PD2 A;  4JXJ A;  3B7N A;  3QWL A;  4GKJ M;  3U61 B;  2DAM A;  2L7H A;  4JI8 M;  3BXW A;  2WSC F;  3GLI A;  2F5N A;  4XGI A;  2YFQ A;  2O25 A;  4DUZ M;  1QZE A;  2CV2 A;  1G8P A;  2CUZ A;  4MM3 B;  2Z4S A;  4TUW A;  2B3T A;  3LW5 F;  2P5T A;  3SFZ A;  4B3T M;  3J7A S;  3UJN A;  1T43 A;  3M6A A;  2X4A A;  4OVZ B;  4S12 A;  1XHB A;  4MGZ E;  3A42 A;  3LQR A;  2MGW A;  4KO8 A;  3K9O A;  4FW9 A;  5F3W A;  2RKO A;  3MK6 A;  4NRV A;  1Q3B A;  4CGY B;  3GRU A;  5FLX S;  3AKZ A;  4NSO B;  3EIE A;  4LF8 M;  2QHO B;  2QSF X;  3IG8 A;  5DNY A;  3DOA A;  4UN2 B;  2I7P A;  4IBK A;  1QUT A;  4GC5 A;  3B74 A;  4LJ7 A;  5DFL A;  2CV1 A;  1EE8 A;  2DAE A;  3D8L A;  4FWD A;  3UK6 A;  3ZQJ A;  5JI2 E;  3TQS A;  2C9O A;  2HCB A;  3TWM A;  2DZO B;  2MRO B;  4W5W A;  1I4W A;  1QQW A;  1IY1 A;  3HU1 A;  2OOA A;  3VK8 A;  3GLF E;  4RNA A;  3GLH E;  3R9X B;  2C5R A;  1XMO M;  1IM2 A;  1E32 A;  3MMP A;  4IJE A;  3J27 B;  2UUC M;  3B7Z A;  2DHY A;  3ILK A;  1VEK A;  5EP3 A;  2XH9 A;  4I5S A;  3OTO M;  2YR0 A;  4I4L A;  2R62 A;  5GKN A;  2JY6 B;  1HQC A;  3GQ3 A;  4GHL A;  1E94 E;  2VF7 A;  4LJA A;  4B08 A;  3UMM A;  5A2Q S;  2Z3X A;  1YE9 A;  2LVO C;  1N33 M;  4G4Q A;  2G5G X;  4B7G A;  2FE8 A;  2ZBK B;  2QCU A;  4AKH A;  3KP1 E;  4X65 M;  3KS8 A;  3HJS A;  1OJL A;  1R5L A;  4LCB A;  3T6P A;  1OIZ A;  4DV4 M;  4REZ A;  2X49 A;  2CWB A;  4IBD A;  2HKJ A;  4LZJ A;  1VDD A;  5ITX E;  3U6P A;  3SBJ A;  4IJF A;  3GLG A;  4ITQ A;  5FTK A;  4L78 A;  2C98 A;  1QAO A;  2VF8 A;  1R4G A;  3KDS E;  3PFI A;  2UXD M;  1PJJ A;  2ZTC A;  1DGH B;  1TTE A;  1L8Q A;  2EKK A;  4Q7J A;  4MGI E;  1WR1 B;  3HU3 A;  4PT5 A;  2R65 A;  3LVW A;  4Z8X A;  3U6S A;  1IN4 A;  4HLQ A;  2L4F A;  3V76 A;  3VK7 A;  3MHV C;  5EQT A;  2LVQ D;  3VDU A;  3GLH A;  3ZCB B;  1L1T A;  2JY8 A;  2F5S A;  1UFZ A;  4YHH M;  3L26 A;  2LNH C;  3CTW B;  1L1Z A;  3TL4 X;  2XFT A;  2JZ1 A;  4D80 A;  2XSZ A;  5EXP A;  4B3M M;  4I81 A;  1QYR A;  