1UFZA

Solution structure of hbs1-like domain in hypothetical protein bab28515
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
b'GSSGSSGEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein BAB28515
molecule tags Translation
source organism Mus musculus
publication title Solution structure of HBS1-like domain in hypothetical protein BAB28515
rcsb
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ufzA01
3GLIE 1GO5A 1OTRA 2KNVA 2JZ1A 3GLGE 1OAIA 1QZEA 3GLFE 3FE3A 1V92A 1ZV1A 5JI2E 2JY8A 2CP8A 2LBCA 1A5TA 1ZMUA 3F92A 1G4AE 1YLAA 2MJ5B 1SG9A 2LVAA 2EJSA 2ZTDA 2MR9A 1VEKA 1JR3E 4UN2B 1IFYA 2OOAA 1HT1E 3K9PA 2BWBA 1HT2E 2DAMA 2JY6B 4G3OA 1PGYA 1IM2A 1BVSA 4Q7JA 1WGLA 2MGWA 1ZMVA 2DENA 2LVPC 1T43A 2DZLA 4F2LA 2L4EA 2JZ0A 1OKSA 2G3QA 1VG5A 1VDLA 2MROB 1DO0A 3IECA 1VQ1A 2JY5A 3E21A 1E94E 3T6PA 1C7YA 1Y8GA 1EFUB 2L2DA 2K0BX 1XXHE 2WZJA 2B3TA 1KYIA 2DAEA 1F4IA 2EKFA 1TR8A 2KNAA 1DV0A 2DKLA 1WIVA 1DO2A 1WJ7A 2LVOC 2BWEA 3E46A 3H4JA 3FRIA 2JNHA 1UFZA 3BBZA 1NV8A 2DNAA 1AIPC 3LCVB 2EKKA 4HEOA 4WP2A 2LVQD 2L4FA 1G41A 3GLHE 2DAGA 1ZMWA 1Q02A 2HWJA 1CUKA 2DI0A 4GEWA 1HQYE 2JUJA 1HJPA 5DFLA 2ZTCA 1NV9A 3LCUA 1P3QQ 2QHOB 2LVNC 2H5XA 2JY7A 1XB2B 1TTEA 1T6OA 2DAIA 2R0IA 2HAKA 4F1IA 1VEJA 1WGNA 3FRHA 2CWBA 1MN3A 2JP7A 1R4GA 2OOBA 3IHPA 2LTUA 2KHHA 1G3IA 3MMPA 2K9DA 2QNJA 2QSFX 1IXSA 2DAKA 3K9OA 1WHCA 1OQYA 2OO9A 2KNZA 3B89A 2RRUA 2O25A 4DBGB 4R71A 2DHYA 1VEGA 1WR1B
chains in the Genus database with same CATH superfamily
1HNXM 3CF0A 3JAMS 3U61B 4JI1M 3RGSA 1JB0F 2HHHM 1NNJA 3KS4A 2KNVA 3WHLA 2G8LA 3GLGE 1C1KA 4M0WA 1QUTA 1W5SA 2L09A 3TPZA 3VDPA 4CIZA 4IIWA 2LH0A 3FTDA 3HU1A 4DV7M 1ZV1A 4G4OA 3CF6E 3I4VA 2J7OA 2FFJA 2Q2EB 1Z6TA 3KS8A 2UUCM 4LZJA 3VFDA 4MGIE 4IBCA 1X37A 3ZC7B 4LZZA 1IY2A 1AUAA 2QP9X 3NBXX 4P17A 4MB7A 4AG5A 3U61A 5L8RF 2EJSA 2KRUA 2ZTDA 3R8FA 1KSFX 4KODA 4DV4M 1SXJE 2DVWB 3J81S 4R7GA 7CATA 3MK6A 3FTCA 5EP3A 3K9PA 3DOAA 3UMMA 4RF1A 5FLXS 2KRKA 3DZDA 4G3OA 4RNAA 3U60A 5GKNA 5EJCA 3FD9A 1WGLA 1IXRC 1Q39A 1ZMVA 2EO2A 1MU5A 3U6DA 3SFZA 1T3TA 4RKUF 2R18A 4LF8M 4CISA 1R6BX 3J80S 1IXSB 2DZOB 3WHKA 2G3QA 3L26A 2MROB 3KSXA 3L2AA 3IECA 3VLFB 3KOWE 2R6FA 4XBOA 2QQ8A 3U6EA 2QBYA 2K0BX 1N36M 4IBFA 1D0KA 2EKFA 2YNMD 1QZMA 2KNAA 1DV0A 1FNNA 1WIVA 1DO2A 3BOSA 4EIWA 2OQ4A 4JV5M 1SXJD 2X49A 3E46A 4FWGA 5KPRA 4NXNM 2A5YB 4OVZA 5FTMA 5FTNA 1PJSA 1UFZA 2Z7JA 2CRUA 3LCVB 1L1TA 1NY6A 2Z4SA 2DXIA 2UXDM 1GLNA 4HEOA 2R44A 1YUBA 4QNMA 4FVMA 4L6V6 4DV2M 4M9SA 4II7A 3BXWA 4GMQA 1SXJB 2HWJA 3ZQJA 4PCZA 1CUKA 3FUTA 2WSEF 5H37D 4JI0M 5KO3A 3GLIB 1HQYE 4D80A 3J7BA 5EXSA 3TQSA 1QUSA 2CHQA 2LHCA 3GLGA 2CE7A 2R62A 3U6LA 1PJJA 2CV1A 1R7RA 