1XNRM

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnrM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnrM02
4ITQA 4G4OA 4KHPM 1NNJA 1FJGM 5ITYA 4X65M 2UXBM 4B3TM 5LMUM 1MX0A 2XZFA 4NXNM 3T1HM 4JI4M 4JI7M 3U6QA 1IBKM 4DV5M 4NXMM 2UXDM 3GQ5A 4X64M 4DV1M 4DV4M 2F5NA 4PD2A 1PJIA 3SASA 1I94M 4DUZM 3A46A 4MB7A 3U6OA 1K3WA 3J7AS 1L1ZA 3TWLA 4DR4M 1PM5A 1K3XA 1Q39A 4JV5M 3OTOM 4PDIA 4NRVA 4JI5M 1Z59A 4X62M 4DR3M 3U6EA 1J5EM 3T1YM 1HR0M 2F5SA 2UU9M 1N33M 2ZBKB 4DV2M 4JI1M 4CISA 4LF6M 1XNRM 3GPUA 4X66M 3GO8A 4DV3M 1MU5A 4LFBM 4OX9M 1Z5AA 3C58A 3GPYA 4DV7M 3SBJA 3JR4A 4PDGA 3DOAA 1IBLM 4JYAM 1EE8A 5ITXA 4LF9M 4YHHM 1XNQM 4B3MM 4B3RM 3U6MA 3U6DA 2F4VM 3JAMS 2F5PA 2EA0A 1PJJA 4AQYM 3SATA 3GPXA 3JR5A 3TWMA 1IBMM 5BR8M 4K0KM 1R2ZA 2HHHM 1N34M 4JI6M 2HKJA 4LFCM 3W0FA 1XMQM 4LFAM 5ITUA 3VK8A 4JI2M 1N36M 1R2YA 5ITQA 1XMOM 3GPPA 4DV0M 4LF8M 1L2BA 4JI3M 5IT9S 1HNWM 4YY3M 3GP1A 2VQFM 3U6CA 1TDZA 1L2DA 3GQ4A 5LMNM 2F5QA 3A45A 4GKKM 5ITTA 2XZUA 4LF7M 5FLXS 5IWAM 3VK7A 5A2QS 2Q2EB 4LF4M 2UUBM 4DR2M 3TWKA 4JI0M 5ITRA 3SAUA 2E5LM 5ITXE 3SARA 2UUAM 4G4QA 4DR1M 3U6LA 1KFVA 1L1TA 1Q3BA 2UUCM 4DUYM 3A42A 2VQEM 2OQ4A 4G4NA 4NRWA 3U6PA 1L2CA 3SAWA 4GKJM 1TDHA 4DV6M 4G4RA 3J81S 3GQ3A 1XC8A 1K82A 4DR6M 2F5OA 4PCZA 2OPFA 2UXCM 1HNXM 4LF5M 3J80S 1Z5CA 2ZM6M 1N32M 1HNZM 3SAVA 4DR5M 1Z5BA 4DR7M 4B3SM 4JI8M 3U6SA 1Q3CA
chains in the Genus database with same CATH superfamily
4RF1A 2C96A 2HL7A 1GABA 5E26A 3VDPA 2DZOB 2YR0A 1NNJA 4NSOB 1EIJA 2HCBA 5KQ8A 4X65M 4B3TM 5EJCA 4NXNM 3T1HM 2QSFX 1GVNA 2LVQD 3U6QA 4DV5M 4NXMM 2RKOA 4II7A 3SMPA 3FTCA 5JI3E 4L4UA 1PJIA 1TGUA 3FE3A 3SASA 5EP3A 3CGWA 2RGHA 1NY5A 2CV0A 1NV8A 1HT1E 3AOGA 4DUZM 2H1RA 3A46A 3B7NA 1IN4A 3D8LA 1HQYE 1H6UA 1N75A 2LH0A 2OO9A 3FYCA 3DZDA 3DA1A 4AI6A 3OTOM 4NRVA 4JI5M 2Z7JA 3L25A 1HR0M 3KVWA 1LV7A 2LWXA 2ZBKB 3H4JA 1F4IA 1XWIA 4CISA 5KQDA 4X66M 3I4VA 4LY6A 3SMSA 4OX9M 1Z5AA 2X4AA 3WHKA 3KOYE 4GH9A 2DWMA 1IN8A 4NSRA 