5IT9S

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 24
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5it9S01
3U6DA 4JI3M 2HKJA 3A46A 2F5OA 3J81S 4DR7M 4B3TM 2UXDM 1K82A 2F5QA 4X64M 4JI5M 5ITXA 4DR6M 2XZUA 1N34M 3SATA 4NXNM 2UXBM 4DR3M 1Q3CA 4LFAM 4JI2M 4DR5M 4GKKM 3GQ4A 1FJGM 3OTOM 1XMQM 4JI0M 1K3XA 3SAUA 1TDHA 2F5NA 3GP1A 3U6SA 1IBMM 1R2ZA 5LMUM 1NNJA 1XNQM 2VQFM 4G4RA 1HNZM 3W0FA 4X66M 3VK7A 1TDZA 1N32M 1L2DA 3TWKA 4LF7M 4LFBM 4B3SM 4PDGA 2Q2EB 2F5SA 4ITQA 4YY3M 1MX0A 3GQ3A 2E5LM 4JV5M 3GO8A 4JYAM 1IBLM 1L2BA 4DR4M 3U6OA 4OX9M 3SAWA 1Q39A 1L1TA 1L1ZA 1XMOM 1HNXM 2OPFA 4NXMM 2UUBM 1PM5A 2UU9M 1K3WA 3GPUA 4AQYM 4DV1M 2UUCM 3TWMA 1XNRM 3VK8A 4LFCM 1IBKM 3GQ5A 4G4NA 4G4OA 2XZFA 4GKJM 4B3RM 3A45A 4JI1M 5A2QS 2UXCM 1EE8A 4DUZM 1Q3BA 3U6PA 5ITUA 4LF6M 3DOAA 1Z59A 1R2YA 3SARA 3U6CA 3JAMS 1N36M 4PD2A 4B3MM 1HR0M 5LMNM 3JR5A 3GPYA 4DV0M 3J80S 4G4QA 3J7AS 4YHHM 3U6EA 1PJIA 5IT9S 3JR4A 4LF8M 4NRVA 3C58A 1MU5A 4JI8M 2ZBKB 2OQ4A 3SAVA 3T1YM 3T1HM 3TWLA 1PJJA 4JI4M 5ITXE 5BR8M 5FLXS 2HHHM 4DV6M 4DR2M 2VQEM 3GPPA 1L2CA 3U6LA 3SASA 5IWAM 4DUYM 2EA0A 5ITQA 2UUAM 4LF5M 4LF9M 4DV2M 2ZM6M 4DV4M 3SBJA 1HNWM 3A42A 5ITRA 1Z5BA 4MB7A 4PDIA 4DV3M 1N33M 4DV7M 1KFVA 4CISA 1Z5AA 4X65M 5ITYA 4PCZA 3U6MA 2F4VM 5ITTA 4DV5M 4LF4M 4K0KM 2F5PA 4X62M 4KHPM 3GPXA 4JI7M 1I94M 3U6QA 1XC8A 1J5EM 1Z5CA 4NRWA 4JI6M 4DR1M
chains in the Genus database with same CATH superfamily
3CGWA 4D81A 5KPZA 2HKJA 1GLNA 2JNHA 3MK6A 3J81S 1PRBA 4B3TM 4HL4A 2XSZA 1QAQA 2Y21A 3FRHA 1QZEA 1IY1A 1K82A 3LMMA 1NY6A 2L2DA 2YQZA 2XZUA 1A5TA 1H6UA 2C98A 2LWXA 3SATA 4NXNM 2I7NA 4PT5A 3PNVA 3SC3A 5EQTA 4AKIA 1SXJC 4LFAM 2KRUA 5E6JA 3KS4A 1XMQM 2DHRA 2VDBB 3IHPA 3FTCA 4R3DA 3FUVA 3HU1A 1OJLA 1TF0B 3B74A 4ANRA 2V6ZM 2ZAOA 4TUWA 1XNQM 2Y20A 5KPRA 3L28A 1EIJA 4KODA 1HNZM 4X66M 2MROB 1IM2A 4FD2A 1DGBA 2JA2A 1JQJC 2CV0A 1DGFA 2R6FA 2L09A 2X49A 4B3SM 2LVNC 2Q2EB 3SMSA 4QHTA 2HL7A 3Q8XA 1QDTA 3K9OA 1IBLM 3W67A 4LZJA 1OAOC 1IXSA 3L26A 3SAWA 2LVQD 4CJ6A 1D0MA 3Q8GA 4RF1A 1L1TA 1ZMVA 3B7ZA 1KYIA 4MH0E 2KEBA 3D8LA 3SMPA 1R4GA 1GJTA 3E21A 1PM5A 3NBXX 1K3WA 3GPUA 4AQYM 1YLAA 3VKGA 2Z4SA 5IREB 1OFIA 1HT2E 2DWZB 3TWMA 3M0EA 1IXSB 2J5YA 4GC5A 1IBKM 2WSEF 2I7PA 3HZJA 4LRSA 1JR3D 2XZFA 3NWLA 4GKJM 4IBBA 1N78A 3A45A 2CHVA 1QYRA 4JI1M 1VEJA 3KS8A 3M7GA 5ITUA 3DOAA 2R4JA 2QPAA 3HJSA 4FCVA 4IBJA 3VKHA 3J2PB 3C9PA 3CF6E 2FE8A 3JAMS 1IFYA 1SXJD 1NV8A 5EXTA 1NSFA 3GLFA 1D2NA 1XXHA 2Z4RA 4GHAA 4GHLA 3FUUA 4P16A 4WURA 4G4QA 7CATA 3T38A 3B89A 3U60A 2R45A 4WP2A 3J7AS 4IBIA 4LJ9A 5IT9S 4W5WA 2VF8A 3FE3A 4NRVA 3C58A 4M9SA 1J09A 2JY6B 5C18A 3SAVA 1XXHB 1P3QQ 2EJSA 3IECA 3SHGB 3U60B 2DAKA 2YR0A 1E94E 2DWMA 3W68A 2XLJA 2ZANA 3DFZA 2QNJA 3K92A 2VQEM 2L4FA 2EA0A 3FUTA 5KPTA 2UUAM 4LF9M 2OOAA 3GLIE 3BXWA 4LGMA 3SBJA 1HNWM 2LNHC 5KQDA 1OQYA 4MB7A 2FOIC 1WJ7A 3A98B 4G6ZA 4CISA 3U5ZA 4AI6A 2QBYA 2XEPA 1F4IA 1Z5AA 1MJGM 2DAIA 2JY8A 2O5RA 3J27B 2K0BX 1T3TA 4F2LA 4DV5M 4KHPM 3AKZA 1NJFA 3K8ZA 4MGYE 2WSCF 3U5ZB 1W5TA 3CTWB 1HQYE 3GLGE 2DAMA 2QBYB 1IN8A 1N75A 1ZMWA 1J5EM 4LJ8A 2L6OA 5EJCA 4RKUF 5FSWA 2LH0A 3FD9A 2DZNB 4L15A 3A46A 1VEKA 2F5OA 4NSRA 2H5XA 2UXDM 1KSFX 3AJIB 2BWEA 3KDSE 2ERCA 2JXNA 2F5QA 4JI5M 3KP0E 3UZUA 4DR6M 5FTNA 5F3WA 3HU2A 3QYBA 4LJ6A 4S12A 4A3VB 4QNRA 3FTDA 3KOYE 1YE9A 1DGHB 1Q3CA 2D7HA 4JI2M 1JR3A 1NY5A 1PJSA 3OTOM 2L7HA 3K2LA 4LGYA 4JV5M 3B9PA 2F5NA 4FWHA 3R8FA 3GP1A 1R2ZA 4M9XA 3VFDA 1HQCA 3MHVC 1NNJA 1TH3A 2GNOA 2LHCA 1DO2A 3VK7A 5E26A 1N32M 3TWKA 4II7A 3KOWE 4CIZA 4LFBM 2GQFA 2K47A 4ITQA 2N35A 4QOSA 4YY3M 4MGZE 2R44A 3GQ3A 1DO0A 1OTRA 1T6OA 4KT0F 3PFIA 4DR4M 3U6OA 2CEAA 1SXJB 2DVWB 1XHBA 3M6AA 2DAEA 5BPVA 3NBIA 1XMOM 2JUJA 2OPFA 1D0KA 5EXXA 3HHWA 1MN3A 3QWLA 1TTEA 2UU9M 4FCWA 2QENA 1GVNA 5EP2A 2DAGA 4NOOB 3VK8A 1QUSA 1V33A 4UN2B 1NO1A 2KNZA 2QHOB 4AKGA 4B3RM 1IN7A 1C1KA 2YNMD 3IG5A 5A2QS 2UXCM 1IY0A 1IQPA 2L7IA 