5IT9S

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 24
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5it9S01
1HNWM 4LFCM 1PJIA 4DR3M 1XNRM 4JI1M 4B3MM 4DV6M 2F5QA 4X66M 4JI3M 2HKJA 1K82A 4LFAM 4NRWA 4PDIA 1PM5A 4JYAM 1XMOM 3SASA 3U6DA 4ITQA 5ITTA 4JV5M 4LF8M 4LF6M 4JI8M 4JI7M 3GQ3A 3T1HM 2HHHM 4GKKM 3SAVA 1NNJA 1N32M 3GP1A 4NXMM 2UU9M 4B3SM 5IWAM 4DV1M 1KFVA 4X65M 3GQ5A 1Z5BA 1L2CA 3GPUA 5ITQA 1Z59A 4DR5M 4PCZA 1Q39A 2EA0A 1PJJA 1IBMM 4LF5M 1N33M 5A2QS 4DR1M 1K3WA 1XMQM 3J81S 1IBLM 5BR8M 1N34M 3A46A 5IT9S 4GKJM 2E5LM 1R2YA 1MX0A 4YY3M 3TWKA 1XNQM 1Z5AA 3JR5A 3C58A 2UUCM 3J80S 2ZBKB 3GPXA 5ITXA 3GPPA 3W0FA 2OQ4A 1EE8A 4DR7M 4JI6M 2F4VM 1K3XA 4LF7M 2Q2EB 4X62M 4G4QA 3T1YM 1J5EM 4DV7M 4B3TM 4JI2M 4OX9M 1Q3CA 3SARA 4DV0M 4DV2M 1XC8A 4DUZM 1HNZM 2XZUA 4DR2M 3A42A 3SBJA 4NRVA 4DV5M 5LMUM 1L1TA 2F5SA 3SATA 4JI4M 4DV3M 2VQEM 2F5OA 4B3RM 5ITUA 1MU5A 3JR4A 1L2BA 3GO8A 3A45A 4LF4M 4AQYM 4NXNM 3VK7A 1R2ZA 3U6QA 3SAWA 2UXCM 1HR0M 5ITXE 4PDGA 3U6MA 4G4NA 1TDZA 1N36M 4JI0M 3U6SA 3OTOM 1I94M 2UXBM 3U6EA 5ITRA 4DR6M 4X64M 5FLXS 2F5PA 2VQFM 5LMNM 2ZM6M 1L1ZA 3JAMS 4YHHM 3TWLA 4KHPM 4G4OA 3TWMA 3SAUA 4JI5M 3U6CA 1IBKM 4LFBM 3VK8A 1HNXM 4CISA 2OPFA 4G4RA 3J7AS 3DOAA 4DV4M 4PD2A 1Q3BA 1TDHA 1L2DA 4MB7A 4DUYM 1FJGM 3U6OA 1Z5CA 3U6LA 3GPYA 4K0KM 2UXDM 3GQ4A 4LF9M 2UUAM 2UUBM 2F5NA 4DR4M 2XZFA 5ITYA 3U6PA
chains in the Genus database with same CATH superfamily
4D81A 1XNRM 3KDSE 1WGLA 2F5QA 4JI1M 1IM2A 5DYGA 1TTEA 4LJ7A 5KO3A 3FKEA 4PT5A 1R6BX 2R65A 4PDIA 4MGZE 2VIIA 4M0WA 4OW0A 2DKLA 2LVPC 3KOWE 2LWXA 2JP7A 2CHGA 4I5SA 4JV5M 4LF8M 1N78A 1IY1A 1R7RA 3GQ3A 4JI7M 4L8RC 2CV0A 1RU3A 3NBIA 4DBGB 1HT2E 4GKKM 4QOZC 3AV0A 2EUCA 4CHTB 4OU7A 2XSZA 3FYCA 1D0KA 2DZNB 2BNKA 4LY6A 3FUUA 4GH9A 3HJSA 1KFVA 1EIJA 1SXJD 3K1JA 1G3IA 2CE7A 2KXEA 2L4EA 4IBFA 1Z5BA 1H6UA 3Q8XA 1IXSA 4L15A 2DI0A 4LJ5A 1L2CA 2JY5A 2LVOC 4LZZA 1DGGA 4F2LA 1T3TA 1OFIA 1Q39A 3SC3A 2OOBA 1W5TA 2R45A 2J7NA 5BPVA 1NNUC 2JZ1A 3F92A 1TH2A 2DAEA 4QHTA 4L78A 1LTMA 3EIEA 2E5LM 3FE3A 4GHLA 2DWZB 5EP2A 3TWKA 2CUZA 1Z5AA 2Y0QA 2ZTDA 1DGHB 1WIVA 2R4JA 1GLNA 2UUCM 1GVNA 3GPXA 2J5YA 4Y28F 2C9CA 2FNAA 1ORYB 3ILKA 5EQTA 2G5GX 4LF7M 2Q2EB 2XF3A 4G4QA 3GLHA 5EP1A 3M6AA 4DV7M 2JY6B 4B3TM 2ERCA 2O01F 4LJ8A 3UK6A 3KSJA 1ZMVA 3SARA 2O5RA 1NV9A 2VDBB 3AKZA 4DV0M 4B08A 2MH8A 3GLIB 2FE8A 3A42A 3H4JA 5E6JA 3SBJA 4I8OA 4QNMA 2F5SA 3PVSA 1AIPC 1DO2A 4CIZA 1XB2B 1JB0F 5FTLA 3A45A 4LF4M 3AOGA 3GRYA 2QHOB 1VEJA 4NXNM 4EIWA 2Z8YM 1G8PA 1NV8A 4IJEA 2DWNA 1Y8GA 3D8BA 3FYDA 5EP4A 1HR0M 2DZOB 3HU1A 1C1KA 3U6PA 1G71A 2N35A 4NSOB 4R71A 4G4NA 1QYRA 3OTOM 3U6EA 3VKHA 1XHBA 2HL7A 2R46A 2Z4RA 2VQFM 1QUTA 4TUWA 4ANRA 2A5YB 1D2NA 2QSFX 3JAMS 2Y0TA 3GLFA 3R8FA 3HHYA 3C3EA 3PXGA 2KNZA 1VEKA 3SAUA 3U6CA 4R7GA 4D82A 3KFUG 3HU2A 1JR3D 2APLA 4MM3B 3GLGB 2O25A 3GLIE 4FCVA 4IBCA 2KRKA 3R9XB 3Q8GA 4LCBA 3PNVA 5EXPA 1F4IA 4PD2A 3U5ZB 1L2DA 1TDHA 3TQSA 3CF2A 4MB7A 2JA2A 4HEOA 1DV0A 1Z5CA 3U60B 1R4GA 4MGIE 1NVMA 4K0KM 4AI6A 4LF9M 4FCWA 2EO2A 2HAKA 2UUAM 1OAOC 4M9ZA 2UUBM 1E32A 2CFOA 3LVVA 1VEGA 4IBJA 1GKIA 5DYIA 4BLCA 2C98A 1UM8A 4LFCM 1PJIA 1QZMA 1WXQA 2DAGA 2ZAOA 2QBYA 4B7HA 1IN8A 2CWBA 5JI2E 4QHSA 3GLFE 2KNVA 1GL7A 3B74A 3WHKA 8CATA 1K82A 3J27B 1PJSA 1XMOM 3KVWA 3SASA 3ZQJA 2CEAA 4LJ4A 4MH0E 4ITQA 1WHCA 2CV1A 2J7OA 3TPZA 1E94E 2X8AA 4M9XA 5FTMA 3H4MA 1DGFA 4FD2A 1HQYE 2B3TA 3KOYE 3GLGE 3L26A 1NNJA 1C7YA 2QP9X 2K6BA 3FUTA 2V1UA 1QQWA 2YFQA 2DAMA 4NXMM 4B3SM 3J2PB 1NHGC 1E9SA 3ZH9B 3WHLA 2EKFA 3GQ5A 1T6OA 2I7NA 3UMMA 5DNYA 1FNNA 1IFYA 2XFTA 1Z59A 3I4YA 2LTUA 1IBMM 1N33M 3IHPA 1E9RA 3PNYA 3FUWA 3CTWB 3AFHA 2CHQA 3FUVA 2CRUA 4FCTA 2XFSA 3J81S 1IBLM 3SYKA 2JXNA 4GC5A 1NY6A 4GKJM 3LQQA 2H5XA 4BB9A 2RGHA 4JN6A 2LH0A 4L16A 5EJCA 4HL4A 1TGUA 3J80S 4NC6A 2WSEF 4MGYE 2ZBKB 3SMSA 4GIPA 1G4AE 4RF1A 5ITXA 3GPPA 3FTCA 3UJNA 4JI6M 4MGHA 3LCUA 4XGIA 5FTNA 3T1YM 