1XNQM

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnqM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnqM02
4LFAM 3U6QA 4G4OA 3J81S 2OPFA 1IBKM 5ITQA 4DR4M 1IBMM 4GKJM 4LFBM 1Z5CA 3SARA 5LMUM 4JYAM 4JI0M 1KFVA 4X62M 4DUZM 4JV5M 4DV6M 2HHHM 4MB7A 1N34M 3SASA 4JI8M 4DR7M 4LF7M 4DV2M 1Z5BA 4YHHM 3GO8A 1J5EM 1Q39A 4LF6M 1N32M 4PDIA 4DV1M 1TDHA 4X66M 4PDGA 4LF5M 2UUBM 3GQ4A 3SATA 3A45A 5BR8M 1Q3CA 1R2ZA 4G4NA 3C58A 3A46A 3W0FA 3U6PA 3GPUA 4DV7M 3TWMA 1HNWM 1HR0M 5ITUA 3GQ3A 4NXNM 1L2DA 2F5SA 3GP1A 5ITXE 4JI4M 5LMNM 4B3RM 4B3TM 4NXMM 5A2QS 1MX0A 4G4RA 3U6OA 2XZUA 1I94M 2ZBKB 4DR6M 3J80S 1K3XA 2E5LM 4DV0M 4PD2A 1Z5AA 1XMOM 1XNQM 1FJGM 1XNRM 2UU9M 3SAVA 1MU5A 3T1YM 3T1HM 2Q2EB 3U6CA 4DR5M 2EA0A 3VK8A 1N36M 5ITRA 3J7AS 4GKKM 1PM5A 3GPYA 1L2CA 4X65M 1EE8A 4DR1M 2F5NA 4JI5M 4DV3M 4DV4M 4B3MM 4JI1M 4DR3M 1N33M 4LF8M 3GPPA 1HNXM 3OTOM 3U6DA 1PJJA 3TWLA 5IWAM 4JI3M 3JR4A 4AQYM 1Q3BA 3JAMS 5FLXS 2HKJA 3VK7A 2VQEM 4K0KM 4CISA 5IT9S 4DR2M 3SAUA 3SBJA 2F4VM 3GPXA 3SAWA 1L2BA 4KHPM 1TDZA 5ITYA 3U6LA 2XZFA 3A42A 4DV5M 1NNJA 2F5OA 3U6MA 1HNZM 1IBLM 4ITQA 1XC8A 5ITXA 3TWKA 1K3WA 2F5QA 2F5PA 4LFCM 4JI2M 3DOAA 2UUCM 1XMQM 4B3SM 2UXDM 3GQ5A 1L1TA 2UXCM 1L1ZA 2UXBM 2OQ4A 1R2YA 1Z59A 2VQFM 2UUAM 4JI6M 4PCZA 3U6EA 4JI7M 4NRWA 4YY3M 4LF9M 5ITTA 4X64M 4NRVA 1K82A 2ZM6M 4OX9M 4DUYM 1PJIA 4G4QA 4LF4M 3U6SA 3JR5A
chains in the Genus database with same CATH superfamily
5C18A 2WSEF 3J81S 3CGWA 1QDRA 3FUWA 1DGHB 3HU2A 2FFJA 4DR4M 1IBMM 1DGGA 7CATA 4LFBM 1R4GA 2GQFA 3M0EA 3GRUA 3TPZA 5LMUM 4JYAM 2G8LA 2DXIA 3UGJA 4MGZE 4IJFA 1Y8GA 4GHAA 1R6BX 1OFHA 1KSFX 3C3EA 1XB2B 2QPAA 4DV2M 1IXRC 2V6ZM 1Z5BA 1ZMWA 3C3DA 5IREB 2KRUA 1V92A 1OIPA 3GO8A 2VDBB 1R5LA 3VKGA 1Q39A 5KQ8A 1N77A 2CHQA 3KS8A 1TDHA 4IBGA 4X66M 3HJSA 4Q7JA 3FTDA 1JR3E 3PNYA 4PDGA 4LF5M 1GKIA 3K9PA 2W82A 3GQ4A 2LTUA 2CFOA 2D7GA 3A45A 3TL4X 3PXGA 3GRRA 1OAIA 3QWLA 5FTNA 1A5TA 2CUZA 2LVOC 3C58A 1C1KA 2DAMA 3W0FA 1QAMA 1IN5A 4IBCA 2GNOA 3ZH9B 5FTLA 4B7GA 5ITUA 3HY5A 2F5SA 3GP1A 2DKLA 2LWXA 4JI4M 1WR1B 5LMNM 4LRSA 1JQJC 4FWDA 4LJ9A 4I4LA 2DNAA 3HGIA 3IG5A 1V34A 1PJTA 3FUVA 2WSCF 3HU3A 1K3XA 2E5LM 4PD2A 4GRIA 1XMOM 1JR3D 4L78A 4FWHA 1OAOC 2XH9A 1MU5A 4CHTB 5IT9S 1G8PA 1W5TA 1GL7A 1JR3A 4I8OA 3T1HM 4NSRA 3R9XB 3FRHA 4GEWA 2EA0A 3U6CA 1N36M 1QZEA 1GLNA 4AW4A 2R0IA 1ZAEA 2ZANA 4M9XA 4X65M 1TGUA 2DAIA 3RFWA 2VIIA 4A3VB 4JI5M 4DV3M 4B3MM 4JI1M 3FRIA 2R4EA 4I5SA 4LG2A 3HU1A 3KW6A 3GPPA 1WXQA 4FCWA 4HL4A 2DHYA 3HX3A 2L09A 5EXSA 3L28A 3VDUA 1DO2A 3K1JA 5KPRA 4CISA 4R71A 1TF0B 5KQDA 4CJ6A 2XSZD 1NVMA 5EQTA 4XK8F 4B08A 3FYDA 1TDZA 5F3WA 2XZFA 4QHSA 2I7PA 1NY5A 1UM8A 1OFIA 3QAUA 1V33A 2BNKA 1QAOA 4LJ6A 5KPZA 3K92A 3VKHA 2R6FA 4IBFA 1XC8A 2F5QA 2R46A 1PJSA 3DOAA 2K6BA 2EO2A 2H1RA 3GLHA 3B9PA 2HCBA 1LTMA 4AG5A 1XMQM 3I04M 4B3SM 2UXDM 2X49A 1L1TA 3ZCBB 4RKUF 1EFUB 2QP9X 1IXZA 3SMSA 2J7OA 2FNAA 2Y0QA 1IN6A 1RU3A 3MK6A 2JUJA 3TE6A 4PCZA 3BXWA 1T6OA 3C9PA 4JN6A 1IQPA 1D0KA 3U6EA 3KOWE 4LF9M 5ITTA 2MH8A 3AOEC 4F2LA 2O01F 3FE3A 3A98B 3I51A 4LJ4A 4DUYM 3U5ZB 4JI7M 1IN4A 3HJQA 2D7HA 4GMQA 4G4OA 1OTRA 3L27A 4LJ5A 2OPFA 3AJIB 4MGIE 5ITQA 1IBKM 1E32A 1SXJC 1AUAA 4GKJM 3WHLA 4FD2A 1XXHB 2MGWA 4LY6A 4X62M 2Z7JA 4DV6M 2LBCA 2HHHM 4M9SA 1N34M 2JNHA 2D7EA 4AKIA 3SASA 4BLCA 4LF7M 2DAKA 2KRKA 3KSXA 2XLJA 1OQYA 1HQCA 4AG6A 1J5EM 2YQZA 3L2AA 2KNVA 4DV1M 1Z6TA 1TR8A 4W5WA 3DA1A 5BPVA 3GLFB 1NY6A 2UUBM 4QHTA 3DFZA 2QZ4A 2LVQD 5DFLA 2R4JA 3GLHE 5BR8M 1DGHA 2G5GX 1DO0A 1IN8A 2RGHA 3A46A 2DZNB 5EP1A 3GPUA 2C9CA 1J7KA 3TWMA 2LNHC 3KDSE 4L4UA 3W68A 2R44A 2O25A 1R7RA 5KPTA 2Z3XA 2DWLA 4GH9A 1E9SA 3D8BA 2M5ZA 4BB9A 3T6PA 3GLGA 3B89A 5A2QS 3SHFA 3W0LB 3TQSA 2C5RA 4KT0F 4DV0M 5EJCA 3KP0E 4KLNA 1XNRM 2C98A 3AV0A 3M7GA 1H6UA 2UU9M 3HJ8A 2EUCA 1NO1A 4FVMA 5H37D 2KZSA 3DZDA 4IBKA 3HWSA 1NHWC 2Y0TA 2RRUA 3WHKA 4DR5M 3QYEA 3J7AS 5ITRA 2DAEA 3M6AA 4GKKM 3AL0C 