1UFZA

Solution structure of hbs1-like domain in hypothetical protein bab28515
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
GSSGSSGEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of HBS1-like domain in hypothetical protein BAB28515
rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords Hypothetical protein BAB28515
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ufzA01
1WJ7A 1HJPA 2EJSA 3K9PA 1HT1E 1IM2A 1TTEA 2LVAA 5JI2E 1DV0A 4Q7JA 1G3IA 3IHPA 2BWEA 3H4JA 1JR3E 2K9DA 1GO5A 2QNJA 1KYIA 2H5XA 2JY7A 3E46A 4HEOA 1DO0A 2KNVA 4UN2B 1UFZA 3LCUA 2LVNC 1QZEA 2DI0A 1YLAA 2ZTCA 1IXSA 1HT2E 1NV9A 2LBCA 3B89A 2B3TA 1VEJA 3F92A 3K9OA 1AIPC 2DKLA 2WZJA 4F1IA 1VG5A 2BWBA 3FE3A 2JZ1A 1T43A 2DHYA 1V92A 1G41A 1Q02A 2G3QA 2MROB 1BVSA 1CUKA 1P3QQ 2ZTDA 2KNAA 4DBGB 2DAKA 2L4FA 2LVPC 1C7YA 2CP8A 1DO2A 2L4EA 1VQ1A 1G4AE 1OQYA 2DAEA 3T6PA 2JNHA 1WR1B 1ZMWA 3FRHA 2QHOB 2MJ5B 2K0BX 2L2DA 1R4GA 3IECA 1OKSA 4G3OA 2KNZA 4R71A 3FRIA 1Y8GA 4GEWA 1E94E 1WHCA 2JY5A 3BBZA 2QSFX 2JY8A 2EKKA 1VDLA 1WIVA 2LTUA 1F4IA 1OTRA 2LVOC 2MGWA 3GLGE 1HQYE 2DAGA 1PGYA 2DAIA 1ZMVA 3MMPA 2DNAA 2JUJA 1XB2B 1ZV1A 2JP7A 1WGLA 2R0IA 1ZMUA 2DZLA 1XXHE 2EKFA 3LCVB 1A5TA 1OAIA 1TR8A 2RRUA 3GLFE 2DENA 2JZ0A 2OOAA 2KHHA 2HWJA 1T6OA 2MR9A 2DAMA 4WP2A 4F2LA 1NV8A 2O25A 1MN3A 1IFYA 1WGNA 3E21A 2OO9A 1VEKA 2JY6B 2OOBA 3GLHE 1EFUB 2CWBA 3GLIE 2LVQD 1VEGA 1SG9A 5DFLA 2HAKA
chains in the Genus database with same CATH superfamily
2LH0A 2EJSA 3SMPA 3GPYA 1Q3BA 2L09A 1AUAA 2LNHC 4CGYB 1HT1E 2R45A 1IN5A 1IM2A 3HU3A 7CATA 1TDHA 5EXPA 3GLFB 2Y20A 1HNWM 1EIJA 3LQRA 4S12A 4LJ8A 2FE8A 1HNZM 4M0DA 3TE6A 4Z6YA 1GL7A 3A42A 3KVWA 1PJTA 4NOOB 3IHPA 3HHZA 4WW0A 5FTLA 3R8FA 3FTEA 3GPUA 4FCWA 2WSCF 3ZQJA 2BWEA 1ZQ9A 1JR3E 4LF6M 3FTFA 2QQ8A 3PNYA 4CIZA 3AOGA 4Z8XA 4IBKA 3SYLA 1GABA 4LJ4A 3KSJA 4IBFA 2QNJA 4LJ6A 2EUCA 4LGMA 3U61B 1Z5BA 3U5ZA 2KRKA 2ZBKB 1N75A 2C96A 1YLAA 2X49A 4NC6A 4NL4H 4Y28F 4YY3M 1SXJD 1IXSA 1HT2E 1NV9A 3B89A 3F92A 3TQSA 2ZM6M 2DKLA 4GHLA 4F1IA 1VG5A 3RGPA 2KW0A 3NWLA 5BPVA 3AL0C 2RGOA 3TWKA 5EJCA 4AG5A 1YUBA 4B08A 5ITQA 1J5EM 3KDSE 3HHXA 3RFWA 2UXBM 4AI6A 3IG5A 4MM3B 3GLFA 2FH0A 1QANA 1L2BA 3VDUA 1Z5CA 4JI5M 3KOWE 4KT0F 4IJEA 3LQQA 2V1CA 3TWMA 1DO2A 2CP8A 2JA2A 3HJQA 1ZAEA 3K92A 1IN4A 1OJLA 2ZAMA 1IBLM 2UXCM 4JI3M 2JNHA 1ZMWA 1IN8A 4RNAA 2F5OA 1EE8A 3SYKA 2MJ5B 2FS1A 2HL7A 3B9PA 5DYIA 1E9SA 4CHTB 3IECA 2YFQA 1OKSA 4G6ZA 3GQ5A 2KNZA 4REZA 3KS4A 1SXJA 4I81A 4GEWA 1E94E 2JY5A 4JI8M 1XHBA 2LHGA 1MU5A 2QSFX 1NNUC 2Y0TA 1SXJE 2O01F 3SHGB 2LTUA 1WIVA 4KODA 4NXMM 4DV2M 3LW5F 4IIWA 2LVOC 3GLGE 1HQYE 4X62M 3BXWA 4RKUF 4R7GA 1DGBA 2DWZB 1PJSA 3DFZA 3TL4X 