1XNQM

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnqM02
1KFVA 5ITXA 4G4RA 3VK7A 1PJJA 4OX9M 4X66M 2Q2EB 4G4NA 4PDGA 4LF7M 1PJIA 3U6QA 2VQFM 2F4VM 5IWAM 4JI7M 4DV4M 4DR3M 1XC8A 1N36M 1J5EM 4NRWA 2UXBM 5LMUM 4NRVA 2UXCM 5ITXE 4PD2A 5IT9S 1L2BA 4LFBM 2ZM6M 3A46A 2VQEM 1XMQM 3U6PA 4X64M 1K3WA 3J80S 3GO8A 4PCZA 3T1HM 4GKJM 4G4OA 1FJGM 1L1ZA 1PM5A 5ITRA 4B3SM 1R2ZA 3GQ3A 3TWLA 3JR4A 1MU5A 1Z5BA 3T1YM 4DUYM 1TDHA 3A45A 3SAVA 4DR2M 1L1TA 1Z5AA 2XZFA 1HNZM 4JV5M 3A42A 2OQ4A 4DV2M 4JI8M 4JI1M 1Q3BA 1K3XA 1HR0M 4JI5M 4LF5M 4LF9M 4DR1M 2F5NA 2F5QA 1Q39A 3TWKA 3SAWA 1NNJA 4JI4M 4YY3M 5ITQA 3OTOM 3GPUA 3GQ5A 3U6CA 3U6SA 3GPYA 4JI6M 3GQ4A 2F5OA 4KHPM 4LF4M 2OPFA 3U6EA 2UUCM 4DR6M 4MB7A 5ITYA 1Q3CA 2EA0A 3U6LA 4JI2M 4B3MM 4B3RM 4JYAM 5ITUA 5BR8M 1IBKM 3SARA 1N33M 4DR7M 1IBMM 4DV3M 2HHHM 2UU9M 4ITQA 3SBJA 4DR4M 3C58A 3W0FA 4NXMM 4X62M 2E5LM 1I94M 3GPPA 1HNWM 4DV1M 4DV0M 1L2CA 1XMOM 4G4QA 2UUBM 3U6DA 3SAUA 2ZBKB 4DV7M 4B3TM 1L2DA 3U6MA 4JI0M 1N34M 3U6OA 1XNQM 3JAMS 3GP1A 2F5SA 1K82A 3GPXA 2UXDM 3TWMA 4JI3M 4X65M 5A2QS 1R2YA 4LF8M 1IBLM 4GKKM 4DV5M 4DR5M 2XZUA 4NXNM 2F5PA 3JR5A 3SATA 5ITTA 4PDIA 1N32M 4LFAM 4AQYM 4DV6M 1MX0A 1TDZA 4LF6M 3J81S 1Z5CA 1XNRM 3J7AS 4YHHM 4LFCM 2UUAM 3DOAA 1Z59A 2HKJA 3VK8A 1EE8A 4DUZM 4K0KM 3SASA 5FLXS 5LMNM 4CISA 1HNXM
chains in the Genus database with same CATH superfamily
3KSJA 4G4RA 2LHGA 1IXSB 3AJIB 4X66M 1NJGA 2DZOB 3K1JA 1D0MA 1ZMVA 4PDGA 3GLFA 1PJIA 4RF1A 2VQFM 5L8RF 5IWAM 4DV4M 2Z8YM 4DR3M 3K2LA 2RGOA 2UXBM 3SYLA 1GL7A 3I51A 3GLIA 2K47A 2UXCM 2BNKA 5EXTA 1E9RA 1QAQA 4EIWA 1L2BA 2ZM6M 1NY5A 3GLHB 3ILKA 3A46A 2Y20A 3M0EA 2DZNB 3THGA 3KVWA 2WZJA 1IN5A 3Q8GA 1EIJA 3M7GA 3NBXX 1HQCA 4LJ6A 4OW0A 3A98B 1PM5A 1XWIA 2X4AA 2KZUA 3NBIA 1R2ZA 1MU5A 2HL7A 5IREB 2CEAA 5DYIA 3SAVA 4DR2M 4IBFA 1JR3A 2JP7A 3CGWA 3VFDA 4HLQA 2CHQA 2BWEA 2C9OA 5C1BA 1YUBA 4R71A 1QUTA 1XHBA 5F3WA 2R45A 2V1UA 1HR0M 1GLNA 2QENA 4LF9M 4DR1M 1GL6A 1P3QQ 2DKLA 1PJQA 4KT0F 2Y21A 1DGHB 4Y28F 5EP2A 1N77A 3FE3A 2OOBA 3OTOM 3WHKA 1WGLA 2J7OA 2JWSA 2ZAMA 5LMNM 3J2PB 3FTCA 4MM3B 1VQ1A 3E9SA 2R65A 3SYKA 4MB7A 1Q3CA 2YQZA 1HQYE 3U6LA 3HU3A 3FYCA 1R5LA 4JYAM 1IM2A 5BR8M 2RRUA 3E21A 3K8ZA 2MROB 4G6ZA 4QNMA 4GC9A 4L78A 1IBKM 2QBYA 4DV3M 3KS8A 1OFIA 1J09A 1LTMA 1TTEA 2ZTCA 1VDLA 5GKNA 2VIIA 1XXHE 1G59A 2XFTA 4IIWA 5KQ8A 8CATA 3B7NA 2E5LM 1IY1A 1XXHB 3KDSE 4M9XA 4AKGA 3UJNA 4ZPXA 3UGJA 3AFHA 4A3VB 5E26A 2EUCA 1KYIA 2R62A 1IN8A 1NO1A 2D7EA 2ZBKB 4IBCA 4M0WA 4DV7M 3SMSA 3SAUA 3HHZA 1OAIA 1A5TA 1L2DA 1G3IA 2JY5A 3I4YA 4NC6A 2XEPA 1JQJC 2MR9A 3BOSA 4Z6YA 3L25A 1N78A 1QVRA 4IBEA 1Q02A 3KFUG 1OAOC 4LZZA 2OOAA 2ERCA 2K0BX 4M9SA 3W0LB 3FRIA 2CP8A 4P17A 4GKKM 3CF0A 3LMMA 5KO3A 3L26A 4DR5M 1SXJB 1T3TA 4AKHA 5H37D 2R4EA 2XLJA 3U5ZB 4AW4A 1ZQ9A 5ITTA 1N32M 2EO2A 4AQYM 3CF2A 3LCUA 1TDZA 1XNRM 1HT1E 1DGHA 1Z5CA 3J81S 4LFCM 1GJTA 3IG8A 5FTNA 3SHFA 2CE7A 4QOSA 1IQPA 1E9SA 4B7FA 2MH8A 3PNVA 7CATA 4II7A 4DUZM 3GLFE 4K0KM 1OFHA 1I4WA 2KRUA 2KA6B 2C98A 2DAMA 4D82A 2Z4RA 3HZJA 2DAKA 4OX9M 1J7KA 1SXJC 3F92A 4G4NA 1DO0A 4LRTA 5EJCA 3BXWA 3ZCBB 4OVZA 3AL0C 2XF3A 3HJSA 4Q7JA 5LMUM 3K92A 5BPVA 2G8LA 5ITXE 3AOGA 2QZ4A 3B7ZA 1WHCA 4ANRA 2QCUA 2APLA 4LFBM 2FH0A 2QHOB 1XMQM 3B74A 3U6PA 1EFUB 2GNOA 4KLNA 4LJAA 3SC3A 1K3WA 3J80S 3GO8A 4PCZA 4FD2A 4XBOA 4AKIA 1UM8A 3FUUA 2ZANA 1LV7A 1FJGM 4CJ6A 3HY5A 1L1ZA 2N35A 1WGNA 3DA1A 1TGUA 5ITRA 3DFZA 4QOZC 4NSRA 2YFQA 2O01F 1L8QA 2ZTDA 3GQ3A 2DWZB 3W67A 3JR4A 4DUYM 1GABA 3A45A 2FS1A 3VLFB 3FUWA 1IN7A 3FKEA 2WSEF 2Y0TA 2LTUA 2LVOC 5FTJA 2OO9A 4FVMA 4DBGB 5FTLA 2QQ8A 1MN3A 5KPZA 1D0KA 4I8OA 3FYDA 1T6OA 3SAWA 2DAIA 3W68A 2DXIA 2M5ZA 3U61B 4WP2A 1NNJA 2FOIC 2L09A 5ITQA 3T15A 4YY3M 2W82A 1OJLA 1YE9A 3K9OA 3V76A 3LVVA 2KRKA 3IHPA 2JZ1A 5JI2E 1KSFX 2XH9A 5DNYA 3HHWA 2R6FA 1VEJA 4DR6M 1E32A 2EA0A 2DNAA 4B3MM 1TR8A 2H1RA 2L6OA 4LJ7A 4GC5A 4DR7M 1WR1B 2HHHM 