1UFZA

Solution structure of hbs1-like domain in hypothetical protein bab28515
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
GSSGSSGEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein BAB28515
publication title Solution structure of HBS1-like domain in hypothetical protein BAB28515
rcsb
source organism Mus musculus
molecule tags Translation
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ufzA01
2JY5A 1EFUB 3T6PA 1G4AE 2HWJA 2OO9A 3MMPA 3BBZA 4F2LA 1DO2A 1Y8GA 5DFLA 1UFZA 2JZ1A 1ZMVA 1WHCA 3IECA 2JP7A 2KNAA 1PGYA 1JR3E 4DBGB 2DKLA 1T6OA 3GLHE 1OAIA 1NV9A 1WJ7A 1SG9A 1OKSA 1TTEA 2EJSA 2MJ5B 2BWBA 1AIPC 4HEOA 2JNHA 1G3IA 2MROB 2CP8A 2DNAA 1WGLA 1TR8A 1R4GA 2QSFX 3E21A 2DAMA 1A5TA 1XB2B 2BWEA 2KHHA 4UN2B 1T43A 1V92A 1HQYE 2DI0A 3GLIE 2LTUA 3F92A 2G3QA 2DHYA 1VQ1A 3GLFE 2L4FA 1IM2A 2L2DA 1DV0A 5JI2E 1YLAA 1DO0A 2DAEA 1NV8A 4G3OA 2LVOC 1IFYA 1HJPA 1MN3A 1CUKA 3LCVB 1VEKA 2LVAA 4F1IA 3E46A 2B3TA 1VEJA 1ZMWA 2JY6B 2EKFA 2K9DA 3GLGE 1HT2E 1C7YA 1QZEA 4GEWA 2LVNC 3IHPA 1P3QQ 2MGWA 1KYIA 1WR1B 4Q7JA 2LBCA 2QNJA 1HT1E 1OTRA 2JUJA 2MR9A 2OOBA 1XXHE 2ZTDA 3FE3A 2KNZA 2K0BX 1E94E 2R0IA 1BVSA 2EKKA 2ZTCA 3K9OA 3LCUA 1GO5A 2DAKA 3FRHA 3H4JA 2KNVA 2DAGA 2HAKA 2DAIA 1ZMUA 3B89A 2JY7A 1WIVA 4WP2A 2L4EA 2CWBA 2DENA 2O25A 4R71A 1G41A 2LVPC 2WZJA 3FRIA 2OOAA 1WGNA 2H5XA 2RRUA 1ZV1A 1IXSA 2QHOB 1Q02A 1VEGA 2JY8A 1VDLA 2JZ0A 2LVQD 1VG5A 2DZLA 3K9PA 1OQYA 1F4IA
chains in the Genus database with same CATH superfamily
1W5TA 2G8LA 2Z4SA 3ZCBB 3U6OA 3A45A 1G4AE 3KOZE 4GIPA 2HWJA 3UJNA 4DR4M 3BBZA 1VDDA 4KLNA 1J5EM 4LJ4A 4F2LA 2Y0QA 1IN8A 4KO8A 5DFLA 3U6PA 4B3SM 4MM3B 3FUVA 1ZMVA 3IECA 2UU9M 3PNVA 5DYGA 2Z3XA 3TWLA 1LV7A 4Y28F 1PGYA 3RGSA 1NV9A 4X66M 2C5RA 3R9XB 3GLGA 1G8PA 3SBJA 4DUZM 8CATA 3DFZA 1G3IA 3HGIA 1G59A 2MROB 2K47A 3FTDA 3GQ5A 1HNXM 4QHTA 5IT9S 1XXHA 3CF2A 3ZC7B 3DZDA 2QSFX 3E21A 1X37A 2NQ8C 3PFIA 3KW6A 1A5TA 4GH9A 2DVWB 1V92A 7CATA 4ZPXA 4K0KM 3MHVC 4IBFA 4G4OA 1HQYE 2DI0A 2KW0A 4GITA 3GLIE 1SXJB 2LTUA 1IBLM 3T38A 4B3MM 3SATA 4AW4A 2KZUA 2LHCA 4MB7A 3BOSA 1IY2A 3VFDA 4M0WA 4DV6M 3U6EA 2WSEF 4DV0M 1DGFA 2HCBA 4KODA 1DO0A 2MH8A 2DAEA 5EQTA 3GPPA 3AV0A 4FCVA 4LF5M 4DV2M 4B3RM 1N36M 3GQ3A 3FUTA 4YY3M 3D8BA 1SXJC 1PM5A 3E46A 3FTCA 2D7EA 2ZANA 3GPXA 5FSWA 2J5YA 3B74A 1N75A 2K9DA 3GLGE 4IBJA 1HT2E 3QYBA 2R18A 2F5NA 3I4VA 1QZEA 3W67A 4DUYM 2XFTA 4L78A 4BBAA 2DHRA 2C9OA 3KFUG 1P3QQ 2MGWA 4MGHA 4GRIA 1Z6TA 5KQ8A 1PJQA 1DGGA 1HT1E 3FE3A 3HJ8A 4AG6A 1XXHE 2JXNA 3T15A 1ZQ9A 3I51A 2F5PA 2QZ4A 4M9ZA 3K9OA 3C3EA 2L7IA 1PJIA 2FOIC 1ORYB 3OTOM 3AOGA 4JI3M 4LJ7A 3H4JA 4P17A 3A46A 4XBOA 1EE8A 4X64M 2R4EA 3Q8XA 5EXSA 3IG5A 1Z5BA 