1XNQM

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnqM02
5A2QS 3GQ4A 5IWAM 4CISA 4DR5M 2F5PA 4JI6M 5IT9S 3U6OA 4DR4M 1IBMM 2F5OA 1XMQM 4G4RA 1Z5BA 4X65M 1IBLM 4DV7M 4JI1M 4LFCM 4LF5M 4B3RM 2VQFM 4X64M 1I94M 4JI5M 4DV3M 2HKJA 5ITUA 2UUBM 4KHPM 3J81S 3A42A 2XZUA 3U6DA 3TWMA 4DR1M 4B3MM 3GQ5A 4DV1M 1L2DA 4JYAM 3SBJA 4G4OA 1L2BA 1EE8A 5ITXA 3GQ3A 3U6EA 1K3WA 1L1ZA 1MU5A 2OQ4A 3A46A 1L2CA 2UUAM 4YY3M 4JI4M 2F4VM 1L1TA 3TWLA 3GPPA 4DR3M 4JI8M 4JI3M 4X66M 3OTOM 1N36M 2OPFA 4JI2M 4JI7M 1XNQM 2UXCM 3JAMS 1N34M 1XMOM 2VQEM 3A45A 4PCZA 1HNXM 1Z59A 1Z5CA 3J80S 4JI0M 4DV4M 2E5LM 4B3SM 4NRWA 3VK8A 4JV5M 4LFBM 3SAUA 4G4QA 5ITTA 1IBKM 4GKKM 4DUZM 3C58A 4PDGA 3TWKA 3U6MA 2Q2EB 4YHHM 1KFVA 4LF4M 4AQYM 2UU9M 4LF8M 4DUYM 1Q3CA 3GPYA 2F5NA 1FJGM 1N33M 3SAWA 1HNZM 3T1YM 4PD2A 1MX0A 3U6LA 2F5QA 2HHHM 1HNWM 4MB7A 1XNRM 4OX9M 1N32M 1TDZA 3W0FA 4PDIA 4DV5M 5ITRA 3U6CA 3SAVA 2EA0A 1K3XA 3GPUA 3J7AS 2ZBKB 4NRVA 3T1HM 4LF9M 4DR7M 3GP1A 5FLXS 1R2YA 2UXDM 4DR6M 2F5SA 3SATA 4LF6M 1HR0M 2UXBM 1TDHA 3VK7A 4GKJM 4DV6M 4NXNM 5BR8M 1Q3BA 1PM5A 1PJJA 3SARA 3JR5A 2XZFA 1Z5AA 2ZM6M 1XC8A 4NXMM 5ITXE 5LMNM 4DV0M 4G4NA 3U6PA 1NNJA 4LF7M 4B3TM 1R2ZA 4DR2M 4ITQA 4LFAM 3GPXA 5LMUM 2UUCM 3JR4A 4X62M 3U6SA 4DV2M 1PJIA 1Q39A 5ITQA 3GO8A 3U6QA 1J5EM 1K82A 3SASA 4K0KM 3DOAA 5ITYA
chains in the Genus database with same CATH superfamily
1QAOA 3T38A 2YR0A 3GQ4A 5IWAM 3B7QA 2ZANA 4QOSA 5C1BA 1Z6TA 5L8RF 7CATA 2F5PA 3HWSA 4IBGA 3CF2A 5IT9S 1OKSA 1MJGM 4GH9A 4ZPXA 2GNOA 2JWSA 2R4JA 2BWEA 3KXEC 1IXSB 4G4RA 1J09A 5EP3A 1Z5BA 2JP7A 2QNJA 3GLHA 3HHWA 4X65M 4JI1M 4DV7M 2C96A 2A5YB 2QSFX 3VLFB 1P3QQ 1WGNA 3U5ZB 3QAUA 2LHGA 4DBGB 2Z8YM 4DV3M 4HEOA 4OVZA 2UUBM 3A42A 3U6DA 2LVAA 1XXHA 3EIHA 4B3MM 3GQ5A 3KOYE 1TGUA 3MJ5A 4JYAM 3GRRA 1CUKA 2W82A 2Z4SA 4L4UA 2X8AA 4QHTA 3AOGA 4Z8XA 5ITXA 1SXJB 3GQ3A 3SMPA 2Z3XA 2OQ4A 1L2CA 3A46A 2Z7JA 3B9PA 2Y20A 3ILKA 3ZC7B 4FCTA 2UUAM 4JXJA 4GMQA 4LY6A 3VFDA 4JI4M 5FTKA 1IY2A 3SHFA 4IJEA 1TH3A 3HGIA 1JB0F 3TWLA 3V76A 4JI8M 2DAKA 1DO2A 2L4EA 3K92A 2OPFA 4RF0A 3W68A 1XNQM 2UXCM 4CGYB 5H37D 3JAMS 2I7NA 3HZJA 1D2NA 1PJQA 1OFHA 2O01F 4FWDA 1L8QA 4B7HA 1GABA 2R18A 4II7A 3VK8A 5EP2A 4LFBM 2XLJA 1TF0B 1E94E 3BBZA 3KSXA 3CF0A 1JR3E 4DUZM 5FTLA 3LW5F 3C58A 3HKPA 4XGIA 1QQWA 2MR9A 3W67A 3GRYA 2Q2EB 4BLCA 4MGKE 1QUTA 1QYRA 1W5SA 1G4AE 3GPYA 2CHGA 1GKIA 1FJGM 4LRSA 1ZMUA 4REZA 4A3VB 2XSZA 3T1YM 4PD2A 3AL0C 2G8LA 1MX0A 3U6LA 3TL4X 2F5QA 2DKLA 2HHHM 4LJ9A 4M9ZA 2WZJA 4LJ8A 1DGFA 3J7BA 2RRUA 3QYBA 4WP2A 4FWHA 4WW0A 5EP1A 4GITA 1A5TA 3GPUA 4NRVA 2XGNA 4MGYE 4LF9M 4DR7M 2DZLA 2ZAOA 2UXDM 4DR6M 1XXHE 2D7EA 2UXBM 1TDHA 1IY0A 3VK7A 2CWBA 1HQCA 2XH9A 1OTRA 1PRBA 1YLAA 2DNAA 5FTNA 1I4WA 1PM5A 2QENA 2GQFA 1OIZA 3I4YA 5F3WA 1EFUB 1SXJD 2R0IA 3LCVB 4F1IA 3GLIB 1N78A 3NBIA 5EXPA 5ITXE 3RGPA 2ERCA 1NNJA 3L2AA 1GJSA 1NJFA 4PT5A 3UZUA 4CHTB 4LFAM 2C9OA 3WHLA 3GPXA 4DR2M 3DA1A 3JR4A 1OQYA 3K8ZA 3GLFB 1Q39A 2H1RA 4FCVA 3LCUA 2FFJA 3HU1A 1IXZA 2DAIA 3SASA 1D0KA 4K0KM 2K6BA 1MN3A 5E26A 4AKHA 2N35A 1IN8A 4G4QA 1QAMA 4R7GA 2KNVA 4RNAA 3VDPA 1GLNA 5A2QS 3BOSA 4LZZA 5KO3A 2NQ8C 2CEAA 2L7HA 4DR5M 1N75A 1TR8A 3H4JA 3U6OA 2L09A 4L16A 1QVRA 3PNVA 3GRUA 1OJLA 3U60B 2K0BX 2F5OA 4ANRA 2QHOB 4KO8A 1R6BX 4L6V6 1NHWC 1IBLM 4B3RM 1WXQA 2VQFM 4IBDA 2DHYA 4MM3B 4GC5A 3KOZE 5ITUA 1TTEA 1AIPC 3NBXX 1WIVA 2JA2A 4D81A 2LXEA 2R4EA 3J81S 1QDRA 2CHVA 2RGOA 3IG8A 2XZUA 2R6FA 2K9DA 1DV0A 4G4OA 1DO0A 1IN4A 4LZJA 1OAIA 1R4GA 4JN6A 3FYCA 4AI6A 3KOXE 2KHHA 1L1ZA 3SC3A 3J7AS 2YNMD 3UMMA 1FNNA 2VIIA 1NHGC 3FUXA 2WSEF 3GLGB 3UJNA 5DYGA 3LMMA 3LVWA 1IN7A 1NNUC 2HWJA 3GPPA 3U61B 3ZQJA 4Y28F 4X66M 4XK8F 2KZSA 1N36M 4JI7M 2J5YA 1N34M 3SYLA 1XMOM 1IM2A 4Q7JA 3A45A 2V1CA 4PCZA 3FUTA 3TQSA 4DV4M 3HHXA 2DZNB 1YUBA 2CFOA 3T6PA 1IXSA 3GLHB 2QP9X 3FUUA 1YSYA 4UN2B 2FNAA 3U5ZA 2LBCA 4MGHA 3RE8A 3FTEA 1NJGA 2OOAA 4LJAA 3UGJA 1ZMWA 