1XNQM

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnqM02
1HNZM 4GKKM 5FLXS 4JI2M 2XZUA 1XNRM 2UXCM 1HNXM 4JV5M 5LMNM 4DUYM 4DV1M 4LF5M 1PJJA 4JYAM 1HNWM 4B3MM 4OX9M 3GPPA 1XC8A 4NRWA 1Q39A 4YY3M 4X64M 3GQ4A 4AQYM 3SATA 3GO8A 2F5PA 2UXDM 1XMOM 1FJGM 2Q2EB 3U6MA 2E5LM 2F5OA 5ITXE 3U6OA 3J7AS 3A46A 2VQEM 1K82A 3JR5A 4DV5M 3GPYA 3SAUA 3VK7A 4PDIA 4JI4M 3U6PA 4B3RM 3GPUA 1K3WA 4NRVA 1L2BA 4KHPM 1MU5A 2HHHM 3SAVA 1NNJA 4DV3M 3SASA 3DOAA 3JR4A 4X66M 4JI1M 5A2QS 3SARA 3A45A 1Q3CA 1Z59A 1K3XA 4ITQA 1Z5BA 3GQ3A 4MB7A 4PCZA 4PDGA 3TWLA 1R2YA 5ITRA 5ITYA 4DR7M 1IBLM 3T1HM 1N33M 4DV6M 1Q3BA 4JI5M 4DR2M 3U6DA 5ITUA 5BR8M 2EA0A 2F5QA 4LF8M 2HKJA 4DV2M 4PD2A 3GQ5A 3J81S 1XMQM 2OPFA 2UUAM 4DV7M 4G4RA 1N36M 5IWAM 1Z5CA 3T1YM 3J80S 4LF4M 4DUZM 4JI7M 4NXMM 5ITTA 4B3TM 5LMUM 3VK8A 4X65M 4LF7M 1Z5AA 1L1TA 1EE8A 2ZBKB 3GP1A 4DV0M 4X62M 4DV4M 2UUCM 4JI6M 3JAMS 4DR5M 4LF6M 1I94M 2F5SA 4LF9M 3OTOM 2UXBM 1MX0A 3TWMA 1L1ZA 5IT9S 4JI3M 4DR1M 1TDZA 1KFVA 2F4VM 4G4OA 4B3SM 2XZFA 5ITXA 4NXNM 5ITQA 3C58A 3U6LA 3U6EA 4LFAM 3A42A 4YHHM 2ZM6M 4GKJM 1J5EM 3U6SA 2UU9M 4LFBM 4K0KM 1N32M 3W0FA 1N34M 1IBMM 4JI8M 1TDHA 1L2CA 1IBKM 1R2ZA 4DR3M 3U6CA 2UUBM 1XNQM 4DR6M 1HR0M 3SAWA 1PJIA 2OQ4A 3SBJA 4LFCM 3GPXA 4DR4M 1L2DA 4JI0M 2VQFM 2F5NA 1PM5A 4G4NA 4CISA 4G4QA 3TWKA 3U6QA
chains in the Genus database with same CATH superfamily
1VDLA 1VG5A 2DZNB 3DZDA 2R6FA 1UM8A 1QANA 1HNXM 3KSXA 4JV5M 2KZUA 2CHVA 3IG8A 1OAIA 4P16A 1NHWC 2QQ8A 2YQZA 4JXJA 4JYAM 4B3MM 3I04M 2KEBA 3RGPA 3T15A 1IXZA 3BBZA 4B7GA 4OX9M 1VQ1A 3GLGA 1WGLA 3FUTA 1Q39A 2LXEA 4YY3M 3GQ4A 4OVZB 2LBCA 1ZV1A 3HU1A 4I8OA 2F5PA 2KZSA 2Y21A 5IZ7D 2DWMA 2Z7JA 2QCUA 1J7KA 3E4RA 3GLHE 2XFTA 5ITXE 4QHTA 2KNVA 2JNHA 3U6OA 1TTEA 2XSZD 4DBGB 3A46A 2KRKA 2RGOA 3KOYE 3T6PA 1HT1E 1ZAEA 3W67A 4B3RM 2JA2A 2MJ5B 4MH0E 2DWLA 2BNKA 1PJTA 3L25A 1QAQA 2HL7A 5IREB 2JY5A 4NSRA 1G3IA 3CTWB 4A3VB 2FNAA 1NNJA 3SASA 4ZPXA 1TH4A 3DOAA 4Z8XA 4X66M 4JI1M 4AKHA 4GIPA 1N75A 2VIIA 1T6OA 3GLIA 1LV7A 1GL7A 2MROB 5DFLA 4RKUF 5EQTA 1Z5BA 2DHYA 4MB7A 1PRBA 2DZLA 2C9OA 2QENA 4QNMA 1IN8A 2P5TA 1V34A 4WP2A 2R62A 5ITUA 2XF3A 1SXJA 1AIPC 3UGJA 2XLJA 4QNRA 4PD2A 5C18A 3M0EA 3J81S 4IBDA 2OPFA 1WIVA 4FCWA 2CHQA 3E9SA 1N36M 4LCBA 3AV0A 3HHZA 4LJ8A 3J80S 4DUZM 2Z8YM 4LG2A 7CATA 3CF6E 1SXJC 1JR3D 4AG5A 2EO2A 1OAOC 4X65M 4S12A 1L1TA 1GABA 1XXHB 2MGWA 3KDSE 3LQQA 2DWZB 3RE8A 4DV0M 3C9PA 3WHLA 1R4GA 4GHLA 4NOOB 2JZ1A 4GC5A 8CATA 2KRUA 3KSJA 4JI3M 1DGGA 5EXPA 2KNZA 2KNAA 2LVOC 2DXIA 1KFVA 2F4VM 1W5SA 4L15A 2B3TA 1DO0A 4XK8F 3U6LA 3A42A 2W82A 4QHSA 4CIZA 4YHHM 2QHOB 2UU9M 3WHKA 3KW6A 1DGFA 1N32M 5KQDA 2CV0A 2DKLA 2XFSA 4OU7A 1N34M 4I81A 1R5LA 1TDHA 3HZJA 2X49A 4B08A 1DV0A 2FS1A 1R2ZA 3K1JA 4LZZA 5FTLA 4LFCM 3SBJA 4OVZA 4FWHA 1NJGA 3UJNA 3K2LA 3SHFA 1PM5A 3FRIA 4G4NA 3HJ8A 5E6JA 3I4VA 2LVAA 1E32A 3T38A 4JI2M 2XZUA 1G59A 1ZQ9A 2YFQA 4REZA 3TL4X 1XNRM 4TUWA 1IXRC 2A5YB 1PJJA 3CGWA 2C5RA 3B74A 1HNWM 2L4EA 1R6BX 2QNJA 3KP1E 1NSFA 3GPPA 1QQWA 3KFUG 4NRWA 4IBBA 4AKIA 3QWLA 2UXDM 2JZ0A 1XMOM 1G71A 5JI3E 3FYDA 3U5ZB 5DYGA 4D81A 2F5OA 1HQCA 3J7AS 3MJ5A 2VQEM 4PT5A 3HJQA 2GNOA 4DV5M 3GPYA 4AKGA 1WGNA 2APLA 4PDIA 5L8RF 2JXNA 4JI4M 2R4EA 1CUKA 1DGHB 3LMMA 5FSWA 4AG6A 1V33A 4UN2B 2LVNC 1NY6A 3NBIA 4KHPM 4OW0A 4KT0F 3LVVA 3MK6A 2EUCA 3GLFE 2LH0A 1I4WA 3B7ZA 4NSOB 1TH3A 3JR4A 3J2PB 2BWEA 1IY0A 3QYBA 5A2QS 1PJSA 3HHXA 1IY2A 3A45A 3ILKA 3KXEC 1Q3CA 3PNVA 2LHCA 2RRUA 4G3OA 4KLNA 3AKZA 1K3XA 4CGYB 4IJEA 4L78A 1FNNA 3VFDA 3TWLA 3SMPA 4FCTA 2L7HA 1YE9A 5ITYA 1XXHA 2ZTDA 3T1HM 1N33M 4DV6M 2LHGA 1Q3BA 1IY1A 1W5TA 4B7FA 2KXEA 3U6DA 4MM3B 3HY5A 4LGYA 1MN3A 2DVWB 3ZH9B 1EFUB 2F5QA 4LF8M 3J7BA 3M6AA 2HKJA 2L7IA 4NC6A 1XMQM 4DV7M 2CUZA 3FE3A 4IBFA 2C98A 4M0DA 4CJ6A 4NXMM 5EJCA 4IIWA 3VLFB 2CRUA 5ITTA 3LVWA 2Z4RA 5LMUM 1GJSA 1NHGC 4HLQA 4GRIA 1TH2A 1EE8A 2ZBKB 1OFIA 1SXJD 3B7NA 2DZOB 3HU3A 