1J5EM 1IXSB 1S3SA 2Y20A 3L27A 1SXJA 3K2LA 3K92A 4IBEA 4OX9M 1Q3CA 1XWIA 2RKOA 3NBXX 1W5SA 1A5TA 1L8QA 2YNMD 3CF0A 1HNZM 3KXEC 1OJLA 5LMUM 1D0LA 1IY0A 4IIWA 3T6PA 2F5OA 2RRUA 2BJVA 3MHVC 1MU5A 1V34A 3JR4A 2R44A 3LVWA 3GO8A 3CF6E 3KP1E 4R3DA 3DZDA 2LHCA 5ITXE 3IECA 2M60A 4GITA 3ZC7B 3I04M 1TDZA 1N36M 4JI0M 3U6SA 1HQCA 1I94M 2UXBM 1PJQA 2G3QA 4X64M 4JXJA 4LGYA 4Z8XA 2DENA 2ZTCA 5FLXS 5LMNM 3TWLA 4L4UA 1J09A 4KHPM 4G4OA 1OIZA 1QDTA 1IXRC 3UZUA 4CGYB 4AKHA 4LFBM 4IBIA 1ZAEA 4IBKA 1GJSA 4G4RA 1YUBA 1IN5A 4IBDA 1GL6A 1I4WA 2L2DA 1NSFA 4DUYM 1FJGM 1IN4A 1TH4A 2XEPA 2QQ8A 3U6LA 3GPYA 3LW5F 3I51A 3KS4A 3GQ4A 4KLNA 2LVAA 3RGPA 1KYIA 2FFJA 1HJPA 4GMQA 1PGYA 3SFZA 3L25A 1HNWM 1ZMWA 3GLHE 3E9SA 4DV6M 2C96A 3GLFB 2MJ5B 2V1CA 4X66M 2K0BX 2HKJA 2K9DA 2KW0A 4LRTA 4M0DA 3U61A 2WSCF 1Q02A 1PM5A 3MK6A 2JZ0A 4LJ6A 1QVRA 3U6DA 4P17A 4NOOB 1QDRA 4BBAA 5ITTA 1JR3A 5KPTA 4JI8M 3K8ZA 2L4FA 3T1HM 1XXHA 3SAVA 2FH0A 3NWLA 4LGMA 2KA6B 4LRSA 3GP1A 3ZCBB 2UU9M 2Z4SA 3HX3A 4FVMA 5IWAM 2JY8A 4DV1M 1KSFX 3HWSA 2QBYB 5C1BA 3W67A 5E26A 5F3WA 3W0LB 3GPUA 4UN2B 3D8LA 3M7GA 1T43A 2DAIA 4PCZA 2EA0A 3FRIA 2OO9A 4L6V6 4LF5M 5IZ7D 4DR1M 3DFZA 1XMQM 3B7ZA 3UGJA 3VDPA 1N34M 5DFLA 1WJ7A 3A46A 5IT9S 2EJSA 1MX0A 5FSWA 4AG5A 3HJQA 3W68A 3JR5A 2CP8A 3C58A 4GHAA 2JUJA 2LHGA 3BBZA 1SXJC 1VDDA 2C99A 1TH3A 2RGOA 1EE8A 3HHWA 3M0EA 3RGSA 4A3VB 2OQ4A 4KT0F 4DR7M 2I7PA 4X62M 2KZSA 1DGBA 5EP3A 1OQYA 4JI2M 4ZPXA 3HZJA 3HU3A 4GEWA 1TF0B 4II7A 5EXXA 2R4EA 1P3QQ 3GRUA 5KPRA 2XZUA 2JWSA 4B7FA 1EFUB 4DR2M 2OOAA 2R6FA 4DV5M 2D7GA 2XH9A 1L1TA 4JI4M 2QPAA 3B9PA 3C3DA 3SATA 2Z7JA 3B89A 1YLAA 3E4RA 4LZJA 1V33A 5ITUA 4M9SA 2GNOA 4I4LA 1QAMA 1R2ZA 4G6ZA 5IREB 3FTDA 3SAWA 2LNHC 4OVZA 2KHHA 3I01M 3VFDA 3IG5A 2D7EA 4GRIA 4WURA 3U6MA 1NHWC 5EXSA 1SXJB 3B7QA 2AHMA 2DHRA 1VG5A 2WSFF 3LCVB 4FWGA 2H1RA 2F5PA 4XK8F 4DR6M 1WGNA 2MROB 2XGNA 3KS8A 3FTFA 1L1ZA 1YE9A 4YHHM 1IN7A 3HHZA 2KEBA 5GKNA 3C9PA 3TWMA 2BJWA 2JY7A 2BWBA 2HWJA 3HGIA 1IBKM 4JI5M 1YSYA 2BWEA 5KPZA 5FTKA 3AJIB 2OPFA 4NSRA 3VKGA 3I4VA 3QYBA 2Z3XA 2X49A 4S12A 1HT1E 1JQJC 2R0IA 5H37D 2K47A 4D80A 3KSXA 2XSZD 2LVQD 3QYEA 3QAUA 3L28A 3THGA 1IN6A 2DAKA 2F5NA 3GLHB 2XZFA 4QOSA 3SHFA 2C5RA 3AL0C 4DR3M 1N75A 1PRBA 3BOSA 4HLQA 4B3MM 1SXJE 4LJAA 2ZANA 4JI3M 2C9OA 1BVSA 3AOEA 2G8LA 1IQPA 2WZJA 2D7HA 3QWLA 4FWHA 4W5WA 4WW0A 4KODA 4LFAM 2YR0A 3GRVA 7CATA 4NRWA 4AKGA 5C18A 2KRUA 3E46A 2L7HA 3RE8A 3SHGB 2JNHA 4JYAM 3HHXA 4AW4A 1AUAA 2R18A 4NL4H 1QANA 4LF6M 4IBGA 4LJ9A 2MGWA 4QNRA 3MMPA 2HHHM 1MJGM 1ZQ9A 1IXZA 1UFZA 2Y21A 4GC9A 2LVNC 4XBOA 2DWMA 3KOXE 1DGHA 4AZFA 1N32M 2DXIA 1OTRA 3EIHA 2QZ4A 1D0MA 1MN3A 3KOZE 1GABA 3VLFB 4FWDA 1G41A 3T38A 3VDUA 2M5ZA 4RF0A 4X65M 3KW6A 1CUKA 2VF8A 1GJTA 1ZMUA 5ITQA 3U61B 2KDLA 2ZAMA 3KP0E 1QZEA 4DR5M 1PJJA 1OKSA 3L29A 3L2AA 4G3OA 5A2QS 3DA1A 1K3WA 3FUXA 3FTEA 3GLIA 1ZV1A 5BR8M 4F1IA 1XXHB 2DZLA 2VF7A 1TR8A 3A98B 3HJ8A 3TE6A 4YY3M 4B7GA 1SG9A 1R2YA 1NO1A 1XNQM 4I81A 3LMMA 3FD9A 2X4AA 1NY5A 3FRHA 4REZA 3W0FA 1X37A 2F4VM 1NJFA 3V76A 2XLJA 2GQFA 3K9PA 1K3XA 3RFWA 2CV2A 1VDLA 2L09A 1QUSA 2MR9A 3LQRA 2EKKA 4WP2A 1G59A 2QENA 4DV2M 3CGWA 1XC8A 3MJ5A 4DUZM 4MGKE 2LBCA 1OFHA 3BXWA 4NRVA 4DV3M 2VQEM 1VQ1A 3TL4X 2HCBA 1N77A 4B3RM 1LV7A 2DHYA 1L2BA 3GLGA 3J7BA 3SMPA 1JR3E 4AQYM 5FTJA 3VK7A 1IY2A 2FS1A 2QCUA 3U6QA 3U5ZA 1XXHE 2DNAA 2L6OA 2UXCM 3U60A 3K9OA 2V6ZM 4Z6YA 4IBBA 5KQDA 4PDGA 3PFIA 4Q7JA 2DVWB 4RNAA 1V92A 3B7NA 4IJFA 5ITRA 1QAQA 2FOIC 3IG8A 4RKUF 2KZUA 2ZM6M 3T15A 1DO0A 1QAOA 4FW9A 5EXTA 4AKIA 1PJTA 2NQ8C 2QNJA 4KO8A 1NJGA 1GO5A 1OIPA 3VK8A 5L8RF 1HNXM 4CISA 4CJ6A 1R5LA 3J7AS 3DOAA 4DV4M 1Q3BA 5KQ8A 2CHVA 1OAIA 1Z6TA 4OVZB 3U6OA 3SYLA 3E21A 2KNAA 2UXDM 3HY5A 2P5TA 1J7KA 2W82A 5JI3E 4P16A 2DWLA 4LG2A 4DR4M 2R62A 2LXEA 2YQZA 3GRRA 3AOEC 4AG6A 5ITYA 3HKPA 1WR1B 2L7IA
chains in the Genus database with same CATH topology
