1XNQM

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnqM02
4YHHM 4JYAM 3C58A 4JV5M 1MU5A 2Q2EB 1PJIA 2F4VM 4NRWA 5ITXE 1MX0A 4PDIA 4PD2A 3GQ3A 4G4NA 4LF9M 3J81S 1J5EM 1Z59A 4NRVA 1IBKM 1N34M 4JI0M 4LF5M 3SARA 2E5LM 3J80S 2VQFM 4G4OA 1L1TA 4NXMM 4GKJM 4DUZM 4MB7A 3GO8A 3U6LA 4B3TM 1HNXM 3U6EA 3SBJA 5A2QS 4LF7M 3U6PA 1XNRM 4X66M 5FLXS 3T1HM 4DV4M 4LF4M 4KHPM 3U6CA 3SAWA 4B3MM 2UXDM 4DV6M 2XZFA 4DV0M 4DV3M 4B3SM 4JI5M 3SAVA 3SATA 4DR6M 4DR4M 2HHHM 3DOAA 3A45A 4X65M 1EE8A 4DR5M 4GKKM 1N36M 1FJGM 4LF8M 4CISA 4JI3M 5BR8M 3GPYA 4DV2M 1L1ZA 4AQYM 4JI8M 5ITYA 3U6QA 4ITQA 5ITQA 4DV1M 3U6MA 3TWKA 1Q3BA 2F5PA 4JI7M 4DR7M 3GPUA 5ITUA 4G4RA 1HNZM 4NXNM 1K3WA 4JI4M 1L2BA 5ITXA 2OPFA 3JR4A 3VK7A 4K0KM 4DV5M 1TDZA 1KFVA 1N32M 1XC8A 4DR1M 2ZM6M 3TWLA 1Q3CA 2VQEM 4G4QA 2F5SA 2UUBM 1TDHA 3GQ5A 3SASA 3J7AS 4PDGA 3U6DA 1XMOM 1XMQM 1IBLM 1L2CA 1Q39A 3A42A 4DUYM 1K82A 4PCZA 1L2DA 4YY3M 2UUCM 3JAMS 4OX9M 1Z5CA 5ITRA 1XNQM 1Z5BA 3T1YM 2HKJA 3JR5A 1PM5A 3GP1A 4DR2M 1Z5AA 1R2ZA 4LF6M 2UXCM 3OTOM 1R2YA 1I94M 5IT9S 2ZBKB 4JI1M 4X64M 2XZUA 3W0FA 2F5OA 3GPPA 5LMUM 5LMNM 4LFCM 4X62M 1N33M 3A46A 3GPXA 5IWAM 2UUAM 3GQ4A 3U6OA 1HNWM 2F5QA 4B3RM 4LFAM 1NNJA 5ITTA 4DV7M 2F5NA 4JI2M 1HR0M 2UXBM 3SAUA 1K3XA 4DR3M 1PJJA 1IBMM 2EA0A 2UU9M 3U6SA 4LFBM 2OQ4A 3VK8A 3TWMA 4JI6M
chains in the Genus database with same CATH superfamily
4XK8F 3D8LA 1OFHA 1CUKA 2JY8A 1T6OA 2V1CA 3GLHA 1QAQA 3HY5A 4RF1A 5EXPA 2MR9A 1AUAA 4D81A 4PDIA 5H37D 5DYGA 3T15A 1YUBA 2HAKA 2JP7A 4LF9M 1GABA 2DWNA 1NJFA 3HJQA 3IG8A 1Z59A 1IBKM 4JN6A 3FTEA 3LCUA 1MN3A 1VEKA 2DNAA 4A3VB 4IBJA 3WHKA 3ZH9B 1QUTA 3J80S 3SYKA 2KDLA 2N35A 4NXMM 4GKJM 3GLIE 2FNAA 3HHWA 1QDRA 3HJ8A 3W0LB 4F2LA 3CTWB 4IBKA 1JR3A 3HU2A 3NWLA 3GO8A 2D7HA 1VQ1A 1GVNA 2QBYB 1R5LA 3U6EA 3SBJA 1WJ7A 3SYLA 3MHVC 5KPRA 1ZQ9A 2LVPC 3FD9A 2J5YA 3RE8A 3GLGA 3U6PA 3LCVB 1XNRM 2C98A 2XFSA 1D0MA 4KHPM 2JY7A 3U60B 3K1JA 3MMPA 2QENA 5DYIA 3L27A 2Y20A 4RF0A 4JI5M 1G41A 4DR6M 3FTFA 2HHHM 2ZAOA 3A45A 1WGNA 3B9PA 4DR5M 4GKKM 2LVQD 3R9XB 4CHTB 1GKIA 4MH0E 2R65A 4XGIA 4AZFA 2CP8A 2K0BX 2KW0A 3AOGA 1NNUC 3KP1E 5BR8M 3MK6A 1JQJC 1PGYA 2O01F 4I5SA 3LVVA 3GPYA 4FWGA 3KOYE 4ITQA 3HHXA 3B74A 5EQTA 2FE8A 4CGYB 4JI7M 3PXGA 3KS4A 2EKFA 1HNZM 1HQYE 4NXNM 1EIJA 2BWEA 1K3WA 3SMSA 4LG2A 2VDBB 3IG5A 1L2BA 5ITXA 1E32A 2L7IA 3JR4A 3WHLA 1QZMA 3EIEA 5FTJA 4Z6YA 3HU1A 1KFVA 1XC8A 2ZM6M 1Q3CA 2DZNB 2I7NA 2WSEF 2XSZA 1IXRC 2X8AA 4PDGA 1JB0F 1L8QA 1NVMA 5FTLA 1QYRA 1XMOM 3KOXE 4G6ZA 1IBLM 3CF6E 3R8FA 1DGFA 1DO0A 2UUCM 2MJ5B 1YE9A 1GLNA 2J7NA 1Z5BA 4IBBA 4MGZE 2HKJA 3FRIA 2GNOA 3KVWA 1QUSA 3NBIA 3U61B 3THGA 2Z8YM 2Y21A 2XZUA 4S12A 1SG9A 2QNJA 4LFCM 3U61A 1BVSA 1SXJA 4L6V6 4NOOB 1DV0A 3U5ZA 3GQ4A 4GC5A 1HNWM 5FTKA 3UK6A 1NNJA 2CE7A 2KXEA 4DV7M 1R4GA 3DFZA 2Y0QA 4JI2M 3TWMA 4B7FA 2UXBM 4ZPXA 2CRUA 1OJLA 2GQFA 2R46A 1IBMM 1WIVA 2G8LA 2XLJA 3FTDA 1DGHB 5DFLA 4GIPA 3KFUG 4LRTA 4JI6M 3LQQA 4YHHM 1S3SA 1G8PA 1MU5A 1IN8A 3TPZA 8CATA 2L7HA 3A98B 4NRWA 3QWLA 1MX0A 4WURA 2YNMD 2VIIA 4PD2A 3HX3A 4R7GA 3QYBA 4G4NA 4AKIA 1WR1B 1QQWA 4MGYE 1W5TA 3SHGB 1LTMA 2R4EA 4AG6A 3SARA 2CV2A 2DAEA 3J7BA 3KOWE 2C5RA 4KODA 2E5LM 2EJSA 2ZTDA 4LY6A 4OVZB 4I8OA 4MB7A 2CV1A 1AIPC 2QPAA 3KXEC 4B3TM 4LJ8A 2R44A 1W5SA 2AHMA 2KNAA 5A2QS 4L8RC 1V92A 1IN4A 3B7QA 3BBZA 1IFYA 4X66M 4R3DA 2LHGA 1P3QQ 2FFJA 1WGLA 2XH9A 1J7KA 1MJGM 5JI3E 2R18A 4LF4M 3U6CA 3ILKA 4IJFA 1QVRA 2DHYA 2XZFA 4DBGB 1X37A 2JWSA 1XXHB 5JI2E 2R45A 3M6AA 2DAIA 4DR4M 2CEAA 1EFUB 4BBAA 4X65M 1XXHA 4AKGA 2KRUA 3RGPA 3MJ5A 4FCVA 1SXJC 2O5RA 2MGWA 4QNRA 3SHFA 2KA6B 1VEJA 4CJ6A 2YR0A 3I01M 4IBCA 4Z8XA 1OIPA 4JI3M 2DVWB 3KSXA 2MROB 1L1ZA 2JZ0A 4AI6A 1G71A 1KYIA 1XWIA 3U6QA 2LNHC 1OTRA 1PJTA 2QSFX 5ITQA 4DV1M 2QBYA 1TTEA 2EUCA 3I4YA 3TWKA 2DWZB 4GC9A 3ZQJA 5FSWA 3L2AA 3TE6A 4R71A 3GPUA 2F5PA 3U60A 4IBEA 2V6ZM 3LMMA 1XHBA 2ZTCA 3B7ZA 3KOZE 3ZCBB 2JY6B 