2M60A 3FUUA 2V1CA 3EIHA 1GVNA 3LW5F 1WJ7A 5E26A 2UUCM 2CHGA 3JAMS 3AOEA 4JI6M 4XGIA 4MGHA 4HEOA 3OTOM 5KO3A 2JP7A 3KOXE 1N78A 2C9CA 2LVPC 3DA1A 4NL4H 1ZMWA 2K0BX 3B9PA 3D8BA 1KSFX 4LRTA 4G4OA 5C1BA 4GH9A 2BWBA 2CE7A 3AJIB 3SC3A 3GLIE 5F3WA 3R9XB 2NQ8C 2KDLA 1QVRA 3AOEC 3U61B 2BJVA 1J5EM 4LFBM 4M9XA 2JUJA 1V92A 2JY6B 3C3DA 3EIEA 3PVSA 1HJPA 2R45A 3W0FA 1IBMM 4JI8M 1IBKM 2OOAA 2JY7A 3NWLA 4DR3M 4L8RC 2UUBM 1XNQM 4DR6M 1HR0M 4Q7JA 2OQ4A 4DR4M 3GPXA 1SXJE 3FUVA 2I7NA 4FCVA 5H37D 3SHGB 2EJSA 2R4JA 2VQFM 1Y8GA 4L6V6 2DAEA 4LJ9A 3GLHB 2MR9A 3TWKA 1OJLA 3L26A 3U5ZA 4F1IA 1QDRA 3B89A 4KO8A 1HNZM 1A5TA 5GKNA 4GKKM 5FLXS 5KQ8A 2AHMA 2FH0A 2UXCM 1XHBA 3ZC7B 3KVWA 4DV1M 1S3SA 4LF5M 1WHCA 1YSYA 3GRRA 1DGBA 1DGHA 2VF8A 3PFIA 5FTNA 1XC8A 4XBOA 2O25A 3K9PA 1EIJA 2Z3XA 2LVQD 1OTRA 2RGHA 3L2AA 3GO8A 4GHAA 1IFYA 1G8PA 3HWSA 4GMQA 2KA6B 2Q2EB 4QOZC 2WSCF 2L2DA 3FYCA 5EXSA 1HT2E 2D7HA 1WXQA 1YLAA 1GLNA 5EP3A 3Q8XA 2L4FA 1E94E 2KHHA 2HCBA 4RNAA 4JN6A 4W5WA 3FUWA 4R3DA 1JR3A 4WW0A 3K92A 4LRSA 1OQYA 2LNHC 3U6PA 3RGSA 3FTEA 4LGMA 3GPUA 2CFOA 3K8ZA 1L2BA 2O01F 2D7GA 1J09A 2VF7A 3K9OA 4LJAA 2M5ZA 3UZUA 3SMSA 1MU5A 2HHHM 3SAVA 3CF0A 1QYRA 2BJWA 4D82A 3L29A 4DV3M 3D8LA 1G4AE 2ZTCA 3W68A 2R18A 3SARA 3QAUA 4CHTB 2YNMD 4P17A 3LCUA 2CV2A 1YUBA 2R44A 2XGNA 2Y20A 4IJFA 4MGKE 3LCVB 3H4MA 1TR8A 4FVMA 3L28A 4GEWA 3SYLA 1C7YA 3FTFA 2D7EA 1C1KA 4PDGA 2YR0A 1E9SA 4FWGA 4LJ6A 1SXJB 5KPRA 1R2YA 5ITRA 4LF9M 2FE8A 4JI5M 2J7NA 1IXSB 2CWBA 3R8FA 1F4IA 2K6BA 4LJ4A 3PNYA 4DV2M 4Y28F 2VDBB 3UMMA 4RF0A 3PXGA 2UUAM 1N77A 3E21A 3VDUA 1Z5CA 2J7OA 2LWXA 5IWAM 3AL0C 1QAMA 4JI7M 3AOGA 3FTDA 3U61A 2H5XA 4B3TM 3THGA 1OIPA 1IN4A 4LF7M 1Z5AA 2C99A 3A98B 3Q8GA 4RF1A 3V76A 4BBAA 3NBXX 4I4LA 2Y0QA 2EKKA 4Z6YA 4DV4M 4DR5M 1NV9A 1I94M 1Z6TA 2F5SA 4LF6M 1T43A 3U60B 1MX0A 1L1ZA 3KS8A 3FD9A 5JI2E 1NO1A 3GLGE 2N35A 2CP8A 4IBIA 3GLHA 5FTMA 1D0LA 2XZFA 5ITXA 1MJGM 2OO9A 2H1RA 5ITQA 3C58A 1IN7A 1DO2A 3U6EA 2MH8A 1TGUA 1X37A 4GC9A 2X8AA 3H4JA 4FWDA 5FTKA 3KS4A 3IG5A 4GITA 2QBYB 1BVSA 1XXHE 3GRVA 1L2CA 4MGYE 5EXXA 5KPZA 3TE6A 3B7QA 3HJSA 3HX3A 1AUAA 3QYEA 4LJ5A 3FKEA 2K47A 4R7GA 3TQSA 3ZQJA 1L2DA 3VKGA 3CF2A 3SYKA 2F5NA 1QAOA 2G5GX 2HWJA 3TPZA 3L27A 3U6QA 2JY8A 3KP0E 1QUSA 2HAKA 2ZANA 4KODA 4LZJA 3MMPA 2OOBA 4M0WA 1ORYB 1WR1B 4IBKA 1PGYA 1QDTA 2LTUA 5LMNM 4DUYM 2XSZA 1QUTA 3IECA 3HHWA 4FD2A 3C3EA 3HHYA 4II7A 1KYIA 2ZAOA 2DAGA 3UK6A 2V6ZM 4X64M 4AQYM 3SATA 1GJTA 1LTMA 2CEAA 2Y0TA 2FOIC 2JWSA 4LY6A 5EP4A 3GRYA 3GLFB 2EKFA 1FJGM 1R7RA 4IBCA 3U6MA 2E5LM 4MGIE 3HGIA 2L6OA 1PJQA 4B7HA 4R71A 1OFHA 1OKSA 2DHRA 1K82A 2KW0A 1SG9A 3BXWA 1L8QA 5EXTA 2I7PA 3JR5A 5EP1A 3SAUA 5KPTA 3VK7A 3LQRA 1D2NA 4QOSA 2ZAMA 4WURA 3FTCA 2X4AA 2ERCA 3F92A 1K3WA 2XH9A 4NRVA 4ANRA 3GLGB 2O5RA 4BB9A 1IM2A 3I01M 4AW4A 2QZ4A 3I51A 4MGZE 1NJFA 1IQPA 1IXSA 2DNAA 2G8LA 2UXBM 1UFZA 1Z59A 2FFJA 3M7GA 4L4UA 4ITQA 4HL4A 3GQ3A 2R65A 1Q02A 2DAMA 4PCZA 2K9DA 3FRHA 1E9RA 3KOWE 5DYIA 2CV1A 1NV8A 1IBLM 4DR7M 3BOSA 3DFZA 3AFHA 4DR2M 4M9ZA 1IN5A 5BR8M 1GO5A 1D0KA 1IN6A 3U60A 2EA0A 2DI0A 2DAIA 3VKHA 1JQJC 3GRUA 2C96A 4G6ZA 1QZEA 5BPVA 3GQ5A 2G3QA 3KOZE 1T3TA 3E46A 3RFWA 4G4RA 3GLIB 1NY5A 4D80A 4LF4M 3T1YM 3HKPA 3SFZA 3VDPA 3FUXA 1VEGA 4AZFA 2RKOA 4BLCA 1JR3E 4F2LA 2QSFX 2QPAA 2V1UA 1NNUC 3VK8A 5DNYA 1ZMVA 1D0MA 2QBYA 2J5YA 3GP1A 2GQFA 3J27B 1ZMUA 2DAKA 1VDDA 4IBGA 4X62M 4M9SA 2DWNA 2QP9X 2DENA 3TWMA 5IT9S 4DR1M 5FTJA 1RU3A 1TDZA 1VEJA 1GL6A 2R0IA 4B3SM 1TF0B 2WZJA 4NXNM 1H6UA 1QZMA 1G41A 4LFAM 4GKJM 2ZM6M 1P3QQ 4IBEA 4EIWA 1HQYE 4IBJA 3U6SA 4K0KM 1GKIA 3HU2A 1XB2B 2XEPA 3W0LB 4L16A 3MHVC 2L09A 4LJ7A 1NVMA 4G4QA 3U6CA 1XWIA 3IHPA 1OIZA 3I4YA 3ZCBB 3SAWA 1PJIA 1VEKA 4AI6A 4JI0M 2R46A 2WSEF 5EP2A 3GLFA 4FW9A 2WSFF 1JB0F 2Z4SA 4CISA 4I5SA
chains in the Genus database with same CATH topology