3QYBA 1SXJA 1YSYA 4R7GA 3GPYA 3B7ZA 2O5RA 1IY0A 1SXJE 2G3QA 3GRVA 3GLFE 1DGFA 4DV4M 3K2LA 2QBYB 3KXEC 4AKHA 3U60A 4IJEA 4ANRA 2R62A 3KVWA 1HNXM 1WGLA 1PJJA 1UFZA 4JI3M 5FSWA 3GLGB 2L6OA 3K9OA 3JR4A 3GLGE 1Q3BA 1MJGM 3VK7A 4K0KM 5DYGA 3SAUA 3SBJA 2BJVA 4S12A 4IBJA 4KHPM 3B7NA 4GITA 3U6LA 3A42A 4NSOB 4RF1A 1TH4A 1HNZM 1T3TA 3EIEA 1IXSA 2DHRA 1NSFA 4ITQA 1G3IA 3RGPA 3HKPA 1VEJA 4GHLA 2UUCM 2JY8A 1T43A 2Y21A 1DV0A 2OQ4A 1Z59A 4RF0A 5DNYA 3BBZA 3HHWA 3E21A 2FOIC 4HEOA 2FS1A 4MH0E 1SXJD 3MHVC 3THGA 4YY3M 4TUWA 1TH2A 2ZM6M 2XF3A 3LQQA 1PJIA 3FKEA 4G4QA 2L2DA 3AOEA 4REZA 4RNAA 2R45A 1ORYB 1YLAA 2CRUA 1E9RA 1VDLA 1AIPC 2KNZA 3HHXA 3L29A 4KODA 2OOAA 3UK6A 3VDPA 4OVZB 1D0MA 4M9ZA 3HHYA 3KFUG 2BWEA 2XGNA 3GLHB 1G4AE 4M0WA 4LGYA 4Z8XA 4MGKE 1VG5A 3SARA 4NC6A 1LV7A 4AKGA 4JV5M 4BBAA 3SYLA 2XSZA 4JI8M 1X37A 2QSFX 3CF0A 4LJ8A 4DR7M 1SXJB 1MN3A 1IFYA 3GLFA 1GVNA 3L25A 1WGNA 2CE7A 3UZUA 4LF6M 3R8FA 1VQ1A 3KOXE 3LW5F 2C9OA 1ZMUA 1G41A 3PVSA 3RGSA 3RE8A 1GABA 2X8AA 3EIHA 2ZAMA 3SATA 1XXHE 3IECA 4II7A 5C1BA 2YFQA 2LHCA 3FUTA 1F4IA 3W67A 4CGYB 1R2ZA 4FCTA 4IIWA 4G4NA 2DWMA 1HT2E 3CTWB 3IHPA 2CV0A 4HLQA 4GC5A 3Q8GA 4B7HA 1YE9A 1HJPA 1OIZA 4IBIA 5EXTA 1QANA 2EKKA 1EIJA 1P3QQ 1C7YA 5L8RF 2DWNA 1VEKA 4NXMM 3KP1E 3FYCA 1MX0A 4FWGA 4G4RA 4QOZC 1NV9A 1ZQ9A 1PJQA 2K9DA 2DWZB 3KS4A 3LVWA 3J80S 4F1IA 1WHCA 4B7FA 2X4AA 1XNQM 1YUBA 1FJGM 3FTCA 4LRTA 3ILKA 2QBYA 2ZTCA 3T1YM 3LCUA 1HT1E 2FE8A 5EP3A 2Q2EB 1GJTA 3PNVA 3VK8A 4WW0A 1FNNA 1TH3A 1PM5A 3U60B 1DGBA 2CV2A 4P16A 2KDLA 2CHVA 1Q02A 1JB0F 2QCUA 2XFTA 2F5NA 3LMMA 1QDTA 2QENA 1D0LA 3VFDA 1QVRA 4DR3M 1PRBA 2K0BX 3SFZA 1QUSA 2JZ1A 2Z4SA 4LF8M 2Z4RA 3OTOM 3U6DA 2B3TA 3TWLA 1S3SA 3NBIA 4LCBA 4AQYM 2CV1A 5FLXS 2OO9A 5E26A 2HKJA 3ZQJA 2VQEM 2Z8YM 2WZJA 2V1UA 2F4VM 2LH0A 3CF2A 3GPXA 2C96A 1L2BA 2H5XA 3KOZE 5EXPA 5ITYA 1NNJA 2C99A 2JA2A 1J09A 2ZAOA 4LZJA 1IBLM 4L15A 2CEAA 2F5PA 4XGIA 4LFCM 4D80A 2A5YB 3GLIB 4FW9A 4Z6YA 2KEBA 1KYIA 2DZOB 3L26A 2UXCM 3HZJA 3UJNA 2JZ0A 4IBBA 3LCVB 1R2YA 3GRYA 3MMPA 3NBXX 2JY7A 1ZMVA 5EP2A 2CHGA 2DENA 4R3DA 2L4FA 4NOOB 4NRVA 4LF4M 3U6SA 3SYKA 4DBGB 2F5OA 4QOSA 2AHMA 2I7NA 2L7IA 2RGOA 2KZUA 3I01M 4LFAM 3B74A 3U6QA 1VDDA 8CATA 3LVVA 2DAGA 1G59A 2JXNA 4UN2B 3H4JA 1IY2A 2MR9A 2N35A 1QZMA 1Z5CA 3J27B 3MJ5A 4IBEA 1IM2A 5JI3E 4JI0M 4MM3B 1KFVA 2JP7A 4DUZM 4NL4H 3E9SA 4MB7A 2Y20A 5FTJA 1L8QA 2QQ8A 3FTEA 2QHOB 5KO3A 4YHHM 5DYIA 2VF8A 5EXXA 3B7QA 4ZPXA 2NQ8C 1HQYE 1N32M 4AI6A 3E4RA 4PDIA 1QUTA 3J2PB 5E6JA 4AZFA 4OVZA 4PT5A 2R65A 2ERCA 3T15A 3AKZA 3FTFA 3NWLA 1ZV1A 2HAKA 3PFIA 4QNRA 2K47A 5GKNA 4FCVA 1Q3CA 4M0DA 1WIVA 4MGHA 2FH0A 1VEGA 2HL7A 3U6PA 2XEPA 1NJGA 4DV7M 1HNWM 1QYRA 3GQ3A 1HR0M 4NXNM 1L2DA 3F92A 1N78A 4WURA 1IXSB 3AOGA 1NHGC 3KSJA 1OKSA 2LXEA 2EJSA 5ITXE 1CUKA 3IG8A 4B3RM 2DVWB 4B3TM 2LVNC 4LZZA 1NNUC 3U61A 3U6OA 2XZUA 2MROB 1I94M 2ZBKB 3J7BA 3KOYE 4DR6M 4QNMA 2DI0A 2M60A 3CF6E 1Z5AA 3I4VA 5FTKA 2KNAA 3Q8XA 2BJWA 2J5YA 4D82A 4CIZA 3SAVA 3I4YA 2EKFA 3SHGB 2APLA 1NV8A 2BWBA 2MJ5B 2LVAA 1N75A 1G71A 4GC9A 1L2CA 2VF7A 4LGMA 2CP8A 4G6ZA 1EE8A 2WSFF 2YNMD 4LJAA 4DR1M 1BVSA 4KO8A 1I4WA 3AFHA 1XHBA 1GO5A 1GJSA 2LVPC 2ZTDA 2JY6B 1N33M 3HHZA 2V1CA 4Y28F 2R18A 4G3OA 2DZLA 5FTMA 5IZ7D 4D81A 5IWAM 2KW0A 3U61B 4MGYE 3FUXA 3K8ZA 3JAMS 4OU7A 3FD9A 2CWBA 3VLFB 3U5ZA 1IY1A 1NJFA 1QQWA 2KXEA 2J7NA 2HWJA 4I81A 4L6V6 1XWIA 3D8LA 3ZC7B 4DR2M 2L4EA 3SAWA 4LJ7A 4WP2A 1E94E 3E46A 4DV5M 4IBDA 1D2NA 3GLIA 3U6MA 5EP4A 2RKOA 1WJ7A 1QAQA 4XBOA 3T38A 3V76A 4EIWA 2KA6B 5ITXA 3TWKA 1K3WA 1W5SA 1SG9A 2XFSA 3UMMA 4JI2M 2L7HA 2YR0A 2OOBA 3SC3A 4L8RC 1XXHA 2JWSA 3FUUA 1GL6A 3GQ5A 4GIPA 3LQRA 1L1ZA 4JXJA 2UXBM 2VQFM 2UUAM 2P5TA 5JI2E 1IN7A 2QNJA 2JY5A 3BOSA 4L16A 4P17A 4OW0A 4JI6M 2KHHA 2LHGA 3GLIE 4NRWA 4X64M 1TTEA 1K82A 4OX9M 1PGYA 1OJLA 3H4MA 3JR5A 3SMPA
chains in the Genus database with same CATH topology