3LVWA 2D7HA 3VKHA 1XB2B 2K47A 3KOZE 4D81A 4G4NA 3GQ4A 1VEJA 2CWBA 3IHPA 1R4GA 1ZAEA 2C9CA 3SBJA 1TF0B 3C58A 1G3IA 8CATA 2QNJA 3UGJA 3HHXA 3IG8A 3Q8XA 4LF6M 3CGWA 5BPVA 1DGBA 3K9OA 1WHCA 4D82A 1OQYA 2OO9A 3A45A 3CF2A 3T15A 4NSRA 1N75A 4X64M 1L2BA 4GHLA 4LFBM 2RRUA 1QYRA 2O25A 3K92A 2VDBB 4L78A 2F5PA 2ZANA 2DHYA 5LMNM 1WR1B 3K8ZA 3KOYE 4I5SA 3RFWA 4PDIA 3GLIE 2F5SA 3GPYA 1LV7A 1ORYB 3SARA 1JQJC 1OTRA 2JWSA 2KZUA 3EIHA 1GVNA 3AV0A 1J5EM 2JZ1A 4MGZE 3AKZA 3IG5A 3EIEA 4NL4H 2KA6B 2J7NA 3GLFE 1K82A 4IBGA 1QAOA 2R46A 3FE3A 1HQCA 3KSJA 4FD2A 3SYLA 4G6ZA 5JI2E 2F5NA 4KHPM 3GPXA 2O01F 3T1HM 3OTOM 3C3EA 2BNKA 1IN5A 2DWZB 3DFZA 3SYKA 2G5GX 3JR4A 1J7KA 1G4AE 4XK8F 1ZQ9A 4FWHA 1N78A 4BLCA 1YLAA 4GHAA 1SG9A 2FS1A 1DGHA 1IQPA 4LY6A 2MH8A 4KO8A 3AL0C 4UN2B 3U6QA 1IFYA 3W67A 2OOAA 1KFVA 1TGUA 4Z6YA 1K3XA 4DUZM 1XMOM 5EXPA 2DAMA 3FTEA 3L25A 2DWLA 4JI7M 3KDSE 1HR0M 1NJGA 5IWAM 4REZA 1BVSA 2YFQA 1MJGM 2R65A 2CFOA 2WSCF 4CGYB 3K1JA 3GO8A 1TDZA 2BJVA 2HL7A 4QHTA 2R4JA 4LJ6A 4LGMA 3GRUA 1VDLA 2X8AA 1VQ1A 3LQQA 2UU9M 1QQWA 3GLFA 4B08A 4DV3M 3T6PA 1C7YA 1NSFA 2KDLA 1TH4A 4LCBA 1G59A 1S3SA 1XXHE 3A42A 3HU2A 3M6AA 2DWNA 2B3TA 2DAEA 4IJFA 4JI4M 1NHWC 1Z59A 1IBLM 4JI8M 3B7QA 4IBBA 2F5OA 3HJSA 1WXQA 4LJ4A 3D8BA 4WW0A 4AQYM 1IN6A 3H4JA 2VQFM 2QBYB 4LRSA 2JNHA 1J09A 3I51A 3RE8A 3U6CA 4LF4M 4DR6M 3BBZA 1NV8A 5DNYA 2CV2A 2Z8YM 3J2PB 4HLQA 2FE8A 4JI2M 3SAVA 1IN7A 2LVQD 3GLHE 2KW0A 4PT5A 3SMSA 4G4RA 2DAGA 4JI6M 2M60A 3AFHA 1PJTA 4ZPXA 3SHFA 1IN8A 5EP4A 2DI0A 3SATA 4GEWA 1NJFA 3TL4X 4LJ5A 3K2LA 4L15A 5DFLA 4FW9A 1G71A 3R9XB 4OX9M 3U60B 3MHVC 4LJ8A 3LCUA 1P3QQ 2QENA 2QCUA 3CTWB 3NWLA 4QHSA 3JR5A 3GRYA 2JY7A 2Y21A 2V6ZM 4TUWA 1E32A 2EUCA 3B9PA 2R0IA 2E5LM 2CUZA 3FRHA 3PVSA 3FUXA 3AJIB 5JI3E 1OJLA 2JA2A 2XFTA 2LTUA 3FUVA 2KHHA 2UXCM 3W0LB 5LMUM 1NY5A 3M7GA 4JI3M 3LQRA 1N32M 4G4QA 1IN4A 2VF7A 4LF9M 2YQZA 1I4WA 4AKGA 4DV5M 1XC8A 1EE8A 4AW4A 1QVRA 4IBJA 4IJEA 5BR8M 2VIIA 4NRVA 2APLA 4DV6M 4CJ6A 2C96A 1GO5A 2CV0A 4JYAM 1L8QA 1UM8A 2RKOA 3SAUA 2Z4RA 1L2DA 3C9PA 3V76A 2XFSA 3GLHA 2L7HA 2UUAM 3L27A 2ERCA 3TE6A 2XGNA 4B3RM 1E9RA 4DUYM 3PXGA 4A3VB 1GL6A 2L7IA 2VF8A 3Q8GA 4ANRA 2UXBM 4LJ7A 2CP8A 1IBKM 3A46A 1Z5AA 1A5TA 4MGKE 4IBEA 1N33M 1ZMUA 2MJ5B 1XXHA 4MGYE 2JXNA 2LVAA 2ZBKB 2CEAA 1XNQM 4LFAM 2Y0TA 1VEKA 1JR3E 2GNOA 3A98B 4DR5M 2WSFF 5EQTA 3UJNA 3U5ZB 1QDTA 3LW5F 4AZFA 4DV1M 1HT1E 2FH0A 2BWBA 1HT2E 1OIZA 2JY6B 1GJTA 3M0EA 2YR0A 4B7GA 4DR4M 5EP1A 3VK7A 4FCVA 2C5RA 4NOOB 3HJ8A 1IM2A 2H1RA 4GITA 4I8OA 4Q7JA 4W5WA 2MGWA 4FCWA 1NVMA 2DENA 3E4RA 5KQ8A 2GQFA 4F2LA 3SAWA 2Y20A 2HCBA 1OIPA 1K3WA 1XWIA 4GH9A 1YSYA 4IBKA 1VG5A 4HL4A 2JY5A 3E21A 3QYEA 1E94E 5DYGA 1Y8GA 