5EQTA 3KOZE 2KNVA 3SBJA 1QZMA 2C5RA 2HWJA 1UFZA 3W0FA 5KPTA 4HL4A 4FWHA 3FD9A 3D8BA 4MGYE 4GIPA 3CF6E 2DWMA 3KP0E 3GPPA 2DAGA 1XMOM 1OIPA 5FTKA 4L16A 4LY6A 3U6DA 4LGYA 2JUJA 2O25A 1ORYB 4D81A 4B3TM 3GLGE 4AZFA 3HJQA 3SHGB 3C9PA 1XNQM 2O5RA 1AIPC 1TF0B 1IN6A 1RU3A 1F4IA 2F5SA 3RGPA 4MGIE 1K82A 1G71A 3VDPA 2UXDM 4W5WA 2C96A 3MMPA 4RKUF 4JI3M 4LF8M 5EP4A 2C99A 3R9XB 1R7RA 2BJWA 2KXEA 2LHCA 3KS4A 4G3OA 4LJ4A 4NXNM 1R6BX 1NV9A 3KOWE 4PDIA 1WXQA 5EXSA 2EJSA 2DHYA 4FW9A 1CUKA 1MX0A 4LF6M 2QSFX 1NNUC 3J7AS 1E94E 3LW5F 4MGKE 3Q8XA 1YLAA 2A5YB 3DOAA 4GHLA 1MJGM 2DVWB 1W5SA 4LRSA 3ZC7B 3U5ZA 2KNAA 2R4JA 4CISA 2YR0A 1AUAA 1SXJD 2LVAA 3GRYA 5ITXA 1KFVA 3KSXA 2Q2EB 4GRIA 4WURA 2CV1A 1N75A 2JY8A 3U6QA 4IBGA 2DENA 3MK6A 4IBKA 3AV0A 2F4VM 1V33A 4JI7M 1XC8A 1J5EM 5E6JA 2DZLA 3I04M 1PJSA 2FFJA 1ZAEA 4NRVA 2KW0A 2X49A 4WW0A 4KO8A 5FSWA 4Z8XA 4OU7A 1C1KA 4LGMA 5IT9S 3HJ8A 4F1IA 2VQEM 2JXNA 3I01M 2LXEA 2Y0QA 3T1HM 4G4OA 3B7QA 2CHGA 4NOOB 1NHWC 3L2AA 1BVSA 2KZSA 3TPZA 1Z5BA 1DGFA 1TDHA 2L7IA 2DHRA 4LCBA 3J7BA 4TUWA 1DV0A 4I5SA 1L1TA 2QBYB 1Z5AA 1S3SA 4NL4H 1HNZM 2Z4SA 1TH2A 3KOYE 3A42A 2OQ4A 4JI8M 1VDDA 4JI1M 1Q3BA 2KHHA 3L29A 4JI5M 4RF0A 4LG2A 3KOXE 2F5NA 1DGGA 2LNHC 1C7YA 1Q39A 3TWKA 2ZAOA 2F5QA 3RGSA 2FE8A 2CV2A 4MH0E 2VF7A 4JI4M 3H4JA 2KEBA 4LJ5A 2L4EA 3GPYA 3HX3A 2V1CA 1IXRC 5IZ7D 1IY0A 4GH9A 4BBAA 1W5TA 2F5OA 4KHPM 3TQSA 5KPRA 2G5GX 3U6EA 3E4RA 4JI2M 4QHSA 4B3RM 1IXSA 5ITUA 4B7HA 2V6ZM 3ZQJA 1Z6TA 4IBJA 5EXXA 3PXGA 3PFIA 3LQQA 1N33M 2UU9M 3PVSA 4DR4M 3C58A 2JNHA 2CRUA 3UZUA 1NV8A 3FUVA 2KDLA 4LJ8A 5C18A 3LCVB 2R18A 3TL4X 1QDRA 3LQRA 3GLGA 1OQYA 1OIZA 1I94M 1H6UA 3RE8A 4DV0M 1SXJE 1QYRA 4G4QA 3GLGB 2CHVA 1ZMUA 3U61A 3NWLA 4B08A 2JZ0A 4IBDA 1DO2A 3KP1E 2R46A 3GRVA 3U6MA 2J7NA 2XGNA 3R8FA 2CV0A 1Y8GA 4LZJA 5EP1A 1JR3E 1QUSA 2VF8A 3IG5A 4QHTA 2K6BA 2QNJA 2Z7JA 2JA2A 3GP1A 4CGYB 3UMMA 1PJTA 4M0DA 3GLFB 4X65M 1JB0F 1QAMA 4RNAA 1IBLM 1VEKA 1ZMWA 4DV5M 1DGBA 2LVQD 1T43A 1XB2B 1QDTA 2F5PA 1NHGC 2LH0A 2WSFF 3SATA 1WJ7A 2I7NA 3B89A 4I4LA 4LJ9A 5KQDA 2L4FA 3KXEC 2DWLA 2CWBA 2JY7A 3VDUA 4MGZE 4IJFA 2D7HA 1Z59A 4GMQA 2CFOA 4L4UA 1ZV1A 3GRRA 3QYBA 2NQ8C 3SMPA 1QANA 3H4MA 4JXJA 5FLXS 2DWNA 3BBZA 2RGHA 4OVZB 3DZDA 4R7GA 5JI3E 1PGYA 3VK7A 1PJJA 2MGWA 4CHTB 2I7PA 4LF7M 3KW6A 4L15A 4S12A 1V92A 2LBCA 3FRHA 1N36M 1TH3A 1NVMA 2X8AA 3EIHA 4NRWA 3M6AA 3TE6A 2G3QA 3T38A 1NJFA 1X37A 2HAKA 2AHMA 1NY6A 2M60A 3CTWB 4PD2A 3HHYA 3U60B 1G4AE 1OTRA 2EKFA 3HKPA 4X64M 2VDBB 4UN2B 1VEGA 2DI0A 2L2DA 4GEWA 4AG5A 3VKHA 4HEOA 4GKJM 3MHVC 3LVWA 4IJEA 4P16A 4FCVA 3FTEA 4REZA 1OKSA 1SXJA 4B3SM 4FWGA 1D0LA 3TWLA 4AI6A 1R4GA 3HHXA 3T1YM 2R44A 4MGHA 5DYGA 4L6V6 4CIZA 2QP9X 3QAUA 3ZH9B 2XZFA 1IN4A 1GKIA 4NSOB 4JV5M 1GO5A 2RKOA 4DV2M 2FNAA 1SG9A 3L27A 4XGIA 2Z3XA 1K3XA 1GVNA 4LF5M 3B9PA 2P5TA 1TH4A 4PT5A 1QAOA 3RFWA 3GRUA 3FUXA 1JR3D 3U60A 4M9ZA 2K9DA 3UK6A 3GPUA 3GQ5A 3U6CA 4L8RC 1FNNA 1YSYA 2WSCF 3U6SA 4JI6M 1XXHA 2LWXA 1NSFA 3VKGA 3GQ4A 4BLCA 2JY6B 3L28A 2L7HA 3T6PA 4LF4M 2OPFA 2UUCM 3MJ5A 5ITYA 2DAEA 2LVPC 3HU2A 3IECA 3AOEA 4XK8F 4JN6A 3PNYA 1QZEA 3WHLA 1WIVA 3SARA 4QNRA 4F2LA 2B3TA 1V34A 2D7GA 1IBMM 4I81A 4FWDA 4ITQA 2QPAA 4IBIA 2R0IA 1QQWA 4X62M 4NXMM 1G41A 4BB9A 3I4VA 2H5XA 2HCBA 1HNWM 3QWLA 1G8PA 4DV1M 3J27B 4FCWA 1L2CA 4D80A 2MJ5B 3C3DA 1PRBA 2YNMD 2UUBM 1HT2E 4GHAA 3FUTA 3E46A 2EKKA 2XFSA 4AG6A 2BWBA 3HWSA 1D2NA 3FTDA 3AOEC 4FCTA 4JI0M 3C3EA 5FTMA 4B7GA 1N34M 3U6OA 1GJSA 2XSZD 2XSZA 3JAMS 4KODA 3GLIE 2CUZA 3QYEA 4GITA 2J5YA 3K9PA 3GPXA 3D8LA 5DFLA 2C9CA 3TWMA 3HGIA 5A2QS 3EIEA 3AKZA 1R2YA 4IBBA 3SFZA 2GQFA 2XZUA 1IXZA 2BJVA 3FTFA 3JR5A 1IFYA 4LFAM 4DV6M 1HJPA 1VG5A 3GLHA 4YHHM 2UUAM 2HKJA 3GLHE 3VK8A 3GLIB 1IY2A 1EE8A 4R3DA 3SASA 5EP3A 2LVNC 5EXPA 2KNZA 3HU1A 1HNXM
chains in the Genus database with same CATH topology