5C18A 3J81S 3FUWA 1DGHB 3HU2A 2FFJA 4DR4M 1IBMM 1DGGA 7CATA 4LFBM 3M0EA 3GRUA 3TPZA 5LMUM 4JYAM 2G8LA 2DXIA 3UGJA 4MGZE 4IJFA 4GHAA 1R6BX 1OFHA 1KSFX 2QPAA 4DV2M 1IXRC 2V6ZM 1Z5BA 5IREB 2KRUA 3GO8A 3VKGA 1Q39A 5KQ8A 1N77A 2CHQA 3KS8A 1TDHA 4IBGA 4X66M 3HJSA 3FTDA 3PNYA 4PDGA 4LF5M 1GKIA 2W82A 3GQ4A 2CFOA 2D7GA 3A45A 3TL4X 3PXGA 3GRRA 5FTNA 3QWLA 2CUZA 3C58A 1C1KA 3W0FA 1QAMA 1IN5A 4IBCA 3ZH9B 5FTLA 4B7GA 5ITUA 2F5SA 3GP1A 2LWXA 4JI4M 5LMNM 4LRSA 1JQJC 4FWDA 4LJ9A 4I4LA 3IG5A 3HGIA 3FUVA 3HU3A 1K3XA 2E5LM 4PD2A 4GRIA 1XMOM 1JR3D 4L78A 4FWHA 2XH9A 1MU5A 4CHTB 1G8PA 1W5TA 1GL7A 1JR3A 4I8OA 3T1HM 4NSRA 3R9XB 3U6CA 2EA0A 1N36M 1GLNA 4AW4A 1ZAEA 2ZANA 4M9XA 4X65M 1TGUA 3RFWA 2VIIA 4A3VB 4JI5M 4DV3M 4B3MM 4JI1M 2R4EA 4I5SA 4LG2A 3HU1A 3KW6A 3GPPA 1WXQA 4FCWA 4HL4A 2L09A 5EXSA 3L28A 3VDUA 1DO2A 3K1JA 5KPRA 4CISA 5KQDA 2XSZD 1NVMA 5EQTA 4B08A 3FYDA 1TDZA 5F3WA 2XZFA 4QHSA 2I7PA 1NY5A 3QAUA 1UM8A 1OFIA 5KPZA 2BNKA 1QAOA 4LJ6A 3VKHA 3K92A 4IBFA 1XC8A 2F5QA 2R46A 3DOAA 2EO2A 2H1RA 3GLHA 3B9PA 2HCBA 4AG5A 1XMQM 4B3SM 2UXDM 2X49A 1L1TA 3ZCBB 2QP9X 1IXZA 3SMSA 2J7OA 2FNAA 2Y0QA 1IN6A 3MK6A 3TE6A 4PCZA 4JN6A 3U6EA 1IQPA 3KOWE 4LF9M 5ITTA 3AOEC 4DUYM 4LJ4A 3A98B 3I51A 3U5ZB 4JI7M 1IN4A 3HJQA 2D7HA 4GMQA 4G4OA 3L27A 4LJ5A 2OPFA 1IBKM 3AJIB 4MGIE 5ITQA 1E32A 1SXJC 4GKJM 3WHLA 4FD2A 1XXHB 4LY6A 4X62M 2Z7JA 4DV6M 2HHHM 4AKIA 4M9SA 1N34M 2D7EA 3SASA 4BLCA 4LF7M 3KSXA 2KRKA 2XLJA 1HQCA 4AG6A 1J5EM 2YQZA 3L2AA 4DV1M 1Z6TA 4W5WA 5BPVA 3DA1A 3GLFB 1NY6A 2UUBM 4QHTA 3DFZA 2QZ4A 2R4JA 5BR8M 1DGHA 2G5GX 1DO0A 1IN8A 2RGHA 3A46A 2DZNB 5EP1A 3GPUA 2C9CA 1J7KA 3TWMA 2LNHC 3KDSE 4L4UA 1R7RA 5KPTA 2Z3XA 2DWLA 4GH9A 1E9SA 3D8BA 2M5ZA 4BB9A 2C5RA 3GLGA 5A2QS 3SHFA 3W0LB 3TQSA 4DV0M 5EJCA 3KP0E 4KLNA 1XNRM 2C98A 3AV0A 3M7GA 1H6UA 2UU9M 4FVMA 3HJ8A 2EUCA 5H37D 2KZSA 3DZDA 4IBKA 3HWSA 1NHWC 2Y0TA 3WHKA 4DR5M 3J7AS 5ITRA 3M6AA 4GKKM 3AL0C 1SXJA 1YSYA 4R7GA 3GPYA 3GRVA 2O5RA 1IY0A 1SXJE 1DGFA 4DV4M 3K2LA 2QBYB 3KXEC 4AKHA 3U60A 4IJEA 2R62A 3KVWA 1HNXM 1PJJA 4JI3M 5FSWA 3GLGB 2L6OA 3JR4A 1Q3BA 3VK7A 4K0KM 5DYGA 3SAUA 3SBJA 2BJVA 4S12A 4IBJA 4KHPM 4GITA 3U6LA 3A42A 4NSOB 4RF1A 1TH4A 1HNZM 1T3TA 3EIEA 2DHRA 1NSFA 4ITQA 1G3IA 3RGPA 3HKPA 4GHLA 2UUCM 2Y21A 2OQ4A 1Z59A 4RF0A 5DNYA 3HHWA 2FOIC 4MH0E 1SXJD 3MHVC 3THGA 4YY3M 4TUWA 1TH2A 2ZM6M 2XF3A 3LQQA 1PJIA 3FKEA 4G4QA 4REZA 3AOEA 4RNAA 2R45A 1ORYB 3HHXA 1E9RA 4KODA 3L29A 3UK6A 3VDPA 4OVZB 4M9ZA 3KFUG 3HHYA 2XGNA 3GLHB 1G4AE 4M0WA 4LGYA 4Z8XA 4MGKE 3SARA 4AKGA 1LV7A 4JV5M 4BBAA 3SYLA 2XSZA 4JI8M 1X37A 3CF0A 4LJ8A 4DR7M 1SXJB 3GLFA 1GVNA 3L25A 2CE7A 3UZUA 4LF6M 3R8FA 3KOXE 2C9OA 1G41A 3PVSA 3RGSA 3RE8A 2X8AA 3EIHA 2ZAMA 3SATA 4II7A 5C1BA 2YFQA 3FUTA 4CGYB 1R2ZA 4FCTA 4IIWA 4G4NA 2DWMA 1HT2E 3CTWB 2CV0A 4HLQA 4GC5A 4B7HA 1YE9A 4IBIA 5EXTA 1QANA 2DWNA 4NXMM 3KP1E 3FYCA 1MX0A 4FWGA 4G4RA 4QOZC 3LVWA 1ZQ9A 3KS4A 2DWZB 3J80S 4B7FA 2X4AA 1XNQM 1YUBA 1FJGM 3FTCA 4LRTA 3ILKA 2QBYA 3T1YM 1HT1E 2FE8A 5EP3A 2Q2EB 3PNVA 3VK8A 4WW0A 1FNNA 1TH3A 1PM5A 3U60B 1DGBA 2CV2A 4P16A 2CHVA 2XFTA 2QCUA 2F5NA 3LMMA 3VFDA 2QENA 1QVRA 4DR3M 3SFZA 2Z4SA 4LF8M 2Z4RA 3OTOM 3U6DA 3TWLA 1S3SA 3NBIA 4LCBA 4AQYM 2CV1A 5FLXS 5E26A 2HKJA 2VQEM 2V1UA 2F4VM 2LH0A 3CF2A 3GPXA 2C96A 1L2BA 3KOZE 5EXPA 5ITYA 1NNJA 2C99A 2JA2A 1J09A 2ZAOA 4LZJA 1IBLM 4L15A 2CEAA 2F5PA 4XGIA 4LFCM 4D80A 2A5YB 3GLIB 4FW9A 4Z6YA 2KEBA 1KYIA 2DZOB 3L26A 2UXCM 3UJNA 4IBBA 1R2YA 3GRYA 5EP2A 2CHGA 4R3DA 4NOOB 4NRVA 4LF4M 3U6SA 3SYKA 2F5OA 4QOSA 2AHMA 2I7NA 2L7IA 2RGOA 2KZUA 4LFAM 3U6QA 1VDDA 8CATA 3LVVA 1G59A 1IY2A 1QZMA 1Z5CA 3J27B 3MJ5A 4IBEA 1IM2A 5JI3E 4JI0M 4MM3B 1KFVA 4DUZM 4NL4H 3E9SA 4MB7A 2Y20A 5FTJA 1L8QA 3FTEA 5KO3A 4YHHM 5DYIA 5EXXA 4ZPXA 2NQ8C 1HQYE 1N32M 4AI6A 3E4RA 4PDIA 3J2PB 5E6JA 4AZFA 4OVZA 4PT5A 2R65A 2ERCA 3T15A 3AKZA 3FTFA 3NWLA 4QNRA 3PFIA 2K47A 5GKNA 4FCVA 1Q3CA 4M0DA 4MGHA 2HL7A 3U6PA 2XEPA 1NJGA 4DV7M 1HNWM 