4LJ5A 3J2PB 2FOIC 2LH0A 3ZCBB 2F5NA 3SAWA 4KT0F 5KQ8A 3L28A 2V6ZM 1UM8A 1T3TA 2Z4RA 2EKFA 2KDLA 3IG5A 2DWLA 3KFUG 4GEWA 3DFZA 2DZOB 4IBJA 4LJ4A 4PDIA 2JUJA 4DV5M 1SXJA 4KLNA 3PFIA 4IBFA 4M0DA 1VEKA 1IY1A 3KOWE 2DAEA 1NSFA 2KNAA 2HL7A 2R65A 3M7GA 2JY5A 1N77A 5FLXS 2LTUA 3SHGB 2WSCF 2B3TA 2KEBA 3SATA 1ZAEA 4LF6M 1HR0M 1WGLA 3FUVA 1GVNA 1EIJA 3KS8A 4NSOB 3FD9A 4DV6M 1OIPA 4EIWA 1Q3BA 4R3DA 3K9PA 1PJJA 2VF7A 3C3DA 5BPVA 4I8OA 2OOBA 1E32A 1S3SA 3J27B 3NWLA 3KVWA 1T6OA 1D0LA 2CRUA 3B74A 3WHKA 3U6PA 4G3OA 4LF7M 4OU7A 3KW6A 1GL7A 2HCBA 1H6UA 3A98B 1VEGA 3M6AA 3SFZA 3LVVA 4CJ6A 1R7RA 4DV2M 2CV2A 5ITQA 2EUCA 5EQTA 3R9XB 3DOAA 5EJCA 1E9RA 2KW0A 2DWNA 4LCBA 5KQDA 3F92A 2KZUA 2C99A 4B7GA 2MGWA 3QYEA 2J7NA 3L27A 1NVMA 2G5GX 2D7HA 4DR4M 4LJ6A 2QBYB 3B7NA 3VDUA 1XMQM 3I04M 2X49A 2KNZA 1LTMA 4LGMA 4G6ZA 1IFYA 3R8FA 4LF5M 3D8BA 3K9OA 4QOZC 1DGHA 4X64M 3PXGA 1VG5A 1E9SA 1WHCA 3TPZA 1ZV1A 3SAUA 2Y21A 3TWMA 3GLIA 5JI2E 4DV1M 1L2DA 1WR1B 1SXJE 5KPTA 1V33A 4LRTA 4KODA 4P16A 1GJTA 2XF3A 1C1KA 2BJWA 2RGHA 2CUZA 3TE6A 2JXNA 2VDBB 3D8LA 2DI0A 3GLFA 4TUWA 2FS1A 1NY6A 1ZQ9A 4WURA 1TH2A 2HAKA 3L29A 3U6EA 3HY5A 1K3WA 1WJ7A 4I4LA 4LG2A 3VKHA 4B08A 1XHBA 1NY5A 1W5TA 2BNKA 2DAMA 2R46A 8CATA 1DGBA 2XFSA 2QPAA 4IJFA 2F4VM 1QZEA 2H5XA 2ZTDA 4AKGA 3KDSE 4DR3M 1UFZA 4IBBA 4FD2A 1G41A 3T15A 2LVNC 3AOEA 4P17A 1G71A 1Y8GA 2JY6B 3KSJA 3FTDA 2VQEM 1SG9A 1QDTA 2JNHA 3KS4A 3I01M 1F4IA 2CV1A 4JI0M 5EXXA 3U60A 2E5LM 4Z6YA 2CV0A 3C3EA 5EXSA 4NRWA 4JV5M 1KSFX 1T43A 1VQ1A 4L78A 3HJQA 3FUWA 1IBKM 2G3QA 4GKKM 5FSWA 1GO5A 3B7ZA 1V34A 3FTCA 5JI3E 2R44A 3HU3A 4FW9A 3TWKA 3U6MA 3SMSA 4YHHM 2CHQA 3HHZA 4AQYM 1ZMVA 3MMPA 4DUYM 4FVMA 4L15A 4NC6A 3RFWA 2O25A 2UU9M 4GC9A 5KPRA 2RKOA 1HNZM 4AKIA 1XWIA 2QQ8A 4GHLA 1G3IA 4IBKA 1QAQA 3I51A 2Y0TA 3FKEA 3L25A 1G8PA 4MB7A 1XNRM 3IECA 4CIZA 1AUAA 1JQJC 2OO9A 2X4AA 3HU2A 1V92A 5DFLA 1N32M 4OW0A 3E21A 2LVPC 1TH4A 5ITRA 2C5RA 3SAVA 1NO1A 5DNYA 2EA0A 1K3XA 2C9CA 2ZBKB 3T1HM 3Q8GA 3CTWB 2L6OA 3MK6A 2R62A 3HJSA 2KRUA 3GP1A 1HJPA 3U61A 1R2YA 2DXIA 4B7FA 4QHSA 3GLIE 2MROB 1VDDA 3I4VA 4NXNM 1NV9A 4OVZB 2XFTA 3EIEA 4F2LA 3GLFE 3SARA 1HQYE 1XXHB 1NV8A 2BJVA 2WSFF 1IXRC 4DV0M 4GIPA 4G4NA 1R2ZA 1G59A 2XEPA 4XBOA 1PGYA 5DYIA 4D80A 3AKZA 5LMUM 2UUCM 2ZAMA 1PJIA 2FH0A 1K82A 1SXJC 2JY7A 3AJIB 4IBCA 1HT2E 3HHYA 3RGSA 2LVOC 4MGZE 1OAOC 4AG5A 3BXWA 2I7PA 5EXTA 4RKUF 3H4MA 4I5SA 1QZMA 5KPZA 4NL4H 4GRIA 4CISA 3FRHA 3PVSA 4JI6M 2DAGA 2R45A 2KXEA 2D7GA 2LHCA 1R5LA 1IBMM 1J7KA 1JR3D 3HX3A 3DZDA 4NSRA 5E6JA 4S12A 2KA6B 4BBAA 4LFCM 3Q8XA 3VKGA 4IBEA 2JZ1A 4LF8M 1I94M 4JI5M 2DWZB 5GKNA 2J7OA 2HKJA 4KHPM 2EJSA 1DGGA 3THGA 3PNYA 5FTJA 4DR1M 1QANA 2KRKA 3UK6A 3SBJA 5C18A 1D0MA 3E9SA 3KP1E 3MHVC 4BB9A 3GLGE 2V1UA 1L2BA 1IN6A 1EE8A 2M5ZA 1MU5A 3L26A 4YY3M 2LVQD 4LJ7A 3AFHA 4I81A 1L1TA 4RF1A 2EO2A 4JI3M 5IZ7D 3OTOM 3HJ8A 4JI2M 3W0LB 2MH8A 3GLHE 3ZH9B 3K2LA 1HNXM 2LWXA 1Z59A 1Z5CA 3J80S 4AZFA 4HLQA 4B3SM 4FCWA 1IQPA 3E46A 4IBIA 4MGIE 2QBYA 2JZ0A 2DWMA 3QWLA 1LV7A 2C98A 1RU3A 2CE7A 2YQZA 3AV0A 3C9PA 2P5TA 3CGWA 3LQQA 4W5WA 4D82A 1X37A 5ITTA 1DGHB 4AW4A 2ZTCA 1YE9A 2LNHC 1ORYB 2O5RA 1XB2B 4AG6A 4PDGA 1KFVA 4LF4M 5IREB 3KP0E 3FTFA 4L8RC 1BVSA 1PJTA 1Q3CA 1C7YA 2QZ4A 1N33M 4LGYA 2DENA 2K47A 2L7IA 3AOEC 3SYKA 1HNWM 2AHMA 1KYIA 4OX9M 3FYDA 1TDZA 3W0FA 1PJSA 1GL6A 3U6CA 4MH0E 3FE3A 3K1JA 1QUSA 1VDLA 4NOOB 4M9SA 2VF8A 2YFQA 2JY8A 3GRVA 2DVWB 2F5SA 2XSZD 3LQRA 3B89A 3CF6E 4GKJM 4M0WA 2FE8A 1OFIA 2L4FA 3IHPA 5BR8M 2MJ5B 2EKKA 4NXMM 2M60A 3JR5A 1Z5AA 2ZM6M 2XZFA 1XC8A 5EP4A 1IN5A 4M9XA 4HL4A 3E4RA 5LMNM 4IIWA 3M0EA 4B3TM 2APLA 2DHRA 1HT1E 2L2DA 4ITQA 3FRIA 4QNRA 4R71A 2Y0QA 4X62M 3U6SA 1VEJA 4FWGA 5FTMA 3GO8A 3U6QA 1J5EM 4GHAA 1JR3A 2CP8A 2BWBA 2QCUA 5ITYA 1Q02A 3GLGA 4QNMA
chains in the Genus database with same CATH topology