3KSJA 4G4RA 1IXSB 3AJIB 4X66M 1NJGA 2DZOB 3K1JA 3GLFA 4PDGA 1PJIA 4RF1A 2VQFM 5IWAM 4DV4M 4DR3M 3K2LA 2RGOA 2UXBM 3SYLA 1GL7A 3I51A 3GLIA 2K47A 2UXCM 2BNKA 5EXTA 1E9RA 1QAQA 4EIWA 1L2BA 2ZM6M 1NY5A 3GLHB 3ILKA 3A46A 2Y20A 3M0EA 2DZNB 3THGA 3KVWA 1IN5A 3M7GA 1HQCA 4LJ6A 4OW0A 3A98B 1PM5A 1XWIA 2X4AA 2KZUA 3NBIA 1R2ZA 1MU5A 2HL7A 5IREB 2CEAA 5DYIA 3SAVA 4DR2M 4IBFA 1JR3A 3VFDA 4HLQA 2CHQA 2C9OA 5C1BA 1YUBA 1XHBA 5F3WA 2R45A 2V1UA 1HR0M 1GLNA 2QENA 4LF9M 4DR1M 1GL6A 2Y21A 1DGHB 5EP2A 1N77A 3OTOM 3WHKA 2J7OA 2ZAMA 3J2PB 3FTCA 4MM3B 3E9SA 2R65A 3SYKA 4MB7A 1Q3CA 2YQZA 1HQYE 3U6LA 3HU3A 3FYCA 4JYAM 1IM2A 5BR8M 3K8ZA 1IBKM 4G6ZA 4QNMA 4L78A 4GC9A 2QBYA 4DV3M 3KS8A 1OFIA 1J09A 5GKNA 2VIIA 1G59A 2XFTA 4IIWA 5KQ8A 8CATA 2E5LM 1IY1A 1XXHB 3KDSE 4M9XA 4AKGA 3UJNA 4ZPXA 3UGJA 3AFHA 4A3VB 5E26A 2EUCA 1KYIA 2R62A 1IN8A 2D7EA 2ZBKB 4IBCA 4M0WA 4DV7M 3SAUA 3SMSA 3HHZA 1L2DA 1G3IA 3I4YA 2XEPA 1JQJC 3BOSA 4Z6YA 3L25A 1N78A 1QVRA 4IBEA 3KFUG 4LZZA 2ERCA 4M9SA 3W0LB 4GKKM 3CF0A 5KO3A 3L26A 4DR5M 1SXJB 1T3TA 4AKHA 5H37D 2R4EA 2XLJA 3U5ZB 4AW4A 1ZQ9A 5ITTA 1N32M 2EO2A 4AQYM 3CF2A 1TDZA 1XNRM 1HT1E 1DGHA 1Z5CA 3J81S 4LFCM 3IG8A 5FTNA 3SHFA 2CE7A 4QOSA 1IQPA 1E9SA 4B7FA 3PNVA 4DUZM 7CATA 4II7A 4K0KM 1OFHA 1I4WA 2KRUA 2KA6B 2C98A 4D82A 2Z4RA 4OX9M 1J7KA 1SXJC 4G4NA 1DO0A 4LRTA 5EJCA 3ZCBB 4OVZA 3AL0C 2XF3A 3HJSA 5LMUM 3K92A 5BPVA 2G8LA 5ITXE 3AOGA 2QZ4A 2QCUA 4LFBM 1XMQM 3U6PA 4KLNA 4LJAA 1K3WA 3SC3A 3J80S 3GO8A 4PCZA 4FD2A 4XBOA 4AKIA 1UM8A 3FUUA 2ZANA 1LV7A 1FJGM 1L1ZA 3DA1A 1TGUA 5ITRA 3DFZA 4QOZC 4NSRA 2YFQA 3GQ3A 1L8QA 3JR4A 2DWZB 4DUYM 3A45A 3VLFB 3FUWA 1IN7A 3FKEA 2Y0TA 5FTJA 4FVMA 5FTLA 5KPZA 4I8OA 3FYDA 3SAWA 2DXIA 2M5ZA 3U61B 1NNJA 2FOIC 2L09A 5ITQA 3T15A 4YY3M 2W82A 1OJLA 1YE9A 3LVVA 2KRKA 5JI2E 1KSFX 2XH9A 5DNYA 3HHWA 4DR6M 1E32A 2EA0A 4B3MM 2H1RA 2L6OA 4LJ7A 4GC5A 4DR7M 2HHHM 5EQTA 3KOZE 3SBJA 1QZMA 2C5RA 5KPTA 3W0FA 4HL4A 4FWHA 3FD9A 3D8BA 4MGYE 4GIPA 3CF6E 2DWMA 3KP0E 3GPPA 1XMOM 5FTKA 4L16A 4LY6A 3U6DA 4LGYA 1ORYB 4D81A 4B3TM 4AZFA 3HJQA 3SHGB 1XNQM 2O5RA 1IN6A 2F5SA 3RGPA 4MGIE 1K82A 3VDPA 2UXDM 4W5WA 2C96A 4JI3M 4LF8M 3R9XB 5EP4A 2C99A 1R7RA 2BJWA 2KXEA 3KS4A 4LJ4A 4NXNM 1R6BX 3KOWE 4PDIA 1WXQA 5EXSA 4FW9A 1MX0A 4LF6M 1NNUC 3J7AS 1E94E 4MGKE 3Q8XA 2A5YB 3DOAA 4GHLA 2DVWB 1W5SA 4LRSA 3ZC7B 3U5ZA 2R4JA 4CISA 2YR0A 5ITXA 1SXJD 3GRYA 1KFVA 3KSXA 2Q2EB 4GRIA 4WURA 2CV1A 1N75A 3U6QA 4IBGA 2F4VM 3MK6A 4IBKA 3AV0A 4JI7M 1XC8A 1J5EM 5E6JA 2FFJA 1ZAEA 4NRVA 2KW0A 2X49A 4WW0A 4KO8A 5FSWA 4Z8XA 4OU7A 1C1KA 4LGMA 5IT9S 3HJ8A 2VQEM 2LXEA 2Y0QA 3T1HM 4G4OA 2CHGA 4NOOB 1NHWC 3L2AA 3TPZA 2KZSA 1Z5BA 1DGFA 1TDHA 2L7IA 2DHRA 4LCBA 3J7BA 4TUWA 4I5SA 1L1TA 2QBYB 1Z5AA 1S3SA 4NL4H 1HNZM 2Z4SA 1TH2A 3KOYE 3A42A 2OQ4A 4JI8M 1VDDA 4JI1M 1Q3BA 4JI5M 3L29A 4RF0A 4LG2A 3KOXE 2F5NA 1DGGA 2LNHC 2F5QA 1Q39A 3TWKA 2ZAOA 3RGSA 2FE8A 2CV2A 4MH0E 4JI4M 2KEBA 4LJ5A 3GPYA 2V1CA 1IXRC 5IZ7D 1IY0A 4GH9A 4BBAA 1W5TA 2F5OA 4KHPM 3TQSA 5KPRA 2G5GX 3U6EA 3E4RA 4JI2M 4QHSA 4B3RM 5ITUA 4B7HA 2V6ZM 1Z6TA 4IBJA 5EXXA 3PXGA 3PFIA 3LQQA 1N33M 2UU9M 3PVSA 4DR4M 3C58A 3UZUA 3FUVA 4LJ8A 5C18A 2R18A 3TL4X 3LQRA 3GLGA 1I94M 1H6UA 3RE8A 4DV0M 1SXJE 1QYRA 4G4QA 3GLGB 2CHVA 3U61A 3NWLA 4B08A 4IBDA 1DO2A 3KP1E 2R46A 3GRVA 3U6MA 2J7NA 2XGNA 3R8FA 2CV0A 4LZJA 5EP1A 3IG5A 4QHTA 2Z7JA 3GP1A 2JA2A 4CGYB 3UMMA 4M0DA 3GLFB 4X65M 1QAMA 4RNAA 1IBLM 4DV5M 1DGBA 2F5PA 1NHGC 2LH0A 3SATA 2I7NA 4I4LA 4LJ9A 5KQDA 3KXEC 2DWLA 3VDUA 4MGZE 4IJFA 2D7HA 1Z59A 4GMQA 2CFOA 4L4UA 3GRRA 2NQ8C 3SMPA 1QANA 3H4MA 4JXJA 5FLXS 2DWNA 4OVZB 2RGHA 3DZDA 4R7GA 5JI3E 3VK7A 1PJJA 4CHTB 2I7PA 4LF7M 3KW6A 4L15A 4S12A 1N36M 1TH3A 1NVMA 2X8AA 3EIHA 4NRWA 3M6AA 3TE6A 3T38A 1NJFA 1X37A 2M60A 2AHMA 1NY6A 3CTWB 4PD2A 3HHYA 3U60B 1G4AE 3HKPA 4X64M 4AG5A 3VKHA 4GKJM 3MHVC 3LVWA 4IJEA 4P16A 4FCVA 3FTEA 4REZA 1SXJA 4B3SM 4FWGA 3TWLA 4AI6A 3HHXA 3T1YM 4MGHA 5DYGA 2QP9X 3QAUA 3ZH9B 2XZFA 1IN4A 1GKIA 4NSOB 4JV5M 2RKOA 