2ZTCA 5EQTA 5EP1A 2BJWA 4IBFA 4CGYB 3FUWA 3ZCBB 1XNQM 3KXEC 1ZMVA 3GLHE 4B3MM 5KPZA 3L26A 1XXHE 2X8AA 4MGIE 4B7GA 1ZMUA 2V6ZM 4B7FA 3SATA 4M9ZA 3TWMA 1QDTA 1TH2A 4K0KM 1R2ZA 2VF7A 3PNYA 1N34M 2CV1A 2KRKA 3T6PA 3TL4X 3SYLA 4D81A 5JI2E 1D2NA 3W0FA 2VIIA 1XMQM 4LJ4A 4FVMA 5ITUA 2K6BA 3L27A 1J09A 4FWDA 4WURA 1XMOM 2N35A 4DV0M 4RKUF 1L2BA 4L16A 4Q7JA 2WSCF 2YNMD 2JZ1A 1TDZA 2DAMA 2M5ZA 4OW0A 3CF0A 2DNAA 4FW9A 1OIZA 4G6ZA 1QYRA 3VKGA 2JWSA 5IWAM 5FLXS 3FUVA 2Q2EB 4EIWA 4LF4M 1G41A 3TWKA 4DR2M 4GHAA 2C9OA 2D7HA 1DGFA 3L29A 3IG5A 2E5LM 2C9CA 5DYGA 2ZTDA 3TE6A 1Q02A 4JN6A 2Y0TA 3QYEA 2R4EA 2CE7A 4GITA 2UUCM 3FTFA 3UK6A 1T3TA 4CHTB 3DFZA 4M9XA 1XHBA 1DGGA 1EFUB 3LW5F 1MJGM 3B89A 1XC8A 3AOEA 2J7NA 3EIHA 3GQ3A 1K82A 2QPAA 4DR6M 2EJSA 1JR3A 1QZEA 2ERCA 4FCVA 4LZZA 5DYIA 1N77A 1LTMA 3UZUA 1Z5CA 4AKGA 2MJ5B 3HU1A 4XGIA 1I4WA 2C5RA 4IBCA 1IY1A 4JI8M 1GKIA 4I8OA 1NVMA 3GLHB 5KPRA 2QZ4A 4FWGA 1IM2A 1R5LA 3LVVA 2LHCA 4D80A 3GLHA 1R6BX 3M7GA 3NBXX 2OOBA 4QNRA 4REZA 5ITYA 4TUWA 3HJSA 4GMQA 5C1BA 2UXBM 3LQQA 4DBGB 1SXJD 3MJ5A 4JI4M 1ZQ9A 1JQJC 2UXDM 2EKKA 1WR1B 3AFHA 1TH4A 4RF0A 1YUBA 4DV1M 4DV4M 3ZQJA 4PD2A 3I04M 4GC5A 1DO2A 3SC3A 4OVZB 2WSEF 3U6OA 4Z6YA 3J7AS 1NJGA 4KO8A 4LJ6A 4OVZA 5EP4A 4R71A 3VKHA 1DGBA 2LVPC 4DR4M 4MGHA 1PM5A 1WXQA 1Q39A 4P16A 1RU3A 2R65A 4JV5M 1N78A 2EKFA 1GJSA 2UU9M 4X62M 3CF6E 3T1YM 1KYIA 1J5EM 1YSYA 2D7GA 3J2PB 3HZJA 4LG2A 2DHRA 2KNZA 3GPUA 3GO8A 2K9DA 1MU5A 4CIZA 4LFBM 1NV9A 1VDDA 3HHWA 3HJQA 2C99A 2JY7A 3AL0C 1G8PA 2DAIA 3DOAA 1IBLM 2EUCA 2JY8A 5FTNA 1EE8A 3ILKA 3PXGA 3VDUA 4LF9M 4M9SA 1E32A 1PGYA 3KOZE 3Q8XA 3HKPA 1QAMA 2F4VM 1S3SA 4Y28F 1IN7A 2FOIC 1PJJA 4FWHA 4BBAA 3AV0A 1NHGC 2MH8A 2R6FA 3CTWB 3GPXA 1IBMM 2FH0A 4MGYE 3HHZA 3HX3A 2DWNA 4FCTA 2L6OA 4IBIA 4B7HA 2R62A 1HT2E 1JR3E 1W5TA 3QWLA 1OAIA 2QQ8A 3E46A 2QENA 5FTMA 5DNYA 3E4RA 5EXSA 4QOSA 1R2YA 2KEBA 2FS1A 3FRIA 5ITQA 4I81A 3GPPA 2CP8A 1PJSA 2Z8YM 2DZLA 4QHSA 2G3QA 1HNWM 4YY3M 2EO2A 3L28A 