1QAOA 3T38A 2YR0A 3GQ4A 5IWAM 2ZANA 4QOSA 5C1BA 1Z6TA 7CATA 2F5PA 3HWSA 4IBGA 3CF2A 5IT9S 4GH9A 4ZPXA 2R4JA 3KXEC 1IXSB 4G4RA 1J09A 5EP3A 1Z5BA 3GLHA 3HHWA 4X65M 4JI1M 4DV7M 2C96A 2A5YB 3VLFB 3U5ZB 3QAUA 4DV3M 4OVZA 2UUBM 3A42A 3U6DA 1XXHA 3EIHA 4B3MM 3GQ5A 3KOYE 1TGUA 3MJ5A 4JYAM 3GRRA 2W82A 2Z4SA 4L4UA 2X8AA 4QHTA 3AOGA 4Z8XA 5ITXA 1SXJB 3GQ3A 3SMPA 2Z3XA 2OQ4A 1L2CA 3A46A 2Z7JA 3B9PA 2Y20A 3ILKA 3ZC7B 4FCTA 2UUAM 4JXJA 4GMQA 4LY6A 3VFDA 4JI4M 5FTKA 1IY2A 3SHFA 4IJEA 1TH3A 3HGIA 3TWLA 4JI8M 2OPFA 1DO2A 3K92A 1XNQM 2UXCM 4RF0A 4CGYB 5H37D 3JAMS 2I7NA 1D2NA 1OFHA 4FWDA 4B7HA 1L8QA 2R18A 4II7A 3VK8A 5EP2A 4LFBM 2XLJA 1E94E 3KSXA 3CF0A 4DUZM 5FTLA 3C58A 3HKPA 4XGIA 1QQWA 3GRYA 2Q2EB 4BLCA 4MGKE 1QYRA 1W5SA 1G4AE 3GPYA 2CHGA 1GKIA 1FJGM 4LRSA 4REZA 4A3VB 2XSZA 3T1YM 4PD2A 3AL0C 2G8LA 1MX0A 3U6LA 3TL4X 2F5QA 2HHHM 4LJ9A 4M9ZA 4LJ8A 1DGFA 3J7BA 4FWHA 4WW0A 5EP1A 4GITA 3GPUA 4NRVA 2XGNA 4MGYE 4LF9M 4DR7M 2ZAOA 2UXDM 4DR6M 2D7EA 2UXBM 1TDHA 1IY0A 3VK7A 1HQCA 2XH9A 5FTNA 1I4WA 1PM5A 2QENA 3I4YA 5F3WA 1SXJD 1N78A 3GLIB 3NBIA 5EXPA 5ITXE 3RGPA 2ERCA 1NNJA 3L2AA 1NJFA 4PT5A 3UZUA 4CHTB 4LFAM 2C9OA 3WHLA 3GPXA 4DR2M 3DA1A 3JR4A 3K8ZA 3GLFB 1Q39A 2H1RA 4FCVA 2FFJA 3HU1A 1IXZA 3SASA 4K0KM 5E26A 4AKHA 1IN8A 1QAMA 4R7GA 3VDPA 4RNAA 1GLNA 5A2QS 3BOSA 4LZZA 5KO3A 2NQ8C 2CEAA 2L7HA 4DR5M 1N75A 3U6OA 2L09A 4L16A 1QVRA 3PNVA 3GRUA 1OJLA 3U60B 2F5OA 4KO8A 1R6BX 1NHWC 1IBLM 4B3RM 1WXQA 2VQFM 4IBDA 4MM3B 4GC5A 3KOZE 5ITUA 4D81A 3J81S 2JA2A 2XZUA 2LXEA 2R4EA 2CHVA 2RGOA 3IG8A 4G4OA 1DO0A 1IN4A 4LZJA 4JN6A 3FYCA 4AI6A 3KOXE 3J7AS 1L1ZA 3SC3A 2YNMD 3UMMA 1FNNA 2VIIA 1NHGC 3FUXA 3GLGB 3UJNA 5DYGA 3LMMA 3LVWA 1IN7A 1NNUC 3GPPA 3U61B 1N36M 4X66M 4JI7M 2KZSA 1N34M 3SYLA 1XMOM 1IM2A 3A45A 2V1CA 4PCZA 3FUTA 3TQSA 4DV4M 3HHXA 2DZNB 1YUBA 2CFOA 3GLHB 2QP9X 3FUUA 1YSYA 2FNAA 3U5ZA 4MGHA 3RE8A 3FTEA 1NJGA 4LJAA 3UGJA 4LJ5A 3J2PB 2FOIC 2LH0A 3ZCBB 2F5NA 3SAWA 5KQ8A 3L28A 2V6ZM 1UM8A 1T3TA 2Z4RA 3IG5A 2DWLA 3KFUG 4IBJA 3DFZA 2DZOB 4LJ4A 4PDIA 4DV5M 1SXJA 4KLNA 3PFIA 4IBFA 4M0DA 1IY1A 3KOWE 1NSFA 2HL7A 2R65A 3M7GA 1N77A 5FLXS 3SHGB 2KEBA 3SATA 1ZAEA 4LF6M 1HR0M 3FUVA 1GVNA 3KS8A 4NSOB 3FD9A 4DV6M 4EIWA 1Q3BA 4R3DA 1PJJA 5BPVA 4I8OA 3NWLA 1E32A 1S3SA 3J27B 3KVWA 3WHKA 3U6PA 4LF7M 3KW6A 1GL7A 2HCBA 1H6UA 3A98B 3M6AA 3SFZA 3LVVA 2CV2A 1R7RA 4DV2M 5ITQA 2EUCA 5EQTA 3R9XB 3DOAA 5EJCA 1E9RA 2KW0A 2DWNA 4LCBA 5KQDA 2KZUA 2C99A 4B7GA 2J7NA 3L27A 1NVMA 2G5GX 2D7HA 4DR4M 4LJ6A 2QBYB 3VDUA 1XMQM 2X49A 4LGMA 4G6ZA 3R8FA 4LF5M 3D8BA 4QOZC 1DGHA 4X64M 3PXGA 1E9SA 3TPZA 3SAUA 2Y21A 3TWMA 3GLIA 5JI2E 4DV1M 1L2DA 1SXJE 5KPTA 4LRTA 4KODA 4P16A 2XF3A 1C1KA 2BJWA 2RGHA 2CUZA 3TE6A 3D8LA 3GLFA 4TUWA 1NY6A 1ZQ9A 4WURA 1TH2A 3L29A 3U6EA 1K3WA 3VKHA 4I4LA 4LG2A 4B08A 1XHBA 1NY5A 1W5TA 2BNKA 2R46A 8CATA 1DGBA 2XFSA 2QPAA 4IJFA 2F4VM 4AKGA 3KDSE 4DR3M 4IBBA 4FD2A 1G41A 3T15A 3AOEA 3KSJA 3FTDA 2VQEM 3KS4A 2CV1A 4JI0M 5EXXA 3U60A 2E5LM 4Z6YA 2CV0A 5EXSA 4NRWA 4JV5M 1KSFX 4L78A 3HJQA 3FUWA 1IBKM 4GKKM 5FSWA 3FTCA 5JI3E 3HU3A 4FW9A 3TWKA 3U6MA 3SMSA 4YHHM 2CHQA 3HHZA 4AQYM 2UU9M 4LF8M 4DUYM 4FVMA 4L15A 3RFWA 4GC9A 5KPRA 2RKOA 1HNZM 4AKIA 1XWIA 4GHLA 1G3IA 4IBKA 1QAQA 3I51A 2Y0TA 3FKEA 3L25A 1G8PA 4MB7A 1XNRM 1JQJC 3HU2A 2X4AA 1N32M 4OW0A 1TH4A 5ITRA 2C5RA 3SAVA 5DNYA 2EA0A 1K3XA 2C9CA 2ZBKB 3T1HM 3CTWB 2L6OA 3MK6A 2R62A 3HJSA 2KRUA 3GP1A 3U61A 1R2YA 2DXIA 4B7FA 4QHSA 1VDDA 3I4VA 4NXNM 4OVZB 2XFTA 3EIEA 3SARA 1HQYE 1XXHB 2BJVA 1IXRC 4DV0M 4GIPA 4G4NA 1R2ZA 1G59A 2XEPA 4XBOA 5DYIA 4D80A 3AKZA 5LMUM 2UUCM 2ZAMA 1PJIA 1K82A 1SXJC 3AJIB 4IBCA 1HT2E 3HHYA 3RGSA 4MGZE 4AG5A 2I7PA 5EXTA 3H4MA 4I5SA 1QZMA 5KPZA 4NL4H 4GRIA 4CISA 3PVSA 4JI6M 2R45A 2KXEA 2D7GA 1IBMM 1J7KA 1JR3D 4NSRA 3DZDA 5E6JA 4S12A 2KA6B 4BBAA 4LFCM 3Q8XA 3VKGA 4IBEA 1I94M 4JI5M 2DWZB 5GKNA 2J7OA 2HKJA 4KHPM 1DGGA 3THGA 3PNYA 5FTJA 4DR1M 1QANA 2KRKA 3UK6A 3SBJA 5C18A 3KP1E 3E9SA 3MHVC 4BB9A 2V1UA 1L2BA 1IN6A 1EE8A 