5IT9S

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
145
Chain Sequence
b'SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
molecule tags Ribosome
source organism Cricket paralysis virus
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
total genus 24
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5it9S01
4LF6M 5ITXE 2UUCM 4YY3M 2F5OA 5A2QS 4DV2M 4DV7M 3W0FA 5ITXA 4JI4M 1XNQM 3J7AS 4YHHM 1R2ZA 3JAMS 3SAVA 3U6LA 5FLXS 2HKJA 3U6CA 1K3WA 3SAWA 1PM5A 1FJGM 3A42A 3C58A 1HNZM 4LF4M 3VK8A 1L2CA 1XNRM 1L2BA 5LMUM 2F5PA 2OPFA 2UUBM 4DV5M 1HNWM 2UXCM 2EA0A 5ITRA 4JI6M 4MB7A 4DV3M 1MU5A 4DV6M 4K0KM 4JI8M 1PJIA 3A45A 3A46A 1IBKM 3U6SA 4PD2A 1N32M 3GQ3A 4JV5M 1XC8A 1XMQM 4NRVA 3JR4A 3T1HM 2XZFA 3VK7A 4DR6M 3U6PA 4G4OA 4DR4M 1K3XA 4AQYM 4DR1M 4DV4M 2UU9M 4LFCM 1EE8A 4GKJM 3U6MA 3U6DA 3GP1A 3T1YM 1IBMM 4DUYM 2F5QA 4KHPM 3SAUA 1Z5BA 4G4NA 3SBJA 1K82A 4JI1M 1L2DA 1HR0M 2F4VM 2UXDM 3TWKA 2VQFM 4DR2M 4LF5M 3TWLA 4X66M 4GKKM 4X62M 3DOAA 4NXNM 4DV1M 1Q3CA 4LFAM 4X65M 1N36M 2F5SA 1J5EM 4B3MM 2ZM6M 4X64M 4JI5M 5ITYA 3JR5A 4DR7M 5ITQA 3GQ4A 3SASA 3U6OA 2HHHM 1I94M 3SATA 3SARA 4PDIA 3GPXA 1HNXM 1IBLM 5BR8M 1TDHA 2UUAM 4B3TM 4JYAM 2XZUA 4LF8M 1Z5AA 1L1TA 2E5LM 1Q39A 4B3RM 2Q2EB 1NNJA 5ITUA 4LF9M 1L1ZA 2OQ4A 4JI2M 4DR5M 3TWMA 4CISA 4JI7M 2VQEM 4JI0M 1Z5CA 4B3SM 4LFBM 2F5NA 4JI3M 3U6QA 4NXMM 4NRWA 3GO8A 1N33M 1Z59A 4ITQA 3OTOM 2UXBM 4PCZA 5ITTA 3GPPA 5IWAM 1PJJA 1Q3BA 4LF7M 4DR3M 1MX0A 4DV0M 1N34M 3J81S 4G4RA 4DUZM 4G4QA 3GQ5A 5LMNM 4PDGA 3GPYA 2ZBKB 3U6EA 1TDZA 1KFVA 4OX9M 3GPUA 5IT9S 1R2YA 1XMOM 3J80S
chains in the Genus database with same CATH superfamily
4GITA 3AL0C 3I01M 4YY3M 2F5OA 1UM8A 1QZEA 2D7EA 4DV2M 4KT0F 3FD9A 3SFZA 3AKZA 3SYKA 5ITXA 2GNOA 4JI4M 1OTRA 3HJSA 4L16A 3GRUA 2KXEA 4YHHM 2JY7A 1NO1A 1R2ZA 4KO8A 2MGWA 3Q8GA 4M9XA 2J7OA 2KZSA 5FLXS 3K2LA 2LH0A 3IECA 1D0LA 3K9PA 4M9SA 3A42A 3GRYA 1W5TA 2DNAA 2C9CA 3GLIA 1FJGM 1KSFX 2L7IA 5LMUM 1GKIA 2KRKA 3VKGA 2MJ5B 2X8AA 5ITRA 1GVNA 4IBEA 1IXZA 4DV3M 1MU5A 3NBXX 5KPTA 1QYRA 3A45A 2G3QA 1TGUA 3A46A 4G3OA 4R3DA 1NV8A 4B7GA 3GLGE 2XH9A 1GJSA 3M7GA 3GQ3A 3PNYA 2JY5A 2Z4SA 3SC3A 1JR3D 5E26A 2QNJA 5EXPA 5KPZA 3SHGB 4DV4M 4AKHA 2ZANA 1EE8A 4FCWA 4LFCM 3U6MA 1IM2A 3GP1A 1WGLA 1IBMM 4DUYM 1WJ7A 2CEAA 3EIHA 4LJAA 1QAMA 4KHPM 2R18A 4JI1M 2RGOA 4FW9A 1L2DA 2YQZA 2UXDM 5KQ8A 3KXEC 4X62M 3DOAA 1IN8A 4X65M 4QHTA 2JY6B 2P5TA 1WXQA 4LGMA 2FS1A 3QWLA 2OOAA 2JUJA 5ITYA 2Y20A 2MR9A 1E32A 3JR5A 2KNVA 2VDBB 1DGHA 4IJEA 3GQ4A 3K9OA 1J7KA 3UK6A 4AG6A 3BOSA 1IN6A 1OFHA 5FTNA 4D81A 3SATA 3NBIA 3SARA 4AKGA 1HNXM 2Y21A 2RRUA 2C98A 1IN7A 2VIIA 3ZCBB 2YNMD 2V6ZM 3TE6A 4LF8M 1J09A 3VFDA 2R44A 3UMMA 5KPRA 4IBJA 4TUWA 2FE8A 4CGYB 3TQSA 1IFYA 3IHPA 1XB2B 4ZPXA 4JI2M 2Z7JA 3TWMA 1YE9A 2C9OA 3FTFA 2VQEM 4JI0M 1V92A 1Z5CA 3MMPA 2QZ4A 4W5WA 2ZAOA 1D0KA 1DO0A 5IZ7D 3HHXA 4JI3M 2EUCA 2DWNA 4QOZC 2LVPC 3LCUA 4IBCA 1N33M 4I81A 1D2NA 3KDSE 1QQWA 2L6OA 4FWDA 5H37D 2L4EA 2LNHC 1NSFA 3M6AA 3AJIB 2CWBA 1DO2A 1YUBA 3HJ8A 4G4QA 1MJGM 3GQ5A 4WW0A 3GPYA 3KOWE 1N78A 5FTJA 4AG5A 4DBGB 2QCUA 3KS4A 2R45A 3T15A 3J27B 3ZH9B 1KFVA 3KOZE 2DAEA 2GQFA 3ILKA 1R2YA 1TH2A 4LF6M 1SXJB 3VDPA 3FUWA 4GH9A 4CJ6A 1C1KA 4IBDA 2K6BA 4MGIE 2DHYA 3UZUA 4LRSA 4DV7M 1TF0B 1QVRA 1SXJD 2DZLA 1XHBA 2Y0TA 3T38A 2JXNA 4MGHA 2WZJA 3SYLA 3SAVA 1OIPA 1OAOC 1SXJA 1K3WA 1HNZM 3B7QA 3SAWA 1PM5A 3SHFA 4I5SA 2CHQA 2NQ8C 1Z6TA 2CUZA 4LF4M 2R62A 2YR0A 1QDRA 4RF0A 2QP9X 1HNWM 4L4UA 2EA0A 3THGA 4IBFA 4K0KM 1PJIA 1KYIA 1S3SA 4AKIA 1QAQA 2RKOA 2DAIA 1D0MA 2KDLA 4KLNA 2EJSA 3WHLA 1N32M 4F2LA 4FCTA 2Z3XA 1VEKA 2CHVA 2FFJA 1OAIA 3KOYE 3T1HM 4G4OA 4DR4M 4JXJA 3PFIA 1HT1E 2LHGA 4GKJM 3FUTA 1LTMA 3U6DA 1HT2E 1I4WA 3HWSA 3A98B 1G71A 3W68A 1V34A 1GLNA 1ZV1A 2AHMA 2KNAA 3U5ZA 3U60A 3SAUA 2XLJA 1XXHA 4G4NA 1K82A 4NC6A 3Q8XA 1HR0M 1QAOA 3R8FA 2F4VM 4NSOB 2VQFM 3AV0A 2Z8YM 3MJ5A 1DGGA 3IG8A 4L78A 3TWLA 3B7ZA 2V1CA 2I7NA 