4RKU F;  5EXT A;  5EP1 A;  4B7H A;  1D0L A;  1NVM A;  4OU7 A;  1IY2 A;  1Z5A A;  2V6Z M;  3MJ5 A;  1K3X A;  1WXQ A;  3SAS A;  1G3I A;  2GQF A;  4IBE A;  4AKI A;  5ITU A;  4IIW A;  4RF0 A;  1WGL A;  4BB9 A;  2K0B X;  1IN5 A;  1D0M A;  1L2D A;  1ZMV A;  2DAG A;  2DEN A;  3J80 S;  1IBL M;  4GC9 A;  1PM5 A;  3B89 A;  1Q39 A;  5ITX A;  2JY5 A;  2W82 A;  5ITY A;  4DR6 M;  3VDP A;  3GPU A;  3FD9 A;  3GLH B;  4P17 A;  4DR1 M;  2D7E A;  3SAT A;  1VQ1 A;  2APL A;  2BWE A;  1N36 M;  3KFU G;  3K92 A;  1SXJ D;  4LFB M;  3HU2 A;  3FUW A;  1NY6 A;  1PJT A;  2DHR A;  1DGG A;  3HY5 A;  1PJS A;  5EXX A;  3U6M A;  1IBM M;  2XFS A;  4CIZ A;  1XXH E;  2LBC A;  2DVW B;  2F5P A;  4M0W A;  3LVV A;  2YQZ A;  2KW0 A;  3U6L A;  2QEN A;  5EXS A;  3GRY A;  4JI5 M;  1K3W A;  3U61 A;  3F92 A;  4LJ5 A;  2DXI A;  5DYG A;  4DR5 M;  3KSJ A;  2CP8 A;  2DZL A;  4LRS A;  1RU3 A;  3SMS A;  1TF0 B;  3KS4 A;  1ZQ9 A;  1XNQ M;  1IQP A;  3KOX E;  2HWJ A;  2Q2E B;  2DWN A;  4NL4 H;  3SHF A;  3B7Q A;  3LMM A;  5ITQ A;  1HT1 E;  2FH0 A;  3FUV A;  4L15 A;  2BNK A;  4X62 M;  1KFV A;  3T38 A;  3HWS A;  2N35 A;  3GRV A;  4QNM A;  2LXE A;  4F1I A;  3A98 B;  3TWL A;  5KO3 A;  4XK8 F;  1XXH B;  1TH3 A;  4L16 A;  2LWX A;  2HAK A;  1TR8 A;  2MJ5 B;  3IHP A;  3BBZ A;  3I4V A;  1R2Y A;  4GHA A;  1R6B X;  1Z5C A;  3H4J A;  2LVP C;  3C58 A;  4AZF A;  2LTU A;  2Z4R A;  2KRK A;  1DV0 A;  3NWL A;  3ZC7 B;  1FJG M;  4F2L A;  1KSF X;  3SC3 A;  2RGH A;  1IN6 A;  3TWK A;  2KDL A;  4AQY M;  4M9X A;  3HHZ A;  4DV6 M;  2O5R A;  3U6O A;  2DWZ B;  4CIS A;  2J5Y A;  2M60 A;  2Z7J A;  1HR0 M;  1Q02 A;  4PDI A;  4JYA M;  4R7G A;  3HGI A;  3HHX A;  3GPP A;  1KYI A;  2J7N A;  3GLF B;  3KSX A;  3AOE A;  4NC6 A;  2KZS A;  1AUA A;  3HZJ A;  5FTJ A;  4HEO A;  2F5Q A;  1PRB A;  4L8R C;  2Y21 A;  2QBY A;  4DR2 M;  2DNA A;  2I7N A;  3H4M A;  2DWM A;  2VDB B;  3JR5 A;  1HQY E;  8CAT A;  3U6D A;  1D0K A;  2F5O A;  2KHH A;  3SYL A;  3SAV A;  3HJQ A;  5ITT