3W0LB 4D81A 1ZMVA 2QENA 3MMPA 2DNAA 3C58A 3U6MA 4P17A 3T38A 4M9SA 3GPXA 4IBBA 1L2DA 3FUUA 3B74A 4FW9A 2XH9A 3L26A 2LXEA 3RE8A 3GO8A 3J7AS 2EKFA 2DWMA 1OAIA 3FYDA 5F3WA 4JI2M 2DENA 2OOAA 4JI0M 5IWAM 2X8AA 3PXGA 1K3XA 4GMQA 3KXEC 2YR0A 2MR9A 2DAMA 3A98B 4OW0A 4F2LA 3U6DA 2ZAOA 3JAMS 1GL6A 4JI6M 1NV8A 2O25A 1IXSB 1FJGM 4LFBM 4L78A 2UUCM 1S3SA 1YSYA 2QPAA 1Q3CA 3C3EA 3E21A 4JN6A 4RF1A 1VEKA 2CV0A 2FNAA 4GC5A 5EP2A 2WSFF 2Z8YM 3FUVA 2DVWB 3GLIE 1KFVA 3CF2A 3EIHA 1JR3A 4DV7M 2LVQD 1XWIA 1E32A 5DFLA 1MX0A 2HAKA 4FCVA 4JV5M 4DR6M 3W68A 1NO1A 4LF7M 3D8LA 3SATA 4B7HA 4I4LA 1NJGA 2C5RA 3J27B 5ITUA 1D2NA 4NRVA 3B7NA 2Z7JA 1D0MA 3I4YA 4B7FA 1N78A 4Q7JA 2OPFA 1XNQM 3FTDA 3U6PA 5FSWA 1N77A 2X4AA 3KOZE 4YHHM 5ITXE 3AV0A 1Z6TA 3JR4A 2H1RA 3VLFB 3GLGB 2CHVA 2LHCA 3FTCA 2XF3A 3NBIA 3J80S 3I4VA 3E46A 1TH4A 4HEOA 4UN2B 2V1UA 1TH2A 5DYGA 3U60B 1NNJA 3GRRA 2LVNC 3LVWA 4DV0M 3SC3A 2R6FA 3FUWA 3HWSA 4GC9A 4OX9M 3C3DA 5KPTA 2B3TA 8CATA 4G4QA 1AIPC 1W5SA 3QWLA 4BLCA 4II7A 1NJFA 1H6UA 2BWBA 3TPZA 3FE3A 3UGJA 2JZ1A 3U6LA 3KOYE 4DR2M 1T43A 1V92A 2DHRA 4LGYA 5E26A 3SAVA 1Q02A 3GLIB 5ITTA 1IN7A 2G3QA 4JYAM 1P3QQ 1CUKA 3KSXA 3VK8A 2ZTDA 3NBXX 1DGGA 2I7NA 4DBGB 5ITRA 2VQFM 1XXHA 2DXIA 3MJ5A 2DAKA 1K82A 3HHYA 2CHGA 4AW4A 1C7YA 4MGKE 4BB9A 4LJ5A 2BNKA 4XBOA 2F5QA 1N33M 2CUZA 1G4AE 2GNOA 1OQYA 1JR3D 1WR1B 2QHOB 2K0BX 1R2YA 4DV1M 3VKGA 5FTMA 3JR5A 4DR1M 1RU3A 4AQYM 3J2PB 4LF8M 4NRWA 2R18A 4QHSA 4B3SM 2D7HA 4FWHA 1QAOA 2JY8A 1QDTA 1VDLA 3LVVA 1OTRA 2QP9X 2C9OA 3E9SA 1IQPA 1L1TA 2JUJA 2CFOA 1FNNA 1LTMA 4MGIE 4L8RC 1TDZA 2C99A 2R46A 5DNYA 5ITYA 1ZMUA 1WXQA 4ZPXA 5KPZA 4LCBA 1TR8A 4RF0A 3HU2A 2JZ0A 5FTNA 1YE9A 3AOEC 2DWLA 5L8RF 2XSZA 3HHWA 3SBJA 4L16A 4LFCM 4HLQA 2KA6B 2DWNA 1IFYA 3PVSA 4DV6M 1IY1A 1NY5A 2CEAA 3GLHE 1EFUB 2CWBA 2VF8A 2VQEM 2J7OA 4DR3M 3J7BA 3H4MA 4WURA 3FYCA 1SG9A 3WHKA 4BBAA 1XC8A 3SMSA 4DV5M 3KFUG 4FCTA 3AJIB 1WJ7A 1HJPA 1OFIA 3K9PA 4PT5A 5FTJA 3U6QA 3T1HM 1N34M 1I94M 1UM8A 2F5PA 3WHLA 3SFZA 5FTKA 1TTEA 2QZ4A 5JI3E 1XXHB 5C18A 5JI2E 4LG2A 5IREB 1E9RA 4B7GA 2R65A 1DV0A 1ORYB 3GPPA 5KQDA 3A45A 1IXZA 1SXJC 3GQ3A 2FFJA 2C9CA 3DOAA 3A46A 4IJFA 1Q39A 2A5YB 3QAUA 4K0KM 4IBJA 3UZUA 3R9XB 3VK7A 1OIPA 4W5WA 3ZH9B 5EP1A 4DV4M 4GKJM 2H5XA 4OVZB 2JY7A 4GRIA 1NSFA 4LZZA 4B3TM 1DGHB 2CV1A 1UFZA 1QZMA 1N32M 2M60A 2Q2EB 1R7RA 1C1KA 1X37A 2E5LM 3GRUA 3VDPA 2C98A 2KZUA 1GKIA 3HKPA 3UMMA 2OQ4A 2LBCA 3U6OA 1HNXM 3KS8A 4P16A 2XLJA 4MGYE 3MK6A 3AFHA 4M9XA 2DZNB 2VF7A 4HL4A 1NY6A 3SHFA 1GJSA 4NSRA 4QNRA 1XMQM 4M9ZA 4JI7M 2R62A 1L2CA 3KP0E 4XGIA 5E6JA 4DV3M 2L7HA 2MROB 1L8QA 2VIIA 4LRTA 2Y21A 4LRSA 3LMMA 2LVPC 1QDRA 1GVNA 2L4EA 1VQ1A 3MHVC 2J5YA 3M7GA 