3TPZA 4GKKM 2LVOC 2YFQA 2CFOA 2ZAMA 1IXSB 4R7GA 4LFAM 3V76A 3ZC7B 1R5LA 4B7FA 1N36M 2F5SA 1J5EM 1G8PA 4OVZA 2DZOB 2CRUA 3QAUA 4LCBA 4IBIA 2EKFA 2Z4RA 3KSJA 4DR7M 2R46A 3FRIA 2K9DA 2QQ8A 3FTCA 2LVAA 4L8RC 3SASA 2BJVA 3W0LB 3GLHE 1L8QA 1I94M 5EXXA 2DAGA 2R0IA 3L2AA 4IBKA 4XGIA 2VF7A 1TR8A 3KVWA 5BR8M 4EIWA 2UUAM 4JYAM 4B3TM 2XZUA 1SXJE 4IBGA 2E5LM 1Q39A 1NNJA 4BBAA 1DV0A 4GRIA 4B7HA 1L1ZA 1Q02A 2OQ4A 4GHAA 5FTKA 2XEPA 2M5ZA 4DR5M 4CISA 4JI7M 1IN4A 3B89A 4KODA 2DWMA 1PJTA 2QSFX 1VDDA 2CHGA 3HX3A 2F5NA 5EQTA 4LJ7A 1LV7A 1XNRM 3VKHA 3U6QA 3I04M 4A3VB 2JWSA 3HHWA 3GO8A 2VF8A 1VEJA 1DGFA 2DWZB 3AOEA 3RE8A 1OIZA 2KW0A 3SMSA 4ITQA 3HU2A 4PCZA 2HCBA 1RU3A 5ITTA 3FYDA 4MM3B 3DZDA 4DR3M 1MX0A 4G4RA 2EO2A 3KOXE 4LY6A 1DGBA 2DAMA 2MH8A 3LCVB 3LW5F 4BLCA 2ZBKB 4D80A 4PDGA 3GLFE 1IXRC 1BVSA 2HAKA 3KP0E 3U6EA 2DVWB 3KFUG 2HL7A 5JI3E 1XXHE 1QUSA 3GLFA 2WSEF 2LHCA 2R6FA 4FWGA 3I4YA 1AIPC 2R4JA 3FTDA 4CHTB 5A2QS 2C5RA 2OO9A 3QYEA 3WHKA 1XWIA 1XNQM 3AOEC 3KSXA 1JB0F 3BBZA 3FUUA 3JAMS 1ZMVA 3B74A 5DFLA 1IY0A 4QOSA 4QHSA 3U6LA 3EIEA 4OW0A 2HKJA 1GO5A 3KP1E 2J7NA 3C58A 1TH4A 4RF1A 2D7GA 3VK8A 1PRBA 3E21A 4I4LA 3RGSA 1L2CA 4G6ZA 2F5PA 2QBYA 1EFUB 2JZ0A 2LTUA 2M60A 2CE7A 1SG9A 2L7HA 1HQYE 2ZTCA 3HY5A 2FH0A 4FD2A 2UUBM 2DZNB 2UXCM 1IXSA 2LBCA 2BWBA 4MB7A 2KZUA 2KEBA 1HJPA 2G5GX 4NOOB 1IY2A 4UN2B 1A5TA 3J2PB 4LJ9A 1IBKM 1PJQA 2DWLA 8CATA 4WP2A 2V1UA 3MHVC 4JI8M 3J7BA 1E94E 1N75A 2B3TA 3GLHB 1XMQM 2JP7A 4LJ4A 3R9XB 3FRHA 4DR6M 2JZ1A 1QANA 3U6PA 3CF0A 4AQYM 4BB9A 1NY6A 5EP4A 3CGWA 4ANRA 3T1YM 3L28A 2APLA 3L25A 4HL4A 1ORYB 4P16A 1VQ1A 2CV2A 4Q7JA 1Z5BA 1G4AE 1OFIA 2EKKA 3LVWA 3SMPA 1V33A 3RFWA 1OQYA 4DR2M 2CP8A 5C18A 4LRTA 1NNUC 4FWHA 3HJQA 4DV1M 3C9PA 1IY1A 1E9RA 4B3MM 4JI5M 3LQRA 4AZFA 4LG2A 4QNMA 3L26A 2QBYB 1QUTA 2DAKA 2QENA 4P17A 4PT5A 5ITQA 1GABA 1NY5A 3IG5A 1R6BX 5EP1A 3BXWA 1G3IA 4PDIA 3HHYA 3GPXA 1IBLM 2L2DA 1N77A 1WGNA 3UJNA 2DHRA 2DENA 2WSFF 5DNYA 1TDHA 3PVSA 2W82A 5FTLA 4GC9A 2I7PA 4FCVA 2Y0QA 1L1TA 2H5XA 1GJTA 3GLGB 3C3DA 2BNKA 2C96A 2CV1A 2DXIA 2BWEA 2Q2EB 4MGZE 2JA2A 2WSCF 3HGIA 2R4EA 1P3QQ 4F1IA 5DYGA 2LVQD 1EIJA 1H6UA 4B3SM 4LGYA 3PNVA 2QPAA 3GLHA 1F4IA 2KHHA 1R7RA 4M0DA 5L8RF 1G41A 4Z8XA 3LQQA 3TL4X 3OTOM 5C1BA 1PJJA 3E4RA 4LF7M 1YLAA 4NL4H 1N34M 1MN3A 1AUAA 1XXHB 2KA6B 1JQJC 3AOGA 3HZJA 4AW4A 2RGHA 2G8LA 2ZTDA 1T6OA 3U61A 1DGHB 3GRRA 1T43A 4LZJA 1VDLA 3GPUA 5IT9S 1QZMA 5IREB 2H1RA 4LJ6A 1WIVA 4JN6A 3J80S 5ITXE 2QHOB 2UUCM 1IQPA 3U60B 3U5ZB 1NVMA 4L6V6 3K8ZA 3DA1A 1NHWC 3W0FA 2XGNA 4XK8F 5DYIA 3LMMA 2BJWA 3GLGA 3J7AS 3RGPA 1NHGC 3E46A 4MH0E 1NJGA 5EP2A 2O5RA 4II7A 2CV0A 1Y8GA 4D82A 4HLQA 3U6CA 4LZZA 1W5SA 2XSZD 3C3EA 4XBOA 3CF6E 1TTEA 2D7HA 1L2BA 3K1JA 5BPVA 5EP3A 2OPFA 1HQCA 4DV5M 1ZMWA 2XFTA 1VEGA 1YSYA 1E9SA 4DV6M 4JI6M 4Y28F 2HWJA 3FKEA 3K92A 4WURA 4PD2A 3CTWB 4OU7A 3U6SA 2MROB 4GHLA 1JR3A 2OOBA 4JV5M 1XC8A 4I8OA 4NRVA 4S12A 1ZMUA 2JNHA 3H4MA 4LJ5A 1OJLA 3JR4A 3B7NA 3FUVA 5KQDA 3VK7A 2XZFA 1K3XA 2LXEA 4DR1M 2UU9M 5JI2E 3I4VA 1NV9A 4GEWA 5FSWA 2JY8A 3PXGA 5KO3A 2F5QA 3SBJA 1FNNA 4R71A 3TWKA 3AFHA 4LF5M 3MK6A 2FNAA 4X66M 4CIZA 5FTMA 2FOIC 3I51A 4NXNM 1Q3CA 4NSRA 2K47A 3HKPA 1GL7A 4M0WA 4RNAA 2XF3A 3UGJA 2L4FA 2ZM6M 2DKLA 3GRVA 4X64M 2J5YA 4GC5A 3QYBA 2L09A 3D8BA 1UFZA 2LWXA 3LVVA 4GIPA 1CUKA 3GLIE 5F3WA 1X37A 1NJFA 1WR1B 4M9ZA 3U6OA 1SXJC 2HHHM 7CATA 5EXTA 3FUXA 3FE3A 4MGYE 3F92A 3HU3A 1C7YA 1PJSA 3FTEA 4AI6A 1GL6A 4MGKE 2XSZA 1TH3A 2ERCA 3KW6A 1Z5AA 3U61B 2DI0A 4QNRA 4REZA 4LJ8A 1JR3E 4IBBA 2N35A 5EXSA 4L15A 3HHZA 4HEOA 4IJFA 4B3RM 5ITUA 2O01F 4LF9M 1WHCA 3VLFB 4B08A 3GLIB 2XFSA 5EJCA 1QDTA 4LFBM 3GLFB 1OKSA 3D8LA 4GMQA 2X4AA 4IIWA 2KNZA 1ZQ9A 3DFZA 4RKUF 3B9PA 4FVMA 1G59A 4NRWA 4NXMM 2K0BX 5E6JA 3CF2A 3NWLA 3H4JA 1PGYA 3L27A 1Z59A 3FYCA 5GKNA 3KS8A 2UXBM 3GPPA 5IWAM 2LVNC 1Q3BA 2X49A 3T6PA 4DV0M 2R65A 3J81S 1ZAEA 4OVZB 4DUZM 1T3TA 3L29A 5LMNM 4Z6YA 3VDUA 1TDZA 3HU1A 1VG5A 2C99A 1IN5A 4OX9M 3ZQJA 2O25A 3W67A 2A5YB 1R4GA 1XMOM 2KRUA 3E9SA 3M0EA