1LV7A 4XBOA 1N32M 5FTMA 2LVAA 2X49A 2KZUA 1HQCA 2ZANA 3UGJA 4DR1M 3VLFB 2HCBA 2RGHA 4W5WA 2VQEM 2DAKA 3M7GA 4M9ZA 3GQ5A 2LVOC 2UUBM 4REZA 2BJWA 3GLIB 3FTCA 5C18A 3H4JA 5EP4A 1L2CA 3K9PA 3PFIA 3FKEA 3QAUA 4GEWA 5KPZA 1OAIA 4PCZA 3KDSE 5FTNA 3GLIA 3JAMS 1NV8A 1Z5CA 3J27B 4II7A 1E9SA 5ITRA 1V33A 4LCBA 3UMMA 3GP1A 4DR2M 2UXCM 3VKGA 3E46A 3L28A 3SC3A 1WHCA 1N77A 1ZMUA 1TF0B 4IBFA 3GPPA 1TH2A 5LMNM 3CF0A 3A46A 1GL7A 3FYDA 1IQPA 4OU7A 1HT1E 1VDLA 5ITTA 3HJSA 4TUWA 2H5XA 3SAUA 3VFDA 1K3XA 4DR3M 2Z3XA 5KO3A 4QOSA 1PJJA 3T38A 2EA0A 2UU9M 2G3QA 3LQRA 4I4LA 2CHVA 1VEGA 3W67A 3U6SA 2RGOA 4QOZC 3L25A 2XGNA 2CV0A 3C58A 2ERCA 4JV5M 3Q8XA 4LJAA 2Q2EB 3IECA 3K8ZA 1PJIA 1QZEA 2F4VM 1A5TA 5EP3A 1C1KA 1GJTA 2M60A 7CATA 3EIHA 4KT0F 2QCUA 3AV0A 4KLNA 1NJGA 2FS1A 4KO8A 3J81S 2DHRA 2K9DA 1NY6A 2LVNC 3FUTA 4PT5A 2YQZA 4JI0M 4LF5M 2L09A 4FVMA 2VQFM 1ZAEA 3E9SA 1NHGC 4F1IA 2EO2A 4DUZM 2KRKA 4RKUF 3U6LA 1PJQA 2BWBA 2QHOB 3LW5F 1HNXM 3L29A 4NSOB 1ZV1A 4GH9A 2HWJA 3FUWA 1DGHA 3T1HM 1GO5A 1ZMWA 3AJIB 4IBDA 2DAGA 5F3WA 2DKLA 2C96A 1G3IA 3SAWA 5EJCA 4GHAA 4B3MM 3GLFE 2OOAA 4DV6M 2UXDM 4DV3M 4GITA 4B3SM 4FWDA 4AG5A 3PNYA 1WXQA 2JXNA 3DZDA 3SAVA 3SATA 4OW0A 1R7RA 2L4EA 1D2NA 4WP2A 1EE8A 3GRYA 1IY2A 4I81A 4ANRA 2BJVA 2JUJA 2KZSA 4IIWA 4HL4A 3L26A 1QAOA 1ZMVA 3GLHE 2D7GA 2XFTA 4CISA 2XF3A 3F92A 1N78A 2R4JA 4M0WA 2B3TA 3FUVA 4OVZA 1DGBA 4DV2M 4AQYM 4JI8M 3PNVA 3HGIA 5E26A 2Z4RA 5ITYA 1VG5A 3SFZA 4M9XA 1NSFA 1Z6TA 3M0EA 1IXZA 1Q3BA 2I7PA 1YSYA 4G4RA 2LH0A 1C7YA 3V76A 3T6PA 5L8RF 1TH3A 2JY5A 3VK7A 4NSRA 4QHTA 3IHPA 3KW6A 3PVSA 1OAOC 3UJNA 2XEPA 1JR3E 3AOEA 3SASA 4HEOA 4G4QA 3C9PA 5EXXA 4LRSA 3GLGE 2KNVA 3U6DA 2W82A 3CGWA 2WSFF 2A5YB 2FOIC 3GLHB 1GL6A 3HKPA 4GRIA 3HHYA 1XMQM 2DXIA 4AKHA 2MH8A 3A42A 1QDTA 3I04M 4LGMA 1N75A 4YY3M 1L2DA 1G59A 1DO2A 1XNQM 2LTUA 1JR3D 3E21A 3T1YM 4M9SA 4BB9A 2Y0TA 3B7NA 3JR5A 1R2ZA 4LF6M 2EKKA 3VDUA 3W68A 3OTOM 1G4AE 1KSFX 2KEBA 2ZBKB 2CFOA 4GMQA 2F5OA 2O25A 5LMUM 5IREB 3RGSA 4L78A 5IWAM 3GPXA 4LJ7A 5EP1A 2UUAM 1HJPA 1GJSA 3CF2A 2F5QA 3GRUA 4B3RM 4LFAM 5BPVA 1HT2E 2JNHA 4FWHA 1TGUA 2F5NA 5IZ7D 1D0LA 3Q8GA 4IJEA 2P5TA 3GLGB 2H1RA 2OQ4A 4MGHA 3VK8A 4LF7M 3NBXX 1ORYB 1F4IA 2C9OA 2CHGA 4D80A 2VF8A 5KPTA 1IN6A 1PRBA 4JYAM 1VDDA 4MGKE 1NO1A 2J7OA 2RKOA 3DA1A 4HLQA 1PJSA 5ITXE 2LBCA 5KQDA 4QNMA 4GHLA 4LJ4A 3GQ3A 3HHZA 1QANA 2X4AA 1UFZA 4FCWA 2APLA 4IBGA 2DWLA 3C3DA 2HL7A 2V1UA 1J5EM 4NRVA 2Z7JA 1XB2B 2FH0A 1N34M 4LZJA 5EXSA 2G5GX 2CHQA 3D8BA 2DI0A 4NL4H 2DWMA 4G4OA 2DENA 1L1TA 1NHWC 2KNZA 1UM8A 4L16A 3AOEC 3K92A 3BXWA 3GRRA 3LVWA 5DNYA 5KQ8A 2XSZD 3UZUA 3SMPA 3VDPA 3AKZA 2KHHA 4P16A 5FLXS 2CWBA 4DV4M 1OQYA 1SXJE 3C3EA 5EXTA 2M5ZA 3QYEA 3RFWA 3ZC7B 2BNKA 4DV0M 5E6JA 2C99A 2DAMA 2QZ4A 1OFIA 4UN2B 2C9CA 3FRHA 3DOAA 1I4WA 2JA2A 4MM3B 1SXJD 1TR8A 4AW4A 3TQSA 3AL0C 1D0KA 4IBIA 1N36M 2OO9A 1FJGM 4LGYA 2D7EA 4CIZA 2JZ1A 2YFQA 4LF8M 5C1BA 1E94E 1QAMA 2R0IA 3FUUA 1OIZA 2R62A 1IM2A 2Z4SA 1IN7A 3KSJA 2VF7A 1J09A 3U6MA 1SXJB 4BLCA 3U5ZB 4Y28F 4DR7M 2OOBA 4FW9A 4LJ9A 4MGIE 5GKNA 5ITUA 2L6OA 2QP9X 1Y8GA 4LJ6A 4JI4M 1R6BX 3K2LA 1V34A 4LJ5A 4QHSA 2OPFA 2WSCF 1OKSA 2DZLA 3H4MA 4K0KM 4DV5M 3B89A 1TDZA 1T43A 1IY1A 2LHCA 3KP0E 1Q02A 2ZAMA 3TWLA 2F5SA 3J7AS 5EP2A 1TDHA 2K47A 4L4UA 3I51A 3HWSA 1NV9A 2L4FA 1Q39A 4FD2A 4EIWA 3FUXA 4DUYM 4D82A 1K82A 4OX9M 3AFHA 2QQ8A 3FYCA 4G3OA 4L15A 2RRUA 4NC6A 2LXEA 4LZZA 1FNNA 2NQ8C 1PM5A 1Z5AA 3KS8A 1R2YA 4WW0A 1IXSB 4B7HA 1I94M 5IT9S 4JI1M 3K9OA 1E9RA 1DGGA 4X64M 1NY5A 1XXHE 2L2DA 1IN5A 3W0FA 3GLFB 3TL4X 2DZOB 4X62M 1IXSA 3GRVA 4JXJA 1N33M 4M0DA 2WZJA 4B08A 3GLFA 2LWXA 4B7GA 3U6OA 3BOSA 1IY0A 4Q7JA 4FCTA 2K6BA 3J2PB 1H6UA 1HR0M 2CUZA 2R6FA 1YLAA 3FE3A 4RNAA 3I4VA 3HU3A 3VKHA 4P17A 1T3TA 1TH4A 3E4RA 3HZJA 4LFBM 1RU3A
chains in the Genus database with same CATH topology