3GQ4A 4WW0A 3HGIA 5LMNM 4IBBA 2XZUA 3RFWA 2LTUA 3LMMA 4R3DA 2UUBM 1IY0A 1KSFX 4JI0M 3W0LB 2MR9A 2Y20A 3L2AA 5ITRA 3SAUA 1SXJC 3E21A 2BJVA 2B3TA 1KFVA 5KPTA 3GRYA 2JXNA 1P3QQ 4LJ9A 4NC6A 2OQ4A 3SHFA 3TQSA 4IBJA 3SAWA 2XSZA 4GKJM 3VLFB 1TDHA 1R7RA 3QAUA 1IQPA 4IBDA 3ZC7B 1E94E 3T15A 4DV6M 4AG6A 4G4RA 5BPVA 4GC9A 1QAQA 3NBIA 4L78A 1HNXM 4LF5M 1OTRA 2JNHA 2V1CA 4NOOB 3C9PA 4GRIA 1HNZM 2Z4SA 3R9XB 3SAVA 1IXRC 1J7KA 3E9SA 2Z4RA 1C7YA 2JA2A 2ZAMA 1Q3CA 1TF0B 4ITQA 3I4YA 4M0DA 1PJTA 1FJGM 1VEJA 2XZFA 2QHOB 2DENA 4KLNA 4W5WA 3WHLA 2V1UA 4FCWA 2KDLA 4G3OA 2F5NA 2CEAA 2QNJA 2W82A 1I94M 2QBYB 3W67A 1GO5A 2QBYA 4MB7A 2DAEA 2RRUA 2C98A 3LCUA 5IZ7D 2I7PA 2OOAA 2VDBB 3C3DA 1K3XA 3GLGE 5C18A 3I01M 4MGKE 2DXIA 3B74A 1AIPC 2DVWB 3U6EA 1N33M 2F5SA 3KSJA 2KNVA 4JI1M 4CJ6A 2JY5A 1QUSA 4LF6M 5F3WA 3UMMA 2L4FA 3HJ8A 1TTEA 4DV3M 1PJQA 4QOZC 2GNOA 5EXPA 4GEWA 2VF8A 3RGSA 3C58A 4DV7M 3SBJA 2M60A 3JR4A 4PDGA 1SXJE 4LRTA 1OQYA 4JYAM 4AZFA 4YHHM 2CRUA 4NL4H 4GIPA 3MHVC 5EXTA 1G3IA 1ORYB 1VQ1A 2FNAA 2XF3A 4FD2A 2A5YB 3U6MA 4IJEA 3M0EA 4LJ8A 3KSXA 2F5PA 2EA0A 4AQYM 1G59A 1QAOA 1R4GA 3SHGB 3W68A 2HAKA 2XLJA 2CHQA 1QVRA 3FUUA 2CFOA 2HHHM 3KW6A 2JZ0A 3B7QA 4OU7A 4BLCA 3GLFB 4JI6M 2LVNC 1W5SA 3SFZA 4Z8XA 1DO0A 1OFHA 2KNAA 3LCVB 2JUJA 2XGNA 4QNMA 2R44A 1NHWC 1NJFA 3NWLA 4LFAM 3GLFA 3VK8A 1N36M 2Y0QA 4JI2M 1DGHB 4XK8F 1G71A 1NY6A 4QHTA 3FRHA 1DGHA 1NSFA 2LHGA 3D8BA 3UGJA 3HU2A 2DZNB 4F2LA 1WIVA 4JI3M 5KO3A 2LBCA 5DFLA 5IT9S 4LZJA 1C1KA 1JB0F 2LVAA 1QQWA 1VDLA 2DWZB 2LXEA 2XSZD 3CF2A 2CHGA 3KOWE 3U6CA 2ZAOA 1L2DA 2HWJA 1IXZA 2R18A 5GKNA 4B08A 4GKKM 4LF7M 3EIEA 1TR8A 1VEGA 2DWLA 2DHYA 4XBOA 1T43A 3PFIA 1GLNA 1BVSA 1D0MA 3HY5A 5IREB 2YQZA 5ITXE 2J7OA 2UUAM 4L6V6 1MN3A 4BB9A 4G4QA 3K8ZA 4D82A 3U6LA 1V33A 2P5TA 2MROB 1UM8A 3GRVA 3K9OA 2L09A 4F1IA 1L1TA 1Q3BA 4DUYM 3A42A 2VQEM 5L8RF 4G4NA 2JY6B 5E6JA 3GLGB 3U6PA 1L2CA 2LNHC 3Q8GA 2R45A 4LJAA 3GLGA 4HEOA 2WSFF 1T6OA 3AKZA 7CATA 2F5OA 5FTKA 4PCZA 