4DV2M 2FNAA 3L27A 4XGIA 2Z3XA 1K3XA 4LF5M 1GVNA 3B9PA 2P5TA 1TH4A 4PT5A 1QAOA 3RFWA 3GRUA 3FUXA 1JR3D 3U60A 4M9ZA 4L8RC 3UK6A 3GPUA 3GQ5A 3U6CA 1FNNA 1YSYA 3U6SA 4JI6M 1XXHA 2LWXA 1NSFA 3VKGA 3GQ4A 4BLCA 3L28A 2L7HA 4LF4M 2OPFA 2UUCM 3MJ5A 5ITYA 3HU2A 3AOEA 4JN6A 3PNYA 3WHLA 3SARA 4QNRA 2D7GA 1IBMM 4I81A 4FWDA 4ITQA 2QPAA 4IBIA 1QQWA 4X62M 4NXMM 1G41A 4BB9A 3I4VA 2HCBA 1HNWM 3QWLA 1G8PA 4DV1M 3J27B 4FCWA 1L2CA 4D80A 2YNMD 2UUBM 1HT2E 4GHAA 3FUTA 2XFSA 4AG6A 3HWSA 1D2NA 3FTDA 3AOEC 4FCTA 4JI0M 5FTMA 4B7GA 1N34M 3U6OA 2XSZD 2XSZA 3JAMS 4KODA 2CUZA 4GITA 3GPXA 3D8LA 3TWMA 2C9CA 3HGIA 5A2QS 3EIEA 3AKZA 1R2YA 4IBBA 3SFZA 2XZUA 1IXZA 2BJVA 3FTFA 3JR5A 4LFAM 4DV6M 3GLHA 4YHHM 2UUAM 2HKJA 3VK8A 3GLIB 1IY2A 1EE8A 4R3DA 3SASA 5EP3A 5LMNM 5EXPA 3LMMA 3HU1A 1HNXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFV A;  5ITX A;  4G4R A;  3VK7 A;  1PJJ A;  4OX9 M;  4X66 M;  2Q2E B;  4G4N A;  4PDG A;  4LF7 M;  1PJI A;  3U6Q A;  2VQF M;  2F4V M;  5IWA M;  4JI7 M;  4DV4 M;  4DR3 M;  1XC8 A;  1N36 M;  1J5E M;  4NRW A;  2UXB M;  5LMU M;  4NRV A;  2UXC M;  5ITX E;  4PD2 A;  5IT9 S;  1L2B A;  4LFB M;  2ZM6 M;  3A46 A;  2VQE M;  1XMQ M;  3U6P A;  4X64 M;  1K3W A;  3J80 S;  3GO8 A;  4PCZ A;  3T1H M;  4GKJ M;  4G4O A;  1FJG M;  1L1Z A;  1PM5 A;  5ITR A;  4B3S M;  1R2Z A;  3GQ3 A;  3TWL A;  3JR4 A;  1MU5 A;  1Z5B A;  3T1Y M;  4DUY M;  1TDH A;  3A45 A;  3SAV A;  4DR2 M;  1L1T A;  1Z5A A;  2XZF A;  1HNZ M;  4JV5 M;  3A42 A;  2OQ4 A;  4DV2 M;  4JI8 M;  4JI1 M;  1Q3B A;  1K3X A;  1HR0 M;  4JI5 M;  4LF5 M;  4LF9 M;  4DR1 M;  2F5N A;  2F5Q A;  1Q39 A;  3TWK A;  3SAW A;  1NNJ A;  4JI4 M;  4YY3 M;  5ITQ A;  3OTO M;  3GPU A;  3GQ5 A;  3U6C A;  3U6S A;  3GPY A;  4JI6 M;  3GQ4 A;  2F5O A;  4KHP M;  4LF4 M;  2OPF A;  3U6E A;  2UUC M;  4DR6 M;  4MB7 A;  5ITY A;  1Q3C A;  2EA0 A;  3U6L A;  4JI2 M;  4B3M M;  4B3R M;  4JYA M;  5ITU A;  5BR8 M;  1IBK M;  3SAR A;  1N33 M;  4DR7 M;  1IBM M;  4DV3 M;  2HHH M;  2UU9 M;  4ITQ A;  3SBJ A;  4DR4 M;  3C58 A;  3W0F A;  4NXM M;  4X62 M;  2E5L M;  1I94 M;  3GPP A;  1HNW M;  4DV1 M;  4DV0 M;  1L2C A;  1XMO M;  4G4Q A;  2UUB M;  3U6D A;  3SAU A;  2ZBK B;  4DV7 M;  4B3T M;  1L2D A;  3U6M A;  4JI0 M;  1N34 M;  3U6O A;  1XNQ M;  3JAM S;  3GP1 A;  2F5S A;  1K82 A;  3GPX A;  2UXD M;  3TWM A;  4JI3 M;  4X65 M;  5A2Q S;  1R2Y A;  4LF8 M;  1IBL M;  4GKK M;  4DV5 M;  4DR5 M;  2XZU A;  4NXN M;  2F5P A;  3JR5 A;  3SAT A;  5ITT A;  4PDI A;  1N32 M;  4LFA M;  4AQY M;  4DV6 M;  1MX0 A;  1TDZ A;  4LF6 M;  3J81 S;  1Z5C A;  1XNR M;  3J7A S;  4YHH M;  4LFC M;  2UUA M;  3DOA A;  1Z59 A;  2HKJ A;  3VK8 A;  1EE8 A;  4DUZ M;  4K0K M;  3SAS A;  5FLX S;  5LMN M;  4CIS A;  1HNX M; 
#chains in the Genus database with same CATH topology
 3KSJ A;  4G4R A;  2LHG A;  1IXS B;  3AJI B;  4X66 M;  1NJG A;  2DZO B;  3K1J A;  1D0M A;  1ZMV A;  4PDG A;  3GLF A;  1PJI A;  4RF1 A;  2VQF M;  5L8R F;  5IWA M;  4DV4 M;  2Z8Y M;  4DR3 M;  3K2L A;  2RGO A;  2UXB M;  3SYL A;  1GL7 A;  3I51 A;  3GLI A;  2K47 A;  2UXC M;  2BNK A;  5EXT A;  1E9R A;  1QAQ A;  4EIW A;  1L2B A;  2ZM6 M;  1NY5 A;  3GLH B;  3ILK A;  3A46 A;  2Y20 A;  3M0E A;  2DZN B;  3THG A;  3KVW A;  2WZJ A;  1IN5 A;  3Q8G A;  1EIJ A;  3M7G A;  3NBX X;  1HQC A;  4LJ6 A;  4OW0 A;  3A98 B;  1PM5 A;  1XWI A;  2X4A A;  2KZU A;  3NBI A;  1R2Z A;  1MU5 A;  2HL7 A;  5IRE B;  2CEA A;  5DYI A;  3SAV A;  4DR2 M;  4IBF A;  1JR3 A;  2JP7 A;  3CGW A;  3VFD A;  4HLQ A;  2CHQ A;  2BWE A;  2C9O A;  5C1B A;  1YUB A;  4R71 A;  1QUT A;  1XHB A;  5F3W A;  2R45 A;  2V1U A;  1HR0 M;  1GLN A;  2QEN A;  4LF9 M;  4DR1 M;  1GL6 A;  1P3Q Q;  2DKL A;  1PJQ A;  4KT0 F;  2Y21 A;  1DGH B;  4Y28 F;  5EP2 A;  1N77 A;  3FE3 A;  2OOB A;  3OTO M;  3WHK A;  1WGL A;  2J7O A;  2JWS A;  2ZAM A;  5LMN M;  3J2P B;  3FTC A;  4MM3 B;  1VQ1 A;  3E9S A;  2R65 A;  