2G5GX 1GL6A 2Z7JA 3U6PA 1QVRA 2CV1A 4LF6M 4NC6A 1NVMA 5KO3A 3L25A 3HU3A 3GLHE 2VIIA 3R9XB 4B3MM 4OW0A 2BJVA 2X8AA 1I4WA 2G3QA 3GPYA 4DV0M 3J80S 4BB9A 3U6EA 1PJIA 4R7GA 3UMMA 3JR4A 1IN5A 4IBGA 3C3DA 3LCUA 1PJJA 2R65A 3FTEA 3HHZA 1OFHA 4FVMA 4M0DA 3ZH9B 4Z6YA 5ITXE 5BR8M 2C9CA 3GPPA 8CATA 4OU7A 1L8QA 4CHTB 4HLQA 4NSOB 3SASA 2B3TA 2KA6B 2KDLA 4I81A 4LY6A 2QQ8A 5ITQA 2KXEA 4LF5M 4QOZC 3HGIA 2ZM6M 4LJAA 3A42A 2D7GA 4QHSA 2P5TA 4RF0A 4D80A 2BJWA 2EKFA 2MJ5B 4LCBA 1NV9A 1VG5A 1TH2A 1QUTA 4IBFA 1UFZA 4X65M 1FNNA 3B7QA 2F4VM 2C96A 2Z8YM 4LF4M 5FTKA 4L16A 3GLFB 3L29A 1E32A 1XXHE 1ZAEA 4MM3B 1GABA 1I94M 4OVZA 2LHGA 2KNAA 4ZPXA 3KSJA 2WSFF 2WZJA 3BBZA 3T6PA 4DR1M 3DA1A 1VDLA 2G8LA 4JI3M 2ZTCA 2XF3A 1TGUA 1QAOA 1BVSA 2O01F 4DR7M 1WGLA 2XFSA 3WHKA 3EIHA 4WW0A 3IG8A 4OVZB 4X64M 2FS1A 3AV0A 1IXZA 4P17A 3FRIA 1N34M 4L78A 2L4EA 2QP9X 5DYGA 5EP1A 4DR3M 2H1RA 2HWJA 4Z8XA 4GKKM 1OIPA 1HJPA 1R5LA 3QAUA 2NQ8C 4IBDA 2KRKA 3GLIA 3B7NA 1K3XA 1GL7A 1AUAA 5LMUM 1WIVA 1HT1E 1W5SA 2JP7A 3KVWA 3TL4X 2D7EA 1ZMUA 4G4RA 1TDZA 3E4RA 1ZV1A 3GLIB 1L2DA 4F1IA 4PDGA 2JWSA 4RNAA 5IZ7D 1NJGA 4AW4A 1MX0A 1R7RA 1PJQA 2CHGA 3GO8A 3U61A 1EFUB 1NHGC 1Q02A 3GLGA 4JYAM 3ZC7B 4OX9M 4B7FA 3F92A 1HNXM 1XWIA 2K6BA 2YFQA 4NXMM 2O25A 3GRVA 1GO5A 3L2AA 3PVSA 3KW6A 5FTLA 3U61B 2EUCA 3QYEA 3GLGB 2MR9A 1QZMA 2AHMA 2KHHA 2KZSA 4LFCM 3GQ5A 4GH9A 1R6BX 5JI3E 3SFZA 1GJSA 3LW5F 5EP4A 4IBKA 1Z59A 2HCBA 1S3SA 2M60A 1YSYA 3I51A 4NL4H 3U6CA 4IJEA 2LXEA 4MGKE 1AIPC 3T15A 1VEGA 4FCTA 1N36M 4FWDA 4B7GA 2DXIA 3UGJA 2C5RA 1PJTA 3CF0A 1SXJE 2CV2A 2J7OA 4LJ4A 1SG9A 2JZ0A 2KZUA 5EXPA 2CWBA 3I01M 2HAKA 4EIWA 3H4JA 5H37D 2APLA 4L8RC 3T1HM 1RU3A 3E9SA 4XBOA 5FLXS 3PXGA 2V1CA 2Y0QA 2BWBA 2DHYA 2RGOA 4DV6M 4DR2M 2M5ZA 4B7HA 1WXQA 3U6LA 3AOEA 3HKPA 4L6V6 4DUYM 4M0WA 1N77A 3UK6A 5DNYA 4DV2M 5DFLA 3AL0C 3GRRA 3LVWA 2QCUA 1Z5BA 4PDIA 1N33M 1G41A 4DV7M 2R0IA 4I5SA 1NNUC 1KFVA 2Y0TA 1JB0F 1WGNA 4D82A 2CE7A 4GIPA 3AOGA 5EXSA 4R71A 2RGHA 3WHLA 3HJQA 5KQ8A 2DNAA 5C1BA 1IY2A 3AOEC 1QQWA 2FFJA 4I8OA 5ITTA 3GLHA 2CP8A 3L27A 2CHQA 3C3EA 4X62M 1G59A 3HJ8A 3GPXA 1QDRA 1UM8A 2LTUA 4JI7M 1E9SA 4GRIA 1XC8A 2DZOB 2ZAMA 3DZDA 1VDDA 3U6DA 4IIWA 5EP3A 1OIZA 3GLHB 3MJ5A 4IBCA 3HX3A 3PNYA 2QZ4A 2LBCA 3FTFA 2RRUA 1G4AE 1ZQ9A 1Y8GA 5ITXA 2V1UA 3I04M 1D0LA 3RE8A 2CFOA 4JXJA 4AG6A 4KLNA 4DBGB 1QANA 2UXBM 2DZLA 3SHFA 1DGGA 4B08A 4DR5M 3GQ4A 1FJGM 3LCVB 4JI0M 3SAUA 1TDHA 4JN6A 3U6SA 1L1ZA 1IBMM 1QAMA 3GLFE 3KP1E 4XK8F 2DWLA 4GEWA 2X4AA 3TQSA 2R4EA 3LQQA 2VQFM 2DWNA 3TE6A 3KOXE 3W0FA 2XGNA 1OKSA 3FUWA 4G3OA 4LF7M 1G3IA 4GITA 3KXEC 4BLCA 2F5SA 2MGWA 2CUZA 2R46A 2LVOC 4KO8A 3HWSA 1G71A 3VDPA 3J7BA 4LJ7A 1IXRC 4XGIA 2JZ1A 2A5YB 2ZTDA 2E5LM 4M9ZA 1L2BA 4AZFA 1LV7A 2EKKA 3GRUA 3RGPA 5DYIA 1Q39A 2XSZD 4IBEA 3SYKA 3KSXA 4BBAA 3CF2A 2UUBM 3MMPA 3EIEA 2BNKA 3HY5A 2OO9A 4I4LA 4DV1M 4MGHA 2UUCM 3FKEA 3E46A 3I4YA 1XNRM 3FYCA 3RGSA 2W82A 2XFTA 4LZZA 4G4NA 4G4OA 2FNAA 3SYLA 4LG2A 3UJNA 3TPZA 1DV0A 1EE8A 1OAIA 1T43A 1Q3BA 1X37A 4DUZM 1PGYA 3ILKA 1R2YA 3THGA 4AKHA 4MGIE 3SARA 4LJ5A 5FTMA 2DI0A 4Y28F 2R18A 1IN6A 3HHXA 4Q7JA 4PD2A 2LVPC 3ZCBB 3RFWA 2QSFX 1HR0M 1GKIA 5LMNM 3JR5A 5L8RF 3LQRA 2OOBA 3K9PA 4YHHM 2FH0A 2R62A 2KW0A 4LF8M 3BOSA 4L4UA 1LTMA 3KFUG 2K9DA 1MU5A 4GC9A 4JI8M 2ZBKB 3LVVA 2OQ4A 3T1YM 3TWLA 1TH4A 3KOZE 1J7KA 1CUKA 2EO2A 5FTJA 2Z3XA 3ZQJA 4JI4M 2HHHM 4REZA 2CRUA 2MH8A 3D8BA 1L2CA 5JI2E 1YUBA 5IWAM 1G8PA 3GRYA 3HHYA 4GMQA 2C99A 1DGHA 1JR3E 3W0LB 1VQ1A 2KNVA 4DV4M 1IN4A 1ORYB 2JY7A 1TR8A 5ITRA 3K1JA 4DV3M 2XH9A 2VF7A 1WR1B 4LRTA 3V76A 2DENA 1XB2B 1C7YA 3I4VA 4FW9A 2RKOA 3FYDA 1WHCA 3AFHA 4HEOA 4QNMA 2C9OA 2DKLA 5ITYA 4IJFA 4PCZA 2JY5A 4CGYB 3U6MA 3VDUA 2LVAA 5GKNA 1Z6TA 4K0KM 1NHWC 2F5PA 3FUXA 4AG5A 3VLFB 3H4MA 4FWGA 2J7NA 3U6QA 1V92A 1Z5CA 4NRWA 1V34A 1SXJA 4JI6M 1E9RA
chains in the Genus database with same CATH topology
