1UFZA

Solution structure of hbs1-like domain in hypothetical protein bab28515
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
GSSGSSGEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Hypothetical protein BAB28515
publication title Solution structure of HBS1-like domain in hypothetical protein BAB28515
rcsb
source organism Mus musculus
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ufzA01
2KHHA 1GO5A 1G3IA 1Y8GA 1VEJA 3FRIA 3GLGE 2JUJA 3E46A 1Q02A 2KNVA 2RRUA 2R0IA 1CUKA 2DAKA 2JP7A 3MMPA 1G41A 1VQ1A 2QSFX 1VDLA 2HAKA 1WGNA 4G3OA 1AIPC 2JZ1A 1XXHE 1UFZA 1OKSA 1NV8A 2JY7A 3GLIE 1HQYE 1HT1E 2MROB 2JZ0A 3FE3A 4GEWA 2LVNC 1OQYA 2K9DA 5JI2E 2G3QA 1OTRA 1TTEA 3FRHA 3LCVB 2LBCA 2BWBA 1YLAA 1QZEA 2DAEA 3F92A 1MN3A 1XB2B 4WP2A 4F2LA 1WJ7A 2L4EA 2DZLA 1WGLA 1DO2A 1BVSA 1NV9A 2ZTCA 1DV0A 2DAIA 1A5TA 2LVQD 2MGWA 2EKFA 1WR1B 1EFUB 1T6OA 1P3QQ 1SG9A 2DNAA 2H5XA 2DI0A 1IFYA 2HWJA 2LTUA 1T43A 2CWBA 3BBZA 1V92A 1VEGA 2MR9A 3LCUA 2OOAA 2QNJA 1HT2E 2JY6B 1KYIA 1OAIA 2JNHA 3H4JA 4F1IA 1HJPA 3K9OA 2LVOC 1ZMUA 2L4FA 3T6PA 1F4IA 4Q7JA 2EJSA 1WHCA 1ZV1A 2DAGA 2LVAA 1JR3E 1R4GA 2DENA 2MJ5B 2B3TA 1IM2A 1ZMWA 2QHOB 1VEKA 2L2DA 4HEOA 5DFLA 3B89A 1TR8A 3IHPA 4UN2B 2KNZA 2CP8A 2OO9A 3E21A 4DBGB 2JY8A 3GLFE 2LVPC 1VG5A 1WIVA 2O25A 3K9PA 1DO0A 2EKKA 3IECA 1G4AE 2ZTDA 2KNAA 2DAMA 4R71A 2WZJA 3GLHE 2K0BX 1IXSA 2DHYA 2OOBA 2DKLA 1E94E 1PGYA 1ZMVA 1C7YA 2BWEA 2JY5A
chains in the Genus database with same CATH superfamily
2W82A 2X49A 1JR3A 5A2QS 1G3IA 1Y8GA 1MX0A 1VEJA 2C98A 2XFSA 4IBDA 2CHQA 4G4QA 1PM5A 1L2DA 2CEAA 3J81S 4CIZA 5KPZA 2RRUA 1ZQ9A 5EP2A 2DVWB 4BB9A 4WW0A 4P16A 1NJGA 3NBXX 5FSWA 4NRWA 3I01M 4JI7M 3B7NA 3UK6A 1EIJA 1N36M 4LFAM 4OVZA 2DWLA 3GLFB 1TH3A 4I5SA 4PCZA 1Z5CA 4I81A 5EXTA 2M5ZA 3SMPA 3HKPA 1OKSA 2C96A 3SAWA 1SXJA 2F4VM 3U6LA 3KP0E 4JI4M 1QAOA 3GLHA 4X66M 1HT1E 4GC9A 4L4UA 1IBMM 3FTFA 3RGSA 3ZCBB 3GPYA 1G71A 2LVNC 3RGPA 4MGYE 3M0EA 5JI2E 2G3QA 4GHAA 5KPTA 1DGHB 3E9SA 4DUZM 3FRHA 3LCVB 1I94M 3JAMS 2V6ZM 4IBKA 1QZEA 1OIPA 2DAEA 3F92A 1KSFX 3KSJA 5ITRA 3GLGA 1MN3A 4M9ZA 3VKHA 2N35A 2CE7A 2L4EA 1BVSA 3QWLA 3CGWA 2LHGA 2XEPA 2VF8A 2EKFA 1WR1B 4IJFA 4KODA 3U60B 3U6PA 3KP1E 1EFUB 2QQ8A 3SBJA 1SG9A 4NXMM 2DHRA 4DR5M 3AOEA 4Y28F 2DI0A 4FD2A 3C9PA 5ITXA 1R5LA 2UXCM 4B08A 3L26A 2QBYB 2JXNA 1XXHB 2CWBA 4LJ4A 4QOZC 1V92A 3LCUA 2DZOB 4LF7M 1EE8A 2OOAA 3HJ8A 3A45A 2JY6B 2KW0A 3GLIB 2LXEA 4ZPXA 3Q8GA 2CV1A 5ITQA 3L28A 3U6SA 3WHLA 3GO8A 1I4WA 4XBOA 4FWGA 1IN8A 1LTMA 3TQSA 3THGA 4AG6A 2XGNA 4AKHA 4M9SA 4NC6A 2L7IA 4CGYB 4MH0E 1KFVA 3KOZE 5E26A 4W5WA 2K47A 3U6EA 3EIHA 3SASA 3GRUA 4JXJA 2B3TA 3HHWA 1IXRC 1ZMWA 3I51A 4QNRA 2C9OA 