1QYRA 3GQ3A 1HR0M 4NXNM 1L2DA 1N78A 4WURA 1IXSB 3AOGA 1NHGC 3KSJA 5ITXE 2LXEA 3IG8A 4B3RM 2DVWB 4B3TM 4LZZA 1NNUC 3U61A 3U6OA 2XZUA 1I94M 2ZBKB 3J7BA 3KOYE 4DR6M 4QNMA 2M60A 3CF6E 1Z5AA 3I4VA 5FTKA 3Q8XA 4D82A 2BJWA 3SAVA 3I4YA 3SHGB 1N75A 4GC9A 1L2CA 4LGMA 4G6ZA 1EE8A 4DR1M 2YNMD 4LJAA 4KO8A 1I4WA 3AFHA 1XHBA 1N33M 3HHZA 2V1CA 2R18A 4D81A 5FTMA 5IZ7D 5IWAM 2KW0A 3U61B 4MGYE 3FUXA 3K8ZA 3JAMS 4OU7A 3FD9A 3VLFB 3U5ZA 1IY1A 1NJFA 1QQWA 2KXEA 2J7NA 4I81A 3ZC7B 4DR2M 1XWIA 3D8LA 5IT9S 3SAWA 4LJ7A 1E94E 4DV5M 4IBDA 1D2NA 3GLIA 3U6MA 5EP4A 2RKOA 3T38A 1QAQA 4XBOA 4EIWA 2KA6B 5ITXA 3TWKA 1K3WA 1W5SA 2XFSA 4JI2M 3UMMA 2L7HA 2YR0A 3SC3A 4L8RC 1XXHA 3FUUA 1GL6A 3GQ5A 4GIPA 3LQRA 1L1ZA 4JXJA 2UXBM 2VQFM 2UUAM 2P5TA 5JI2E 1IN7A 4L16A 3BOSA 4JI6M 4OW0A 4NRWA 4X64M 1K82A 4OX9M 1OJLA 3H4MA 3JR5A 3SMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA M;  3U6Q A;  4G4O A;  3J81 S;  2OPF A;  1IBK M;  5ITQ A;  4DR4 M;  1IBM M;  4GKJ M;  4LFB M;  1Z5C A;  3SAR A;  5LMU M;  4JYA M;  4JI0 M;  1KFV A;  4X62 M;  4DUZ M;  4JV5 M;  4DV6 M;  2HHH M;  4MB7 A;  1N34 M;  3SAS A;  4JI8 M;  4DR7 M;  4LF7 M;  4DV2 M;  1Z5B A;  4YHH M;  3GO8 A;  1J5E M;  1Q39 A;  4LF6 M;  1N32 M;  4PDI A;  4DV1 M;  1TDH A;  4X66 M;  4PDG A;  4LF5 M;  2UUB M;  3GQ4 A;  3SAT A;  3A45 A;  5BR8 M;  1Q3C A;  1R2Z A;  4G4N A;  3C58 A;  3A46 A;  3W0F A;  3U6P A;  3GPU A;  4DV7 M;  3TWM A;  1HNW M;  1HR0 M;  5ITU A;  3GQ3 A;  4NXN M;  1L2D A;  2F5S A;  3GP1 A;  5ITX E;  4JI4 M;  5LMN M;  4B3R M;  4B3T M;  4NXM M;  5A2Q S;  1MX0 A;  4G4R A;  3U6O A;  2XZU A;  1I94 M;  2ZBK B;  4DR6 M;  3J80 S;  1K3X A;  2E5L M;  4DV0 M;  4PD2 A;  1Z5A A;  1XMO M;  1XNQ M;  1FJG M;  1XNR M;  2UU9 M;  3SAV A;  1MU5 A;  3T1Y M;  3T1H M;  2Q2E B;  3U6C A;  4DR5 M;  2EA0 A;  3VK8 A;  1N36 M;  5ITR A;  3J7A S;  4GKK M;  1PM5 A;  3GPY A;  1L2C A;  4X65 M;  1EE8 A;  4DR1 M;  2F5N A;  4JI5 M;  4DV3 M;  4DV4 M;  4B3M M;  4JI1 M;  4DR3 M;  1N33 M;  4LF8 M;  3GPP A;  1HNX M;  3OTO M;  3U6D A;  1PJJ A;  3TWL A;  5IWA M;  4JI3 M;  3JR4 A;  4AQY M;  1Q3B A;  3JAM S;  5FLX S;  2HKJ A;  3VK7 A;  2VQE M;  4K0K M;  4CIS A;  5IT9 S;  4DR2 M;  3SAU A;  3SBJ A;  2F4V M;  3GPX A;  3SAW A;  1L2B A;  4KHP M;  1TDZ A;  5ITY A;  3U6L A;  2XZF A;  3A42 A;  4DV5 M;  1NNJ A;  2F5O A;  3U6M A;  1HNZ M;  1IBL M;  4ITQ A;  1XC8 A;  5ITX A;  3TWK A;  1K3W A;  2F5Q A;  2F5P A;  4LFC M;  4JI2 M;  3DOA A;  2UUC M;  1XMQ M;  4B3S M;  2UXD M;  3GQ5 A;  1L1T A;  2UXC M;  1L1Z A;  2UXB M;  2OQ4 A;  1R2Y A;  1Z59 A;  2VQF M;  2UUA M;  4JI6 M;  4PCZ A;  3U6E A;  4JI7 M;  4NRW A;  4YY3 M;  4LF9 M;  5ITT A;  4X64 M;  4NRV A;  1K82 A;  2ZM6 M;  4OX9 M;  4DUY M;  1PJI A;  4G4Q A;  4LF4 M;  3U6S A;  3JR5 A; 
#chains in the Genus database with same CATH topology
 5C18 A;  2WSE F;  3J81 S;  3CGW A;  1QDR A;  3FUW A;  1DGH B;  3HU2 A;  2FFJ A;  4DR4 M;  1IBM M;  1DGG A;  7CAT A;  4LFB M;  1R4G A;  2GQF A;  3M0E A;  3GRU A;  3TPZ A;  5LMU M;  4JYA M;  2G8L A;  2DXI A;  3UGJ A;  4MGZ E;  4IJF A;  1Y8G A;  4GHA A;  1R6B X;  1OFH A;  1KSF X;  3C3E A;  1XB2 B;  2QPA A;  4DV2 M;  1IXR C;  2V6Z M;  1Z5B A;  1ZMW A;  3C3D A;  5IRE B;  2KRU A;  1V92 A;  1OIP A;  3GO8 A;  2VDB B;  1R5L A;  3VKG A;  1Q39 A;  5KQ8 A;  1N77 A;  2CHQ A;  3KS8 A;  1TDH A;  4IBG A;  4X66 M;  3HJS A;  4Q7J A;  3FTD A;  1JR3 E;  3PNY A;  4PDG A;  4LF5 M;  1GKI A;  3K9P A;  2W82 A;  3GQ4 A;  2LTU A;  2CFO A;  2D7G A;  3A45 A;  3TL4 X;  3PXG A;  3GRR A;  1OAI A;  3QWL A;  5FTN A;  1A5T A;  2CUZ A;  2LVO C;  3C58 A;  1C1K A;  2DAM A;  3W0F A;  1QAM A;  1IN5 A;  4IBC A;  2GNO A;  3ZH9 B;  5FTL A;  4B7G A;  5ITU A;  3HY5 A;  2F5S A;  3GP1 A;  2DKL A;  2LWX A;  4JI4 M;  1WR1 B;  5LMN M;  4LRS A;  1JQJ C;  4FWD A;  4LJ9 A;  4I4L A;  2DNA A;  3HGI A;  3IG5 A;  1V34 A;  1PJT A;  3FUV A;  2WSC F;  3HU3 A;  