3KW6A 3KOXE 2LHGA 4L4UA 5ITXA 4GKKM 3GLHB 2L6OA 4L16A 3HJQA 4IBDA 1KYIA 3HU3A 1EIJA 3GQ5A 3FYDA 3HZJA 1TR8A 2LNHC 3PNYA 2DKLA 2XZUA 2UUBM 5E26A 2LVOC 1WJ7A 4DR2M 1GL7A 2BWEA 2QPAA 1HNZM 5E6JA 4B3SM 4BB9A 4KT0F 4LF7M 4MM3B 3FRIA 5FTJA 4PD2A 4QOSA 3U6SA 4NRWA 3GQ3A 1SXJA 5EXTA 3T38A 3AOGA 2EKKA 4X65M 2CHGA 2W82A 2O5RA 4GIPA 1NHGC 1ZMWA 2I7PA 3GPPA 4DR7M 2F4VM 3FUWA 3I04M 1GJSA 1DGHB 2N35A 1OAOC 4OVZB 4P16A 1HJPA 2BJWA 2P5TA 3THGA 2QHOB 2NQ8C 2LVNC 5C1BA 2H5XA 4X66M 3D8LA 5ITTA 3GP1A 3T1YM 4F1IA 5KPZA 4WURA 3ZCBB 3QWLA 2VQEM 1IY1A 1MN3A 2XEPA 2CHVA 2OOBA 3KFUG 3KP0E 1R2YA 3PFIA 1GKIA 1R5LA 2K9DA 1H6UA 1Q3CA 3GRRA 3HWSA 3LVVA 3MMPA 3FYCA 3B7NA 3KXEC 1OFHA 4LJAA 2V1CA 2OPFA 3UK6A 1IXSA 2F5QA 4I81A 5IZ7D 3KP1E 4OU7A 3HKPA 5KPTA 3RGPA 2I7NA 3HHZA 1XXHB 1TDHA 3HHWA 3FTFA 4QNRA 4DBGB 4R71A 3J27B 2ZAMA 1L2CA 1G8PA 3KVWA 4M9ZA 1VEGA 4LRTA 4DV0M 4B7FA 2RGHA 3GRVA 2QZ4A 1TH3A 2C99A 1D2NA 3AOEA 5EXXA 1VDDA 3VDUA 1OAIA 1QZEA 3W0FA 4LF5M 3GLFB 3ZH9B 1W5TA 2HKJA 4L8RC 5ITUA 1QAQA 1V92A 1SXJC 2AHMA 2JY8A 4K0KM 3B7ZA 4M9XA 2LBCA 3VK8A 1GABA 3NBIA 5FTKA 3MJ5A 4MGHA 5EP2A 2XSZA 2DWMA 4MH0E 4NC6A 2J5YA 2ZM6M 3F92A 3GPUA 1V34A 4JXJA 4ITQA 2C9OA 3SASA 5ITXE 4LGYA 2RGOA 4CHTB 4X62M 2V1UA 3GLIA 1IXZA 4GC9A 1QDRA 2MR9A 4OW0A 1XMQM 1TH2A 4B3TM 3U6MA 2EA0A 3I4YA 4JN6A 4PDGA 2X4AA 1E9SA 4NSOB 3E9SA 4GRIA 1R2ZA 4QOZC 2XZFA 5ITYA 1PGYA 1D0MA 1XNRM 2KZSA 2K6BA 2FOIC 3I01M 1XHBA 2LVPC 1T43A 1QAMA 3PNVA 3TWLA 1IBMM 1YE9A 2DZLA 2XLJA 3U6PA 4LG2A 2L4EA 2JZ0A 3VKGA 1JR3D 1OKSA 4KLNA 4AKIA 3SMPA 4R3DA 1HNWM 3FKEA 4Z8XA 1DO0A 2DHRA 3QYBA 5KQDA 5ITRA 2D7GA 5DYIA 4NXMM 4XGIA 4YY3M 2M5ZA 1Z5BA 4DR3M 4AKHA 1EFUB 2L2DA 5FTLA 1L1ZA 2Z3XA 2WZJA 1NNUC 3SHGB 1FJGM 1F4IA 2XH9A 1JR3A 5FSWA 1Q3BA 3ILKA 1RU3A 4IBIA 4DR1M 1I94M 1N34M 2LXEA 2DNAA 1AIPC 4JI5M 4LFCM 2FNAA 4WP2A 4B7HA 4GC5A 2L4FA 1G41A 2XSZD 2LWXA 1DGGA 1QANA 5C18A 1MX0A 1Q02A 4Y28F 3AOEC 3L29A 3TWKA 2XF3A 4RF0A 3UZUA 1PM5A 2C98A 3FUUA 3B74A 5A2QS 4BBAA 1PRBA 2JUJA 1V33A 2ZTCA 3QAUA 3W68A 1NV9A 1PJQA 4I4LA 3SC3A 4B3MM 3C3DA 4LJ9A 2Y0QA 3GLGB 2ZAOA 2D7EA 2DZNB 5IREB 1TTEA 1T6OA 2DAIA 1IY0A 3U5ZA 2HAKA 1WGNA 3J7AS 3H4MA 1N77A 2JP7A 4FWDA 5ITQA 1DGFA 1Z5CA 2KXEA 3L28A 1NO1A 2QSFX 4GKJM 1OFIA 2DAKA 3U6OA 1LTMA 3LMMA 3HHYA 3HX3A 3TWMA 4AG6A 1PJIA 2KNZA 3B89A 3HGIA 4AI6A 1D0LA 5F3WA 2R45A 3DA1A 3HY5A 2KEBA 4S12A 4YHHM 4M0DA 5IT9S 2R4EA 4FCTA
chains in the Genus database with same CATH topology