2Y20A 1VDDA 2L2DA 4HEOA 5DFLA 4CJ6A 3PXGA 4X64M 4UN2B 1QAMA 1OAOC 1Q3CA 3A98B 3D8BA 1J5EM 2E5LM 2OO9A 1MJGM 1LV7A 3HHZA 3HJQA 3SAUA 2XZFA 1GJSA 1VG5A 1XC8A 3GRVA 3U6MA 1XMQM 3K9PA 3I4YA 2YR0A 2Z4RA 3K92A 4HL4A 2EKKA 5FTNA 4AI6A 5KPRA 4MM3B 3UZUA 1N77A 3HZJA 3HU3A 4Z8XA 4X62M 2QENA 4JI5M 2ZAMA 3V76A 1IXSB 4L78A 2OOBA 4NL4H 4AZFA 4MGZE 2BWEA 4M0DA 2JY5A 5H37D 4DR6M 4GH9A 4LFCM 1GO5A 3WHKA 1OIZA 4LGYA 1AUAA 3U5ZB 2MH8A 2HL7A 3E46A 1Q02A 2XSZA 3KW6A 2R0IA 2DAKA 2XH9A 4L16A 2JP7A 3LQQA 4QNMA 5IREB 3AOEC 3SFZA 2CV0A 4GITA 1XWIA 3FUWA 3FTEA 2QSFX 2R62A 3SARA 4DR4M 3M7GA 1L2BA 4FCWA 1NY5A 2JZ1A 4FCVA 2P5TA 4OU7A 2R18A 3AFHA 1NV8A 4MGHA 3D8LA 2R44A 4DV7M 1SXJB 4EIWA 5KQDA 2XLJA 1SXJD 3VLFB 3FUUA 4LJ5A 4LJ8A 3JR4A 3KXEC 3GLHB 1QVRA 1IN4A 4GEWA 1OQYA 3K2LA 3K1JA 4A3VB 4DV1M 2LNHC 1IY2A 3KVWA 4JN6A 1L1ZA 1TTEA 3EIEA 3L29A 3HU1A 2L6OA 4LRSA 3U6QA 4PT5A 2HHHM 3OTOM 2DWZB 2VIIA 4AG5A 2YQZA 4IBGA 4IBFA 4GC5A 3GLGB 4F2LA 2CV2A 3E4RA 4M9XA 2ZBKB 3VFDA 3LMMA 4JI8M 2QCUA 2DAIA 1RU3A 4NRVA 3T1YM 2F5NA 2MGWA 2R4JA 2R4EA 4GHLA 1XNRM 3UMMA 3AV0A 1N78A 1ZAEA 1DGGA 3FKEA 1IFYA 4DUYM 2C9CA 1QDTA 2CRUA 3PVSA 3SATA 3FYDA 1QDRA 2WSFF 5ITYA 1HQCA 2Z3XA 4LF5M 1Q39A 3I4VA 2V1UA 1OAIA 2JNHA 2FOIC 4LZZA 2J7NA 4F1IA 1DGFA 5DNYA 3K9OA 2LVOC 3C3EA 4FCTA 2L4FA 5EP1A 2QP9X 5EXSA 4JI6M 1QUSA 4Q7JA 1QQWA 4PDIA 3FUXA 3J7AS 4PD2A 3HU2A 2LVAA 2WSCF 1R4GA 3DOAA 3J27B 4NOOB 1GABA 2DENA 1IM2A 1GKIA 1W5TA 2QHOB 1PJJA 4YHHM 3BOSA 1VEKA 3LQRA 3DA1A 1R6BX 3HWSA 4RF0A 5EXXA 2NQ8C 2X8AA 4B3SM 3TL4X 2Y0QA 4LF6M 3B89A 1TR8A 5E6JA 3R8FA 2UXBM 2VF7A 4XK8F 2CP8A 4RNAA 4ANRA 1L8QA 3PNYA 3E21A 3CF0A 2R6FA 3PNVA 4KLNA 3GLFE 1IBLM 1NVMA 3GQ4A 1WIVA 2O25A 3GRRA 1S3SA 1DO0A 2EUCA 2APLA 5LMNM 1G4AE 3C58A 2YFQA 4QHTA 4JI0M 4AKGA 2KA6B 5EQTA 2O01F 1D0LA 4KT0F 4XGIA 2I7NA 4YY3M 1Q3BA 2DHYA 2DZNB 4RKUF 1PGYA 1IQPA 3B9PA 3CF6E 1NY6A 2D7GA 1IN5A 1V34A 4JV5M 3W68A 3NWLA 2H1RA 1WXQA 4LFBM 3NBIA 3KOWE 1NO1A 1NHWC 2G8LA 2JUJA 4JI2M 3SC3A 4IIWA 1HNZM 4LG2A 1CUKA 1SXJC 2Z8YM 2XSZD 3FUVA 3MMPA 1E32A 3TE6A 7CATA 1J7KA 3TWKA 2EA0A 1TH2A 2JA2A 1C1KA 1E9SA 1N75A 1VDLA 2HAKA 2J7OA 2Y0TA 1WGNA 4L15A 4DV5M 2YNMD 1XXHE 1V33A 1FNNA 2FE8A 2R46A 1L1TA 4K0KM 1UFZA 4JYAM 2VDBB 3AJIB 3LVVA 2JY7A 1QZMA 4GKKM 3GLIE 5IZ7D 3VDUA 1HQYE 4D80A 2QBYA 1XMOM 2M60A 1D2NA 1PRBA 1XXHA 2MROB 4X65M 2UUCM 3R9XB 4TUWA 1Z5AA 1GJTA 5KO3A 2UUAM 2LWXA 3KOYE 1IXZA 3KOXE 3QYEA 4LJAA 4IBCA 2LBCA 1YLAA 3HJSA 4R7GA 4DV6M 1PJIA 2CHVA 3HHYA 3KDSE 3HY5A 1XB2B 4FW9A 3VK7A 1YSYA 4KO8A 1WGLA 2DZLA 1NV9A 2KZSA 4CHTB 5DYGA 2DWMA 4B3RM 1R2ZA 2LH0A 2LVQD 4OVZB 4D81A 1K3XA 1DV0A 3ILKA 3U61A 4AKIA 2JWSA 2OPFA 2DNAA 5L8RF 1DGBA 2J5YA 4GMQA 1TDHA 4LJ9A 2F5QA 1UM8A 1W5SA 5BPVA 3JR5A 3U6DA 2LTUA 4ITQA 1T43A 1QANA 2F5OA 2MR9A 1H6UA 2QNJA 2ZM6M 5C1BA 1PJTA 2KRUA 4REZA 4B7FA 3W67A 1NNJA 2Y21A 3H4JA 4GIPA 4NSRA 3T15A 4BBAA 3T1HM 4B3TM 3W0LB 5EJCA 3RE8A 3KFUG 4DV0M 3HHXA 2XZUA 4R3DA 3B7QA 2VQEM 4LJ7A 2QZ4A 1F4IA 3ZH9B 2WSEF 1J09A 2FH0A 3ZC7B 1GVNA 1WHCA 2EO2A 3PFIA 2FFJA 5ITTA 1JR3E 2L09A 3H4MA 1PJSA 2MJ5B 2O5RA 2ERCA 5FTJA 4B3MM 4KHPM 3U5ZA 1YUBA 3IHPA 3AL0C 3L27A 8CATA 2KNZA 3UJNA 4AW4A 3B7ZA 2Z7JA 1IY1A 2JY8A 2V1CA 2XF3A 4MB7A 1QYRA 2Z4SA 2LVPC 5EP3A 3TWLA 3U6OA 1N33M 3VDPA 3DFZA 3GQ3A 4AQYM 2FS1A 3IECA 1SXJE 3L2AA 3SMSA 4LF8M 1YE9A 2ZTDA 2KNAA 1OFIA 3GLHE 3SYLA 4LGMA 5BR8M 2D7HA 4IBBA 4DR3M 4GKJM 3FTDA 2RKOA 3VK8A 3W0FA 1QAQA 2X4AA 2QPAA 1GL6A 4LY6A 1ZMVA 1IY0A 4LCBA 1HNWM 1K3WA 5FLXS 2KHHA 3MK6A 3FRIA 3MJ5A 3GLGE 3J80S 1HR0M 4I4LA 2BNKA 3HGIA 3J2PB 2KNVA 1R7RA 1TGUA 5GKNA 5EXPA 1HNXM 2GQFA 3QAUA 1Z59A 1G41A 3FD9A 1VQ1A 3GQ5A 5ITUA 3A42A 4DV4M 4JI3M 2R65A 2CUZA 2XFTA 3GLFA 3U6CA 3B74A 3LW5F 5FTLA 3KSXA 4G3OA 5ITXE 1AIPC 1QUTA 4I8OA 2K6BA 3FUTA 4L6V6 3AKZA 2DWNA 4G6ZA 2VQFM 1TH4A 2F5SA 2DXIA 2KXEA 2ZANA 2ZAOA 2C99A 4G4RA 2KDLA 2UUBM 3LVWA 1NJFA 3VKGA 1T3TA 2JZ0A 1D0MA 3DZDA 4BLCA 3FE3A 3SHFA 2G5GX 4NSOB 4PDGA 3GPPA 1N34M 1GL7A 3TPZA 1DGHA 2K9DA 4DV2M 1OTRA 2GNOA 5KQ8A 1IN6A 2BWBA 3FTCA 4CISA 2D7EA 1FJGM 5IWAM 4WP2A 4Z6YA 1WJ7A 4B7HA 2R45A 1DO2A 4S12A 3GPUA 4P17A 2ZTCA 1R2YA 4OX9M 1A5TA 3K8ZA 1N32M 3U60A 3SYKA 3M6AA 4MGKE 1PJQA 1NSFA 3MHVC 1T6OA 1P3QQ 4IJEA 3U61B 2BJVA 1K82A 2RGOA 1JB0F 4FWDA 4JI1M 4LF4M 2H5XA 3KS4A 4IBIA 1X37A 3GP1A 2HWJA 3QYBA 3C3DA 3HX3A 4OW0A 1OFHA 3SHGB 3BBZA 3ZQJA 1VEGA 3SAVA 5F3WA 4DR7M 4B7GA 1HT2E 1NNUC 3GLIA 1KYIA 1TF0B 4FWHA 4GRIA 1Z6TA 2Q2EB 1HJPA 1E9RA 2LHCA 4FVMA 3L25A 2UXDM 5DYIA 1ZMUA 3CF2A 2UU9M 1OJLA 4IBJA 3GRYA 3I04M 3T6PA 2KZUA 2OQ4A 2EJSA 4M0WA 4G4NA 1ZV1A 2DAGA 4LRTA 3KS8A 3UGJA 1NHGC 1Z5BA 1L2CA 5EP4A 3T38A 1IBKM 4RF1A 3FYCA 4IBEA 1MU5A 4WURA 1XHBA 1JR3D 4NXNM 2F5PA 2A5YB 2KEBA 3IG8A 3TWMA 3CTWB 4LJ6A 3AOGA 2BJWA 4DBGB 5LMUM 4LF9M 2I7PA 3J7BA 4D82A 1XNQM 1D0KA 3GPXA 2C5RA 4HLQA 5IT9S 4MGIE 4QHSA 2L7HA 4L8RC 1ORYB 1TDZA 3IG5A 2CHGA 4G4OA 5FTKA 3RFWA 5C18A 1G59A 2DAMA 4R71A 2WZJA 1IN7A 2K0BX 1IXSA 2KRKA 5FTMA 4DV3M 2HCBA 1JQJC 3BXWA 4LZJA 1G8PA 2HKJA 2RGHA 3Q8XA 4DR1M 2DKLA 1GLNA 4QOSA 4II7A 1E94E 2CFOA 5JI3E 3A46A 1C7YA 4DR2M 2FNAA 2AHMA
chains in the Genus database with same CATH topology