5ITXA 1QZMA 3VK8A 1TH3A 3SAVA 4WP2A 4IBCA 4PDGA 4LF9M 2FE8A 4R71A 4JI4M 5LMNM 1Q3BA 5L8RF 1PJSA 5GKNA 2LVPC 3FUXA 2L09A 3WHLA 4QOSA 4GC5A 2QP9X 4QHSA 2DZNB 2H5XA 4YHHM 1NHGC 2QHOB 1Q02A 3TQSA 3LVWA 2J7NA 3UZUA 2AHMA 3GLFA 3FYCA 4DV7M 4DR6M 4KHPM 3VLFB 1DGHA 4LRSA 2XZUA 1EFUB 4RNAA 3HU1A 3VDPA 3KS4A 4ITQA 1GKIA 1OFIA 2D7HA 3VK7A 3WHKA 1E9RA 1YE9A 4OVZB 1K82A 2EO2A 4LJAA 4JXJA 1IBKM 1TH4A 1UFZA 3K8ZA 3LW5F 5BPVA 3J7AS 2RKOA 4FWGA 2JP7A 2KNAA 2YFQA 3AOEC 4LF6M 1L8QA 4DBGB 2DKLA 1T6OA 2YQZA 5EXPA 2VIIA 3HX3A 1SG9A 3GLGB 4CGYB 1XNQM 1OKSA 1TTEA 2Y21A 2EJSA 4M9XA 4X65M 4HLQA 3GLIA 2DWNA 2BWBA 1J7KA 2VDBB 3SMSA 4HEOA 4B7HA 2R44A 3L28A 1OFHA 2VF8A 3K1JA 4NOOB 1DGBA 3AJIB 1GVNA 5ITXE 2CP8A 2DNAA 4NRWA 1R2YA 1XXHB 2XGNA 1XNRM 1TF0B 4AG5A 4LF8M 1TR8A 3RE8A 4OW0A 4AKIA 4DV3M 4S12A 2CV0A 4AKHA 2Z7JA 3J80S 3SYLA 3I4YA 1XWIA 3SARA 4DV5M 3GPUA 3C3DA 3AKZA 3KXEC 1QVRA 5IZ7D 1D0LA 2ZBKB 3F92A 2G3QA 2I7PA 3HJQA 5EP1A 5EXTA 2BJWA 1VQ1A 2CHGA 2FNAA 4ANRA 4TUWA 3GLFE 4IJEA 1IM2A 4CHTB 3W0LB 1RU3A 4PD2A 5FLXS 1YLAA 4I4LA 5C18A 3FTFA 3KP0E 1PJJA 2L7HA 3U60A 4G3OA 2LVOC 4JI0M 4I81A 1HJPA 2UUBM 2F4VM 1CUKA 3R8FA 2DZOB 2Z4RA 1W5SA 2LVAA 3THGA 4F1IA 3UK6A 3RFWA 3KSXA 2DXIA 4CJ6A 1N33M 3HY5A 2DWZB 4XGIA 2CFOA 2J7OA 3DOAA 4GHAA 1PRBA 1GJTA 1V33A 3U61B 1HNWM 3T1HM 4Q7JA 2H1RA 1N32M 1NNJA 3U6DA 2QNJA 1WXQA 2OOBA 4IBIA 2ZTDA 2LXEA 2MR9A 4D82A 2QBYA 3SASA 4II7A 3U6QA 1IN5A 2FS1A 1GLNA 4PCZA 3GO8A 3U6CA 4Z6YA 1FJGM 1QAQA 2EUCA 2BNKA 4RF1A 2GNOA 2DWMA 1FNNA 4LJ5A 4D81A 1QANA 3QYEA 2DAGA 4A3VB 4LJ9A 2V6ZM 2DAIA 2XLJA 4JI2M 2WSCF 4WW0A 2O25A 4Z8XA 4NRVA 2R65A 4LRTA 1G41A 5E6JA 5C1BA 2KRKA 3LMMA 1UM8A 2I7NA 1TH2A 1WGNA 1XHBA 3T1YM 1GJSA 2RGHA 1ZV1A 2O01F 1QUSA 1NJGA 2KZSA 2JY8A 2HKJA 3C9PA 1QAOA 4NSRA 2C99A 2JZ0A 3W0FA 4MGZE 4JV5M 1G71A 3JAMS 3B7QA 3K9PA 1K3WA 2WSFF 3NWLA 1IXZA 5IWAM 3JR4A 2CV1A 1DGHB 1F4IA 1L2BA 1NVMA 2C98A 4FCWA 2HHHM 4FVMA 1NO1A 5EP3A 3MMPA 2CHVA 2KDLA 1E9SA 4G4NA 2V1CA 4GMQA 4LFAM 2JZ1A 2M60A 1TGUA 2YR0A 3KOWE 1NSFA 3SMPA 2JA2A 3SAUA 4LZJA 5ITTA 3HHXA 3U6MA 4RF0A 3NBIA 1R7RA 1OAIA 1Q3CA 4IBDA 4QNMA 2R6FA 3TPZA 4QNRA 3RGPA 3GLIB 2MJ5B 1NY6A 4X62M 4REZA 1R2ZA 4AZFA 2F5QA 2KXEA 3TL4X 4DV4M 3E4RA 4IBKA 2CRUA 1WGLA 2JWSA 1R4GA 3SHFA 1HR0M 4R3DA 5ITRA 1NY5A 3KVWA 2EA0A 1T3TA 3J7BA 2R4JA 2E5LM 2KHHA 5ITYA 3L27A 1L2DA 2G5GX 4HL4A 4I8OA 3QWLA 4IJFA 4AQYM 3H4MA 1E32A 2FFJA 4DR5M 2DHYA 2QCUA 2CE7A 2Y0TA 1IY1A 5EJCA 3U6LA 3PNYA 1LTMA 3GRYA 4NL4H 5JI2E 4GKJM 4DR1M 3U60B 1JQJC 2X8AA 2CHQA 4MGIE 3M0EA 3EIEA 4M9SA 3L29A 5KO3A 4AKGA 2ZAMA 4OX9M 1XMOM 3U5ZA 2DWLA 1VEKA 3QAUA 4BLCA 1D0KA 4MH0E 3C58A 2B3TA 2JY6B 1ZMWA 5F3WA 2F5SA 2EKFA 3KOYE 