3D8LA 1OFHA 2V1CA 3GLHA 1QAQA 4RF1A 5EXPA 4D81A 4PDIA 5H37D 5DYGA 3T15A 1YUBA 4LF9M 2DWNA 1NJFA 3HJQA 3IG8A 1Z59A 1IBKM 4JN6A 3FTEA 4A3VB 4IBJA 3WHKA 3ZH9B 3J80S 3SYKA 4NXMM 4GKJM 2FNAA 3HHWA 3W0LB 3HJ8A 3CTWB 4IBKA 1JR3A 3HU2A 3NWLA 3GO8A 2D7HA 1GVNA 2QBYB 3U6EA 3SBJA 3SYLA 3MHVC 5KPRA 1ZQ9A 3FD9A 3RE8A 3GLGA 3U6PA 1XNRM 2C98A 2XFSA 4KHPM 3U60B 3K1JA 2QENA 5DYIA 3L27A 2Y20A 4RF0A 4JI5M 1G41A 4DR6M 3FTFA 2HHHM 2ZAOA 3A45A 3B9PA 4DR5M 4GKKM 3R9XB 4CHTB 1GKIA 4MH0E 2R65A 4XGIA 4AZFA 2KW0A 3AOGA 1NNUC 3KP1E 5BR8M 3MK6A 1JQJC 4I5SA 3LVVA 3GPYA 4FWGA 3KOYE 4ITQA 3HHXA 5EQTA 2FE8A 4CGYB 4JI7M 3PXGA 3KS4A 1HNZM 1HQYE 4NXNM 1K3WA 3SMSA 4LG2A 3IG5A 1L2BA 5ITXA 1E32A 2L7IA 3JR4A 3WHLA 1QZMA 3EIEA 5FTJA 4Z6YA 3HU1A 1KFVA 1XC8A 2ZM6M 1Q3CA 2DZNB 2I7NA 2XSZA 1IXRC 2X8AA 4PDGA 5FTLA 1L8QA 1NVMA 1QYRA 1XMOM 3KOXE 4G6ZA 1IBLM 3CF6E 3R8FA 1DGFA 1DO0A 2UUCM 1YE9A 1GLNA 2J7NA 1Z5BA 4IBBA 4MGZE 2HKJA 3KVWA 3NBIA 3U61B 3THGA 2Y21A 2XZUA 4S12A 4LFCM 3U61A 1SXJA 4NOOB 3U5ZA 3GQ4A 4GC5A 1HNWM 5FTKA 3UK6A 1NNJA 2CE7A 2KXEA 4DV7M 3DFZA 2Y0QA 4JI2M 4B7FA 2UXBM 4ZPXA 2R46A 1OJLA 1IBMM 2G8LA 2XLJA 3FTDA 1DGHB 3KFUG 4GIPA 4LRTA 4JI6M 3LQQA 4YHHM 1S3SA 1G8PA 1MU5A 1IN8A 3TPZA 8CATA 2L7HA 3A98B 4NRWA 3QWLA 1MX0A 4WURA 2YNMD 2VIIA 4PD2A 4R7GA 4G4NA 4AKIA 1QQWA 4MGYE 1W5TA 3SHGB 2R4EA 4AG6A 3SARA 2CV2A 2E5LM 3J7BA 3KOWE 2C5RA 4KODA 4LY6A 4OVZB 4I8OA 4MB7A 2CV1A 2QPAA 3KXEC 4B3TM 4LJ8A 1W5SA 2AHMA 5A2QS 4L8RC 1IN4A 4X66M 4R3DA 2XH9A 2FFJA 1J7KA 5JI3E 2R18A 4LF4M 3U6CA 3ILKA 4IJFA 1QVRA 2XZFA 1X37A 1XXHB 5JI2E 2R45A 3M6AA 4DR4M 2CEAA 4BBAA 4X65M 1XXHA 4AKGA 2KRUA 3RGPA 3MJ5A 4FCVA 1SXJC 2O5RA 4QNRA 3SHFA 2KA6B 2YR0A 4IBCA 4Z8XA 4JI3M 2DVWB 3KSXA 1L1ZA 4AI6A 1KYIA 1XWIA 3U6QA 2LNHC 5ITQA 4DV1M 2QBYA 2EUCA 3I4YA 3TWKA 2DWZB 4GC9A 5FSWA 3GPUA 3L2AA 3TE6A 2F5PA 3U60A 4IBEA 2V6ZM 3LMMA 1XHBA 3KOZE 3ZCBB 1LV7A 4XBOA 1N32M 5FTMA 2X49A 2KZUA 1HQCA 2ZANA 3UGJA 4DR1M 3VLFB 2HCBA 2RGHA 4W5WA 2VQEM 3M7GA 4M9ZA 2UUBM 3GQ5A 4REZA 2BJWA 3GLIB 3FTCA 5C18A 5EP4A 1L2CA 3PFIA 3QAUA 3FKEA 5KPZA 3GLIA 4PCZA 3KDSE 5FTNA 3JAMS 1Z5CA 3J27B 4II7A 1E9SA 5ITRA 4LCBA 3UMMA 3GP1A 4DR2M 2UXCM 3VKGA 3L28A 3SC3A 1N77A 4IBFA 3GPPA 1TH2A 5LMNM 3CF0A 3A46A 1GL7A 3FYDA 1IQPA 4OU7A 1HT1E 5ITTA 3HJSA 4TUWA 3SAUA 3VFDA 1K3XA 4DR3M 2Z3XA 5KO3A 4QOSA 1PJJA 3T38A 2EA0A 2UU9M 3LQRA 3U6SA 4I4LA 2CHVA 2RGOA 4QOZC 3L25A 2XGNA 2CV0A 3C58A 2ERCA 4JV5M 3Q8XA 4LJAA 2Q2EB 3K8ZA 1PJIA 2F4VM 5EP3A 1C1KA 2M60A 7CATA 3EIHA 2QCUA 3AV0A 4KLNA 1NJGA 4KO8A 3J81S 2DHRA 1NY6A 3FUTA 4PT5A 2YQZA 4JI0M 4LF5M 2L09A 4FVMA 2VQFM 1ZAEA 3E9SA 1NHGC 2EO2A 4DUZM 2KRKA 3U6LA 1HNXM 3L29A 4NSOB 4GH9A 3FUWA 1DGHA 3T1HM 3AJIB 4IBDA 5F3WA 2C96A 1G3IA 3SAWA 5EJCA 4GHAA 4B3MM 2UXDM 4DV6M 4DV3M 4GITA 4B3SM 4FWDA 4AG5A 3PNYA 1WXQA 3DZDA 3SAVA 3SATA 4OW0A 1R7RA 1D2NA 1EE8A 3GRYA 1IY2A 4I81A 2BJVA 4IIWA 2KZSA 4HL4A 3L26A 1QAOA 2D7GA 2XFTA 4CISA 2XF3A 1N78A 2R4JA 4M0WA 4OVZA 3FUVA 1DGBA 4DV2M 4AQYM 4JI8M 3PNVA 3HGIA 5E26A 2Z4RA 5ITYA 3SFZA 4M9XA 1NSFA 1Z6TA 3M0EA 1IXZA 1Q3BA 2I7PA 1YSYA 4G4RA 2LH0A 1TH3A 3VK7A 4NSRA 4QHTA 3KW6A 3PVSA 3UJNA 2XEPA 3AOEA 3SASA 4G4QA 5EXXA 4LRSA 3U6DA 2W82A 3HKPA 2A5YB 2FOIC 3GLHB 1GL6A 4GRIA 3HHYA 1XMQM 2DXIA 4AKHA 3A42A 4LGMA 1L2DA 1N75A 4YY3M 1XNQM 1G59A 1DO2A 1JR3D 3T1YM 4M9SA 4BB9A 2Y0TA 3JR5A 1R2ZA 4LF6M 3VDUA 3OTOM 1G4AE 1KSFX 2KEBA 2ZBKB 2CFOA 4GMQA 2F5OA 5LMUM 5IREB 3RGSA 4L78A 5IWAM 3GPXA 4LJ7A 5EP1A 2UUAM 3CF2A 2F5QA 3GRUA 4B3RM 4LFAM 5BPVA 1HT2E 4FWHA 1TGUA 2F5NA 5IZ7D 4IJEA 2P5TA 3GLGB 2H1RA 2OQ4A 4MGHA 3VK8A 4LF7M 1ORYB 2C9OA 2CHGA 4D80A 5KPTA 1IN6A 4JYAM 1VDDA 4MGKE 2J7OA 2RKOA 3DA1A 4HLQA 5ITXE 5KQDA 4QNMA 4GHLA 4LJ4A 3GQ3A 3HHZA 1QANA 2X4AA 4IBGA 4FCWA 2DWLA 2V1UA 2HL7A 1J5EM 4NRVA 2Z7JA 1N34M 4LZJA 5EXSA 2G5GX 2CHQA 3D8BA 4NL4H 2DWMA 4G4OA 1L1TA 1NHWC 1UM8A 4L16A 3AOEC 3K92A 3GRRA 3LVWA 5DNYA 5KQ8A 2XSZD 3UZUA 3SMPA 3VDPA 3AKZA 4P16A 5FLXS 4DV4M 1SXJE 5EXTA 2M5ZA 3RFWA 3ZC7B 