chains in the Genus database with same CATH topology
4GITA 3AL0C 4YY3M 2F5OA 1UM8A 2D7EA 4DV2M 3FD9A 3SFZA 3AKZA 3SYKA 5ITXA 4JI4M 3HJSA 4L16A 3GRUA 2KXEA 4YHHM 1R2ZA 4KO8A 4M9XA 2J7OA 2KZSA 5FLXS 3K2LA 2LH0A 4M9SA 3A42A 3GRYA 1W5TA 3GLIA 2C9CA 1FJGM 1KSFX 2L7IA 5LMUM 1GKIA 2KRKA 3VKGA 2X8AA 5ITRA 1GVNA 4IBEA 1IXZA 4DV3M 1MU5A 5KPTA 1QYRA 3A45A 1TGUA 3A46A 4R3DA 4B7GA 2XH9A 3M7GA 3GQ3A 3PNYA 2Z4SA 3SC3A 1JR3D 5E26A 5EXPA 5KPZA 3SHGB 4DV4M 4AKHA 2ZANA 1EE8A 4FCWA 4LFCM 3U6MA 1IM2A 3GP1A 1IBMM 4DUYM 3EIHA 2CEAA 4LJAA 1QAMA 4KHPM 2R18A 4JI1M 2RGOA 4FW9A 1L2DA 2YQZA 2UXDM 5KQ8A 3KXEC 4X62M 3DOAA 1IN8A 4X65M 4QHTA 2P5TA 1WXQA 4LGMA 3QWLA 5ITYA 2Y20A 1E32A 3JR5A 1DGHA 4IJEA 3GQ4A 1J7KA 3UK6A 4AG6A 3BOSA 1IN6A 1OFHA 5FTNA 4D81A 3SATA 3NBIA 3SARA 4AKGA 1HNXM 2Y21A 2C98A 1IN7A 2VIIA 3ZCBB 2YNMD 2V6ZM 3TE6A 4LF8M 1J09A 3VFDA 3UMMA 5KPRA 4IBJA 4TUWA 2FE8A 4CGYB 3TQSA 4JI2M 4ZPXA 2Z7JA 3TWMA 1YE9A 2C9OA 3FTFA 2VQEM 4JI0M 1Z5CA 4W5WA 2QZ4A 2ZAOA 1DO0A 5IZ7D 3HHXA 4JI3M 2EUCA 2DWNA 4QOZC 4IBCA 1N33M 4I81A 1D2NA 3KDSE 1QQWA 2L6OA 4FWDA 5H37D 2LNHC 1NSFA 3M6AA 3AJIB 1DO2A 1YUBA 3HJ8A 4G4QA 3GQ5A 4WW0A 3GPYA 3KOWE 1N78A 5FTJA 4AG5A 2QCUA 3KS4A 2R45A 3T15A 3J27B 3ZH9B 1KFVA 3KOZE 1R2YA 3ILKA 1TH2A 4LF6M 1SXJB 3VDPA 3FUWA 4GH9A 1C1KA 4IBDA 4MGIE 3UZUA 4LRSA 4DV7M 1QVRA 1SXJD 1XHBA 2Y0TA 3T38A 4MGHA 3SYLA 3SAVA 1SXJA 1K3WA 3SAWA 1PM5A 3SHFA 4I5SA 2CHQA 2NQ8C 1Z6TA 2CUZA 4LF4M 2R62A 2YR0A 4RF0A 2QP9X 1HNWM 4L4UA 2EA0A 3THGA 4IBFA 4K0KM 1PJIA 1KYIA 1S3SA 4AKIA 1QAQA 2RKOA 4KLNA 1N32M 3WHLA 4FCTA 2Z3XA 2CHVA 3KOYE 2FFJA 3T1HM 4G4OA 4DR4M 4JXJA 3PFIA 1HT1E 4GKJM 3FUTA 3U6DA 1HT2E 1I4WA 3HWSA 3A98B 1GLNA 2AHMA 3U5ZA 3U60A 3SAUA 2XLJA 1XXHA 4G4NA 1K82A 3Q8XA 1HR0M 1QAOA 3R8FA 2F4VM 4NSOB 2VQFM 3AV0A 3MJ5A 3TWLA 1DGGA 3IG8A 4L78A 2V1CA 2I7NA 3TPZA 4GKKM 2YFQA 2CFOA 2ZAMA 1IXSB 4R7GA 4LFAM 3ZC7B 4B7FA 1N36M 2F5SA 1J5EM 1G8PA 4OVZA 2DZOB 3QAUA 4LCBA 4IBIA 2Z4RA 3KSJA 4DR7M 2R46A 3FTCA 4L8RC 3SASA 2BJVA 3W0LB 1L8QA 1I94M 5EXXA 3L2AA 4IBKA 4XGIA 3KVWA 5BR8M 4EIWA 2UUAM 4JYAM 4B3TM 2XZUA 1SXJE 4IBGA 2E5LM 1Q39A 1NNJA 4BBAA 4GRIA 4B7HA 1L1ZA 2OQ4A 4GHAA 5FTKA 2XEPA 2M5ZA 4DR5M 4CISA 4JI7M 1IN4A 4KODA 2DWMA 1VDDA 2CHGA 1XNRM 2F5NA 5EQTA 4LJ7A 1LV7A 3VKHA 3U6QA 4A3VB 3HHWA 3GO8A 2DWZB 1DGFA 3AOEA 3RE8A 2KW0A 3SMSA 4ITQA 3HU2A 4PCZA 2HCBA 5ITTA 3FYDA 4MM3B 3DZDA 4DR3M 1MX0A 4G4RA 2EO2A 3KOXE 4LY6A 1DGBA 4D80A 4BLCA 4PDGA 2ZBKB 3U6EA 1IXRC 3KP0E 2DVWB 3KFUG 2HL7A 5JI3E 3GLFA 4FWGA 3I4YA 2R4JA 3FTDA 4CHTB 5A2QS 2C5RA 3WHKA 1XWIA 1XNQM 3AOEC 3KSXA 3FUUA 3JAMS 1IY0A 4QOSA 4QHSA 3U6LA 3EIEA 4OW0A 2HKJA 3KP1E 2J7NA 3C58A 1TH4A 4RF1A 2D7GA 3VK8A 4I4LA 3RGSA 1L2CA 1HNZM 2QBYA 4G6ZA 2F5PA 2M60A 2CE7A 2L7HA 2UUBM 1HQYE 2UXCM 4FD2A 2DZNB 4MB7A 2KZUA 2KEBA 2G5GX 4NOOB 4JI8M 1IY2A 1IBKM 3J2PB 4LJ9A 2DWLA 8CATA 2V1UA 3MHVC 3J7BA 1E94E 1N75A 3GLHB 1XMQM 4LJ4A 3R9XB 4DR6M 1QANA 3U6PA 3CF0A 4AQYM 4BB9A 1NY6A 5EP4A 3T1YM 3L28A 3L25A 4HL4A 1ORYB 4P16A 2CV2A 1Z5BA 1G4AE 1OFIA 3LVWA 3SMPA 3RFWA 4DR2M 5C18A 4LRTA 1NNUC 4FWHA 3HJQA 4DV1M 1IY1A 1E9RA 4B3MM 4JI5M 3LQRA 4AZFA 4LG2A 4QNMA 3L26A 2QBYB 2QENA 4PT5A 5ITQA 1NY5A 3IG5A 1R6BX 5EP1A 1G3IA 4PDIA 3HHYA 3GPXA 1IBLM 1N77A 3UJNA 2DHRA 5DNYA 1TDHA 3PVSA 2W82A 5FTLA 4GC9A 2I7PA 4FCVA 2Y0QA 1L1TA 3GLGB 2BNKA 2C96A 2CV1A 2DXIA 2Q2EB 4MGZE 2JA2A 3HGIA 2R4EA 5DYGA 1H6UA 4B3SM 4LGYA 3PNVA 2QPAA 3GLHA 1R7RA 4M0DA 1G41A 4Z8XA 3LQQA 3TL4X 3OTOM 5C1BA 1PJJA 3E4RA 4LF7M 4NL4H 1N34M 1XXHB 2KA6B 1JQJC 3AOGA 4AW4A 2RGHA 2G8LA 3U61A 1DGHB 3GRRA 4LZJA 3GPUA 5IT9S 1QZMA 5IREB 2H1RA 4LJ6A 3J80S 4JN6A 5ITXE 2UUCM 1IQPA 3U60B 3U5ZB 1NVMA 3K8ZA 3DA1A 1NHWC 3W0FA 2XGNA 5DYIA 3LMMA 2BJWA 3GLGA 3J7AS 3RGPA 1NHGC 4MH0E 1NJGA 5EP2A 2O5RA 4II7A 2CV0A 4D82A 4HLQA 3U6CA 4LZZA 1W5SA 2XSZD 4XBOA 3CF6E 2D7HA 1L2BA 3K1JA 5BPVA 5EP3A 