3GLIE 1GO5A 1OTRA 2KNVA 2JZ1A 3GLGE 1OAIA 1QZEA 3GLFE 3FE3A 1V92A 1ZV1A 5JI2E 2JY8A 2CP8A 2LBCA 1A5TA 1ZMUA 3F92A 1G4AE 1YLAA 2MJ5B 1SG9A 2LVAA 2EJSA 2ZTDA 2MR9A 1VEKA 1JR3E 4UN2B 1IFYA 2OOAA 1HT1E 3K9PA 2BWBA 1HT2E 2DAMA 2JY6B 4G3OA 1PGYA 1IM2A 1BVSA 4Q7JA 1WGLA 2MGWA 1ZMVA 2DENA 2LVPC 1T43A 2DZLA 4F2LA 2L4EA 2JZ0A 1OKSA 2G3QA 1VG5A 1VDLA 2MROB 1DO0A 3IECA 1VQ1A 2JY5A 3E21A 1E94E 3T6PA 1C7YA 1Y8GA 1EFUB 2L2DA 2K0BX 1XXHE 2WZJA 2B3TA 1KYIA 2DAEA 1F4IA 2EKFA 1TR8A 2KNAA 1DV0A 2DKLA 1WIVA 1DO2A 1WJ7A 2LVOC 2BWEA 3E46A 3H4JA 3FRIA 2JNHA 1UFZA 3BBZA 1NV8A 2DNAA 1AIPC 3LCVB 2EKKA 4HEOA 4WP2A 2LVQD 2L4FA 1G41A 3GLHE 2DAGA 1ZMWA 1Q02A 2HWJA 1CUKA 2DI0A 4GEWA 1HQYE 2JUJA 1HJPA 5DFLA 2ZTCA 1NV9A 3LCUA 1P3QQ 2QHOB 2LVNC 2H5XA 2JY7A 1XB2B 1TTEA 1T6OA 2DAIA 2R0IA 2HAKA 4F1IA 1VEJA 1WGNA 3FRHA 2CWBA 1MN3A 2JP7A 1R4GA 2OOBA 3IHPA 2LTUA 2KHHA 1G3IA 3MMPA 2K9DA 2QNJA 2QSFX 1IXSA 2DAKA 3K9OA 1WHCA 1OQYA 2OO9A 2KNZA 3B89A 2RRUA 2O25A 4DBGB 4R71A 2DHYA 1VEGA 1WR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLI E;  1GO5 A;  1OTR A;  2KNV A;  2JZ1 A;  3GLG E;  1OAI A;  1QZE A;  3GLF E;  3FE3 A;  1V92 A;  1ZV1 A;  5JI2 E;  2JY8 A;  2CP8 A;  2LBC A;  1A5T A;  1ZMU A;  3F92 A;  1G4A E;  1YLA A;  2MJ5 B;  1SG9 A;  2LVA A;  2EJS A;  2ZTD A;  2MR9 A;  1VEK A;  1JR3 E;  4UN2 B;  1IFY A;  2OOA A;  1HT1 E;  3K9P A;  2BWB A;  1HT2 E;  2DAM A;  2JY6 B;  4G3O A;  1PGY A;  1IM2 A;  1BVS A;  4Q7J A;  1WGL A;  2MGW A;  1ZMV A;  2DEN A;  2LVP C;  1T43 A;  2DZL A;  4F2L A;  2L4E A;  2JZ0 A;  1OKS A;  2G3Q A;  1VG5 A;  1VDL A;  2MRO B;  1DO0 A;  3IEC A;  1VQ1 A;  2JY5 A;  3E21 A;  1E94 E;  3T6P A;  1C7Y A;  1Y8G A;  1EFU B;  2L2D A;  2K0B X;  1XXH E;  2WZJ A;  2B3T A;  1KYI A;  2DAE A;  1F4I A;  2EKF A;  1TR8 A;  2KNA A;  1DV0 A;  2DKL A;  1WIV A;  1DO2 A;  1WJ7 A;  2LVO C;  2BWE A;  3E46 A;  3H4J A;  3FRI A;  2JNH A;  1UFZ A;  3BBZ A;  1NV8 A;  2DNA A;  1AIP C;  3LCV B;  2EKK A;  4HEO A;  4WP2 A;  2LVQ D;  2L4F A;  1G41 A;  3GLH E;  2DAG A;  1ZMW A;  1Q02 A;  2HWJ A;  1CUK A;  2DI0 A;  4GEW A;  1HQY E;  2JUJ A;  1HJP A;  5DFL A;  2ZTC A;  1NV9 A;  3LCU A;  1P3Q Q;  2QHO B;  2LVN C;  2H5X A;  2JY7 A;  1XB2 B;  1TTE A;  1T6O A;  2DAI A;  2R0I A;  2HAK A;  4F1I A;  1VEJ A;  1WGN A;  3FRH A;  2CWB A;  1MN3 A;  2JP7 A;  1R4G A;  2OOB A;  3IHP A;  2LTU A;  2KHH A;  1G3I A;  3MMP A;  2K9D A;  2QNJ A;  2QSF X;  1IXS A;  2DAK A;  3K9O A;  1WHC A;  1OQY A;  2OO9 A;  2KNZ A;  3B89 A;  2RRU A;  2O25 A;  4DBG B;  4R71 A;  2DHY A;  1VEG A;  1WR1 B; 
#chains in the Genus database with same CATH topology