2BNKA 4DV0M 5E6JA 2C99A 2QZ4A 1OFIA 2C9CA 3DOAA 1I4WA 2JA2A 4MM3B 1SXJD 4AW4A 3AL0C 3TQSA 4IBIA 1N36M 1FJGM 4LGYA 2D7EA 2YFQA 4LF8M 5C1BA 1E94E 1QAMA 3FUUA 2R62A 1IM2A 2Z4SA 1IN7A 3KSJA 1J09A 3U6MA 1SXJB 4BLCA 3U5ZB 4DR7M 4FW9A 4LJ9A 4MGIE 5GKNA 5ITUA 2L6OA 2QP9X 4LJ6A 4JI4M 1R6BX 3K2LA 4QHSA 4LJ5A 2OPFA 3H4MA 4K0KM 4DV5M 1TDZA 1IY1A 3KP0E 2ZAMA 3TWLA 2F5SA 3J7AS 5EP2A 1TDHA 2K47A 4L4UA 3I51A 3HWSA 4EIWA 1Q39A 4FD2A 3FUXA 4DUYM 4D82A 1K82A 4OX9M 3AFHA 3FYCA 4L15A 2LXEA 4LZZA 1FNNA 2NQ8C 1PM5A 1Z5AA 3KS8A 1R2YA 4WW0A 1IXSB 4B7HA 1I94M 5IT9S 4JI1M 1E9RA 1DGGA 4X64M 1NY5A 3W0FA 1IN5A 3GLFB 3TL4X 2DZOB 4X62M 4JXJA 3GRVA 1N33M 4M0DA 4B08A 3U6OA 3GLFA 2LWXA 4B7GA 3BOSA 1IY0A 4FCTA 3J2PB 1H6UA 1HR0M 2CUZA 4RNAA 3VKHA 3I4VA 3HU3A 1T3TA 1TH4A 3E4RA 4LFBM 3TWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH M;  4JYA M;  3C58 A;  4JV5 M;  1MU5 A;  2Q2E B;  1PJI A;  2F4V M;  4NRW A;  5ITX E;  1MX0 A;  4PDI A;  4PD2 A;  3GQ3 A;  4G4N A;  4LF9 M;  3J81 S;  1J5E M;  1Z59 A;  4NRV A;  1IBK M;  1N34 M;  4JI0 M;  4LF5 M;  3SAR A;  2E5L M;  3J80 S;  2VQF M;  4G4O A;  1L1T A;  4NXM M;  4GKJ M;  4DUZ M;  4MB7 A;  3GO8 A;  3U6L A;  4B3T M;  1HNX M;  3U6E A;  3SBJ A;  5A2Q S;  4LF7 M;  3U6P A;  1XNR M;  4X66 M;  5FLX S;  3T1H M;  4DV4 M;  4LF4 M;  4KHP M;  3U6C A;  3SAW A;  4B3M M;  2UXD M;  4DV6 M;  2XZF A;  4DV0 M;  4DV3 M;  4B3S M;  4JI5 M;  3SAV A;  3SAT A;  4DR6 M;  4DR4 M;  2HHH M;  3DOA A;  3A45 A;  4X65 M;  1EE8 A;  4DR5 M;  4GKK M;  1N36 M;  1FJG M;  4LF8 M;  4CIS A;  4JI3 M;  5BR8 M;  3GPY A;  4DV2 M;  1L1Z A;  4AQY M;  4JI8 M;  5ITY A;  3U6Q A;  4ITQ A;  5ITQ A;  4DV1 M;  3U6M A;  3TWK A;  1Q3B A;  2F5P A;  4JI7 M;  4DR7 M;  3GPU A;  5ITU A;  4G4R A;  1HNZ M;  4NXN M;  1K3W A;  4JI4 M;  1L2B A;  5ITX A;  2OPF A;  3JR4 A;  3VK7 A;  4K0K M;  4DV5 M;  1TDZ A;  1KFV A;  1N32 M;  1XC8 A;  4DR1 M;  2ZM6 M;  3TWL A;  1Q3C A;  2VQE M;  4G4Q A;  2F5S A;  2UUB M;  1TDH A;  3GQ5 A;  3SAS A;  3J7A S;  4PDG A;  3U6D A;  1XMO M;  1XMQ M;  1IBL M;  1L2C A;  1Q39 A;  3A42 A;  4DUY M;  1K82 A;  4PCZ A;  1L2D A;  4YY3 M;  2UUC M;  3JAM S;  4OX9 M;  1Z5C A;  5ITR A;  1XNQ M;  1Z5B A;  3T1Y M;  2HKJ A;  3JR5 A;  1PM5 A;  3GP1 A;  4DR2 M;  1Z5A A;  1R2Z A;  4LF6 M;  2UXC M;  3OTO M;  1R2Y A;  1I94 M;  5IT9 S;  2ZBK B;  4JI1 M;  4X64 M;  2XZU A;  3W0F A;  2F5O A;  3GPP A;  5LMU M;  5LMN M;  4LFC M;  4X62 M;  1N33 M;  3A46 A;  3GPX A;  5IWA M;  2UUA M;  3GQ4 A;  3U6O A;  1HNW M;  2F5Q A;  4B3R M;  4LFA M;  1NNJ A;  5ITT A;  4DV7 M;  2F5N A;  4JI2 M;  1HR0 M;  2UXB M;  3SAU A;  1K3X A;  4DR3 M;  1PJJ A;  1IBM M;  2EA0 A;  2UU9 M;  3U6S A;  4LFB M;  2OQ4 A;  3VK8 A;  3TWM A;  4JI6 M; 
#chains in the Genus database with same CATH topology
 4XK8 F;  3D8L A;  1OFH A;  1CUK A;  2JY8 A;  1T6O A;  2V1C A;  3GLH A;  1QAQ A;  3HY5 A;  4RF1 A;  5EXP A;  2MR9 A;  1AUA A;  4D81 A;  4PDI A;  5H37 D;  5DYG A;  3T15 A;  1YUB A;  2HAK A;  2JP7 A;  4LF9 M;  1GAB A;  2DWN A;  1NJF A;  3HJQ A;  3IG8 A;  1Z59 A;  1IBK M;  4JN6 A;  3FTE A;  3LCU A;  1MN3 A;  1VEK A;  2DNA A;  4A3V B;  4IBJ A;  3WHK A;  3ZH9 B;  1QUT A;  3J80 S;  3SYK A;  2KDL A;  2N35 A;  4NXM M;  4GKJ M;  3GLI E;  2FNA A;  3HHW A;  1QDR A;  3HJ8 A;  3W0L B;  4F2L A;  3CTW B;  4IBK A;  1JR3 A;  3HU2 A;  3NWL A;  3GO8 A;  2D7H A;  1VQ1 A;  1GVN A;  2QBY B;  1R5L A;  3U6E A;  3SBJ A;  1WJ7 A;  3SYL A;  3MHV C;  5KPR A;  1ZQ9 A;  2LVP C;  3FD9 A;  2J5Y A;  3RE8 A;  3GLG A;  3U6P A;  3LCV B;  1XNR M;  2C98 A;  2XFS A;  1D0M A;  4KHP M;  2JY7 A;  3U60 B;  3K1J A;  3MMP A;  2QEN A;  5DYI A;  3L27 A;  2Y20 A;  4RF0 A;  4JI5 M;  1G41 A;  4DR6 M;  3FTF A;  2HHH M;  2ZAO A;  3A45 A;  1WGN A;  3B9P A;  4DR5 M;  4GKK M;  2LVQ D;  3R9X B;  4CHT B;  1GKI A;  4MH0 E;  2R65 A;  4XGI A;  4AZF A;  2CP8 A;  2K0B X;  2KW0 A;  3AOG A;  