2M5ZA 1MU5A 3L26A 4YY3M 4LJ7A 3AFHA 4I81A 1L1TA 4RF1A 2EO2A 4JI3M 5IZ7D 3OTOM 3HJ8A 4JI2M 3W0LB 3ZH9B 3K2LA 1HNXM 2LWXA 1Z59A 1Z5CA 3J80S 4AZFA 4HLQA 4B3SM 4FCWA 1IQPA 4IBIA 4MGIE 2QBYA 2DWMA 3QWLA 1LV7A 2C98A 2CE7A 3AV0A 2YQZA 3LQQA 4W5WA 2P5TA 5ITTA 4OU7A 4G4QA 4D82A 1X37A 1DGHB 4AW4A 1YE9A 2LNHC 1ORYB 2O5RA 4AG6A 4PDGA 1KFVA 4LF4M 5IREB 3KP0E 3FTFA 4L8RC 1Q3CA 2QZ4A 1N33M 4LGYA 2K47A 2L7IA 3AOEC 3SYKA 1HNWM 2AHMA 1KYIA 4OX9M 3FYDA 1TDZA 3W0FA 1GL6A 3U6CA 4MH0E 3K1JA 4NOOB 4M9SA 2YFQA 3GRVA 2DVWB 2F5SA 2XSZD 3LQRA 3CF6E 4GKJM 4M0WA 1OFIA 2FE8A 5BR8M 4NXMM 2M60A 3JR5A 1Z5AA 2ZM6M 2XZFA 1XC8A 5EP4A 1IN5A 4M9XA 4HL4A 3E4RA 5LMNM 4IIWA 3M0EA 4B3TM 2DHRA 1HT1E 4ITQA 4QNRA 2Y0QA 4X62M 3U6SA 4FWGA 5FTMA 3GO8A 3U6QA 1J5EM 4GHAA 1JR3A 2QCUA 5ITYA 3GLGA 4QNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q S;  3GQ4 A;  5IWA M;  4CIS A;  4DR5 M;  2F5P A;  4JI6 M;  5IT9 S;  3U6O A;  4DR4 M;  1IBM M;  2F5O A;  1XMQ M;  4G4R A;  1Z5B A;  4X65 M;  1IBL M;  4DV7 M;  4JI1 M;  4LFC M;  4LF5 M;  4B3R M;  2VQF M;  4X64 M;  1I94 M;  4JI5 M;  4DV3 M;  2HKJ A;  5ITU A;  2UUB M;  4KHP M;  3J81 S;  3A42 A;  2XZU A;  3U6D A;  3TWM A;  4DR1 M;  4B3M M;  3GQ5 A;  4DV1 M;  1L2D A;  4JYA M;  3SBJ A;  4G4O A;  1L2B A;  1EE8 A;  5ITX A;  3GQ3 A;  3U6E A;  1K3W A;  1L1Z A;  1MU5 A;  2OQ4 A;  3A46 A;  1L2C A;  2UUA M;  4YY3 M;  4JI4 M;  2F4V M;  1L1T A;  3TWL A;  3GPP A;  4DR3 M;  4JI8 M;  4JI3 M;  4X66 M;  3OTO M;  1N36 M;  2OPF A;  4JI2 M;  4JI7 M;  1XNQ M;  2UXC M;  3JAM S;  1N34 M;  1XMO M;  2VQE M;  3A45 A;  4PCZ A;  1HNX M;  1Z59 A;  1Z5C A;  3J80 S;  4JI0 M;  4DV4 M;  2E5L M;  4B3S M;  4NRW A;  3VK8 A;  4JV5 M;  4LFB M;  3SAU A;  4G4Q A;  5ITT A;  1IBK M;  4GKK M;  4DUZ M;  3C58 A;  4PDG A;  3TWK A;  3U6M A;  2Q2E B;  4YHH M;  1KFV A;  4LF4 M;  4AQY M;  2UU9 M;  4LF8 M;  4DUY M;  1Q3C A;  3GPY A;  2F5N A;  1FJG M;  1N33 M;  3SAW A;  1HNZ M;  3T1Y M;  4PD2 A;  1MX0 A;  3U6L A;  2F5Q A;  2HHH M;  1HNW M;  4MB7 A;  1XNR M;  4OX9 M;  1N32 M;  1TDZ A;  3W0F A;  4PDI A;  4DV5 M;  5ITR A;  3U6C A;  3SAV A;  2EA0 A;  1K3X A;  3GPU A;  3J7A S;  2ZBK B;  4NRV A;  3T1H M;  4LF9 M;  4DR7 M;  3GP1 A;  5FLX S;  1R2Y A;  2UXD M;  4DR6 M;  2F5S A;  3SAT A;  4LF6 M;  1HR0 M;  2UXB M;  1TDH A;  3VK7 A;  4GKJ M;  4DV6 M;  4NXN M;  5BR8 M;  1Q3B A;  1PM5 A;  1PJJ A;  3SAR A;  3JR5 A;  2XZF A;  1Z5A A;  2ZM6 M;  1XC8 A;  4NXM M;  5ITX E;  5LMN M;  4DV0 M;  4G4N A;  3U6P A;  1NNJ A;  4LF7 M;  4B3T M;  1R2Z A;  4DR2 M;  4ITQ A;  4LFA M;  3GPX A;  5LMU M;  2UUC M;  3JR4 A;  4X62 M;  3U6S A;  4DV2 M;  1PJI A;  1Q39 A;  5ITQ A;  3GO8 A;  3U6Q A;  1J5E M;  1K82 A;  3SAS A;  4K0K M;  3DOA A;  5ITY A; 
#chains in the Genus database with same CATH topology
 1QAO A;  3T38 A;  2YR0 A;  3GQ4 A;  5IWA M;  3B7Q A;  2ZAN A;  4QOS A;  5C1B A;  1Z6T A;  5L8R F;  7CAT A;  2F5P A;  3HWS A;  4IBG A;  3CF2 A;  5IT9 S;  1OKS A;  1MJG M;  4GH9 A;  4ZPX A;  2GNO A;  2JWS A;  2R4J A;  2BWE A;  3KXE C;  1IXS B;  4G4R A;  1J09 A;  5EP3 A;  1Z5B A;  2JP7 A;  2QNJ A;  3GLH A;  3HHW A;  4X65 M;  4JI1 M;  4DV7 M;  2C96 A;  2A5Y B;  2QSF X;  3VLF B;  1P3Q Q;  1WGN A;  3U5Z B;  3QAU A;  2LHG A;  4DBG B;  2Z8Y M;  4DV3 M;  4HEO A;  4OVZ A;  2UUB M;  3A42 A;  3U6D A;  2LVA A;  1XXH A;  3EIH A;  4B3M M;  3GQ5 A;  3KOY E;  1TGU A;  3MJ5 A;  4JYA M;  3GRR A;  1CUK A;  2W82 A;  2Z4S A;  4L4U A;  2X8A A;  4QHT A;  3AOG A;  4Z8X A;  5ITX A;  1SXJ B;  3GQ3 A;  3SMP A;  2Z3X A;  2OQ4 A;  1L2C A;  3A46 A;  2Z7J A;  3B9P A;  2Y20 A;  3ILK A;  3ZC7 B;  4FCT A;  2UUA M;  4JXJ A;  4GMQ A;  4LY6 A;  3VFD A;  4JI4 M;  5FTK A;  1IY2 A;  3SHF A;  4IJE A;  1TH3 A;  3HGI A;  1JB0 F;  3TWL A;  3V76 A;  4JI8 M;  2DAK A;  1DO2 A;  2L4E A;  3K92 A;  2OPF A;  4RF0 A;  3W68 A;  1XNQ M;  2UXC M;  4CGY B;  5H37 D;  3JAM S;  2I7N A;  