 1HNX M;  3CF0 A;  3JAM S;  3U61 B;  4JI1 M;  3RGS A;  1JB0 F;  2HHH M;  1NNJ A;  3KS4 A;  2KNV A;  3WHL A;  2G8L A;  3GLG E;  1C1K A;  4M0W A;  1QUT A;  1W5S A;  2L09 A;  3TPZ A;  3VDP A;  4CIZ A;  4IIW A;  2LH0 A;  3FTD A;  3HU1 A;  4DV7 M;  1ZV1 A;  4G4O A;  3CF6 E;  3I4V A;  2J7O A;  2FFJ A;  2Q2E B;  1Z6T A;  3KS8 A;  2UUC M;  4LZJ A;  3VFD A;  4MGI E;  4IBC A;  1X37 A;  3ZC7 B;  4LZZ A;  1IY2 A;  1AUA A;  2QP9 X;  3NBX X;  4P17 A;  4MB7 A;  4AG5 A;  3U61 A;  5L8R F;  2EJS A;  2KRU A;  2ZTD A;  3R8F A;  1KSF X;  4KOD A;  4DV4 M;  1SXJ E;  2DVW B;  3J81 S;  4R7G A;  7CAT A;  3MK6 A;  3FTC A;  5EP3 A;  3K9P A;  3DOA A;  3UMM A;  4RF1 A;  5FLX S;  2KRK A;  3DZD A;  4G3O A;  4RNA A;  3U60 A;  5GKN A;  5EJC A;  3FD9 A;  1WGL A;  1IXR C;  1Q39 A;  1ZMV A;  2EO2 A;  1MU5 A;  3U6D A;  3SFZ A;  1T3T A;  4RKU F;  2R18 A;  4LF8 M;  4CIS A;  1R6B X;  3J80 S;  1IXS B;  2DZO B;  3WHK A;  2G3Q A;  3L26 A;  2MRO B;  3KSX A;  3L2A A;  3IEC A;  3VLF B;  3KOW E;  2R6F A;  4XBO A;  2QQ8 A;  3U6E A;  2QBY A;  2K0B X;  1N36 M;  4IBF A;  1D0K A;  2EKF A;  2YNM D;  1QZM A;  2KNA A;  1DV0 A;  1FNN A;  1WIV A;  1DO2 A;  3BOS A;  4EIW A;  2OQ4 A;  4JV5 M;  1SXJ D;  2X49 A;  3E46 A;  4FWG A;  5KPR A;  4NXN M;  2A5Y B;  4OVZ A;  5FTM A;  5FTN A;  1PJS A;  1UFZ A;  2Z7J A;  2CRU A;  3LCV B;  1L1T A;  1NY6 A;  2Z4S A;  2DXI A;  2UXD M;  1GLN A;  4HEO A;  2R44 A;  1YUB A;  4QNM A;  4FVM A;  4L6V 6;  4DV2 M;  4M9S A;  4II7 A;  3BXW A;  4GMQ A;  1SXJ B;  2HWJ A;  3ZQJ A;  4PCZ A;  1CUK A;  3FUT A;  2WSE F;  5H37 D;  4JI0 M;  5KO3 A;  3GLI B;  1HQY E;  4D80 A;  3J7B A;  5EXS A;  3TQS A;  1QUS A;  2CHQ A;  2LHC A;  3GLG A;  2CE7 A;  2R62 A;  3U6L A;  1PJJ A;  2CV1 A;  1R7R A;  3LVW A;  2D7H A;  3VKH A;  1XB2 B;  2K47 A;  3KOZ E;  4D81 A;  4G4N A;  3GQ4 A;  1VEJ A;  2CWB A;  3IHP A;  1R4G A;  1ZAE A;  2C9C A;  3SBJ A;  1TF0 B;  3C58 A;  1G3I A;  8CAT A;  2QNJ A;  3UGJ A;  3HHX A;  3IG8 A;  3Q8X A;  4LF6 M;  3CGW A;  5BPV A;  1DGB A;  3K9O A;  1WHC A;  4D82 A;  1OQY A;  2OO9 A;  3A45 A;  3CF2 A;  3T15 A;  4NSR A;  1N75 A;  4X64 M;  1L2B A;  4GHL A;  4LFB M;  2RRU A;  1QYR A;  2O25 A;  3K92 A;  2VDB B;  4L78 A;  2F5P A;  2ZAN A;  2DHY A;  5LMN M;  1WR1 B;  3K8Z A;  3KOY E;  4I5S A;  3RFW A;  4PDI A;  3GLI E;  2F5S A;  3GPY A;  1LV7 A;  1ORY B;  3SAR A;  1JQJ C;  1OTR A;  2JWS A;  2KZU A;  3EIH A;  1GVN A;  3AV0 A;  1J5E M;  2JZ1 A;  4MGZ E;  3AKZ A;  3IG5 A;  3EIE A;  4NL4 H;  2KA6 B;  2J7N A;  3GLF E;  1K82 A;  4IBG A;  1QAO A;  2R46 A;  3FE3 A;  1HQC A;  3KSJ A;  4FD2 A;  3SYL A;  4G6Z A;  5JI2 E;  2F5N A;  4KHP M;  3GPX A;  2O01 F;  3T1H M;  3OTO M;  3C3E A;  2BNK A;  1IN5 A;  2DWZ B;  3DFZ A;  3SYK A;  2G5G X;  3JR4 A;  1J7K A;  1G4A E;  4XK8 F;  1ZQ9 A;  4FWH A;  1N78 A;  4BLC A;  1YLA A;  4GHA A;  1SG9 A;  2FS1 A;  1DGH A;  1IQP A;  4LY6 A;  2MH8 A;  4KO8 A;  3AL0 C;  4UN2 B;  3U6Q A;  1IFY A;  3W67 