4D81A 1XNRM 3KDSE 4JI1M 2F5QA 1IM2A 5DYGA 4LJ7A 5KO3A 3FKEA 4PT5A 1R6BX 2R65A 4PDIA 4MGZE 2VIIA 4M0WA 4OW0A 3KOWE 2LWXA 2CHGA 4I5SA 4JV5M 4LF8M 1N78A 1IY1A 1R7RA 3GQ3A 4JI7M 4L8RC 2CV0A 4GKKM 3NBIA 1HT2E 4QOZC 3AV0A 2EUCA 4CHTB 4OU7A 2XSZA 3FYCA 2DZNB 2BNKA 4LY6A 3FUUA 4GH9A 3HJSA 1KFVA 1SXJD 3K1JA 1G3IA 2CE7A 2KXEA 4IBFA 1Z5BA 1H6UA 3Q8XA 4L15A 4LJ5A 1L2CA 4LZZA 1DGGA 1T3TA 1OFIA 1Q39A 3SC3A 1W5TA 2R45A 2J7NA 5BPVA 1NNUC 1TH2A 4QHTA 4L78A 3EIEA 2E5LM 4GHLA 2DWZB 5EP2A 3TWKA 2CUZA 1Z5AA 2Y0QA 1DGHB 2R4JA 2UUCM 1GLNA 1GVNA 3GPXA 2C9CA 2FNAA 1ORYB 3ILKA 5EQTA 2G5GX 4LF7M 2Q2EB 2XF3A 4G4QA 3GLHA 5EP1A 3M6AA 4DV7M 4B3TM 2ERCA 4LJ8A 3UK6A 3KSJA 3SARA 2O5RA 4DV0M 3AKZA 4B08A 3GLIB 2FE8A 3A42A 5E6JA 3SBJA 4I8OA 4QNMA 2F5SA 3PVSA 1DO2A 5FTLA 3A45A 4LF4M 3AOGA 3GRYA 4NXNM 4EIWA 2DWNA 1G8PA 4IJEA 3D8BA 3FYDA 5EP4A 1HR0M 2DZOB 3HU1A 1C1KA 4NSOB 4G4NA 1QYRA 3OTOM 3U6EA 3VKHA 1XHBA 2HL7A 2R46A 2Z4RA 2VQFM 4TUWA 2A5YB 1D2NA 3JAMS 2Y0TA 3GLFA 3R8FA 3HHYA 3PXGA 3SAUA 3U6CA 4R7GA 4D82A 3KFUG 3HU2A 1JR3D 4MM3B 3GLGB 4FCVA 4IBCA 2KRKA 3R9XB 4LCBA 3PNVA 5EXPA 4PD2A 3U5ZB 1L2DA 1TDHA 3TQSA 3CF2A 4MB7A 2JA2A 1Z5CA 3U60B 4MGIE 1NVMA 4K0KM 4AI6A 4LF9M 4FCWA 2EO2A 2UUAM 4M9ZA 2UUBM 1E32A 2CFOA 3LVVA 4IBJA 1GKIA 5DYIA 4BLCA 2C98A 1UM8A 4LFCM 1PJIA 1QZMA 1WXQA 2ZAOA 2QBYA 4B7HA 1IN8A 5JI2E 4QHSA 8CATA 1GL7A 1K82A 3WHKA 3J27B 1XMOM 3KVWA 3SASA 2CEAA 4LJ4A 4MH0E 4ITQA 2CV1A 2J7OA 3TPZA 1E94E 2X8AA 4M9XA 5FTMA 3H4MA 1DGFA 4FD2A 1HQYE 3KOYE 3L26A 1NNJA 2QP9X 3FUTA 2V1UA 1QQWA 2YFQA 4NXMM 4B3SM 3J2PB 1NHGC 1E9SA 3ZH9B 3WHLA 3GQ5A 2I7NA 3UMMA 5DNYA 1FNNA 2XFTA 1Z59A 3I4YA 1N33M 1IBMM 1E9RA 3PNYA 3FUWA 3CTWB 3AFHA 2CHQA 3FUVA 4FCTA 2XFSA 3J81S 1IBLM 3SYKA 4GKJM 4GC5A 1NY6A 3LQQA 4BB9A 2RGHA 4JN6A 2LH0A 4L16A 5EJCA 4HL4A 1TGUA 3J80S 3SMSA 4MGYE 2ZBKB 4GIPA 1G4AE 4RF1A 5ITXA 3GPPA 3FTCA 3UJNA 4JI6M 4MGHA 4XGIA 5FTNA 3T1YM 1J5EM 1IXSB 1S3SA 2Y20A 3L27A 1SXJA 3K2LA 3K92A 4IBEA 4OX9M 1Q3CA 1XWIA 2RKOA 1W5SA 1L8QA 2YNMD 3CF0A 1HNZM 3KXEC 1OJLA 5LMUM 1IY0A 4IIWA 2F5OA 2BJVA 3MHVC 1MU5A 3JR4A 3LVWA 3GO8A 3CF6E 3KP1E 4R3DA 3DZDA 5ITXE 2M60A 4GITA 3ZC7B 1TDZA 1N36M 4JI0M 3U6SA 1HQCA 1I94M 2UXBM 4X64M 4JXJA 4LGYA 4Z8XA 5FLXS 5LMNM 3TWLA 4L4UA 1J09A 4KHPM 4G4OA 1IXRC 3UZUA 4CGYB 4AKHA 4LFBM 4IBIA 1ZAEA 4IBKA 4G4RA 1YUBA 1IN5A 4IBDA 1GL6A 1I4WA 1NSFA 4DUYM 1FJGM 1IN4A 1TH4A 2XEPA 3U6LA 3GPYA 3I51A 3KS4A 3GQ4A 4KLNA 3RGPA 1KYIA 2FFJA 4GMQA 3SFZA 3L25A 1HNWM 3E9SA 4DV6M 2C96A 3GLFB 2V1CA 4X66M 2HKJA 2KW0A 4LRTA 4M0DA 3U61A 1PM5A 3MK6A 4LJ6A 1QVRA 3U6DA 4NOOB 4BBAA 5ITTA 1JR3A 5KPTA 4JI8M 3K8ZA 3T1HM 1XXHA 3SAVA 3NWLA 4LGMA 2KA6B 4LRSA 3GP1A 3ZCBB 2UU9M 2Z4SA 5IWAM 4FVMA 4DV1M 1KSFX 3HWSA 2QBYB 5C1BA 5E26A 5F3WA 3W0LB 3GPUA 3D8LA 3M7GA 4PCZA 2EA0A 4LF5M 5IZ7D 4DR1M 3DFZA 1XMQM 3UGJA 3VDPA 1N34M 3A46A 5IT9S 1MX0A 5FSWA 4AG5A 3HJQA 3JR5A 3C58A 4GHAA 1SXJC 1VDDA 2C99A 1TH3A 2RGOA 1EE8A 3HHWA 3M0EA 3RGSA 4A3VB 2OQ4A 4DR7M 2I7PA 4X62M 2KZSA 1DGBA 5EP3A 4JI2M 4ZPXA 3HU3A 5EXXA 4II7A 2R4EA 3GRUA 5KPRA 2XZUA 4B7FA 4DR2M 4DV5M 2D7GA 2XH9A 1L1TA 4JI4M 2QPAA 3B9PA 3SATA 2Z7JA 3E4RA 4LZJA 5ITUA 4M9SA 4I4LA 1QAMA 1R2ZA 4G6ZA 5IREB 3FTDA 3SAWA 2LNHC 4OVZA 3VFDA 3IG5A 2D7EA 4GRIA 4WURA 3U6MA 1NHWC 5EXSA 1SXJB 2AHMA 2DHRA 4FWGA 4DR6M 2H1RA 2F5PA 2XGNA 3KS8A 3FTFA 1L1ZA 1YE9A 4YHHM 1IN7A 3HHZA 2KEBA 5GKNA 3TWMA 2BJWA 3HGIA 1IBKM 4JI5M 1YSYA 5KPZA 5FTKA 3AJIB 2OPFA 4NSRA 3VKGA 3I4VA 2Z3XA 2X49A 4S12A 1HT1E 1JQJC 5H37D 2K47A 4D80A 3KSXA 2XSZD 3QAUA 3L28A 3THGA 1IN6A 2F5NA 3GLHB 2XZFA 4QOSA 3SHFA 2C5RA 3AL0C 4DR3M 1N75A 4HLQA 3BOSA 4B3MM 1SXJE 4LJAA 2ZANA 4JI3M 2C9OA 3AOEA 2G8LA 1IQPA 4FWHA 2D7HA 3QWLA 4W5WA 4LFAM 4WW0A 4KODA 4NRWA 2YR0A 3GRVA 7CATA 4AKGA 5C18A 2KRUA 3RE8A 2L7HA 3SHGB 4JYAM 3HHXA 4AW4A 2R18A 4NL4H 1QANA 4LF6M 4IBGA 4LJ9A 4QNRA 2HHHM 1ZQ9A 1IXZA 4GC9A 2Y21A 2DWMA 4XBOA 1N32M 3KOXE 1DGHA 4AZFA 2DXIA 3EIHA 2QZ4A 3KOZE 3VLFB 