5IT9S

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 24
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5it9S01
1XNRM 1IBLM 3JR5A 2ZBKB 4DR6M 2XZUA 2E5LM 3VK8A 4YY3M 4JYAM 3GPPA 3GPYA 4G4NA 3SASA 4JI6M 1L1TA 4JV5M 3J80S 2UUAM 2HHHM 4LF6M 2OQ4A 4LFAM 4X66M 3U6DA 3GQ4A 4LF7M 4DR7M 4JI4M 1Q3BA 3U6EA 1XMQM 4G4OA 4LF5M 3JR4A 1N34M 3TWMA 5IT9S 1NNJA 2UUCM 2UXDM 1TDHA 2ZM6M 4PDIA 5ITYA 1HNXM 4X64M 4KHPM 4DV6M 1PJJA 1Z5AA 5ITQA 4DV7M 3J7AS 1N32M 4G4RA 4X65M 1N36M 4B3MM 4JI0M 1IBKM 3TWLA 1XMOM 4JI2M 1R2ZA 4JI5M 1N33M 3GPUA 5BR8M 3SARA 5ITUA 1MX0A 2VQEM 2Q2EB 1L1ZA 1Z5CA 3SATA 2F5QA 4NXMM 3T1YM 2UUBM 2UU9M 4DUZM 3C58A 4DV1M 3U6LA 3GP1A 1PM5A 4OX9M 4DR2M 4AQYM 4DV4M 1HR0M 4NRWA 4PCZA 1L2CA 5FLXS 1L2BA 3U6OA 1I94M 4LF9M 4YHHM 4DR1M 4PDGA 1K3WA 3U6QA 1MU5A 2HKJA 4DR3M 4G4QA 1L2DA 4LFBM 5IWAM 4ITQA 2F5OA 3SBJA 4B3TM 4X62M 1FJGM 3SAWA 4NXNM 4GKJM 5ITRA 3U6SA 3T1HM 2OPFA 2F5NA 4GKKM 4DV0M 3GO8A 1Q3CA 4B3RM 1Z5BA 4LF4M 3GPXA 3DOAA 5A2QS 2XZFA 2VQFM 5ITXA 1XC8A 3GQ3A 4DV5M 2UXCM 4PD2A 4K0KM 3SAUA 3A46A 3GQ5A 1Z59A 4DR5M 3A42A 4NRVA 4DUYM 2F5SA 4DV3M 4JI1M 2EA0A 3U6PA 4JI8M 4DR4M 3SAVA 5LMUM 1HNWM 1R2YA 1KFVA 1K82A 1Q39A 4LFCM 3J81S 4CISA 4DV2M 3W0FA 4B3SM 5LMNM 1HNZM 3OTOM 4JI7M 4JI3M 4LF8M 1TDZA 3A45A 1J5EM 2F5PA 3U6MA 1IBMM 3TWKA 5ITXE 4MB7A 5ITTA 3U6CA 3VK7A 1K3XA 1XNQM 2UXBM 3JAMS 2F4VM 1EE8A 1PJIA
chains in the Genus database with same CATH superfamily
5KPZA 1TR8A 1PGYA 3JR5A 5EXSA 1XXHE 1SXJE 1D0KA 1E9SA 4IIWA 3U60B 4FWDA 3A98B 3GPYA 3SASA 2QHOB 1YSYA 3WHKA 4JI6M 4JV5M 2UUAM 3R8FA 5E6JA 4LGYA 2G3QA 2VDBB 1UM8A 2CUZA 4GKJM 4X66M 2CRUA 4GC5A 1QAQA 4II7A 3GQ4A 4JI4M 1Q3BA 4M0DA 3GLGA 3K2LA 4MGKE 4LF5M 1D2NA 1KYIA 1TGUA 3GLIE 2XSZD 2CV2A 4CGYB 1IXSA 3HGIA 1VG5A 3HU1A 3KOYE 1Y8GA 4X64M 2Z3XA 4I81A 3I4YA 1Z5AA 1PJJA 1R5LA 3M7GA 4DV7M 1XWIA 2R18A 2QENA 3ZQJA 4AI6A 2WZJA 3Q8XA 1N75A 4JI0M 1DGFA 2EUCA 1XMOM 1NNUC 3VKHA 1OAIA 4JI2M 2DAMA 2DI0A 2FS1A 2JXNA 1MX0A 4LZJA 1NO1A 3SATA 2BWBA 2CV1A 4KLNA 3T6PA 2UU9M 3J7BA 3FTDA 2XGNA 2C9CA 1JR3D 3FYCA 2L09A 4LJ4A 3IECA 1OQYA 3GLGE 2ZTCA 4AQYM 2R62A 4DV4M 1W5SA 2CHVA 2I7NA 3AOEA 4M9ZA 2OOAA 4AKIA 3U6OA 1C1KA 3CF0A 2DAEA 1K3WA 2AHMA 2HKJA 4MGIE 2DAIA 1DGGA 2G5GX 2QNJA 4IJFA 2C96A 2F5OA 4B3TM 3EIEA 4IBBA 1R6BX 2DZNB 4NXNM 3B74A 2MJ5B 3U5ZB 4LRSA 4QHTA 4L4UA 3DFZA 3KSJA 2OPFA 3KFUG 4RKUF 4GH9A 2LVAA 1J09A 3KS4A 1IQPA 3GO8A 1Z5BA 1TH4A 5EXPA 2C9OA 4RF1A 1VEKA 2X4AA 5A2QS 4GHLA 3FUVA 3NBIA 3L2AA 4DV5M 2GQFA 2EJSA 1SXJC 2C99A 2JY6B 1ZAEA 2V1CA 5EXTA 3IG8A 4FWHA 1GJTA 2Z8YM 3KOWE 2Y0TA 3SAUA 3I01M 2NQ8C 2Z4SA 8CATA 3B7QA 1J7KA 4AZFA 1LV7A 2CHGA 5FTNA 2DVWB 3NBXX 4NSRA 2LVPC 4JI8M 4DR4M 1NHGC 2BJVA 2RRUA 2B3TA 3KP0E 5JI3E 5LMUM 3SAVA 3L25A 2L2DA 1VEJA 4BBAA 2DKLA 1KFVA 2KHHA 3GLHA 1QQWA 2H1RA 1WIVA 1IY0A 3ZH9B 5LMNM 1HNZM 1IY2A 1XB2B 3K92A 1LTMA 2XEPA 4Z8XA 4JI3M 4B7GA 2LNHC 5L8RF 2LVQD 3K9OA 4JXJA 3VK7A 4XBOA 3GRUA 2I7PA 1XNRM 1GABA 3I04M 1IBLM 3AFHA 1NJFA 1WJ7A 2JWSA 1OTRA 4GEWA 2ZBKB 2DWNA 2DZOB 4I8OA 2YR0A 1VEGA 4JYAM 2QBYB 3GPPA 2ZTDA 1L1TA 2R65A 1IN4A 3TL4X 3VFDA 1GLNA 3PVSA 1DGBA 1NJGA 3C3EA 3IG5A 4KO8A 1GJSA 4LF7M 4DR7M 3LW5F 5FTMA 1G4AE 3U6EA 1XMQM 1QUTA 1QYRA 1TH2A 4OW0A 4G4OA 1N34M 3TWMA 4CJ6A 3GLFA 1D0LA 4XK8F 3M6AA 1A5TA 4FCTA 2JY7A 2UXDM 4FWGA 5EP2A 3WHLA 3FRIA 4JN6A 4R3DA 5ITYA 1HNXM 4MH0E 4AKHA 3MMPA 1V92A 2VF7A 1ZMWA 4AKGA 2C5RA 1YLAA 2XF3A 3E9SA 4D80A 1BVSA 5BR8M 2OO9A 1GO5A 3SHGB 4BLCA 1FNNA 3UK6A 1ZV1A 1DGHA 5C18A 1OIZA 2M5ZA 5H37D 1T3TA 1N78A 2EO2A 4OVZA 4QHSA 4L15A 3C58A 3AJIB 2HCBA 3UZUA 2EKFA 3THGA 4OX9M 3MHVC 2EKKA 2X8AA 3PNYA 1V34A 1YUBA 3FYDA 3GLFE 1HR0M 5KPRA 5FLXS 2ZAMA 4LF9M 3PFIA 2HWJA 4PDGA 3NWLA 2XSZA 3TQSA 4G4QA 4GIPA 1L2DA 4LFBM 1OKSA 2J5YA 1VDLA 5IWAM 3SBJA 1FJGM 3KW6A 4X62M 5FSWA 3SAWA 4LGMA 3RGPA 1OFIA 4B7HA 4WURA 2CHQA 5KPTA 2YFQA 4LJ5A 5FTKA 4DBGB 5DNYA 2O01F 4NOOB 3U6SA 3LVWA 