A;  2OOA A;  1KFV A;  1TGU A;  4Z6Y A;  1K3X A;  4DUZ M;  1XMO M;  5EXP A;  2DAM A;  3FTE A;  3L25 A;  2DWL A;  4JI7 M;  3KDS E;  1HR0 M;  1NJG A;  5IWA M;  4REZ A;  1BVS A;  2YFQ A;  1MJG M;  2R65 A;  2CFO A;  2WSC F;  4CGY B;  3K1J A;  3GO8 A;  1TDZ A;  2BJV A;  2HL7 A;  4QHT A;  2R4J A;  4LJ6 A;  4LGM A;  3GRU A;  1VDL A;  2X8A A;  1VQ1 A;  3LQQ A;  2UU9 M;  1QQW A;  3GLF A;  4B08 A;  4DV3 M;  3T6P A;  1C7Y A;  1NSF A;  2KDL A;  1TH4 A;  4LCB A;  1G59 A;  1S3S A;  1XXH E;  3A42 A;  3HU2 A;  3M6A A;  2DWN A;  2B3T A;  2DAE A;  4IJF A;  4JI4 M;  1NHW C;  1Z59 A;  1IBL M;  4JI8 M;  3B7Q A;  4IBB A;  2F5O A;  3HJS A;  1WXQ A;  4LJ4 A;  3D8B A;  4WW0 A;  4AQY M;  1IN6 A;  3H4J A;  2VQF M;  2QBY B;  4LRS A;  2JNH A;  1J09 A;  3I51 A;  3RE8 A;  3U6C A;  4LF4 M;  4DR6 M;  3BBZ A;  1NV8 A;  5DNY A;  2CV2 A;  2Z8Y M;  3J2P B;  4HLQ A;  2FE8 A;  4JI2 M;  3SAV A;  1IN7 A;  2LVQ D;  3GLH E;  2KW0 A;  4PT5 A;  3SMS A;  4G4R A;  2DAG A;  4JI6 M;  2M60 A;  3AFH A;  1PJT A;  4ZPX A;  3SHF A;  1IN8 A;  5EP4 A;  2DI0 A;  3SAT A;  4GEW A;  1NJF A;  3TL4 X;  4LJ5 A;  3K2L A;  4L15 A;  5DFL A;  4FW9 A;  1G71 A;  3R9X B;  4OX9 M;  3U60 B;  3MHV C;  4LJ8 A;  3LCU A;  1P3Q Q;  2QEN A;  2QCU A;  3CTW B;  3NWL A;  4QHS A;  3JR5 A;  3GRY A;  2JY7 A;  2Y21 A;  2V6Z M;  4TUW A;  1E32 A;  2EUC A;  3B9P A;  2R0I A;  2E5L M;  2CUZ A;  3FRH A;  3PVS A;  3FUX A;  3AJI B;  5JI3 E;  1OJL A;  2JA2 A;  2XFT A;  2LTU A;  3FUV A;  2KHH A;  2UXC M;  3W0L B;  5LMU M;  1NY5 A;  3M7G A;  4JI3 M;  3LQR A;  1N32 M;  4G4Q A;  1IN4 A;  2VF7 A;  4LF9 M;  2YQZ A;  1I4W A;  4AKG A;  4DV5 M;  1XC8 A;  1EE8 A;  4AW4 A;  1QVR A;  4IBJ A;  4IJE A;  5BR8 M;  2VII A;  4NRV A;  2APL A;  4DV6 M;  4CJ6 A;  2C96 A;  1GO5 A;  2CV0 A;  4JYA M;  1L8Q A;  1UM8 A;  2RKO A;  3SAU A;  2Z4R A;  1L2D A;  3C9P A;  3V76 A;  2XFS A;  3GLH A;  2L7H A;  2UUA M;  3L27 A;  2ERC A;  3TE6 A;  2XGN A;  4B3R M;  1E9R A;  4DUY M;  3PXG A;  4A3V B;  1GL6 A;  2L7I A;  2VF8 A;  3Q8G A;  4ANR A;  2UXB M;  4LJ7 A;  2CP8 A;  1IBK M;  3A46 A;  1Z5A A;  1A5T A;  4MGK E;  4IBE A;  1N33 M;  1ZMU A;  2MJ5 B;  1XXH A;  4MGY E;  2JXN A;  2LVA A;  2ZBK B;  2CEA A;  1XNQ M;  4LFA M;  2Y0T A;  1VEK A;  1JR3 E;  2GNO A;  3A98 B;  4DR5 M;  2WSF F;  5EQT A;  3UJN A;  3U5Z B;  1QDT A;  3LW5 F;  4AZF A;  4DV1 M;  1HT1 E;  2FH0 A;  2BWB A;  1HT2 E;  1OIZ A;  2JY6 B;  1GJT A;  3M0E A;  2YR0 A;  4B7G A;  4DR4 M;  5EP1 A;  3VK7 A;  4FCV A;  2C5R A;  4NOO B;  3HJ8 A;  1IM2 A;  2H1R A;  4GIT A;  4I8O A;  4Q7J A;  4W5W A;  2MGW A;  4FCW A;  1NVM A;  2DEN A;  3E4R A;  5KQ8 A;  2GQF A;  4F2L A;  3SAW A;  2Y20 A;  2HCB A;  1OIP A;  1K3W A;  1XWI A;  4GH9 A;  1YSY A;  4IBK A;  1VG5 A;  4HL4 A;  2JY5 A;  3E21 A;  3QYE A;  1E94 E;  5DYG A;  1Y8G A;  3KW6 A;  3KOX E;  2LHG A;  4L4U A;  5ITX A;  4GKK M;  3GLH B;  2L6O A;  4L16 A;  3HJQ A;  4IBD A;  1KYI A;  3HU3 A;  1EIJ A;  3GQ5 A;  3FYD A;  3HZJ A;  1TR8 A;  2LNH C;  3PNY A;  2DKL A;  2XZU A;  2UUB M;  5E26 A;  2LVO C;  1WJ7 A;  4DR2 M;  1GL7 A;  2BWE A;  2QPA A;  1HNZ M;  5E6J A;  4B3S M;  4BB9 A;  4KT0 F;  4LF7 M;  4MM3 B;  3FRI A;  5FTJ A;  4PD2 A;  4QOS A;  3U6S A;  4NRW A;  3GQ3 A;  1SXJ A;  5EXT A;  3T38 A;  3AOG A;  2EKK A;  4X65 M;  2CHG A;  2W82 A;  2O5R A;  4GIP A;  1NHG C;  1ZMW A;  2I7P A;  3GPP A;  4DR7 M;  2F4V M;  3FUW A;  3I04 M;  1GJS A;  1DGH B;  2N35 A;  1OAO C;  4OVZ B;  4P16 A;  1HJP A;  2BJW A;  2P5T A;  3THG A;  2QHO B;  2NQ8 C;  2LVN C;  5C1B A;  2H5X A;  4X66 M;  3D8L A;  5ITT A;  3GP1 A;  3T1Y M;  4F1I A;  5KPZ A;  4WUR A;  3ZCB B;  3QWL A;  2VQE M;  1IY1 A;  1MN3 A;  2XEP A;  2CHV A;  2OOB A;  3KFU G;  3KP0 E;  1R2Y A;  3PFI A;  1GKI A;  1R5L A;  2K9D A;  1H6U A;  1Q3C A;  3GRR A;  3HWS A;  3LVV A;  3MMP A;  3FYC A;  3B7N A;  3KXE C;  1OFH A;  4LJA A;  2V1C A;  2OPF A;  3UK6 A;  1IXS A;  2F5Q A;  4I81 A;  5IZ7 D;  3KP1 E;  4OU7 A;  3HKP A;  5KPT A;  3RGP A;  2I7N A;  3HHZ A;  1XXH B;  1TDH A;  3HHW A;  3FTF A;  4QNR A;  4DBG B;  4R71 A;  3J27 B;  2ZAM A;  1L2C A;  1G8P A;  3KVW A;  4M9Z A;  1VEG A;  4LRT A;  4DV0 M;  4B7F A;  2RGH A;  3GRV A;  2QZ4 A;  1TH3 A;  2C99 A;  1D2N A;  3AOE A;  5EXX A;  1VDD A;  3VDU A;  1OAI A;  1QZE A;  3W0F A;  4LF5 M;  3GLF B;  3ZH9 B;  1W5T A;  2HKJ A;  4L8R C;  5ITU A;  1QAQ A;  1V92 A;  1SXJ C;  2AHM A;  2JY8 A;  4K0K M;  3B7Z A;  4M9X A;  2LBC A;  3VK8 A;  1GAB A;  3NBI A;  5FTK A;  3MJ5 A;  4MGH A;  5EP2 A;  2XSZ A;  2DWM A;  4MH0 E;  4NC6 A;  2J5Y A;  2ZM6 M;  3F92 A;  3GPU A;  1V34 A;  4JXJ A;  4ITQ A;  2C9O A;  3SAS A;  5ITX E;  4LGY A;  2RGO A;  4CHT B;  4X62 M;  2V1U A;  3GLI A;  1IXZ A;  4GC9 A;  1QDR A;  2MR9 A;  4OW0 A;  1XMQ M;  1TH2 A;  4B3T M;  3U6M A;  2EA0 A;  3I4Y A;  4JN6 A;  4PDG A;  2X4A A;  1E9S A;  4NSO B;  3E9S A;  4GRI A;  1R2Z A;  4QOZ C;  2XZF A;  5ITY A;  1PGY A;  1D0M A;  1XNR M;  2KZS A;  2K6B A;  2FOI C;  3I01 M;  1XHB A;  2LVP C;  1T43 A;  1QAM A;  3PNV A;  3TWL A;  1IBM M;  1YE9 A;  2DZL A;  2XLJ A;  3U6P A;  4LG2 A;  2L4E A;  2JZ0 A;  3VKG A;  1JR3 D;  1OKS A;  4KLN A;  4AKI A;  3SMP A;  4R3D A;  1HNW M;  3FKE A;  4Z8X A;  1DO0 A;  2DHR A;  3QYB A;  5KQD A;  5ITR A;  2D7G A;  5DYI A;  4NXM M;  4XGI A;  4YY3 M;  2M5Z A;  1Z5B A;  4DR3 M;  4AKH A;  1EFU B;  2L2D A;  5FTL A;  1L1Z A;  