4FWDA 1G41A 3T38A 3VDUA 2M5ZA 4RF0A 4X65M 3KW6A 5ITQA 3U61B 2ZAMA 4DR5M 3KP0E 1PJJA 3L29A 3L2AA 5A2QS 3DA1A 1K3WA 3FUXA 3FTEA 3GLIA 5BR8M 1XXHB 3A98B 1R2YA 3HJ8A 3TE6A 4YY3M 4B7GA 1XNQM 4AKIA 4I81A 3LMMA 3FD9A 2X4AA 1NY5A 4REZA 3W0FA 1X37A 2F4VM 1NJFA 2XLJA 1K3XA 3RFWA 2CV2A 2L09A 3LQRA 1G59A 2QENA 4DV2M 1XC8A 3MJ5A 4DUZM 4MGKE 1OFHA 4NRVA 4DV3M 2VQEM 3TL4X 2HCBA 1N77A 4B3RM 1LV7A 1L2BA 3GLGA 3J7BA 3SMPA 4AQYM 5FTJA 3VK7A 1IY2A 2QCUA 3U6QA 3U5ZA 2L6OA 2UXCM 3U60A 5KQDA 2V6ZM 4Z6YA 4IBBA 4PDGA 3PFIA 2DVWB 4RNAA 4IJFA 5ITRA 1QAQA 2FOIC 3IG8A 2KZUA 2ZM6M 3T15A 1DO0A 1QAOA 4FW9A 5EXTA 2NQ8C 4KO8A 1NJGA 3VK8A 1HNXM 4CISA 3J7AS 3DOAA 4DV4M 1Q3BA 5KQ8A 2CHVA 1Z6TA 4OVZB 3U6OA 3SYLA 2UXDM 2P5TA 1J7KA 2W82A 5JI3E 4P16A 2DWLA 4LG2A 4DR4M 2R62A 2LXEA 2YQZA 3GRRA 3AOEC 4AG6A 5ITYA 3HKPA 3U6PA 2L7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW M;  4LFC M;  1PJI A;  4DR3 M;  1XNR M;  4JI1 M;  4B3M M;  4DV6 M;  2F5Q A;  4X66 M;  4JI3 M;  2HKJ A;  1K82 A;  4LFA M;  4NRW A;  4PDI A;  1PM5 A;  4JYA M;  1XMO M;  3SAS A;  3U6D A;  4ITQ A;  5ITT A;  4JV5 M;  4LF8 M;  4LF6 M;  4JI8 M;  4JI7 M;  3GQ3 A;  3T1H M;  2HHH M;  4GKK M;  3SAV A;  1NNJ A;  1N32 M;  3GP1 A;  4NXM M;  2UU9 M;  4B3S M;  5IWA M;  4DV1 M;  1KFV A;  4X65 M;  3GQ5 A;  1Z5B A;  1L2C A;  3GPU A;  5ITQ A;  1Z59 A;  4DR5 M;  4PCZ A;  1Q39 A;  2EA0 A;  1PJJ A;  1IBM M;  4LF5 M;  1N33 M;  5A2Q S;  4DR1 M;  1K3W A;  1XMQ M;  3J81 S;  1IBL M;  5BR8 M;  1N34 M;  3A46 A;  5IT9 S;  4GKJ M;  2E5L M;  1R2Y A;  1MX0 A;  4YY3 M;  3TWK A;  1XNQ M;  1Z5A A;  3JR5 A;  3C58 A;  2UUC M;  3J80 S;  2ZBK B;  3GPX A;  5ITX A;  3GPP A;  3W0F A;  2OQ4 A;  1EE8 A;  4DR7 M;  4JI6 M;  2F4V M;  1K3X A;  4LF7 M;  2Q2E B;  4X62 M;  4G4Q A;  3T1Y M;  1J5E M;  4DV7 M;  4B3T M;  4JI2 M;  4OX9 M;  1Q3C A;  3SAR A;  4DV0 M;  4DV2 M;  1XC8 A;  4DUZ M;  1HNZ M;  2XZU A;  4DR2 M;  3A42 A;  3SBJ A;  4NRV A;  4DV5 M;  5LMU M;  1L1T A;  2F5S A;  3SAT A;  4JI4 M;  4DV3 M;  2VQE M;  2F5O A;  4B3R M;  5ITU A;  1MU5 A;  3JR4 A;  1L2B A;  3GO8 A;  3A45 A;  4LF4 M;  4AQY M;  4NXN M;  3VK7 A;  1R2Z A;  3U6Q A;  3SAW A;  2UXC M;  1HR0 M;  5ITX E;  4PDG A;  3U6M A;  4G4N A;  1TDZ A;  1N36 M;  4JI0 M;  3U6S A;  3OTO M;  1I94 M;  2UXB M;  3U6E A;  5ITR A;  4DR6 M;  4X64 M;  5FLX S;  2F5P A;  2VQF M;  5LMN M;  2ZM6 M;  1L1Z A;  3JAM S;  4YHH M;  3TWL A;  4KHP M;  4G4O A;  3TWM A;  3SAU A;  4JI5 M;  3U6C A;  1IBK M;  4LFB M;  3VK8 A;  1HNX M;  4CIS A;  2OPF A;  4G4R A;  3J7A S;  3DOA A;  4DV4 M;  4PD2 A;  1Q3B A;  1TDH A;  1L2D A;  4MB7 A;  4DUY M;  1FJG M;  3U6O A;  1Z5C A;  3U6L A;  3GPY A;  4K0K M;  2UXD M;  3GQ4 A;  4LF9 M;  2UUA M;  2UUB M;  2F5N A;  4DR4 M;  2XZF A;  5ITY A;  3U6P A; 
#chains in the Genus database with same CATH topology
 4D81 A;  1XNR M;  3KDS E;  1WGL A;  2F5Q A;  4JI1 M;  1IM2 A;  5DYG A;  1TTE A;  4LJ7 A;  5KO3 A;  3FKE A;  4PT5 A;  1R6B X;  2R65 A;  4PDI A;  4MGZ E;  2VII A;  4M0W A;  4OW0 A;  2DKL A;  2LVP C;  3KOW E;  2LWX A;  2JP7 A;  2CHG A;  4I5S A;  4JV5 M;  4LF8 M;  1N78 A;  1IY1 A;  1R7R A;  3GQ3 A;  4JI7 M;  4L8R C;  2CV0 A;  1RU3 A;  3NBI A;  4DBG B;  1HT2 E;  4GKK M;  4QOZ C;  3AV0 A;  2EUC A;  4CHT B;  4OU7 A;  2XSZ A;  3FYC A;  1D0K A;  2DZN B;  2BNK A;  4LY6 A;  3FUU A;  4GH9 A;  3HJS A;  1KFV A;  1EIJ A;  1SXJ D;  3K1J A;  1G3I A;  2CE7 A;  2KXE A;  2L4E A;  4IBF A;  1Z5B A;  1H6U A;  3Q8X A;  1IXS A;  4L15 A;  2DI0 A;  4LJ5 A;  1L2C A;  2JY5 A;  2LVO C;  4LZZ A;  1DGG A;  4F2L A;  1T3T A;  1OFI A;  1Q39 A;  3SC3 A;  2OOB A;  1W5T A;  2R45 A;  2J7N A;  5BPV A;  1NNU C;  2JZ1 A;  3F92 A;  1TH2 A;  2DAE A;  4QHT A;  4L78 A;  1LTM A;  3EIE A;  2E5L M;  3FE3 A;  4GHL A;  2DWZ B;  5EP2 A;  3TWK A;  2CUZ A;  1Z5A A;  2Y0Q A;  2ZTD A;  1DGH B;  1WIV A;  2R4J A;  1GLN A;  2UUC M;  1GVN A;  3GPX A;  2J5Y A;  