3I51A 3T6PA 1G59A 3CF0A 2R4JA 3IG8A 3CGWA 2N35A 1NVMA 4MGHA 3W67A 3U6EA 1J09A 4I5SA 3Q8GA 4MGZE 2L7IA 4R71A 4FVMA 3U6SA 1SXJB 4FD2A 1IXRC 1Y8GA 2D7EA 2UU9M 4GKKM 1WHCA 3BBZA 4FWGA 1QAQA 3D8BA 3HJSA 4QOSA 4TUWA 1I4WA 1LV7A 1IBMM 1JQJC 1QAMA 1OAOC 2MGWA 2R4EA 2DAGA 4DR5M 2UUAM 2BJVA 5FLXS 3V76A 5C1BA 3QYBA 3KW6A 3M0EA 1XB2B 3I01M 1ZV1A 4KHPM 2JP7A 2Z4RA 1WGLA 2R0IA 3GRVA 4X66M 4ITQA 2W82A 3K8ZA 3I04M 1IY0A 3T1YM 5GKNA 2DZLA 2EO2A 1IN6A 1D0LA 4OVZA 5EQTA 4OU7A 4AKIA 2ERCA 4IBIA 4L6V6 3FKEA 3TWLA 2HWJA 3C9PA 2XFTA 3HZJA 3RGSA 4L4UA 4IBGA 4WP2A 3THGA 4X64M 3CTWB 2CHQA 1MN3A 5EXSA 2KDLA 4AKGA 5EXXA 4XK8F 2KRUA 1N36M 2OOBA 4GHAA 4AG6A 1QYRA 3ILKA 1PM5A 2G5GX 1VDDA 2J7NA 3CF6E 2O5RA 1KSFX 3DZDA 3ZCBB 3L29A 1PRBA 1W5TA 1G8PA 1R6BX 2XEPA 3FD9A 3L2AA 2P5TA 4CJ6A 2UXDM 3GP1A 2LVAA 2XZFA 1QQWA 2YQZA 4MH0E 2CE7A 4PDIA 3B7QA 2HKJA 3PNVA 4DUZM 4D80A 5EP4A 5ITXA 4GITA 1G3IA 4DR7M 2M5ZA 2V6ZM 1QUTA 3H4JA 4GIPA 3HU1A 2K9DA 2QCUA 2F5SA 2LWXA 5H37D 2FOIC 5KO3A 4LF9M 2D7GA 3AKZA 1TGUA 1GO5A 1PJQA 1NHGC 2NQ8C 1KYIA 1V34A 1V33A 4LY6A 4QOZC 1NHWC 1DO0A 2APLA 2I7PA 2KNVA 1L1ZA 2F4VM 2HCBA 3LCUA 4CISA 1QZEA 4KO8A 3AOEA 1IBKM 2WSEF 2DI0A 4LJ9A 4LZJA 5KPRA 3GQ4A 2RGHA 3SAUA 4B3MM 1HR0M 2ZTCA 5IZ7D 4G4OA 1OIZA 3SAWA 1QUSA 2CRUA 1VEJA 2L6OA 2K47A 3K9OA 3GLHA 2MH8A 1JB0F 2WZJA 4PCZA 1R2ZA 3HJ8A 4R3DA 3BOSA 3VFDA 2DHYA 1G71A 2RKOA 4NXNM 4JI4M 1G41A 2R44A 1IY2A 3GLIA 1HQCA 3KOXE 5KQ8A 4DUYM 3K1JA 1BVSA 3M6AA 3UJNA 2KNAA 4MB7A 4D82A 3L28A 1TH3A 2BJWA 2L4FA 3FUXA 3OTOM 3E4RA 4PDGA 1Z59A 2XSZD 2DAEA 1PJJA 4LF5M 4X65M 4G4RA 3FRHA 2JWSA 2HHHM 2ZANA 1QVRA 4IBDA 2L2DA 1GJTA 1R4GA 3GLGA 5LMNM 3SASA 3SARA 4LFAM 4LJ7A 4G3OA 1DGFA 3HGIA 2CV2A 3FRIA 2UUBM 1DGHA 3HY5A 3KP1E 3U61A 4KLNA 3ZC7B 2QBYA 2QBYB 2Y0QA 2YNMD 4FWDA 3U6CA 3GRYA 4DR4M 4M0WA 1XMOM 2EKKA 4AKHA 1F4IA 4LJAA 1MJGM 3L27A 4GH9A 5A2QS 2Z4SA 3EIEA 3QYEA 1PGYA 1R5LA 2K6BA 4I8OA 2DAIA 5EP3A 4G4NA 3FUTA 4QNMA 2Z3XA 4ANRA 2DZOB 3K2LA 4PD2A 4QHTA 1D0KA 2AHMA 2G8LA 2KZSA 2XGNA 2GQFA 3DA1A 5EXTA 4AZFA 4EIWA 1J7KA 4JI1M 5BR8M 4B3RM 5IT9S 1XXHE 3LCVB 2VDBB 1A5TA 2RRUA 4JXJA 2F5NA 3T15A 3UK6A 1TF0B 3J81S 3GLFE 5LMUM 3Q8XA 4NSOB 4LF4M 4L15A 2KHHA 3U60A 2XFSA 1Z5AA 4A3VB 1T6OA 1K3WA 1PJIA 3U5ZB 3L25A 3PFIA 1OFHA 1T3TA 1WGNA 4IBCA 2KEBA 2KXEA 3B7ZA 2OO9A 2EA0A 2JY6B 2XZUA 3GLHB 3W0FA 1XNRM 2JXNA 1VEGA 3HX3A 4IBEA 1GLNA 3VKHA
chains in the Genus database with same CATH topology