3HWSA 2KNAA 1WXQA 3HHYA 4MM3B 4D81A 3GPXA 4NC6A 2XZFA 2QP9X 1T43A 1RU3A 3ILKA 4KT0F 2VQFM 1XC8A 3GQ3A 2Z7JA 4F1IA 2UXCM 3K8ZA 2XLJA 2H5XA 1QZMA 4PD2A 3A46A 2VF8A 3GQ5A 1Z59A 1DO2A 4DR5M 2QCUA 2F5SA 3QYEA 4DV3M 3ZC7B 1AUAA 3SMPA 3CTWB 3FRHA 2V6ZM 4IBDA 4JI1M 1JR3A 3E4RA 5BPVA 1G8PA 2HAKA 2GNOA 3HHWA 1IN5A 4GHAA 2DNAA 2LH0A 3KOXE 2WSCF 1GVNA 2K47A 3KOZE 3AOGA 4R7GA 4D82A 2RKOA 3UJNA 1HQYE 1K82A 2QSFX 1I4WA 2APLA 2KEBA 2Y0QA 2CEAA 1UFZA 4LY6A 3CGWA 3J81S 3C9PA 4JI7M 4F2LA 2R6FA 3W0LB 3GRVA 1TDZA 2JZ1A 3A45A 4GMQA 5GKNA 2F5PA 5KQDA 4Z6YA 2RGHA 3TWKA 4MB7A 1PJSA 5ITTA 1K3XA 4DUYM 2VIIA 3GRRA 3HHXA 4LF4M 5C1BA 1QVRA 1GL6A 1OJLA 4DR6M 2R0IA 2E5LM 3MJ5A 2KDLA 3VK8A 4Q7JA 1WGLA 4G4NA 3KS8A 2KRUA 2KW0A 3L27A 1JR3E 5KQ8A 4LF6M 2OOBA 2OQ4A 3QWLA 4LFAM 3V76A 2DXIA 3FTCA 3U6DA 4FD2A 4TUWA 2YQZA 3U5ZA 4QOZC 4FCWA 5EP3A 5IT9S 1NNJA 1XXHB 1SXJB 1VDDA 4XGIA 2UUCM 2BWEA 3H4MA 1TDHA 2Z4RA 3KXEC 4G6ZA 1IFYA 1R4GA 4KHPM 1TH3A 3I4VA 5ITQA 3QAUA 4WW0A 4LJ8A 3J7AS 4G4RA 1N32M 1TTEA 3KP1E 1N36M 2KA6B 4B3MM 1IBKM 4CHTB 1NSFA 3BOSA 4HEOA 3U61B 3H4JA 3AL0C 3CF2A 1JQJC 3GLIB 1ZMUA 2FE8A 2XH9A 3GPUA 1R2ZA 3R9XB 1N33M 4IBKA 4MGHA 2J7NA 3FTEA 3B7ZA 3UMMA 5ITUA 2VQEM 2Q2EB 1Z5CA 2BNKA 3LCVB 1G71A 1SXJD 4NXMM 3T1YM 1PJQA 1E32A 2R45A 7CATA 2JY5A 2V1UA 4DR2M 3FUUA 3SYKA 3PXGA 4PCZA 4IBGA 1V33A 3VDUA 1L2BA 4FCVA 4AG6A 4YHHM 3FD9A 3FUXA 2CWBA 1MJGM 3C3DA 1NV8A 2KNZA 3TPZA 5DFLA 4RF0A 3F92A 2X49A 1MN3A 2L6OA 1G3IA 3HY5A 4M9SA 1QANA 4IJEA 4L78A 5ITRA 5F3WA 4RNAA 5EJCA 4IBCA 3DA1A 4UN2B 3GLGB 3D8BA 3B89A 2QBYA 4NSOB 5DYIA 1HT2E 4IBJA 2D7EA 2P5TA 4DV0M 4GC9A 2L4FA 2FFJA 2LHCA 1SG9A 3K1JA 4IBFA 3DOAA 4LZZA 4B3RM 1IXSB 2L7HA 5ITXA 3LQRA 4AW4A 2R46A 3FKEA 3SHFA 1GKIA 2W82A 2O25A 3AOEC 4K0KM 1PJTA 4IBEA 1H6UA 1KSFX 2CE7A 3B9PA 3D8LA 3KDSE 4IBIA 3A42A 5E26A 1IXRC 2RGOA 1S3SA 3GRYA 4EIWA 1F4IA 2EA0A 3U6PA 2MROB 4A3VB 2ZANA 4Y28F 1E9RA 1NY6A 1PRBA 4QNMA 3M0EA 1YE9A 4OU7A 3K9PA 2O5RA 1G41A 3E46A 1R2YA 1JB0F 1Q39A 4PT5A 2CP8A 4LFCM 2QZ4A 4CISA 4DV2M 5FTLA 2DWMA 4B3SM 3HX3A 3B7NA 1IM2A 2LXEA 4FW9A 4LJAA 3TE6A 4BB9A 3OTOM 2J7OA 4LCBA 3T38A 3HJSA 3KVWA 1J5EM 1ORYB 4MGYE 1QUSA 3HKPA 2Y20A 5ITXE 1QAOA 4R71A 1T6OA 1XNQM 3JAMS 5FTJA 2F4VM 2DENA 3QYBA 4QNRA 3VKGA 2XFSA 2XZUA 2DZLA 3SFZA 2WSFF 3MK6A 5JI2E 1DO0A 3PNVA 4YY3M 4L8RC 1EIJA 3J80S 1NY5A 1OFHA 2HHHM 2HL7A 3EIHA 3J27B 1WHCA 5EXXA 1DV0A 4S12A 3HJQA 3KSXA 4LJ7A 4B08A 4FVMA 2WSEF 1QAMA 3FUWA 3JR4A 3HU2A 2L7IA 3L28A 3FUTA 2JNHA 4PDIA 2ZM6M 2M60A 3ZCBB 2FNAA 2L4EA 3CF6E 1R7RA 5EP4A 4DV6M 3W67A 2N35A 4KODA 1ZMVA 4X65M 1HQCA 4ZPXA 1XHBA 2LVOC 3J2PB 3U60A 3TWLA 3T15A 4GITA 5KO3A 4LG2A 2MH8A 2A5YB 3DZDA 1IBMM 4L16A 3GLHB 4JI5M 2DWZB 4REZA 4GRIA 2JUJA 3SARA 4L6V6 3AKZA 4W5WA 3SC3A 1L1ZA 1E94E 2KNVA 3L26A 1ZQ9A 2R44A 2JA2A 1IN6A 2F5QA 1G59A 2DWLA 1IN7A 2KZUA 2UUBM 1IN8A 4DUZM 2LWXA 4LJ6A 1HJPA 1WR1B 4DV1M 4MGZE 3U6LA 3GP1A 1PM5A 1EFUB 2FOIC 3VDPA 2BJWA 4NRWA 4LRTA 3HHZA 1L2CA 1L8QA 4QOSA 1N77A 1Q02A 3LMMA 1I94M 3FE3A 4WP2A 2YNMD 1QDRA 3AV0A 4DR1M 3RE8A 3U6QA 1MU5A 3BXWA 4DR3M 2JY8A 4B7FA 3LCUA 2JP7A 2QPAA 2CV0A 1NVMA 1QDTA 2K9DA 4G3OA 4ITQA 2CFOA 1NHWC 2ERCA 2LVNC 3HJ8A 4I5SA 1CUKA 1HT1E 3UGJA 3T1HM 1GL7A 1QZEA 3GLFB 5DYGA 4AG5A 2F5NA 5EP1A 4GKKM 3VLFB 1Q3CA 1OIPA 2DHYA 2DAGA 5IZ7D 2D7HA 3W68A 3U6MA 2D7GA 2K0BX 2G8LA 3HZJA 3IHPA 2KRKA 3FTFA 1NV9A 1TF0B 4P16A 3E21A 2LTUA 5IREB 3BBZA 2KZSA 4P17A 1XXHA 1SXJA 1W5TA 1X37A 2QQ8A 3Q8GA 4NRVA 4HLQA 4NL4H 3SYLA 2DHRA 1C7YA 2FH0A 3L29A 1IXZA 4M0WA 5EQTA 1DGHB 2K6BA 3LVVA 1WGNA 1HNWM 4M9XA 2XFTA 4I4LA 3U61A 1IY1A 4OVZB 2R4EA 3I51A 3GLIA 4HL4A 3W0FA 2MGWA 3GLHE 3SMSA 2DAKA 4LJ9A 2ZAOA 2R4JA 4LF8M 2MR9A 2C98A 1D0MA 1VQ1A 3RFWA 2JZ0A 1AIPC 1P3QQ 1Z6TA 2LBCA 2Y21A 3HU3A 3RGSA 3LQQA 4CIZA 2LHGA 2KXEA 3U6CA 1OAOC 4ANRA 2UXBM 1EE8A 1PJIA
chains in the Genus database with same CATH topology