A;  4JI6 M;  1X37 A;  2E5L M;  2MR9 A;  1S3S A;  1PGY A;  4AG6 A;  3K9P A;  3NBI A;  4PDG A;  1XNR M;  1DO2 A;  1JR3 A;  2EO2 A;  1VEG A;  2FNA A;  3RFW A;  4LF5 M;  2CV0 A;  2KZU A;  2DAI A;  3CF6 E;  3SHG B;  1NJF A;  3AL0 C;  4G6Z A;  1NY5 A;  2V1C A;  3GQ5 A;  1XB2 B;  5FTN A;  1E9R A;  4DV7 M;  4LZZ A;  1DGB A;  3UGJ A;  1HJP A;  1IFY A;  3C3E A;  4FCW A;  1OKS A;  5C1B A;  1XWI A;  1GKI A;  4II7 A;  1HNW M;  3W68 A;  1QZM A;  3KVW A;  1JR3 D;  2FS1 A;  1TDH A;  4FD2 A;  2LH0 A;  2WSE F;  3WHL A;  1IBK M;  4KLN A;  1LTM A;  3FTE A;  3A46 A;  3I4Y A;  1Y8G A;  4AKG A;  3HKP A;  4MB7 A;  4JI4 M;  4GMQ A;  4CHT B;  1OFI A;  4R3D A;  3SAU A;  1C1K A;  2Y0T A;  4K0K M;  3IG5 A;  1IXZ A;  4OVZ A;  1QAQ A;  2KNV A;  5FSW A;  4G4N A;  1ZV1 A;  1Q3C A;  2LVA A;  1GL6 A;  1NSF A;  2LHG A;  4A3V B;  4DR3 M;  3J7B A;  1G4A E;  2DKL A;  1J7K A;  3CF0 A;  2KNA A;  1IN8 A;  3I04 M;  3T1H M;  3W67 A;  4KHP M;  3GLG B;  1NHW C;  2R46 A;  2G3Q A;  2ZTD A;  4NOO B;  4AI6 A;  1DO0 A;  4D81 A;  1IXS B;  1JB0 F;  1E9S A;  1YLA A;  4B3S M;  1W5S A;  1QDT A;  4G4R A;  1GL7 A;  3W0F A;  1GVN A;  4FCT A;  1MN3 A;  2KEB A;  2Y20 A;  5KPT A;  1W5T A;  4GKK M;  2QZ4 A;  3PVS A;  4GIP A;  4FWH A;  2BWB A;  3GRR A;  4LJ6 A;  4MH0 E;  4EIW A;  1K82 A;  2UUB M;  3J81 S;  3GO8 A;  2X8A A;  2XEP A;  2KA6 B;  4NRW A;  3I01 M;  2QP9 X;  4NSR A;  1VG5 A;  3K1J A;  2XZF A;  2JWS A;  4LJ8 A;  4JI1 M;  3FUT A;  4IBG A;  3IEC A;  4M9Z A;  3L27 A;  3FTC A;  2DI0 A;  2K6B A;  3U6Q A;  1QAM A;  3SMP A;  4Y28 F;  4DR4 M;  2QPA A;  4DR7 M;  3PNV A;  1IXS A;  3HHY A;  3J2P B;  5BR8 M;  3GLF A;  1J5E M;  4G4O A;  1EFU B;  2L6O A;  2ERC A;  4WW0 A;  3AV0 A;  2CHV A;  2JZ0 A;  2D7G A;  4QNR A;  3SAW A;  2OO9 A;  2ZAM A;  4X64 M;  2R4J A;  1HNZ M;  4LF4 M;  4JV5 M;  3FRI A;  3VKG A;  2RRU A;  1GLN A;  1YUB A;  1SXJ A;  4LF7 M;  5LMU M;  3JAM S;  3M7G A;  2WZJ A;  3L2A A;  4BLC A;  5H37 D;  4IBC A;  3U6C A;  3C3D