1WJ7A 1HJPA 2EJSA 3K9PA 1HT1E 1IM2A 1TTEA 2LVAA 5JI2E 1DV0A 4Q7JA 1G3IA 3IHPA 2BWEA 3H4JA 1JR3E 2K9DA 1GO5A 2QNJA 1KYIA 2H5XA 2JY7A 3E46A 4HEOA 1DO0A 2KNVA 4UN2B 1UFZA 3LCUA 2LVNC 1QZEA 2DI0A 1YLAA 2ZTCA 1IXSA 1HT2E 1NV9A 2LBCA 3B89A 2B3TA 1VEJA 3F92A 3K9OA 1AIPC 2DKLA 2WZJA 4F1IA 1VG5A 2BWBA 3FE3A 2JZ1A 1T43A 2DHYA 1V92A 1G41A 1Q02A 2G3QA 2MROB 1BVSA 1CUKA 1P3QQ 2ZTDA 2KNAA 4DBGB 2DAKA 2L4FA 2LVPC 1C7YA 2CP8A 1DO2A 2L4EA 1VQ1A 1G4AE 1OQYA 2DAEA 3T6PA 2JNHA 1WR1B 1ZMWA 3FRHA 2QHOB 2MJ5B 2K0BX 2L2DA 1R4GA 3IECA 1OKSA 4G3OA 2KNZA 4R71A 3FRIA 1Y8GA 4GEWA 1E94E 1WHCA 2JY5A 3BBZA 2QSFX 2JY8A 2EKKA 1VDLA 1WIVA 2LTUA 1F4IA 1OTRA 2LVOC 2MGWA 3GLGE 1HQYE 2DAGA 1PGYA 2DAIA 1ZMVA 3MMPA 2DNAA 2JUJA 1XB2B 1ZV1A 2JP7A 1WGLA 2R0IA 1ZMUA 2DZLA 1XXHE 2EKFA 3LCVB 1A5TA 1OAIA 1TR8A 2RRUA 3GLFE 2DENA 2JZ0A 2OOAA 2KHHA 2HWJA 1T6OA 2MR9A 2DAMA 4WP2A 4F2LA 1NV8A 2O25A 1MN3A 1IFYA 1WGNA 3E21A 2OO9A 1VEKA 2JY6B 2OOBA 3GLHE 1EFUB 2CWBA 3GLIE 2LVQD 1VEGA 1SG9A 5DFLA 2HAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ7 A;  1HJP A;  2EJS A;  3K9P A;  1HT1 E;  1IM2 A;  1TTE A;  2LVA A;  5JI2 E;  1DV0 A;  4Q7J A;  1G3I A;  3IHP A;  2BWE A;  3H4J A;  1JR3 E;  2K9D A;  1GO5 A;  2QNJ A;  1KYI A;  2H5X A;  2JY7 A;  3E46 A;  4HEO A;  1DO0 A;  2KNV A;  4UN2 B;  1UFZ A;  3LCU A;  2LVN C;  1QZE A;  2DI0 A;  1YLA A;  2ZTC A;  1IXS A;  1HT2 E;  1NV9 A;  2LBC A;  3B89 A;  2B3T A;  1VEJ A;  3F92 A;  3K9O A;  1AIP C;  2DKL A;  2WZJ A;  4F1I A;  1VG5 A;  2BWB A;  3FE3 A;  2JZ1 A;  1T43 A;  2DHY A;  1V92 A;  1G41 A;  1Q02 A;  2G3Q A;  2MRO B;  1BVS A;  1CUK A;  1P3Q Q;  2ZTD A;  2KNA A;  4DBG B;  2DAK A;  2L4F A;  2LVP C;  1C7Y A;  2CP8 A;  1DO2 A;  2L4E A;  1VQ1 A;  1G4A E;  1OQY A;  2DAE A;  3T6P A;  2JNH A;  1WR1 B;  1ZMW A;  3FRH A;  2QHO B;  2MJ5 B;  2K0B X;  2L2D A;  1R4G A;  3IEC A;  1OKS A;  4G3O A;  2KNZ A;  4R71 A;  3FRI A;  1Y8G A;  4GEW A;  1E94 E;  1WHC A;  2JY5 A;  3BBZ A;  2QSF X;  2JY8 A;  2EKK A;  1VDL A;  1WIV A;  2LTU A;  1F4I A;  1OTR A;  2LVO C;  2MGW A;  3GLG E;  1HQY E;  2DAG A;  1PGY A;  2DAI A;  1ZMV A;  3MMP A;  2DNA A;  2JUJ A;  1XB2 B;  1ZV1 A;  2JP7 A;  1WGL A;  2R0I A;  1ZMU A;  2DZL A;  1XXH E;  2EKF A;  3LCV B;  1A5T A;  1OAI A;  1TR8 A;  2RRU A;  3GLF E;  2DEN A;  2JZ0 A;  2OOA A;  2KHH A;  2HWJ A;  1T6O A;  2MR9 A;  2DAM A;  4WP2 A;  4F2L A;  1NV8 A;  2O25 A;  1MN3 A;  1IFY A;  1WGN A;  3E21 A;  2OO9 A;  1VEK A;  2JY6 B;  2OOB A;  3GLH E;  1EFU B;  2CWB A;  3GLI E;  2LVQ D;  1VEG A;  1SG9 A;  5DFL A;  2HAK A; 
#chains in the Genus database with same CATH topology