5KPZA 3JR5A 5EXSA 1SXJE 1E9SA 4IIWA 3U60B 4FWDA 3A98B 3GPYA 3SASA 4JI6M 1YSYA 3WHKA 4JV5M 2UUAM 3R8FA 5E6JA 4LGYA 1UM8A 2CUZA 4GKJM 4X66M 4GC5A 1QAQA 4II7A 3GQ4A 4JI4M 1Q3BA 4M0DA 3GLGA 3K2LA 4MGKE 4LF5M 1D2NA 1KYIA 1TGUA 2XSZD 2CV2A 4CGYB 3HGIA 3HU1A 3KOYE 4X64M 2Z3XA 4I81A 3I4YA 1Z5AA 1PJJA 3M7GA 4DV7M 1XWIA 2R18A 2QENA 4AI6A 3Q8XA 1N75A 4JI0M 1DGFA 2EUCA 1XMOM 1NNUC 3VKHA 4JI2M 1MX0A 4LZJA 3SATA 2CV1A 4KLNA 2UU9M 3J7BA 3FTDA 2XGNA 2C9CA 1JR3D 3FYCA 2L09A 4LJ4A 4AQYM 2R62A 4DV4M 1W5SA 2CHVA 2I7NA 3AOEA 4M9ZA 4AKIA 3U6OA 1C1KA 3CF0A 1K3WA 2AHMA 2HKJA 4MGIE 1DGGA 2G5GX 4IJFA 2C96A 2F5OA 4B3TM 3EIEA 4IBBA 1R6BX 2DZNB 4NXNM 3U5ZB 4LRSA 4QHTA 4L4UA 3DFZA 3KSJA 2OPFA 3KFUG 4GH9A 1J09A 3KS4A 1IQPA 3GO8A 1Z5BA 1TH4A 5EXPA 2C9OA 4RF1A 2X4AA 5A2QS 4GHLA 3FUVA 3NBIA 3L2AA 4DV5M 1SXJC 2C99A 5EXTA 1ZAEA 2V1CA 3IG8A 1EE8A 4FWHA 3SAUA 3KOWE 2Y0TA 2NQ8C 2Z4SA 8CATA 1J7KA 4AZFA 1LV7A 2CHGA 5FTNA 2DVWB 4NSRA 4JI8M 4DR4M 1NHGC 2BJVA 5LMUM 3SAVA 3KP0E 5JI3E 3L25A 4BBAA 1KFVA 3GLHA 1QQWA 2H1RA 1IY0A 3ZH9B 5LMNM 1HNZM 1IY2A 3K92A 4Z8XA 2XEPA 4B7GA 4JI3M 2LNHC 4JXJA 3VK7A 4XBOA 3GRUA 2I7PA 1XNRM 1IBLM 3AFHA 1NJFA 2ZBKB 2DWNA 2DZOB 4I8OA 2YR0A 4JYAM 2QBYB 3GPPA 1L1TA 2R65A 1IN4A 3TL4X 3VFDA 1GLNA 3PVSA 1DGBA 1NJGA 3IG5A 4KO8A 4LF7M 4DR7M 5FTMA 1G4AE 3U6EA 1XMQM 1TH2A 1QYRA 4OW0A 4G4OA 1N34M 3TWMA 3GLFA 3M6AA 4FCTA 2UXDM 4FWGA 5EP2A 3WHLA 4JN6A 4R3DA 5ITYA 1HNXM 4MH0E 4AKHA 4AKGA 2C5RA 2XF3A 3E9SA 4D80A 5BR8M 3SHGB 4BLCA 1FNNA 3UK6A 1DGHA 5C18A 2M5ZA 5H37D 1T3TA 1N78A 2EO2A 4OVZA 4QHSA 4L15A 3C58A 3AJIB 2HCBA 3UZUA 3THGA 4OX9M 3MHVC 2X8AA 3PNYA 1HR0M 1YUBA 3FYDA 5KPRA 5FLXS 2ZAMA 4LF9M 3PFIA 4PDGA 3NWLA 2XSZA 3TQSA 4G4QA 4GIPA 1L2DA 4LFBM 5IWAM 3SBJA 1FJGM 3KW6A 4X62M 5FSWA 3SAWA 4LGMA 3RGPA 1OFIA 4B7HA 4WURA 2CHQA 5KPTA 2YFQA 4LJ5A 5FTKA 5DNYA 3U6SA 4NOOB 3U60A 3LVWA 3HWSA 1WXQA 3HHYA 4MM3B 4D81A 3GPXA 2XZFA 2QP9X 3ILKA 2VQFM 1XC8A 3GQ3A 2Z7JA 2UXCM 3K8ZA 2XLJA 4PD2A 1QZMA 3A46A 3GQ5A 1Z59A 1DO2A 4DR5M 2QCUA 2F5SA 4DV3M 3ZC7B 3SMPA 3CTWB 4IBDA 2V6ZM 4JI1M 1JR3A 3E4RA 5BPVA 1G8PA 4GHAA 3HHWA 1IN5A 2LH0A 3KOXE 1GVNA 2K47A 3KOZE 3AOGA 4R7GA 4D82A 2RKOA 3UJNA 1HQYE 1K82A 1I4WA 2KEBA 2Y0QA 2CEAA 4LY6A 3J81S 4JI7M 3W0LB 3GRVA 1TDZA 3A45A 4GMQA 5GKNA 2F5PA 5KQDA 4Z6YA 2RGHA 3TWKA 4MB7A 5ITTA 1K3XA 4DUYM 2VIIA 3GRRA 3HHXA 4LF4M 5C1BA 1QVRA 1GL6A 1OJLA 4DR6M 2E5LM 3MJ5A 3VK8A 4G4NA 3KS8A 2KRUA 2KW0A 3L27A 4LF6M 5KQ8A 2OQ4A 3QWLA 4LFAM 2DXIA 3FTCA 3U6DA 4FD2A 4TUWA 2YQZA 3U5ZA 4QOZC 4FCWA 5EP3A 5IT9S 1NNJA 1XXHB 1SXJB 1VDDA 4XGIA 2UUCM 3H4MA 1TDHA 2Z4RA 3KXEC 4G6ZA 4KHPM 1TH3A 3I4VA 5ITQA 3QAUA 4WW0A 4LJ8A 3J7AS 4G4RA 1N32M 1N36M 3KP1E 4B3MM 2KA6B 1IBKM 4CHTB 1NSFA 3BOSA 3U61B 3AL0C 3CF2A 1JQJC 3GLIB 2FE8A 2XH9A 3GPUA 1R2ZA 3R9XB 1N33M 4IBKA 4MGHA 2J7NA 3FTEA 5ITUA 3UMMA 2VQEM 2Q2EB 1Z5CA 2BNKA 1SXJD 4NXMM 3T1YM 1E32A 2R45A 7CATA 2V1UA 4DR2M 3FUUA 3SYKA 3PXGA 4PCZA 4IBGA 3VDUA 1L2BA 4FCVA 4AG6A 4YHHM 3FD9A 3FUXA 3TPZA 4RF0A 2X49A 2L6OA 1G3IA 4M9SA 1QANA 4IJEA 4L78A 5ITRA 5F3WA 4RNAA 5EJCA 4IBCA 3DA1A 3GLGB 2QBYA 3D8BA 4NSOB 5DYIA 1HT2E 4IBJA 2D7EA 2P5TA 4DV0M 4GC9A 4B3RM 2FFJA 3K1JA 4IBFA 4LZZA 3DOAA 1IXSB 2L7HA 5ITXA 3LQRA 4AW4A 2R46A 3FKEA 3SHFA 1GKIA 2W82A 3AOEC 4K0KM 4IBEA 1H6UA 1KSFX 3B9PA 2CE7A 3KDSE 3D8LA 4IBIA 3A42A 5E26A 1IXRC 2RGOA 1S3SA 3GRYA 4EIWA 2EA0A 3U6PA 4A3VB 2ZANA 1E9RA 1NY6A 4OU7A 4QNMA 3M0EA 1YE9A 2O5RA 1G41A 1R2YA 1Q39A 4PT5A 4LFCM 2QZ4A 4CISA 4DV2M 5FTLA 2DWMA 4B3SM 4FW9A 1IM2A 2LXEA 4LJAA 4BB9A 3TE6A 3OTOM 2J7OA 4LCBA 3T38A 3HJSA 3KVWA 1J5EM 1ORYB 4MGYE 3HKPA 2Y20A 5ITXE 1QAOA 1XNQM 3JAMS 5FTJA 2F4VM 4QNRA 3VKGA 2XFSA 2XZUA 3SFZA 5JI2E 4YY3M 3MK6A 1DO0A 3PNVA 4L8RC 3J80S 1NY5A 1OFHA 2HHHM 2HL7A 3EIHA 3J27B 5EXXA 4S12A 3HJQA 3KSXA 4LJ7A 4B08A 4FVMA 1QAMA 3FUWA 3JR4A 3HU2A 2L7IA 3L28A 3FUTA 4PDIA 2ZM6M 2M60A 3ZCBB 2FNAA 3CF6E 5EP4A 1R7RA 4DV6M 4KODA 4X65M 1HQCA 4ZPXA 1XHBA 3J2PB 