3SYK A;  4MB7 A;  1Q3C A;  2YQZ A;  1HQY E;  3U6L A;  3HU3 A;  3FYC A;  1R5L A;  4JYA M;  1IM2 A;  5BR8 M;  2RRU A;  3E21 A;  3K8Z A;  2MRO B;  4G6Z A;  4QNM A;  4GC9 A;  4L78 A;  1IBK M;  2QBY A;  4DV3 M;  3KS8 A;  1OFI A;  1J09 A;  1LTM A;  1TTE A;  2ZTC A;  1VDL A;  5GKN A;  2VII A;  1XXH E;  1G59 A;  2XFT A;  4IIW A;  5KQ8 A;  8CAT A;  3B7N A;  2E5L M;  1IY1 A;  1XXH B;  3KDS E;  4M9X A;  4AKG A;  3UJN A;  4ZPX A;  3UGJ A;  3AFH A;  4A3V B;  5E26 A;  2EUC A;  1KYI A;  2R62 A;  1IN8 A;  1NO1 A;  2D7E A;  2ZBK B;  4IBC A;  4M0W A;  4DV7 M;  3SMS A;  3SAU A;  3HHZ A;  1OAI A;  1A5T A;  1L2D A;  1G3I A;  2JY5 A;  3I4Y A;  4NC6 A;  2XEP A;  1JQJ C;  2MR9 A;  3BOS A;  4Z6Y A;  3L25 A;  1N78 A;  1QVR A;  4IBE A;  1Q02 A;  3KFU G;  1OAO C;  4LZZ A;  2OOA A;  2ERC A;  2K0B X;  4M9S A;  3W0L B;  3FRI A;  2CP8 A;  4P17 A;  4GKK M;  3CF0 A;  3LMM A;  5KO3 A;  3L26 A;  4DR5 M;  1SXJ B;  1T3T A;  4AKH A;  5H37 D;  2R4E A;  2XLJ A;  3U5Z B;  4AW4 A;  1ZQ9 A;  5ITT A;  1N32 M;  2EO2 A;  4AQY M;  3CF2 A;  3LCU A;  1TDZ A;  1XNR M;  1HT1 E;  1DGH A;  1Z5C A;  3J81 S;  4LFC M;  1GJT A;  3IG8 A;  5FTN A;  3SHF A;  2CE7 A;  4QOS A;  1IQP A;  1E9S A;  4B7F A;  2MH8 A;  3PNV A;  7CAT A;  4II7 A;  4DUZ M;  3GLF E;  4K0K M;  1OFH A;  1I4W A;  2KRU A;  2KA6 B;  2C98 A;  2DAM A;  4D82 A;  2Z4R A;  3HZJ A;  2DAK A;  4OX9 M;  1J7K A;  1SXJ C;  3F92 A;  4G4N A;  1DO0 A;  4LRT A;  5EJC A;  3BXW A;  3ZCB B;  4OVZ A;  3AL0 C;  2XF3 A;  3HJS A;  4Q7J A;  5LMU M;  3K92 A;  5BPV A;  2G8L A;  5ITX E;  3AOG A;  2QZ4 A;  3B7Z A;  1WHC A;  4ANR A;  2QCU A;  2APL A;  4LFB M;  2FH0 A;  2QHO B;  1XMQ M;  3B74 A;  3U6P A;  1EFU B;  2GNO A;  4KLN A;  4LJA A;  3SC3 A;  1K3W A;  3J80 S;  3GO8 A;  4PCZ A;  4FD2 A;  4XBO A;  4AKI A;  1UM8 A;  3FUU A;  2ZAN A;  1LV7 A;  1FJG M;  4CJ6 A;  3HY5 A;  1L1Z A;  2N35 A;  1WGN A;  3DA1 A;  1TGU A;  5ITR A;  3DFZ A;  4QOZ C;  4NSR A;  2YFQ A;  2O01 F;  1L8Q A;  2ZTD A;  3GQ3 A;  2DWZ B;  3W67 A;  3JR4 A;  4DUY M;  1GAB A;  3A45 A;  2FS1 A;  3VLF B;  3FUW A;  1IN7 A;  3FKE A;  2WSE F;  2Y0T A;  2LTU A;  2LVO C;  5FTJ A;  2OO9 A;  4FVM A;  4DBG B;  5FTL A;  2QQ8 A;  1MN3 A;  5KPZ A;  1D0K A;  4I8O A;  3FYD A;  1T6O A;  3SAW A;  2DAI A;  3W68 A;  2DXI A;  2M5Z A;  3U61 B;  4WP2 A;  1NNJ A;  2FOI C;  2L09 A;  5ITQ A;  3T15 A;  4YY3 M;  2W82 A;  1OJL A;  1YE9 A;  3K9O A;  3V76 A;  3LVV A;  2KRK A;  3IHP A;  2JZ1 A;  5JI2 E;  1KSF X;  2XH9 A;  5DNY A;  3HHW A;  2R6F A;  1VEJ A;  4DR6 M;  1E32 A;  2EA0 A;  2DNA A;  4B3M M;  1TR8 A;  2H1R A;  2L6O A;  4LJ7 A;  4GC5 A;  4DR7 M;  1WR1 B;  2HHH M;  5EQT A;  3KOZ E;  2KNV A;  3SBJ A;  1QZM A;  2C5R A;  2HWJ A;  1UFZ A;  3W0F A;  5KPT A;  4HL4 A;  4FWH A;  3FD9 A;  3D8B A;  4MGY E;  4GIP A;  3CF6 E;  2DWM A;  3KP0 E;  3GPP A;  2DAG A;  1XMO M;  1OIP A;  5FTK A;  4L16 A;  4LY6 A;  3U6D A;  4LGY A;  2JUJ A;  2O25 A;  1ORY B;  4D81 A;  4B3T M;  3GLG E;  4AZF A;  3HJQ A;  3SHG B;  3C9P A;  1XNQ M;  2O5R A;  1AIP C;  1TF0 B;  1IN6 A;  1RU3 A;  1F4I A;  2F5S A;  3RGP A;  4MGI E;  1K82 A;  1G71 A;  3VDP A;  2UXD M;  4W5W A;  2C96 A;  3MMP A;  4RKU F;  4JI3 M;  4LF8 M;  5EP4 A;  2C99 A;  3R9X B;  1R7R A;  2BJW A;  2KXE A;  2LHC A;  3KS4 A;  4G3O A;  4LJ4 A;  4NXN M;  1R6B X;  1NV9 A;  3KOW E;  4PDI A;  1WXQ A;  5EXS A;  2EJS A;  2DHY A;  4FW9 A;  1CUK A;  1MX0 A;  4LF6 M;  2QSF X;  1NNU C;  3J7A S;  1E94 E;  3LW5 F;  4MGK E;  3Q8X A;  1YLA A;  2A5Y B;  3DOA A;  4GHL A;  1MJG M;  2DVW B;  1W5S A;  4LRS A;  3ZC7 B;  3U5Z A;  2KNA A;  2R4J A;  4CIS A;  2YR0 A;  1AUA A;  1SXJ D;  2LVA A;  3GRY A;  5ITX A;  1KFV A;  3KSX A;  2Q2E B;  4GRI A;  4WUR A;  2CV1 A;  1N75 A;  2JY8 A;  3U6Q A;  4IBG A;  2DEN A;  3MK6 A;  4IBK A;  3AV0 A;  2F4V M;  1V33 A;  4JI7 M;  1XC8 A;  1J5E M;  5E6J A;  2DZL A;  3I04 M;  1PJS A;  