1N78A 4DV1M 4PT5A 4DR2M 1IQPA 3EIHA 4FWHA 1NNUC 1C7YA 1GL6A 4OU7A 1D0MA 1YSYA 2LVNC 3IHPA 4WURA 3K2LA 3PVSA 1WR1B 3TE6A 2R45A 2KEBA 3PXGA 4G4QA 2VQFM 2QBYB 1OTRA 2JUJA 4FD2A 3ZH9B 2XH9A 3UGJA 3SAWA 2XF3A 5ITUA 4JI1M 2K0BX 1YUBA 1E94E 2EKKA 1JR3A 4LF7M 3GLHA 1QAMA 2OPFA 3ILKA 3LVVA 3FD9A 2LNHC 1MJGM 3ZQJA 4GC9A 3MJ5A 1HNZM 2HAKA 1I4WA 1NJFA 2QENA 3B9PA 4OVZA 3HKPA 4JI6M 1PJTA 2ERCA 2R46A 3TWKA 3B89A 5DYIA 2JY7A 3VKGA 1WIVA 5JI3E 2CWBA 3J27B 1Z5AA 4L8RC 1L2CA 3E9SA 3FUUA 1QUTA 2XFSA 3FRIA 4D80A 4JYAM 3HZJA 1IXSA 4JI7M 5A2QS 1VDLA 2N35A 3I01M 1I94M 3KS8A 1H6UA 1VG5A 2DZLA 1Q39A 5EP2A 2XZFA 4IBEA 2JY5A 4JI5M 2X4AA 3T6PA 1OAOC 3VKHA 2OO9A 3CF0A 3GRUA 1KSFX 2KA6B 4NXNM 4DR3M 1TDHA 2GQFA 5H37D 1DO2A 1Y8GA 3BXWA 4NC6A 5FTLA 5BR8M 1WHCA 1AUAA 3UMMA 1QQWA 4MGYE 4CISA 2O5RA 5KPTA 4G4RA 1JB0F 2FH0A 4B7FA 3GP1A 1JR3E 5FTNA 2XSZD 3L2AA 4LGYA 3GLHE 4W5WA 1IN7A 1WJ7A 1J09A 1JR3D 3I04M 4DR7M 4LY6A 2ZAOA 1IY0A 3HHWA 2QPAA 3FUWA 3GPYA 1AIPC 2V1UA 2JNHA 4GHLA 3D8LA 2APLA 1S3SA 4QOZC 4JI8M 3GLFB 2BJVA 5IREB 3SYKA 5KQDA 2UUAM 2R62A 1L1ZA 1IN6A 2RGOA 3CF6E 1MU5A 2Y20A 1V34A 2DAMA 4B3TM 3HHYA 1OIZA 1XB2B 4LCBA 2BWEA 4RKUF 4UN2B 4L15A 4PDIA 1T43A 3M7GA 1TDZA 2W82A 2VQEM 2QQ8A 2LWXA 3AFHA 3A98B 2UXDM 1SXJA 3CGWA 3VDUA 4LG2A 3U61A 4B7GA 2LHGA 1IXRC 3U6SA 1Z59A 4GKKM 3LQRA 2OQ4A 1OJLA 4XK8F 2L4FA 4IIWA 2ZM6M 2CEAA 3HWSA 2L2DA 1K3XA 3CTWB 2UXCM 1DV0A 2C9CA 1R6BX 3GRRA 1L1TA 2UUCM 4NXMM 2UXBM 1NV8A 3DA1A 1IFYA 5ITQA 3FTEA 1MN3A 5FTKA 1XC8A 3KDSE 1HQCA 3LCVB 3U5ZB 4LF4M 3TWMA 1NHWC 2M5ZA 4FWDA 4G6ZA 3SC3A 1D2NA 1VEJA 2P5TA 3HU2A 4FCTA 5LMUM 1C1KA 1QDRA 2A5YB 4I5SA 4M0DA 4KT0F 3MK6A 4LZZA 2CUZA 4IBBA 3KSJA 4L6V6 4MGKE 2K6BA 4GEWA 1N34M 3L26A 2C96A 4LJ8A 5KPZA 1KYIA 4IBGA 1GL7A 2LBCA 2Z8YM 4R7GA 1MX0A 3A42A 1R5LA 1QYRA 4B08A 2L6OA 2KNZA 4AI6A 2LH0A 3V76A 3J81S 3GQ4A 2CV2A 5E26A 2R0IA 1BVSA 4LFBM 1ZAEA 3LQQA 2ZTCA 5DNYA 3K92A 3GLHB 3B7NA 3LCUA 2DAKA 1GO5A 1QDTA 3FRHA 3SHGB 4JN6A 2KNVA 1SXJE 3HU3A 1N77A 1OIPA 3GRVA 1SXJD 3J2PB 3FKEA 1ZMUA 1KFVA 3NBXX 1IBMM 3AL0C 4CIZA 1IN4A 3B7ZA 3HJSA 2L4EA 4NSOB 4L4UA 2KRUA 3W68A 2DENA 4BB9A 2F5OA 3L25A 4P16A 3JR5A 3Q8GA 2HL7A 2WZJA 2D7GA 5KPRA 3SFZA 2OOAA 4FW9A 2X49A 3FYDA 4LJ6A 4EIWA 1EIJA 4L16A 3KOXE 2RRUA 1IXSB 3M6AA 5FTMA 1VEGA 3AOEA 3IG8A 5EP4A 2XSZA 5EXXA 2VF7A 4LFCM 1GABA 2LVQD 3HHZA 1XMQM 1OQYA 2YNMD 2Q2EB 2XEPA 5FTJA 1Z5CA 3KP1E 4LGMA
chains in the Genus database with same CATH topology