3HZJ A;  1D2N A;  1PJQ A;  1OFH A;  2O01 F;  4FWD A;  1L8Q A;  4B7H A;  1GAB A;  2R18 A;  4II7 A;  3VK8 A;  5EP2 A;  4LFB M;  2XLJ A;  1TF0 B;  1E94 E;  3BBZ A;  3KSX A;  3CF0 A;  1JR3 E;  4DUZ M;  5FTL A;  3LW5 F;  3C58 A;  3HKP A;  4XGI A;  1QQW A;  2MR9 A;  3W67 A;  3GRY A;  2Q2E B;  4BLC A;  4MGK E;  1QUT A;  1QYR A;  1W5S A;  1G4A E;  3GPY A;  2CHG A;  1GKI A;  1FJG M;  4LRS A;  1ZMU A;  4REZ A;  4A3V B;  2XSZ A;  3T1Y M;  4PD2 A;  3AL0 C;  2G8L A;  1MX0 A;  3U6L A;  3TL4 X;  2F5Q A;  2DKL A;  2HHH M;  4LJ9 A;  4M9Z A;  2WZJ A;  4LJ8 A;  1DGF A;  3J7B A;  2RRU A;  3QYB A;  4WP2 A;  4FWH A;  4WW0 A;  5EP1 A;  4GIT A;  1A5T A;  3GPU A;  4NRV A;  2XGN A;  4MGY E;  4LF9 M;  4DR7 M;  2DZL A;  2ZAO A;  2UXD M;  4DR6 M;  1XXH E;  2D7E A;  2UXB M;  1TDH A;  1IY0 A;  3VK7 A;  2CWB A;  1HQC A;  2XH9 A;  1OTR A;  1PRB A;  1YLA A;  2DNA A;  5FTN A;  1I4W A;  1PM5 A;  2QEN A;  2GQF A;  1OIZ A;  3I4Y A;  5F3W A;  1EFU B;  1SXJ D;  2R0I A;  3LCV B;  4F1I A;  3GLI B;  1N78 A;  3NBI A;  5EXP A;  5ITX E;  3RGP A;  2ERC A;  1NNJ A;  3L2A A;  1GJS A;  1NJF A;  4PT5 A;  3UZU A;  4CHT B;  4LFA M;  2C9O A;  3WHL A;  3GPX A;  4DR2 M;  3DA1 A;  3JR4 A;  1OQY A;  3K8Z A;  3GLF B;  1Q39 A;  2H1R A;  4FCV A;  3LCU A;  2FFJ A;  3HU1 A;  1IXZ A;  2DAI A;  3SAS A;  1D0K A;  4K0K M;  2K6B A;  1MN3 A;  5E26 A;  4AKH A;  2N35 A;  1IN8 A;  4G4Q A;  1QAM A;  4R7G A;  2KNV A;  4RNA A;  3VDP A;  1GLN A;  5A2Q S;  3BOS A;  4LZZ A;  5KO3 A;  2NQ8 C;  2CEA A;  2L7H A;  4DR5 M;  1N75 A;  1TR8 A;  3H4J A;  3U6O A;  2L09 A;  4L16 A;  1QVR A;  3PNV A;  3GRU A;  1OJL A;  3U60 B;  2K0B X;  2F5O A;  4ANR A;  2QHO B;  4KO8 A;  1R6B X;  4L6V 6;  1NHW C;  1IBL M;  4B3R M;  1WXQ A;  2VQF M;  4IBD A;  2DHY A;  4MM3 B;  4GC5 A;  3KOZ E;  5ITU A;  1TTE A;  1AIP C;  3NBX X;  1WIV A;  2JA2 A;  4D81 A;  2LXE A;  2R4E A;  3J81 S;  1QDR A;  2CHV A;  2RGO A;  3IG8 A;  2XZU A;  2R6F A;  2K9D A;  1DV0 A;  4G4O A;  1DO0 A;  1IN4 A;  4LZJ A;  1OAI A;  1R4G A;  4JN6 A;  3FYC A;  4AI6 A;  3KOX E;  2KHH A;  1L1Z A;  3SC3 A;  3J7A S;  2YNM D;  3UMM A;  1FNN A;  2VII A;  1NHG C;  3FUX A;  2WSE F;  3GLG B;  3UJN A;  5DYG A;  3LMM A;  3LVW A;  1IN7 A;  1NNU C;  2HWJ A;  3GPP A;  3U61 B;  3ZQJ A;  4Y28 F;  4X66 M;  4XK8 F;  2KZS A;  1N36 M;  4JI7 M;  2J5Y A;  1N34 M;  3SYL A;  1XMO M;  1IM2 A;  4Q7J A;  3A45 A;  2V1C A;  4PCZ A;  3FUT A;  3TQS A;  4DV4 M;  3HHX A;  2DZN B;  1YUB A;  2CFO A;  3T6P A;  1IXS A;  3GLH B;  2QP9 X;  3FUU A;  1YSY A;  4UN2 B;  2FNA A;  3U5Z A;  2LBC A;  4MGH A;  3RE8 A;  3FTE A;  1NJG A;  2OOA A;  4LJA A;  3UGJ A;  1ZMW A;  4LJ5 A;  3J2P B;  2FOI C;  2LH0 A;  3ZCB B;  2F5N A;  3SAW A;  4KT0 F;  5KQ8 A;  3L28 A;  2V6Z M;  1UM8 A;  1T3T A;  2Z4R A;  2EKF A;  2KDL A;  3IG5 A;  2DWL A;  3KFU G;  4GEW A;  3DFZ A;  2DZO B;  4IBJ A;  4LJ4 A;  4PDI A;  2JUJ A;  4DV5 M;  1SXJ A;  4KLN A;  3PFI A;  4IBF A;  4M0D A;  1VEK A;  1IY1 A;  3KOW E;  2DAE A;  1NSF A;  2KNA A;  2HL7 A;  2R65 A;  3M7G A;  2JY5 A;  1N77 A;  5FLX S;  2LTU A;  3SHG B;  2WSC F;  2B3T A;  2KEB A;  3SAT A;  1ZAE A;  4LF6 M;  1HR0 M;  1WGL A;  3FUV A;  1GVN A;  1EIJ A;  3KS8 A;  4NSO B;  3FD9 A;  4DV6 M;  1OIP A;  4EIW A;  1Q3B A;  4R3D A;  3K9P A;  1PJJ A;  2VF7 A;  3C3D A;  5BPV A;  4I8O A;  2OOB A;  1E32 A;  1S3S A;  3J27 B;  3NWL A;  3KVW A;  1T6O A;  1D0L A;  2CRU A;  3B74 A;  3WHK A;  3U6P A;  4G3O A;  4LF7 M;  4OU7 A;  3KW6 A;  1GL7 A;  2HCB A;  1H6U A;  3A98 B;  1VEG A;  3M6A A;  3SFZ A;  3LVV A;  4CJ6 A;  1R7R A;  4DV2 M;  2CV2 A;  5ITQ A;  2EUC A;  5EQT A;  3R9X B;  3DOA A;  5EJC A;  1E9R A;  2KW0 A;  2DWN A;  4LCB A;  5KQD A;  3F92 A;  2KZU A;  2C99 A;  4B7G A;  2MGW A;  3QYE A;  2J7N A;  3L27 A;  1NVM A;  2G5G X;  2D7H A;  4DR4 M;  4LJ6 A;  2QBY B;  3B7N A;  3VDU A;  1XMQ M;  3I04 M;  2X49 A;  2KNZ A;  