2FFJ A;  1ZAE A;  4NRV A;  2KW0 A;  2X49 A;  4WW0 A;  4KO8 A;  5FSW A;  4Z8X A;  4OU7 A;  1C1K A;  4LGM A;  5IT9 S;  3HJ8 A;  4F1I A;  2VQE M;  2JXN A;  3I01 M;  2LXE A;  2Y0Q A;  3T1H M;  4G4O A;  3B7Q A;  2CHG A;  4NOO B;  1NHW C;  3L2A A;  1BVS A;  2KZS A;  3TPZ A;  1Z5B A;  1DGF A;  1TDH A;  2L7I A;  2DHR A;  4LCB A;  3J7B A;  4TUW A;  1DV0 A;  4I5S A;  1L1T A;  2QBY B;  1Z5A A;  1S3S A;  4NL4 H;  1HNZ M;  2Z4S A;  1TH2 A;  3KOY E;  3A42 A;  2OQ4 A;  4JI8 M;  1VDD A;  4JI1 M;  1Q3B A;  2KHH A;  3L29 A;  4JI5 M;  4RF0 A;  4LG2 A;  3KOX E;  2F5N A;  1DGG A;  2LNH C;  1C7Y A;  1Q39 A;  3TWK A;  2ZAO A;  2F5Q A;  3RGS A;  2FE8 A;  2CV2 A;  4MH0 E;  2VF7 A;  4JI4 M;  3H4J A;  2KEB A;  4LJ5 A;  2L4E A;  3GPY A;  3HX3 A;  2V1C A;  1IXR C;  5IZ7 D;  1IY0 A;  4GH9 A;  4BBA A;  1W5T A;  2F5O A;  4KHP M;  3TQS A;  5KPR A;  2G5G X;  3U6E A;  3E4R A;  4JI2 M;  4QHS A;  4B3R M;  1IXS A;  5ITU A;  4B7H A;  2V6Z M;  3ZQJ A;  1Z6T A;  4IBJ A;  5EXX A;  3PXG A;  3PFI A;  3LQQ A;  1N33 M;  2UU9 M;  3PVS A;  4DR4 M;  3C58 A;  2JNH A;  2CRU A;  3UZU A;  1NV8 A;  3FUV A;  2KDL A;  4LJ8 A;  5C18 A;  3LCV B;  2R18 A;  3TL4 X;  1QDR A;  3LQR A;  3GLG A;  1OQY A;  1OIZ A;  1I94 M;  1H6U A;  3RE8 A;  4DV0 M;  1SXJ E;  1QYR A;  4G4Q A;  3GLG B;  2CHV A;  1ZMU A;  3U61 A;  3NWL A;  4B08 A;  2JZ0 A;  4IBD A;  1DO2 A;  3KP1 E;  2R46 A;  3GRV A;  3U6M A;  2J7N A;  2XGN A;  3R8F A;  2CV0 A;  1Y8G A;  4LZJ A;  5EP1 A;  1JR3 E;  1QUS A;  2VF8 A;  3IG5 A;  4QHT A;  2K6B A;  2QNJ A;  2Z7J A;  2JA2 A;  3GP1 A;  4CGY B;  3UMM A;  1PJT A;  4M0D A;  3GLF B;  4X65 M;  1JB0 F;  1QAM A;  4RNA A;  1IBL M;  1VEK A;  1ZMW A;  4DV5 M;  1DGB A;  2LVQ D;  1T43 A;  1XB2 B;  1QDT A;  2F5P A;  1NHG C;  2LH0 A;  2WSF F;  3SAT A;  1WJ7 A;  2I7N A;  3B89 A;  4I4L A;  4LJ9 A;  5KQD A;  2L4F A;  3KXE C;  2DWL A;  2CWB A;  2JY7 A;  3VDU A;  4MGZ E;  4IJF A;  2D7H A;  1Z59 A;  4GMQ A;  2CFO A;  4L4U A;  1ZV1 A;  3GRR A;  3QYB A;  2NQ8 C;  3SMP A;  1QAN A;  3H4M A;  4JXJ A;  5FLX S;  2DWN A;  3BBZ A;  2RGH A;  4OVZ B;  3DZD A;  4R7G A;  5JI3 E;  1PGY A;  3VK7 A;  1PJJ A;  2MGW A;  4CHT B;  2I7P A;  4LF7 M;  3KW6 A;  4L15 A;  4S12 A;  1V92 A;  2LBC A;  3FRH A;  1N36 M;  1TH3 A;  1NVM A;  2X8A A;  3EIH A;  4NRW A;  3M6A A;  3TE6 A;  2G3Q A;  3T38 A;  1NJF A;  1X37 A;  2HAK A;  2AHM A;  1NY6 A;  2M60 A;  3CTW B;  4PD2 A;  3HHY A;  3U60 B;  1G4A E;  1OTR A;  2EKF A;  3HKP A;  4X64 M;  2VDB B;  4UN2 B;  1VEG A;  2DI0 A;  2L2D A;  4GEW A;  4AG5 A;  3VKH A;  4HEO A;  4GKJ M;  3MHV C;  3LVW A;  4IJE A;  4P16 A;  4FCV A;  3FTE A;  4REZ A;  1OKS A;  1SXJ A;  4B3S M;  4FWG A;  1D0L A;  3TWL A;  4AI6 A;  1R4G A;  3HHX A;  3T1Y M;  2R44 A;  4MGH A;  5DYG A;  4L6V 6;  4CIZ A;  2QP9 X;  3QAU A;  3ZH9 B;  2XZF A;  1IN4 A;  1GKI A;  4NSO B;  4JV5 M;  1GO5 A;  2RKO A;  4DV2 M;  2FNA A;  1SG9 A;  3L27 A;  4XGI A;  2Z3X A;  1K3X A;  1GVN A;  4LF5 M;  3B9P A;  2P5T A;  1TH4 A;  4PT5 A;  1QAO A;  3RFW A;  3GRU A;  3FUX A;  1JR3 D;  3U60 A;  4M9Z A;  2K9D A;  3UK6 A;  3GPU A;  3GQ5 A;  3U6C A;  4L8R C;  1FNN A;  1YSY A;  2WSC F;  3U6S A;  4JI6 M;  1XXH A;  2LWX A;  1NSF A;  3VKG A;  3GQ4 A;  4BLC A;  2JY6 B;  3L28 A;  2L7H A;  3T6P A;  4LF4 M;  2OPF A;  2UUC M;  3MJ5 A;  5ITY A;  2DAE A;  2LVP C;  3HU2 A;  3IEC A;  3AOE A;  4XK8 F;  4JN6 A;  3PNY A;  1QZE A;  3WHL A;  1WIV A;  3SAR A;  4QNR A;  4F2L A;  2B3T A;  1V34 A;  2D7G A;  1IBM M;  4I81 A;  4FWD A;  4ITQ A;  2QPA A;  4IBI A;  2R0I A;  1QQW A;  4X62 M;  4NXM M;  1G41 A;  4BB9 A;  3I4V A;  2H5X A;  2HCB A;  1HNW M;  3QWL A;  1G8P A;  4DV1 M;  3J27 B;  4FCW A;  1L2C A;  4D80 A;  2MJ5 B;  3C3D A;  1PRB A;  2YNM D;  2UUB M;  1HT2 E;  4GHA A;  3FUT A;  3E46 A;  2EKK A;  2XFS A;  4AG6 A;  2BWB A;  3HWS A;  1D2N A;  3FTD A;  3AOE C;  4FCT A;  4JI0 M;  3C3E A;  5FTM A;  4B7G A;  1N34 M;  3U6O A;  1GJS A;  2XSZ D;  2XSZ A;  3JAM S;  4KOD A;  3GLI E;  2CUZ A;  3QYE A;  4GIT A;  2J5Y A;  3K9P A;  3GPX A;  3D8L A;  5DFL A;  2C9C A;  3TWM A;  3HGI A;  5A2Q S;  3EIE A;  3AKZ A;  1R2Y A;  4IBB A;  3SFZ A;  2GQF A;  2XZU A;  1IXZ A;  2BJV A;  3FTF A;  3JR5 A;  1IFY A;  4LFA M;  4DV6 M;  1HJP A;  1VG5 A;  3GLH A;  4YHH M;  2UUA M;  2HKJ A;  3GLH E;  3VK8 A;  3GLI B;  1IY2 A;  1EE8 A;  4R3D A;  3SAS A;  5EP3 A;  2LVN C;  5EXP A;  2KNZ A;  3HU1 A;  1HNX M; 