2JY5A 1EFUB 3T6PA 1G4AE 2HWJA 2OO9A 3MMPA 3BBZA 4F2LA 1DO2A 1Y8GA 5DFLA 1UFZA 2JZ1A 1ZMVA 1WHCA 3IECA 2JP7A 2KNAA 1PGYA 1JR3E 4DBGB 2DKLA 1T6OA 3GLHE 1OAIA 1NV9A 1WJ7A 1SG9A 1OKSA 1TTEA 2EJSA 2MJ5B 2BWBA 1AIPC 4HEOA 2JNHA 1G3IA 2MROB 2CP8A 2DNAA 1WGLA 1TR8A 1R4GA 2QSFX 3E21A 2DAMA 1A5TA 1XB2B 2BWEA 2KHHA 4UN2B 1T43A 1V92A 1HQYE 2DI0A 3GLIE 2LTUA 3F92A 2G3QA 2DHYA 1VQ1A 3GLFE 2L4FA 1IM2A 2L2DA 1DV0A 5JI2E 1YLAA 1DO0A 2DAEA 1NV8A 4G3OA 2LVOC 1IFYA 1HJPA 1MN3A 1CUKA 3LCVB 1VEKA 2LVAA 4F1IA 3E46A 2B3TA 1VEJA 1ZMWA 2JY6B 2EKFA 2K9DA 3GLGE 1HT2E 1C7YA 1QZEA 4GEWA 2LVNC 3IHPA 1P3QQ 2MGWA 1KYIA 1WR1B 4Q7JA 2LBCA 2QNJA 1HT1E 1OTRA 2JUJA 2MR9A 2OOBA 1XXHE 2ZTDA 3FE3A 2KNZA 2K0BX 1E94E 2R0IA 1BVSA 2EKKA 2ZTCA 3K9OA 3LCUA 1GO5A 2DAKA 3FRHA 3H4JA 2KNVA 2DAGA 2HAKA 2DAIA 1ZMUA 3B89A 2JY7A 1WIVA 4WP2A 2L4EA 2CWBA 2DENA 2O25A 4R71A 1G41A 2LVPC 2WZJA 3FRIA 2OOAA 1WGNA 2H5XA 2RRUA 1ZV1A 1IXSA 2QHOB 1Q02A 1VEGA 2JY8A 1VDLA 2JZ0A 2LVQD 1VG5A 2DZLA 3K9PA 1OQYA 1F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY5 A;  1EFU B;  3T6P A;  1G4A E;  2HWJ A;  2OO9 A;  3MMP A;  3BBZ A;  4F2L A;  1DO2 A;  1Y8G A;  5DFL A;  1UFZ A;  2JZ1 A;  1ZMV A;  1WHC A;  3IEC A;  2JP7 A;  2KNA A;  1PGY A;  1JR3 E;  4DBG B;  2DKL A;  1T6O A;  3GLH E;  1OAI A;  1NV9 A;  1WJ7 A;  1SG9 A;  1OKS A;  1TTE A;  2EJS A;  2MJ5 B;  2BWB A;  1AIP C;  4HEO A;  2JNH A;  1G3I A;  2MRO B;  2CP8 A;  2DNA A;  1WGL A;  1TR8 A;  1R4G A;  2QSF X;  3E21 A;  2DAM A;  1A5T A;  1XB2 B;  2BWE A;  2KHH A;  4UN2 B;  1T43 A;  1V92 A;  1HQY E;  2DI0 A;  3GLI E;  2LTU A;  3F92 A;  2G3Q A;  2DHY A;  1VQ1 A;  3GLF E;  2L4F A;  1IM2 A;  2L2D A;  1DV0 A;  5JI2 E;  1YLA A;  1DO0 A;  2DAE A;  1NV8 A;  4G3O A;  2LVO C;  1IFY A;  1HJP A;  1MN3 A;  1CUK A;  3LCV B;  1VEK A;  2LVA A;  4F1I A;  3E46 A;  2B3T A;  1VEJ A;  1ZMW A;  2JY6 B;  2EKF A;  2K9D A;  3GLG E;  1HT2 E;  1C7Y A;  1QZE A;  4GEW A;  2LVN C;  3IHP A;  1P3Q Q;  2MGW A;  1KYI A;  1WR1 B;  4Q7J A;  2LBC A;  2QNJ A;  1HT1 E;  1OTR A;  2JUJ A;  2MR9 A;  2OOB A;  1XXH E;  2ZTD A;  3FE3 A;  2KNZ A;  2K0B X;  1E94 E;  2R0I A;  1BVS A;  2EKK A;  2ZTC A;  3K9O A;  3LCU A;  1GO5 A;  2DAK A;  3FRH A;  3H4J A;  2KNV A;  2DAG A;  2HAK A;  2DAI A;  1ZMU A;  3B89 A;  2JY7 A;  1WIV A;  4WP2 A;  2L4E A;  2CWB A;  2DEN A;  2O25 A;  4R71 A;  1G41 A;  2LVP C;  2WZJ A;  3FRI A;  2OOA A;  1WGN A;  2H5X A;  2RRU A;  1ZV1 A;  1IXS A;  2QHO B;  1Q02 A;  1VEG A;  2JY8 A;  1VDL A;  2JZ0 A;  2LVQ D;  1VG5 A;  2DZL A;  3K9P A;  1OQY A;  1F4I A; 
#chains in the Genus database with same CATH topology