2KHHA 1GO5A 1G3IA 1Y8GA 1VEJA 3FRIA 3GLGE 2JUJA 3E46A 1Q02A 2KNVA 2RRUA 2R0IA 1CUKA 2DAKA 2JP7A 3MMPA 1G41A 1VQ1A 2QSFX 1VDLA 2HAKA 1WGNA 4G3OA 1AIPC 2JZ1A 1XXHE 1UFZA 1OKSA 1NV8A 2JY7A 3GLIE 1HQYE 1HT1E 2MROB 2JZ0A 3FE3A 4GEWA 2LVNC 1OQYA 2K9DA 5JI2E 2G3QA 1OTRA 1TTEA 3FRHA 3LCVB 2LBCA 2BWBA 1YLAA 1QZEA 2DAEA 3F92A 1MN3A 1XB2B 4WP2A 4F2LA 1WJ7A 2L4EA 2DZLA 1WGLA 1DO2A 1BVSA 1NV9A 2ZTCA 1DV0A 2DAIA 1A5TA 2LVQD 2MGWA 2EKFA 1WR1B 1EFUB 1T6OA 1P3QQ 1SG9A 2DNAA 2H5XA 2DI0A 1IFYA 2HWJA 2LTUA 1T43A 2CWBA 3BBZA 1V92A 1VEGA 2MR9A 3LCUA 2OOAA 2QNJA 1HT2E 2JY6B 1KYIA 1OAIA 2JNHA 3H4JA 4F1IA 1HJPA 3K9OA 2LVOC 1ZMUA 2L4FA 3T6PA 1F4IA 4Q7JA 2EJSA 1WHCA 1ZV1A 2DAGA 2LVAA 1JR3E 1R4GA 2DENA 2MJ5B 2B3TA 1IM2A 1ZMWA 2QHOB 1VEKA 2L2DA 4HEOA 5DFLA 3B89A 1TR8A 3IHPA 4UN2B 2KNZA 2CP8A 2OO9A 3E21A 4DBGB 2JY8A 3GLFE 2LVPC 1VG5A 1WIVA 2O25A 3K9PA 1DO0A 2EKKA 3IECA 1G4AE 2ZTDA 2KNAA 2DAMA 4R71A 2WZJA 3GLHE 2K0BX 1IXSA 2DHYA 2OOBA 2DKLA 1E94E 1PGYA 1ZMVA 1C7YA 2BWEA 2JY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHH A;  1GO5 A;  1G3I A;  1Y8G A;  1VEJ A;  3FRI A;  3GLG E;  2JUJ A;  3E46 A;  1Q02 A;  2KNV A;  2RRU A;  2R0I A;  1CUK A;  2DAK A;  2JP7 A;  3MMP A;  1G41 A;  1VQ1 A;  2QSF X;  1VDL A;  2HAK A;  1WGN A;  4G3O A;  1AIP C;  2JZ1 A;  1XXH E;  1UFZ A;  1OKS A;  1NV8 A;  2JY7 A;  3GLI E;  1HQY E;  1HT1 E;  2MRO B;  2JZ0 A;  3FE3 A;  4GEW A;  2LVN C;  1OQY A;  2K9D A;  5JI2 E;  2G3Q A;  1OTR A;  1TTE A;  3FRH A;  3LCV B;  2LBC A;  2BWB A;  1YLA A;  1QZE A;  2DAE A;  3F92 A;  1MN3 A;  1XB2 B;  4WP2 A;  4F2L A;  1WJ7 A;  2L4E A;  2DZL A;  1WGL A;  1DO2 A;  1BVS A;  1NV9 A;  2ZTC A;  1DV0 A;  2DAI A;  1A5T A;  2LVQ D;  2MGW A;  2EKF A;  1WR1 B;  1EFU B;  1T6O A;  1P3Q Q;  1SG9 A;  2DNA A;  2H5X A;  2DI0 A;  1IFY A;  2HWJ A;  2LTU A;  1T43 A;  2CWB A;  3BBZ A;  1V92 A;  1VEG A;  2MR9 A;  3LCU A;  2OOA A;  2QNJ A;  1HT2 E;  2JY6 B;  1KYI A;  1OAI A;  2JNH A;  3H4J A;  4F1I A;  1HJP A;  3K9O A;  2LVO C;  1ZMU A;  2L4F A;  3T6P A;  1F4I A;  4Q7J A;  2EJS A;  1WHC A;  1ZV1 A;  2DAG A;  2LVA A;  1JR3 E;  1R4G A;  2DEN A;  2MJ5 B;  2B3T A;  1IM2 A;  1ZMW A;  2QHO B;  1VEK A;  2L2D A;  4HEO A;  5DFL A;  3B89 A;  1TR8 A;  3IHP A;  4UN2 B;  2KNZ A;  2CP8 A;  2OO9 A;  3E21 A;  4DBG B;  2JY8 A;  3GLF E;  2LVP C;  1VG5 A;  1WIV A;  2O25 A;  3K9P A;  1DO0 A;  2EKK A;  3IEC A;  1G4A E;  2ZTD A;  2KNA A;  2DAM A;  4R71 A;  2WZJ A;  3GLH E;  2K0B X;  1IXS A;  2DHY A;  2OOB A;  2DKL A;  1E94 E;  1PGY A;  1ZMV A;  1C7Y A;  2BWE A;  2JY5 A; 
#chains in the Genus database with same CATH topology