#chains in the Genus database with same CATH homology
 3KSJ A;  4G4R A;  1IXS B;  3AJI B;  4X66 M;  1NJG A;  2DZO B;  3K1J A;  3GLF A;  4PDG A;  1PJI A;  4RF1 A;  2VQF M;  5IWA M;  4DV4 M;  4DR3 M;  3K2L A;  2RGO A;  2UXB M;  3SYL A;  1GL7 A;  3I51 A;  3GLI A;  2K47 A;  2UXC M;  2BNK A;  5EXT A;  1E9R A;  1QAQ A;  4EIW A;  1L2B A;  2ZM6 M;  1NY5 A;  3GLH B;  3ILK A;  3A46 A;  2Y20 A;  3M0E A;  2DZN B;  3THG A;  3KVW A;  1IN5 A;  3M7G A;  1HQC A;  4LJ6 A;  4OW0 A;  3A98 B;  1PM5 A;  1XWI A;  2X4A A;  2KZU A;  3NBI A;  1R2Z A;  1MU5 A;  2HL7 A;  5IRE B;  2CEA A;  5DYI A;  3SAV A;  4DR2 M;  4IBF A;  1JR3 A;  3VFD A;  4HLQ A;  2CHQ A;  2C9O A;  5C1B A;  1YUB A;  1XHB A;  5F3W A;  2R45 A;  2V1U A;  1HR0 M;  1GLN A;  2QEN A;  4LF9 M;  4DR1 M;  1GL6 A;  2Y21 A;  1DGH B;  5EP2 A;  1N77 A;  3OTO M;  3WHK A;  2J7O A;  2ZAM A;  3J2P B;  3FTC A;  4MM3 B;  3E9S A;  2R65 A;  3SYK A;  4MB7 A;  1Q3C A;  2YQZ A;  1HQY E;  3U6L A;  3HU3 A;  3FYC A;  4JYA M;  1IM2 A;  5BR8 M;  3K8Z A;  1IBK M;  4G6Z A;  4QNM A;  4L78 A;  4GC9 A;  2QBY A;  4DV3 M;  3KS8 A;  1OFI A;  1J09 A;  5GKN A;  2VII A;  1G59 A;  2XFT A;  4IIW A;  5KQ8 A;  8CAT A;  2E5L M;  1IY1 A;  1XXH B;  3KDS E;  4M9X A;  4AKG A;  3UJN A;  4ZPX A;  3UGJ A;  3AFH A;  4A3V B;  5E26 A;  2EUC A;  1KYI A;  2R62 A;  1IN8 A;  2D7E A;  2ZBK B;  4IBC A;  4M0W A;  4DV7 M;  3SAU A;  3SMS A;  3HHZ A;  1L2D A;  1G3I A;  3I4Y A;  2XEP A;  1JQJ C;  3BOS A;  4Z6Y A;  3L25 A;  1N78 A;  1QVR A;  4IBE A;  3KFU G;  4LZZ A;  2ERC A;  4M9S A;  3W0L B;  4GKK M;  3CF0 A;  5KO3 A;  3L26 A;  4DR5 M;  1SXJ B;  1T3T A;  4AKH A;  5H37 D;  2R4E A;  2XLJ A;  3U5Z B;  4AW4 A;  1ZQ9 A;  5ITT A;  1N32 M;  2EO2 A;  4AQY M;  3CF2 A;  1TDZ A;  1XNR M;  1HT1 E;  1DGH A;  1Z5C A;  3J81 S;  4LFC M;  3IG8 A;  5FTN A;  3SHF A;  2CE7 A;  4QOS A;  1IQP A;  1E9S A;  4B7F A;  3PNV A;  4DUZ M;  7CAT A;  4II7 A;  4K0K M;  1OFH A;  1I4W A;  2KRU A;  2KA6 B;  2C98 A;  4D82 A;  2Z4R A;  4OX9 M;  1J7K A;  1SXJ C;  4G4N A;  1DO0 A;  4LRT A;  5EJC A;  3ZCB B;  4OVZ A;  3AL0 C;  2XF3 A;  3HJS A;  5LMU M;  3K92 A;  5BPV A;  2G8L A;  5ITX E;  3AOG A;  2QZ4 A;  2QCU A;  4LFB M;  1XMQ M;  3U6P A;  4KLN A;  4LJA A;  1K3W A;  3SC3 A;  3J80 S;  3GO8 A;  4PCZ A;  4FD2 A;  4XBO A;  4AKI A;  1UM8 A;  3FUU A;  2ZAN A;  1LV7 A;  1FJG M;  1L1Z A;  3DA1 A;  1TGU A;  5ITR A;  3DFZ A;  4QOZ C;  4NSR A;  2YFQ A;  3GQ3 A;  1L8Q A;  3JR4 A;  2DWZ B;  4DUY M;  3A45 A;  3VLF B;  3FUW A;  1IN7 A;  3FKE A;  2Y0T A;  5FTJ A;  4FVM A;  5FTL A;  5KPZ A;  4I8O A;  3FYD A;  3SAW A;  2DXI A;  2M5Z A;  3U61 B;  1NNJ A;  2FOI C;  2L09 A;  5ITQ A;  3T15 A;  4YY3 M;  2W82 A;  1OJL A;  1YE9 A;  3LVV A;  2KRK A;  5JI2 E;  1KSF X;  2XH9 A;  5DNY A;  3HHW A;  4DR6 M;  1E32 A;  2EA0 A;  4B3M M;  2H1R A;  2L6O A;  4LJ7 A;  4GC5 A;  4DR7 M;  2HHH M;  5EQT A;  3KOZ E;  3SBJ A;  1QZM A;  2C5R A;  5KPT A;  3W0F A;  4HL4 A;  4FWH A;  3FD9 A;  3D8B A;  4MGY E;  4GIP A;  3CF6 E;  2DWM A;  3KP0 E;  3GPP A;  1XMO M;  5FTK A;  4L16 A;  4LY6 A;  3U6D A;  4LGY A;  1ORY B;  4D81 A;  4B3T M;  4AZF A;  3HJQ A;  3SHG B;  1XNQ M;  2O5R A;  1IN6 A;  2F5S A;  3RGP A;  4MGI E;  1K82 A;  3VDP A;  2UXD M;  4W5W A;  2C96 A;  4JI3 M;  4LF8 M;  3R9X B;  5EP4 A;  2C99 A;  1R7R A;  2BJW A;  2KXE A;  3KS4 A;  4LJ4 A;  4NXN M;  1R6B