1NNU C;  3KP1 E;  5BR8 M;  3MK6 A;  1JQJ C;  1PGY A;  2O01 F;  4I5S A;  3LVV A;  3GPY A;  4FWG A;  3KOY E;  4ITQ A;  3HHX A;  3B74 A;  5EQT A;  2FE8 A;  4CGY B;  4JI7 M;  3PXG A;  3KS4 A;  2EKF A;  1HNZ M;  1HQY E;  4NXN M;  1EIJ A;  2BWE A;  1K3W A;  3SMS A;  4LG2 A;  2VDB B;  3IG5 A;  1L2B A;  5ITX A;  1E32 A;  2L7I A;  3JR4 A;  3WHL A;  1QZM A;  3EIE A;  5FTJ A;  4Z6Y A;  3HU1 A;  1KFV A;  1XC8 A;  2ZM6 M;  1Q3C A;  2DZN B;  2I7N A;  2WSE F;  2XSZ A;  1IXR C;  2X8A A;  4PDG A;  1JB0 F;  1L8Q A;  1NVM A;  5FTL A;  1QYR A;  1XMO M;  3KOX E;  4G6Z A;  1IBL M;  3CF6 E;  3R8F A;  1DGF A;  1DO0 A;  2UUC M;  2MJ5 B;  1YE9 A;  1GLN A;  2J7N A;  1Z5B A;  4IBB A;  4MGZ E;  2HKJ A;  3FRI A;  2GNO A;  3KVW A;  1QUS A;  3NBI A;  3U61 B;  3THG A;  2Z8Y M;  2Y21 A;  2XZU A;  4S12 A;  1SG9 A;  2QNJ A;  4LFC M;  3U61 A;  1BVS A;  1SXJ A;  4L6V 6;  4NOO B;  1DV0 A;  3U5Z A;  3GQ4 A;  4GC5 A;  1HNW M;  5FTK A;  3UK6 A;  1NNJ A;  2CE7 A;  2KXE A;  4DV7 M;  1R4G A;  3DFZ A;  2Y0Q A;  4JI2 M;  3TWM A;  4B7F A;  2UXB M;  4ZPX A;  2CRU A;  1OJL A;  2GQF A;  2R46 A;  1IBM M;  1WIV A;  2G8L A;  2XLJ A;  3FTD A;  1DGH B;  5DFL A;  4GIP A;  3KFU G;  4LRT A;  4JI6 M;  3LQQ A;  4YHH M;  1S3S A;  1G8P A;  1MU5 A;  1IN8 A;  3TPZ A;  8CAT A;  2L7H A;  3A98 B;  4NRW A;  3QWL A;  1MX0 A;  4WUR A;  2YNM D;  2VII A;  4PD2 A;  3HX3 A;  4R7G A;  3QYB A;  4G4N A;  4AKI A;  1WR1 B;  1QQW A;  4MGY E;  1W5T A;  3SHG B;  1LTM A;  2R4E A;  4AG6 A;  3SAR A;  2CV2 A;  2DAE A;  3J7B A;  3KOW E;  2C5R A;  4KOD A;  2E5L M;  2EJS A;  2ZTD A;  4LY6 A;  4OVZ B;  4I8O A;  4MB7 A;  2CV1 A;  1AIP C;  2QPA A;  3KXE C;  4B3T M;  4LJ8 A;  2R44 A;  1W5S A;  2AHM A;  2KNA A;  5A2Q S;  4L8R C;  1V92 A;  1IN4 A;  3B7Q A;  3BBZ A;  1IFY A;  4X66 M;  4R3D A;  2LHG A;  1P3Q Q;  2FFJ A;  1WGL A;  2XH9 A;  1J7K A;  1MJG M;  5JI3 E;  2R18 A;  4LF4 M;  3U6C A;  3ILK A;  4IJF A;  1QVR A;  2DHY A;  2XZF A;  4DBG B;  1X37 A;  2JWS A;  1XXH B;  5JI2 E;  2R45 A;  3M6A A;  2DAI A;  4DR4 M;  2CEA A;  1EFU B;  4BBA A;  4X65 M;  1XXH A;  4AKG A;  2KRU A;  3RGP A;  3MJ5 A;  4FCV A;  1SXJ C;  2O5R A;  2MGW A;  4QNR A;  3SHF A;  2KA6 B;  1VEJ A;  4CJ6 A;  2YR0 A;  3I01 M;  4IBC A;  4Z8X A;  1OIP A;  4JI3 M;  2DVW B;  3KSX A;  2MRO B;  1L1Z A;  2JZ0 A;  4AI6 A;  1G71 A;  1KYI A;  1XWI A;  3U6Q A;  2LNH C;  1OTR A;  1PJT A;  2QSF X;  5ITQ A;  4DV1 M;  2QBY A;  1TTE A;  2EUC A;  3I4Y A;  3TWK A;  2DWZ B;  4GC9 A;  3ZQJ A;  5FSW A;  3L2A A;  3TE6 A;  4R71 A;  3GPU A;  2F5P A;  3U60 A;  4IBE A;  2V6Z M;  3LMM A;  1XHB A;  2ZTC A;  3B7Z A;  3KOZ E;  3ZCB B;  2JY6 B;  1LV7 A;  4XBO A;  1N32 M;  5FTM A;  2LVA A;  2X49 A;  2KZU A;  1HQC A;  2ZAN A;  3UGJ A;  4DR1 M;  3VLF B;  2HCB A;  2RGH A;  4W5W A;  2VQE M;  2DAK A;  3M7G A;  4M9Z A;  3GQ5 A;  2LVO C;  2UUB M;  4REZ A;  2BJW A;  3GLI B;  3FTC A;  5C18 A;  3H4J A;  5EP4 A;  1L2C A;  3K9P A;  3PFI A;  3FKE A;  3QAU A;  4GEW A;  5KPZ A;  1OAI A;  4PCZ A;  3KDS E;  5FTN A;  3GLI A;  3JAM S;  1NV8 A;  1Z5C A;  3J27 B;  4II7 A;  1E9S A;  5ITR A;  1V33 A;  4LCB A;  3UMM A;  3GP1 A;  4DR2 M;  2UXC M;  3VKG A;  3E46 A;  3L28 A;  3SC3 A;  1WHC A;  1N77 A;  1ZMU A;  1TF0 B;  4IBF A;  3GPP A;  1TH2 A;  5LMN M;  3CF0 A;  3A46 A;  1GL7 A;  3FYD A;  1IQP A;  4OU7 A;  1HT1 E;  1VDL A;  5ITT A;  3HJS A;  4TUW A;  2H5X A;  3SAU A;  3VFD A;  1K3X A;  4DR3 M;  2Z3X A;  5KO3 A;  4QOS A;  1PJJ A;  3T38 A;  2EA0 A;  2UU9 M;  2G3Q A;  3LQR A;  4I4L A;  2CHV A;  1VEG A;  3W67 A;  3U6S A;  2RGO A;  4QOZ C;  3L25 A;  2XGN A;  2CV0 A;  3C58 A;  2ERC A;  4JV5 M;  3Q8X A;  4LJA A;  2Q2E B;  3IEC A;  3K8Z A;  1PJI A;  1QZE A;  2F4V M;  1A5T A;  5EP3 A;  1C1K A;  1GJT A;  2M60 A;  7CAT A;  3EIH A;  4KT0 F;  2QCU A;  3AV0 A;  4KLN A;  1NJG A;  2FS1 A;  4KO8 A;  3J81 S;  2DHR A;  2K9D A;  1NY6 A;  