 2LH0 A;  2EJS A;  3SMP A;  3GPY A;  1Q3B A;  2L09 A;  1AUA A;  2LNH C;  4CGY B;  1HT1 E;  2R45 A;  1IN5 A;  1IM2 A;  3HU3 A;  7CAT A;  1TDH A;  5EXP A;  3GLF B;  2Y20 A;  1HNW M;  1EIJ A;  3LQR A;  4S12 A;  4LJ8 A;  2FE8 A;  1HNZ M;  4M0D A;  3TE6 A;  4Z6Y A;  1GL7 A;  3A42 A;  3KVW A;  1PJT A;  4NOO B;  3IHP A;  3HHZ A;  4WW0 A;  5FTL A;  3R8F A;  3FTE A;  3GPU A;  4FCW A;  2WSC F;  3ZQJ A;  2BWE A;  1ZQ9 A;  1JR3 E;  4LF6 M;  3FTF A;  2QQ8 A;  3PNY A;  4CIZ A;  3AOG A;  4Z8X A;  4IBK A;  3SYL A;  1GAB A;  4LJ4 A;  3KSJ A;  4IBF A;  2QNJ A;  4LJ6 A;  2EUC A;  4LGM A;  3U61 B;  1Z5B A;  3U5Z A;  2KRK A;  2ZBK B;  1N75 A;  2C96 A;  1YLA A;  2X49 A;  4NC6 A;  4NL4 H;  4Y28 F;  4YY3 M;  1SXJ D;  1IXS A;  1HT2 E;  1NV9 A;  3B89 A;  3F92 A;  3TQS A;  2ZM6 M;  2DKL A;  4GHL A;  4F1I A;  1VG5 A;  3RGP A;  2KW0 A;  3NWL A;  5BPV A;  3AL0 C;  2RGO A;  3TWK A;  5EJC A;  4AG5 A;  1YUB A;  4B08 A;  5ITQ A;  1J5E M;  3KDS E;  3HHX A;  3RFW A;  2UXB M;  4AI6 A;  3IG5 A;  4MM3 B;  3GLF A;  2FH0 A;  1QAN A;  1L2B A;  3VDU A;  1Z5C A;  4JI5 M;  3KOW E;  4KT0 F;  4IJE A;  3LQQ A;  2V1C A;  3TWM A;  1DO2 A;  2CP8 A;  2JA2 A;  3HJQ A;  1ZAE A;  3K92 A;  1IN4 A;  1OJL A;  2ZAM A;  1IBL M;  2UXC M;  4JI3 M;  2JNH A;  1ZMW A;  1IN8 A;  4RNA A;  2F5O A;  1EE8 A;  3SYK A;  2MJ5 B;  2FS1 A;  2HL7 A;  3B9P A;  5DYI A;  1E9S A;  4CHT B;  3IEC A;  2YFQ A;  1OKS A;  4G6Z A;  3GQ5 A;  2KNZ A;  4REZ A;  3KS4 A;  1SXJ A;  4I81 A;  4GEW A;  1E94 E;  2JY5 A;  4JI8 M;  1XHB A;  2LHG A;  1MU5 A;  2QSF X;  1NNU C;  2Y0T A;  1SXJ E;  2O01 F;  3SHG B;  2LTU A;  1WIV A;  4KOD A;  4NXM M;  4DV2 M;  3LW5 F;  4IIW A;  2LVO C;  3GLG E;  1HQY E;  4X62 M;  3BXW A;  4RKU F;  4R7G A;  1DGB A;  2DWZ B;  1PJS A;  3DFZ A;  3TL4 X;  3W0L B;  4D81 A;  1ZMV A;  2QEN A;  3MMP A;  2DNA A;  3C58 A;  3U6M A;  4P17 A;  3T38 A;  4M9S A;  3GPX A;  4IBB A;  1L2D A;  3FUU A;  3B74 A;  4FW9 A;  2XH9 A;  3L26 A;  2LXE A;  3RE8 A;  3GO8 A;  3J7A S;  2EKF A;  2DWM A;  1OAI A;  3FYD A;  5F3W A;  4JI2 M;  2DEN A;  2OOA A;  4JI0 M;  5IWA M;  2X8A A;  3PXG A;  1K3X A;  4GMQ A;  3KXE C;  2YR0 A;  2MR9 A;  2DAM A;  3A98 B;  4OW0 A;  4F2L A;  3U6D A;  2ZAO A;  3JAM S;  1GL6 A;  4JI6 M;  1NV8 A;  2O25 A;  1IXS B;  1FJG M;  4LFB M;  4L78 A;  2UUC M;  1S3S A;  1YSY A;  2QPA A;  1Q3C A;  3C3E A;  3E21 A;  4JN6 A;  4RF1 A;  1VEK A;  2CV0 A;  2FNA A;  4GC5 A;  5EP2 A;  2WSF F;  2Z8Y M;  3FUV A;  2DVW B;  3GLI E;  1KFV A;  3CF2 A;  3EIH A;  1JR3 A;  4DV7 M;  2LVQ D;  1XWI A;  1E32 A;  5DFL A;  1MX0 A;  2HAK A;  4FCV A;  4JV5 M;  4DR6 M;  3W68 A;  1NO1 A;  4LF7 M;  3D8L A;  3SAT A;  4B7H A;  4I4L A;  1NJG A;  2C5R A;  3J27 B;  5ITU A;  1D2N A;  4NRV A;  3B7N A;  2Z7J A;  1D0M A;  3I4Y A;  4B7F A;  1N78 A;  4Q7J A;  2OPF A;  1XNQ M;  3FTD A;  3U6P A;  5FSW A;  1N77 A;  2X4A A;  3KOZ E;  4YHH M;  5ITX E;  3AV0 A;  1Z6T A;  3JR4 A;  2H1R A;  3VLF B;  3GLG B;  2CHV