3DZDA 2DZNB 1UM8A 1QANA 1HNXM 3KSXA 4JV5M 2KZUA 2CHVA 3IG8A 4P16A 1NHWC 2YQZA 4JXJA 4JYAM 4B3MM 3T15A 2KEBA 3RGPA 1IXZA 4B7GA 4OX9M 3GLGA 3FUTA 1Q39A 2LXEA 4YY3M 3GQ4A 4OVZB 3HU1A 4I8OA 2F5PA 2KZSA 2Y21A 5IZ7D 2DWMA 2Z7JA 2QCUA 1J7KA 3E4RA 2XFTA 5ITXE 4QHTA 3U6OA 2XSZD 3A46A 2KRKA 2RGOA 3KOYE 1HT1E 1ZAEA 4B3RM 2JA2A 4MH0E 2DWLA 2BNKA 3L25A 1QAQA 2HL7A 5IREB 4NSRA 1G3IA 3CTWB 4A3VB 2FNAA 1NNJA 3SASA 4ZPXA 1TH4A 3DOAA 4Z8XA 4X66M 4JI1M 4AKHA 4GIPA 1N75A 2VIIA 3GLIA 1LV7A 1GL7A 5EQTA 1Z5BA 4MB7A 2C9OA 2QENA 4QNMA 1IN8A 2P5TA 2R62A 5ITUA 2XF3A 1SXJA 3UGJA 2XLJA 4QNRA 4PD2A 5C18A 3M0EA 3J81S 4IBDA 2OPFA 4FCWA 2CHQA 3E9SA 1N36M 4LCBA 3AV0A 3HHZA 4LJ8A 3J80S 4DUZM 4LG2A 7CATA 3CF6E 1SXJC 1JR3D 4AG5A 2EO2A 4X65M 4S12A 1L1TA 3KDSE 1XXHB 3LQQA 3RE8A 2DWZB 4DV0M 3WHLA 4GHLA 4NOOB 4GC5A 8CATA 2KRUA 3KSJA 4JI3M 1DGGA 5EXPA 2DXIA 1KFVA 2F4VM 1W5SA 4L15A 1DO0A 3U6LA 3A42A 2W82A 4QHSA 4YHHM 2UU9M 3WHKA 3KW6A 1DGFA 1N32M 5KQDA 2CV0A 2XFSA 4OU7A 1N34M 4I81A 4B08A 1TDHA 2X49A 1R2ZA 3K1JA 4LZZA 5FTLA 4LFCM 3SBJA 4OVZA 4FWHA 1NJGA 3UJNA 3K2LA 3SHFA 1PM5A 4G4NA 3HJ8A 5E6JA 3I4VA 1E32A 3T38A 4JI2M 2XZUA 1G59A 1ZQ9A 2YFQA 4REZA 3TL4X 1XNRM 4TUWA 1IXRC 2A5YB 1PJJA 2C5RA 1HNWM 1R6BX 3KP1E 1NSFA 3GPPA 1QQWA 3KFUG 4NRWA 4IBBA 4AKIA 3QWLA 2UXDM 1XMOM 5JI3E 3FYDA 3U5ZB 5DYGA 4D81A 2F5OA 1HQCA 3J7AS 3MJ5A 2VQEM 4PT5A 3HJQA 4DV5M 3GPYA 4AKGA 4PDIA 4JI4M 2R4EA 1DGHB 3LMMA 5FSWA 4AG6A 4KHPM 1NY6A 3NBIA 4OW0A 3LVVA 3MK6A 2EUCA 2LH0A 1I4WA 4NSOB 1TH3A 3JR4A 3J2PB 1IY0A 5A2QS 3HHXA 1IY2A 3A45A 3ILKA 3KXEC 1Q3CA 3PNVA 4KLNA 3AKZA 1K3XA 4CGYB 4IJEA 4L78A 1FNNA 3VFDA 3TWLA 3SMPA 4FCTA 2L7HA 1YE9A 5ITYA 1XXHA 3T1HM 1N33M 4DV6M 1Q3BA 1IY1A 1W5TA 4B7FA 2KXEA 3U6DA 4MM3B 4LGYA 2DVWB 3ZH9B 2F5QA 4LF8M 3J7BA 3M6AA 2HKJA 2L7IA 1XMQM 4DV7M 2CUZA 4IBFA 2C98A 4M0DA 4NXMM 5EJCA 4IIWA 3VLFB 5ITTA 3LVWA 2Z4RA 5LMUM 1NHGC 4HLQA 4GRIA 1TH2A 1EE8A 2ZBKB 1OFIA 1SXJD 3M7GA 2DZOB 3HU3A 2M60A 3FUUA 2V1CA 3EIHA 1GVNA 5E26A 2UUCM 2CHGA 3JAMS 3AOEA 4JI6M 4XGIA 4MGHA 3OTOM 5KO3A 3KOXE 1N78A 2C9CA 3DA1A 4NL4H 3B9PA 3D8BA 4LRTA 1KSFX 4G4OA 5C1BA 4GH9A 2CE7A 3AJIB 3SC3A 5F3WA 3R9XB 2NQ8C 1QVRA 3AOEC 3U61B 2BJVA 1J5EM 4LFBM 4M9XA 3EIEA 3PVSA 2R45A 3W0FA 1IBMM 4JI8M 1IBKM 3NWLA 4DR3M 4L8RC 2UUBM 1XNQM 4DR6M 1HR0M 2OQ4A 4DR4M 3GPXA 1SXJE 3FUVA 2I7NA 4FCVA 5H37D 3SHGB 2R4JA 2VQFM 4LJ9A 3GLHB 3L26A 3TWKA 1OJLA 3U5ZA 4KO8A 1HNZM 4GKKM 5GKNA 5FLXS 5KQ8A 2AHMA 2UXCM 1XHBA 3ZC7B 3KVWA 4DV1M 1S3SA 4LF5M 1YSYA 3GRRA 1DGBA 1DGHA 3PFIA 5FTNA 1XC8A 4XBOA 2Z3XA 3L2AA 2RGHA 3GO8A 4GHAA 1G8PA 3HWSA 4GMQA 2KA6B 2Q2EB 4QOZC 3FYCA 5EXSA 1HT2E 2D7HA 1WXQA 1GLNA 5EP3A 3Q8XA 1E94E 4RNAA 2HCBA 4JN6A 4W5WA 3FUWA 4R3DA 1JR3A 4WW0A 3K92A 4LRSA 2LNHC 3U6PA 3RGSA 3FTEA 4LGMA 3GPUA 2CFOA 3K8ZA 1L2BA 2D7GA 1J09A 4LJAA 3UZUA 2M5ZA 3SMSA 1MU5A 2HHHM 3SAVA 3CF0A 1QYRA 2BJWA 4D82A 3L29A 4DV3M 3D8LA 1G4AE 2R18A 3SARA 3QAUA 2YNMD 2CV2A 1YUBA 2XGNA 2Y20A 4IJFA 4MGKE 4FVMA 3H4MA 3SYLA 3L28A 3FTFA 2D7EA 1C1KA 4PDGA 2YR0A 1E9SA 4FWGA 4LJ6A 1SXJB 5KPRA 1R2YA 5ITRA 2FE8A 4JI5M 2J7NA 1IXSB 3R8FA 4LJ4A 3PNYA 4DV2M 3UMMA 4RF0A 3PXGA 2UUAM 1N77A 3VDUA 5IWAM 1Z5CA 2J7OA 2LWXA 3AL0C 1QAMA 4JI7M 3AOGA 3FTDA 3U61A 4B3TM 3THGA 1IN4A 4LF7M 1Z5AA 2C99A 3A98B 4RF1A 4BBAA 4I4LA 2Y0QA 4Z6YA 4DV4M 4DR5M 4LF6M 1I94M 1Z6TA 2F5SA 4LF9M 3U60B 3KS8A 1MX0A 1L1ZA 2UXBM 3FD9A 5JI2E 4IBIA 3GLHA 5FTMA 2XZFA 5ITXA 2H1RA 5ITQA 3C58A 1IN7A 1DO2A 3U6EA 1TGUA 1X37A 4GC9A 2X8AA 4FWDA 5FTKA 3KS4A 3IG5A 4GITA 2QBYB 3GRVA 1L2CA 4MGYE 5EXXA 5KPZA 3TE6A 3HJSA 4CHTB 3TQSA 4LJ5A 3FKEA 2K47A 4R7GA 1L2DA 3VKGA 3CF2A 3SYKA 2F5NA 1QAOA 2G5GX 3TPZA 3L27A 3U6QA 3KP0E 2ZANA 4KODA 4LZJA 4M0WA 1ORYB 4IBKA 5LMNM 4DUYM 2XSZA 3HHWA 4FD2A 3HHYA 4II7A 1KYIA 2ZAOA 3UK6A 2V6ZM 4X64M 4AQYM 3SATA 4LY6A 2Y0TA 2CEAA 2FOIC 5EP4A 3GRYA 3GLFB 1FJGM 1R7RA 4IBCA 3U6MA 2E5LM 4MGIE 3HGIA 2L6OA 4B7HA 1OFHA 2DHRA 1K82A 2KW0A 3JR5A 3SAUA 1L8QA 5EXTA 2I7PA 5EP1A 5KPTA 3VK7A 