 1W5T A;  2G8L A;  2Z4S A;  3ZCB B;  3U6O A;  3A45 A;  1G4A E;  3KOZ E;  4GIP A;  2HWJ A;  3UJN A;  4DR4 M;  3BBZ A;  1VDD A;  4KLN A;  1J5E M;  4LJ4 A;  4F2L A;  2Y0Q A;  1IN8 A;  4KO8 A;  5DFL A;  3U6P A;  4B3S M;  4MM3 B;  3FUV A;  1ZMV A;  3IEC A;  2UU9 M;  3PNV A;  5DYG A;  2Z3X A;  3TWL A;  1LV7 A;  4Y28 F;  1PGY A;  3RGS A;  1NV9 A;  4X66 M;  2C5R A;  3R9X B;  3GLG A;  1G8P A;  3SBJ A;  4DUZ M;  8CAT A;  3DFZ A;  1G3I A;  3HGI A;  1G59 A;  2MRO B;  2K47 A;  3FTD A;  3GQ5 A;  1HNX M;  4QHT A;  5IT9 S;  1XXH A;  3CF2 A;  3ZC7 B;  3DZD A;  2QSF X;  3E21 A;  1X37 A;  2NQ8 C;  3PFI A;  3KW6 A;  1A5T A;  4GH9 A;  2DVW B;  1V92 A;  7CAT A;  4ZPX A;  4K0K M;  3MHV C;  4IBF A;  4G4O A;  1HQY E;  2DI0 A;  2KW0 A;  4GIT A;  3GLI E;  1SXJ B;  2LTU A;  1IBL M;  3T38 A;  4B3M M;  3SAT A;  4AW4 A;  2KZU A;  2LHC A;  4MB7 A;  3BOS A;  1IY2 A;  3VFD A;  4M0W A;  4DV6 M;  3U6E A;  2WSE F;  4DV0 M;  1DGF A;  2HCB A;  4KOD A;  1DO0 A;  2MH8 A;  2DAE A;  5EQT A;  3GPP A;  3AV0 A;  4FCV A;  4LF5 M;  4DV2 M;  4B3R M;  1N36 M;  3GQ3 A;  3FUT A;  4YY3 M;  3D8B A;  1SXJ C;  1PM5 A;  3E46 A;  3FTC A;  2D7E A;  2ZAN A;  3GPX A;  5FSW A;  2J5Y A;  3B74 A;  1N75 A;  2K9D A;  3GLG E;  4IBJ A;  1HT2 E;  3QYB A;  2R18 A;  2F5N A;  3I4V A;  1QZE A;  3W67 A;  4DUY M;  2XFT A;  4L78 A;  4BBA A;  2DHR A;  2C9O A;  3KFU G;  1P3Q Q;  2MGW A;  4MGH A;  4GRI A;  1Z6T A;  5KQ8 A;  1PJQ A;  1DGG A;  1HT1 E;  3FE3 A;  3HJ8 A;  4AG6 A;  1XXH E;  2JXN A;  3T15 A;  1ZQ9 A;  3I51 A;  2F5P A;  2QZ4 A;  4M9Z A;  3K9O A;  3C3E A;  2L7I A;  1PJI A;  2FOI C;  1ORY B;  3OTO M;  3AOG A;  4JI3 M;  4LJ7 A;  3H4J A;  4P17 A;  3A46 A;  4XBO A;  1EE8 A;  4X64 M;  2R4E A;  3Q8X A;  5EXS A;  3IG5 A;  1Z5B A;  5ITX A;  1QZM A;  3VK8 A;  1TH3 A;  3SAV A;  4WP2 A;  4IBC A;  4PDG A;  4LF9 M;  2FE8 A;  4R71 A;  4JI4 M;  5LMN M;  1Q3B A;  5L8R F;  1PJS A;  5GKN A;  2LVP C;  3FUX A;  2L09 A;  3WHL A;  4QOS A;  4GC5 A;  2QP9 X;  4QHS A;  2DZN B;  2H5X A;  4YHH M;  1NHG C;  2QHO B;  1Q02 A;  3TQS A;  3LVW A;  2J7N A;  3UZU A;  2AHM A;  3GLF A;  3FYC A;  4DV7 M;  4DR6 M;  4KHP M;  3VLF B;  1DGH A;  4LRS A;  2XZU A;  1EFU B;  4RNA A;  3HU1 A;  3VDP A;  3KS4 A;  4ITQ A;  1GKI A;  1OFI A;  2D7H A;  3VK7 A;  3WHK A;  1E9R A;  1YE9 A;  4OVZ B;  1K82 A;  2EO2 A;  4LJA A;  4JXJ A;  1IBK M;  1TH4 A;  1UFZ A;  3K8Z A;  3LW5 F;  5BPV A;  3J7A S;  2RKO A;  4FWG A;  2JP7 A;  2KNA A;  2YFQ A;  3AOE C;  4LF6 M;  1L8Q A;  4DBG B;  2DKL A;  1T6O A;  2YQZ A;  5EXP A;  2VII A;  3HX3 A;  1SG9 A;  3GLG B;  4CGY B;  1XNQ M;  1OKS A;  1TTE A;  2Y21 A;  2EJS A;  4M9X A;  4X65 M;  4HLQ A;  3GLI A;  2DWN A;  2BWB A;  1J7K A;  2VDB B;  3SMS A;  4HEO A;  4B7H A;  2R44 A;  3L28 A;  1OFH A;  2VF8 A;  3K1J A;  4NOO B;  1DGB A;  3AJI B;  1GVN A;  5ITX E;  2CP8 A;  2DNA A;  4NRW A;  1R2Y A;  1XXH B;  2XGN A;  1XNR M;  1TF0 B;  4AG5 A;  4LF8 M;  1TR8 A;  3RE8 A;  4OW0 