A;  1V34 A;  3U5Z B;  2KNZ A;  3EIH A;  4LGM A;  2Z8Y M;  1LV7 A;  3AJI B;  1EIJ A;  1XMQ M;  2EKF A;  3B9P A;  4RF1 A;  1WGN A;  2WSF F;  3QYB A;  2BJV A;  1R7R A;  5FTM A;  1IN7 A;  1P3Q Q;  1PJQ A;  3E46 A;  3Q8G A;  2EA0 A;  3DFZ A;  2M5Z A;  4I8O A;  2EUC A;  4JI0 M;  5BPV A;  3QAU A;  3DZD A;  4IBI A;  4JI2 M;  3K8Z A;  3HJ8 A;  3THG A;  2C9C A;  3R8F A;  1N75 A;  5KPZ A;  3L29 A;  4DV3 M;  4KT0 F;  2V1U A;  1I94 M;  1QDR A;  1GO5 A;  1N78 A;  2KRU A;  1H6U A;  1QAN A;  3KP0 E;  3GPX A;  2QQ8 A;  4IBJ A;  4L4U A;  5EP2 A;  2XZU A;  2MH8 A;  3FYC A;  2R0I A;  1ORY B;  2QNJ A;  3L28 A;  5EJC A;  1OIP A;  4M0D A;  1SG9 A;  1TGU A;  1OQY A;  4GRI A;  1R2Z A;  7CAT A;  3GLI E;  2JUJ A;  2Y0Q A;  3M0E A;  3I51 A;  2YNM D;  3LCU A;  3D8B A;  1YSY A;  3E9S A;  3BOS A;  1ZAE A;  3K2L A;  3C9P A;  4LJ4 A;  1G59 A;  5KPR A;  2CFO A;  4JN6 A;  4IBB A;  5LMN M;  1PJI A;  1WJ7 A;  2H5X A;  1T3T A;  1ZMW A;  2OPF A;  1DGF A;  1MU5 A;  1JR3 E;  4LFA M;  3TE6 A;  3AOE C;  3KOW E;  2DAK A;  2L7I A;  1BVS A;  2CHG A;  2JNH A;  2DZN B;  4FCV A;  1Z59 A;  3VLF B;  5C18 A;  3VKH A;  2CEA A;  3GQ4 A;  1FNN A;  3U60 B;  2F4V M;  4QHS A;  4LRT A;  4PCZ A;  1AIP C;  4GEW A;  3KXE C;  1SXJ B;  2UU9 M;  4ZPX A;  3KW6 A;  3RE8 A;  2L09 A;  2VQF M;  1F4I A;  4DV1 M;  3GLI B;  5IZ7 D;  1OAI A;  3VFD A;  2LVN C;  5KQ8 A;  3Q8X A;  1MX0 A;  4WUR A;  4IBF A;  4DBG B;  1NNU C;  3U60 A;  4GH9 A;  5DYI A;  3SYK A;  1G41 A;  3HHW A;  5E6J A;  4R71 A;  4LF6 M;  5IWA M;  3T1Y M;  4MGH A;  2RGO A;  2A5Y B;  5FTL A;  3U5Z A;  2GNO A;  1G71 A;  1NV8 A;  2L4E A;  1XC8 A;  1WHC A;  3FYD A;  3L25 A;  1IY0 A;  1MJG M;  1TH4 A;  2JA2 A;  2KXE A;  3DA1 A;  3HX3 A;  4LJ9 A;  1HNX M;  2ZAO A;  2AHM A;  1DGH A;  4P16 A;  3U6E A;  4LY6 A;  4QOS A;  5KQD A;  2XF3 A;  3CGW A;  2XLJ A;  4DV5 M;  1ZMU A;  3GP1 A;  2EJS A;  2VII A;  4OW0 A;  2K9D A;  1IXR C;  1NO1 A;  3FUX A;  1L2C A;  2CRU A;  1QUS A;  1QVR A;  2XSZ D;  2LHC A;  1D2N A;  4MGY E;  4JI7 M;  3ZH9 B;  4NXM M;  3GLG E;  2XGN A;  1OFH A;  4LGY A;  4QHT A;  4JI3 M;  4X66 M;  4YY3 M;  2OQ4 A;  4DV0 M;  1NNJ A;  1TH2 A;  1VEJ A;  2HHH M;  5IT9 S;  4ANR A;  3PXG A;  2R6F A;  3W0L B;  4AG5 A;  1GJT A;  2R4E A;  2NQ8 C;  2H1R A;  3JR4 A;  4B3R M;  3FUU A;  1VDL A;  2C96 A;  3SAR A;  1V92 A;  3A45 A;  2QBY B;  1NV9 A;  2FFJ A;  3KOZ E;  2CE7 A;  2C99 A;  3FTD A;  4XBO A;  2G8L A;  4D82 A;  2R45 A;  1C7Y A;  1UM8 A;  4B7F A;  1GAB A;  2ZAN A;  1N32 M;  3LCV B;  1NHG C;  5IRE B;  2K47 A;  3E21 A;  2R18 A;  4GIT A;  4DUY M;  1TDZ A;  5L8R F;  4AW4 A;  4LFC M;  4LG2 A;  2BJW A;  3NBX X;  3PNY A;  5ITR A;  4G3O A;  4FWG A;  5EP4 A;  1V33 A;  3AFH A; 
#chains in the Genus database with same CATH homology
 3AOG A;  2UXB M;  1JQJ C;  1HT2 E;  3LQQ A;  3KOY E;  1N34 M;  4NXN M;  1L2B A;  3TPZ A;  3GPY A;  2UUA M;  4FVM A;  1XXH A;  1J09 A;  2VQE M;  3FTF A;  2ZM6 M;  1SXJ E;  2D7H A;  3E4R A;  1SXJ C;  3CF2 A;  1Z6T A;  1NJG A;  4LF9 M;  4M9S A;  4DV2 M;  4KOD A;  4HL4 A;  3T15 A;  2DWL A;  4MGK E;  2J7O A;  2HL7 A;  3WHK A;  3UZU A;  4BBA A;  2UXC M;  4OX9 M;  3RGP A;  2FOI C;  3RGS A;  2CHQ A;  4Z6Y A;  5JI3 E;  4QOZ C;  1Z5B A;  5E26 A;  1N77 A;  3FKE A;  4PD2 A;  4JXJ A;  3QWL A;  4GKJ M;  3U61 B;  2L7H A;  4JI8 M;  3GLI A;  2F5N A;  4XGI A;  2YFQ A;  4DUZ M;  2CV2 A;  1G8P A;  2CUZ A;  4MM3 B;  2Z4S A;  4TUW A;  2P5T A;  3SFZ A;  4B3T M;  3J7A S;  3UJN A;  3M6A A;  2X4A A;  4OVZ B;  4S12 A;  1XHB A;  4MGZ E;  3A42 A;  3LQR A;  4KO8 A;  5F3W A;  4FW9 A;  2RKO A;  3MK6 A;  4NRV A;  1Q3B A;  4CGY B;  3GRU A;  5FLX S;  3AKZ A;  4NSO B;  3EIE A;  4LF8 M;  3IG8 A;  5DNY A;  3DOA A;  2I7P A;  4IBK A;  4GC5 A;  4LJ7 A;  2CV1 A;  1EE8 A;  3D8L A;  4FWD A;  3UK6 A;  5JI2 E;  3TQS A;  2C9O A;  2HCB A;  3TWM A;  2DZO B;  4W5W A;  1I4W A;  1QQW A;  1IY1 A;  3HU1 A;  3VK8 A;  4RNA A;  3R9X B;  2C5R A;  1XMO M;  1IM2 A;  1E32 A;  4IJE A;  3J27 