 2W82 A;  2X49 A;  1JR3 A;  5A2Q S;  1G3I A;  1Y8G A;  1MX0 A;  1VEJ A;  2C98 A;  2XFS A;  4IBD A;  2CHQ A;  4G4Q A;  1PM5 A;  1L2D A;  2CEA A;  3J81 S;  4CIZ A;  5KPZ A;  2RRU A;  1ZQ9 A;  5EP2 A;  2DVW B;  4BB9 A;  4WW0 A;  4P16 A;  1NJG A;  3NBX X;  5FSW A;  4NRW A;  3I01 M;  4JI7 M;  3B7N A;  3UK6 A;  1EIJ A;  1N36 M;  4LFA M;  4OVZ A;  2DWL A;  3GLF B;  1TH3 A;  4I5S A;  4PCZ A;  1Z5C A;  4I81 A;  5EXT A;  2M5Z A;  3SMP A;  3HKP A;  1OKS A;  2C96 A;  3SAW A;  1SXJ A;  2F4V M;  3U6L A;  3KP0 E;  4JI4 M;  1QAO A;  3GLH A;  4X66 M;  1HT1 E;  4GC9 A;  4L4U A;  1IBM M;  3FTF A;  3RGS A;  3ZCB B;  3GPY A;  1G71 A;  2LVN C;  3RGP A;  4MGY E;  3M0E A;  5JI2 E;  2G3Q A;  4GHA A;  5KPT A;  1DGH B;  3E9S A;  4DUZ M;  3FRH A;  3LCV B;  1I94 M;  3JAM S;  2V6Z M;  4IBK A;  1QZE A;  1OIP A;  2DAE A;  3F92 A;  1KSF X;  3KSJ A;  5ITR A;  3GLG A;  1MN3 A;  4M9Z A;  3VKH A;  2N35 A;  2CE7 A;  2L4E A;  1BVS A;  3QWL A;  3CGW A;  2LHG A;  2XEP A;  2VF8 A;  2EKF A;  1WR1 B;  4IJF A;  4KOD A;  3U60 B;  3U6P A;  3KP1 E;  1EFU B;  2QQ8 A;  3SBJ A;  1SG9 A;  4NXM M;  2DHR A;  4DR5 M;  3AOE A;  4Y28 F;  2DI0 A;  4FD2 A;  3C9P A;  5ITX A;  1R5L A;  2UXC M;  4B08 A;  3L26 A;  2QBY B;  2JXN A;  1XXH B;  2CWB A;  4LJ4 A;  4QOZ C;  1V92 A;  3LCU A;  2DZO B;  4LF7 M;  1EE8 A;  2OOA A;  3HJ8 A;  3A45 A;  2JY6 B;  2KW0 A;  3GLI B;  2LXE A;  4ZPX A;  3Q8G A;  2CV1 A;  5ITQ A;  3L28 A;  3U6S A;  3WHL A;  3GO8 A;  1I4W A;  4XBO A;  4FWG A;  1IN8 A;  1LTM A;  3TQS A;  3THG A;  4AG6 A;  2XGN A;  4AKH A;  4M9S A;  4NC6 A;  2L7I A;  4CGY B;  4MH0 E;  1KFV A;  3KOZ E;  5E26 A;  4W5W A;  2K47 A;  3U6E A;  3EIH A;  3SAS A;  3GRU A;  4JXJ A;  2B3T A;  3HHW A;  1IXR C;  1ZMW A;  3I51 A;  4QNR A;  2C9O A;  2Y20 A;  1VDD A;  2L2D A;  4HEO A;  5DFL A;  4CJ6 A;  3PXG A;  4X64 M;  4UN2 B;  1QAM A;  1OAO C;  1Q3C A;  3A98 B;  3D8B A;  1J5E M;  2E5L M;  2OO9 A;  1MJG M;  1LV7 A;  3HHZ A;  3HJQ A;  3SAU A;  2XZF A;  1GJS A;  1VG5 A;  1XC8 A;  3GRV A;  3U6M A;  1XMQ M;  3K9P A;  3I4Y A;  2YR0 A;  2Z4R A;  3K92 A;  4HL4 A;  2EKK A;  5FTN A;  4AI6 A;  5KPR A;  4MM3 B;  3UZU A;  1N77 A;  3HZJ A;  3HU3 A;  4Z8X A;  4X62 M;  2QEN A;  4JI5 M;  2ZAM A;  3V76 A;  1IXS B;  4L78 A;  2OOB A;  4NL4 H;  4AZF A;  4MGZ E;  2BWE A;  4M0D A;  2JY5 A;  5H37 D;  4DR6 M;  4GH9 A;  4LFC M;  1GO5 A;  3WHK A;  1OIZ A;  4LGY A;  1AUA A;  3U5Z B;  2MH8 A;  2HL7 A;  3E46 A;  1Q02 A;  2XSZ A;  3KW6 A;  2R0I A;  2DAK A;  2XH9 A;  4L16 A;  2JP7 A;  3LQQ A;  4QNM A;  5IRE B;  3AOE C;  3SFZ A;  2CV0 A;  4GIT A;  1XWI A;  3FUW A;  3FTE A;  2QSF X;  2R62 A;  3SAR A;  4DR4 M;  3M7G A;  1L2B A;  4FCW A;  1NY5 A;  2JZ1 A;  4FCV A;  2P5T A;  4OU7 A;  2R18 A;  3AFH A;  1NV8 A;  4MGH A;  3D8L A;  2R44 A;  4DV7 M;  1SXJ B;  4EIW A;  5KQD A;  2XLJ A;  1SXJ D;  3VLF B;  3FUU A;  4LJ5 A;  4LJ8 A;  3JR4 A;  3KXE C;  3GLH B;  1QVR A;  1IN4 A;  4GEW A;  1OQY A;  3K2L A;  