1K3X A;  2E5L M;  4PD2 A;  4GRI A;  1XMO M;  1JR3 D;  4L78 A;  4FWH A;  1OAO C;  2XH9 A;  1MU5 A;  4CHT B;  5IT9 S;  1G8P A;  1W5T A;  1GL7 A;  1JR3 A;  4I8O A;  3T1H M;  4NSR A;  3R9X B;  3FRH A;  4GEW A;  2EA0 A;  3U6C A;  1N36 M;  1QZE A;  1GLN A;  4AW4 A;  2R0I A;  1ZAE A;  2ZAN A;  4M9X A;  4X65 M;  1TGU A;  2DAI A;  3RFW A;  2VII A;  4A3V B;  4JI5 M;  4DV3 M;  4B3M M;  4JI1 M;  3FRI A;  2R4E A;  4I5S A;  4LG2 A;  3HU1 A;  3KW6 A;  3GPP A;  1WXQ A;  4FCW A;  4HL4 A;  2DHY A;  3HX3 A;  2L09 A;  5EXS A;  3L28 A;  3VDU A;  1DO2 A;  3K1J A;  5KPR A;  4CIS A;  4R71 A;  1TF0 B;  5KQD A;  4CJ6 A;  2XSZ D;  1NVM A;  5EQT A;  4XK8 F;  4B08 A;  3FYD A;  1TDZ A;  5F3W A;  2XZF A;  4QHS A;  2I7P A;  1NY5 A;  1UM8 A;  1OFI A;  3QAU A;  1V33 A;  2BNK A;  1QAO A;  4LJ6 A;  5KPZ A;  3K92 A;  3VKH A;  2R6F A;  4IBF A;  1XC8 A;  2F5Q A;  2R46 A;  1PJS A;  3DOA A;  2K6B A;  2EO2 A;  2H1R A;  3GLH A;  3B9P A;  2HCB A;  1LTM A;  4AG5 A;  1XMQ M;  3I04 M;  4B3S M;  2UXD M;  2X49 A;  1L1T A;  3ZCB B;  4RKU F;  1EFU B;  2QP9 X;  1IXZ A;  3SMS A;  2J7O A;  2FNA A;  2Y0Q A;  1IN6 A;  1RU3 A;  3MK6 A;  2JUJ A;  3TE6 A;  4PCZ A;  3BXW A;  1T6O A;  3C9P A;  4JN6 A;  1IQP A;  1D0K A;  3U6E A;  3KOW E;  4LF9 M;  5ITT A;  2MH8 A;  3AOE C;  4F2L A;  2O01 F;  3FE3 A;  3A98 B;  3I51 A;  4LJ4 A;  4DUY M;  3U5Z B;  4JI7 M;  1IN4 A;  3HJQ A;  2D7H A;  4GMQ A;  4G4O A;  1OTR A;  3L27 A;  4LJ5 A;  2OPF A;  3AJI B;  4MGI E;  5ITQ A;  1IBK M;  1E32 A;  1SXJ C;  1AUA A;  4GKJ M;  3WHL A;  4FD2 A;  1XXH B;  2MGW A;  4LY6 A;  4X62 M;  2Z7J A;  4DV6 M;  2LBC A;  2HHH M;  4M9S A;  1N34 M;  2JNH A;  2D7E A;  4AKI A;  3SAS A;  4BLC A;  4LF7 M;  2DAK A;  2KRK A;  3KSX A;  2XLJ A;  1OQY A;  1HQC A;  4AG6 A;  1J5E M;  2YQZ A;  3L2A A;  2KNV A;  4DV1 M;  1Z6T A;  1TR8 A;  4W5W A;  3DA1 A;  5BPV A;  3GLF B;  1NY6 A;  2UUB M;  4QHT A;  3DFZ A;  2QZ4 A;  2LVQ D;  5DFL A;  2R4J A;  3GLH E;  5BR8 M;  1DGH A;  2G5G X;  1DO0 A;  1IN8 A;  2RGH A;  3A46 A;  2DZN B;  5EP1 A;  3GPU A;  2C9C A;  1J7K A;  3TWM A;  2LNH C;  3KDS E;  4L4U A;  3W68 A;  2R44 A;  2O25 A;  1R7R A;  5KPT A;  2Z3X A;  2DWL A;  4GH9 A;  1E9S A;  3D8B A;  2M5Z A;  4BB9 A;  3T6P A;  3GLG A;  3B89 A;  5A2Q S;  3SHF A;  3W0L B;  3TQS A;  2C5R A;  4KT0 F;  4DV0 M;  5EJC A;  3KP0 E;  4KLN A;  1XNR M;  2C98 A;  3AV0 A;  3M7G A;  1H6U A;  2UU9 M;  3HJ8 A;  2EUC A;  1NO1 A;  4FVM A;  5H37 D;  2KZS A;  3DZD A;  4IBK A;  3HWS A;  1NHW C;  2Y0T A;  2RRU A;  3WHK A;  4DR5 M;  3QYE A;  3J7A S;  5ITR A;  2DAE A;  3M6A A;  4GKK M;  3AL0 C;  3QYB A;  1SXJ A;  1YSY A;  4R7G A;  3GPY A;  3B7Z A;  2O5R A;  1IY0 A;  1SXJ E;  2G3Q A;  3GRV A;  3GLF E;  1DGF A;  4DV4 M;  3K2L A;  2QBY B;  3KXE C;  4AKH A;  3U60 A;  4IJE A;  4ANR A;  2R62 A;  3KVW A;  1HNX M;  1WGL A;  1PJJ A;  1UFZ A;  4JI3 M;  5FSW A;  3GLG B;  2L6O A;  3K9O A;  3JR4 A;  3GLG E;  1Q3B A;  1MJG M;  3VK7 A;  4K0K M;  5DYG A;  3SAU A;  3SBJ A;  2BJV A;  4S12 A;  4IBJ A;  4KHP M;  3B7N A;  4GIT A;  3U6L A;  3A42 A;  4NSO B;  4RF1 A;  1TH4 A;  1HNZ M;  1T3T A;  3EIE A;  1IXS A;  2DHR A;  1NSF A;  4ITQ A;  1G3I A;  3RGP A;  3HKP A;  1VEJ A;  4GHL A;  2UUC M;  2JY8 A;  1T43 A;  2Y21 A;  1DV0 A;  2OQ4 A;  1Z59 A;  4RF0 A;  5DNY A;  3BBZ A;  3HHW A;  3E21 A;  2FOI C;  4HEO A;  2FS1 A;  4MH0 E;  1SXJ D;  3MHV C;  3THG A;  4YY3 M;  4TUW A;  1TH2 A;  2ZM6 M;  2XF3 A;  3LQQ A;  1PJI A;  3FKE A;  4G4Q A;  2L2D A;  3AOE A;  4REZ A;  4RNA A;  2R45 A;  1ORY B;  1YLA A;  2CRU A;  1E9R A;  1VDL A;  1AIP C;  2KNZ A;  3HHX A;  3L29 A;  4KOD A;  2OOA A;  3UK6 A;  3VDP A;  4OVZ B;  1D0M A;  4M9Z A;  3HHY A;  3KFU G;  2BWE A;  2XGN A;  3GLH B;  1G4A E;  4M0W A;  4LGY A;  4Z8X A;  4MGK E;  1VG5 A;  3SAR A;  4NC6 A;  1LV7 A;  4AKG A;  4JV5 M;  4BBA A;  3SYL A;  2XSZ A;  4JI8 M;  1X37 A;  2QSF X;  3CF0 A;  