B;  2UUC M;  3ILK A;  5EP3 A;  2XH9 A;  4I5S A;  3OTO M;  2YR0 A;  4I4L A;  2R62 A;  5GKN A;  1HQC A;  3GQ3 A;  4GHL A;  1E94 E;  4LJA A;  4B08 A;  3UMM A;  5A2Q S;  2Z3X A;  1YE9 A;  1N33 M;  4G4Q A;  2G5G X;  4B7G A;  2FE8 A;  2ZBK B;  2QCU A;  4AKH A;  3KP1 E;  4X65 M;  3KS8 A;  3HJS A;  1OJL A;  4LCB A;  4DV4 M;  4REZ A;  2X49 A;  4IBD A;  4LZJ A;  2HKJ A;  3SBJ A;  1VDD A;  5ITX E;  3U6P A;  4IJF A;  3GLG A;  4ITQ A;  5FTK A;  4L78 A;  2C98 A;  1QAO A;  3KDS E;  3PFI A;  2UXD M;  1PJJ A;  1DGH B;  1L8Q A;  4MGI E;  3HU3 A;  4PT5 A;  2R65 A;  3LVW A;  4Z8X A;  3U6S A;  1IN4 A;  4HLQ A;  3VK7 A;  3MHV C;  5EQT A;  3VDU A;  3ZCB B;  3GLH A;  1L1T A;  2F5S A;  4YHH M;  3L26 A;  2LNH C;  3CTW B;  1L1Z A;  3TL4 X;  2XFT A;  4D80 A;  2XSZ A;  5EXP A;  4B3M M;  4I81 A;  1QYR A;  5EXT A;  5EP1 A;  4B7H A;  1NVM A;  4OU7 A;  1IY2 A;  1Z5A A;  2V6Z M;  3MJ5 A;  1K3X A;  1WXQ A;  3SAS A;  1G3I A;  4IBE A;  4AKI A;  5ITU A;  4IIW A;  4RF0 A;  4BB9 A;  1IN5 A;  1L2D A;  3J80 S;  1IBL M;  4GC9 A;  1PM5 A;  1Q39 A;  5ITX A;  2W82 A;  5ITY A;  4DR6 M;  3VDP A;  3GPU A;  3FD9 A;  3GLH B;  4DR1 M;  2D7E A;  3SAT A;  3KFU G;  4LFB M;  1N36 M;  3K92 A;  1SXJ D;  3HU2 A;  3FUW A;  1NY6 A;  2DHR A;  5EXX A;  1DGG A;  3U6M A;  1IBM M;  2XFS A;  2DVW B;  2F5P A;  4M0W A;  3LVV A;  2YQZ A;  2KW0 A;  3U6L A;  2QEN A;  5EXS A;  3GRY A;  4JI5 M;  1K3W A;  3U61 A;  4LJ5 A;  2DXI A;  5DYG A;  4DR5 M;  3KSJ A;  4LRS A;  3SMS A;  3KS4 A;  1ZQ9 A;  1XNQ M;  1IQP A;  3KOX E;  2Q2E B;  2DWN A;  4NL4 H;  3SHF A;  3LMM A;  5ITQ A;  1HT1 E;  4L15 A;  3FUV A;  2BNK A;  4X62 M;  1KFV A;  3T38 A;  3HWS A;  3GRV A;  4QNM A;  2LXE A;  3A98 B;  3TWL A;  5KO3 A;  1XXH B;  1TH3 A;  4L16 A;  2LWX A;  1R2Y A;  3I4V A;  4GHA A;  1R6B X;  1Z5C A;  3C58 A;  4AZF A;  2Z4R A;  2KRK A;  3NWL A;  3ZC7 B;  1FJG M;  1KSF X;  3SC3 A;  2RGH A;  1IN6 A;  3TWK A;  4AQY M;  4M9X A;  3HHZ A;  4DV6 M;  2O5R A;  3U6O A;  2DWZ B;  4CIS A;  2M60 A;  2Z7J A;  1HR0 M;  4PDI A;  4JYA M;  4R7G A;  3HGI A;  3HHX A;  1KYI A;  2J7N A;  3GLF B;  3KSX A;  3AOE A;  2KZS A;  5FTJ A;  2F5Q A;  4L8R C;  2Y21 A;  2QBY A;  4DR2 M;  2I7N A;  3H4M A;  2DWM A;  3JR5 A;  1HQY E;  8CAT A;  3U6D A;  2F5O A;  3SYL A;  3SAV A;  3HJQ A;  5ITT A;  4JI6 M;  1X37 A;  2E5L M;  1S3S A;  4AG6 A;  3NBI A;  4PDG A;  1XNR M;  1DO2 A;  1JR3 A;  2EO2 A;  2FNA A;  3RFW A;  4LF5 M;  2CV0 A;  2KZU A;  3SHG B;  3CF6 E;  1NJF A;  3AL0 C;  4G6Z A;  1NY5 A;  2V1C A;  3GQ5 A;  5FTN A;  1E9R A;  4DV7 M;  4LZZ A;  1DGB A;  3UGJ A;  4FCW A;  5C1B A;  1XWI A;  1GKI A;  4II7 A;  1HNW M;  1QZM A;  3KVW A;  1JR3 D;  1TDH A;  4FD2 A;  2LH0 A;  3WHL A;  1IBK M;  4KLN A;  3FTE A;  3A46 A;  3I4Y A;  4AKG A;  3HKP A;  4MB7 A;  4JI4 M;  4GMQ A;  4CHT B;  1OFI A;  4R3D A;  3SAU A;  1C1K A;  2Y0T A;  4K0K M;  3IG5 A;  1IXZ A;  4OVZ A;  1QAQ A;  5FSW A;  4G4N A;  1Q3C A;  1GL6 A;  1NSF A;  4A3V B;  4DR3 M;  3J7B A;  1G4A E;  1J7K A;  3CF0 A;  1IN8 A;  3T1H M;  4KHP M;  3GLG B;  1NHW C;  2R46 A;  4NOO B;  4AI6 A;  1DO0 A;  4D81 A;  1IXS B;  1E9S A;  4B3S M;  1W5S A;  4G4R A;  1GL7 A;  3W0F A;  1GVN A;  4FCT A;  2KEB A;  2Y20 A;  5KPT A;  4GKK M;  1W5T A;  2QZ4 A;  3PVS A;  4GIP A;  4FWH A;  4LJ6 A;  3GRR A;  4MH0 E;  4EIW A;  1K82 A;  2UUB M;  3J81 S;  3GO8 A;  2X8A A;  2XEP A;  2KA6 B;  4NRW A;  4NSR A;  2QP9 X;  2XZF A;  3K1J A;  4LJ8 A;  4JI1 M;  3FUT A;  4IBG A;  4M9Z A;  3L27 A;  3FTC A;  3U6Q A;  1QAM A;  3SMP A;  4DR4 M;  2QPA A;  4DR7 M;  3PNV A;  3HHY A;  3J2P B;  5BR8 M;  3GLF A;  1J5E M;  4G4O A;  2L6O A;  2ERC A;  4WW0 A;  3AV0 A;  2CHV A;  2D7G A;  4QNR A;  3SAW A;  1HNZ M;  2ZAM A;  4X64 M;  2R4J A;  4LF4 M;  4JV5 M;  3VKG A;  1GLN A;  1YUB A;  1SXJ A;  4LF7 M;  5LMU M;  3JAM S;  3M7G A;  3L2A A;  4BLC A;  5H37 D;  4IBC A;  3U6C A;  3U5Z B;  3EIH A;  4LGM A;  1LV7 A;  3AJI B;  1XMQ M;  3B9P A;  4RF1 A;  2BJV A;  1R7R A;  5FTM A;  1IN7 A;  