4D81A 5KPZA 2HKJA 1GLNA 3MK6A 3J81S 4B3TM 4HL4A 2XSZA 1QAQA 2Y21A 1K82A 1IY1A 1NY6A 2YQZA 2XZUA 1H6UA 2C98A 2LWXA 3SATA 4NXNM 2I7NA 4PT5A 3PNVA 3SC3A 5EQTA 4AKIA 1SXJC 4LFAM 2KRUA 5E6JA 3KS4A 1XMQM 2DHRA 3FTCA 4R3DA 3FUVA 3HU1A 1OJLA 2V6ZM 2ZAOA 4TUWA 1XNQM 2Y20A 5KPRA 3L28A 4KODA 1HNZM 4X66M 1IM2A 4FD2A 1DGBA 2JA2A 1JQJC 2CV0A 1DGFA 2L09A 2X49A 4B3SM 3SMSA 2Q2EB 4QHTA 2HL7A 3Q8XA 1IBLM 4LZJA 3L26A 3SAWA 1L1TA 4RF1A 1L1ZA 4MH0E 1KYIA 2KEBA 3D8LA 3SMPA 1PM5A 1K3WA 3GPUA 4AQYM 3VKGA 2Z4SA 5IREB 1OFIA 1HT2E 2DWZB 3TWMA 3M0EA 1IXSB 4GC5A 1IBKM 2I7PA 4LRSA 1JR3D 2XZFA 3NWLA 4GKJM 4IBBA 1N78A 3A45A 2CHVA 1QYRA 4JI1M 3KS8A 3M7GA 5ITUA 3DOAA 2R4JA 2QPAA 3HJSA 4FCVA 4IBJA 3VKHA 3J2PB 3CF6E 2FE8A 3JAMS 1SXJD 5EXTA 1NSFA 3GLFA 1D2NA 1XXHA 2Z4RA 4GHAA 4GHLA 3FUUA 4P16A 4WURA 4G4QA 7CATA 3T38A 3J7AS 3U60A 2R45A 5IT9S 4IBIA 4LJ9A 4W5WA 4NRVA 3C58A 4M9SA 1J09A 5C18A 3SAVA 1XXHB 3SHGB 3U60B 2YR0A 1E94E 2DWMA 2XLJA 2ZANA 3DFZA 2VQEM 3K92A 2EA0A 3FUTA 5KPTA 2UUAM 4LF9M 4LGMA 3SBJA 1HNWM 2LNHC 5KQDA 4MB7A 2FOIC 3A98B 4G6ZA 4CISA 3U5ZA 4AI6A 2QBYA 2XEPA 1Z5AA 2O5RA 3J27B 1T3TA 4DV5M 4KHPM 3AKZA 1NJFA 3K8ZA 4MGYE 3U5ZB 1W5TA 3CTWB 1HQYE 2QBYB 1IN8A 1N75A 1J5EM 4LJ8A 2L6OA 5EJCA 5FSWA 2LH0A 3FD9A 2DZNB 4L15A 3A46A 2F5OA 4NSRA 2UXDM 1KSFX 3AJIB 3KDSE 2ERCA 2F5QA 4JI5M 3KP0E 3UZUA 4DR6M 5FTNA 5F3WA 3HU2A 4LJ6A 4A3VB 4S12A 4QNRA 3FTDA 3KOYE 1YE9A 1DGHB 1Q3CA 2D7HA 4JI2M 1JR3A 1NY5A 3OTOM 2L7HA 3K2LA 4LGYA 3B9PA 2F5NA 4FWHA 3R8FA 3GP1A 1R2ZA 4M9XA 3VFDA 1HQCA 3MHVC 1NNJA 1TH3A 1DO2A 3VK7A 5E26A 1N32M 3TWKA 4II7A 3KOWE 4LFBM 2K47A 4ITQA 4QOSA 4YY3M 4MGZE 3GQ3A 1DO0A 3PFIA 4DR4M 3U6OA 2CEAA 1SXJB 2DVWB 1XHBA 3M6AA 5BPVA 3NBIA 1XMOM 2OPFA 5EXXA 3HHWA 3QWLA 2UU9M 4FCWA 2QENA 1GVNA 5EP2A 4NOOB 3VK8A 4AKGA 4B3RM 1IN7A 1C1KA 2YNMD 3IG5A 5A2QS 2UXCM 1IY0A 1IQPA 2L7IA 2G5GX 1GL6A 2Z7JA 3U6PA 1QVRA 2CV1A 4LF6M 1NVMA 5KO3A 3L25A 3HU3A 2VIIA 3R9XB 4B3MM 4OW0A 2BJVA 2X8AA 1I4WA 3GPYA 4DV0M 3J80S 4BB9A 3U6EA 1PJIA 4R7GA 3UMMA 3JR4A 1IN5A 4IBGA 1PJJA 2R65A 3FTEA 3HHZA 1OFHA 4FVMA 4M0DA 3ZH9B 4Z6YA 5ITXE 5BR8M 2C9CA 3GPPA 8CATA 4OU7A 1L8QA 4CHTB 4HLQA 4NSOB 3SASA 2KA6B 4LY6A 4I81A 5ITQA 2KXEA 4LF5M 4QOZC 3HGIA 2ZM6M 4LJAA 3A42A 2D7GA 4QHSA 2P5TA 4RF0A 4D80A 2BJWA 4LCBA 4IBFA 1TH2A 4X65M 1FNNA 2F4VM 2C96A 4LF4M 5FTKA 4L16A 3GLFB 3L29A 1E32A 4MM3B 1ZAEA 1I94M 4OVZA 4ZPXA 3KSJA 4DR1M 3DA1A 2G8LA 4JI3M 2XF3A 1TGUA 1QAOA 4DR7M 1Z5CA 2XFSA 3WHKA 3EIHA 4WW0A 3IG8A 4OVZB 4X64M 3AV0A 1IXZA 1N34M 4L78A 2QP9X 5DYGA 5EP1A 4DR3M 2H1RA 4Z8XA 4GKKM 3QAUA 2NQ8C 4IBDA 2KRKA 3GLIA 1K3XA 1GL7A 5LMUM 1HT1E 1W5SA 3TL4X 3KVWA 4G4RA 2D7EA 1TDZA 3E4RA 3GLIB 1L2DA 4PDGA 4RNAA 5IZ7D 1NJGA 4AW4A 1MX0A 1R7RA 2CHGA 3GO8A 3U61A 1NHGC 4JYAM 3GLGA 3ZC7B 4OX9M 4B7FA 1HNXM 1XWIA 2YFQA 4NXMM 3GRVA 3L2AA 3PVSA 3KW6A 5FTLA 3U61B 2EUCA 3GLGB 1QZMA 2AHMA 2KZSA 4LFCM 3GQ5A 4GH9A 1R6BX 5JI3E 3SFZA 5EP4A 4IBKA 1Z59A 2HCBA 1S3SA 2M60A 1YSYA 3I51A 4NL4H 3U6CA 4IJEA 2LXEA 4MGKE 3T15A 4FCTA 1N36M 4FWDA 4B7GA 2DXIA 3UGJA 2C5RA 3CF0A 1SXJE 2CV2A 2J7OA 4LJ4A 2KZUA 5EXPA 4EIWA 5H37D 4L8RC 3T1HM 3E9SA 4XBOA 5FLXS 3PXGA 2V1CA 2Y0QA 2RGOA 4DV6M 4DR2M 2M5ZA 4B7HA 1WXQA 3U6LA 3AOEA 3HKPA 4DUYM 4M0WA 1N77A 3UK6A 5DNYA 4DV2M 3AL0C 3GRRA 3LVWA 2QCUA 1Z5BA 4PDIA 1N33M 1G41A 4DV7M 4I5SA 1NNUC 1KFVA 2Y0TA 4D82A 2CE7A 4GIPA 3AOGA 5EXSA 2RGHA 3WHLA 3HJQA 5KQ8A 5C1BA 1IY2A 3AOEC 1QQWA 2FFJA 4I8OA 5ITTA 3GLHA 3L27A 2CHQA 4X62M 1G59A 3HJ8A 3GPXA 1UM8A 4JI7M 1E9SA 4GRIA 1XC8A 2DZOB 2ZAMA 3DZDA 1VDDA 3U6DA 4IIWA 5EP3A 3GLHB 3MJ5A 4IBCA 3PNYA 2QZ4A 3FTFA 1G4AE 1ZQ9A 5ITXA 2V1UA 3RE8A 2CFOA 4JXJA 4AG6A 4KLNA 1QANA 2UXBM 3SHFA 1DGGA 4B08A 4DR5M 3GQ4A 1FJGM 4JI0M 3SAUA 1TDHA 4JN6A 3U6SA 1IBMM 1QAMA 3KP1E 2DWLA 2X4AA 3TQSA 2R4EA 3LQQA 2VQFM 2DWNA 3TE6A 3KOXE 3W0FA 2XGNA 3FUWA 4LF7M 1G3IA 4GITA 3KXEC 4BLCA 2F5SA 2CUZA 2R46A 4KO8A 3HWSA 3VDPA 3J7BA 4LJ7A 1IXRC 4XGIA 2E5LM 2A5YB 4JV5M 