4Y28 F;  2C9C A;  2FNA A;  1ORY B;  3ILK A;  5EQT A;  2G5G X;  4LF7 M;  2Q2E B;  2XF3 A;  4G4Q A;  3GLH A;  5EP1 A;  3M6A A;  4DV7 M;  2JY6 B;  4B3T M;  2ERC A;  2O01 F;  4LJ8 A;  3UK6 A;  3KSJ A;  1ZMV A;  3SAR A;  2O5R A;  1NV9 A;  2VDB B;  3AKZ A;  4DV0 M;  4B08 A;  2MH8 A;  3GLI B;  2FE8 A;  3A42 A;  3H4J A;  5E6J A;  3SBJ A;  4I8O A;  4QNM A;  2F5S A;  3PVS A;  1AIP C;  1DO2 A;  4CIZ A;  1XB2 B;  1JB0 F;  5FTL A;  3A45 A;  4LF4 M;  3AOG A;  3GRY A;  2QHO B;  1VEJ A;  4NXN M;  4EIW A;  2Z8Y M;  1G8P A;  1NV8 A;  4IJE A;  2DWN A;  1Y8G A;  3D8B A;  3FYD A;  5EP4 A;  1HR0 M;  2DZO B;  3HU1 A;  1C1K A;  3U6P A;  1G71 A;  2N35 A;  4NSO B;  4R71 A;  4G4N A;  1QYR A;  3OTO M;  3U6E A;  3VKH A;  1XHB A;  2HL7 A;  2R46 A;  2Z4R A;  2VQF M;  1QUT A;  4TUW A;  4ANR A;  2A5Y B;  1D2N A;  2QSF X;  3JAM S;  2Y0T A;  3GLF A;  3R8F A;  3HHY A;  3C3E A;  3PXG A;  2KNZ A;  1VEK A;  3SAU A;  3U6C A;  4R7G A;  4D82 A;  3KFU G;  3HU2 A;  1JR3 D;  2APL A;  4MM3 B;  3GLG B;  2O25 A;  3GLI E;  4FCV A;  4IBC A;  2KRK A;  3R9X B;  3Q8G A;  4LCB A;  3PNV A;  5EXP A;  1F4I A;  4PD2 A;  3U5Z B;  1L2D A;  1TDH A;  3TQS A;  3CF2 A;  4MB7 A;  2JA2 A;  4HEO A;  1DV0 A;  1Z5C A;  3U60 B;  1R4G A;  4MGI E;  1NVM A;  4K0K M;  4AI6 A;  4LF9 M;  4FCW A;  2EO2 A;  2HAK A;  2UUA M;  1OAO C;  4M9Z A;  2UUB M;  1E32 A;  2CFO A;  3LVV A;  1VEG A;  4IBJ A;  1GKI A;  5DYI A;  4BLC A;  2C98 A;  1UM8 A;  4LFC M;  1PJI A;  1QZM A;  1WXQ A;  2DAG A;  2ZAO A;  2QBY A;  4B7H A;  1IN8 A;  2CWB A;  5JI2 E;  4QHS A;  3GLF E;  2KNV A;  1GL7 A;  3B74 A;  3WHK A;  8CAT A;  1K82 A;  3J27 B;  1PJS A;  1XMO M;  3KVW A;  3SAS A;  3ZQJ A;  2CEA A;  4LJ4 A;  4MH0 E;  4ITQ A;  1WHC A;  2CV1 A;  2J7O A;  3TPZ A;  1E94 E;  2X8A A;  4M9X A;  5FTM A;  3H4M A;  1DGF A;  4FD2 A;  1HQY E;  2B3T A;  3KOY E;  3GLG E;  3L26 A;  1NNJ A;  1C7Y A;  2QP9 X;  2K6B A;  3FUT A;  2V1U A;  1QQW A;  2YFQ A;  2DAM A;  4NXM M;  4B3S M;  3J2P B;  1NHG C;  1E9S A;  3ZH9 B;  3WHL A;  2EKF A;  3GQ5 A;  1T6O A;  2I7N A;  3UMM A;  5DNY A;  1FNN A;  1IFY A;  2XFT A;  1Z59 A;  3I4Y A;  2LTU A;  1IBM M;  1N33 M;  3IHP A;  1E9R A;  3PNY A;  3FUW A;  3CTW B;  3AFH A;  2CHQ A;  3FUV A;  2CRU A;  4FCT A;  2XFS A;  3J81 S;  1IBL M;  3SYK A;  2JXN A;  4GC5 A;  1NY6 A;  4GKJ M;  3LQQ A;  2H5X A;  4BB9 A;  2RGH A;  4JN6 A;  2LH0 A;  4L16 A;  5EJC A;  4HL4 A;  1TGU A;  3J80 S;  4NC6 A;  2WSE F;  4MGY E;  2ZBK B;  3SMS A;  4GIP A;  1G4A E;  4RF1 A;  5ITX A;  3GPP A;  3FTC A;  3UJN A;  4JI6 M;  4MGH A;  3LCU A;  4XGI A;  5FTN A;  3T1Y M;  1J5E M;  1IXS B;  1S3S A;  2Y20 A;  3L27 A;  1SXJ A;  3K2L A;  3K92 A;  4IBE A;  4OX9 M;  1Q3C A;  1XWI A;  2RKO A;  3NBX X;  1W5S A;  1A5T A;  1L8Q A;  2YNM D;  3CF0 A;  1HNZ M;  3KXE C;  1OJL A;  5LMU M;  1D0L A;  1IY0 A;  4IIW A;  3T6P A;  2F5O A;  2RRU A;  2BJV A;  3MHV C;  1MU5 A;  1V34 A;  3JR4 A;  2R44 A;  3LVW A;  3GO8 A;  3CF6 E;  3KP1 E;  4R3D A;  3DZD A;  2LHC A;  5ITX E;  3IEC A;  2M60 A;  4GIT A;  3ZC7 B;  3I04 M;  1TDZ A;  1N36 M;  4JI0 M;  3U6S A;  1HQC A;  1I94 M;  2UXB M;  1PJQ A;  2G3Q A;  4X64 M;  4JXJ A;  4LGY A;  4Z8X A;  2DEN A;  2ZTC A;  5FLX S;  5LMN M;  3TWL A;  4L4U A;  1J09 A;  4KHP M;  4G4O A;  1OIZ A;  1QDT A;  1IXR C;  3UZU A;  4CGY B;  4AKH A;  4LFB M;  4IBI A;  1ZAE A;  4IBK A;  1GJS A;  4G4R A;  1YUB A;  1IN5 A;  4IBD A;  1GL6 A;  1I4W A;  2L2D A;  1NSF A;  4DUY M;  1FJG M;  1IN4 A;  1TH4 A;  2XEP A;  2QQ8 A;  3U6L A;  3GPY A;  3LW5 F;  3I51 A;  3KS4 A;  3GQ4 A;  4KLN A;  2LVA A;  3RGP A;  1KYI A;  2FFJ A;  1HJP A;  4GMQ A;  1PGY A;  3SFZ A;  3L25 A;  1HNW M;  1ZMW A;  3GLH E;  3E9S A;  4DV6 M;  2C96 A;  3GLF B;  2MJ5 B;  2V1C A;  4X66 M;  2K0B X;  2HKJ A;  2K9D A;  2KW0 A;  4LRT A;  4M0D A;  3U61 A;  2WSC F;  1Q02 A;  1PM5 A;  3MK6 A;  2JZ0 A;  4LJ6 A;  1QVR A;  3U6D A;  