3LQRA 1D2NA 4QOSA 2ZAMA 4WURA 3FTCA 2X4AA 2ERCA 1K3WA 2XH9A 4NRVA 3GLGB 2O5RA 4BB9A 1IM2A 4AW4A 2QZ4A 3I51A 4MGZE 1NJFA 1IQPA 2G8LA 1Z59A 2FFJA 4L4UA 4ITQA 4HL4A 3GQ3A 2R65A 4PCZA 1E9RA 3KOWE 5DYIA 2CV1A 4DR7M 1IBLM 3BOSA 3DFZA 3AFHA 4DR2M 4M9ZA 1IN5A 5BR8M 1IN6A 3U60A 2EA0A 3VKHA 1JQJC 3GRUA 2C96A 4G6ZA 5BPVA 3GQ5A 3KOZE 1T3TA 3RFWA 4G4RA 3GLIB 1NY5A 4D80A 4LF4M 3T1YM 3HKPA 3SFZA 3VDPA 3FUXA 4AZFA 2RKOA 4BLCA 2QPAA 2V1UA 1NNUC 3VK8A 5DNYA 2QBYA 3GP1A 3J27B 1VDDA 4IBGA 4X62M 4M9SA 2DWNA 2QP9X 5IT9S 3TWMA 4DR1M 5FTJA 1TDZA 4B3SM 1GL6A 4NXNM 1H6UA 1QZMA 1G41A 4LFAM 4GKJM 2ZM6M 3U6SA 4IBEA 4EIWA 1HQYE 4IBJA 4K0KM 1GKIA 3HU2A 3W0LB 2XEPA 4L16A 3MHVC 2L09A 4LJ7A 1NVMA 4G4QA 3U6CA 1XWIA 3I4YA 3ZCBB 3SAWA 1PJIA 4AI6A 4JI0M 2R46A 5EP2A 3GLFA 4FW9A 4CISA 2Z4SA 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ M;  4GKK M;  5FLX S;  4JI2 M;  2XZU A;  1XNR M;  2UXC M;  1HNX M;  4JV5 M;  5LMN M;  4DUY M;  4DV1 M;  4LF5 M;  1PJJ A;  4JYA M;  1HNW M;  4B3M M;  4OX9 M;  3GPP A;  1XC8 A;  4NRW A;  1Q39 A;  4YY3 M;  4X64 M;  3GQ4 A;  4AQY M;  3SAT A;  3GO8 A;  2F5P A;  2UXD M;  1XMO M;  1FJG M;  2Q2E B;  3U6M A;  2E5L M;  2F5O A;  5ITX E;  3U6O A;  3J7A S;  3A46 A;  2VQE M;  1K82 A;  3JR5 A;  4DV5 M;  3GPY A;  3SAU A;  3VK7 A;  4PDI A;  4JI4 M;  3U6P A;  4B3R M;  3GPU A;  1K3W A;  4NRV A;  1L2B A;  4KHP M;  1MU5 A;  2HHH M;  3SAV A;  1NNJ A;  4DV3 M;  3SAS A;  3DOA A;  3JR4 A;  4X66 M;  4JI1 M;  5A2Q S;  3SAR A;  3A45 A;  1Q3C A;  1Z59 A;  1K3X A;  4ITQ A;  1Z5B A;  3GQ3 A;  4MB7 A;  4PCZ A;  4PDG A;  3TWL A;  1R2Y A;  5ITR A;  5ITY A;  4DR7 M;  1IBL M;  3T1H M;  1N33 M;  4DV6 M;  1Q3B A;  4JI5 M;  4DR2 M;  3U6D A;  5ITU A;  5BR8 M;  2EA0 A;  2F5Q A;  4LF8 M;  2HKJ A;  4DV2 M;  4PD2 A;  3GQ5 A;  3J81 S;  1XMQ M;  2OPF A;  2UUA M;  4DV7 M;  4G4R A;  1N36 M;  5IWA M;  1Z5C A;  3T1Y M;  3J80 S;  4LF4 M;  4DUZ M;  4JI7 M;  4NXM M;  5ITT A;  4B3T M;  5LMU M;  3VK8 A;  4X65 M;  4LF7 M;  1Z5A A;  1L1T A;  1EE8 A;  2ZBK B;  3GP1 A;  4DV0 M;  4X62 M;  4DV4 M;  2UUC M;  4JI6 M;  3JAM S;  4DR5 M;  4LF6 M;  1I94 M;  2F5S A;  4LF9 M;  3OTO M;  2UXB M;  1MX0 A;  3TWM A;  1L1Z A;  5IT9 S;  4JI3 M;  4DR1 M;  1TDZ A;  1KFV A;  2F4V M;  4G4O A;  4B3S M;  2XZF A;  5ITX A;  4NXN M;  5ITQ A;  3C58 A;  3U6L A;  3U6E A;  4LFA M;  3A42 A;  4YHH M;  2ZM6 M;  4GKJ M;  1J5E M;  3U6S A;  2UU9 M;  4LFB M;  4K0K M;  1N32 M;  3W0F A;  1N34 M;  1IBM M;  4JI8 M;  1TDH A;  1L2C A;  1IBK M;  1R2Z A;  4DR3 M;  3U6C A;  2UUB M;  1XNQ M;  4DR6 M;  1HR0 M;  3SAW A;  1PJI A;  2OQ4 A;  3SBJ A;  4LFC M;  3GPX A;  4DR4 M;  1L2D A;  4JI0 M;  2VQF M;  2F5N A;  1PM5 A;  4G4N A;  4CIS A;  4G4Q A;  3TWK A;  3U6Q A; 
#chains in the Genus database with same CATH topology
 1VDL A;  1VG5 A;  2DZN B;  3DZD A;  2R6F A;  1UM8 A;  1QAN A;  1HNX M;  3KSX A;  4JV5 M;  2KZU A;  2CHV A;  3IG8 A;  1OAI A;  4P16 A;  1NHW C;  2QQ8 A;  2YQZ A;  4JXJ A;  4JYA M;  4B3M M;  3I04 M;  2KEB A;  3RGP A;  3T15 A;  1IXZ A;  3BBZ A;  4B7G A;  4OX9 M;  1VQ1 A;  3GLG A;  1WGL A;  3FUT A;  1Q39 A;  2LXE A;  4YY3 M;  3GQ4 A;  4OVZ B;  2LBC A;  1ZV1 A;  3HU1 A;  4I8O A;  2F5P A;  2KZS A;  2Y21 A;  5IZ7 D;  2DWM A;  2Z7J A;  2QCU A;  1J7K A;  3E4R A;  3GLH E;  2XFT A;  5ITX E;  4QHT A;  2KNV A;  2JNH A;  3U6O A;  1TTE A;  2XSZ D;  4DBG B;  3A46 A;  2KRK A;  2RGO A;  3KOY E;  3T6P A;  1HT1 E;  1ZAE A;  3W67 A;  4B3R M;  2JA2 A;  2MJ5 B;  4MH0 E;  2DWL A;  2BNK A;  1PJT A;  3L25 A;  1QAQ A;  2HL7 A;  5IRE B;  2JY5 A;  4NSR A;  1G3I A;  3CTW B;  4A3V B;  2FNA A;  1NNJ A;  3SAS A;  4ZPX A;  1TH4 A;  3DOA A;  4Z8X A;  4X66 M;  4JI1 M;  4AKH A;  4GIP A;  1N75 A;  2VII A;  1T6O A;  3GLI A;  1LV7 A;  1GL7 A;  2MRO B;  5DFL A;  4RKU F;  5EQT A;  1Z5B A;  2DHY A;  4MB7 A;  1PRB A;  2DZL A;  2C9O A;  2QEN A;  4QNM A;  1IN8 A;  2P5T A;  