3K1J A;  4A3V B;  4DV1 M;  2LNH C;  1IY2 A;  3KVW A;  4JN6 A;  1L1Z A;  1TTE A;  3EIE A;  3L29 A;  3HU1 A;  2L6O A;  4LRS A;  3U6Q A;  4PT5 A;  2HHH M;  3OTO M;  2DWZ B;  2VII A;  4AG5 A;  2YQZ A;  4IBG A;  4IBF A;  4GC5 A;  3GLG B;  4F2L A;  2CV2 A;  3E4R A;  4M9X A;  2ZBK B;  3VFD A;  3LMM A;  4JI8 M;  2QCU A;  2DAI A;  1RU3 A;  4NRV A;  3T1Y M;  2F5N A;  2MGW A;  2R4J A;  2R4E A;  4GHL A;  1XNR M;  3UMM A;  3AV0 A;  1N78 A;  1ZAE A;  1DGG A;  3FKE A;  1IFY A;  4DUY M;  2C9C A;  1QDT A;  2CRU A;  3PVS A;  3SAT A;  3FYD A;  1QDR A;  2WSF F;  5ITY A;  1HQC A;  2Z3X A;  4LF5 M;  1Q39 A;  3I4V A;  2V1U A;  1OAI A;  2JNH A;  2FOI C;  4LZZ A;  2J7N A;  4F1I A;  1DGF A;  5DNY A;  3K9O A;  2LVO C;  3C3E A;  4FCT A;  2L4F A;  5EP1 A;  2QP9 X;  5EXS A;  4JI6 M;  1QUS A;  4Q7J A;  1QQW A;  4PDI A;  3FUX A;  3J7A S;  4PD2 A;  3HU2 A;  2LVA A;  2WSC F;  1R4G A;  3DOA A;  3J27 B;  4NOO B;  1GAB A;  2DEN A;  1IM2 A;  1GKI A;  1W5T A;  2QHO B;  1PJJ A;  4YHH M;  3BOS A;  1VEK A;  3LQR A;  3DA1 A;  1R6B X;  3HWS A;  4RF0 A;  5EXX A;  2NQ8 C;  2X8A A;  4B3S M;  3TL4 X;  2Y0Q A;  4LF6 M;  3B89 A;  1TR8 A;  5E6J A;  3R8F A;  2UXB M;  2VF7 A;  4XK8 F;  2CP8 A;  4RNA A;  4ANR A;  1L8Q A;  3PNY A;  3E21 A;  3CF0 A;  2R6F A;  3PNV A;  4KLN A;  3GLF E;  1IBL M;  1NVM A;  3GQ4 A;  1WIV A;  2O25 A;  3GRR A;  1S3S A;  1DO0 A;  2EUC A;  2APL A;  5LMN M;  1G4A E;  3C58 A;  2YFQ A;  4QHT A;  4JI0 M;  4AKG A;  2KA6 B;  5EQT A;  2O01 F;  1D0L A;  4KT0 F;  4XGI A;  2I7N A;  4YY3 M;  1Q3B A;  2DHY A;  2DZN B;  4RKU F;  1PGY A;  1IQP A;  3B9P A;  3CF6 E;  1NY6 A;  2D7G A;  1IN5 A;  1V34 A;  4JV5 M;  3W68 A;  3NWL A;  2H1R A;  1WXQ A;  4LFB M;  3NBI A;  3KOW E;  1NO1 A;  1NHW C;  2G8L A;  2JUJ A;  4JI2 M;  3SC3 A;  4IIW A;  1HNZ M;  4LG2 A;  1CUK A;  1SXJ C;  2Z8Y M;  2XSZ D;  3FUV A;  3MMP A;  1E32 A;  3TE6 A;  7CAT A;  1J7K A;  3TWK A;  2EA0 A;  1TH2 A;  2JA2 A;  1C1K A;  1E9S A;  1N75 A;  1VDL A;  2HAK A;  2J7O A;  2Y0T A;  1WGN A;  4L15 A;  4DV5 M;  2YNM D;  1XXH E;  1V33 A;  1FNN A;  2FE8 A;  2R46 A;  1L1T A;  4K0K M;  1UFZ A;  4JYA M;  2VDB B;  3AJI B;  3LVV A;  2JY7 A;  1QZM A;  4GKK M;  3GLI E;  5IZ7 D;  3VDU A;  1HQY E;  4D80 A;  2QBY A;  1XMO M;  2M60 A;  1D2N A;  1PRB A;  1XXH A;  2MRO B;  4X65 M;  2UUC M;  3R9X B;  4TUW A;  1Z5A A;  1GJT A;  5KO3 A;  2UUA M;  2LWX A;  3KOY E;  1IXZ A;  3KOX E;  3QYE A;  4LJA A;  4IBC A;  2LBC A;  1YLA A;  3HJS A;  4R7G A;  4DV6 M;  1PJI A;  2CHV A;  3HHY A;  3KDS E;  3HY5 A;  1XB2 B;  4FW9 A;  3VK7 A;  1YSY A;  4KO8 A;  1WGL A;  2DZL A;  1NV9 A;  2KZS A;  4CHT B;  5DYG A;  2DWM A;  4B3R M;  1R2Z