4P17 A;  4NOO B;  1QDR A;  4BBA A;  5ITT A;  1JR3 A;  5KPT A;  4JI8 M;  3K8Z A;  2L4F A;  3T1H M;  1XXH A;  3SAV A;  2FH0 A;  3NWL A;  4LGM A;  2KA6 B;  4LRS A;  3GP1 A;  3ZCB B;  2UU9 M;  2Z4S A;  3HX3 A;  4FVM A;  5IWA M;  2JY8 A;  4DV1 M;  1KSF X;  3HWS A;  2QBY B;  5C1B A;  3W67 A;  5E26 A;  5F3W A;  3W0L B;  3GPU A;  4UN2 B;  3D8L A;  3M7G A;  1T43 A;  2DAI A;  4PCZ A;  2EA0 A;  3FRI A;  2OO9 A;  4L6V 6;  4LF5 M;  5IZ7 D;  4DR1 M;  3DFZ A;  1XMQ M;  3B7Z A;  3UGJ A;  3VDP A;  1N34 M;  5DFL A;  1WJ7 A;  3A46 A;  5IT9 S;  2EJS A;  1MX0 A;  5FSW A;  4AG5 A;  3HJQ A;  3W68 A;  3JR5 A;  2CP8 A;  3C58 A;  4GHA A;  2JUJ A;  2LHG A;  3BBZ A;  1SXJ C;  1VDD A;  2C99 A;  1TH3 A;  2RGO A;  1EE8 A;  3HHW A;  3M0E A;  3RGS A;  4A3V B;  2OQ4 A;  4KT0 F;  4DR7 M;  2I7P A;  4X62 M;  2KZS A;  1DGB A;  5EP3 A;  1OQY A;  4JI2 M;  4ZPX A;  3HZJ A;  3HU3 A;  4GEW A;  1TF0 B;  4II7 A;  5EXX A;  2R4E A;  1P3Q Q;  3GRU A;  5KPR A;  2XZU A;  2JWS A;  4B7F A;  1EFU B;  4DR2 M;  2OOA A;  2R6F A;  4DV5 M;  2D7G A;  2XH9 A;  1L1T A;  4JI4 M;  2QPA A;  3B9P A;  3C3D A;  3SAT A;  2Z7J A;  3B89 A;  1YLA A;  3E4R A;  4LZJ A;  1V33 A;  5ITU A;  4M9S A;  2GNO A;  4I4L A;  1QAM A;  1R2Z A;  4G6Z A;  5IRE B;  3FTD A;  3SAW A;  2LNH C;  4OVZ A;  2KHH A;  3I01 M;  3VFD A;  3IG5 A;  2D7E A;  4GRI A;  4WUR A;  3U6M A;  1NHW C;  5EXS A;  1SXJ B;  3B7Q A;  2AHM A;  2DHR A;  1VG5 A;  2WSF F;  3LCV B;  4FWG A;  2H1R A;  2F5P A;  4XK8 F;  4DR6 M;  1WGN A;  2MRO B;  2XGN A;  3KS8 A;  3FTF A;  1L1Z A;  1YE9 A;  4YHH M;  1IN7 A;  3HHZ A;  2KEB A;  5GKN A;  3C9P A;  3TWM A;  2BJW A;  2JY7 A;  2BWB A;  2HWJ A;  3HGI A;  1IBK M;  4JI5 M;  1YSY A;  2BWE A;  5KPZ A;  5FTK A;  3AJI B;  2OPF A;  4NSR A;  3VKG A;  3I4V A;  3QYB A;  2Z3X A;  2X49 A;  4S12 A;  1HT1 E;  1JQJ C;  2R0I A;  5H37 D;  2K47 A;  4D80 A;  3KSX A;  2XSZ D;  2LVQ D;  3QYE A;  3QAU A;  3L28 A;  3THG A;  1IN6 A;  2DAK A;  2F5N A;  3GLH B;  2XZF A;  4QOS A;  3SHF A;  2C5R A;  3AL0 C;  4DR3 M;  1N75 A;  1PRB A;  3BOS A;  4HLQ A;  4B3M M;  1SXJ E;  4LJA A;  2ZAN A;  4JI3 M;  2C9O A;  1BVS A;  3AOE A;  2G8L A;  1IQP A;  2WZJ A;  2D7H A;  3QWL A;  4FWH A;  4W5W A;  4WW0 A;  4KOD A;  4LFA M;  2YR0 A;  3GRV A;  7CAT A;  4NRW A;  4AKG A;  5C18 A;  2KRU A;  3E46 A;  2L7H A;  3RE8 A;  3SHG B;  2JNH A;  4JYA M;  3HHX A;  4AW4 A;  1AUA A;  2R18 A;  4NL4 H;  1QAN A;  4LF6 M;  4IBG A;  4LJ9 A;  2MGW A;  4QNR A;  3MMP A;  2HHH M;  1MJG M;  1ZQ9 A;  1IXZ A;  1UFZ A;  2Y21 A;  4GC9 A;  2LVN C;  4XBO A;  2DWM A;  3KOX E;  1DGH A;  4AZF A;  1N32 M;  2DXI A;  1OTR A;  3EIH A;  2QZ4 A;  1D0M A;  1MN3 A;  3KOZ E;  1GAB A;  3VLF B;  4FWD A;  1G41 A;  3T38 A;  3VDU A;  2M5Z A;  4RF0 A;  4X65 M;  3KW6 A;  1CUK A;  2VF8 A;  1GJT A;  1ZMU A;  5ITQ A;  3U61 B;  2KDL A;  2ZAM A;  3KP0 E;  1QZE A;  4DR5 M;  1PJJ A;  1OKS A;  3L29 A;  3L2A A;  4G3O A;  5A2Q S;  3DA1 A;  1K3W A;  3FUX A;  3FTE A;  3GLI A;  1ZV1 A;  5BR8 M;  4F1I A;  1XXH B;  2DZL A;  2VF7 A;  1TR8 A;  3A98 B;  3HJ8 A;  3TE6 A;  4YY3 M;  4B7G A;  1SG9 A;  1R2Y A;  1NO1 A;  1XNQ M;  4I81 A;  3LMM A;  3FD9 A;  2X4A A;  1NY5 A;  3FRH A;  4REZ A;  3W0F A;  1X37 A;  2F4V M;  1NJF A;  3V76 A;  2XLJ A;  2GQF A;  3K9P A;  1K3X A;  3RFW A;  2CV2 A;  1VDL A;  2L09 A;  1QUS A;  2MR9 A;  3LQR A;  2EKK A;  4WP2 A;  1G59 A;  2QEN A;  4DV2 M;  3CGW A;  1XC8 A;  3MJ5 A;  4DUZ M;  4MGK E;  2LBC A;  1OFH A;  3BXW A;  4NRV A;  4DV3 M;  2VQE M;  1VQ1 A;  3TL4 X;  2HCB A;  1N77 A;  4B3R M;  1LV7 A;  2DHY A;  1L2B A;  3GLG A;  3J7B A;  3SMP A;  1JR3 E;  4AQY M;  5FTJ A;  3VK7 A;  1IY2 A;  2FS1 A;  2QCU A;  3U6Q A;  3U5Z A;  1XXH E;  2DNA A;  2L6O A;  2UXC M;  3U60 A;  3K9O A;  2V6Z M;  4Z6Y A;  4IBB A;  5KQD A;  4PDG A;  3PFI A;  4Q7J A;  2DVW B;  4RNA A;  1V92 A;  3B7N A;  4IJF A;  5ITR A;  1QAQ A;  2FOI C;  3IG8 A;  4RKU F;  2KZU A;  2ZM6 M;  3T15 A;  1DO0 A;  1QAO A;  4FW9 A;  5EXT A;  4AKI A;  1PJT A;  2NQ8 C;  2QNJ A;  4KO8 A;  1NJG A;  1GO5 A;  1OIP A;  3VK8 A;  5L8R F;  1HNX M;  4CIS A;  4CJ6 A;  1R5L A;  3J7A S;  3DOA A;  4DV4 M;  1Q3B A;  5KQ8 A;  2CHV A;  1OAI A;  1Z6T A;  4OVZ B;  3U6O A;  3SYL A;  3E21 A;  2KNA A;  2UXD M;  3HY5 A;  2P5T A;  1J7K A;  2W82 A;  5JI3 E;  4P16 A;  2DWL A;  4LG2 A;  4DR4 M;  2R62 A;  2LXE A;  2YQZ A;  3GRR A;  3AOE C;  4AG6 A;  5ITY A;  3HKP A;  1WR1 B;  2L7I A; 
#chains in the Genus database with same CATH homology
 4D81 A;  1XNR M;  3KDS E;  4JI1 M;  2F5Q A;  1IM2 A;  5DYG A;  4LJ7 A;  5KO3 A;  3FKE A;  4PT5 A;  1R6B X;  2R65 A;  4PDI A;  4MGZ E;  2VII A;  4M0W A;  4OW0 A;  3KOW E;  2LWX A;  2CHG A;  4I5S A;  4JV5 M;  4LF8 M;  1N78 A;  1IY1 A;  1R7R A;  3GQ3 A;  4JI7 M;  4L8R C;  2CV0 A;  4GKK M;  3NBI A;  1HT2 E;  4QOZ C;  3AV0 A;  2EUC A;  4CHT B;  4OU7 A;  2XSZ A;  3FYC A;  2DZN B;  2BNK A;  4LY6 A;  3FUU A;  4GH9 A;  3HJS A;  1KFV A;  1SXJ D;  3K1J A;  1G3I A;  2CE7 A;  2KXE A;  4IBF A;  1Z5B A;  1H6U A;  3Q8X A;  4L15 A;  4LJ5 A;  1L2C A;  4LZZ A;  1DGG A;  1T3T A;  1OFI A;  1Q39 A;  3SC3 A;  1W5T A;  2R45 A;  2J7N A;  5BPV A;  1NNU C;  1TH2 A;  4QHT A;  4L78 A;  3EIE A;  2E5L M;  4GHL A;  2DWZ B;  5EP2 A;  3TWK A;  2CUZ A;  1Z5A A;  2Y0Q A;  1DGH B;  2R4J A;  2UUC M;  1GLN A;  1GVN A;  3GPX A;  2C9C A;  2FNA A;  1ORY B;  3ILK A;  5EQT A;  2G5G X;  4LF7 M;  2Q2E B;  2XF3 A;  4G4Q A;  3GLH A;  5EP1 A;  3M6A A;  4DV7 M;  4B3T M;  2ERC A;  4LJ8 A;  3UK6 A;  3KSJ A;  3SAR A;  2O5R A;  4DV0 M;  3AKZ A;  4B08 A;  3GLI B;  2FE8 A;  3A42 A;  5E6J A;  3SBJ A;  4I8O A;  4QNM A;  2F5S A;  3PVS A;  1DO2 A;  5FTL A;  3A45 A;  4LF4 M;  3AOG A;  3GRY A;  4NXN M;  4EIW A;  2DWN A;  1G8P A;  4IJE A;  3D8B A;  3FYD A;  5EP4 A;  1HR0 M;  2DZO B;  3HU1 A;  1C1K A;  4NSO B;  4G4N A;  1QYR A;  3OTO M;  3U6E A;  3VKH A;  1XHB A;  2HL7 A;  2R46 A;  2Z4R A;  2VQF M;  4TUW A;  2A5Y B;  1D2N A;  3JAM S;  2Y0T A;  3GLF A;  3R8F A;  3HHY A;  3PXG A;  3SAU A;  3U6C A;  4R7G A;  4D82 A;  3KFU G;  3HU2 A;  1JR3 D;  4MM3 B;  3GLG B;  4FCV A;  4IBC A;  2KRK A;  3R9X B;  4LCB A;  3PNV A;  5EXP A;  4PD2 A;  3U5Z B;  1L2D A;  1TDH A;  3TQS A;  3CF2 A;  4MB7 A;  2JA2 A;  1Z5C A;  3U60 B;  4MGI E;  1NVM A;  4K0K M;  4AI6 A;  4LF9 M;  4FCW A;  2EO2 A;  2UUA M;  4M9Z A;  2UUB M;  1E32 A;  2CFO A;  3LVV A;  4IBJ A;  1GKI A;  5DYI A;  4BLC A;  2C98 A;  1UM8 A;  4LFC M;  1PJI A;  1QZM A;  1WXQ A;  2ZAO A;  2QBY A;  4B7H A;  1IN8 A;  5JI2 E;  4QHS A;  8CAT A;  1GL7 A;  1K82 A;  3WHK A;  3J27 B;  1XMO M;  3KVW A;  3SAS A;  2CEA A;  4LJ4 A;  4MH0 E;  4ITQ A;  2CV1 A;  2J7O A;  3TPZ A;  1E94 E;  2X8A A;  4M9X A;  5FTM A;  3H4M A;  1DGF A;  4FD2 A;  1HQY E;  3KOY E;  3L26 A;  1NNJ A;  2QP9 X;  3FUT A;  2V1U A;  1QQW A;  2YFQ A;  4NXM M;  4B3S M;  3J2P B;  1NHG C;  1E9S A;  3ZH9 B;  3WHL A;  3GQ5 A;  2I7N A;  3UMM A;  5DNY A;  1FNN A;  2XFT A;  1Z59 A;  3I4Y A;  1N33 M;  1IBM M;  1E9R A;  3PNY A;  3FUW A;  3CTW B;  3AFH A;  2CHQ A;  3FUV A;  4FCT A;  2XFS A;  3J81 S;  1IBL M;  3SYK A;  4GKJ M;  4GC5 A;  1NY6 A;  3LQQ A;  4BB9 A;  2RGH A;  4JN6 A;  2LH0 A;  4L16 A;  5EJC A;  4HL4 A;  1TGU A;  3J80 S;  3SMS A;  4MGY E;  2ZBK B;  4GIP A;  1G4A E;  4RF1 A;  5ITX A;  3GPP A;  3FTC A;  3UJN A;  4JI6 M;  4MGH A;  4XGI A;  5FTN A;  3T1Y M;  1J5E M;  1IXS B;  1S3S A;  2Y20 A;  3L27 A;  1SXJ A;  3K2L A;  3K92 A;  4IBE A;  4OX9 M;  1Q3C A;  1XWI A;  2RKO A;  1W5S A;  1L8Q A;  2YNM D;  3CF0 A;  1HNZ M;  3KXE C;  1OJL A;  5LMU M;  1IY0 A;  4IIW A;  2F5O A;  2BJV A;  3MHV C;  1MU5 A;  3JR4 A;  3LVW A;  3GO8 A;  3CF6 E;  3KP1 E;  4R3D A;  3DZD A;  5ITX E;  2M60 A;  4GIT A;  3ZC7 B;  1TDZ A;  1N36 M;  4JI0 M;  3U6S A;  1HQC A;  1I94 M;  2UXB M;  4X64 M;  4JXJ A;  4LGY A;  4Z8X A;  5FLX S;  5LMN M;  3TWL A;  4L4U A;  1J09 A;  4KHP M;  4G4O A;  1IXR C;  3UZU A;  4CGY B;  4AKH A;  4LFB M;  4IBI A;  1ZAE A;  4IBK A;  4G4R A;  1YUB A;  1IN5 A;  4IBD A;  1GL6 A;  1I4W A;  1NSF A;  4DUY M;  1FJG M;  1IN4 A;  1TH4 A;  2XEP A;  3U6L A;  3GPY A;  3I51 A;  3KS4 A;  3GQ4 A;  4KLN A;  3RGP A;  1KYI A;  2FFJ A;  4GMQ A;  3SFZ A;  3L25 A;  1HNW M;  3E9S A;  4DV6 M;  2C96 A;  3GLF B;  2V1C A;  4X66 M;  2HKJ A;  2KW0 A;  4LRT A;  4M0D A;  3U61 A;  1PM5 A;  3MK6 A;  4LJ6 A;  1QVR A;  3U6D A;  4NOO B;  4BBA A;  5ITT A;  1JR3 A;  5KPT A;  4JI8 M;  3K8Z A;  3T1H M;  1XXH A;  3SAV A;  3NWL A;  4LGM A;  2KA6 B;  4LRS A;  3GP1 A;  3ZCB B;  2UU9 M;  2Z4S A;  5IWA M;  4FVM A;  4DV1 M;  1KSF X;  3HWS A;  2QBY B;  5C1B A;  5E26 A;  5F3W A;  3W0L B;  3GPU A;  3D8L A;  3M7G A;  4PCZ A;  2EA0 A;  4LF5 M;  5IZ7 D;  4DR1 M;  3DFZ A;  1XMQ M;  3UGJ A;  3VDP A;  1N34 M;  3A46 A;  5IT9 S;  1MX0 A;  5FSW A;  4AG5 A;  3HJQ A;  3JR5 A;  3C58 A;  4GHA A;  1SXJ C;  1VDD A;  2C99 A;  1TH3 A;  2RGO A;  1EE8 A;  3HHW A;  3M0E A;  3RGS A;  4A3V B;  2OQ4 A;  4DR7 M;  2I7P A;  4X62 M;  2KZS A;  1DGB A;  5EP3 A;  4JI2 M;  4ZPX A;  3HU3 A;  5EXX A;  4II7 A;  2R4E A;  3GRU A;  5KPR A;  2XZU A;  4B7F A;  4DR2 M;  4DV5 M;  2D7G A;  2XH9 A;  1L1T A;  4JI4 M;  2QPA A;  3B9P A;  3SAT A;  2Z7J A;  3E4R A;  4LZJ A;  5ITU A;  4M9S A;  4I4L A;  1QAM A;  1R2Z A;  4G6Z A;  5IRE B;  3FTD A;  3SAW A;  2LNH C;  4OVZ A;  3VFD A;  3IG5 A;  2D7E A;  4GRI A;  4WUR A;  3U6M A;  1NHW C;  5EXS A;  1SXJ B;  2AHM A;  2DHR A;  4FWG A;  4DR6 M;  2H1R A;  2F5P A;  2XGN A;  3KS8 A;  3FTF A;  1L1Z A;  1YE9 A;  4YHH M;  1IN7 A;  3HHZ A;  2KEB A;  5GKN A;  3TWM A;  2BJW A;  3HGI A;  1IBK M;  4JI5 M;  1YSY A;  5KPZ A;  5FTK A;  3AJI B;  2OPF A;  4NSR A;  3VKG A;  3I4V A;  2Z3X A;  2X49 A;  4S12 A;  1HT1 E;  1JQJ C;  5H37 D;  2K47 A;  4D80 A;  3KSX A;  2XSZ D;  3QAU A;  3L28 A;  3THG A;  1IN6 A;  2F5N A;  3GLH B;  2XZF A;  4QOS A;  3SHF A;  2C5R A;  3AL0 C;  4DR3 M;  1N75 A;  4HLQ A;  3BOS A;  4B3M M;  1SXJ E;  4LJA A;  2ZAN A;  4JI3 M;  2C9O A;  3AOE A;  2G8L A;  1IQP A;  4FWH A;  2D7H A;  3QWL A;  4W5W A;  4LFA M;  4WW0 A;  4KOD A;  4NRW A;  2YR0 A;  3GRV A;  7CAT A;  4AKG A;  5C18 A;  2KRU A;  3RE8 A;  2L7H A;  3SHG B;  4JYA M;  3HHX A;  4AW4 A;  2R18 A;  4NL4 H;  1QAN A;  4LF6 M;  4IBG A;  4LJ9 A;  4QNR A;  2HHH M;  1ZQ9 A;  1IXZ A;  4GC9 A;  2Y21 A;  2DWM A;  4XBO A;  1N32 M;  3KOX E;  1DGH A;  4AZF A;  2DXI A;  3EIH A;  2QZ4 A;  3KOZ E;  3VLF B;  4FWD A;  1G41 A;  3T38 A;  3VDU A;  2M5Z A;  4RF0 A;  4X65 M;  3KW6 A;  5ITQ A;  3U61 B;  2ZAM A;  4DR5 M;  3KP0 E;  1PJJ A;  3L29 A;  3L2A A;  5A2Q S;  3DA1 A;  1K3W A;  3FUX A;  3FTE A;  3GLI A;  5BR8 M;  1XXH B;  3A98 B;  1R2Y A;  3HJ8 A;  3TE6 A;  4YY3 M;  4B7G A;  1XNQ M;  4AKI A;  4I81 A;  3LMM A;  3FD9 A;  2X4A A;  1NY5 A;  4REZ A;  3W0F A;  1X37 A;  2F4V M;  1NJF A;  2XLJ A;  1K3X A;  3RFW A;  2CV2 A;  2L09 A;  3LQR A;  1G59 A;  2QEN A;  4DV2 M;  1XC8 A;  3MJ5 A;  4DUZ M;  4MGK E;  1OFH A;  4NRV A;  4DV3 M;  2VQE M;  3TL4 X;  2HCB A;  1N77 A;  4B3R M;  1LV7 A;  1L2B A;  3GLG A;  3J7B A;  3SMP A;  4AQY M;  5FTJ A;  3VK7 A;  1IY2 A;  2QCU A;  3U6Q A;  3U5Z A;  2L6O A;  2UXC M;  3U60 A;  5KQD A;  2V6Z M;  4Z6Y A;  4IBB A;  4PDG A;  3PFI A;  2DVW B;  4RNA A;  4IJF A;  5ITR A;  1QAQ A;  2FOI C;  3IG8 A;  2KZU A;  2ZM6 M;  3T15 A;  1DO0 A;  1QAO A;  4FW9 A;  5EXT A;  2NQ8 C;  4KO8 A;  1NJG A;  3VK8 A;  1HNX M;  4CIS A;  3J7A S;  3DOA A;  4DV4 M;  1Q3B A;  5KQ8 A;  2CHV A;  1Z6T A;  4OVZ B;  3U6O A;  3SYL A;  2UXD M;  2P5T A;  1J7K A;  2W82 A;  5JI3 E;  4P16 A;  2DWL A;  4LG2 A;  4DR4 M;  2R62 A;  2LXE A;  2YQZ A;  3GRR A;  3AOE C;  4AG6 A;  5ITY A;  3HKP A;  3U6P A;  2L7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...