A;  4AKI A;  4DV3 M;  4S12 A;  2CV0 A;  4AKH A;  2Z7J A;  3J80 S;  3SYL A;  3I4Y A;  1XWI A;  3SAR A;  4DV5 M;  3GPU A;  3C3D A;  3AKZ A;  3KXE C;  1QVR A;  5IZ7 D;  1D0L A;  2ZBK B;  3F92 A;  2G3Q A;  2I7P A;  3HJQ A;  5EP1 A;  5EXT A;  2BJW A;  1VQ1 A;  2CHG A;  2FNA A;  4ANR A;  4TUW A;  3GLF E;  4IJE A;  1IM2 A;  4CHT B;  3W0L B;  1RU3 A;  4PD2 A;  5FLX S;  1YLA A;  4I4L A;  5C18 A;  3FTF A;  3KP0 E;  1PJJ A;  2L7H A;  3U60 A;  4G3O A;  2LVO C;  4JI0 M;  4I81 A;  1HJP A;  2UUB M;  2F4V M;  1CUK A;  3R8F A;  2DZO B;  2Z4R A;  1W5S A;  2LVA A;  3THG A;  4F1I A;  3UK6 A;  3RFW A;  3KSX A;  2DXI A;  4CJ6 A;  1N33 M;  3HY5 A;  2DWZ B;  4XGI A;  2CFO A;  2J7O A;  3DOA A;  4GHA A;  1PRB A;  1GJT A;  1V33 A;  3U61 B;  1HNW M;  3T1H M;  4Q7J A;  2H1R A;  1N32 M;  1NNJ A;  3U6D A;  2QNJ A;  1WXQ A;  2OOB A;  4IBI A;  2ZTD A;  2LXE A;  2MR9 A;  4D82 A;  2QBY A;  3SAS A;  4II7 A;  3U6Q A;  1IN5 A;  2FS1 A;  1GLN A;  4PCZ A;  3GO8 A;  3U6C A;  4Z6Y A;  1FJG M;  1QAQ A;  2EUC A;  2BNK A;  4RF1 A;  2GNO A;  2DWM A;  1FNN A;  4LJ5 A;  4D81 A;  1QAN A;  3QYE A;  2DAG A;  4A3V B;  4LJ9 A;  2V6Z M;  2DAI A;  2XLJ A;  4JI2 M;  2WSC F;  4WW0 A;  2O25 A;  4Z8X A;  4NRV A;  2R65 A;  4LRT A;  1G41 A;  5E6J A;  5C1B A;  2KRK A;  3LMM A;  1UM8 A;  2I7N A;  1TH2 A;  1WGN A;  1XHB A;  3T1Y M;  1GJS A;  2RGH A;  1ZV1 A;  2O01 F;  1QUS A;  1NJG A;  2KZS A;  2JY8 A;  2HKJ A;  3C9P A;  1QAO A;  4NSR A;  2C99 A;  2JZ0 A;  3W0F A;  4MGZ E;  4JV5 M;  1G71 A;  3JAM S;  3B7Q A;  3K9P A;  1K3W A;  2WSF F;  3NWL A;  1IXZ A;  5IWA M;  3JR4 A;  2CV1 A;  1DGH B;  1F4I A;  1L2B A;  1NVM A;  2C98 A;  4FCW A;  2HHH M;  4FVM A;  1NO1 A;  5EP3 A;  3MMP A;  2CHV A;  2KDL A;  1E9S A;  4G4N A;  2V1C A;  4GMQ A;  4LFA M;  2JZ1 A;  2M60 A;  1TGU A;  2YR0 A;  3KOW E;  1NSF A;  3SMP A;  2JA2 A;  3SAU A;  4LZJ A;  5ITT A;  3HHX A;  3U6M A;  4RF0 A;  3NBI A;  1R7R A;  1OAI A;  1Q3C A;  4IBD A;  4QNM A;  2R6F A;  3TPZ A;  4QNR A;  3RGP A;  3GLI B;  2MJ5 B;  1NY6 A;  4X62 M;  4REZ A;  1R2Z A;  4AZF A;  2F5Q A;  2KXE A;  3TL4 X;  4DV4 M;  3E4R A;  4IBK A;  2CRU A;  1WGL A;  2JWS A;  1R4G A;  3SHF A;  1HR0 M;  4R3D A;  5ITR A;  1NY5 A;  3KVW A;  2EA0 A;  1T3T A;  3J7B A;  2R4J A;  2E5L M;  2KHH A;  5ITY A;  3L27 A;  1L2D A;  2G5G X;  4HL4 A;  4I8O A;  3QWL A;  4IJF A;  4AQY M;  3H4M A;  1E32 A;  2FFJ A;  4DR5 M;  2DHY A;  2QCU A;  2CE7 A;  2Y0T A;  1IY1 A;  5EJC A;  3U6L A;  3PNY A;  1LTM A;  3GRY A;  4NL4 H;  5JI2 E;  4GKJ M;  4DR1 M;  3U60 B;  1JQJ C;  2X8A A;  2CHQ A;  4MGI E;  3M0E A;  3EIE A;  4M9S A;  3L29 A;  5KO3 A;  4AKG A;  2ZAM A;  4OX9 M;  1XMO M;  