X;  3KOW E;  4PDI A;  1WXQ A;  5EXS A;  4FW9 A;  1MX0 A;  4LF6 M;  1NNU C;  3J7A S;  1E94 E;  4MGK E;  3Q8X A;  2A5Y B;  3DOA A;  4GHL A;  2DVW B;  1W5S A;  4LRS A;  3ZC7 B;  3U5Z A;  2R4J A;  4CIS A;  2YR0 A;  5ITX A;  1SXJ D;  3GRY A;  1KFV A;  3KSX A;  2Q2E B;  4GRI A;  4WUR A;  2CV1 A;  1N75 A;  3U6Q A;  4IBG A;  2F4V M;  3MK6 A;  4IBK A;  3AV0 A;  4JI7 M;  1XC8 A;  1J5E M;  5E6J A;  2FFJ A;  1ZAE A;  4NRV A;  2KW0 A;  2X49 A;  4WW0 A;  4KO8 A;  5FSW A;  4Z8X A;  4OU7 A;  1C1K A;  4LGM A;  5IT9 S;  3HJ8 A;  2VQE M;  2LXE A;  2Y0Q A;  3T1H M;  4G4O A;  2CHG A;  4NOO B;  1NHW C;  3L2A A;  3TPZ A;  2KZS A;  1Z5B A;  1DGF A;  1TDH A;  2L7I A;  2DHR A;  4LCB A;  3J7B A;  4TUW A;  4I5S A;  1L1T A;  2QBY B;  1Z5A A;  1S3S A;  4NL4 H;  1HNZ M;  2Z4S A;  1TH2 A;  3KOY E;  3A42 A;  2OQ4 A;  4JI8 M;  1VDD A;  4JI1 M;  1Q3B A;  4JI5 M;  3L29 A;  4RF0 A;  4LG2 A;  3KOX E;  2F5N A;  1DGG A;  2LNH C;  2F5Q A;  1Q39 A;  3TWK A;  2ZAO A;  3RGS A;  2FE8 A;  2CV2 A;  4MH0 E;  4JI4 M;  2KEB A;  4LJ5 A;  3GPY A;  2V1C A;  1IXR C;  5IZ7 D;  1IY0 A;  4GH9 A;  4BBA A;  1W5T A;  2F5O A;  4KHP M;  3TQS A;  5KPR A;  2G5G X;  3U6E A;  3E4R A;  4JI2 M;  4QHS A;  4B3R M;  5ITU A;  4B7H A;  2V6Z M;  1Z6T A;  4IBJ A;  5EXX A;  3PXG A;  3PFI A;  3LQQ A;  1N33 M;  2UU9 M;  3PVS A;  4DR4 M;  3C58 A;  3UZU A;  3FUV A;  4LJ8 A;  5C18 A;  2R18 A;  3TL4 X;  3LQR A;  3GLG A;  1I94 M;  1H6U A;  3RE8 A;  4DV0 M;  1SXJ E;  1QYR A;  4G4Q A;  3GLG B;  2CHV A;  3U61 A;  3NWL A;  4B08 A;  4IBD A;  1DO2 A;  3KP1 E;  2R46 A;  3GRV A;  3U6M A;  2J7N A;  2XGN A;  3R8F A;  2CV0 A;  4LZJ A;  5EP1 A;  3IG5 A;  4QHT A;  2Z7J A;  3GP1 A;  2JA2 A;  4CGY B;  3UMM A;  4M0D A;  3GLF B;  4X65 M;  1QAM A;  4RNA A;  1IBL M;  4DV5 M;  1DGB A;  2F5P A;  1NHG C;  2LH0 A;  3SAT A;  2I7N A;  4I4L A;  4LJ9 A;  5KQD A;  3KXE C;  2DWL A;  3VDU A;  4MGZ E;  4IJF A;  2D7H A;  1Z59 A;  4GMQ A;  2CFO A;  4L4U A;  3GRR A;  2NQ8 C;  3SMP A;  1QAN A;  3H4M A;  4JXJ A;  5FLX S;  2DWN A;  4OVZ B;  2RGH A;  3DZD A;  4R7G A;  5JI3 E;  3VK7 A;  1PJJ A;  4CHT B;  2I7P A;  4LF7 M;  3KW6 A;  4L15 A;  4S12 A;  1N36 M;  1TH3 A;  1NVM A;  2X8A A;  3EIH A;  4NRW A;  3M6A A;  3TE6 A;  3T38 A;  1NJF A;  1X37 A;  2M60 A;  2AHM A;  1NY6 A;  3CTW B;  4PD2 A;  3HHY A;  3U60 B;  1G4A E;  3HKP A;  4X64 M;  4AG5 A;  3VKH A;  4GKJ M;  3MHV C;  3LVW A;  4IJE A;  4P16 A;  4FCV A;  3FTE A;  4REZ A;  1SXJ A;  4B3S M;  4FWG A;  3TWL A;  4AI6 A;  3HHX A;  3T1Y M;  4MGH A;  5DYG A;  2QP9 X;  3QAU A;  3ZH9 B;  2XZF A;  1IN4 A;  1GKI A;  4NSO B;  4JV5 M;  2RKO A;  4DV2 M;  2FNA A;  3L27 A;  4XGI A;  2Z3X A;  1K3X A;  4LF5 M;  1GVN A;  3B9P A;  2P5T A;  1TH4 A;  4PT5 A;  1QAO A;  3RFW A;  3GRU A;  3FUX A;  1JR3 D;  3U60 A;  4M9Z A;  4L8R C;  3UK6 A;  3GPU A;  3GQ5 A;  3U6C A;  1FNN A;  1YSY A;  3U6S A;  4JI6 M;  1XXH A;  2LWX A;  1NSF A;  3VKG A;  3GQ4 A;  4BLC A;  3L28 A;  2L7H A;  4LF4 M;  2OPF A;  2UUC M;  3MJ5 A;  5ITY A;  3HU2 A;  3AOE A;  4JN6 A;  3PNY A;  3WHL A;  3SAR A;  4QNR A;  2D7G A;  1IBM M;  4I81 A;  4FWD A;  4ITQ A;  2QPA A;  4IBI A;  1QQW A;  4X62 M;  4NXM M;  1G41 A;  4BB9 A;  3I4V A;  2HCB A;  1HNW M;  3QWL A;  1G8P A;  4DV1 M;  3J27 B;  4FCW A;  1L2C A;  4D80 A;  2YNM D;  2UUB M;  1HT2 E;  4GHA A;  3FUT A;  2XFS A;  4AG6 A;  3HWS A;  1D2N A;  3FTD A;  3AOE C;  4FCT A;  4JI0 M;  5FTM A;  4B7G A;  1N34 M;  3U6O A;  2XSZ D;  2XSZ A;  3JAM S;  4KOD A;  2CUZ A;  4GIT A;  3GPX A;  3D8L A;  3TWM A;  2C9C A;  3HGI A;  5A2Q S;  3EIE A;  3AKZ A;  1R2Y A;  4IBB A;  3SFZ A;  2XZU A;  1IXZ A;  2BJV A;  3FTF A;  3JR5 A;  4LFA M;  4DV6 M;  3GLH A;  4YHH M;  2UUA M;  2HKJ A;  3VK8 A;  3GLI B;  1IY2 A;  1EE8 A;  4R3D A;  3SAS A;  5EP3 A;  5LMN M;  5EXP A;  3LMM A;  3HU1 A;  1HNX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...