2OPFA 1HQCA 4DV5M 4JI6M 2XFTA 1YSYA 1E9SA 4DV6M 3FKEA 3K92A 4WURA 4PD2A 3CTWB 4OU7A 3U6SA 4GHLA 1JR3A 4JV5M 1XC8A 4I8OA 4NRVA 4S12A 4LJ5A 3H4MA 1OJLA 3JR4A 3FUVA 5KQDA 3VK7A 2XZFA 1K3XA 2LXEA 4DR1M 2UU9M 5JI2E 3I4VA 5FSWA 3PXGA 5KO3A 2F5QA 3SBJA 1FNNA 3TWKA 3AFHA 4LF5M 3MK6A 2FNAA 4X66M 5FTMA 2FOIC 3I51A 4NXNM 1Q3CA 4NSRA 2K47A 3HKPA 1GL7A 4M0WA 4RNAA 2XF3A 3UGJA 2ZM6M 3GRVA 4X64M 4GC5A 2L09A 3D8BA 2LWXA 3LVVA 4GIPA 5F3WA 1X37A 1NJFA 4M9ZA 3U6OA 1SXJC 2HHHM 7CATA 5EXTA 3FUXA 4MGYE 3HU3A 3FTEA 4AI6A 1GL6A 4MGKE 2XSZA 1TH3A 2ERCA 3KW6A 1Z5AA 3U61B 4QNRA 4REZA 4LJ8A 4IBBA 5EXSA 3HHZA 4L15A 4IJFA 4B3RM 5ITUA 4LF9M 3VLFB 4B08A 3GLIB 2XFSA 5EJCA 4LFBM 3GLFB 3D8LA 4GMQA 2X4AA 4IIWA 4NXMM 1ZQ9A 3DFZA 1G59A 3B9PA 4FVMA 4NRWA 5E6JA 3CF2A 3NWLA 3L27A 1Z59A 3FYCA 5GKNA 3KS8A 2UXBM 3GPPA 5IWAM 1Q3BA 2X49A 4DV0M 2R65A 3J81S 1ZAEA 4OVZB 4DUZM 1T3TA 3L29A 5LMNM 4Z6YA 3VDUA 1TDZA 3HU1A 2C99A 1IN5A 4OX9M 2A5YB 1XMOM 2KRUA 3E9SA 3M0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 M;  5ITX E;  2UUC M;  4YY3 M;  2F5O A;  5A2Q S;  4DV2 M;  4DV7 M;  3W0F A;  5ITX A;  4JI4 M;  1XNQ M;  3J7A S;  4YHH M;  1R2Z A;  3JAM S;  3SAV A;  3U6L A;  5FLX S;  2HKJ A;  3U6C A;  1K3W A;  3SAW A;  1PM5 A;  1FJG M;  3A42 A;  3C58 A;  1HNZ M;  4LF4 M;  3VK8 A;  1L2C A;  1XNR M;  1L2B A;  5LMU M;  2F5P A;  2OPF A;  2UUB M;  4DV5 M;  1HNW M;  2UXC M;  2EA0 A;  5ITR A;  4JI6 M;  4MB7 A;  4DV3 M;  1MU5 A;  4DV6 M;  4K0K M;  4JI8 M;  1PJI A;  3A45 A;  3A46 A;  1IBK M;  3U6S A;  4PD2 A;  1N32 M;  3GQ3 A;  4JV5 M;  1XC8 A;  1XMQ M;  4NRV A;  3JR4 A;  3T1H M;  2XZF A;  3VK7 A;  4DR6 M;  3U6P A;  4G4O A;  4DR4 M;  1K3X A;  4AQY M;  4DR1 M;  4DV4 M;  2UU9 M;  4LFC M;  1EE8 A;  4GKJ M;  3U6M A;  3U6D A;  3GP1 A;  3T1Y M;  1IBM M;  4DUY M;  2F5Q A;  4KHP M;  3SAU A;  1Z5B A;  4G4N A;  3SBJ A;  1K82 A;  4JI1 M;  1L2D A;  1HR0 M;  2F4V M;  2UXD M;  3TWK A;  2VQF M;  4DR2 M;  4LF5 M;  3TWL A;  4X66 M;  4GKK M;  4X62 M;  3DOA A;  4NXN M;  4DV1 M;  1Q3C A;  4LFA M;  4X65 M;  1N36 M;  2F5S A;  1J5E M;  4B3M M;  2ZM6 M;  4X64 M;  4JI5 M;  5ITY A;  3JR5 A;  4DR7 M;  5ITQ A;  3GQ4 A;  3SAS A;  3U6O A;  2HHH M;  1I94 M;  3SAT A;  3SAR A;  4PDI A;  3GPX A;  1HNX M;  1IBL M;  5BR8 M;  1TDH A;  2UUA M;  4B3T M;  4JYA M;  2XZU A;  4LF8 M;  1Z5A A;  1L1T A;  2E5L M;  1Q39 A;  4B3R M;  2Q2E B;  1NNJ A;  5ITU A;  4LF9 M;  1L1Z A;  2OQ4 A;  4JI2 M;  4DR5 M;  3TWM A;  4CIS A;  4JI7 M;  2VQE M;  4JI0 M;  1Z5C A;  4B3S M;  4LFB M;  2F5N A;  4JI3 M;  3U6Q A;  4NXM M;  4NRW A;  3GO8 A;  1N33 M;  1Z59 A;  4ITQ A;  3OTO M;  2UXB M;  4PCZ A;  5ITT A;  3GPP A;  5IWA M;  1PJJ A;  1Q3B A;  4LF7 M;  4DR3 M;  1MX0 A;  4DV0 M;  1N34 M;  3J81 S;  4G4R A;  4DUZ M;  4G4Q A;  3GQ5 A;  5LMN M;  4PDG A;  3GPY A;  2ZBK B;  3U6E A;  1TDZ A;  1KFV A;  4OX9 M;  3GPU A;  5IT9 S;  1R2Y A;  1XMO M;  3J80 S; 
#chains in the Genus database with same CATH topology
 4GIT A;  3AL0 C;  3I01 M;  4YY3 M;  2F5O A;  1UM8 A;  1QZE A;  2D7E A;  4DV2 M;  4KT0 F;  3FD9 A;  3SFZ A;  3AKZ A;  3SYK A;  5ITX A;  2GNO A;  4JI4 M;  1OTR A;  3HJS A;  4L16 A;  3GRU A;  2KXE A;  4YHH M;  2JY7 A;  1NO1 A;  1R2Z A;  4KO8 A;  2MGW A;  3Q8G A;  4M9X A;  2J7O A;  2KZS A;  5FLX S;  3K2L A;  2LH0 A;  3IEC A;  1D0L A;  3K9P A;  4M9S A;  3A42 A;  3GRY A;  1W5T A;  2DNA A;  2C9C A;  3GLI A;  1FJG M;  1KSF X;  2L7I A;  5LMU M;  1GKI A;  2KRK A;  3VKG A;  2MJ5 B;  2X8A A;  5ITR A;  1GVN A;  4IBE A;  1IXZ A;  4DV3 M;  1MU5 A;  3NBX X;  5KPT A;  1QYR A;  3A45 A;  2G3Q A;  1TGU A;  3A46 A;  4G3O A;  4R3D A;  1NV8 A;  4B7G A;  3GLG E;  2XH9 A;  1GJS A;  3M7G A;  3GQ3 A;  3PNY A;  2JY5 A;  2Z4S A;  3SC3 A;  1JR3 D;  5E26 A;  2QNJ A;  5EXP A;  5KPZ A;  3SHG B;  4DV4 M;  4AKH A;  2ZAN A;  1EE8 A;  4FCW A;  4LFC M;  3U6M A;  1IM2 A;  3GP1 A;  1WGL A;  1IBM M;  4DUY M;  1WJ7 A;  2CEA A;  3EIH A;  4LJA