1V34 A;  4WP2 A;  2R62 A;  5ITU A;  2XF3 A;  1SXJ A;  1AIP C;  3UGJ A;  2XLJ A;  4QNR A;  4PD2 A;  5C18 A;  3M0E A;  3J81 S;  4IBD A;  2OPF A;  1WIV A;  4FCW A;  2CHQ A;  3E9S A;  1N36 M;  4LCB A;  3AV0 A;  3HHZ A;  4LJ8 A;  3J80 S;  4DUZ M;  2Z8Y M;  4LG2 A;  7CAT A;  3CF6 E;  1SXJ C;  1JR3 D;  4AG5 A;  2EO2 A;  1OAO C;  4X65 M;  4S12 A;  1L1T A;  1GAB A;  1XXH B;  2MGW A;  3KDS E;  3LQQ A;  2DWZ B;  3RE8 A;  4DV0 M;  3C9P A;  3WHL A;  1R4G A;  4GHL A;  4NOO B;  2JZ1 A;  4GC5 A;  8CAT A;  2KRU A;  3KSJ A;  4JI3 M;  1DGG A;  5EXP A;  2KNZ A;  2KNA A;  2LVO C;  2DXI A;  1KFV A;  2F4V M;  1W5S A;  4L15 A;  2B3T A;  1DO0 A;  4XK8 F;  3U6L A;  3A42 A;  2W82 A;  4QHS A;  4CIZ A;  4YHH M;  2QHO B;  2UU9 M;  3WHK A;  3KW6 A;  1DGF A;  1N32 M;  5KQD A;  2CV0 A;  2DKL A;  2XFS A;  4OU7 A;  1N34 M;  4I81 A;  1R5L A;  1TDH A;  3HZJ A;  2X49 A;  4B08 A;  1DV0 A;  2FS1 A;  1R2Z A;  3K1J A;  4LZZ A;  5FTL A;  4LFC M;  3SBJ A;  4OVZ A;  4FWH A;  1NJG A;  3UJN A;  3K2L A;  3SHF A;  1PM5 A;  3FRI A;  4G4N A;  3HJ8 A;  5E6J A;  3I4V A;  2LVA A;  1E32 A;  3T38 A;  4JI2 M;  2XZU A;  1G59 A;  1ZQ9 A;  2YFQ A;  4REZ A;  3TL4 X;  1XNR M;  4TUW A;  1IXR C;  2A5Y B;  1PJJ A;  3CGW A;  2C5R A;  3B74 A;  1HNW M;  2L4E A;  1R6B X;  2QNJ A;  3KP1 E;  1NSF A;  3GPP A;  1QQW A;  3KFU G;  4NRW A;  4IBB A;  4AKI A;  3QWL A;  2UXD M;  2JZ0 A;  1XMO M;  1G71 A;  5JI3 E;  3FYD A;  3U5Z B;  5DYG A;  4D81 A;  2F5O A;  1HQC A;  3J7A S;  3MJ5 A;  2VQE M;  4PT5 A;  3HJQ A;  2GNO A;  4DV5 M;  3GPY A;  4AKG A;  1WGN A;  2APL A;  4PDI A;  5L8R F;  2JXN A;  4JI4 M;  2R4E A;  1CUK A;  1DGH B;  3LMM A;  5FSW A;  4AG6 A;  1V33 A;  4UN2 B;  2LVN C;  1NY6 A;  3NBI A;  4KHP M;  4OW0 A;  4KT0 F;  3LVV A;  3MK6 A;  2EUC A;  3GLF E;  2LH0 A;  1I4W A;  3B7Z A;  4NSO B;  1TH3 A;  3JR4 A;  3J2P B;  2BWE A;  1IY0 A;  3QYB A;  5A2Q S;  1PJS A;  3HHX A;  1IY2 A;  3A45 A;  3ILK A;  3KXE C;  1Q3C A;  3PNV A;  2LHC A;  2RRU A;  4G3O A;  4KLN A;  3AKZ A;  1K3X A;  4CGY B;  4IJE A;  4L78 A;  1FNN A;  3VFD A;  3TWL A;  3SMP A;  4FCT A;  2L7H A;  1YE9 A;  5ITY A;  1XXH A;  2ZTD A;  3T1H M;  1N33 M;  4DV6 M;  2LHG A;  1Q3B A;  1IY1 A;  1W5T A;  4B7F A;  2KXE A;  3U6D A;  4MM3 B;  3HY5 A;  4LGY A;  1MN3 A;  2DVW B;  3ZH9 B;  1EFU B;  2F5Q A;  4LF8 M;  3J7B A;  3M6A A;  2HKJ A;  2L7I A;  4NC6 A;  1XMQ M;  4DV7 M;  2CUZ A;  3FE3 A;  4IBF A;  2C98 A;  4M0D A;  4CJ6 A;  4NXM M;  5EJC A;  4IIW A;  3VLF B;  2CRU A;  5ITT A;  3LVW A;  2Z4R A;  5LMU M;  1GJS A;  1NHG C;  4HLQ A;  4GRI A;  1TH2 A;  1EE8 A;  2ZBK B;  1OFI A;  1SXJ D;  3B7N A;  2DZO B;  3HU3 A;  2M60 A;  3FUU A;  2V1C A;  3EIH A;  1GVN A;  3LW5 F;  1WJ7 A;  5E26 A;  2UUC M;  2CHG A;  3JAM S;  3AOE A;  4JI6 M;  4XGI A;  4MGH A;  4HEO A;  3OTO M;  5KO3 A;  2JP7 A;  3KOX E;  1N78 A;  2C9C A;  2LVP C;  3DA1 A;  4NL4 H;  1ZMW A;  2K0B X;  3B9P A;  3D8B A;  1KSF X;  4LRT A;  4G4O A;  5C1B A;  4GH9 A;  2BWB A;  2CE7 A;  3AJI B;  3SC3 A;  3GLI E;  5F3W A;  3R9X B;  2NQ8 C;  2KDL A;  1QVR A;  3AOE C;  3U61 B;  2BJV A;  1J5E M;  4LFB M;  4M9X A;  2JUJ A;  1V92 A;  2JY6 B;  3C3D A;  3EIE A;  3PVS A;  1HJP A;  2R45 A;  3W0F A;  1IBM M;  4JI8 M;  1IBK M;  2OOA A;  2JY7 A;  3NWL A;  4DR3 M;  4L8R C;  2UUB M;  1XNQ M;  4DR6 M;  1HR0 M;  4Q7J A;  2OQ4 A;  4DR4 M;  3GPX A;  1SXJ E;  3FUV A;  2I7N A;  4FCV A;  5H37 D;  3SHG B;  2EJS A;  2R4J A;  2VQF M;  1Y8G A;  4L6V 6;  2DAE A;  4LJ9 A;  3GLH B;  2MR9 A;  3TWK A;  1OJL A;  3L26 A;  3U5Z A;  4F1I A;  1QDR A;  3B89 A;  4KO8 A;  1HNZ M;  1A5T A;  5GKN A;  4GKK M;  5FLX S;  5KQ8 A;  2AHM A;  2FH0 A;  2UXC M;  1XHB A;  3ZC7 B;  3KVW A;  4DV1 M;  1S3S A;  4LF5 M;  1WHC A;  1YSY A;  3GRR A;  1DGB A;  1DGH A;  2VF8 A;  3PFI A;  5FTN A;  1XC8 A;  4XBO A;  2O25 A;  3K9P A;  1EIJ A;  2Z3X A;  2LVQ D;  1OTR A;  2RGH A;  