4LJ8 A;  4DR7 M;  1SXJ B;  1MN3 A;  1IFY A;  3GLF A;  1GVN A;  3L25 A;  1WGN A;  2CE7 A;  3UZU A;  4LF6 M;  3R8F A;  1VQ1 A;  3KOX E;  3LW5 F;  2C9O A;  1ZMU A;  1G41 A;  3PVS A;  3RGS A;  3RE8 A;  1GAB A;  2X8A A;  3EIH A;  2ZAM A;  3SAT A;  1XXH E;  3IEC A;  4II7 A;  5C1B A;  2YFQ A;  2LHC A;  3FUT A;  1F4I A;  3W67 A;  4CGY B;  1R2Z A;  4FCT A;  4IIW A;  4G4N A;  2DWM A;  1HT2 E;  3CTW B;  3IHP A;  2CV0 A;  4HLQ A;  4GC5 A;  3Q8G A;  4B7H A;  1YE9 A;  1HJP A;  1OIZ A;  4IBI A;  5EXT A;  1QAN A;  2EKK A;  1EIJ A;  1P3Q Q;  1C7Y A;  5L8R F;  2DWN A;  1VEK A;  4NXM M;  3KP1 E;  3FYC A;  1MX0 A;  4FWG A;  4G4R A;  4QOZ C;  1NV9 A;  1ZQ9 A;  1PJQ A;  2K9D A;  2DWZ B;  3KS4 A;  3LVW A;  3J80 S;  4F1I A;  1WHC A;  4B7F A;  2X4A A;  1XNQ M;  1YUB A;  1FJG M;  3FTC A;  4LRT A;  3ILK A;  2QBY A;  2ZTC A;  3T1Y M;  3LCU A;  1HT1 E;  2FE8 A;  5EP3 A;  2Q2E B;  1GJT A;  3PNV A;  3VK8 A;  4WW0 A;  1FNN A;  1TH3 A;  1PM5 A;  3U60 B;  1DGB A;  2CV2 A;  4P16 A;  2KDL A;  2CHV A;  1Q02 A;  1JB0 F;  2QCU A;  2XFT A;  2F5N A;  3LMM A;  1QDT A;  2QEN A;  1D0L A;  3VFD A;  1QVR A;  4DR3 M;  1PRB A;  2K0B X;  3SFZ A;  1QUS A;  2JZ1 A;  2Z4S A;  4LF8 M;  2Z4R A;  3OTO M;  3U6D A;  2B3T A;  3TWL A;  1S3S A;  3NBI A;  4LCB A;  4AQY M;  2CV1 A;  5FLX S;  2OO9 A;  5E26 A;  2HKJ A;  3ZQJ A;  2VQE M;  2Z8Y M;  2WZJ A;  2V1U A;  2F4V M;  2LH0 A;  3CF2 A;  3GPX A;  2C96 A;  1L2B A;  2H5X A;  3KOZ E;  5EXP A;  5ITY A;  1NNJ A;  2C99 A;  2JA2 A;  1J09 A;  2ZAO A;  4LZJ A;  1IBL M;  4L15 A;  2CEA A;  2F5P A;  4XGI A;  4LFC M;  4D80 A;  2A5Y B;  3GLI B;  4FW9 A;  4Z6Y A;  2KEB A;  1KYI A;  2DZO B;  3L26 A;  2UXC M;  3HZJ A;  3UJN A;  2JZ0 A;  4IBB A;  3LCV B;  1R2Y A;  3GRY A;  3MMP A;  3NBX X;  2JY7 A;  1ZMV A;  5EP2 A;  2CHG A;  2DEN A;  4R3D A;  2L4F A;  4NOO B;  4NRV A;  4LF4 M;  3U6S A;  3SYK A;  4DBG B;  2F5O A;  4QOS A;  2AHM A;  2I7N A;  2L7I A;  2RGO A;  2KZU A;  3I01 M;  4LFA M;  3B74 A;  3U6Q A;  1VDD A;  8CAT A;  3LVV A;  2DAG A;  1G59 A;  2JXN A;  4UN2 B;  3H4J A;  1IY2 A;  2MR9 A;  2N35 A;  1QZM A;  1Z5C A;  3J27 B;  3MJ5 A;  4IBE A;  1IM2 A;  5JI3 E;  4JI0 M;  4MM3 B;  1KFV A;  2JP7 A;  4DUZ M;  4NL4 H;  3E9S A;  4MB7 A;  2Y20 A;  5FTJ A;  1L8Q A;  2QQ8 A;  3FTE A;  2QHO B;  5KO3 A;  4YHH M;  5DYI A;  2VF8 A;  5EXX A;  3B7Q A;  4ZPX A;  2NQ8 C;  1HQY E;  1N32 M;  4AI6 A;  3E4R A;  4PDI A;  1QUT A;  3J2P B;  5E6J A;  4AZF A;  4OVZ A;  4PT5 A;  2R65 A;  2ERC A;  3T15 A;  3AKZ A;  3FTF A;  3NWL A;  1ZV1 A;  2HAK A;  3PFI A;  4QNR A;  2K47 A;  5GKN A;  4FCV A;  1Q3C A;  4M0D A;  1WIV A;  4MGH A;  2FH0 A;  1VEG A;  2HL7 A;  3U6P A;  2XEP A;  1NJG A;  4DV7 M;  1HNW M;  1QYR A;  3GQ3 A;  1HR0 M;  4NXN M;  1L2D A;  3F92 A;  1N78 A;  4WUR A;  1IXS B;  3AOG A;  1NHG C;  3KSJ A;  1OKS A;  2LXE A;  2EJS A;  5ITX E;  1CUK A;  3IG8 A;  4B3R M;  2DVW B;  4B3T M;  2LVN C;  4LZZ A;  1NNU C;  3U61 A;  3U6O A;  2XZU A;  2MRO B;  1I94 M;  2ZBK B;  3J7B A;  3KOY E;  4DR6 M;  4QNM A;  2DI0 A;  2M60 A;  3CF6 E;  1Z5A A;  3I4V A;  5FTK A;  2KNA A;  3Q8X A;  2BJW A;  2J5Y A;  4D82 A;  4CIZ A;  3SAV A;  3I4Y A;  2EKF A;  3SHG B;  2APL A;  1NV8 A;  2BWB A;  2MJ5 B;  2LVA A;  1N75 A;  1G71 A;  4GC9 A;  1L2C A;  2VF7 A;  4LGM A;  2CP8 A;  4G6Z A;  1EE8 A;  2WSF F;  2YNM D;  4LJA A;  4DR1 M;  1BVS A;  4KO8 A;  1I4W A;  3AFH A;  1XHB A;  1GO5 A;  1GJS A;  2LVP C;  2ZTD A;  2JY6 B;  1N33 M;  3HHZ A;  2V1C A;  4Y28 F;  2R18 A;  4G3O A;  2DZL A;  5FTM A;  5IZ7 D;  4D81 A;  5IWA M;  2KW0 A;  3U61 B;  4MGY E;  3FUX A;  3K8Z A;  3JAM S;  4OU7 A;  3FD9 A;  2CWB A;  3VLF B;  3U5Z A;  1IY1 A;  1NJF A;  1QQW A;  2KXE A;  2J7N A;  2HWJ A;  4I81 A;  4L6V 6;  1XWI A;  3D8L A;  3ZC7 B;  4DR2 M;  2L4E A;  3SAW A;  4LJ7 A;  4WP2 A;  1E94 E;  3E46 A;  4DV5 M;  4IBD A;  1D2N A;  3GLI A;  3U6M A;  5EP4 A;  2RKO A;  1WJ7 A;  1QAQ A;  4XBO A;  3T38 A;  3V76 A;  4EIW A;  2KA6 B;  5ITX A;  3TWK A;  1K3W A;  1W5S A;  1SG9 A;  2XFS A;  3UMM A;  4JI2 M;  2L7H A;  2YR0 A;  2OOB A;  3SC3 A;  4L8R C;  1XXH A;  2JWS A;  3FUU A;  1GL6 A;  3GQ5 A;  4GIP A;  3LQR A;  1L1Z A;  4JXJ A;  2UXB M;  2VQF M;  2UUA M;  2P5T A;  5JI2 E;  1IN7 A;  2QNJ A;  2JY5 A;  3BOS A;  4L16 A;  4P17 A;  4OW0 A;  4JI6 M;  2KHH A;  2LHG A;  3GLI E;  4NRW A;  4X64 M;  1TTE A;  1K82 A;  4OX9 M;  1PGY A;  1OJL A;  3H4M A;  3JR5 A;  3SMP A; 