3TWLA 3T15A 4GITA 5KO3A 4LG2A 2A5YB 3DZDA 4L16A 3GLHB 4JI5M 2DWZB 4REZA 4GRIA 3SARA 3AKZA 4W5WA 3SC3A 1L1ZA 1E94E 3L26A 1ZQ9A 2JA2A 1IN6A 2F5QA 1G59A 2DWLA 1IN7A 2KZUA 2UUBM 1IN8A 4DUZM 2LWXA 4LJ6A 4DV1M 4MGZE 3U6LA 3GP1A 1PM5A 3VDPA 2FOIC 2BJWA 4NRWA 4LRTA 3HHZA 1L2CA 1L8QA 4QOSA 1N77A 3LMMA 1I94M 2YNMD 3AV0A 4DR1M 3RE8A 3U6QA 1MU5A 4DR3M 4B7FA 2QPAA 2CV0A 1NVMA 4ITQA 2CFOA 1NHWC 2ERCA 3HJ8A 4I5SA 1HT1E 3UGJA 3T1HM 1GL7A 3GLFB 5DYGA 4AG5A 2F5NA 5EP1A 4GKKM 3VLFB 1Q3CA 5IZ7D 2D7HA 2D7GA 2G8LA 2KRKA 3FTFA 4P16A 5IREB 2KZSA 1XXHA 1SXJA 1W5TA 1X37A 4NRVA 4HLQA 4NL4H 3SYLA 2DHRA 3L29A 1IXZA 4M0WA 5EQTA 1DGHB 3LVVA 1HNWM 4M9XA 2XFTA 4I4LA 3U61A 1IY1A 4OVZB 2R4EA 3I51A 3GLIA 4HL4A 3W0FA 3SMSA 4LJ9A 2ZAOA 2R4JA 4LF8M 2C98A 3RFWA 1Z6TA 3RGSA 3U6MA 1IBMM 3HU3A 3LQQA 3U6CA 2UXBM 2KXEA 2Y21A 1PJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR M;  1IBL M;  3JR5 A;  2ZBK B;  4DR6 M;  2XZU A;  2E5L M;  3VK8 A;  4YY3 M;  4JYA M;  3GPP A;  3GPY A;  4G4N A;  3SAS A;  4JI6 M;  1L1T A;  4JV5 M;  3J80 S;  2UUA M;  2HHH M;  4LF6 M;  2OQ4 A;  4LFA M;  4X66 M;  3U6D A;  3GQ4 A;  4LF7 M;  4DR7 M;  4JI4 M;  1Q3B A;  3U6E A;  1XMQ M;  4G4O A;  4LF5 M;  3JR4 A;  1N34 M;  3TWM A;  5IT9 S;  1NNJ A;  2UUC M;  2UXD M;  1TDH A;  2ZM6 M;  4PDI A;  5ITY A;  1HNX M;  4X64 M;  4KHP M;  4DV6 M;  1PJJ A;  1Z5A A;  5ITQ A;  4DV7 M;  3J7A S;  1N32 M;  4G4R A;  4X65 M;  1N36 M;  4B3M M;  4JI0 M;  1IBK M;  3TWL A;  1XMO M;  4JI2 M;  1R2Z A;  4JI5 M;  1N33 M;  3GPU A;  5BR8 M;  3SAR A;  5ITU A;  1MX0 A;  2VQE M;  2Q2E B;  1L1Z A;  1Z5C A;  3SAT A;  2F5Q A;  4NXM M;  3T1Y M;  2UUB M;  2UU9 M;  4DUZ M;  3C58 A;  4DV1 M;  3U6L A;  3GP1 A;  1PM5 A;  4OX9 M;  4DR2 M;  4AQY M;  4DV4 M;  1HR0 M;  4NRW A;  4PCZ A;  1L2C A;  5FLX S;  1L2B A;  3U6O A;  1I94 M;  4LF9 M;  4YHH M;  4DR1 M;  4PDG A;  1K3W A;  3U6Q A;  1MU5 A;  2HKJ A;  4DR3 M;  4G4Q A;  1L2D A;  4LFB M;  5IWA M;  4ITQ A;  2F5O A;  3SBJ A;  4B3T M;  4X62 M;  1FJG M;  3SAW A;  4NXN M;  4GKJ M;  5ITR A;  3U6S A;  3T1H M;  2OPF A;  2F5N A;  4GKK M;  4DV0 M;  3GO8 A;  1Q3C A;  4B3R M;  1Z5B A;  4LF4 M;  3GPX A;  3DOA A;  5A2Q S;  2XZF A;  2VQF M;  5ITX A;  1XC8 A;  3GQ3 A;  4DV5 M;  2UXC M;  4PD2 A;  4K0K M;  3SAU A;  3A46 A;  3GQ5 A;  1Z59 A;  4DR5 M;  3A42 A;  4NRV A;  4DUY M;  2F5S A;  4DV3 M;  4JI1 M;  2EA0 A;  3U6P A;  4JI8 M;  4DR4 M;  3SAV A;  5LMU M;  1HNW M;  1R2Y A;  1KFV A;  1K82 A;  1Q39 A;  4LFC M;  3J81 S;  4CIS A;  4DV2 M;  3W0F A;  4B3S M;  5LMN M;  1HNZ M;  3OTO M;  4JI7 M;  4JI3 M;  4LF8 M;  1TDZ A;  3A45 A;  1J5E M;  2F5P A;  3U6M A;  1IBM M;  3TWK A;  5ITX E;  4MB7 A;  5ITT A;  3U6C A;  3VK7 A;  1K3X A;  1XNQ M;  2UXB M;  3JAM S;  2F4V M;  1EE8 A;  1PJI A; 
#chains in the Genus database with same CATH topology
 5KPZ A;  1TR8 A;  1PGY A;  3JR5 A;  5EXS A;  1XXH E;  1SXJ E;  1D0K A;  1E9S A;  4IIW A;  3U60 B;  4FWD A;  3A98 B;  3GPY A;  3SAS A;  2QHO B;  1YSY A;  3WHK A;  4JI6 M;  4JV5 M;  2UUA M;  3R8F A;  5E6J A;  4LGY A;  2G3Q A;  2VDB B;  1UM8 A;  2CUZ A;  4GKJ M;  4X66 M;  2CRU A;  4GC5 A;  1QAQ A;  4II7 A;  3GQ4 A;  4JI4 M;  1Q3B A;  4M0D A;  3GLG A;  3K2L A;  4MGK E;  4LF5 M;  1D2N A;  1KYI A;  1TGU A;  3GLI E;  2XSZ D;  2CV2 A;  4CGY B;  1IXS A;  3HGI A;  1VG5 A;  3HU1 A;  3KOY E;  1Y8G A;  4X64 M;  2Z3X A;  4I81 A;  3I4Y A;  1Z5A A;  1PJJ A;  1R5L A;  3M7G A;  4DV7 M;  1XWI A;  2R18 A;  2QEN A;  3ZQJ A;  4AI6 A;  2WZJ A;  3Q8X A;  1N75 A;  4JI0 M;  1DGF A;  2EUC A;  1XMO M;  1NNU C;  3VKH A;  1OAI A;  4JI2 M;  2DAM A;  2DI0 A;  2FS1 A;  2JXN A;  1MX0 A;  4LZJ A;  1NO1 A;  3SAT A;  2BWB A;  2CV1 A;  4KLN A;  3T6P A;  2UU9 M;  3J7B A;  3FTD A;  2XGN A;  2C9C A;  1JR3 D;  3FYC A;  2L09 A;  4LJ4 A;  3IEC A;  1OQY A;  3GLG E;  2ZTC A;  4AQY M;  2R62 A;  4DV4 M;  1W5S A;  2CHV A;  2I7N A;  3AOE A;  4M9Z A;  