3L2A A;  3GO8 A;  4GHA A;  1IFY A;  1G8P A;  3HWS A;  4GMQ A;  2KA6 B;  2Q2E B;  4QOZ C;  2WSC F;  2L2D A;  3FYC A;  5EXS A;  1HT2 E;  2D7H A;  1WXQ A;  1YLA A;  1GLN A;  5EP3 A;  3Q8X A;  2L4F A;  1E94 E;  2KHH A;  2HCB A;  4RNA A;  4JN6 A;  4W5W A;  3FUW A;  4R3D A;  1JR3 A;  4WW0 A;  3K92 A;  4LRS A;  1OQY A;  2LNH C;  3U6P A;  3RGS A;  3FTE A;  4LGM A;  3GPU A;  2CFO A;  3K8Z A;  1L2B A;  2O01 F;  2D7G A;  1J09 A;  2VF7 A;  3K9O A;  4LJA A;  2M5Z A;  3UZU A;  3SMS A;  1MU5 A;  2HHH M;  3SAV A;  3CF0 A;  1QYR A;  2BJW A;  4D82 A;  3L29 A;  4DV3 M;  3D8L A;  1G4A E;  2ZTC A;  3W68 A;  2R18 A;  3SAR A;  3QAU A;  4CHT B;  2YNM D;  4P17 A;  3LCU A;  2CV2 A;  1YUB A;  2R44 A;  2XGN A;  2Y20 A;  4IJF A;  4MGK E;  3LCV B;  3H4M A;  1TR8 A;  4FVM A;  3L28 A;  4GEW A;  3SYL A;  1C7Y A;  3FTF A;  2D7E A;  1C1K A;  4PDG A;  2YR0 A;  1E9S A;  4FWG A;  4LJ6 A;  1SXJ B;  5KPR A;  1R2Y A;  5ITR A;  4LF9 M;  2FE8 A;  4JI5 M;  2J7N A;  1IXS B;  2CWB A;  3R8F A;  1F4I A;  2K6B A;  4LJ4 A;  3PNY A;  4DV2 M;  4Y28 F;  2VDB B;  3UMM A;  4RF0 A;  3PXG A;  2UUA M;  1N77 A;  3E21 A;  3VDU A;  1Z5C A;  2J7O A;  2LWX A;  5IWA M;  3AL0 C;  1QAM A;  4JI7 M;  3AOG A;  3FTD A;  3U61 A;  2H5X A;  4B3T M;  3THG A;  1OIP A;  1IN4 A;  4LF7 M;  1Z5A A;  2C99 A;  3A98 B;  3Q8G A;  4RF1 A;  3V76 A;  4BBA A;  3NBX X;  4I4L A;  2Y0Q A;  2EKK A;  4Z6Y A;  4DV4 M;  4DR5 M;  1NV9 A;  1I94 M;  1Z6T A;  2F5S A;  4LF6 M;  1T43 A;  3U60 B;  1MX0 A;  1L1Z A;  3KS8 A;  3FD9 A;  5JI2 E;  1NO1 A;  3GLG E;  2N35 A;  2CP8 A;  4IBI A;  3GLH A;  5FTM A;  1D0L A;  2XZF A;  5ITX A;  1MJG M;  2OO9 A;  2H1R A;  5ITQ A;  3C58 A;  1IN7 A;  1DO2 A;  3U6E A;  2MH8 A;  1TGU A;  1X37 A;  4GC9 A;  2X8A A;  3H4J A;  4FWD A;  5FTK A;  3KS4 A;  3IG5 A;  4GIT A;  2QBY B;  1BVS A;  1XXH E;  3GRV A;  1L2C A;  4MGY E;  5EXX A;  5KPZ A;  3TE6 A;  3B7Q A;  3HJS A;  3HX3 A;  1AUA A;  3QYE A;  4LJ5 A;  3FKE A;  2K47 A;  4R7G A;  3TQS A;  3ZQJ A;  1L2D A;  3VKG A;  3CF2 A;  3SYK A;  2F5N A;  1QAO A;  2G5G X;  2HWJ A;  3TPZ A;  3L27 A;  3U6Q A;  2JY8 A;  3KP0 E;  1QUS A;  2HAK A;  2ZAN A;  4KOD A;  4LZJ A;  3MMP A;  2OOB A;  4M0W A;  1ORY B;  1WR1 B;  4IBK A;  1PGY A;  1QDT A;  2LTU A;  5LMN M;  4DUY M;  2XSZ A;  1QUT A;  3IEC A;  3HHW A;  4FD2 A;  3C3E A;  3HHY A;  4II7 A;  1KYI A;  2ZAO A;  2DAG A;  3UK6 A;  2V6Z M;  4X64 M;  4AQY M;  3SAT A;  1GJT A;  1LTM A;  2CEA A;  2Y0T A;  2FOI C;  2JWS A;  4LY6 A;  5EP4 A;  3GRY A;  3GLF B;  2EKF A;  1FJG M;  1R7R A;  4IBC A;  3U6M A;  2E5L M;  4MGI E;  3HGI A;  2L6O A;  1PJQ A;  4B7H A;  4R71 A;  1OFH A;  1OKS A;  2DHR A;  1K82 A;  2KW0 A;  1SG9 A;  3BXW A;  1L8Q A;  5EXT A;  2I7P A;  3JR5 A;  5EP1 A;  3SAU A;  5KPT A;  3VK7 A;  3LQR A;  1D2N A;  4QOS A;  2ZAM A;  4WUR A;  3FTC A;  2X4A A;  2ERC A;  3F92 A;  1K3W A;  2XH9 A;  4NRV A;  4ANR A;  3GLG B;  2O5R A;  4BB9 A;  1IM2 A;  3I01 M;  4AW4 A;  2QZ4 A;  3I51 A;  4MGZ E;  1NJF A;  1IQP A;  1IXS A;  2DNA A;  2G8L A;  2UXB M;  1UFZ A;  1Z59 A;  2FFJ A;  3M7G A;  4L4U A;  4ITQ A;  4HL4 A;  3GQ3 A;  2R65 A;  1Q02 A;  2DAM A;  4PCZ A;  2K9D A;  3FRH A;  1E9R A;  3KOW E;  5DYI A;  2CV1 A;  1NV8 A;  1IBL M;  4DR7 M;  3BOS A;  3DFZ A;  3AFH A;  4DR2 M;  4M9Z A;  1IN5 A;  5BR8 M;  1GO5 A;  1D0K A;  1IN6 A;  3U60 A;  2EA0 A;  2DI0 A;  2DAI A;  3VKH A;  1JQJ C;  3GRU A;  2C96 A;  4G6Z A;  1QZE A;  5BPV A;  3GQ5 A;  2G3Q A;  3KOZ E;  1T3T A;  3E46 A;  3RFW A;  4G4R A;  3GLI B;  1NY5 A;  4D80 A;  4LF4 M;  3T1Y M;  3HKP A;  3SFZ A;  3VDP A;  3FUX A;  1VEG A;  4AZF A;  2RKO A;  4BLC A;  1JR3 E;  4F2L A;  2QSF X;  2QPA A;  2V1U A;  1NNU C;  3VK8 A;  5DNY A;  1ZMV A;  1D0M A;  2QBY A;  2J5Y A;  3GP1 A;  2GQF A;  3J27 B;  1ZMU A;  2DAK A;  1VDD A;  4IBG A;  4X62 M;  4M9S A;  2DWN A;  2QP9 X;  2DEN A;  3TWM A;  5IT9 S;  4DR1 M;  5FTJ A;  1RU3 A;  1TDZ A;  1VEJ A;  1GL6 A;  2R0I A;  4B3S M;  1TF0 B;  2WZJ A;  4NXN M;  1H6U A;  1QZM A;  1G41 A;  4LFA M;  4GKJ M;  2ZM6 M;  1P3Q Q;  4IBE A;  4EIW A;  1HQY E;  4IBJ A;  3U6S A;  4K0K M;  1GKI A;  3HU2 A;  1XB2 B;  2XEP A;  3W0L B;  4L16 A;  3MHV C;  2L09 A;  4LJ7 A;  1NVM A;  4G4Q A;  3U6C A;  1XWI A;  3IHP A;  1OIZ A;  3I4Y A;  3ZCB B;  3SAW A;  1PJI A;  1VEK A;  4AI6 A;  4JI0 M;  2R46 A;  2WSE F;  5EP2 A;  3GLF A;  4FW9 A;  2WSF F;  1JB0 F;  2Z4S A;  4CIS A;  4I5S A; 