A;  2LH0 A;  2LVQ D;  4OVZ B;  4D81 A;  1K3X A;  1DV0 A;  3ILK A;  3U61 A;  4AKI A;  2JWS A;  2OPF A;  2DNA A;  5L8R F;  1DGB A;  2J5Y A;  4GMQ A;  1TDH A;  4LJ9 A;  2F5Q A;  1UM8 A;  1W5S A;  5BPV A;  3JR5 A;  3U6D A;  2LTU A;  4ITQ A;  1T43 A;  1QAN A;  2F5O A;  2MR9 A;  1H6U A;  2QNJ A;  2ZM6 M;  5C1B A;  1PJT A;  2KRU A;  4REZ A;  4B7F A;  3W67 A;  1NNJ A;  2Y21 A;  3H4J A;  4GIP A;  4NSR A;  3T15 A;  4BBA A;  3T1H M;  4B3T M;  3W0L B;  5EJC A;  3RE8 A;  3KFU G;  4DV0 M;  3HHX A;  2XZU A;  4R3D A;  3B7Q A;  2VQE M;  4LJ7 A;  2QZ4 A;  1F4I A;  3ZH9 B;  2WSE F;  1J09 A;  2FH0 A;  3ZC7 B;  1GVN A;  1WHC A;  2EO2 A;  3PFI A;  2FFJ A;  5ITT A;  1JR3 E;  2L09 A;  3H4M A;  1PJS A;  2MJ5 B;  2O5R A;  2ERC A;  5FTJ A;  4B3M M;  4KHP M;  3U5Z A;  1YUB A;  3IHP A;  3AL0 C;  3L27 A;  8CAT A;  2KNZ A;  3UJN A;  4AW4 A;  3B7Z A;  2Z7J A;  1IY1 A;  2JY8 A;  2V1C A;  2XF3 A;  4MB7 A;  1QYR A;  2Z4S A;  2LVP C;  5EP3 A;  3TWL A;  3U6O A;  1N33 M;  3VDP A;  3DFZ A;  3GQ3 A;  4AQY M;  2FS1 A;  3IEC A;  1SXJ E;  3L2A A;  3SMS A;  4LF8 M;  1YE9 A;  2ZTD A;  2KNA A;  1OFI A;  3GLH E;  3SYL A;  4LGM A;  5BR8 M;  2D7H A;  4IBB A;  4DR3 M;  4GKJ M;  3FTD A;  2RKO A;  3VK8 A;  3W0F A;  1QAQ A;  2X4A A;  2QPA A;  1GL6 A;  4LY6 A;  1ZMV A;  1IY0 A;  4LCB A;  1HNW M;  1K3W A;  5FLX S;  2KHH A;  3MK6 A;  3FRI A;  3MJ5 A;  3GLG E;  3J80 S;  1HR0 M;  4I4L A;  2BNK A;  3HGI A;  3J2P B;  2KNV A;  1R7R A;  1TGU A;  5GKN A;  5EXP A;  1HNX M;  2GQF A;  3QAU A;  1Z59 A;  1G41 A;  3FD9 A;  1VQ1 A;  3GQ5 A;  5ITU A;  3A42 A;  4DV4 M;  4JI3 M;  2R65 A;  2CUZ A;  2XFT A;  3GLF A;  3U6C A;  3B74 A;  3LW5 F;  5FTL A;  3KSX A;  4G3O A;  5ITX E;  1AIP C;  1QUT A;  4I8O A;  2K6B A;  3FUT A;  4L6V 6;  3AKZ A;  2DWN A;  4G6Z A;  2VQF M;  1TH4 A;  2F5S A;  2DXI A;  2KXE A;  2ZAN A;  2ZAO A;  2C99 A;  4G4R A;  2KDL A;  2UUB M;  3LVW A;  1NJF A;  3VKG A;  1T3T A;  2JZ0 A;  1D0M A;  3DZD A;  4BLC A;  3FE3 A;  3SHF A;  2G5G X;  4NSO B;  4PDG A;  3GPP A;  1N34 M;  1GL7 A;  3TPZ A;  1DGH A;  2K9D A;  4DV2 M;  1OTR A;  2GNO A;  5KQ8 A;  1IN6 A;  2BWB A;  3FTC A;  4CIS A;  2D7E A;  1FJG M;  5IWA M;  4WP2 A;  4Z6Y A;  1WJ7 A;  4B7H A;  2R45 A;  1DO2 A;  4S12 A;  3GPU A;  4P17 A;  2ZTC A;  1R2Y A;  4OX9 M;  1A5T A;  3K8Z A;  1N32 M;  3U60 A;  3SYK A;  3M6A A;  4MGK E;  1PJQ A;  1NSF A;  3MHV C;  1T6O A;  1P3Q Q;  4IJE A;  3U61 B;  2BJV A;  1K82 A;  2RGO A;  1JB0 F;  4FWD A;  4JI1 M;  4LF4 M;  2H5X A;  3KS4 A;  4IBI A;  1X37 A;  3GP1 A;  2HWJ A;  3QYB A;  3C3D A;  3HX3 A;  4OW0 A;  1OFH A;  3SHG B;  3BBZ A;  3ZQJ A;  1VEG A;  3SAV A;  5F3W A;  4DR7 M;  4B7G A;  