A;  2LHC A;  3FTC A;  2XF3 A;  3NBI A;  3J80 S;  3I4V A;  3E46 A;  1TH4 A;  4HEO A;  4UN2 B;  2V1U A;  1TH2 A;  5DYG A;  3U60 B;  1NNJ A;  3GRR A;  2LVN C;  3LVW A;  4DV0 M;  3SC3 A;  2R6F A;  3FUW A;  3HWS A;  4GC9 A;  4OX9 M;  3C3D A;  5KPT A;  2B3T A;  8CAT A;  4G4Q A;  1AIP C;  1W5S A;  3QWL A;  4BLC A;  4II7 A;  1NJF A;  1H6U A;  2BWB A;  3TPZ A;  3FE3 A;  3UGJ A;  2JZ1 A;  3U6L A;  3KOY E;  4DR2 M;  1T43 A;  1V92 A;  2DHR A;  4LGY A;  5E26 A;  3SAV A;  1Q02 A;  3GLI B;  5ITT A;  1IN7 A;  2G3Q A;  4JYA M;  1P3Q Q;  1CUK A;  3KSX A;  3VK8 A;  2ZTD A;  3NBX X;  1DGG A;  2I7N A;  4DBG B;  5ITR A;  2VQF M;  1XXH A;  2DXI A;  3MJ5 A;  2DAK A;  1K82 A;  3HHY A;  2CHG A;  4AW4 A;  1C7Y A;  4MGK E;  4BB9 A;  4LJ5 A;  2BNK A;  4XBO A;  2F5Q A;  1N33 M;  2CUZ A;  1G4A E;  2GNO A;  1OQY A;  1JR3 D;  1WR1 B;  2QHO B;  2K0B X;  1R2Y A;  4DV1 M;  3VKG A;  5FTM A;  3JR5 A;  4DR1 M;  1RU3 A;  4AQY M;  3J2P B;  4LF8 M;  4NRW A;  2R18 A;  4QHS A;  4B3S M;  2D7H A;  4FWH A;  1QAO A;  2JY8 A;  1QDT A;  1VDL A;  3LVV A;  1OTR A;  2QP9 X;  2C9O A;  3E9S A;  1IQP A;  1L1T A;  2JUJ A;  2CFO A;  1FNN A;  1LTM A;  4MGI E;  4L8R C;  1TDZ A;  2C99 A;  2R46 A;  5DNY A;  5ITY A;  1ZMU A;  1WXQ A;  4ZPX A;  5KPZ A;  4LCB A;  1TR8 A;  4RF0 A;  3HU2 A;  2JZ0 A;  5FTN A;  1YE9 A;  3AOE C;  2DWL A;  5L8R F;  2XSZ A;  3HHW A;  3SBJ A;  4L16 A;  4LFC M;  4HLQ A;  2KA6 B;  2DWN A;  1IFY A;  3PVS A;  4DV6 M;  1IY1 A;  1NY5 A;  2CEA A;  3GLH E;  1EFU B;  2CWB A;  2VF8 A;  2VQE M;  2J7O A;  4DR3 M;  3J7B A;  3H4M A;  4WUR A;  3FYC A;  1SG9 A;  3WHK A;  4BBA A;  1XC8 A;  3SMS A;  4DV5 M;  3KFU G;  4FCT A;  3AJI B;  1WJ7 A;  1HJP A;  1OFI A;  3K9P A;  4PT5 A;  5FTJ A;  3U6Q A;  3T1H M;  1N34 M;  1I94 M;  1UM8 A;  2F5P A;  3WHL A;  3SFZ A;  5FTK A;  1TTE A;  2QZ4 A;  5JI3 E;  1XXH B;  5C18 A;  5JI2 E;  4LG2 A;  5IRE B;  1E9R A;  4B7G A;  2R65 A;  1DV0 A;  1ORY B;  3GPP A;  5KQD A;  3A45 A;  1IXZ A;  1SXJ C;  3GQ3 A;  2FFJ A;  2C9C A;  3DOA A;  3A46 A;  4IJF A;  1Q39 A;  2A5Y B;  3QAU A;  4K0K M;  4IBJ A;  3UZU A;  3R9X B;  3VK7 A;  1OIP A;  4W5W A;  3ZH9 B;  5EP1 A;  4DV4 M;  4GKJ M;  2H5X A;  4OVZ B;  2JY7 A;  4GRI A;  1NSF A;  4LZZ A;  4B3T M;  1DGH B;  2CV1 A;  1UFZ A;  1QZM A;  1N32 M;  2M60 A;  2Q2E B;  1R7R A;  1C1K A;  1X37 A;  2E5L M;  3GRU A;  3VDP A;  2C98 A;  2KZU A;  1GKI A;  3HKP A;  3UMM A;  2OQ4 A;  2LBC A;  3U6O A;  1HNX M;  3KS8 A;  4P16 A;  2XLJ A;  4MGY E;  3MK6 A;  3AFH A;  4M9X A;  2DZN B;  2VF7 A;  4HL4 A;  1NY6 A;  3SHF A;  1GJS A;  4NSR A;  4QNR A;  1XMQ M;  4M9Z A;  4JI7 M;  2R62 A;  1L2C A;  3KP0 E;  4XGI A;  5E6J A;  