#chains in the Genus database with same CATH homology
 3DZD A;  2DZN B;  1UM8 A;  1QAN A;  1HNX M;  3KSX A;  4JV5 M;  2KZU A;  2CHV A;  3IG8 A;  4P16 A;  1NHW C;  2YQZ A;  4JXJ A;  4JYA M;  4B3M M;  3T15 A;  2KEB A;  3RGP A;  1IXZ A;  4B7G A;  4OX9 M;  3GLG A;  3FUT A;  1Q39 A;  2LXE A;  4YY3 M;  3GQ4 A;  4OVZ B;  3HU1 A;  4I8O A;  2F5P A;  2KZS A;  2Y21 A;  5IZ7 D;  2DWM A;  2Z7J A;  2QCU A;  1J7K A;  3E4R A;  2XFT A;  5ITX E;  4QHT A;  3U6O A;  2XSZ D;  3A46 A;  2KRK A;  2RGO A;  3KOY E;  1HT1 E;  1ZAE A;  4B3R M;  2JA2 A;  4MH0 E;  2DWL A;  2BNK A;  3L25 A;  1QAQ A;  2HL7 A;  5IRE B;  4NSR A;  1G3I A;  3CTW B;  4A3V B;  2FNA A;  1NNJ A;  3SAS A;  4ZPX A;  1TH4 A;  3DOA A;  4Z8X A;  4X66 M;  4JI1 M;  4AKH A;  4GIP A;  1N75 A;  2VII A;  3GLI A;  1LV7 A;  1GL7 A;  5EQT A;  1Z5B A;  4MB7 A;  2C9O A;  2QEN A;  4QNM A;  1IN8 A;  2P5T A;  2R62 A;  5ITU A;  2XF3 A;  1SXJ A;  3UGJ A;  2XLJ A;  4QNR A;  4PD2 A;  5C18 A;  3M0E A;  3J81 S;  4IBD A;  2OPF A;  4FCW A;  2CHQ A;  3E9S A;  1N36 M;  4LCB A;  3AV0 A;  3HHZ A;  4LJ8 A;  3J80 S;  4DUZ M;  4LG2 A;  7CAT A;  3CF6 E;  1SXJ C;  1JR3 D;  4AG5 A;  2EO2 A;  4X65 M;  4S12 A;  1L1T A;  3KDS E;  1XXH B;  3LQQ A;  3RE8 A;  2DWZ B;  4DV0 M;  3WHL A;  4GHL A;  4NOO B;  4GC5 A;  8CAT A;  2KRU A;  3KSJ A;  4JI3 M;  1DGG A;  5EXP A;  2DXI A;  1KFV A;  2F4V M;  1W5S A;  4L15 A;  1DO0 A;  3U6L A;  3A42 A;  2W82 A;  4QHS A;  4YHH M;  2UU9 M;  3WHK A;  3KW6 A;  1DGF A;  1N32 M;  5KQD A;  2CV0 A;  2XFS A;  4OU7 A;  1N34 M;  4I81 A;  4B08 A;  1TDH A;  2X49 A;  1R2Z A;  3K1J A;  4LZZ A;  5FTL A;  4LFC M;  3SBJ A;  4OVZ A;  4FWH A;  1NJG A;  3UJN A;  3K2L A;  3SHF A;  1PM5 A;  4G4N A;  3HJ8 A;  5E6J A;  3I4V A;  1E32 A;  3T38 A;  4JI2 M;  2XZU A;  1G59 A;  1ZQ9 A;  2YFQ A;  4REZ A;  3TL4 X;  1XNR M;  4TUW A;  1IXR C;  2A5Y B;  1PJJ A;  2C5R A;  1HNW M;  1R6B X;  3KP1 E;  1NSF A;  3GPP A;  1QQW A;  3KFU G;  4NRW A;  4IBB A;  4AKI A;  3QWL A;  2UXD M;  1XMO M;  5JI3 E;  3FYD A;  3U5Z B;  5DYG A;  4D81 A;  2F5O A;  1HQC A;  3J7A S;  3MJ5 A;  2VQE M;  4PT5 A;  3HJQ A;  4DV5 M;  3GPY A;  4AKG A;  4PDI A;  4JI4 M;  2R4E A;  1DGH B;  3LMM A;  5FSW A;  4AG6 A;  4KHP M;  1NY6 A;  3NBI A;  4OW0 A;  3LVV A;  3MK6 A;  2EUC A;  2LH0 A;  1I4W A;  4NSO B;  1TH3 A;  3JR4 A;  3J2P B;  1IY0 A;  5A2Q S;  3HHX A;  1IY2 A;  3A45 A;  3ILK A;  3KXE C;  1Q3C A;  3PNV A;  4KLN A;  3AKZ A;  1K3X A;  4CGY B;  4IJE A;  4L78 A;  1FNN A;  3VFD A;  3TWL A;  3SMP A;  4FCT A;  2L7H A;  1YE9 A;  5ITY A;  1XXH A;  3T1H M;  1N33 M;  4DV6 M;  1Q3B A;  1IY1 A;  1W5T A;  4B7F A;  2KXE A;  3U6D A;  4MM3 B;  4LGY A;  2DVW B;  3ZH9 B;  2F5Q A;  4LF8 M;  3J7B A;  3M6A A;  2HKJ A;  2L7I A;  1XMQ M;  4DV7 M;  2CUZ A;  4IBF A;  2C98 A;  4M0D A;  4NXM M;  5EJC A;  4IIW A;  3VLF B;  5ITT A;  3LVW A;  2Z4R A;  5LMU M;  1NHG C;  4HLQ A;  4GRI A;  1TH2 A;  1EE8 A;  2ZBK B;  1OFI A;  1SXJ D;  3M7G A;  2DZO B;  3HU3 A;  2M60 A;  3FUU A;  2V1C A;  3EIH A;  1GVN A;  5E26 A;  2UUC M;  2CHG A;  3JAM S;  3AOE A;  4JI6 M;  4XGI A;  4MGH A;  3OTO M;  5KO3 A;  3KOX E;  1N78 A;  2C9C A;  3DA1 A;  4NL4 H;  3B9P A;  3D8B A;  4LRT A;  1KSF X;  4G4O A;  5C1B A;  4GH9 A;  2CE7 A;  3AJI B;  3SC3 A;  5F3W A;  3R9X B;  2NQ8 C;  1QVR A;  3AOE C;  3U61 B;  2BJV A;  1J5E M;  4LFB M;  4M9X A;  