4M9ZA 1L2BA 4AZFA 1LV7A 3GRUA 3RGPA 5DYIA 1Q39A 2XSZD 4IBEA 3SYKA 3KSXA 4BBAA 3CF2A 2UUBM 3EIEA 2BNKA 4I4LA 4DV1M 4MGHA 2UUCM 3I4YA 1XNRM 3FYCA 3RGSA 2W82A 2XFTA 4LZZA 4G4NA 4G4OA 2FNAA 3SYLA 4LG2A 3UJNA 3TPZA 1EE8A 4DUZM 1Q3BA 1X37A 3ILKA 1R2YA 3THGA 4AKHA 4MGIE 3SARA 4LJ5A 5FTMA 2R18A 1IN6A 3HHXA 4PD2A 3ZCBB 3RFWA 1HR0M 1GKIA 5LMNM 3JR5A 3LQRA 4YHHM 2R62A 2KW0A 4LF8M 3BOSA 4L4UA 3KFUG 1MU5A 4GC9A 4JI8M 2ZBKB 3LVVA 2OQ4A 3T1YM 3TWLA 1TH4A 3KOZE 1J7KA 2EO2A 5FTJA 2Z3XA 4JI4M 2HHHM 4REZA 3D8BA 1L2CA 5JI2E 1YUBA 5IWAM 1G8PA 3GRYA 3HHYA 4GMQA 2C99A 1DGHA 3W0LB 4DV4M 1IN4A 1ORYB 5ITRA 3K1JA 4DV3M 2XH9A 4LRTA 3I4VA 4FW9A 2RKOA 3FYDA 3AFHA 4QNMA 2C9OA 5ITYA 4PCZA 4IJFA 3U6MA 4CGYB 3VDUA 5GKNA 1Z6TA 4K0KM 1NHWC 2F5PA 3FUXA 4AG5A 3VLFB 3H4MA 4FWGA 2J7NA 3U6QA 3FKEA 4NRWA 3LMMA 1SXJA 4JI6M 1E9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6D A;  4JI3 M;  2HKJ A;  3A46 A;  2F5O A;  3J81 S;  4DR7 M;  4B3T M;  2UXD M;  1K82 A;  2F5Q A;  4X64 M;  4JI5 M;  5ITX A;  4DR6 M;  2XZU A;  1N34 M;  3SAT A;  4NXN M;  2UXB M;  4DR3 M;  1Q3C A;  4LFA M;  4JI2 M;  4DR5 M;  4GKK M;  3GQ4 A;  1FJG M;  3OTO M;  1XMQ M;  4JI0 M;  1K3X A;  3SAU A;  1TDH A;  2F5N A;  3GP1 A;  3U6S A;  1IBM M;  1R2Z A;  5LMU M;  1NNJ A;  1XNQ M;  2VQF M;  4G4R A;  1HNZ M;  3W0F A;  4X66 M;  3VK7 A;  1TDZ A;  1N32 M;  1L2D A;  3TWK A;  4LF7 M;  4LFB M;  4B3S M;  4PDG A;  2Q2E B;  2F5S A;  4ITQ A;  4YY3 M;  1MX0 A;  3GQ3 A;  2E5L M;  4JV5 M;  3GO8 A;  4JYA M;  1IBL M;  1L2B A;  4DR4 M;  3U6O A;  4OX9 M;  3SAW A;  1Q39 A;  1L1T A;  1L1Z A;  1XMO M;  1HNX M;  2OPF A;  4NXM M;  2UUB M;  1PM5 A;  2UU9 M;  1K3W A;  3GPU A;  4AQY M;  4DV1 M;  2UUC M;  3TWM A;  1XNR M;  3VK8 A;  4LFC M;  1IBK M;  3GQ5 A;  4G4N A;  4G4O A;  2XZF A;  4GKJ M;  4B3R M;  3A45 A;  4JI1 M;  5A2Q S;  2UXC M;  1EE8 A;  4DUZ M;  1Q3B A;  3U6P A;  5ITU A;  4LF6 M;  3DOA A;  1Z59 A;  1R2Y A;  3SAR A;  3U6C A;  3JAM S;  1N36 M;  4PD2 A;  4B3M M;  1HR0 M;  5LMN M;  3JR5 A;  3GPY A;  4DV0 M;  3J80 S;  4G4Q A;  3J7A S;  4YHH M;  3U6E A;  1PJI A;  5IT9 S;  3JR4 A;  4LF8 M;  4NRV A;  3C58 A;  1MU5 A;  4JI8 M;  2ZBK B;  2OQ4 A;  3SAV A;  3T1Y M;  3T1H M;  3TWL A;  1PJJ A;  4JI4 M;  5ITX E;  5BR8 M;  5FLX S;  2HHH M;  4DV6 M;  4DR2 M;  2VQE M;  3GPP A;  1L2C A;  3U6L A;  3SAS A;  5IWA M;  4DUY M;  2EA0 A;  5ITQ A;  2UUA M;  4LF5 M;  4LF9 M;  4DV2 M;  2ZM6 M;  4DV4 M;  3SBJ A;  1HNW M;  3A42 A;  5ITR A;  1Z5B A;  4MB7 A;  4PDI A;  4DV3 M;  1N33 M;  4DV7 M;  1KFV A;  4CIS A;  1Z5A A;  4X65 M;  5ITY A;  4PCZ A;  3U6M A;  2F4V M;  5ITT A;  4DV5 M;  4LF4 M;  4K0K M;  2F5P A;  4X62 M;  4KHP M;  3GPX A;  4JI7 M;  1I94 M;  3U6Q A;  1XC8 A;  1J5E M;  1Z5C A;  4NRW A;  4JI6 M;  4DR1 M; 
#chains in the Genus database with same CATH topology
 3CGW A;  4D81 A;  5KPZ A;  2HKJ A;  1GLN A;  2JNH A;  3MK6 A;  3J81 S;  1PRB A;  4B3T M;  4HL4 A;  2XSZ A;  1QAQ A;  2Y21 A;  3FRH A;  1QZE A;  1IY1 A;  1K82 A;  3LMM A;  1NY6 A;  2L2D A;  2YQZ A;  2XZU A;  1A5T A;  1H6U A;  2C98 A;  2LWX A;  3SAT A;  4NXN M;  2I7N A;  4PT5 A;  3PNV A;  3SC3 A;  5EQT A;  4AKI A;  1SXJ C;  4LFA M;  2KRU A;  5E6J A;  3KS4 A;  1XMQ M;  2DHR A;  2VDB B;  3IHP A;  3FTC A;  4R3D A;  3FUV A;  3HU1 A;  1OJL A;  1TF0 B;  3B74 A;  4ANR A;  2V6Z M;  2ZAO A;  4TUW A;  1XNQ M;  2Y20 A;  5KPR A;  3L28 A;  1EIJ A;  4KOD A;  1HNZ M;  4X66 M;  2MRO B;  1IM2 A;  4FD2 A;  1DGB A;  2JA2 A;  1JQJ C;  2CV0 A;  1DGF A;  2R6F A;  2L09 A;  2X49 A;  4B3S M;  2LVN C;  2Q2E B;  3SMS A;  4QHT A;  2HL7 A;  3Q8X A;  1QDT A;  3K9O A;  1IBL M;  3W67 A;  4LZJ A;  1OAO C;  1IXS A;  3L26 A;  3SAW A;  2LVQ D;  4CJ6 A;  1D0M A;  3Q8G A;  4RF1 A;  1L1T A;  1ZMV A;  3B7Z A;  1KYI A;  4MH0 E;  2KEB A;  3D8L A;  3SMP A;  1R4G A;  1GJT A;  3E21 A;  1PM5 A;  3NBX X;  1K3W A;  3GPU A;  4AQY M;  1YLA A;  3VKG