#chains in the Genus database with same CATH homology
 5C18 A;  3J81 S;  3FUW A;  1DGH B;  3HU2 A;  2FFJ A;  4DR4 M;  1IBM M;  1DGG A;  7CAT A;  4LFB M;  3M0E A;  3GRU A;  3TPZ A;  5LMU M;  4JYA M;  2G8L A;  2DXI A;  3UGJ A;  4MGZ E;  4IJF A;  4GHA A;  1R6B X;  1OFH A;  1KSF X;  2QPA A;  4DV2 M;  1IXR C;  2V6Z M;  1Z5B A;  5IRE B;  2KRU A;  3GO8 A;  3VKG A;  1Q39 A;  5KQ8 A;  1N77 A;  2CHQ A;  3KS8 A;  1TDH A;  4IBG A;  4X66 M;  3HJS A;  3FTD A;  3PNY A;  4PDG A;  4LF5 M;  1GKI A;  2W82 A;  3GQ4 A;  2CFO A;  2D7G A;  3A45 A;  3TL4 X;  3PXG A;  3GRR A;  5FTN A;  3QWL A;  2CUZ A;  3C58 A;  1C1K A;  3W0F A;  1QAM A;  1IN5 A;  4IBC A;  3ZH9 B;  5FTL A;  4B7G A;  5ITU A;  2F5S A;  3GP1 A;  2LWX A;  4JI4 M;  5LMN M;  4LRS A;  1JQJ C;  4FWD A;  4LJ9 A;  4I4L A;  3IG5 A;  3HGI A;  3FUV A;  3HU3 A;  1K3X A;  2E5L M;  4PD2 A;  4GRI A;  1XMO M;  1JR3 D;  4L78 A;  4FWH A;  2XH9 A;  1MU5 A;  4CHT B;  1G8P A;  1W5T A;  1GL7 A;  1JR3 A;  4I8O A;  3T1H M;  4NSR A;  3R9X B;  3U6C A;  2EA0 A;  1N36 M;  1GLN A;  4AW4 A;  1ZAE A;  2ZAN A;  4M9X A;  4X65 M;  1TGU A;  3RFW A;  2VII A;  4A3V B;  4JI5 M;  4DV3 M;  4B3M M;  4JI1 M;  2R4E A;  4I5S A;  4LG2 A;  3HU1 A;  3KW6 A;  3GPP A;  1WXQ A;  4FCW A;  4HL4 A;  2L09 A;  5EXS A;  3L28 A;  3VDU A;  1DO2 A;  3K1J A;  5KPR A;  4CIS A;  5KQD A;  2XSZ D;  1NVM A;  5EQT A;  4B08 A;  3FYD A;  1TDZ A;  5F3W A;  2XZF A;  4QHS A;  2I7P A;  1NY5 A;  3QAU A;  1UM8 A;  1OFI A;  5KPZ A;  2BNK A;  1QAO A;  4LJ6 A;  3VKH A;  3K92 A;  4IBF A;  1XC8 A;  2F5Q A;  2R46 A;  3DOA A;  2EO2 A;  2H1R A;  3GLH A;  3B9P A;  2HCB A;  4AG5 A;  1XMQ M;  4B3S M;  2UXD M;  2X49 A;  1L1T A;  3ZCB B;  2QP9 X;  1IXZ A;  3SMS A;  2J7O A;  2FNA A;  2Y0Q A;  1IN6 A;  3MK6 A;  3TE6 A;  4PCZ A;  4JN6 A;  3U6E A;  1IQP A;  3KOW E;  4LF9 M;  5ITT A;  3AOE C;  4DUY M;  4LJ4 A;  3A98 B;  3I51 A;  3U5Z B;  4JI7 M;  1IN4 A;  3HJQ A;  2D7H A;  4GMQ A;  4G4O A;  3L27 A;  4LJ5 A;  2OPF A;  1IBK M;  3AJI B;  4MGI E;  5ITQ A;  1E32 A;  1SXJ C;  4GKJ M;  3WHL A;  4FD2 A;  1XXH B;  4LY6 A;  4X62 M;  2Z7J A;  4DV6 M;  2HHH M;  4AKI A;  4M9S A;  1N34 M;  2D7E A;  3SAS A;  4BLC A;  4LF7 M;  3KSX A;  2KRK A;  2XLJ A;  1HQC A;  4AG6 A;  1J5E M;  2YQZ A;  3L2A A;  4DV1 M;  1Z6T A;  4W5W A;  5BPV A;  3DA1 A;  3GLF B;  1NY6 A;  2UUB M;  4QHT A;  3DFZ A;  2QZ4 A;  2R4J A;  5BR8 M;  1DGH A;  2G5G X;  1DO0 A;  1IN8 A;  2RGH A;  3A46 A;  2DZN B;  5EP1 A;  3GPU A;  2C9C A;  1J7K A;  3TWM A;  2LNH C;  3KDS E;  4L4U A;  1R7R A;  5KPT A;  2Z3X A;  2DWL A;  4GH9 A;  1E9S A;  3D8B A;  2M5Z A;  4BB9 A;  2C5R A;  3GLG A;  5A2Q S;  3SHF A;  3W0L B;  3TQS A;  4DV0 M;  5EJC A;  3KP0 E;  4KLN A;  1XNR M;  2C98 A;  3AV0 A;  3M7G A;  1H6U A;  2UU9 M;  4FVM A;  3HJ8 A;  2EUC A;  5H37 D;  2KZS A;  3DZD A;  4IBK A;  3HWS A;  1NHW C;  2Y0T A;  3WHK A;  4DR5 M;  3J7A S;  5ITR A;  3M6A A;  4GKK M;  3AL0 C;  1SXJ A;  1YSY A;  4R7G A;  3GPY A;  3GRV A;  2O5R A;  1IY0 A;  1SXJ E;  1DGF A;  4DV4 M;  3K2L A;  2QBY B;  3KXE C;  4AKH A;  3U60 A;  4IJE A;  2R62 A;  3KVW A;  1HNX M;  1PJJ A;  4JI3 M;  5FSW A;  3GLG B;  2L6O A;  3JR4 A;  1Q3B A;  3VK7 A;  4K0K M;  5DYG A;  3SAU A;  3SBJ A;  2BJV A;  4S12 A;  4IBJ A;  4KHP M;  4GIT A;  3U6L A;  3A42 A;  4NSO B;  4RF1 A;  1TH4 A;  1HNZ M;  1T3T A;  3EIE A;  2DHR