2OOA A;  4AKI A;  3U6O A;  1C1K A;  3CF0 A;  2DAE A;  1K3W A;  2AHM A;  2HKJ A;  4MGI E;  2DAI A;  1DGG A;  2G5G X;  2QNJ A;  4IJF A;  2C96 A;  2F5O A;  4B3T M;  3EIE A;  4IBB A;  1R6B X;  2DZN B;  4NXN M;  3B74 A;  2MJ5 B;  3U5Z B;  4LRS A;  4QHT A;  4L4U A;  3DFZ A;  3KSJ A;  2OPF A;  3KFU G;  4RKU F;  4GH9 A;  2LVA A;  1J09 A;  3KS4 A;  1IQP A;  3GO8 A;  1Z5B A;  1TH4 A;  5EXP A;  2C9O A;  4RF1 A;  1VEK A;  2X4A A;  5A2Q S;  4GHL A;  3FUV A;  3NBI A;  3L2A A;  4DV5 M;  2GQF A;  2EJS A;  1SXJ C;  2C99 A;  2JY6 B;  1ZAE A;  2V1C A;  5EXT A;  3IG8 A;  4FWH A;  1GJT A;  2Z8Y M;  3KOW E;  2Y0T A;  3SAU A;  3I01 M;  2NQ8 C;  2Z4S A;  8CAT A;  3B7Q A;  1J7K A;  4AZF A;  1LV7 A;  2CHG A;  5FTN A;  2DVW B;  3NBX X;  4NSR A;  2LVP C;  4JI8 M;  4DR4 M;  1NHG C;  2BJV A;  2RRU A;  2B3T A;  3KP0 E;  5JI3 E;  5LMU M;  3SAV A;  3L25 A;  2L2D A;  1VEJ A;  4BBA A;  2DKL A;  1KFV A;  2KHH A;  3GLH A;  1QQW A;  2H1R A;  1WIV A;  1IY0 A;  3ZH9 B;  5LMN M;  1HNZ M;  1IY2 A;  1XB2 B;  3K92 A;  1LTM A;  2XEP A;  4Z8X A;  4JI3 M;  4B7G A;  2LNH C;  5L8R F;  2LVQ D;  3K9O A;  4JXJ A;  3VK7 A;  4XBO A;  3GRU A;  2I7P A;  1XNR M;  1GAB A;  3I04 M;  1IBL M;  3AFH A;  1NJF A;  1WJ7 A;  2JWS A;  1OTR A;  4GEW A;  2ZBK B;  2DWN A;  2DZO B;  4I8O A;  2YR0 A;  1VEG A;  4JYA M;  2QBY B;  3GPP A;  2ZTD A;  1L1T A;  2R65 A;  1IN4 A;  3TL4 X;  3VFD A;  1GLN A;  3PVS A;  1DGB A;  1NJG A;  3C3E A;  3IG5 A;  4KO8 A;  1GJS A;  4LF7 M;  4DR7 M;  3LW5 F;  5FTM A;  1G4A E;  3U6E A;  1XMQ M;  1QUT A;  1QYR A;  1TH2 A;  4OW0 A;  4G4O A;  1N34 M;  3TWM A;  4CJ6 A;  3GLF A;  1D0L A;  4XK8 F;  3M6A A;  1A5T A;  4FCT A;  2JY7 A;  2UXD M;  4FWG A;  5EP2 A;  3WHL A;  3FRI A;  4JN6 A;  4R3D A;  5ITY A;  1HNX M;  4MH0 E;  4AKH A;  3MMP A;  1V92 A;  2VF7 A;  1ZMW A;  4AKG A;  2C5R A;  1YLA A;  2XF3 A;  3E9S A;  4D80 A;  1BVS A;  5BR8 M;  2OO9 A;  1GO5 A;  3SHG B;  4BLC A;  1FNN A;  3UK6 A;  1ZV1 A;  1DGH A;  5C18 A;  1OIZ A;  2M5Z A;  5H37 D;  1T3T A;  1N78 A;  2EO2 A;  4OVZ A;  4QHS A;  4L15 A;  3C58 A;  3AJI B;  2HCB A;  3UZU A;  2EKF A;  3THG A;  4OX9 M;  3MHV C;  2EKK A;  2X8A A;  3PNY A;  1V34 A;  1YUB A;  3FYD A;  3GLF E;  1HR0 M;  5KPR A;  5FLX S;  2ZAM A;  4LF9 M;  3PFI A;  2HWJ A;  4PDG A;  3NWL A;  2XSZ A;  3TQS A;  4G4Q A;  4GIP A;  1L2D A;  4LFB M;  1OKS A;  2J5Y A;  1VDL A;  5IWA M;  3SBJ A;  1FJG M;  3KW6 A;  4X62 M;  5FSW A;  3SAW A;  4LGM A;  3RGP A;  1OFI A;  4B7H A;  4WUR A;  2CHQ A;  5KPT A;  2YFQ A;  4LJ5 A;  5FTK A;  4DBG B;  5DNY A;  2O01 F;  4NOO B;  3U6S A;  3LVW A;  3HWS A;  2KNA A;  1WXQ A;  3HHY A;  4MM3 B;  4D81 A;  3GPX A;  4NC6 A;  2XZF A;  2QP9 X;  1T43 A;  1RU3 A;  3ILK A;  4KT0 F;  2VQF M;  1XC8 A;  3GQ3 A;  2Z7J A;  4F1I A;  2UXC M;  3K8Z A;  2XLJ A;  2H5X A;  1QZM A;  4PD2 A;  3A46 A;  2VF8 A;  3GQ5 A;  1Z59 A;  1DO2 A;  4DR5 M;  2QCU A;  2F5S A;  3QYE A;  4DV3 M;  3ZC7 B;  1AUA A;  3SMP A;  3CTW B;  3FRH A;  2V6Z M;  4IBD A;  4JI1 M;  1JR3 A;  3E4R A;  5BPV A;  1G8P A;  2HAK A;  2GNO A;  3HHW A;  1IN5 A;  4GHA A;  2DNA A;  2LH0 A;  3KOX E;  2WSC F;  1GVN A;  2K47 A;  3KOZ E;  3AOG A;  4R7G A;  4D82 A;  2RKO A;  3UJN A;  1HQY E;  1K82 A;  2QSF X;  1I4W A;  2APL A;  2KEB A;  2Y0Q A;  2CEA A;  1UFZ A;  4LY6 A;  3CGW A;  3J81 S;  3C9P A;  4JI7 M;  4F2L A;  2R6F A;  3W0L B;  3GRV A;  1TDZ A;  2JZ1 A;  3A45 A;  4GMQ A;  5GKN A;  2F5P A;  5KQD A;  4Z6Y A;  2RGH A;  3TWK A;  4MB7 A;  1PJS A;  5ITT A;  1K3X A;  4DUY M;  2VII A;  3GRR A;  3HHX A;  4LF4 M;  5C1B A;  1QVR A;  1GL6 A;  1OJL A;  4DR6 M;  2R0I A;  2E5L M;  3MJ5 A;  2KDL A;  3VK8 A;  4Q7J A;  1WGL A;  4G4N A;  3KS8 A;  2KRU A;  2KW0 A;  3L27 A;  1JR3 E;  5KQ8 A;  4LF6 M;  2OOB A;  2OQ4 A;  3QWL A;  4LFA M;  3V76 A;  2DXI A;  3FTC A;  3U6D A;  4FD2 A;  4TUW A;  2YQZ A;  3U5Z A;  4QOZ C;  4FCW A;  5EP3 A;  