A;  1QAM A;  4KHP M;  2R18 A;  4JI1 M;  2RGO A;  4FW9 A;  1L2D A;  2YQZ A;  2UXD M;  5KQ8 A;  3KXE C;  4X62 M;  3DOA A;  1IN8 A;  4X65 M;  4QHT A;  2JY6 B;  2P5T A;  1WXQ A;  4LGM A;  2FS1 A;  3QWL A;  2OOA A;  2JUJ A;  5ITY A;  2Y20 A;  2MR9 A;  1E32 A;  3JR5 A;  2KNV A;  2VDB B;  1DGH A;  4IJE A;  3GQ4 A;  3K9O A;  1J7K A;  3UK6 A;  4AG6 A;  3BOS A;  1IN6 A;  1OFH A;  5FTN A;  4D81 A;  3SAT A;  3NBI A;  3SAR A;  4AKG A;  1HNX M;  2Y21 A;  2RRU A;  2C98 A;  1IN7 A;  2VII A;  3ZCB B;  2YNM D;  2V6Z M;  3TE6 A;  4LF8 M;  1J09 A;  3VFD A;  2R44 A;  3UMM A;  5KPR A;  4IBJ A;  4TUW A;  2FE8 A;  4CGY B;  3TQS A;  1IFY A;  3IHP A;  1XB2 B;  4ZPX A;  4JI2 M;  2Z7J A;  3TWM A;  1YE9 A;  2C9O A;  3FTF A;  2VQE M;  4JI0 M;  1V92 A;  1Z5C A;  3MMP A;  2QZ4 A;  4W5W A;  2ZAO A;  1D0K A;  1DO0 A;  5IZ7 D;  3HHX A;  4JI3 M;  2EUC A;  2DWN A;  4QOZ C;  2LVP C;  3LCU A;  4IBC A;  1N33 M;  4I81 A;  1D2N A;  3KDS E;  1QQW A;  2L6O A;  4FWD A;  5H37 D;  2L4E A;  2LNH C;  1NSF A;  3M6A A;  3AJI B;  2CWB A;  1DO2 A;  1YUB A;  3HJ8 A;  4G4Q A;  1MJG M;  3GQ5 A;  4WW0 A;  3GPY A;  3KOW E;  1N78 A;  5FTJ A;  4AG5 A;  4DBG B;  2QCU A;  3KS4 A;  2R45 A;  3T15 A;  3J27 B;  3ZH9 B;  1KFV A;  3KOZ E;  2DAE A;  2GQF A;  3ILK A;  1R2Y A;  1TH2 A;  4LF6 M;  1SXJ B;  3VDP A;  3FUW A;  4GH9 A;  4CJ6 A;  1C1K A;  4IBD A;  2K6B A;  4MGI E;  2DHY A;  3UZU A;  4LRS A;  4DV7 M;  1TF0 B;  1QVR A;  1SXJ D;  2DZL A;  1XHB A;  2Y0T A;  3T38 A;  2JXN A;  4MGH A;  2WZJ A;  3SYL A;  3SAV A;  1OIP A;  1OAO C;  1SXJ A;  1K3W A;  1HNZ M;  3B7Q A;  3SAW A;  1PM5 A;  3SHF A;  4I5S A;  2CHQ A;  2NQ8 C;  1Z6T A;  2CUZ A;  4LF4 M;  2R62 A;  2YR0 A;  1QDR A;  4RF0 A;  2QP9 X;  1HNW M;  4L4U A;  2EA0 A;  3THG A;  4IBF A;  4K0K M;  1PJI A;  1KYI A;  1S3S A;  4AKI A;  1QAQ A;  2RKO A;  2DAI A;  1D0M A;  2KDL A;  4KLN A;  2EJS A;  3WHL A;  1N32 M;  4F2L A;  4FCT A;  2Z3X A;  1VEK A;  2CHV A;  2FFJ A;  1OAI A;  3KOY E;  3T1H M;  4G4O A;  4DR4 M;  4JXJ A;  3PFI A;  1HT1 E;  2LHG A;  4GKJ M;  3FUT A;  1LTM A;  3U6D A;  1HT2 E;  1I4W A;  3HWS A;  3A98 B;  1G71 A;  3W68 A;  1V34 A;  1GLN A;  1ZV1 A;  2AHM A;  2KNA A;  3U5Z A;  3U60 A;  3SAU A;  2XLJ A;  1XXH A;  4G4N A;  1K82 A;  4NC6 A;  3Q8X A;  1HR0 M;  1QAO A;  3R8F A;  2F4V M;  4NSO B;  2VQF M;  3AV0 A;  2Z8Y M;  3MJ5 A;  1DGG A;  3IG8 A;  4L78 A;  3TWL A;  3B7Z A;  2V1C A;  2I7N A;  3TPZ A;  4GKK M;  2LVO C;  2YFQ A;  2CFO A;  2ZAM A;  1IXS B;  4R7G A;  4LFA M;  3V76 A;  3ZC7 B;  1R5L A;  4B7F A;  1N36 M;  2F5S A;  1J5E M;  1G8P A;  4OVZ A;  2DZO B;  2CRU A;  3QAU A;  4LCB A;  4IBI A;  2EKF A;  2Z4R A;  3KSJ A;  4DR7 M;  2R46 A;  3FRI A;  2K9D A;  2QQ8 A;  3FTC A;  2LVA A;  4L8R C;  3SAS A;  2BJV A;  3W0L B;  3GLH E;  1L8Q A;  1I94 M;  5EXX A;  2DAG A;  2R0I A;  3L2A A;  4IBK A;  4XGI A;  2VF7 A;  1TR8 A;  3KVW A;  5BR8 M;  4EIW A;  2UUA M;  4JYA M;  4B3T M;  2XZU A;  1SXJ E;  4IBG A;  2E5L M;  1Q39 A;  1NNJ A;  4BBA A;  1DV0 A;  4GRI A;  4B7H A;  1L1Z A;  1Q02 A;  2OQ4 A;  4GHA A;  5FTK A;  2XEP A;  2M5Z A;  4DR5 M;  4CIS A;  4JI7 M;  1IN4 A;  3B89 A;  4KOD A;  2DWM A;  1PJT A;  2QSF X;  1VDD A;  2CHG A;  3HX3 A;  2F5N A;  5EQT A;  4LJ7 A;  1LV7 A;  1XNR M;  3VKH A;  3U6Q A;  3I04 M;  4A3V B;  2JWS A;  3HHW A;  3GO8 A;  2VF8 A;  1VEJ A;  1DGF A;  2DWZ B;  3AOE A;  3RE8 A;  1OIZ A;  2KW0 A;  3SMS A;  4ITQ A;  3HU2 A;  4PCZ A;  2HCB A;  1RU3 A;  5ITT A;  3FYD A;  4MM3 B;  3DZD A;  4DR3 M;  1MX0 A;  4G4R A;  2EO2 A;  3KOX E;  4LY6 A;  1DGB A;  2DAM A;  2MH8 A;  3LCV B;  3LW5 F;  4BLC A;  2ZBK B;  4D80 A;  4PDG A;  3GLF E;  1IXR C;  1BVS A;  2HAK A;  3KP0 E;  3U6E A;  2DVW B;  3KFU G;  2HL7 A;  5JI3 E;  1XXH E;  1QUS A;  3GLF A;  2WSE F;  2LHC A;  2R6F A;  4FWG A;  3I4Y A;  1AIP C;  2R4J A;  3FTD A;  4CHT B;  5A2Q S;  2C5R A;  2OO9 A;  3QYE A;  3WHK A;  1XWI A;  1XNQ M;  3AOE