2EA0 A;  3DFZ A;  2M5Z A;  4I8O A;  2EUC A;  4JI0 M;  5BPV A;  3QAU A;  3DZD A;  4IBI A;  4JI2 M;  3K8Z A;  3HJ8 A;  3THG A;  2C9C A;  3R8F A;  1N75 A;  5KPZ A;  3L29 A;  4DV3 M;  2V1U A;  1I94 M;  1N78 A;  2KRU A;  1H6U A;  1QAN A;  3KP0 E;  3GPX A;  4IBJ A;  4L4U A;  5EP2 A;  2XZU A;  3FYC A;  1ORY B;  3GPP A;  3L28 A;  5EJC A;  4M0D A;  1TGU A;  4GRI A;  1R2Z A;  7CAT A;  2Y0Q A;  3M0E A;  3I51 A;  2YNM D;  3D8B A;  1YSY A;  3E9S A;  3BOS A;  1ZAE A;  3K2L A;  1G59 A;  4LJ4 A;  5KPR A;  2CFO A;  4JN6 A;  4IBB A;  5LMN M;  1PJI A;  1T3T A;  2OPF A;  1DGF A;  1MU5 A;  4LFA M;  3TE6 A;  3AOE C;  3KOW E;  2L7I A;  2CHG A;  2DZN B;  4FCV A;  1Z59 A;  3VLF B;  5C18 A;  3VKH A;  2CEA A;  3GQ4 A;  1FNN A;  3U60 B;  2F4V M;  4QHS A;  4LRT A;  4PCZ A;  3KXE C;  1SXJ B;  2UU9 M;  4ZPX A;  3KW6 A;  3RE8 A;  2L09 A;  2VQF M;  4DV1 M;  3GLI B;  5IZ7 D;  3VFD A;  5KQ8 A;  3Q8X A;  1MX0 A;  4WUR A;  4IBF A;  3U60 A;  1NNU C;  4GH9 A;  5DYI A;  3SYK A;  1G41 A;  3HHW A;  5E6J A;  4LF6 M;  5IWA M;  3T1Y M;  4MGH A;  2RGO A;  2A5Y B;  5FTL A;  3U5Z A;  1XC8 A;  3FYD A;  3L25 A;  1IY0 A;  1TH4 A;  2JA2 A;  3DA1 A;  2KXE A;  4LJ9 A;  1HNX M;  2ZAO A;  2AHM A;  1DGH A;  4P16 A;  3U6E A;  4LY6 A;  4QOS A;  5KQD A;  2XF3 A;  2XLJ A;  4DV5 M;  3GP1 A;  4OW0 A;  2VII A;  1IXR C;  3FUX A;  1L2C A;  1QVR A;  2XSZ D;  1D2N A;  4MGY E;  4JI7 M;  3ZH9 B;  4NXM M;  2XGN A;  1OFH A;  4LGY A;  4QHT A;  4JI3 M;  4X66 M;  4YY3 M;  2OQ4 A;  4DV0 M;  1NNJ A;  1TH2 A;  2HHH M;  5IT9 S;  3PXG A;  3W0L B;  4AG5 A;  2R4E A;  2NQ8 C;  2H1R A;  3JR4 A;  4B3R M;  3FUU A;  2C96 A;  3SAR A;  3A45 A;  2QBY B;  2FFJ A;  3KOZ E;  2CE7 A;  2C99 A;  3FTD A;  4XBO A;  2G8L A;  4D82 A;  2R45 A;  1UM8 A;  4B7F A;  2ZAN A;  1N32 M;  1NHG C;  5IRE B;  2K47 A;  2R18 A;  4GIT A;  4DUY M;  1TDZ A;  4AW4 A;  4LFC M;  4LG2 A;  2BJW A;  3PNY A;  5ITR A;  4FWG A;  5EP4 A;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...