5IT9 S;  1NNJ A;  1XXH B;  1SXJ B;  1VDD A;  4XGI A;  2UUC M;  2BWE A;  3H4M A;  1TDH A;  2Z4R A;  3KXE C;  4G6Z A;  1IFY A;  1R4G A;  4KHP M;  1TH3 A;  3I4V A;  5ITQ A;  3QAU A;  4WW0 A;  4LJ8 A;  3J7A S;  4G4R A;  1N32 M;  1TTE A;  3KP1 E;  1N36 M;  2KA6 B;  4B3M M;  1IBK M;  4CHT B;  1NSF A;  3BOS A;  4HEO A;  3U61 B;  3H4J A;  3AL0 C;  3CF2 A;  1JQJ C;  3GLI B;  1ZMU A;  2FE8 A;  2XH9 A;  3GPU A;  1R2Z A;  3R9X B;  1N33 M;  4IBK A;  4MGH A;  2J7N A;  3FTE A;  3B7Z A;  3UMM A;  5ITU A;  2VQE M;  2Q2E B;  1Z5C A;  2BNK A;  3LCV B;  1G71 A;  1SXJ D;  4NXM M;  3T1Y M;  1PJQ A;  1E32 A;  2R45 A;  7CAT A;  2JY5 A;  2V1U A;  4DR2 M;  3FUU A;  3SYK A;  3PXG A;  4PCZ A;  4IBG A;  1V33 A;  3VDU A;  1L2B A;  4FCV A;  4AG6 A;  4YHH M;  3FD9 A;  3FUX A;  2CWB A;  1MJG M;  3C3D A;  1NV8 A;  2KNZ A;  3TPZ A;  5DFL A;  4RF0 A;  3F92 A;  2X49 A;  1MN3 A;  2L6O A;  1G3I A;  3HY5 A;  4M9S A;  1QAN A;  4IJE A;  4L78 A;  5ITR A;  5F3W A;  4RNA A;  5EJC A;  4IBC A;  3DA1 A;  4UN2 B;  3GLG B;  3D8B A;  3B89 A;  2QBY A;  4NSO B;  5DYI A;  1HT2 E;  4IBJ A;  2D7E A;  2P5T A;  4DV0 M;  4GC9 A;  2L4F A;  2FFJ A;  2LHC A;  1SG9 A;  3K1J A;  4IBF A;  3DOA A;  4LZZ A;  4B3R M;  1IXS B;  2L7H A;  5ITX A;  3LQR A;  4AW4 A;  2R46 A;  3FKE A;  3SHF A;  1GKI A;  2W82 A;  2O25 A;  3AOE C;  4K0K M;  1PJT A;  4IBE A;  1H6U A;  1KSF X;  2CE7 A;  3B9P A;  3D8L A;  3KDS E;  4IBI A;  3A42 A;  5E26 A;  1IXR C;  2RGO A;  1S3S A;  3GRY A;  4EIW A;  1F4I A;  2EA0 A;  3U6P A;  2MRO B;  4A3V B;  2ZAN A;  4Y28 F;  1E9R A;  1NY6 A;  1PRB A;  4QNM A;  3M0E A;  1YE9 A;  4OU7 A;  3K9P A;  2O5R A;  1G41 A;  3E46 A;  1R2Y A;  1JB0 F;  1Q39 A;  4PT5 A;  2CP8 A;  4LFC M;  2QZ4 A;  4CIS A;  4DV2 M;  5FTL A;  2DWM A;  4B3S M;  3HX3 A;  3B7N A;  1IM2 A;  2LXE A;  4FW9 A;  4LJA A;  3TE6 A;  4BB9 A;  3OTO M;  2J7O A;  4LCB A;  3T38 A;  3HJS A;  3KVW A;  1J5E M;  1ORY B;  4MGY E;  1QUS A;  3HKP A;  2Y20 A;  5ITX E;  1QAO A;  4R71 A;  1T6O A;  1XNQ M;  3JAM S;  5FTJ A;  2F4V M;  2DEN A;  3QYB A;  4QNR A;  3VKG A;  2XFS A;  2XZU A;  2DZL A;  3SFZ A;  2WSF F;  3MK6 A;  5JI2 E;  1DO0 A;  3PNV A;  4YY3 M;  4L8R C;  1EIJ A;  3J80 S;  1NY5 A;  1OFH A;  2HHH M;  2HL7 A;  3EIH A;  3J27 B;  1WHC A;  5EXX A;  1DV0 A;  4S12 A;  3HJQ A;  3KSX A;  4LJ7 A;  4B08 A;  4FVM A;  2WSE F;  1QAM A;  3FUW A;  3JR4 A;  3HU2 A;  2L7I A;  3L28 A;  3FUT A;  2JNH A;  4PDI A;  2ZM6 M;  2M60 A;  3ZCB B;  2FNA A;  2L4E A;  3CF6 E;  1R7R A;  5EP4 A;  4DV6 M;  3W67 A;  2N35 A;  4KOD A;  1ZMV A;  4X65 M;  1HQC A;  4ZPX A;  1XHB A;  2LVO C;  3J2P B;  3U60 A;  3TWL A;  3T15 A;  4GIT A;  5KO3 A;  4LG2 A;  2MH8 A;  2A5Y B;  3DZD A;  1IBM M;  4L16 A;  3GLH B;  4JI5 M;  2DWZ B;  4REZ A;  4GRI A;  2JUJ A;  3SAR A;  4L6V 6;  3AKZ A;  4W5W A;  3SC3 A;  1L1Z A;  1E94 E;  2KNV A;  3L26 A;  1ZQ9 A;  2R44 A;  2JA2 A;  1IN6 A;  2F5Q A;  1G59 A;  2DWL A;  1IN7 A;  2KZU A;  2UUB M;  1IN8 A;  4DUZ M;  2LWX A;  4LJ6 A;  1HJP A;  1WR1 B;  4DV1 M;  4MGZ E;  3U6L A;  3GP1 A;  1PM5 A;  1EFU B;  2FOI C;  3VDP A;  2BJW A;  4NRW A;  4LRT A;  3HHZ A;  1L2C A;  1L8Q A;  4QOS A;  1N77 A;  1Q02 A;  3LMM A;  1I94 M;  3FE3 A;  4WP2 A;  2YNM D;  1QDR A;  3AV0 A;  4DR1 M;  3RE8 A;  3U6Q A;  1MU5 A;  3BXW A;  4DR3 M;  2JY8 A;  4B7F A;  3LCU A;  2JP7 A;  2QPA A;  2CV0 A;  1NVM A;  1QDT A;  2K9D A;  4G3O A;  4ITQ A;  2CFO A;  1NHW C;  2ERC A;  2LVN C;  3HJ8 A;  4I5S A;  1CUK A;  1HT1 E;  3UGJ A;  3T1H M;  1GL7 A;  1QZE A;  3GLF B;  5DYG A;  4AG5 A;  2F5N A;  5EP1 A;  4GKK M;  3VLF B;  1Q3C A;  1OIP A;  2DHY A;  2DAG A;  5IZ7 D;  2D7H A;  3W68 A;  3U6M A;  2D7G A;  2K0B X;  2G8L A;  3HZJ A;  3IHP A;  2KRK A;  3FTF A;  1NV9 A;  1TF0 B;  4P16 A;  3E21 A;  2LTU A;  5IRE B;  3BBZ A;  2KZS A;  4P17 A;  1XXH A;  1SXJ A;  1W5T A;  1X37 A;  2QQ8 A;  3Q8G A;  4NRV A;  4HLQ A;  4NL4 H;  3SYL A;  2DHR A;  1C7Y A;  2FH0 A;  3L29 A;  1IXZ A;  4M0W A;  5EQT A;  1DGH B;  2K6B A;  3LVV A;  1WGN A;  1HNW M;  4M9X A;  2XFT A;  4I4L A;  3U61 A;  1IY1 A;  4OVZ B;  2R4E A;  3I51 A;  3GLI A;  4HL4 A;  3W0F A;  2MGW A;  3GLH E;  3SMS A;  2DAK A;  4LJ9 A;  2ZAO A;  2R4J A;  4LF8 M;  2MR9 A;  2C98 A;  1D0M A;  1VQ1 A;  3RFW A;  2JZ0 A;  1AIP C;  1P3Q Q;  1Z6T A;  2LBC A;  2Y21 A;  3HU3 A;  3RGS A;  3LQQ A;  4CIZ A;  2LHG A;  2KXE A;  3U6C A;  1OAO C;  4ANR A;  2UXB M;  1EE8 A;  1PJI A; 