2Z3X A;  2WZJ A;  1NNU C;  3SHG B;  1FJG M;  1F4I A;  2XH9 A;  1JR3 A;  5FSW A;  1Q3B A;  3ILK A;  1RU3 A;  4IBI A;  4DR1 M;  1I94 M;  1N34 M;  2LXE A;  2DNA A;  1AIP C;  4JI5 M;  4LFC M;  2FNA A;  4WP2 A;  4B7H A;  4GC5 A;  2L4F A;  1G41 A;  2XSZ D;  2LWX A;  1DGG A;  1QAN A;  5C18 A;  1MX0 A;  1Q02 A;  4Y28 F;  3AOE C;  3L29 A;  3TWK A;  2XF3 A;  4RF0 A;  3UZU A;  1PM5 A;  2C98 A;  3FUU A;  3B74 A;  5A2Q S;  4BBA A;  1PRB A;  2JUJ A;  1V33 A;  2ZTC A;  3QAU A;  3W68 A;  1NV9 A;  1PJQ A;  4I4L A;  3SC3 A;  4B3M M;  3C3D A;  4LJ9 A;  2Y0Q A;  3GLG B;  2ZAO A;  2D7E A;  2DZN B;  5IRE B;  1TTE A;  1T6O A;  2DAI A;  1IY0 A;  3U5Z A;  2HAK A;  1WGN A;  3J7A S;  3H4M A;  1N77 A;  2JP7 A;  4FWD A;  5ITQ A;  1DGF A;  1Z5C A;  2KXE A;  3L28 A;  1NO1 A;  2QSF X;  4GKJ M;  1OFI A;  2DAK A;  3U6O A;  1LTM A;  3LMM A;  3HHY A;  3HX3 A;  3TWM A;  4AG6 A;  1PJI A;  2KNZ A;  3B89 A;  3HGI A;  4AI6 A;  1D0L A;  5F3W A;  2R45 A;  3DA1 A;  3HY5 A;  2KEB A;  4S12 A;  4YHH M;  4M0D A;  5IT9 S;  2R4E A;  4FCT A; 
#chains in the Genus database with same CATH homology
 3GLI E;  1GO5 A;  1OTR A;  2KNV A;  2JZ1 A;  3GLG E;  1OAI A;  1QZE A;  3GLF E;  3FE3 A;  1V92 A;  1ZV1 A;  5JI2 E;  2JY8 A;  2CP8 A;  2LBC A;  1A5T A;  1ZMU A;  3F92 A;  1G4A E;  1YLA A;  2MJ5 B;  1SG9 A;  2LVA A;  2EJS A;  2ZTD A;  2MR9 A;  1VEK A;  1JR3 E;  4UN2 B;  1IFY A;  2OOA A;  1HT1 E;  3K9P A;  2BWB A;  1HT2 E;  2DAM A;  2JY6 B;  4G3O A;  1PGY A;  1IM2 A;  1BVS A;  4Q7J A;  1WGL A;  2MGW A;  1ZMV A;  2DEN A;  2LVP C;  1T43 A;  2DZL A;  4F2L A;  2L4E A;  2JZ0 A;  1OKS A;  2G3Q A;  1VG5 A;  1VDL A;  2MRO B;  1DO0 A;  3IEC A;  1VQ1 A;  2JY5 A;  3E21 A;  1E94 E;  3T6P A;  1C7Y A;  1Y8G A;  1EFU B;  2L2D A;  2K0B X;  1XXH E;  2WZJ A;  2B3T A;  1KYI A;  2DAE A;  1F4I A;  2EKF A;  1TR8 A;  2KNA A;  1DV0 A;  2DKL A;  1WIV A;  1DO2 A;  1WJ7 A;  2LVO C;  2BWE A;  3E46 A;  3H4J A;  3FRI A;  2JNH A;  1UFZ A;  3BBZ A;  1NV8 A;  2DNA A;  1AIP C;  3LCV B;  2EKK A;  4HEO A;  4WP2 A;  2LVQ D;  2L4F A;  1G41 A;  3GLH E;  2DAG A;  1ZMW A;  1Q02 A;  2HWJ A;  1CUK A;  2DI0 A;  4GEW A;  1HQY E;  2JUJ A;  1HJP A;  5DFL A;  2ZTC A;  1NV9 A;  3LCU A;  1P3Q Q;  2QHO B;  2LVN C;  2H5X A;  2JY7 A;  1XB2 B;  1TTE A;  1T6O A;  2DAI A;  2R0I A;  2HAK A;  4F1I A;  1VEJ A;  1WGN A;  3FRH A;  2CWB A;  1MN3 A;  2JP7 A;  1R4G A;  2OOB A;  3IHP A;  2LTU A;  2KHH A;  1G3I A;  3MMP A;  2K9D A;  2QNJ A;  2QSF X;  1IXS A;  2DAK A;  3K9O A;  1WHC A;  1OQY A;  2OO9 A;  2KNZ A;  3B89 A;  2RRU A;  2O25 A;  4DBG B;  4R71 A;  2DHY A;  1VEG A;  1WR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...