1LTM A;  4LGM A;  4G6Z A;  1IFY A;  3R8F A;  4LF5 M;  3D8B A;  3K9O A;  4QOZ C;  1DGH A;  4X64 M;  3PXG A;  1VG5 A;  1E9S A;  1WHC A;  3TPZ A;  1ZV1 A;  3SAU A;  2Y21 A;  3TWM A;  3GLI A;  5JI2 E;  4DV1 M;  1L2D A;  1WR1 B;  1SXJ E;  5KPT A;  1V33 A;  4LRT A;  4KOD A;  4P16 A;  1GJT A;  2XF3 A;  1C1K A;  2BJW A;  2RGH A;  2CUZ A;  3TE6 A;  2JXN A;  2VDB B;  3D8L A;  2DI0 A;  3GLF A;  4TUW A;  2FS1 A;  1NY6 A;  1ZQ9 A;  4WUR A;  1TH2 A;  2HAK A;  3L29 A;  3U6E A;  3HY5 A;  1K3W A;  1WJ7 A;  4I4L A;  4LG2 A;  3VKH A;  4B08 A;  1XHB A;  1NY5 A;  1W5T A;  2BNK A;  2DAM A;  2R46 A;  8CAT A;  1DGB A;  2XFS A;  2QPA A;  4IJF A;  2F4V M;  1QZE A;  2H5X A;  2ZTD A;  4AKG A;  3KDS E;  4DR3 M;  1UFZ A;  4IBB A;  4FD2 A;  1G41 A;  3T15 A;  2LVN C;  3AOE A;  4P17 A;  1G71 A;  1Y8G A;  2JY6 B;  3KSJ A;  3FTD A;  2VQE M;  1SG9 A;  1QDT A;  2JNH A;  3KS4 A;  3I01 M;  1F4I A;  2CV1 A;  4JI0 M;  5EXX A;  3U60 A;  2E5L M;  4Z6Y A;  2CV0 A;  3C3E A;  5EXS A;  4NRW A;  4JV5 M;  1KSF X;  1T43 A;  1VQ1 A;  4L78 A;  3HJQ A;  3FUW A;  1IBK M;  2G3Q A;  4GKK M;  5FSW A;  1GO5 A;  3B7Z A;  1V34 A;  3FTC A;  5JI3 E;  2R44 A;  3HU3 A;  4FW9 A;  3TWK A;  3U6M A;  3SMS A;  4YHH M;  2CHQ A;  3HHZ A;  4AQY M;  1ZMV A;  3MMP A;  4DUY M;  4FVM A;  4L15 A;  4NC6 A;  3RFW A;  2O25 A;  2UU9 M;  4GC9 A;  5KPR A;  2RKO A;  1HNZ M;  4AKI A;  1XWI A;  2QQ8 A;  4GHL A;  1G3I A;  4IBK A;  1QAQ A;  3I51 A;  2Y0T A;  3FKE A;  3L25 A;  1G8P A;  4MB7 A;  1XNR M;  3IEC A;  4CIZ A;  1AUA A;  1JQJ C;  2OO9 A;  2X4A A;  3HU2 A;  1V92 A;  5DFL A;  1N32 M;  4OW0 A;  3E21 A;  2LVP C;  1TH4 A;  5ITR A;  2C5R A;  3SAV A;  1NO1 A;  5DNY A;  2EA0 A;  1K3X A;  2C9C A;  2ZBK B;  3T1H M;  3Q8G A;  3CTW B;  2L6O A;  3MK6 A;  2R62 A;  3HJS A;  2KRU A;  3GP1 A;  1HJP A;  3U61 A;  1R2Y A;  2DXI A;  4B7F A;  4QHS A;  3GLI E;  2MRO B;  1VDD A;  3I4V A;  4NXN M;  1NV9 A;  4OVZ B;  2XFT A;  3EIE A;  4F2L A;  3GLF E;  3SAR A;  1HQY E;  1XXH B;  1NV8 A;  2BJV A;  2WSF F;  1IXR C;  4DV0 M;  4GIP A;  4G4N A;  1R2Z A;  1G59 A;  2XEP A;  4XBO A;  1PGY A;  5DYI A;  4D80 A;  3AKZ A;  5LMU M;  2UUC M;  2ZAM A;  1PJI A;  2FH0 A;  1K82 A;  1SXJ C;  2JY7 A;  3AJI B;  4IBC A;  1HT2 E;  3HHY A;  3RGS A;  2LVO C;  4MGZ E;  1OAO C;  4AG5 A;  3BXW A;  2I7P A;  5EXT A;  4RKU F;  3H4M A;  4I5S A;  1QZM A;  5KPZ A;  4NL4 H;  4GRI A;  4CIS A;  3FRH A;  3PVS A;  4JI6 M;  2DAG A;  2R45 A;  2KXE A;  2D7G A;  2LHC A;  1R5L A;  1IBM M;  1J7K A;  1JR3 D;  3HX3 A;  3DZD A;  4NSR A;  5E6J A;  4S12 A;  2KA6 B;  4BBA A;  4LFC M;  3Q8X A;  3VKG A;  4IBE A;  2JZ1 A;  4LF8 M;  1I94 M;  4JI5 M;  2DWZ B;  5GKN A;  2J7O A;  2HKJ A;  4KHP M;  2EJS A;  1DGG A;  3THG A;  3PNY A;  5FTJ A;  4DR1 M;  1QAN A;  2KRK A;  3UK6 A;  3SBJ A;  5C18 A;  1D0M A;  3E9S A;  3KP1 E;  3MHV C;  4BB9 A;  3GLG E;  2V1U A;  1L2B A;  1IN6 A;  1EE8 A;  2M5Z A;  1MU5 A;  3L26 A;  4YY3 M;  2LVQ D;  4LJ7 A;  3AFH A;  4I81 A;  1L1T A;  4RF1 A;  2EO2 A;  4JI3 M;  5IZ7 D;  3OTO M;  3HJ8 A;  4JI2 M;  3W0L B;  2MH8 A;  3GLH E;  3ZH9 B;  3K2L A;  1HNX M;  2LWX A;  1Z59 A;  1Z5C A;  3J80 S;  4AZF A;  4HLQ A;  4B3S M;  4FCW A;  1IQP A;  3E46 A;  4IBI A;  4MGI E;  2QBY A;  2JZ0 A;  2DWM A;  3QWL A;  1LV7 A;  2C98 A;  1RU3 A;  2CE7 A;  2YQZ A;  3AV0 A;  3C9P A;  2P5T A;  3CGW A;  3LQQ A;  4W5W A;  4D82 A;  1X37 A;  5ITT A;  1DGH B;  4AW4 A;  2ZTC A;  1YE9 A;  2LNH C;  1ORY B;  2O5R A;  1XB2 B;  4AG6 A;  4PDG A;  1KFV A;  4LF4 M;  5IRE B;  3KP0 E;  3FTF A;  4L8R C;  1BVS A;  1PJT A;  1Q3C A;  1C7Y A;  2QZ4 A;  1N33 M;  4LGY A;  2DEN A;  2K47 A;  2L7I A;  3AOE C;  3SYK A;  1HNW M;  2AHM A;  1KYI A;  4OX9 M;  3FYD A;  1TDZ A;  3W0F A;  1PJS A;  1GL6 A;  3U6C A;  4MH0 E;  3FE3 A;  3K1J A;  1QUS A;  1VDL A;  4NOO B;  4M9S A;  2VF8 A;  2YFQ A;  2JY8 A;  3GRV A;  2DVW B;  2F5S A;  2XSZ D;  3LQR A;  3B89 A;  3CF6 E;  4GKJ M;  4M0W A;  2FE8 A;  1OFI A;  2L4F A;  3IHP A;  5BR8 M;  2MJ5 B;  2EKK A;  4NXM M;  2M60 A;  3JR5 A;  1Z5A A;  2ZM6 M;  2XZF A;  1XC8 A;  5EP4 A;  1IN5 A;  4M9X A;  4HL4 A;  3E4R A;  5LMN M;  4IIW A;  3M0E A;  4B3T M;  2APL A;  2DHR A;  1HT1 E;  2L2D A;  4ITQ A;  3FRI A;  4QNR A;  4R71 A;  2Y0Q A;  4X62 M;  3U6S A;  1VEJ A;  4FWG A;  5FTM A;  3GO8 A;  3U6Q A;  1J5E M;  4GHA A;  1JR3 A;  2CP8 A;  2BWB A;  2QCU A;  5ITY A;  1Q02 A;  3GLG A;  4QNM A; 