#chains in the Genus database with same CATH homology
 5KPZ A;  3JR5 A;  5EXS A;  1SXJ E;  1E9S A;  4IIW A;  3U60 B;  4FWD A;  3A98 B;  3GPY A;  3SAS A;  4JI6 M;  1YSY A;  3WHK A;  4JV5 M;  2UUA M;  3R8F A;  5E6J A;  4LGY A;  1UM8 A;  2CUZ A;  4GKJ M;  4X66 M;  4GC5 A;  1QAQ A;  4II7 A;  3GQ4 A;  4JI4 M;  1Q3B A;  4M0D A;  3GLG A;  3K2L A;  4MGK E;  4LF5 M;  1D2N A;  1KYI A;  1TGU A;  2XSZ D;  2CV2 A;  4CGY B;  3HGI A;  3HU1 A;  3KOY E;  4X64 M;  2Z3X A;  4I81 A;  3I4Y A;  1Z5A A;  1PJJ A;  3M7G A;  4DV7 M;  1XWI A;  2R18 A;  2QEN A;  4AI6 A;  3Q8X A;  1N75 A;  4JI0 M;  1DGF A;  2EUC A;  1XMO M;  1NNU C;  3VKH A;  4JI2 M;  1MX0 A;  4LZJ A;  3SAT A;  2CV1 A;  4KLN A;  2UU9 M;  3J7B A;  3FTD A;  2XGN A;  2C9C A;  1JR3 D;  3FYC A;  2L09 A;  4LJ4 A;  4AQY M;  2R62 A;  4DV4 M;  1W5S A;  2CHV A;  2I7N A;  3AOE A;  4M9Z A;  4AKI A;  3U6O A;  1C1K A;  3CF0 A;  1K3W A;  2AHM A;  2HKJ A;  4MGI E;  1DGG A;  2G5G X;  4IJF A;  2C96 A;  2F5O A;  4B3T M;  3EIE A;  4IBB A;  1R6B X;  2DZN B;  4NXN M;  3U5Z B;  4LRS A;  4QHT A;  4L4U A;  3DFZ A;  3KSJ A;  2OPF A;  3KFU G;  4GH9 A;  1J09 A;  3KS4 A;  1IQP A;  3GO8 A;  1Z5B A;  1TH4 A;  5EXP A;  2C9O A;  4RF1 A;  2X4A A;  5A2Q S;  4GHL A;  3FUV A;  3NBI A;  3L2A A;  4DV5 M;  1SXJ C;  2C99 A;  5EXT A;  1ZAE A;  2V1C A;  3IG8 A;  1EE8 A;  4FWH A;  3SAU A;  3KOW E;  2Y0T A;  2NQ8 C;  2Z4S A;  8CAT A;  1J7K A;  4AZF A;  1LV7 A;  2CHG A;  5FTN A;  2DVW B;  4NSR A;  4JI8 M;  4DR4 M;  1NHG C;  2BJV A;  5LMU M;  3SAV A;  3KP0 E;  5JI3 E;  3L25 A;  4BBA A;  1KFV A;  3GLH A;  1QQW A;  2H1R A;  1IY0 A;  3ZH9 B;  5LMN M;  1HNZ M;  1IY2 A;  3K92 A;  4Z8X A;  2XEP A;  4B7G A;  4JI3 M;  2LNH C;  4JXJ A;  3VK7 A;  4XBO A;  3GRU A;  2I7P A;  1XNR M;  1IBL M;  3AFH A;  1NJF A;  2ZBK B;  2DWN A;  2DZO B;  4I8O A;  2YR0 A;  4JYA M;  2QBY B;  3GPP A;  1L1T A;  2R65 A;  1IN4 A;  3TL4 X;  3VFD A;  1GLN A;  3PVS A;  1DGB A;  1NJG A;  3IG5 A;  4KO8 A;  4LF7 M;  4DR7 M;  5FTM A;  1G4A E;  3U6E A;  1XMQ M;  1TH2 A;  1QYR A;  4OW0 A;  4G4O A;  1N34 M;  3TWM A;  3GLF A;  3M6A A;  4FCT A;  2UXD M;  4FWG A;  5EP2 A;  3WHL A;  4JN6 A;  4R3D A;  5ITY A;  1HNX M;  4MH0 E;  4AKH A;  4AKG A;  2C5R A;  2XF3 A;  3E9S A;  4D80 A;  5BR8 M;  3SHG B;  4BLC A;  1FNN A;  3UK6 A;  1DGH A;  5C18 A;  2M5Z A;  5H37 D;  1T3T A;  1N78 A;  2EO2 A;  4OVZ A;  4QHS A;  4L15 A;  3C58 A;  3AJI B;  2HCB A;  3UZU A;  3THG A;  4OX9 M;  3MHV C;  2X8A A;  3PNY A;  1HR0 M;  1YUB A;  3FYD A;  5KPR A;  5FLX S;  2ZAM A;  4LF9 M;  3PFI A;  4PDG A;  3NWL A;  2XSZ A;  3TQS A;  4G4Q A;  4GIP A;  1L2D A;  4LFB M;  5IWA M;  3SBJ A;  1FJG M;  3KW6 A;  4X62 M;  5FSW A;  3SAW A;  4LGM A;  3RGP A;  1OFI A;  4B7H A;  4WUR A;  2CHQ A;  5KPT A;  2YFQ A;  4LJ5 A;  5FTK A;  5DNY A;  3U6S A;  4NOO B;  3U60 A;  3LVW A;  3HWS A;  1WXQ A;  3HHY A;  4MM3 B;  4D81 A;  3GPX A;  2XZF A;  2QP9 X;  3ILK A;  2VQF M;  1XC8 A;  3GQ3 A;  2Z7J A;  2UXC M;  3K8Z A;  2XLJ A;  4PD2 A;  1QZM A;  3A46 A;  3GQ5 A;  1Z59 A;  1DO2 A;  4DR5 M;  2QCU A;  2F5S A;  4DV3 M;  3ZC7 B;  3SMP A;  3CTW B;  4IBD A;  2V6Z M;  4JI1 M;  1JR3 A;  3E4R A;  5BPV A;  1G8P A;  4GHA A;  3HHW A;  1IN5 A;  2LH0 A;  3KOX E;  1GVN A;  2K47 A;  3KOZ E;  3AOG A;  4R7G A;  4D82 A;  2RKO A;  3UJN A;  1HQY E;  1K82 A;  1I4W A;  2KEB A;  2Y0Q