C;  3KSX A;  1JB0 F;  3BBZ A;  3FUU A;  3JAM S;  1ZMV A;  3B74 A;  5DFL A;  1IY0 A;  4QOS A;  4QHS A;  3U6L A;  3EIE A;  4OW0 A;  2HKJ A;  1GO5 A;  3KP1 E;  2J7N A;  3C58 A;  1TH4 A;  4RF1 A;  2D7G A;  3VK8 A;  1PRB A;  3E21 A;  4I4L A;  3RGS A;  1L2C A;  4G6Z A;  2F5P A;  2QBY A;  1EFU B;  2JZ0 A;  2LTU A;  2M60 A;  2CE7 A;  1SG9 A;  2L7H A;  1HQY E;  2ZTC A;  3HY5 A;  2FH0 A;  4FD2 A;  2UUB M;  2DZN B;  2UXC M;  1IXS A;  2LBC A;  2BWB A;  4MB7 A;  2KZU A;  2KEB A;  1HJP A;  2G5G X;  4NOO B;  1IY2 A;  4UN2 B;  1A5T A;  3J2P B;  4LJ9 A;  1IBK M;  1PJQ A;  2DWL A;  8CAT A;  4WP2 A;  2V1U A;  3MHV C;  4JI8 M;  3J7B A;  1E94 E;  1N75 A;  2B3T A;  3GLH B;  1XMQ M;  2JP7 A;  4LJ4 A;  3R9X B;  3FRH A;  4DR6 M;  2JZ1 A;  1QAN A;  3U6P A;  3CF0 A;  4AQY M;  4BB9 A;  1NY6 A;  5EP4 A;  3CGW A;  4ANR A;  3T1Y M;  3L28 A;  2APL A;  3L25 A;  4HL4 A;  1ORY B;  4P16 A;  1VQ1 A;  2CV2 A;  4Q7J A;  1Z5B A;  1G4A E;  1OFI A;  2EKK A;  3LVW A;  3SMP A;  1V33 A;  3RFW A;  1OQY A;  4DR2 M;  2CP8 A;  5C18 A;  4LRT A;  1NNU C;  4FWH A;  3HJQ A;  4DV1 M;  3C9P A;  1IY1 A;  1E9R A;  4B3M M;  4JI5 M;  3LQR A;  4AZF A;  4LG2 A;  4QNM A;  3L26 A;  2QBY B;  1QUT A;  2DAK A;  2QEN A;  4P17 A;  4PT5 A;  5ITQ A;  1GAB A;  1NY5 A;  3IG5 A;  1R6B X;  5EP1 A;  3BXW A;  1G3I A;  4PDI A;  3HHY A;  3GPX A;  1IBL M;  2L2D A;  1N77 A;  1WGN A;  3UJN A;  2DHR A;  2DEN A;  2WSF F;  5DNY A;  1TDH A;  3PVS A;  2W82 A;  5FTL A;  4GC9 A;  2I7P A;  4FCV A;  2Y0Q A;  1L1T A;  2H5X A;  1GJT A;  3GLG B;  3C3D A;  2BNK A;  2C96 A;  2CV1 A;  2DXI A;  2BWE A;  2Q2E B;  4MGZ E;  2JA2 A;  2WSC F;  3HGI A;  2R4E A;  1P3Q Q;  4F1I A;  5DYG A;  2LVQ D;  1EIJ A;  1H6U A;  4B3S M;  4LGY A;  3PNV A;  2QPA A;  3GLH A;  1F4I A;  2KHH A;  1R7R A;  4M0D A;  5L8R F;  1G41 A;  4Z8X A;  3LQQ A;  3TL4 X;  3OTO M;  5C1B A;  1PJJ A;  3E4R A;  4LF7 M;  1YLA A;  4NL4 H;  1N34 M;  1MN3 A;  1AUA A;  1XXH B;  2KA6 B;  1JQJ C;  3AOG A;  3HZJ A;  4AW4 A;  2RGH A;  2G8L A;  2ZTD A;  1T6O A;  3U61 A;  1DGH B;  3GRR A;  1T43 A;  4LZJ A;  1VDL A;  3GPU A;  5IT9 S;  1QZM A;  5IRE B;  2H1R A;  4LJ6 A;  1WIV A;  4JN6 A;  3J80 S;  5ITX E;  2QHO B;  2UUC M;  1IQP A;  3U60 B;  3U5Z B;  1NVM A;  4L6V 6;  3K8Z A;  3DA1 A;  1NHW C;  3W0F A;  2XGN A;  4XK8 F;  5DYI A;  3LMM A;  2BJW A;  3GLG A;  3J7A S;  3RGP A;  1NHG C;  3E46 A;  4MH0 E;  1NJG A;  5EP2 A;  2O5R A;  4II7 A;  2CV0 A;  1Y8G A;  4D82 A;  4HLQ A;  3U6C A;  4LZZ A;  1W5S A;  2XSZ D;  3C3E A;  4XBO A;  3CF6 E;  1TTE A;  2D7H A;  1L2B A;  3K1J A;  5BPV A;  5EP3 A;  2OPF A;  1HQC A;  4DV5 M;  1ZMW A;  2XFT A;  1VEG A;  1YSY A;  1E9S A;  4DV6 M;  4JI6 M;  4Y28 F;  2HWJ A;  3FKE A;  3K92 A;  4WUR A;  4PD2 A;  3CTW B;  4OU7 A;  3U6S A;  2MRO B;  4GHL A;  1JR3 A;  2OOB A;  4JV5 M;  1XC8 A;  4I8O A;  4NRV A;  4S12 A;  1ZMU A;  2JNH A;  3H4M A;  4LJ5 A;  1OJL A;  3JR4 A;  3B7N A;  3FUV A;  5KQD A;  3VK7 A;  2XZF A;  1K3X A;  2LXE A;  4DR1 M;  2UU9 M;  5JI2 E;  3I4V A;  1NV9 A;  4GEW A;  5FSW A;  2JY8 A;  3PXG A;  5KO3 A;  2F5Q A;  3SBJ A;  1FNN A;  4R71 A;  3TWK A;  3AFH A;  4LF5 M;  3MK6 A;  2FNA A;  4X66 M;  4CIZ A;  5FTM A;  2FOI C;  3I51 A;  4NXN M;  1Q3C A;  4NSR A;  2K47 A;  3HKP A;  1GL7 A;  4M0W A;  4RNA A;  2XF3 A;  3UGJ A;  2L4F A;  2ZM6 M;  2DKL A;  3GRV A;  4X64 M;  2J5Y A;  4GC5 A;  3QYB A;  2L09 A;  3D8B A;  1UFZ A;  2LWX A;  3LVV A;  4GIP A;  1CUK A;  3GLI E;  5F3W A;  1X37 A;  1NJF A;  1WR1 B;  4M9Z A;  3U6O A;  1SXJ C;  2HHH M;  7CAT A;  5EXT A;  3FUX A;  3FE3 A;  4MGY E;  3F92 A;  3HU3 A;  1C7Y A;  1PJS A;  3FTE A;  4AI6 A;  1GL6 A;  4MGK E;  2XSZ A;  1TH3 A;  2ERC A;  3KW6 A;  1Z5A A;  3U61 B;  2DI0 A;  4QNR A;  4REZ A;  4LJ8 A;  1JR3 E;  4IBB A;  2N35 A;  5EXS A;  4L15 A;  3HHZ A;  4HEO A;  4IJF A;  4B3R M;  5ITU A;  2O01 F;  4LF9 M;  1WHC A;  3VLF B;  4B08 A;  3GLI B;  2XFS A;  5EJC A;  1QDT A;  4LFB M;  3GLF B;  1OKS A;  3D8L A;  4GMQ A;  2X4A A;  4IIW A;  2KNZ A;  1ZQ9 A;  3DFZ A;  4RKU F;  3B9P A;  4FVM A;  1G59 A;  4NRW A;  4NXM M;  2K0B X;  5E6J A;  3CF2 A;  3NWL A;  3H4J A;  1PGY A;  3L27 A;  1Z59 A;  3FYC A;  5GKN A;  3KS8 A;  2UXB M;  3GPP A;  5IWA M;  2LVN C;  1Q3B A;  2X49 A;  3T6P A;  4DV0 M;  2R65 A;  3J81 S;  1ZAE A;  4OVZ B;  4DUZ M;  1T3T A;  3L29 A;  5LMN M;  4Z6Y A;  3VDU A;  1TDZ A;  3HU1 A;  1VG5 A;  2C99 A;  1IN5 A;  4OX9 M;  3ZQJ A;  2O25 A;  3W67 A;  2A5Y B;  1R4G A;  1XMO M;  2KRU A;  3E9S A;  3M0E A; 