2LVN C;  3FUT A;  4PT5 A;  2YQZ A;  4JI0 M;  4LF5 M;  2L09 A;  4FVM A;  2VQF M;  1ZAE A;  3E9S A;  1NHG C;  4F1I A;  2EO2 A;  4DUZ M;  2KRK A;  4RKU F;  3U6L A;  1PJQ A;  2BWB A;  2QHO B;  3LW5 F;  1HNX M;  3L29 A;  4NSO B;  1ZV1 A;  4GH9 A;  2HWJ A;  3FUW A;  1DGH A;  3T1H M;  1GO5 A;  1ZMW A;  3AJI B;  4IBD A;  2DAG A;  5F3W A;  2DKL A;  2C96 A;  1G3I A;  3SAW A;  5EJC A;  4GHA A;  4B3M M;  3GLF E;  2OOA A;  4DV6 M;  2UXD M;  4DV3 M;  4GIT A;  4B3S M;  4FWD A;  4AG5 A;  3PNY A;  1WXQ A;  2JXN A;  3DZD A;  3SAV A;  3SAT A;  4OW0 A;  1R7R A;  2L4E A;  1D2N A;  4WP2 A;  1EE8 A;  3GRY A;  1IY2 A;  4I81 A;  4ANR A;  2BJV A;  2JUJ A;  2KZS A;  4IIW A;  4HL4 A;  3L26 A;  1QAO A;  1ZMV A;  3GLH E;  2D7G A;  2XFT A;  4CIS A;  2XF3 A;  3F92 A;  1N78 A;  2R4J A;  4M0W A;  2B3T A;  3FUV A;  4OVZ A;  1DGB A;  4DV2 M;  4AQY M;  4JI8 M;  3PNV A;  3HGI A;  5E26 A;  2Z4R A;  5ITY A;  1VG5 A;  3SFZ A;  4M9X A;  1NSF A;  1Z6T A;  3M0E A;  1IXZ A;  1Q3B A;  2I7P A;  1YSY A;  4G4R A;  2LH0 A;  1C7Y A;  3V76 A;  3T6P A;  5L8R F;  1TH3 A;  2JY5 A;  3VK7 A;  4NSR A;  4QHT A;  3IHP A;  3KW6 A;  3PVS A;  1OAO C;  3UJN A;  2XEP A;  1JR3 E;  3AOE A;  3SAS A;  4HEO A;  4G4Q A;  3C9P A;  5EXX A;  4LRS A;  3GLG E;  2KNV A;  3U6D A;  2W82 A;  3CGW A;  2WSF F;  2A5Y B;  2FOI C;  3GLH B;  1GL6 A;  3HKP A;  4GRI A;  3HHY A;  1XMQ M;  2DXI A;  4AKH A;  2MH8 A;  3A42 A;  1QDT A;  3I04 M;  4LGM A;  1N75 A;  4YY3 M;  1L2D A;  1G59 A;  1DO2 A;  1XNQ M;  2LTU A;  1JR3 D;  3E21 A;  3T1Y M;  4M9S A;  4BB9 A;  2Y0T A;  3B7N A;  3JR5 A;  1R2Z A;  4LF6 M;  2EKK A;  3VDU A;  3W68 A;  3OTO M;  1G4A E;  1KSF X;  2KEB A;  2ZBK B;  2CFO A;  4GMQ A;  2F5O A;  2O25 A;  5LMU M;  5IRE B;  3RGS A;  4L78 A;  5IWA M;  3GPX A;  4LJ7 A;  5EP1 A;  2UUA M;  1HJP A;  1GJS A;  3CF2 A;  2F5Q A;  3GRU A;  4B3R M;  4LFA M;  5BPV A;  1HT2 E;  2JNH A;  4FWH A;  1TGU A;  2F5N A;  5IZ7 D;  1D0L A;  3Q8G A;  4IJE A;  2P5T A;  3GLG B;  2H1R A;  2OQ4 A;  4MGH A;  3VK8 A;  4LF7 M;  3NBX X;  1ORY B;  1F4I A;  2C9O A;  2CHG A;  4D80 A;  2VF8 A;  5KPT A;  1IN6 A;  1PRB A;  4JYA M;  1VDD A;  4MGK E;  1NO1 A;  2J7O A;  2RKO A;  3DA1 A;  4HLQ A;  1PJS A;  5ITX E;  2LBC A;  5KQD A;  4QNM A;  4GHL A;  4LJ4 A;  3GQ3 A;  3HHZ A;  1QAN A;  2X4A A;  1UFZ A;  4FCW A;  2APL A;  4IBG A;  2DWL A;  3C3D A;  2HL7 A;  2V1U A;  1J5E M;  4NRV A;  2Z7J A;  1XB2 B;  2FH0 A;  1N34 M;  4LZJ A;  5EXS A;  2G5G X;  2CHQ A;  3D8B A;  2DI0 A;  4NL4 H;  2DWM A;  4G4O A;  2DEN A;  1L1T A;  1NHW C;  2KNZ A;  1UM8 A;  4L16 A;  3AOE C;  3K92 A;  3BXW A;  3GRR A;  3LVW A;  5DNY A;  5KQ8 A;  2XSZ D;  3UZU A;  3SMP A;  3VDP A;  3AKZ A;  2KHH A;  4P16 A;  5FLX S;  2CWB A;  4DV4 M;  1OQY A;  1SXJ E;  3C3E A;  5EXT A;  2M5Z A;  3QYE A;  3RFW A;  3ZC7 B;  2BNK A;  4DV0 M;  5E6J A;  2C99 A;  2DAM A;  2QZ4 A;  1OFI A;  4UN2 B;  2C9C A;  3FRH A;  3DOA A;  1I4W A;  2JA2 A;  4MM3 B;  1SXJ D;  1TR8 A;  4AW4 A;  3TQS A;  3AL0 C;  1D0K A;  4IBI A;  1N36 M;  2OO9 A;  1FJG M;  4LGY A;  2D7E A;  4CIZ A;  2JZ1 A;  2YFQ A;  4LF8 M;  5C1B A;  1E94 E;  1QAM A;  2R0I A;  3FUU A;  1OIZ A;  2R62 A;  1IM2 A;  2Z4S A;  1IN7 A;  3KSJ A;  2VF7 A;  1J09 A;  3U6M A;  1SXJ B;  4BLC A;  3U5Z B;  4Y28 F;  4DR7 M;  2OOB A;  4FW9 A;  4LJ9 A;  4MGI E;  5GKN A;  5ITU A;  2L6O A;  2QP9 X;  1Y8G A;  4LJ6 A;  4JI4 M;  1R6B X;  3K2L A;  1V34 A;  4LJ5 A;  4QHS A;  2OPF A;  2WSC F;  1OKS A;  2DZL A;  3H4M A;  4K0K M;  4DV5 M;  3B89 A;  1TDZ A;  1T43 A;  1IY1 A;  2LHC A;  3KP0 E;  1Q02 A;  2ZAM A;  3TWL A;  2F5S A;  3J7A S;  5EP2 A;  1TDH A;  2K47 A;  4L4U A;  3I51 A;  3HWS A;  1NV9 A;  2L4F A;  1Q39 A;  4FD2 A;  4EIW A;  3FUX A;  4DUY M;  4D82 A;  1K82 A;  4OX9 M;  3AFH A;  2QQ8 A;  3FYC A;  4G3O A;  4L15 A;  2RRU A;  4NC6 A;  2LXE A;  4LZZ A;  1FNN A;  2NQ8 C;  1PM5 A;  1Z5A A;  3KS8 A;  1R2Y A;  4WW0 A;  1IXS B;  4B7H A;  1I94 M;  5IT9 S;  4JI1 M;  3K9O A;  1E9R A;  1DGG A;  4X64 M;  1NY5 A;  1XXH E;  2L2D A;  1IN5 A;  3W0F A;  3GLF B;  3TL4 X;  2DZO B;  4X62 M;  1IXS A;  3GRV A;  4JXJ A;  1N33 M;  4M0D A;  2WZJ A;  4B08 A;  3GLF A;  2LWX A;  4B7G A;  3U6O A;  3BOS A;  1IY0 A;  4Q7J A;  4FCT A;  2K6B A;  3J2P B;  1H6U A;  1HR0 M;  2CUZ A;  2R6F A;  1YLA A;  3FE3 A;  4RNA A;  3I4V A;  3HU3 A;  3VKH A;  4P17 A;  1T3T A;  1TH4 A;  3E4R A;  3HZJ A;  4LFB M;  1RU3 A; 