#chains in the Genus database with same CATH homology
 1QAO A;  3T38 A;  2YR0 A;  3GQ4 A;  5IWA M;  2ZAN A;  4QOS A;  5C1B A;  1Z6T A;  7CAT A;  2F5P A;  3HWS A;  4IBG A;  3CF2 A;  5IT9 S;  4GH9 A;  4ZPX A;  2R4J A;  3KXE C;  1IXS B;  4G4R A;  1J09 A;  5EP3 A;  1Z5B A;  3GLH A;  3HHW A;  4X65 M;  4JI1 M;  4DV7 M;  2C96 A;  2A5Y B;  3VLF B;  3U5Z B;  3QAU A;  4DV3 M;  4OVZ A;  2UUB M;  3A42 A;  3U6D A;  1XXH A;  3EIH A;  4B3M M;  3GQ5 A;  3KOY E;  1TGU A;  3MJ5 A;  4JYA M;  3GRR A;  2W82 A;  2Z4S A;  4L4U A;  2X8A A;  4QHT A;  3AOG A;  4Z8X A;  5ITX A;  1SXJ B;  3GQ3 A;  3SMP A;  2Z3X A;  2OQ4 A;  1L2C A;  3A46 A;  2Z7J A;  3B9P A;  2Y20 A;  3ILK A;  3ZC7 B;  4FCT A;  2UUA M;  4JXJ A;  4GMQ A;  4LY6 A;  3VFD A;  4JI4 M;  5FTK A;  1IY2 A;  3SHF A;  4IJE A;  1TH3 A;  3HGI A;  3TWL A;  4JI8 M;  2OPF A;  1DO2 A;  3K92 A;  1XNQ M;  2UXC M;  4RF0 A;  4CGY B;  5H37 D;  3JAM S;  2I7N A;  1D2N A;  1OFH A;  4FWD A;  4B7H A;  1L8Q A;  2R18 A;  4II7 A;  3VK8 A;  5EP2 A;  4LFB M;  2XLJ A;  1E94 E;  3KSX A;  3CF0 A;  4DUZ M;  5FTL A;  3C58 A;  3HKP A;  4XGI A;  1QQW A;  3GRY A;  2Q2E B;  4BLC A;  4MGK E;  1QYR A;  1W5S A;  1G4A E;  3GPY A;  2CHG A;  1GKI A;  1FJG M;  4LRS A;  4REZ A;  4A3V B;  2XSZ A;  3T1Y M;  4PD2 A;  3AL0 C;  2G8L A;  1MX0 A;  3U6L A;  3TL4 X;  2F5Q A;  2HHH M;  4LJ9 A;  4M9Z A;  4LJ8 A;  1DGF A;  3J7B A;  4FWH A;  4WW0 A;  5EP1 A;  4GIT A;  3GPU A;  4NRV A;  2XGN A;  4MGY E;  4LF9 M;  4DR7 M;  2ZAO A;  2UXD M;  4DR6 M;  2D7E A;  2UXB M;  1TDH A;  1IY0 A;  3VK7 A;  1HQC A;  2XH9 A;  5FTN A;  1I4W A;  1PM5 A;  2QEN A;  3I4Y A;  5F3W A;  1SXJ D;  1N78 A;  3GLI B;  3NBI A;  5EXP A;  5ITX E;  3RGP A;  2ERC A;  1NNJ A;  3L2A A;  1NJF A;  4PT5 A;  3UZU A;  4CHT B;  4LFA M;  2C9O A;  3WHL A;  3GPX A;  4DR2 M;  3DA1 A;  3JR4 A;  3K8Z A;  3GLF B;  1Q39 A;  2H1R A;  4FCV A;  2FFJ A;  3HU1 A;  1IXZ A;  3SAS A;  4K0K M;  5E26 A;  4AKH A;  1IN8 A;  1QAM A;  4R7G A;  3VDP A;  4RNA A;  1GLN A;  5A2Q S;  3BOS A;  4LZZ A;  5KO3 A;  2NQ8 C;  2CEA A;  2L7H A;  4DR5 M;  1N75 A;  3U6O A;  2L09 A;  4L16 A;  1QVR A;  3PNV A;  3GRU A;  1OJL A;  3U60 B;  2F5O A;  4KO8 A;  1R6B X;  1NHW C;  1IBL M;  4B3R M;  1WXQ A;  2VQF M;  4IBD A;  4MM3 B;  4GC5 A;  3KOZ E;  5ITU A;  4D81 A;  3J81 S;  2JA2 A;  2XZU A;  2LXE A;  2R4E A;  2CHV A;  2RGO A;  3IG8 A;  4G4O A;  1DO0 A;  1IN4 A;  4LZJ A;  4JN6 A;  3FYC A;  4AI6 A;  3KOX E;  3J7A S;  1L1Z A;  3SC3 A;  2YNM D;  3UMM A;  1FNN A;  2VII A;  1NHG C;  3FUX A;  3GLG B;  3UJN A;  5DYG A;  3LMM A;  3LVW A;  1IN7 A;  1NNU C;  3GPP A;  3U61 B;  1N36 M;  4X66 M;  4JI7 M;  2KZS A;  1N34 M;  3SYL A;  1XMO M;  1IM2 A;  3A45 A;  2V1C A;  4PCZ A;  3FUT A;  3TQS A;  4DV4 M;  3HHX A;  2DZN B;  1YUB A;  2CFO A;  3GLH B;  2QP9 X;  3FUU A;  1YSY A;  2FNA A;  3U5Z A;  4MGH A;  3RE8 A;  3FTE A;  1NJG A;  4LJA A;  3UGJ A;  4LJ5 A;  3J2P B;  2FOI C;  2LH0 A;  3ZCB B;  2F5N A;  3SAW A;  5KQ8 A;  3L28 A;  2V6Z M;  1UM8 A;  1T3T A;  2Z4R A;  3IG5 A;  2DWL A;  3KFU G;  4IBJ A;  3DFZ A;  2DZO B;  4LJ4 A;  4PDI A;  4DV5 M;  1SXJ A;  4KLN A;  3PFI A;  4IBF A;  4M0D A;  1IY1 A;  3KOW E;  1NSF A;  2HL7 A;  2R65 A;  3M7G A;  1N77 A;  5FLX S;  3SHG B;  2KEB A;  3SAT A;  1ZAE A;  4LF6 M;  1HR0 M;  3FUV A;  1GVN A;  3KS8 A;  4NSO B;  3FD9 A;  4DV6 M;  4EIW A;  1Q3B