#chains in the Genus database with same CATH homology
 4GIT A;  3AL0 C;  4YY3 M;  2F5O A;  1UM8 A;  2D7E A;  4DV2 M;  3FD9 A;  3SFZ A;  3AKZ A;  3SYK A;  5ITX A;  4JI4 M;  3HJS A;  4L16 A;  3GRU A;  2KXE A;  4YHH M;  1R2Z A;  4KO8 A;  4M9X A;  2J7O A;  2KZS A;  5FLX S;  3K2L A;  2LH0 A;  4M9S A;  3A42 A;  3GRY A;  1W5T A;  3GLI A;  2C9C A;  1FJG M;  1KSF X;  2L7I A;  5LMU M;  1GKI A;  2KRK A;  3VKG A;  2X8A A;  5ITR A;  1GVN A;  4IBE A;  1IXZ A;  4DV3 M;  1MU5 A;  5KPT A;  1QYR A;  3A45 A;  1TGU A;  3A46 A;  4R3D A;  4B7G A;  2XH9 A;  3M7G A;  3GQ3 A;  3PNY A;  2Z4S A;  3SC3 A;  1JR3 D;  5E26 A;  5EXP A;  5KPZ A;  3SHG B;  4DV4 M;  4AKH A;  2ZAN A;  1EE8 A;  4FCW A;  4LFC M;  3U6M A;  1IM2 A;  3GP1 A;  1IBM M;  4DUY M;  3EIH A;  2CEA A;  4LJA A;  1QAM A;  4KHP M;  2R18 A;  4JI1 M;  2RGO A;  4FW9 A;  1L2D A;  2YQZ A;  2UXD M;  5KQ8 A;  3KXE C;  4X62 M;  3DOA A;  1IN8 A;  4X65 M;  4QHT A;  2P5T A;  1WXQ A;  4LGM A;  3QWL A;  5ITY A;  2Y20 A;  1E32 A;  3JR5 A;  1DGH A;  4IJE A;  3GQ4 A;  1J7K A;  3UK6 A;  4AG6 A;  3BOS A;  1IN6 A;  1OFH A;  5FTN A;  4D81 A;  3SAT A;  3NBI A;  3SAR A;  4AKG A;  1HNX M;  2Y21 A;  2C98 A;  1IN7 A;  2VII A;  3ZCB B;  2YNM D;  2V6Z M;  3TE6 A;  4LF8 M;  1J09 A;  3VFD A;  3UMM A;  5KPR A;  4IBJ A;  4TUW A;  2FE8 A;  4CGY B;  3TQS A;  4JI2 M;  4ZPX A;  2Z7J A;  3TWM A;  1YE9 A;  2C9O A;  3FTF A;  2VQE M;  4JI0 M;  1Z5C A;  4W5W A;  2QZ4 A;  2ZAO A;  1DO0 A;  5IZ7 D;  3HHX A;  4JI3 M;  2EUC A;  2DWN A;  4QOZ C;  4IBC A;  1N33 M;  4I81 A;  1D2N A;  3KDS E;  1QQW A;  2L6O A;  4FWD A;  5H37 D;  2LNH C;  1NSF A;  3M6A A;  3AJI B;  1DO2 A;  1YUB A;  3HJ8 A;  4G4Q A;  3GQ5 A;  4WW0 A;  3GPY A;  3KOW E;  1N78 A;  5FTJ A;  4AG5 A;  2QCU A;  3KS4 A;  2R45 A;  3T15 A;  3J27 B;  3ZH9 B;  1KFV A;  3KOZ E;  1R2Y A;  3ILK A;  1TH2 A;  4LF6 M;  1SXJ B;  3VDP A;  3FUW A;  4GH9 A;  1C1K A;  4IBD A;  4MGI E;  3UZU A;  4LRS A;  4DV7 M;  1QVR A;  1SXJ D;  1XHB A;  2Y0T A;  3T38 A;  4MGH A;  3SYL A;  3SAV A;  1SXJ A;  1K3W A;  3SAW A;  1PM5 A;  3SHF A;  4I5S A;  2CHQ A;  2NQ8 C;  1Z6T A;  2CUZ A;  4LF4 M;  2R62 A;  2YR0 A;  4RF0 A;  2QP9 X;  1HNW M;  4L4U A;  2EA0 A;  3THG A;  4IBF A;  4K0K M;  1PJI A;  1KYI A;  1S3S A;  4AKI A;  1QAQ A;  2RKO A;  4KLN A;  1N32 M;  3WHL A;  4FCT A;  2Z3X A;  2CHV A;  3KOY E;  2FFJ A;  3T1H M;  4G4O A;  4DR4 M;  4JXJ A;  3PFI A;  1HT1 E;  4GKJ M;  3FUT A;  3U6D A;  1HT2 E;  1I4W A;  3HWS A;  3A98 B;  1GLN A;  2AHM A;  3U5Z A;  3U60 A;  3SAU A;  2XLJ A;  1XXH A;  4G4N A;  1K82 A;  3Q8X A;  1HR0 M;  1QAO A;  3R8F A;  2F4V M;  4NSO B;  2VQF M;  3AV0 A;  3MJ5 A;  3TWL A;  1DGG A;  3IG8 A;  4L78 A;  2V1C A;  2I7N A;  3TPZ A;  4GKK M;  2YFQ A;  2CFO A;  2ZAM A;  1IXS B;  4R7G A;  4LFA M;  3ZC7 B;  4B7F A;  1N36 M;  2F5S A;  1J5E M;  1G8P A;  4OVZ A;  2DZO B;  3QAU A;  4LCB A;  4IBI A;  2Z4R A;  3KSJ A;  4DR7 M;  2R46 A;  3FTC A;  4L8R C;  3SAS A;  2BJV A;  3W0L B;  1L8Q A;  1I94 M;  5EXX A;  3L2A A;  4IBK A;  4XGI A;  3KVW A;  5BR8 M;  4EIW A;  2UUA M;  4JYA M;  4B3T M;  2XZU A;  1SXJ E;  4IBG A;  2E5L M;  1Q39 A;  1NNJ A;  4BBA A;  4GRI A;  4B7H A;  1L1Z A;  2OQ4 A;  4GHA A;  5FTK A;  2XEP A;  2M5Z A;  4DR5 M;  4CIS A;  4JI7 M;  1IN4 A;  4KOD A;  2DWM A;  1VDD A;  2CHG A;  1XNR M;  2F5N