#chains in the Genus database with same CATH homology
 3D8L A;  1OFH A;  2V1C A;  3GLH A;  1QAQ A;  4RF1 A;  5EXP A;  4D81 A;  4PDI A;  5H37 D;  5DYG A;  3T15 A;  1YUB A;  4LF9 M;  2DWN A;  1NJF A;  3HJQ A;  3IG8 A;  1Z59 A;  1IBK M;  4JN6 A;  3FTE A;  4A3V B;  4IBJ A;  3WHK A;  3ZH9 B;  3J80 S;  3SYK A;  4NXM M;  4GKJ M;  2FNA A;  3HHW A;  3W0L B;  3HJ8 A;  3CTW B;  4IBK A;  1JR3 A;  3HU2 A;  3NWL A;  3GO8 A;  2D7H A;  1GVN A;  2QBY B;  3U6E A;  3SBJ A;  3SYL A;  3MHV C;  5KPR A;  1ZQ9 A;  3FD9 A;  3RE8 A;  3GLG A;  3U6P A;  1XNR M;  2C98 A;  2XFS A;  4KHP M;  3U60 B;  3K1J A;  2QEN A;  5DYI A;  3L27 A;  2Y20 A;  4RF0 A;  4JI5 M;  1G41 A;  4DR6 M;  3FTF A;  2HHH M;  2ZAO A;  3A45 A;  3B9P A;  4DR5 M;  4GKK M;  3R9X B;  4CHT B;  1GKI A;  4MH0 E;  2R65 A;  4XGI A;  4AZF A;  2KW0 A;  3AOG A;  1NNU C;  3KP1 E;  5BR8 M;  3MK6 A;  1JQJ C;  4I5S A;  3LVV A;  3GPY A;  4FWG A;  3KOY E;  4ITQ A;  3HHX A;  5EQT A;  2FE8 A;  4CGY B;  4JI7 M;  3PXG A;  3KS4 A;  1HNZ M;  1HQY E;  4NXN M;  1K3W A;  3SMS A;  4LG2 A;  3IG5 A;  1L2B A;  5ITX A;  1E32 A;  2L7I A;  3JR4 A;  3WHL A;  1QZM A;  3EIE A;  5FTJ A;  4Z6Y A;  3HU1 A;  1KFV A;  1XC8 A;  2ZM6 M;  1Q3C A;  2DZN B;  2I7N A;  2XSZ A;  1IXR C;  2X8A A;  4PDG A;  5FTL A;  1L8Q A;  1NVM A;  1QYR A;  1XMO M;  3KOX E;  4G6Z A;  1IBL M;  3CF6 E;  3R8F A;  1DGF A;  1DO0 A;  2UUC M;  1YE9 A;  1GLN A;  2J7N A;  1Z5B A;  4IBB A;  4MGZ E;  2HKJ A;  3KVW A;  3NBI A;  3U61 B;  3THG A;  2Y21 A;  2XZU A;  4S12 A;  4LFC M;  3U61 A;  1SXJ A;  4NOO B;  3U5Z A;  3GQ4 A;  4GC5 A;  1HNW M;  5FTK A;  3UK6 A;  1NNJ A;  2CE7 A;  2KXE A;  4DV7 M;  3DFZ A;  2Y0Q A;  4JI2 M;  4B7F A;  2UXB M;  4ZPX A;  2R46 A;  1OJL A;  1IBM M;  2G8L A;  2XLJ A;  3FTD A;  1DGH B;  3KFU G;  4GIP A;  4LRT A;  4JI6 M;  3LQQ A;  4YHH M;  1S3S A;  1G8P A;  1MU5 A;  1IN8 A;  3TPZ A;  8CAT A;  2L7H A;  3A98 B;  4NRW A;  3QWL A;  1MX0 A;  4WUR A;  2YNM D;  2VII A;  4PD2 A;  4R7G A;  4G4N A;  4AKI A;  1QQW A;  4MGY E;  1W5T A;  3SHG B;  2R4E A;  4AG6 A;  3SAR A;  2CV2 A;  2E5L M;  3J7B A;  3KOW E;  2C5R A;  4KOD A;  4LY6 A;  4OVZ B;  4I8O A;  4MB7 A;  2CV1 A;  2QPA A;  3KXE C;  4B3T M;  4LJ8 A;  1W5S A;  2AHM A;  5A2Q S;  4L8R C;  1IN4 A;  4X66 M;  4R3D A;  2XH9 A;  2FFJ A;  1J7K A;  5JI3 E;  2R18 A;  4LF4 M;  3U6C A;  3ILK A;  4IJF A;  1QVR A;  2XZF A;  1X37 A;  1XXH B;  5JI2 E;  2R45 A;  3M6A A;  4DR4 M;  2CEA A;  4BBA A;  4X65 M;  1XXH A;  4AKG A;  2KRU A;  3RGP A;  3MJ5 A;  4FCV A;  1SXJ C;  2O5R A;  4QNR A;  3SHF A;  2KA6 B;  2YR0 A;  4IBC A;  4Z8X A;  4JI3 M;  2DVW B;  3KSX A;  1L1Z A;  4AI6 A;  1KYI A;  1XWI A;  3U6Q A;  2LNH C;  5ITQ A;  4DV1 M;  2QBY A;  2EUC A;  3I4Y A;  3TWK A;  2DWZ B;  4GC9 A;  5FSW A;  3GPU A;  3L2A A;  3TE6 A;  2F5P A;  3U60 A;  4IBE A;  2V6Z M;  3LMM A;  1XHB A;  3KOZ E;  3ZCB B;  1LV7 A;  4XBO A;  1N32 M;  5FTM A;  2X49 A;  2KZU A;  1HQC A;  2ZAN A;  3UGJ A;  4DR1 M;  3VLF B;  2HCB A;  2RGH A;  4W5W A;  2VQE M;  3M7G A;  4M9Z A;  2UUB M;  3GQ5 A;  4REZ A;  2BJW A;  3GLI B;  3FTC A;  5C18 A;  5EP4 A;  1L2C A;  3PFI A;  3QAU A;  3FKE A;  5KPZ A;  3GLI A;  4PCZ A;  3KDS E;  5FTN A;  3JAM S;  1Z5C A;  3J27 B;  4II7 A;  1E9S A;  5ITR A;  4LCB A;  3UMM A;  3GP1 A;  4DR2 M;  2UXC M;  3VKG A;  3L28 A;  3SC3 A;  1N77 A;  4IBF A;  3GPP A;  1TH2 