4DV3 M;  2L7H A;  2MRO B;  1L8Q A;  2VII A;  4LRT A;  2Y21 A;  4LRS A;  3LMM A;  2LVP C;  1QDR A;  1GVN A;  2L4E A;  1VQ1 A;  3MHV C;  2J5Y A;  3M7G A;  3I51 A;  3T6P A;  1G59 A;  3CF0 A;  2R4J A;  3IG8 A;  3CGW A;  2N35 A;  1NVM A;  4MGH A;  3W67 A;  3U6E A;  1J09 A;  4I5S A;  3Q8G A;  4MGZ E;  2L7I A;  4R71 A;  4FVM A;  3U6S A;  1SXJ B;  4FD2 A;  1IXR C;  1Y8G A;  2D7E A;  2UU9 M;  4GKK M;  1WHC A;  3BBZ A;  4FWG A;  1QAQ A;  3D8B A;  3HJS A;  4QOS A;  4TUW A;  1I4W A;  1LV7 A;  1IBM M;  1JQJ C;  1QAM A;  1OAO C;  2MGW A;  2R4E A;  2DAG A;  4DR5 M;  2UUA M;  2BJV A;  5FLX S;  3V76 A;  5C1B A;  3QYB A;  3KW6 A;  3M0E A;  1XB2 B;  3I01 M;  1ZV1 A;  4KHP M;  2JP7 A;  2Z4R A;  1WGL A;  2R0I A;  3GRV A;  4X66 M;  4ITQ A;  2W82 A;  3K8Z A;  3I04 M;  1IY0 A;  3T1Y M;  5GKN A;  2DZL A;  2EO2 A;  1IN6 A;  1D0L A;  4OVZ A;  5EQT A;  4OU7 A;  4AKI A;  2ERC A;  4IBI A;  4L6V 6;  3FKE A;  3TWL A;  2HWJ A;  3C9P A;  2XFT A;  3HZJ A;  3RGS A;  4L4U A;  4IBG A;  4WP2 A;  3THG A;  4X64 M;  3CTW B;  2CHQ A;  1MN3 A;  5EXS A;  2KDL A;  4AKG A;  5EXX A;  4XK8 F;  2KRU A;  1N36 M;  2OOB A;  4GHA A;  4AG6 A;  1QYR A;  3ILK A;  1PM5 A;  2G5G X;  1VDD A;  2J7N A;  3CF6 E;  2O5R A;  1KSF X;  3DZD A;  3ZCB B;  3L29 A;  1PRB A;  1W5T A;  1G8P A;  1R6B X;  2XEP A;  3FD9 A;  3L2A A;  2P5T A;  4CJ6 A;  2UXD M;  3GP1 A;  2LVA A;  2XZF A;  1QQW A;  2YQZ A;  4MH0 E;  2CE7 A;  4PDI A;  3B7Q A;  2HKJ A;  3PNV A;  4DUZ M;  4D80 A;  5EP4 A;  5ITX A;  4GIT A;  1G3I A;  4DR7 M;  2M5Z A;  2V6Z M;  1QUT A;  3H4J A;  4GIP A;  3HU1 A;  2K9D A;  2QCU A;  2F5S A;  2LWX A;  5H37 D;  2FOI C;  5KO3 A;  4LF9 M;  2D7G A;  3AKZ A;  1TGU A;  1GO5 A;  1PJQ A;  1NHG C;  2NQ8 C;  1KYI A;  1V34 A;  1V33 A;  4LY6 A;  4QOZ C;  1NHW C;  1DO0 A;  2APL A;  2I7P A;  2KNV A;  1L1Z A;  2F4V M;  2HCB A;  3LCU A;  4CIS A;  1QZE A;  4KO8 A;  3AOE A;  1IBK M;  2WSE F;  2DI0 A;  4LJ9 A;  4LZJ A;  5KPR A;  3GQ4 A;  2RGH A;  3SAU A;  4B3M M;  1HR0 M;  2ZTC A;  5IZ7 D;  4G4O A;  1OIZ A;  3SAW A;  1QUS A;  2CRU A;  1VEJ A;  2L6O A;  2K47 A;  3K9O A;  3GLH A;  2MH8 A;  1JB0 F;  2WZJ A;  4PCZ A;  1R2Z A;  3HJ8 A;  4R3D A;  3BOS A;  3VFD A;  2DHY A;  1G71 A;  2RKO A;  4NXN M;  4JI4 M;  1G41 A;  2R44 A;  1IY2 A;  3GLI A;  1HQC A;  3KOX E;  5KQ8 A;  4DUY M;  3K1J A;  1BVS A;  3M6A A;  3UJN A;  2KNA A;  4MB7 A;  4D82 A;  3L28 A;  1TH3 A;  2BJW A;  2L4F A;  3FUX A;  3OTO M;  3E4R A;  4PDG A;  1Z59 A;  2XSZ D;  2DAE A;  1PJJ A;  4LF5 M;  4X65 M;  4G4R A;  3FRH A;  2JWS A;  2HHH M;  2ZAN A;  1QVR A;  4IBD A;  2L2D A;  1GJT A;  1R4G A;  3GLG A;  5LMN M;  3SAS A;  3SAR A;  4LFA M;  