1HT2 E;  1NNU C;  3GLI A;  1KYI A;  1TF0 B;  4FWH A;  4GRI A;  1Z6T A;  2Q2E B;  1HJP A;  1E9R A;  2LHC A;  4FVM A;  3L25 A;  2UXD M;  5DYI A;  1ZMU A;  3CF2 A;  2UU9 M;  1OJL A;  4IBJ A;  3GRY A;  3I04 M;  3T6P A;  2KZU A;  2OQ4 A;  2EJS A;  4M0W A;  4G4N A;  1ZV1 A;  2DAG A;  4LRT A;  3KS8 A;  3UGJ A;  1NHG C;  1Z5B A;  1L2C A;  5EP4 A;  3T38 A;  1IBK M;  4RF1 A;  3FYC A;  4IBE A;  1MU5 A;  4WUR A;  1XHB A;  1JR3 D;  4NXN M;  2F5P A;  2A5Y B;  2KEB A;  3IG8 A;  3TWM A;  3CTW B;  4LJ6 A;  3AOG A;  2BJW A;  4DBG B;  5LMU M;  4LF9 M;  2I7P A;  3J7B A;  4D82 A;  1XNQ M;  1D0K A;  3GPX A;  2C5R A;  4HLQ A;  5IT9 S;  4MGI E;  4QHS A;  2L7H A;  4L8R C;  1ORY B;  1TDZ A;  3IG5 A;  2CHG A;  4G4O A;  5FTK A;  3RFW A;  5C18 A;  1G59 A;  2DAM A;  4R71 A;  2WZJ A;  1IN7 A;  2K0B X;  1IXS A;  2KRK A;  5FTM A;  4DV3 M;  2HCB A;  1JQJ C;  3BXW A;  4LZJ A;  1G8P A;  2HKJ A;  2RGH A;  3Q8X A;  4DR1 M;  2DKL A;  1GLN A;  4QOS A;  4II7 A;  1E94 E;  2CFO A;  5JI3 E;  3A46 A;  1C7Y A;  4DR2 M;  2FNA A;  2AHM A; 
#chains in the Genus database with same CATH homology
 2KHH A;  1GO5 A;  1G3I A;  1Y8G A;  1VEJ A;  3FRI A;  3GLG E;  2JUJ A;  3E46 A;  1Q02 A;  2KNV A;  2RRU A;  2R0I A;  1CUK A;  2DAK A;  2JP7 A;  3MMP A;  1G41 A;  1VQ1 A;  2QSF X;  1VDL A;  2HAK A;  1WGN A;  4G3O A;  1AIP C;  2JZ1 A;  1XXH E;  1UFZ A;  1OKS A;  1NV8 A;  2JY7 A;  3GLI E;  1HQY E;  1HT1 E;  2MRO B;  2JZ0 A;  3FE3 A;  4GEW A;  2LVN C;  1OQY A;  2K9D A;  5JI2 E;  2G3Q A;  1OTR A;  1TTE A;  3FRH A;  3LCV B;  2LBC A;  2BWB A;  1YLA A;  1QZE A;  2DAE A;  3F92 A;  1MN3 A;  1XB2 B;  4WP2 A;  4F2L A;  1WJ7 A;  2L4E A;  2DZL A;  1WGL A;  1DO2 A;  1BVS A;  1NV9 A;  2ZTC A;  1DV0 A;  2DAI A;  1A5T A;  2LVQ D;  2MGW A;  2EKF A;  1WR1 B;  1EFU B;  1T6O A;  1P3Q Q;  1SG9 A;  2DNA A;  2H5X A;  2DI0 A;  1IFY A;  2HWJ A;  2LTU A;  1T43 A;  2CWB A;  3BBZ A;  1V92 A;  1VEG A;  2MR9 A;  3LCU A;  2OOA A;  2QNJ A;  1HT2 E;  2JY6 B;  1KYI A;  1OAI A;  2JNH A;  3H4J A;  4F1I A;  1HJP A;  3K9O A;  2LVO C;  1ZMU A;  2L4F A;  3T6P A;  1F4I A;  4Q7J A;  2EJS A;  1WHC A;  1ZV1 A;  2DAG A;  2LVA A;  1JR3 E;  1R4G A;  2DEN A;  2MJ5 B;  2B3T A;  1IM2 A;  1ZMW A;  2QHO B;  1VEK A;  2L2D A;  4HEO A;  5DFL A;  3B89 A;  1TR8 A;  3IHP A;  4UN2 B;  2KNZ A;  2CP8 A;  2OO9 A;  3E21 A;  4DBG B;  2JY8 A;  3GLF E;  2LVP C;  1VG5 A;  1WIV A;  2O25 A;  3K9P A;  1DO0 A;  2EKK A;  3IEC A;  1G4A E;  2ZTD A;  2KNA A;  2DAM A;  4R71 A;  2WZJ A;  3GLH E;  2K0B X;  1IXS A;  2DHY A;  2OOB A;  2DKL A;  1E94 E;  1PGY A;  1ZMV A;  1C7Y A;  2BWE A;  2JY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...