A;  2Z4S A;  5IRE B;  1OFI A;  1HT2 E;  2DWZ B;  3TWM A;  3M0E A;  1IXS B;  2J5Y A;  4GC5 A;  1IBK M;  2WSE F;  2I7P A;  3HZJ A;  4LRS A;  1JR3 D;  2XZF A;  3NWL A;  4GKJ M;  4IBB A;  1N78 A;  3A45 A;  2CHV A;  1QYR A;  4JI1 M;  1VEJ A;  3KS8 A;  3M7G A;  5ITU A;  3DOA A;  2R4J A;  2QPA A;  3HJS A;  4FCV A;  4IBJ A;  3VKH A;  3J2P B;  3C9P A;  3CF6 E;  2FE8 A;  3JAM S;  1IFY A;  1SXJ D;  1NV8 A;  5EXT A;  1NSF A;  3GLF A;  1D2N A;  1XXH A;  2Z4R A;  4GHA A;  4GHL A;  3FUU A;  4P16 A;  4WUR A;  4G4Q A;  7CAT A;  3T38 A;  3B89 A;  3U60 A;  2R45 A;  4WP2 A;  3J7A S;  4IBI A;  4LJ9 A;  5IT9 S;  4W5W A;  2VF8 A;  3FE3 A;  4NRV A;  3C58 A;  4M9S A;  1J09 A;  2JY6 B;  5C18 A;  3SAV A;  1XXH B;  1P3Q Q;  2EJS A;  3IEC A;  3SHG B;  3U60 B;  2DAK A;  2YR0 A;  1E94 E;  2DWM A;  3W68 A;  2XLJ A;  2ZAN A;  3DFZ A;  2QNJ A;  3K92 A;  2VQE M;  2L4F A;  2EA0 A;  3FUT A;  5KPT A;  2UUA M;  4LF9 M;  2OOA A;  3GLI E;  3BXW A;  4LGM A;  3SBJ A;  1HNW M;  2LNH C;  5KQD A;  1OQY A;  4MB7 A;  2FOI C;  1WJ7 A;  3A98 B;  4G6Z A;  4CIS A;  3U5Z A;  4AI6 A;  2QBY A;  2XEP A;  1F4I A;  1Z5A A;  1MJG M;  2DAI A;  2JY8 A;  2O5R A;  3J27 B;  2K0B X;  1T3T A;  4F2L A;  4DV5 M;  4KHP M;  3AKZ A;  1NJF A;  3K8Z A;  4MGY E;  2WSC F;  3U5Z B;  1W5T A;  3CTW B;  1HQY E;  3GLG E;  2DAM A;  2QBY B;  1IN8 A;  1N75 A;  1ZMW A;  1J5E M;  4LJ8 A;  2L6O A;  5EJC A;  4RKU F;  5FSW A;  2LH0 A;  3FD9 A;  2DZN B;  4L15 A;  3A46 A;  1VEK A;  2F5O A;  4NSR A;  2H5X A;  2UXD M;  1KSF X;  3AJI B;  2BWE A;  3KDS E;  2ERC A;  2JXN A;  2F5Q A;  4JI5 M;  3KP0 E;  3UZU A;  4DR6 M;  5FTN A;  5F3W A;  3HU2 A;  3QYB A;  4LJ6 A;  4S12 A;  4A3V B;  4QNR A;  3FTD A;  3KOY E;  1YE9 A;  1DGH B;  1Q3C A;  2D7H A;  4JI2 M;  1JR3 A;  1NY5 A;  1PJS A;  3OTO M;  2L7H A;  3K2L A;  4LGY A;  4JV5 M;  3B9P A;  2F5N A;  4FWH A;  3R8F A;  3GP1 A;  1R2Z A;  4M9X A;  3VFD A;  1HQC A;  3MHV C;  1NNJ A;  1TH3 A;  2GNO A;  2LHC A;  1DO2 A;  3VK7 A;  5E26 A;  1N32 M;  3TWK A;  4II7 A;  3KOW E;  4CIZ A;  4LFB M;  2GQF A;  2K47 A;  4ITQ A;  2N35 A;  4QOS A;  4YY3 M;  4MGZ E;  2R44 A;  3GQ3 A;  1DO0 A;  1OTR A;  1T6O A;  4KT0 F;  3PFI A;  4DR4 M;  3U6O A;  2CEA A;  1SXJ B;  2DVW B;  1XHB A;  3M6A A;  2DAE A;  5BPV A;  3NBI A;  1XMO M;  2JUJ A;  2OPF A;  1D0K A;  5EXX A;  3HHW A;  1MN3 A;  3QWL A;  1TTE A;  2UU9 M;  4FCW A;  2QEN A;  1GVN A;  5EP2 A;  2DAG A;  4NOO B;  3VK8 A;  1QUS A;  1V33 A;  4UN2 B;  1NO1 A;  2KNZ A;  2QHO B;  4AKG A;  4B3R M;  1IN7 A;  1C1K A;  2YNM D;  3IG5 A;  5A2Q S;  2UXC M;  1IY0 A;  1IQP A;  2L7I A;  2G5G X;  1GL6 A;  2Z7J A;  3U6P A;  1QVR A;  2CV1 A;  4LF6 M;  4NC6 A;  1NVM A;  5KO3 A;  3L25 A;  3HU3 A;  3GLH E;  2VII A;  3R9X B;  4B3M M;  4OW0 A;  2BJV A;  2X8A A;  1I4W A;  2G3Q A;  3GPY A;  4DV0 M;  3J80 S;  4BB9 A;  3U6E A;  1PJI A;  4R7G A;  3UMM A;  3JR4 A;  1IN5 A;  4IBG A;  3C3D A;  3LCU A;  1PJJ A;  2R65 A;  3FTE A;  3HHZ A;  1OFH A;  4FVM A;  4M0D A;  3ZH9 B;  4Z6Y A;  5ITX E;  5BR8 M;  2C9C A;  3GPP A;  8CAT A;  4OU7 A;  1L8Q A;  4CHT B;  4HLQ A;  4NSO B;  3SAS A;  2B3T A;  2KA6 B;  2KDL A;  4I81 A;  4LY6 A;  2QQ8 A;  5ITQ A;  2KXE A;  4LF5 M;  4QOZ C;  3HGI A;  2ZM6 M;  4LJA A;  3A42 A;  2D7G A;  4QHS A;  2P5T A;  4RF0 A;  4D80 A;  2BJW A;  2EKF A;  2MJ5 B;  4LCB A;  1NV9 A;  1VG5 A;  1TH2 A;  1QUT A;  4IBF A;  1UFZ A;  4X65 M;  1FNN A;  3B7Q A;  2F4V M;  2C96 A;  2Z8Y M;  4LF4 M;  5FTK A;  4L16 A;  3GLF B;  3L29 A;  1E32 A;  1XXH E;  1ZAE A;  4MM3 B;  1GAB A;  1I94 M;  4OVZ A;  2LHG A;  2KNA A;  4ZPX A;  3KSJ A;  2WSF F;  2WZJ A;  3BBZ A;  3T6P A;  4DR1 M;  3DA1 A;  1VDL A;  2G8L A;  4JI3 M;  2ZTC A;  2XF3 A;  1TGU A;  1QAO A;  1BVS A;  2O01 F;  4DR7 M;  1WGL A;  2XFS A;  3WHK A;  3EIH A;  4WW0 A;  3IG8 A;  4OVZ B;  4X64 M;  2FS1 A;  3AV0 A;  1IXZ A;  4P17 A;  3FRI A;  1N34 M;  4L78 