3EIE A;  3PVS A;  2R45 A;  3W0F A;  1IBM M;  4JI8 M;  1IBK M;  3NWL A;  4DR3 M;  4L8R C;  2UUB M;  1XNQ M;  4DR6 M;  1HR0 M;  2OQ4 A;  4DR4 M;  3GPX A;  1SXJ E;  3FUV A;  2I7N A;  4FCV A;  5H37 D;  3SHG B;  2R4J A;  2VQF M;  4LJ9 A;  3GLH B;  3L26 A;  3TWK A;  1OJL A;  3U5Z A;  4KO8 A;  1HNZ M;  4GKK M;  5GKN A;  5FLX S;  5KQ8 A;  2AHM A;  2UXC M;  1XHB A;  3ZC7 B;  3KVW A;  4DV1 M;  1S3S A;  4LF5 M;  1YSY A;  3GRR A;  1DGB A;  1DGH A;  3PFI A;  5FTN A;  1XC8 A;  4XBO A;  2Z3X A;  3L2A A;  2RGH A;  3GO8 A;  4GHA A;  1G8P A;  3HWS A;  4GMQ A;  2KA6 B;  2Q2E B;  4QOZ C;  3FYC A;  5EXS A;  1HT2 E;  2D7H A;  1WXQ A;  1GLN A;  5EP3 A;  3Q8X A;  1E94 E;  4RNA A;  2HCB A;  4JN6 A;  4W5W A;  3FUW A;  4R3D A;  1JR3 A;  4WW0 A;  3K92 A;  4LRS A;  2LNH C;  3U6P A;  3RGS A;  3FTE A;  4LGM A;  3GPU A;  2CFO A;  3K8Z A;  1L2B A;  2D7G A;  1J09 A;  4LJA A;  3UZU A;  2M5Z A;  3SMS A;  1MU5 A;  2HHH M;  3SAV A;  3CF0 A;  1QYR A;  2BJW A;  4D82 A;  3L29 A;  4DV3 M;  3D8L A;  1G4A E;  2R18 A;  3SAR A;  3QAU A;  2YNM D;  2CV2 A;  1YUB A;  2XGN A;  2Y20 A;  4IJF A;  4MGK E;  4FVM A;  3H4M A;  3SYL A;  3L28 A;  3FTF A;  2D7E A;  1C1K A;  4PDG A;  2YR0 A;  1E9S A;  4FWG A;  4LJ6 A;  1SXJ B;  5KPR A;  1R2Y A;  5ITR A;  2FE8 A;  4JI5 M;  2J7N A;  1IXS B;  3R8F A;  4LJ4 A;  3PNY A;  4DV2 M;  3UMM A;  4RF0 A;  3PXG A;  2UUA M;  1N77 A;  3VDU A;  5IWA M;  1Z5C A;  2J7O A;  2LWX A;  3AL0 C;  1QAM A;  4JI7 M;  3AOG A;  3FTD A;  3U61 A;  4B3T M;  3THG A;  1IN4 A;  4LF7 M;  1Z5A A;  2C99 A;  3A98 B;  4RF1 A;  4BBA A;  4I4L A;  2Y0Q A;  4Z6Y A;  4DV4 M;  4DR5 M;  4LF6 M;  1I94 M;  1Z6T A;  2F5S A;  4LF9 M;  3U60 B;  3KS8 A;  1MX0 A;  1L1Z A;  2UXB M;  3FD9 A;  5JI2 E;  4IBI A;  3GLH A;  5FTM A;  2XZF A;  5ITX A;  2H1R A;  5ITQ A;  3C58 A;  1IN7 A;  1DO2 A;  3U6E A;  1TGU A;  1X37 A;  4GC9 A;  2X8A A;  4FWD A;  5FTK A;  3KS4 A;  3IG5 A;  4GIT A;  2QBY B;  3GRV A;  1L2C A;  4MGY E;  5EXX A;  5KPZ A;  3TE6 A;  3HJS A;  4CHT B;  3TQS A;  4LJ5 A;  3FKE A;  2K47 A;  4R7G A;  1L2D A;  3VKG A;  3CF2 A;  3SYK A;  2F5N A;  1QAO A;  2G5G X;  3TPZ A;  3L27 A;  3U6Q A;  3KP0 E;  2ZAN A;  4KOD A;  4LZJ A;  4M0W A;  1ORY B;  4IBK A;  5LMN M;  4DUY M;  2XSZ A;  3HHW A;  4FD2 A;  3HHY A;  4II7 A;  1KYI A;  2ZAO A;  3UK6 A;  2V6Z M;  4X64 M;  4AQY M;  3SAT A;  4LY6 A;  2Y0T A;  2CEA A;  2FOI C;  5EP4 A;  3GRY A;  3GLF B;  1FJG M;  1R7R A;  4IBC A;  3U6M A;  2E5L M;  4MGI E;  3HGI A;  2L6O A;  4B7H A;  1OFH A;  2DHR A;  1K82 A;  2KW0 A;  3JR5 A;  3SAU A;  1L8Q A;  5EXT A;  2I7P A;  5EP1 A;  5KPT A;  3VK7 A;  3LQR A;  1D2N A;  4QOS A;  2ZAM A;  4WUR A;  3FTC A;  2X4A A;  2ERC A;  1K3W A;  2XH9 A;  4NRV A;  3GLG B;  2O5R A;  4BB9 A;  1IM2 A;  4AW4 A;  2QZ4 A;  3I51 A;  4MGZ E;  1NJF A;  1IQP A;  2G8L A;  1Z59 A;  2FFJ A;  4L4U A;  4ITQ A;  4HL4 A;  3GQ3 A;  2R65 A;  4PCZ A;  1E9R A;  3KOW E;  5DYI A;  2CV1 A;  4DR7 M;  1IBL M;  3BOS A;  3DFZ A;  3AFH A;  4DR2 M;  4M9Z A;  1IN5 A;  5BR8 M;  1IN6 A;  3U60 A;  2EA0 A;  3VKH A;  1JQJ C;  3GRU A;  2C96 A;  4G6Z A;  5BPV A;  3GQ5 A;  3KOZ E;  1T3T A;  3RFW A;  4G4R A;  3GLI B;  1NY5 A;  4D80 A;  4LF4 M;  3T1Y M;  3HKP A;  3SFZ A;  3VDP A;  3FUX A;  4AZF A;  2RKO A;  4BLC A;  2QPA A;  2V1U A;  1NNU C;  3VK8 A;  5DNY A;  2QBY A;  3GP1 A;  3J27 B;  1VDD A;  4IBG A;  4X62 M;  4M9S A;  2DWN A;  2QP9 X;  5IT9 S;  3TWM A;  4DR1 M;  5FTJ A;  1TDZ A;  4B3S M;  1GL6 A;  4NXN M;  1H6U A;  1QZM A;  1G41 A;  4LFA M;  4GKJ M;  2ZM6 M;  3U6S A;  4IBE A;  4EIW A;  1HQY E;  4IBJ A;  4K0K M;  1GKI A;  3HU2 A;  3W0L B;  2XEP A;  4L16 A;  3MHV C;  2L09 A;  4LJ7 A;  1NVM A;  4G4Q A;  3U6C A;  1XWI A;  3I4Y A;  3ZCB B;  3SAW A;  1PJI A;  4AI6 A;  4JI0 M;  2R46 A;  5EP2 A;  3GLF A;  4FW9 A;  4CIS A;  2Z4S A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...