3U5Z A;  2DWL A;  1VEK A;  3QAU A;  4BLC A;  1D0K A;  4MH0 E;  3C58 A;  2B3T A;  2JY6 B;  1ZMW A;  5F3W A;  2F5S A;  2EKF A;  3KOY E;  1N78 A;  4DV1 M;  4PT5 A;  4DR2 M;  1IQP A;  3EIH A;  4FWH A;  1NNU C;  1C7Y A;  1GL6 A;  4OU7 A;  1D0M A;  1YSY A;  2LVN C;  3IHP A;  4WUR A;  3K2L A;  3PVS A;  1WR1 B;  3TE6 A;  2R45 A;  2KEB A;  3PXG A;  4G4Q A;  2VQF M;  2QBY B;  1OTR A;  2JUJ A;  4FD2 A;  3ZH9 B;  2XH9 A;  3UGJ A;  3SAW A;  2XF3 A;  5ITU A;  4JI1 M;  2K0B X;  1YUB A;  1E94 E;  2EKK A;  1JR3 A;  4LF7 M;  3GLH A;  1QAM A;  2OPF A;  3ILK A;  3LVV A;  3FD9 A;  2LNH C;  1MJG M;  3ZQJ A;  4GC9 A;  3MJ5 A;  1HNZ M;  2HAK A;  1I4W A;  1NJF A;  2QEN A;  3B9P A;  4OVZ A;  3HKP A;  4JI6 M;  1PJT A;  2ERC A;  2R46 A;  3TWK A;  3B89 A;  5DYI A;  2JY7 A;  3VKG A;  1WIV A;  5JI3 E;  2CWB A;  3J27 B;  1Z5A A;  4L8R C;  1L2C A;  3E9S A;  3FUU A;  1QUT A;  2XFS A;  3FRI A;  4D80 A;  4JYA M;  3HZJ A;  1IXS A;  4JI7 M;  5A2Q S;  1VDL A;  2N35 A;  3I01 M;  1I94 M;  3KS8 A;  1H6U A;  1VG5 A;  2DZL A;  1Q39 A;  5EP2 A;  2XZF A;  4IBE A;  2JY5 A;  4JI5 M;  2X4A A;  3T6P A;  1OAO C;  3VKH A;  2OO9 A;  3CF0 A;  3GRU A;  1KSF X;  2KA6 B;  4NXN M;  4DR3 M;  1TDH A;  2GQF A;  5H37 D;  1DO2 A;  1Y8G A;  3BXW A;  4NC6 A;  5FTL A;  5BR8 M;  1WHC A;  1AUA A;  3UMM A;  1QQW A;  4MGY E;  4CIS A;  2O5R A;  5KPT A;  4G4R A;  1JB0 F;  2FH0 A;  4B7F A;  3GP1 A;  1JR3 E;  5FTN A;  2XSZ D;  3L2A A;  4LGY A;  3GLH E;  4W5W A;  1IN7 A;  1WJ7 A;  1J09 A;  1JR3 D;  3I04 M;  4DR7 M;  4LY6 A;  2ZAO A;  1IY0 A;  3HHW A;  2QPA A;  3FUW A;  3GPY A;  1AIP C;  2V1U A;  2JNH A;  4GHL A;  3D8L A;  2APL A;  1S3S A;  4QOZ C;  4JI8 M;  3GLF B;  2BJV A;  5IRE B;  3SYK A;  5KQD A;  2UUA M;  2R62 A;  1L1Z A;  1IN6 A;  2RGO A;  3CF6 E;  1MU5 A;  2Y20 A;  1V34 A;  2DAM A;  4B3T M;  3HHY A;  1OIZ A;  1XB2 B;  4LCB A;  2BWE A;  4RKU F;  4UN2 B;  4L15 A;  4PDI A;  1T43 A;  3M7G A;  1TDZ A;  2W82 A;  2VQE M;  2QQ8 A;  2LWX A;  3AFH A;  3A98 B;  2UXD M;  1SXJ A;  3CGW A;  3VDU A;  4LG2 A;  3U61 A;  4B7G A;  2LHG A;  1IXR C;  3U6S A;  1Z59 A;  4GKK M;  3LQR A;  2OQ4 A;  1OJL A;  4XK8 F;  2L4F A;  4IIW A;  2ZM6 M;  2CEA A;  3HWS A;  2L2D A;  1K3X A;  3CTW B;  2UXC M;  1DV0 A;  2C9C A;  1R6B X;  3GRR A;  1L1T A;  2UUC M;  4NXM M;  2UXB M;  1NV8 A;  3DA1 A;  1IFY A;  5ITQ A;  3FTE A;  1MN3 A;  5FTK A;  1XC8 A;  3KDS E;  1HQC A;  3LCV B;  3U5Z B;  4LF4 M;  3TWM A;  1NHW C;  2M5Z A;  4FWD A;  4G6Z A;  3SC3 A;  1D2N A;  1VEJ A;  2P5T A;  3HU2 A;  4FCT A;  5LMU M;  1C1K A;  1QDR A;  2A5Y B;  4I5S A;  4M0D A;  4KT0 F;  3MK6 A;  4LZZ A;  2CUZ A;  4IBB A;  3KSJ A;  4L6V 6;  4MGK E;  