A;  5LMN M;  3CF0 A;  3A46 A;  1GL7 A;  3FYD A;  1IQP A;  4OU7 A;  1HT1 E;  5ITT A;  3HJS A;  4TUW A;  3SAU A;  3VFD A;  1K3X A;  4DR3 M;  2Z3X A;  5KO3 A;  4QOS A;  1PJJ A;  3T38 A;  2EA0 A;  2UU9 M;  3LQR A;  3U6S A;  4I4L A;  2CHV A;  2RGO A;  4QOZ C;  3L25 A;  2XGN A;  2CV0 A;  3C58 A;  2ERC A;  4JV5 M;  3Q8X A;  4LJA A;  2Q2E B;  3K8Z A;  1PJI A;  2F4V M;  5EP3 A;  1C1K A;  2M60 A;  7CAT A;  3EIH A;  2QCU A;  3AV0 A;  4KLN A;  1NJG A;  4KO8 A;  3J81 S;  2DHR A;  1NY6 A;  3FUT A;  4PT5 A;  2YQZ A;  4JI0 M;  4LF5 M;  2L09 A;  4FVM A;  2VQF M;  1ZAE A;  3E9S A;  1NHG C;  2EO2 A;  4DUZ M;  2KRK A;  3U6L A;  1HNX M;  3L29 A;  4NSO B;  4GH9 A;  3FUW A;  1DGH A;  3T1H M;  3AJI B;  4IBD A;  5F3W A;  2C96 A;  1G3I A;  3SAW A;  5EJC A;  4GHA A;  4B3M M;  2UXD M;  4DV6 M;  4DV3 M;  4GIT A;  4B3S M;  4FWD A;  4AG5 A;  3PNY A;  1WXQ A;  3DZD A;  3SAV A;  3SAT A;  4OW0 A;  1R7R A;  1D2N A;  1EE8 A;  3GRY A;  1IY2 A;  4I81 A;  2BJV A;  4IIW A;  2KZS A;  4HL4 A;  3L26 A;  1QAO A;  2D7G A;  2XFT A;  4CIS A;  2XF3 A;  1N78 A;  2R4J A;  4M0W A;  4OVZ A;  3FUV A;  1DGB A;  4DV2 M;  4AQY M;  4JI8 M;  3PNV A;  3HGI A;  5E26 A;  2Z4R A;  5ITY A;  3SFZ A;  4M9X A;  1NSF A;  1Z6T A;  3M0E A;  1IXZ A;  1Q3B A;  2I7P A;  1YSY A;  4G4R A;  2LH0 A;  1TH3 A;  3VK7 A;  4NSR A;  4QHT A;  3KW6 A;  3PVS A;  3UJN A;  2XEP A;  3AOE A;  3SAS A;  4G4Q A;  5EXX A;  4LRS A;  3U6D A;  2W82 A;  3HKP A;  2A5Y B;  2FOI C;  3GLH B;  1GL6 A;  4GRI A;  3HHY A;  1XMQ M;  2DXI A;  4AKH A;  3A42 A;  4LGM A;  1L2D A;  1N75 A;  4YY3 M;  1XNQ M;  1G59 A;  1DO2 A;  1JR3 D;  3T1Y M;  4M9S A;  4BB9 A;  2Y0T A;  3JR5 A;  1R2Z A;  4LF6 M;  3VDU A;  3OTO M;  1G4A E;  1KSF X;  2KEB A;  2ZBK B;  2CFO A;  4GMQ A;  2F5O A;  5LMU M;  5IRE B;  3RGS A;  4L78 A;  5IWA M;  3GPX A;  4LJ7 A;  5EP1 A;  2UUA M;  3CF2 A;  2F5Q A;  3GRU A;  4B3R M;  4LFA M;  5BPV A;  1HT2 E;  4FWH A;  1TGU A;  2F5N A;  5IZ7 D;  4IJE A;  2P5T A;  3GLG B;  2H1R A;  2OQ4 A;  4MGH A;  3VK8 A;  4LF7 M;  1ORY B;  2C9O A;  2CHG A;  4D80 A;  5KPT A;  1IN6 A;  4JYA M;  1VDD A;  4MGK E;  2J7O A;  2RKO A;  3DA1 A;  4HLQ A;  5ITX E;  5KQD A;  4QNM A;  4GHL A;  4LJ4 A;  3GQ3 A;  3HHZ A;  1QAN A;  2X4A A;  4IBG A;  4FCW A;  2DWL A;  2V1U A;  2HL7 A;  1J5E M;  4NRV A;  2Z7J A;  1N34 M;  4LZJ A;  5EXS A;  2G5G X;  2CHQ A;  3D8B A;  4NL4 H;  2DWM A;  4G4O A;  1L1T A;  1NHW C;  1UM8 A;  4L16 A;  3AOE C;  3K92 A;  3GRR A;  3LVW A;  5DNY A;  5KQ8 A;  2XSZ D;  3UZU A;  3SMP A;  3VDP A;  3AKZ A;  4P16 A;  5FLX S;  4DV4 M;  1SXJ E;  5EXT A;  2M5Z A;  3RFW A;  3ZC7 B;  2BNK A;  4DV0 M;  5E6J A;  2C99 A;  2QZ4 A;  1OFI A;  2C9C A;  3DOA A;  1I4W A;  2JA2 A;  4MM3 B;  1SXJ D;  4AW4 A;  3AL0 C;  3TQS A;  4IBI A;  1N36 M;  1FJG M;  4LGY A;  2D7E A;  2YFQ A;  4LF8 M;  5C1B A;  1E94 E;  1QAM A;  3FUU A;  2R62 A;  1IM2 A;  2Z4S A;  1IN7 A;  3KSJ A;  1J09 A;  3U6M A;  1SXJ B;  4BLC A;  3U5Z B;  4DR7 M;  4FW9 A;  4LJ9 A;  4MGI E;  5GKN A;  5ITU A;  2L6O A;  2QP9 X;  4LJ6 A;  4JI4 M;  1R6B X;  3K2L A;  4QHS A;  4LJ5 A;  2OPF A;  3H4M A;  4K0K M;  4DV5 M;  1TDZ A;  1IY1 A;  3KP0 E;  2ZAM A;  3TWL A;  2F5S A;  3J7A S;  5EP2 A;  1TDH A;  2K47 A;  4L4U A;  3I51 A;  3HWS A;  4EIW A;  1Q39 A;  4FD2 A;  3FUX A;  4DUY M;  4D82 A;  1K82 A;  4OX9 M;  3AFH A;  3FYC A;  4L15 A;  2LXE A;  4LZZ A;  1FNN A;  2NQ8 C;  1PM5 A;  1Z5A A;  3KS8 A;  1R2Y A;  4WW0 A;  1IXS B;  4B7H A;  1I94 M;  5IT9 S;  4JI1 M;  1E9R A;  1DGG A;  4X64 M;  1NY5 A;  3W0F A;  1IN5 A;  3GLF B;  3TL4 X;  2DZO B;  4X62 M;  4JXJ A;  3GRV A;  1N33 M;  4M0D A;  4B08 A;  3U6O A;  3GLF A;  2LWX A;  4B7G A;  3BOS A;  1IY0 A;  4FCT A;  3J2P B;  1H6U A;  1HR0 M;  2CUZ A;  4RNA A;  3VKH A;  3I4V A;  3HU3 A;  1T3T A;  1TH4 A;  3E4R A;  4LFB M;  3TWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...