A;  4R3D A;  1PJJ A;  5BPV A;  4I8O A;  3NWL A;  1E32 A;  1S3S A;  3J27 B;  3KVW A;  3WHK A;  3U6P A;  4LF7 M;  3KW6 A;  1GL7 A;  2HCB A;  1H6U A;  3A98 B;  3M6A A;  3SFZ A;  3LVV A;  2CV2 A;  1R7R A;  4DV2 M;  5ITQ A;  2EUC A;  5EQT A;  3R9X B;  3DOA A;  5EJC A;  1E9R A;  2KW0 A;  2DWN A;  4LCB A;  5KQD A;  2KZU A;  2C99 A;  4B7G A;  2J7N A;  3L27 A;  1NVM A;  2G5G X;  2D7H A;  4DR4 M;  4LJ6 A;  2QBY B;  3VDU A;  1XMQ M;  2X49 A;  4LGM A;  4G6Z A;  3R8F A;  4LF5 M;  3D8B A;  4QOZ C;  1DGH A;  4X64 M;  3PXG A;  1E9S A;  3TPZ A;  3SAU A;  2Y21 A;  3TWM A;  3GLI A;  5JI2 E;  4DV1 M;  1L2D A;  1SXJ E;  5KPT A;  4LRT A;  4KOD A;  4P16 A;  2XF3 A;  1C1K A;  2BJW A;  2RGH A;  2CUZ A;  3TE6 A;  3D8L A;  3GLF A;  4TUW A;  1NY6 A;  1ZQ9 A;  4WUR A;  1TH2 A;  3L29 A;  3U6E A;  1K3W A;  3VKH A;  4I4L A;  4LG2 A;  4B08 A;  1XHB A;  1NY5 A;  1W5T A;  2BNK A;  2R46 A;  8CAT A;  1DGB A;  2XFS A;  2QPA A;  4IJF A;  2F4V M;  4AKG A;  3KDS E;  4DR3 M;  4IBB A;  4FD2 A;  1G41 A;  3T15 A;  3AOE A;  3KSJ A;  3FTD A;  2VQE M;  3KS4 A;  2CV1 A;  4JI0 M;  5EXX A;  3U60 A;  2E5L M;  4Z6Y A;  2CV0 A;  5EXS A;  4NRW A;  4JV5 M;  1KSF X;  4L78 A;  3HJQ A;  3FUW A;  1IBK M;  4GKK M;  5FSW A;  3FTC A;  5JI3 E;  3HU3 A;  4FW9 A;  3TWK A;  3U6M A;  3SMS A;  4YHH M;  2CHQ A;  3HHZ A;  4AQY M;  2UU9 M;  4LF8 M;  4DUY M;  4FVM A;  4L15 A;  3RFW A;  4GC9 A;  5KPR A;  2RKO A;  1HNZ M;  4AKI A;  1XWI A;  4GHL A;  1G3I A;  4IBK A;  1QAQ A;  3I51 A;  2Y0T A;  3FKE A;  3L25 A;  1G8P A;  4MB7 A;  1XNR M;  1JQJ C;  3HU2 A;  2X4A A;  1N32 M;  4OW0 A;  1TH4 A;  5ITR A;  2C5R A;  3SAV A;  5DNY A;  2EA0 A;  1K3X A;  2C9C A;  2ZBK B;  3T1H M;  3CTW B;  2L6O A;  3MK6 A;  2R62 A;  3HJS A;  2KRU A;  3GP1 A;  3U61 A;  1R2Y A;  2DXI A;  4B7F A;  4QHS A;  1VDD A;  3I4V A;  4NXN M;  4OVZ B;  2XFT A;  3EIE A;  3SAR A;  1HQY E;  1XXH B;  2BJV A;  1IXR C;  4DV0 M;  4GIP A;  4G4N A;  1R2Z A;  1G59 A;  2XEP A;  4XBO A;  5DYI A;  4D80 A;  3AKZ A;  5LMU M;  2UUC M;  2ZAM A;  1PJI A;  1K82 A;  1SXJ C;  3AJI B;  4IBC A;  1HT2 E;  3HHY A;  3RGS A;  4MGZ E;  4AG5 A;  2I7P A;  5EXT A;  3H4M A;  4I5S A;  1QZM A;  5KPZ A;  4NL4 H;  4GRI A;  4CIS A;  3PVS A;  4JI6 M;  2R45 A;  2KXE A;  2D7G A;  1IBM M;  1J7K A;  1JR3 D;  4NSR A;  3DZD A;  5E6J A;  4S12 A;  2KA6 B;  4BBA A;  4LFC M;  3Q8X A;  3VKG A;  4IBE A;  1I94 M;  4JI5 M;  2DWZ B;  5GKN A;  2J7O A;  2HKJ A;  4KHP M;  1DGG A;  3THG A;  3PNY A;  5FTJ A;  4DR1 M;  1QAN A;  2KRK A;  3UK6 A;  3SBJ A;  5C18 A;  3KP1 E;  3E9S A;  3MHV C;  4BB9 A;  2V1U A;  1L2B A;  1IN6 A;  1EE8 A;  2M5Z A;  1MU5 A;  3L26 A;  4YY3 M;  4LJ7 A;  3AFH A;  4I81 A;  1L1T A;  4RF1 A;  2EO2 A;  4JI3 M;  5IZ7 D;  3OTO M;  3HJ8 A;  4JI2 M;  3W0L B;  3ZH9 B;  3K2L A;  1HNX M;  2LWX A;  1Z59 A;  1Z5C A;  3J80 S;  4AZF A;  4HLQ A;  4B3S M;  4FCW A;  1IQP A;  4IBI A;  4MGI E;  2QBY A;  2DWM A;  3QWL A;  1LV7 A;  2C98 A;  2CE7 A;  3AV0 A;  2YQZ A;  3LQQ A;  4W5W A;  2P5T A;  5ITT A;  4OU7 A;  4G4Q A;  4D82 A;  1X37 A;  1DGH B;  4AW4 A;  1YE9 A;  2LNH C;  1ORY B;  2O5R A;  4AG6 A;  4PDG A;  1KFV A;  4LF4 M;  5IRE B;  3KP0 E;  3FTF A;  4L8R C;  1Q3C A;  2QZ4 A;  1N33 M;  4LGY A;  2K47 A;  2L7I A;  3AOE C;  3SYK A;  1HNW M;  2AHM A;  1KYI A;  4OX9 M;  3FYD A;  1TDZ A;  3W0F A;  1GL6 A;  3U6C A;  4MH0 E;  3K1J A;  4NOO B;  4M9S A;  2YFQ A;  3GRV A;  2DVW B;  2F5S A;  2XSZ D;  3LQR A;  3CF6 E;  4GKJ M;  4M0W A;  1OFI A;  2FE8 A;  5BR8 M;  4NXM M;  2M60 A;  3JR5 A;  1Z5A A;  2ZM6 M;  2XZF A;  1XC8 A;  5EP4 A;  1IN5 A;  4M9X A;  4HL4 A;  3E4R A;  5LMN M;  4IIW A;  3M0E A;  4B3T M;  2DHR A;  1HT1 E;  4ITQ A;  4QNR A;  2Y0Q A;  4X62 M;  3U6S A;  4FWG A;  5FTM A;  3GO8 A;  3U6Q A;  1J5E M;  4GHA A;  1JR3 A;  2QCU A;  5ITY A;  3GLG A;  4QNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...