A;  5EQT A;  4LJ7 A;  1LV7 A;  3VKH A;  3U6Q A;  4A3V B;  3HHW A;  3GO8 A;  2DWZ B;  1DGF A;  3AOE A;  3RE8 A;  2KW0 A;  3SMS A;  4ITQ A;  3HU2 A;  4PCZ A;  2HCB A;  5ITT A;  3FYD A;  4MM3 B;  3DZD A;  4DR3 M;  1MX0 A;  4G4R A;  2EO2 A;  3KOX E;  4LY6 A;  1DGB A;  4D80 A;  4BLC A;  4PDG A;  2ZBK B;  3U6E A;  1IXR C;  3KP0 E;  2DVW B;  3KFU G;  2HL7 A;  5JI3 E;  3GLF A;  4FWG A;  3I4Y A;  2R4J A;  3FTD A;  4CHT B;  5A2Q S;  2C5R A;  3WHK A;  1XWI A;  1XNQ M;  3AOE C;  3KSX A;  3FUU A;  3JAM S;  1IY0 A;  4QOS A;  4QHS A;  3U6L A;  3EIE A;  4OW0 A;  2HKJ A;  3KP1 E;  2J7N A;  3C58 A;  1TH4 A;  4RF1 A;  2D7G A;  3VK8 A;  4I4L A;  3RGS A;  1L2C A;  1HNZ M;  2QBY A;  4G6Z A;  2F5P A;  2M60 A;  2CE7 A;  2L7H A;  2UUB M;  1HQY E;  2UXC M;  4FD2 A;  2DZN B;  4MB7 A;  2KZU A;  2KEB A;  2G5G X;  4NOO B;  4JI8 M;  1IY2 A;  1IBK M;  3J2P B;  4LJ9 A;  2DWL A;  8CAT A;  2V1U A;  3MHV C;  3J7B A;  1E94 E;  1N75 A;  3GLH B;  1XMQ M;  4LJ4 A;  3R9X B;  4DR6 M;  1QAN A;  3U6P A;  3CF0 A;  4AQY M;  4BB9 A;  1NY6 A;  5EP4 A;  3T1Y M;  3L28 A;  3L25 A;  4HL4 A;  1ORY B;  4P16 A;  2CV2 A;  1Z5B A;  1G4A E;  1OFI A;  3LVW A;  3SMP A;  3RFW A;  4DR2 M;  5C18 A;  4LRT A;  1NNU C;  4FWH A;  3HJQ A;  4DV1 M;  1IY1 A;  1E9R A;  4B3M M;  4JI5 M;  3LQR A;  4AZF A;  4LG2 A;  4QNM A;  3L26 A;  2QBY B;  2QEN A;  4PT5 A;  5ITQ A;  1NY5 A;  3IG5 A;  1R6B X;  5EP1 A;  1G3I A;  4PDI A;  3HHY A;  3GPX A;  1IBL M;  1N77 A;  3UJN A;  2DHR A;  5DNY A;  1TDH A;  3PVS A;  2W82 A;  5FTL A;  4GC9 A;  2I7P A;  4FCV A;  2Y0Q A;  1L1T A;  3GLG B;  2BNK A;  2C96 A;  2CV1 A;  2DXI A;  2Q2E B;  4MGZ E;  2JA2 A;  3HGI A;  2R4E A;  5DYG A;  1H6U A;  4B3S M;  4LGY A;  3PNV A;  2QPA A;  3GLH A;  1R7R A;  4M0D A;  1G41 A;  4Z8X A;  3LQQ A;  3TL4 X;  3OTO M;  5C1B A;  1PJJ A;  3E4R A;  4LF7 M;  4NL4 H;  1N34 M;  1XXH B;  2KA6 B;  1JQJ C;  3AOG A;  4AW4 A;  2RGH A;  2G8L A;  3U61 A;  1DGH B;  3GRR A;  4LZJ A;  3GPU A;  5IT9 S;  1QZM A;  5IRE B;  2H1R A;  4LJ6 A;  3J80 S;  4JN6 A;  5ITX E;  2UUC M;  1IQP A;  3U60 B;  3U5Z B;  1NVM A;  3K8Z A;  3DA1 A;  1NHW C;  3W0F A;  2XGN A;  5DYI A;  3LMM A;  2BJW A;  3GLG A;  3J7A S;  3RGP A;  1NHG C;  4MH0 E;  1NJG A;  5EP2 A;  2O5R A;  4II7 A;  2CV0 A;  4D82 A;  4HLQ A;  3U6C A;  4LZZ A;  1W5S A;  2XSZ D;  4XBO A;  3CF6 E;  2D7H A;  1L2B A;  3K1J A;  5BPV A;  5EP3 A;  2OPF A;  1HQC A;  4DV5 M;  4JI6 M;  2XFT A;  1YSY A;  1E9S A;  4DV6 M;  3FKE A;  3K92 A;  4WUR A;  4PD2 A;  3CTW B;  4OU7 A;  3U6S A;  4GHL A;  1JR3 A;  4JV5 M;  1XC8 A;  4I8O A;  4NRV A;  4S12 A;  4LJ5 A;  3H4M A;  1OJL A;  3JR4 A;  3FUV A;  5KQD A;  3VK7 A;  2XZF A;  1K3X A;  2LXE A;  4DR1 M;  2UU9 M;  5JI2 E;  3I4V A;  5FSW A;  3PXG A;  5KO3 A;  2F5Q A;  3SBJ A;  1FNN A;  3TWK A;  3AFH A;  4LF5 M;  3MK6 A;  2FNA A;  4X66 M;  5FTM A;  2FOI C;  3I51 A;  4NXN M;  1Q3C A;  4NSR A;  2K47 A;  3HKP A;  1GL7 A;  4M0W A;  4RNA A;  2XF3 A;  3UGJ A;  2ZM6 M;  3GRV A;  4X64 M;  4GC5 A;  2L09 A;  3D8B A;  2LWX A;  3LVV A;  4GIP A;  5F3W A;  1X37 A;  1NJF A;  4M9Z A;  3U6O A;  1SXJ C;  2HHH M;  7CAT A;  5EXT A;  3FUX A;  4MGY E;  3HU3 A;  3FTE A;  4AI6 A;  1GL6 A;  4MGK E;  2XSZ A;  1TH3 A;  2ERC A;  3KW6 A;  1Z5A A;  3U61 B;  4QNR A;  4REZ A;  4LJ8 A;  4IBB A;  5EXS A;  3HHZ A;  4L15 A;  4IJF A;  4B3R M;  5ITU A;  4LF9 M;  3VLF B;  4B08 A;  3GLI B;  2XFS A;  5EJC A;  4LFB M;  3GLF B;  3D8L A;  4GMQ A;  2X4A A;  4IIW A;  4NXM M;  1ZQ9 A;  3DFZ A;  1G59 A;  3B9P A;  4FVM A;  4NRW A;  5E6J A;  3CF2 A;  3NWL A;  3L27 A;  1Z59 A;  3FYC A;  5GKN A;  3KS8 A;  2UXB M;  3GPP A;  5IWA M;  1Q3B A;  2X49 A;  4DV0 M;  2R65 A;  3J81 S;  1ZAE A;  4OVZ B;  4DUZ M;  1T3T A;  3L29 A;  5LMN M;  4Z6Y A;  3VDU A;  1TDZ A;  3HU1 A;  2C99 A;  1IN5 A;  4OX9 M;  2A5Y B;  1XMO M;  2KRU A;  3E9S A;  3M0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...