4LJ7 A;  4G3O A;  1DGF A;  3HGI A;  2CV2 A;  3FRI A;  2UUB M;  1DGH A;  3HY5 A;  3KP1 E;  3U61 A;  4KLN A;  3ZC7 B;  2QBY A;  2QBY B;  2Y0Q A;  2YNM D;  4FWD A;  3U6C A;  3GRY A;  4DR4 M;  4M0W A;  1XMO M;  2EKK A;  4AKH A;  1F4I A;  4LJA A;  1MJG M;  3L27 A;  4GH9 A;  5A2Q S;  2Z4S A;  3EIE A;  3QYE A;  1PGY A;  1R5L A;  2K6B A;  4I8O A;  2DAI A;  5EP3 A;  4G4N A;  3FUT A;  4QNM A;  2Z3X A;  4ANR A;  2DZO B;  3K2L A;  4PD2 A;  4QHT A;  1D0K A;  2AHM A;  2G8L A;  2KZS A;  2XGN A;  2GQF A;  3DA1 A;  5EXT A;  4AZF A;  4EIW A;  1J7K A;  4JI1 M;  5BR8 M;  4B3R M;  5IT9 S;  1XXH E;  3LCV B;  2VDB B;  1A5T A;  2RRU A;  4JXJ A;  2F5N A;  3T15 A;  3UK6 A;  1TF0 B;  3J81 S;  3GLF E;  5LMU M;  3Q8X A;  4NSO B;  4LF4 M;  4L15 A;  2KHH A;  3U60 A;  2XFS A;  1Z5A A;  4A3V B;  1T6O A;  1K3W A;  1PJI A;  3U5Z B;  3L25 A;  3PFI A;  1OFH A;  1T3T A;  1WGN A;  4IBC A;  2KEB A;  2KXE A;  3B7Z A;  2OO9 A;  2EA0 A;  2JY6 B;  2XZU A;  3GLH B;  3W0F A;  1XNR M;  2JXN A;  1VEG A;  3HX3 A;  4IBE A;  1GLN A;  3VKH A; 
#chains in the Genus database with same CATH homology
 1WJ7 A;  1HJP A;  2EJS A;  3K9P A;  1HT1 E;  1IM2 A;  1TTE A;  2LVA A;  5JI2 E;  1DV0 A;  4Q7J A;  1G3I A;  3IHP A;  2BWE A;  3H4J A;  1JR3 E;  2K9D A;  1GO5 A;  2QNJ A;  1KYI A;  2H5X A;  2JY7 A;  3E46 A;  4HEO A;  1DO0 A;  2KNV A;  4UN2 B;  1UFZ A;  3LCU A;  2LVN C;  1QZE A;  2DI0 A;  1YLA A;  2ZTC A;  1IXS A;  1HT2 E;  1NV9 A;  2LBC A;  3B89 A;  2B3T A;  1VEJ A;  3F92 A;  3K9O A;  1AIP C;  2DKL A;  2WZJ A;  4F1I A;  1VG5 A;  2BWB A;  3FE3 A;  2JZ1 A;  1T43 A;  2DHY A;  1V92 A;  1G41 A;  1Q02 A;  2G3Q A;  2MRO B;  1BVS A;  1CUK A;  1P3Q Q;  2ZTD A;  2KNA A;  4DBG B;  2DAK A;  2L4F A;  2LVP C;  1C7Y A;  2CP8 A;  1DO2 A;  2L4E A;  1VQ1 A;  1G4A E;  1OQY A;  2DAE A;  3T6P A;  2JNH A;  1WR1 B;  1ZMW A;  3FRH A;  2QHO B;  2MJ5 B;  2K0B X;  2L2D A;  1R4G A;  3IEC A;  1OKS A;  4G3O A;  2KNZ A;  4R71 A;  3FRI A;  1Y8G A;  4GEW A;  1E94 E;  1WHC A;  2JY5 A;  3BBZ A;  2QSF X;  2JY8 A;  2EKK A;  1VDL A;  1WIV A;  2LTU A;  1F4I A;  1OTR A;  2LVO C;  2MGW A;  3GLG E;  1HQY E;  2DAG A;  1PGY A;  2DAI A;  1ZMV A;  3MMP A;  2DNA A;  2JUJ A;  1XB2 B;  1ZV1 A;  2JP7 A;  1WGL A;  2R0I A;  1ZMU A;  2DZL A;  1XXH E;  2EKF A;  3LCV B;  1A5T A;  1OAI A;  1TR8 A;  2RRU A;  3GLF E;  2DEN A;  2JZ0 A;  2OOA A;  2KHH A;  2HWJ A;  1T6O A;  2MR9 A;  2DAM A;  4WP2 A;  4F2L A;  1NV8 A;  2O25 A;  1MN3 A;  1IFY A;  1WGN A;  3E21 A;  2OO9 A;  1VEK A;  2JY6 B;  2OOB A;  3GLH E;  1EFU B;  2CWB A;  3GLI E;  2LVQ D;  1VEG A;  1SG9 A;  5DFL A;  2HAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...