A;  2L4E A;  2QP9 X;  5DYG A;  5EP1 A;  4DR3 M;  2H1R A;  2HWJ A;  4Z8X A;  4GKK M;  1OIP A;  1HJP A;  1R5L A;  3QAU A;  2NQ8 C;  4IBD A;  2KRK A;  3GLI A;  3B7N A;  1K3X A;  1GL7 A;  1AUA A;  5LMU M;  1WIV A;  1HT1 E;  1W5S A;  2JP7 A;  3KVW A;  3TL4 X;  2D7E A;  1ZMU A;  4G4R A;  1TDZ A;  3E4R A;  1ZV1 A;  3GLI B;  1L2D A;  4F1I A;  4PDG A;  2JWS A;  4RNA A;  5IZ7 D;  1NJG A;  4AW4 A;  1MX0 A;  1R7R A;  1PJQ A;  2CHG A;  3GO8 A;  3U61 A;  1EFU B;  1NHG C;  1Q02 A;  3GLG A;  4JYA M;  3ZC7 B;  4OX9 M;  4B7F A;  3F92 A;  1HNX M;  1XWI A;  2K6B A;  2YFQ A;  4NXM M;  2O25 A;  3GRV A;  1GO5 A;  3L2A A;  3PVS A;  3KW6 A;  5FTL A;  3U61 B;  2EUC A;  3QYE A;  3GLG B;  2MR9 A;  1QZM A;  2AHM A;  2KHH A;  2KZS A;  4LFC M;  3GQ5 A;  4GH9 A;  1R6B X;  5JI3 E;  3SFZ A;  1GJS A;  3LW5 F;  5EP4 A;  4IBK A;  1Z59 A;  2HCB A;  1S3S A;  2M60 A;  1YSY A;  3I51 A;  4NL4 H;  3U6C A;  4IJE A;  2LXE A;  4MGK E;  1AIP C;  3T15 A;  1VEG A;  4FCT A;  1N36 M;  4FWD A;  4B7G A;  2DXI A;  3UGJ A;  2C5R A;  1PJT A;  3CF0 A;  1SXJ E;  2CV2 A;  2J7O A;  4LJ4 A;  1SG9 A;  2JZ0 A;  2KZU A;  5EXP A;  2CWB A;  3I01 M;  2HAK A;  4EIW A;  3H4J A;  5H37 D;  2APL A;  4L8R C;  3T1H M;  1RU3 A;  3E9S A;  4XBO A;  5FLX S;  3PXG A;  2V1C A;  2Y0Q A;  2BWB A;  2DHY A;  2RGO A;  4DV6 M;  4DR2 M;  2M5Z A;  4B7H A;  1WXQ A;  3U6L A;  3AOE A;  3HKP A;  4L6V 6;  4DUY M;  4M0W A;  1N77 A;  3UK6 A;  5DNY A;  4DV2 M;  5DFL A;  3AL0 C;  3GRR A;  3LVW A;  2QCU A;  1Z5B A;  4PDI A;  1N33 M;  1G41 A;  4DV7 M;  2R0I A;  4I5S A;  1NNU C;  1KFV A;  2Y0T A;  1JB0 F;  1WGN A;  4D82 A;  2CE7 A;  4GIP A;  3AOG A;  5EXS A;  4R71 A;  2RGH A;  3WHL A;  3HJQ A;  5KQ8 A;  2DNA A;  5C1B A;  1IY2 A;  3AOE C;  1QQW A;  2FFJ A;  4I8O A;  5ITT A;  3GLH A;  2CP8 A;  3L27 A;  2CHQ A;  3C3E A;  4X62 M;  1G59 A;  3HJ8 A;  3GPX A;  1QDR A;  1UM8 A;  2LTU A;  4JI7 M;  1E9S A;  4GRI A;  1XC8 A;  2DZO B;  2ZAM A;  3DZD A;  1VDD A;  3U6D A;  4IIW A;  5EP3 A;  1OIZ A;  3GLH B;  3MJ5 A;  4IBC A;  3HX3 A;  3PNY A;  2QZ4 A;  2LBC A;  3FTF A;  2RRU A;  1G4A E;  1ZQ9 A;  1Y8G A;  5ITX A;  2V1U A;  3I04 M;  1D0L A;  3RE8 A;  2CFO A;  4JXJ A;  4AG6 A;  4KLN A;  4DBG B;  1QAN A;  2UXB M;  2DZL A;  3SHF A;  1DGG A;  4B08 A;  4DR5 M;  3GQ4 A;  1FJG M;  3LCV B;  4JI0 M;  3SAU A;  1TDH A;  4JN6 A;  3U6S A;  1L1Z A;  1IBM M;  1QAM A;  3GLF E;  3KP1 E;  4XK8 F;  2DWL A;  4GEW A;  2X4A A;  3TQS A;  2R4E A;  3LQQ A;  2VQF M;  2DWN A;  3TE6 A;  3KOX E;  3W0F A;  2XGN A;  1OKS A;  3FUW A;  4G3O A;  4LF7 M;  1G3I A;  4GIT A;  3KXE C;  4BLC A;  2F5S A;  2MGW A;  2CUZ A;  2R46 A;  2LVO C;  4KO8 A;  3HWS A;  1G71 A;  3VDP A;  3J7B A;  4LJ7 A;  1IXR C;  4XGI A;  2JZ1 A;  2A5Y B;  2ZTD A;  2E5L M;  4M9Z A;  1L2B A;  4AZF A;  1LV7 A;  2EKK A;  3GRU A;  3RGP A;  5DYI A;  1Q39 A;  2XSZ D;  4IBE A;  3SYK A;  3KSX A;  4BBA A;  3CF2 A;  2UUB M;  3MMP A;  3EIE A;  2BNK A;  3HY5 A;  2OO9 A;  4I4L A;  4DV1 M;  4MGH A;  2UUC M;  3FKE A;  3E46 A;  3I4Y A;  1XNR M;  3FYC A;  3RGS A;  2W82 A;  2XFT A;  4LZZ A;  4G4N A;  4G4O A;  2FNA A;  3SYL A;  4LG2 A;  3UJN A;  3TPZ A;  1DV0 A;  1EE8 A;  1OAI A;  1T43 A;  1Q3B A;  1X37 A;  4DUZ M;  1PGY A;  3ILK A;  1R2Y A;  3THG A;  4AKH A;  4MGI E;  3SAR A;  4LJ5 A;  5FTM A;  2DI0 A;  4Y28 F;  2R18 A;  1IN6 A;  3HHX A;  4Q7J A;  4PD2 A;  2LVP C;  3ZCB B;  3RFW A;  2QSF X;  1HR0 M;  1GKI A;  5LMN M;  3JR5 A;  5L8R F;  3LQR A;  2OOB A;  3K9P A;  4YHH M;  2FH0 A;  2R62 A;  2KW0 A;  4LF8 M;  3BOS A;  4L4U A;  1LTM A;  3KFU G;  2K9D A;  1MU5 A;  4GC9 A;  4JI8 M;  2ZBK B;  3LVV A;  2OQ4 A;  3T1Y M;  3TWL A;  1TH4 A;  3KOZ E;  1J7K A;  1CUK A;  2EO2 A;  5FTJ A;  2Z3X A;  3ZQJ A;  4JI4 M;  2HHH M;  4REZ A;  2CRU A;  2MH8 A;  3D8B A;  1L2C A;  5JI2 E;  1YUB A;  5IWA M;  1G8P A;  3GRY A;  3HHY A;  4GMQ A;  2C99 A;  1DGH A;  1JR3 E;  3W0L B;  1VQ1 A;  2KNV A;  4DV4 M;  1IN4 A;  1ORY B;  2JY7 A;  1TR8 A;  5ITR A;  3K1J A;  4DV3 M;  2XH9 A;  2VF7 A;  1WR1 B;  4LRT A;  3V76 A;  2DEN A;  1XB2 B;  1C7Y A;  3I4V A;  4FW9 A;  2RKO A;  3FYD A;  1WHC A;  3AFH A;  4HEO A;  4QNM A;  2C9O A;  2DKL A;  5ITY A;  4IJF A;  4PCZ A;  2JY5 A;  4CGY B;  3U6M A;  3VDU A;  2LVA A;  5GKN A;  1Z6T A;  4K0K M;  1NHW C;  2F5P A;  3FUX A;  4AG5 A;  3VLF B;  3H4M A;  4FWG A;  2J7N A;  3U6Q A;  1V92 A;  1Z5C A;  4NRW A;  1V34 A;  1SXJ A;  4JI6 M;  1E9R A; 