A;  2CEA A;  4LY6 A;  3J81 S;  4JI7 M;  3W0L B;  3GRV A;  1TDZ A;  3A45 A;  4GMQ A;  5GKN A;  2F5P A;  5KQD A;  4Z6Y A;  2RGH A;  3TWK A;  4MB7 A;  5ITT A;  1K3X A;  4DUY M;  2VII A;  3GRR A;  3HHX A;  4LF4 M;  5C1B A;  1QVR A;  1GL6 A;  1OJL A;  4DR6 M;  2E5L M;  3MJ5 A;  3VK8 A;  4G4N A;  3KS8 A;  2KRU A;  2KW0 A;  3L27 A;  4LF6 M;  5KQ8 A;  2OQ4 A;  3QWL A;  4LFA M;  2DXI A;  3FTC A;  3U6D A;  4FD2 A;  4TUW A;  2YQZ A;  3U5Z A;  4QOZ C;  4FCW A;  5EP3 A;  5IT9 S;  1NNJ A;  1XXH B;  1SXJ B;  1VDD A;  4XGI A;  2UUC M;  3H4M A;  1TDH A;  2Z4R A;  3KXE C;  4G6Z A;  4KHP M;  1TH3 A;  3I4V A;  5ITQ A;  3QAU A;  4WW0 A;  4LJ8 A;  3J7A S;  4G4R A;  1N32 M;  1N36 M;  3KP1 E;  4B3M M;  2KA6 B;  1IBK M;  4CHT B;  1NSF A;  3BOS A;  3U61 B;  3AL0 C;  3CF2 A;  1JQJ C;  3GLI B;  2FE8 A;  2XH9 A;  3GPU A;  1R2Z A;  3R9X B;  1N33 M;  4IBK A;  4MGH A;  2J7N A;  3FTE A;  5ITU A;  3UMM A;  2VQE M;  2Q2E B;  1Z5C A;  2BNK A;  1SXJ D;  4NXM M;  3T1Y M;  1E32 A;  2R45 A;  7CAT A;  2V1U A;  4DR2 M;  3FUU A;  3SYK A;  3PXG A;  4PCZ A;  4IBG A;  3VDU A;  1L2B A;  4FCV A;  4AG6 A;  4YHH M;  3FD9 A;  3FUX A;  3TPZ A;  4RF0 A;  2X49 A;  2L6O A;  1G3I A;  4M9S A;  1QAN A;  4IJE A;  4L78 A;  5ITR A;  5F3W A;  4RNA A;  5EJC A;  4IBC A;  3DA1 A;  3GLG B;  2QBY A;  3D8B A;  4NSO B;  5DYI A;  1HT2 E;  4IBJ A;  2D7E A;  2P5T A;  4DV0 M;  4GC9 A;  4B3R M;  2FFJ A;  3K1J A;  4IBF A;  4LZZ A;  3DOA A;  1IXS B;  2L7H A;  5ITX A;  3LQR A;  4AW4 A;  2R46 A;  3FKE A;  3SHF A;  1GKI A;  2W82 A;  3AOE C;  4K0K M;  4IBE A;  1H6U A;  1KSF X;  3B9P A;  2CE7 A;  3KDS E;  3D8L A;  4IBI A;  3A42 A;  5E26 A;  1IXR C;  2RGO A;  1S3S A;  3GRY A;  4EIW A;  2EA0 A;  3U6P A;  4A3V B;  2ZAN A;  1E9R A;  1NY6 A;  4OU7 A;  4QNM A;  3M0E A;  1YE9 A;  2O5R A;  1G41 A;  1R2Y A;  1Q39 A;  4PT5 A;  4LFC M;  2QZ4 A;  4CIS A;  4DV2 M;  5FTL A;  2DWM A;  4B3S M;  4FW9 A;  1IM2 A;  2LXE A;  4LJA A;  4BB9 A;  3TE6 A;  3OTO M;  2J7O A;  4LCB A;  3T38 A;  3HJS A;  3KVW A;  1J5E M;  1ORY B;  4MGY E;  3HKP A;  2Y20 A;  5ITX E;  1QAO A;  1XNQ M;  3JAM S;  5FTJ A;  2F4V M;  4QNR A;  3VKG A;  2XFS A;  2XZU A;  3SFZ A;  5JI2 E;  4YY3 M;  3MK6 A;  1DO0 A;  3PNV A;  4L8R C;  3J80 S;  1NY5 A;  1OFH A;  2HHH M;  2HL7 A;  3EIH A;  3J27 B;  5EXX A;  4S12 A;  3HJQ A;  3KSX A;  4LJ7 A;  4B08 A;  4FVM A;  1QAM A;  3FUW A;  3JR4 A;  3HU2 A;  2L7I A;  3L28 A;  3FUT A;  4PDI A;  2ZM6 M;  2M60 A;  3ZCB B;  2FNA A;  3CF6 E;  5EP4 A;  1R7R A;  4DV6 M;  4KOD A;  4X65 M;  1HQC A;  4ZPX A;  1XHB A;  3J2P B;  3TWL A;  3T15 A;  4GIT A;  5KO3 A;  4LG2 A;  2A5Y B;  3DZD A;  4L16 A;  3GLH B;  4JI5 M;  2DWZ B;  4REZ A;  4GRI A;  3SAR A;  3AKZ A;  4W5W A;  3SC3 A;  1L1Z A;  1E94 E;  3L26 A;  1ZQ9 A;  2JA2 A;  1IN6 A;  2F5Q A;  1G59 A;  2DWL A;  1IN7 A;  2KZU A;  2UUB M;  1IN8 A;  4DUZ M;  2LWX A;  4LJ6 A;  4DV1 M;  4MGZ E;  3U6L A;  3GP1 A;  1PM5 A;  3VDP A;  2FOI C;  2BJW A;  4NRW A;  4LRT A;  3HHZ A;  1L2C A;  1L8Q A;  4QOS A;  1N77 A;  3LMM A;  1I94 M;  2YNM D;  3AV0 A;  4DR1 M;  3RE8 A;  3U6Q A;  1MU5 A;  4DR3 M;  4B7F A;  2QPA A;  2CV0 A;  1NVM A;  4ITQ A;  2CFO A;  1NHW C;  2ERC A;  3HJ8 A;  4I5S A;  1HT1 E;  3UGJ A;  3T1H M;  1GL7 A;  3GLF B;  5DYG A;  4AG5 A;  2F5N A;  5EP1 A;  4GKK M;  3VLF B;  1Q3C A;  5IZ7 D;  2D7H A;  2D7G A;  2G8L A;  2KRK A;  3FTF A;  4P16 A;  5IRE B;  2KZS A;  1XXH A;  1SXJ A;  1W5T A;  1X37 A;  4NRV A;  4HLQ A;  4NL4 H;  3SYL A;  2DHR A;  3L29 A;  1IXZ A;  4M0W A;  5EQT A;  1DGH B;  3LVV A;  1HNW M;  4M9X A;  2XFT A;  4I4L A;  3U61 A;  1IY1 A;  4OVZ B;  2R4E A;  3I51 A;  3GLI A;  4HL4 A;  3W0F A;  3SMS A;  4LJ9 A;  2ZAO A;  2R4J A;  4LF8 M;  2C98 A;  3RFW A;  1Z6T A;  3RGS A;  3U6M A;  1IBM M;  3HU3 A;  3LQQ A;  3U6C A;  2UXB M;  2KXE A;  2Y21 A;  1PJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...