2K6B A;  4GEW A;  1N34 M;  3L26 A;  2C96 A;  4LJ8 A;  5KPZ A;  1KYI A;  4IBG A;  1GL7 A;  2LBC A;  2Z8Y M;  4R7G A;  1MX0 A;  3A42 A;  1R5L A;  1QYR A;  4B08 A;  2L6O A;  2KNZ A;  4AI6 A;  2LH0 A;  3V76 A;  3J81 S;  3GQ4 A;  2CV2 A;  5E26 A;  2R0I A;  1BVS A;  4LFB M;  1ZAE A;  3LQQ A;  2ZTC A;  5DNY A;  3K92 A;  3GLH B;  3B7N A;  3LCU A;  2DAK A;  1GO5 A;  1QDT A;  3FRH A;  3SHG B;  4JN6 A;  2KNV A;  1SXJ E;  3HU3 A;  1N77 A;  1OIP A;  3GRV A;  1SXJ D;  3J2P B;  3FKE A;  1ZMU A;  1KFV A;  3NBX X;  1IBM M;  3AL0 C;  4CIZ A;  1IN4 A;  3B7Z A;  3HJS A;  2L4E A;  4NSO B;  4L4U A;  2KRU A;  3W68 A;  2DEN A;  4BB9 A;  2F5O A;  3L25 A;  4P16 A;  3JR5 A;  3Q8G A;  2HL7 A;  2WZJ A;  2D7G A;  5KPR A;  3SFZ A;  2OOA A;  4FW9 A;  2X49 A;  3FYD A;  4LJ6 A;  4EIW A;  1EIJ A;  4L16 A;  3KOX E;  2RRU A;  1IXS B;  3M6A A;  5FTM A;  1VEG A;  3AOE A;  3IG8 A;  5EP4 A;  2XSZ A;  5EXX A;  2VF7 A;  4LFC M;  1GAB A;  2LVQ D;  3HHZ A;  1XMQ M;  1OQY A;  2YNM D;  2Q2E B;  2XEP A;  5FTJ A;  1Z5C A;  3KP1 E;  4LGM A; 
#chains in the Genus database with same CATH homology
 2JY5 A;  1EFU B;  3T6P A;  1G4A E;  2HWJ A;  2OO9 A;  3MMP A;  3BBZ A;  4F2L A;  1DO2 A;  1Y8G A;  5DFL A;  1UFZ A;  2JZ1 A;  1ZMV A;  1WHC A;  3IEC A;  2JP7 A;  2KNA A;  1PGY A;  1JR3 E;  4DBG B;  2DKL A;  1T6O A;  3GLH E;  1OAI A;  1NV9 A;  1WJ7 A;  1SG9 A;  1OKS A;  1TTE A;  2EJS A;  2MJ5 B;  2BWB A;  1AIP C;  4HEO A;  2JNH A;  1G3I A;  2MRO B;  2CP8 A;  2DNA A;  1WGL A;  1TR8 A;  1R4G A;  2QSF X;  3E21 A;  2DAM A;  1A5T A;  1XB2 B;  2BWE A;  2KHH A;  4UN2 B;  1T43 A;  1V92 A;  1HQY E;  2DI0 A;  3GLI E;  2LTU A;  3F92 A;  2G3Q A;  2DHY A;  1VQ1 A;  3GLF E;  2L4F A;  1IM2 A;  2L2D A;  1DV0 A;  5JI2 E;  1YLA A;  1DO0 A;  2DAE A;  1NV8 A;  4G3O A;  2LVO C;  1IFY A;  1HJP A;  1MN3 A;  1CUK A;  3LCV B;  1VEK A;  2LVA A;  4F1I A;  3E46 A;  2B3T A;  1VEJ A;  1ZMW A;  2JY6 B;  2EKF A;  2K9D A;  3GLG E;  1HT2 E;  1C7Y A;  1QZE A;  4GEW A;  2LVN C;  3IHP A;  1P3Q Q;  2MGW A;  1KYI A;  1WR1 B;  4Q7J A;  2LBC A;  2QNJ A;  1HT1 E;  1OTR A;  2JUJ A;  2MR9 A;  2OOB A;  1XXH E;  2ZTD A;  3FE3 A;  2KNZ A;  2K0B X;  1E94 E;  2R0I A;  1BVS A;  2EKK A;  2ZTC A;  3K9O A;  3LCU A;  1GO5 A;  2DAK A;  3FRH A;  3H4J A;  2KNV A;  2DAG A;  2HAK A;  2DAI A;  1ZMU A;  3B89 A;  2JY7 A;  1WIV A;  4WP2 A;  2L4E A;  2CWB A;  2DEN A;  2O25 A;  4R71 A;  1G41 A;  2LVP C;  2WZJ A;  3FRI A;  2OOA A;  1WGN A;  2H5X A;  2RRU A;  1ZV1 A;  1IXS A;  2QHO B;  1Q02 A;  1VEG A;  2JY8 A;  1VDL A;  2JZ0 A;  2LVQ D;  1VG5 A;  2DZL A;  3K9P A;  1OQY A;  1F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...