#chains in the Genus database with same CATH homology
 4D81 A;  5KPZ A;  2HKJ A;  1GLN A;  3MK6 A;  3J81 S;  4B3T M;  4HL4 A;  2XSZ A;  1QAQ A;  2Y21 A;  1K82 A;  1IY1 A;  1NY6 A;  2YQZ A;  2XZU A;  1H6U A;  2C98 A;  2LWX A;  3SAT A;  4NXN M;  2I7N A;  4PT5 A;  3PNV A;  3SC3 A;  5EQT A;  4AKI A;  1SXJ C;  4LFA M;  2KRU A;  5E6J A;  3KS4 A;  1XMQ M;  2DHR A;  3FTC A;  4R3D A;  3FUV A;  3HU1 A;  1OJL A;  2V6Z M;  2ZAO A;  4TUW A;  1XNQ M;  2Y20 A;  5KPR A;  3L28 A;  4KOD A;  1HNZ M;  4X66 M;  1IM2 A;  4FD2 A;  1DGB A;  2JA2 A;  1JQJ C;  2CV0 A;  1DGF A;  2L09 A;  2X49 A;  4B3S M;  3SMS A;  2Q2E B;  4QHT A;  2HL7 A;  3Q8X A;  1IBL M;  4LZJ A;  3L26 A;  3SAW A;  1L1T A;  4RF1 A;  1L1Z A;  4MH0 E;  1KYI A;  2KEB A;  3D8L A;  3SMP A;  1PM5 A;  1K3W A;  3GPU A;  4AQY M;  3VKG A;  2Z4S A;  5IRE B;  1OFI A;  1HT2 E;  2DWZ B;  3TWM A;  3M0E A;  1IXS B;  4GC5 A;  1IBK M;  2I7P A;  4LRS A;  1JR3 D;  2XZF A;  3NWL A;  4GKJ M;  4IBB A;  1N78 A;  3A45 A;  2CHV A;  1QYR A;  4JI1 M;  3KS8 A;  3M7G A;  5ITU A;  3DOA A;  2R4J A;  2QPA A;  3HJS A;  4FCV A;  4IBJ A;  3VKH A;  3J2P B;  3CF6 E;  2FE8 A;  3JAM S;  1SXJ D;  5EXT A;  1NSF A;  3GLF A;  1D2N A;  1XXH A;  2Z4R A;  4GHA A;  4GHL A;  3FUU A;  4P16 A;  4WUR A;  4G4Q A;  7CAT A;  3T38 A;  3J7A S;  3U60 A;  2R45 A;  5IT9 S;  4IBI A;  4LJ9 A;  4W5W A;  4NRV A;  3C58 A;  4M9S A;  1J09 A;  5C18 A;  3SAV A;  1XXH B;  3SHG B;  3U60 B;  2YR0 A;  1E94 E;  2DWM A;  2XLJ A;  2ZAN A;  3DFZ A;  2VQE M;  3K92 A;  2EA0 A;  3FUT A;  5KPT A;  2UUA M;  4LF9 M;  4LGM A;  3SBJ A;  1HNW M;  2LNH C;  5KQD A;  4MB7 A;  2FOI C;  3A98 B;  4G6Z A;  4CIS A;  3U5Z A;  4AI6 A;  2QBY A;  2XEP A;  1Z5A A;  2O5R A;  3J27 B;  1T3T A;  4DV5 M;  4KHP M;  3AKZ A;  1NJF A;  3K8Z A;  4MGY E;  3U5Z B;  1W5T A;  3CTW B;  1HQY E;  2QBY B;  1IN8 A;  1N75 A;  1J5E M;  4LJ8 A;  2L6O A;  5EJC A;  5FSW A;  2LH0 A;  3FD9 A;  2DZN B;  4L15 A;  3A46 A;  2F5O A;  4NSR A;  2UXD M;  1KSF X;  3AJI B;  3KDS E;  2ERC A;  2F5Q A;  4JI5 M;  3KP0 E;  3UZU A;  4DR6 M;  5FTN A;  5F3W A;  3HU2 A;  4LJ6 A;  4A3V B;  4S12 A;  4QNR A;  3FTD A;  3KOY E;  1YE9 A;  1DGH B;  1Q3C A;  2D7H A;  4JI2 M;  1JR3 A;  1NY5 A;  3OTO M;  2L7H A;  3K2L A;  4LGY A;  3B9P A;  2F5N A;  4FWH A;  3R8F A;  3GP1 A;  1R2Z A;  4M9X A;  3VFD A;  1HQC A;  3MHV C;  1NNJ A;  1TH3 A;  1DO2 A;  3VK7 A;  5E26 A;  1N32 M;  3TWK A;  4II7 A;  3KOW E;  4LFB M;  2K47 A;  4ITQ A;  4QOS A;  4YY3 M;  4MGZ E;  3GQ3 A;  1DO0 A;  3PFI A;  4DR4 M;  3U6O A;  2CEA A;  1SXJ B;  2DVW B;  1XHB A;  3M6A A;  5BPV A;  3NBI A;  1XMO M;  2OPF A;  5EXX A;  3HHW A;  3QWL A;  2UU9 M;  4FCW A;  2QEN A;  1GVN A;  5EP2 A;  4NOO B;  3VK8 A;  4AKG A;  4B3R M;  1IN7 A;  1C1K A;  2YNM D;  3IG5 A;  5A2Q S;  2UXC M;  1IY0 A;  1IQP A;  2L7I A;  2G5G X;  1GL6 A;  2Z7J A;  3U6P A;  1QVR A;  2CV1 A;  4LF6 M;  1NVM A;  5KO3 A;  3L25 A;  3HU3 A;  2VII A;  3R9X B;  4B3M M;  4OW0 A;  2BJV A;  2X8A A;  1I4W A;  3GPY A;  4DV0 M;  3J80 S;  4BB9 A;  3U6E A;  1PJI A;  4R7G A;  3UMM A;  3JR4 A;  1IN5 A;  4IBG A;  1PJJ A;  2R65 A;  3FTE A;  3HHZ A;  1OFH A;  4FVM A;  4M0D A;  3ZH9 B;  4Z6Y A;  5ITX E;  5BR8 M;  2C9C A;  3GPP A;  8CAT A;  4OU7 A;  1L8Q A;  4CHT B;  4HLQ A;  4NSO B;  3SAS A;  2KA6 B;  4LY6 A;  4I81 A;  5ITQ A;  2KXE A;  4LF5 M;  4QOZ C;  3HGI A;  2ZM6 M;  4LJA A;  3A42 A;  2D7G A;  4QHS A;  2P5T A;  4RF0 A;  4D80 A;  2BJW A;  4LCB A;  4IBF A;  1TH2 A;  4X65 M;  1FNN A;  2F4V M;  2C96 A;  4LF4 M;  5FTK A;  4L16 A;  3GLF B;  3L29 A;  1E32 A;  4MM3 B;  1ZAE A;  1I94 M;  4OVZ A;  4ZPX A;  3KSJ A;  4DR1 M;  3DA1 A;  2G8L A;  4JI3 M;  2XF3 A;  1TGU A;  1QAO A;  4DR7 M;  1Z5C A;  2XFS A;  3WHK A;  3EIH A;  4WW0 A;  3IG8 A;  4OVZ B;  4X64 M;  3AV0 A;  1IXZ A;  1N34 M;  4L78 A;  2QP9 X;  5DYG A;  5EP1 A;  4DR3 M;  2H1R A;  4Z8X A;  4GKK M;  3QAU A;  2NQ8 C;  4IBD A;  2KRK A;  3GLI A;  1K3X A;  1GL7 A;  5LMU M;  1HT1 E;  1W5S A;  3TL4 X;  3KVW A;  4G4R A;  2D7E A;  1TDZ A;  3E4R A;  3GLI B;  1L2D A;  4PDG A;  4RNA A;  5IZ7 D;  1NJG A;  4AW4 A;  1MX0 A;  1R7R A;  2CHG A;  3GO8 A;  3U61 A;  1NHG C;  4JYA M;  3GLG A;  3ZC7 B;  4OX9 M;  4B7F A;  1HNX M;  1XWI A;  2YFQ A;  4NXM M;  3GRV A;  3L2A A;  3PVS A;  3KW6 A;  5FTL A;  3U61 B;  2EUC A;  3GLG B;  1QZM A;  2AHM A;  2KZS A;  4LFC M;  3GQ5 A;  4GH9 A;  1R6B X;  5JI3 E;  3SFZ A;  5EP4 A;  4IBK A;  1Z59 A;  2HCB A;  1S3S A;  2M60 A;  1YSY A;  3I51 A;  4NL4 H;  3U6C A;  4IJE A;  2LXE A;  4MGK E;  3T15 A;  4FCT A;  1N36 M;  4FWD A;  4B7G A;  2DXI A;  3UGJ A;  2C5R A;  3CF0 A;  1SXJ E;  2CV2 A;  2J7O A;  4LJ4 A;  2KZU A;  5EXP A;  4EIW A;  5H37 D;  4L8R C;  3T1H M;  3E9S A;  4XBO A;  5FLX S;  3PXG A;  2V1C A;  2Y0Q A;  2RGO A;  4DV6 M;  4DR2 M;  2M5Z A;  4B7H A;  1WXQ A;  3U6L A;  3AOE A;  3HKP A;  4DUY M;  4M0W A;  1N77 A;  3UK6 A;  5DNY A;  4DV2 M;  3AL0 C;  3GRR A;  3LVW A;  2QCU A;  1Z5B A;  4PDI A;  1N33 M;  1G41 A;  4DV7 M;  4I5S A;  1NNU C;  1KFV A;  2Y0T A;  4D82 A;  2CE7 A;  4GIP A;  3AOG A;  5EXS A;  2RGH A;  3WHL A;  3HJQ A;  5KQ8 A;  5C1B A;  1IY2 A;  3AOE C;  1QQW A;  2FFJ A;  4I8O A;  5ITT A;  3GLH A;  3L27 A;  2CHQ A;  4X62 M;  1G59 A;  3HJ8 A;  3GPX A;  1UM8 A;  4JI7 M;  1E9S A;  4GRI A;  1XC8 A;  2DZO B;  2ZAM A;  3DZD A;  1VDD A;  3U6D A;  4IIW A;  5EP3 A;  3GLH B;  3MJ5 A;  4IBC A;  3PNY A;  2QZ4 A;  3FTF A;  1G4A E;  1ZQ9 A;  5ITX A;  2V1U A;  3RE8 A;  2CFO A;  4JXJ A;  4AG6 A;  4KLN A;  1QAN A;  2UXB M;  3SHF A;  1DGG A;  4B08 A;  4DR5 M;  3GQ4 A;  1FJG M;  4JI0 M;  3SAU A;  1TDH A;  4JN6 A;  3U6S A;  1IBM M;  1QAM A;  3KP1 E;  2DWL A;  2X4A A;  3TQS A;  2R4E A;  3LQQ A;  2VQF M;  2DWN A;  3TE6 A;  3KOX E;  3W0F A;  2XGN A;  3FUW A;  4LF7 M;  1G3I A;  4GIT A;  3KXE C;  4BLC A;  2F5S A;  2CUZ A;  2R46 A;  4KO8 A;  3HWS A;  3VDP A;  3J7B A;  4LJ7 A;  1IXR C;  4XGI A;  2E5L M;  2A5Y B;  4JV5 M;  4M9Z A;  1L2B A;  4AZF A;  1LV7 A;  3GRU A;  3RGP A;  5DYI A;  1Q39 A;  2XSZ D;  4IBE A;  3SYK A;  3KSX A;  4BBA A;  3CF2 A;  2UUB M;  3EIE A;  2BNK A;  4I4L A;  4DV1 M;  4MGH A;  2UUC M;  3I4Y A;  1XNR M;  3FYC A;  3RGS A;  2W82 A;  2XFT A;  4LZZ A;  4G4N A;  4G4O A;  2FNA A;  3SYL A;  4LG2 A;  3UJN A;  3TPZ A;  1EE8 A;  4DUZ M;  1Q3B A;  1X37 A;  3ILK A;  1R2Y A;  3THG A;  4AKH A;  4MGI E;  3SAR A;  4LJ5 A;  5FTM A;  2R18 A;  1IN6 A;  3HHX A;  4PD2 A;  3ZCB B;  3RFW A;  1HR0 M;  1GKI A;  5LMN M;  3JR5 A;  3LQR A;  4YHH M;  2R62 A;  2KW0 A;  4LF8 M;  3BOS A;  4L4U A;  3KFU G;  1MU5 A;  4GC9 A;  4JI8 M;  2ZBK B;  3LVV A;  2OQ4 A;  3T1Y M;  3TWL A;  1TH4 A;  3KOZ E;  1J7K A;  2EO2 A;  5FTJ A;  2Z3X A;  4JI4 M;  2HHH M;  4REZ A;  3D8B A;  1L2C A;  5JI2 E;  1YUB A;  5IWA M;  1G8P A;  3GRY A;  3HHY A;  4GMQ A;  2C99 A;  1DGH A;  3W0L B;  4DV4 M;  1IN4 A;  1ORY B;  5ITR A;  3K1J A;  4DV3 M;  2XH9 A;  4LRT A;  3I4V A;  4FW9 A;  2RKO A;  3FYD A;  3AFH A;  4QNM A;  2C9O A;  5ITY A;  4PCZ A;  4IJF A;  3U6M A;  4CGY B;  3VDU A;  5GKN A;  1Z6T A;  4K0K M;  1NHW C;  2F5P A;  3FUX A;  4AG5 A;  3VLF B;  3H4M A;  4FWG A;  2J7N A;  3U6Q A;  3FKE A;  4NRW A;  3LMM A;  1SXJ A;  4JI6 M;  1E9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...