A;  1NSF A;  4ITQ A;  1G3I A;  3RGP A;  3HKP A;  4GHL A;  2UUC M;  2Y21 A;  2OQ4 A;  1Z59 A;  4RF0 A;  5DNY A;  3HHW A;  2FOI C;  4MH0 E;  1SXJ D;  3MHV C;  3THG A;  4YY3 M;  4TUW A;  1TH2 A;  2ZM6 M;  2XF3 A;  3LQQ A;  1PJI A;  3FKE A;  4G4Q A;  4REZ A;  3AOE A;  4RNA A;  2R45 A;  1ORY B;  3HHX A;  1E9R A;  4KOD A;  3L29 A;  3UK6 A;  3VDP A;  4OVZ B;  4M9Z A;  3KFU G;  3HHY A;  2XGN A;  3GLH B;  1G4A E;  4M0W A;  4LGY A;  4Z8X A;  4MGK E;  3SAR A;  4AKG A;  1LV7 A;  4JV5 M;  4BBA A;  3SYL A;  2XSZ A;  4JI8 M;  1X37 A;  3CF0 A;  4LJ8 A;  4DR7 M;  1SXJ B;  3GLF A;  1GVN A;  3L25 A;  2CE7 A;  3UZU A;  4LF6 M;  3R8F A;  3KOX E;  2C9O A;  1G41 A;  3PVS A;  3RGS A;  3RE8 A;  2X8A A;  3EIH A;  2ZAM A;  3SAT A;  4II7 A;  5C1B A;  2YFQ A;  3FUT A;  4CGY B;  1R2Z A;  4FCT A;  4IIW A;  4G4N A;  2DWM A;  1HT2 E;  3CTW B;  2CV0 A;  4HLQ A;  4GC5 A;  4B7H A;  1YE9 A;  4IBI A;  5EXT A;  1QAN A;  2DWN A;  4NXM M;  3KP1 E;  3FYC A;  1MX0 A;  4FWG A;  4G4R A;  4QOZ C;  3LVW A;  1ZQ9 A;  3KS4 A;  2DWZ B;  3J80 S;  4B7F A;  2X4A A;  1XNQ M;  1YUB A;  1FJG M;  3FTC A;  4LRT A;  3ILK A;  2QBY A;  3T1Y M;  1HT1 E;  2FE8 A;  5EP3 A;  2Q2E B;  3PNV A;  3VK8 A;  4WW0 A;  1FNN A;  1TH3 A;  1PM5 A;  3U60 B;  1DGB A;  2CV2 A;  4P16 A;  2CHV A;  2XFT A;  2QCU A;  2F5N A;  3LMM A;  3VFD A;  2QEN A;  1QVR A;  4DR3 M;  3SFZ A;  2Z4S A;  4LF8 M;  2Z4R A;  3OTO M;  3U6D A;  3TWL A;  1S3S A;  3NBI A;  4LCB A;  4AQY M;  2CV1 A;  5FLX S;  5E26 A;  2HKJ A;  2VQE M;  2V1U A;  2F4V M;  2LH0 A;  3CF2 A;  3GPX A;  2C96 A;  1L2B A;  3KOZ E;  5EXP A;  5ITY A;  1NNJ A;  2C99 A;  2JA2 A;  1J09 A;  2ZAO A;  4LZJ A;  1IBL M;  4L15 A;  2CEA A;  2F5P A;  4XGI A;  4LFC M;  4D80 A;  2A5Y B;  3GLI B;  4FW9 A;  4Z6Y A;  2KEB A;  1KYI A;  2DZO B;  3L26 A;  2UXC M;  3UJN A;  4IBB A;  1R2Y A;  3GRY A;  5EP2 A;  2CHG A;  4R3D A;  4NOO B;  4NRV A;  4LF4 M;  3U6S A;  3SYK A;  2F5O A;  4QOS A;  2AHM A;  2I7N A;  2L7I A;  2RGO A;  2KZU A;  4LFA M;  3U6Q A;  1VDD A;  8CAT A;  3LVV A;  1G59 A;  1IY2 A;  1QZM A;  1Z5C A;  3J27 B;  3MJ5 A;  4IBE A;  1IM2 A;  5JI3 E;  4JI0 M;  4MM3 B;  1KFV A;  4DUZ M;  4NL4 H;  3E9S A;  4MB7 A;  2Y20 A;  5FTJ A;  1L8Q A;  3FTE A;  5KO3 A;  4YHH M;  5DYI A;  5EXX A;  4ZPX A;  2NQ8 C;  1HQY E;  1N32 M;  4AI6 A;  3E4R A;  4PDI A;  3J2P B;  5E6J A;  4AZF A;  4OVZ A;  4PT5 A;  2R65 A;  2ERC A;  3T15 A;  3AKZ A;  3FTF A;  3NWL A;  4QNR A;  3PFI A;  2K47 A;  5GKN A;  4FCV A;  1Q3C A;  4M0D A;  4MGH A;  2HL7 A;  3U6P A;  2XEP A;  1NJG A;  4DV7 M;  1HNW M;  1QYR A;  3GQ3 A;  1HR0 M;  4NXN M;  1L2D A;  1N78 A;  4WUR A;  1IXS B;  3AOG A;  1NHG C;  3KSJ A;  5ITX E;  2LXE A;  3IG8 A;  4B3R M;  2DVW B;  4B3T M;  4LZZ A;  1NNU C;  3U61 A;  3U6O A;  2XZU A;  1I94 M;  2ZBK B;  3J7B A;  3KOY E;  4DR6 M;  4QNM A;  2M60 A;  3CF6 E;  1Z5A A;  3I4V A;  5FTK A;  3Q8X A;  4D82 A;  2BJW A;  3SAV A;  3I4Y A;  3SHG B;  1N75 A;  4GC9 A;  1L2C A;  4LGM A;  4G6Z A;  1EE8 A;  4DR1 M;  2YNM D;  4LJA A;  4KO8 A;  1I4W A;  3AFH A;  1XHB A;  1N33 M;  3HHZ A;  2V1C A;  2R18 A;  4D81 A;  5FTM A;  5IZ7 D;  5IWA M;  2KW0 A;  3U61 B;  4MGY E;  3FUX A;  3K8Z A;  3JAM S;  4OU7 A;  3FD9 A;  3VLF B;  3U5Z A;  1IY1 A;  1NJF A;  1QQW A;  2KXE A;  2J7N A;  4I81 A;  3ZC7 B;  4DR2 M;  1XWI A;  3D8L A;  5IT9 S;  3SAW A;  4LJ7 A;  1E94 E;  4DV5 M;  4IBD A;  1D2N A;  3GLI A;  3U6M A;  5EP4 A;  2RKO A;  3T38 A;  1QAQ A;  4XBO A;  4EIW A;  2KA6 B;  5ITX A;  3TWK A;  1K3W A;  1W5S A;  2XFS A;  4JI2 M;  3UMM A;  2L7H A;  2YR0 A;  3SC3 A;  4L8R C;  1XXH A;  3FUU A;  1GL6 A;  3GQ5 A;  4GIP A;  3LQR A;  1L1Z A;  4JXJ A;  2UXB M;  2VQF M;  2UUA M;  2P5T A;  5JI2 E;  1IN7 A;  4L16 A;  3BOS A;  4JI6 M;  4OW0 A;  4NRW A;  4X64 M;  1K82 A;  4OX9 M;  1OJL A;  3H4M A;  3JR5 A;  3SMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...