3KP1E 1QZMA 3RGPA 1PRBA 2KXEA 3HHXA 3K9PA 2MGWA 5H37D 4UN2B 1UFZA 1D0LA 3FUXA 2CHVA 1L8QA 2R4JA 1JR3D 3KS4A 3BOSA 5EP2A 2L7HA 1Z5BA 1SXJB 1ZAEA 2BWBA 3J7BA 4I5SA 4ZPXA 3TPZA 3A98B 1SXJA 5FTJA 2QCUA 2J5YA 3LQRA 4G4OA 4KHPM 2XFTA 3HWSA 3GRUA 4GHLA 2DKLA 2KA6B 3SYKA 1OJLA 1QDRA 2NQ8C 1MX0A 4IJFA 3ZH9B 5LMUM 4JI7M 1IBKM 3IECA 2K0BX 3GLIB 3GQ5A 3U60B 4L8RC 4X64M 2AHMA 2G5GX 4L15A 3QYBA 3GLIA 1D0KA 1OFIA 3U60A 4AKIA 1A5TA 2JP7A 3GLFE 2KZSA 1K3WA 3FTEA 2FE8A 3FUTA 1ZV1A 1L1ZA 4IBKA 3TWLA 3IG8A 3FTDA 1OAOC 4PDIA 1YLAA 1Z59A 4DR3M 3F92A 3H4MA 3GRRA 1X37A 2RGOA 4ANRA 4AW4A 2D7EA 2KW0A 4IIWA 4DV2M 4IBGA 1OIPA 3T38A 1XNRM 3RE8A 2KHHA 5FTLA 1ZMWA 4RNAA 3AJIB 3MK6A 3K1JA 2L7IA 3GPYA 1CUKA 2QP9X 4I4LA 1Y8GA 3KDSE 1TH3A 4KT0F 5ITXA 1IN6A 2BWEA 4PT5A 3UJNA 1HQCA 2APLA 4B3RM 1Z6TA 2DAGA 3M6AA 3U6DA 2H5XA 3BBZA 2CUZA 3K2LA 3U5ZB 4WP2A 3KS8A 3B9PA 3JAMS 1HJPA 4HL4A 2GQFA 3JR5A 2O5RA 5BR8M 3U5ZA 2XH9A 1V34A 1WHCA 4LJ5A 8CATA 2HKJA 4LFCM 2I7NA 3K92A 4LCBA 3KFUG 2R46A 3C3EA 1IFYA 3KP0E 1WGNA 3BXWA 5EXXA 1GL7A 1AUAA 1FNNA 1IN5A 2R0IA 2DAKA 2DI0A 3AOEC 4LF8M 2XEPA 3THGA 3R8FA 2X49A 1YE9A 3GP1A 2VQFM 4MM3B 4S12A 4LJ7A 2KZUA 1E9RA 1OKSA 3A45A 2CV2A 2F5QA 2ZANA 1WJ7A 5ITTA 3VK7A 5A2QS 1IY2A 1G4AE 2WZJA 2O01F 4JXJA 3FKEA 3PNVA 3HHYA 3MMPA 4LGMA 4LRSA 1IXSB 3SARA 3GLIE 1XXHB 4DR1M 2Y21A 4KODA 1VG5A 4AG5A 1IXSA 1XXHA 2O25A 4IBEA 4MH0E 4M0WA 4A3VB 4NRWA 1WGLA 4HLQA 1NO1A 5FSWA 3KOXE 4R7GA 3PVSA 2FFJA 2BNKA 3J27B 4P17A 1XB2B 2LVOC 3J81S 2Z3XA 2CWBA 1V92A 2L2DA 3FYDA 3U61B 1GL6A 4AKHA 2YFQA 1NNUC 2K47A 3U61A 2OPFA 4MGZE 1SG9A 2UXCM 1QUTA 2L4EA 1DV0A 3FD9A 3J80S 2ZM6M 1GJTA 1N32M 3HU3A 2XFSA 2G8LA 1VEKA 1QANA 3I51A 3VFDA 4LGYA 4DR5M 4DR7M 4B3SM 3LVWA 1E9SA 3V76A 3U6SA 3B7ZA 3IHPA 2KRUA
chains in the Genus database with same CATH topology
4RF1A 2C96A 2HL7A 5E26A 3VDPA 2DZOB 2YR0A 1NNJA 4NSOB 2HCBA 5KQ8A 4X65M 4B3TM 5EJCA 4NXNM 3T1HM 1GVNA 3U6QA 4DV5M 4NXMM 2RKOA 4II7A 3SMPA 3FTCA 5JI3E 4L4UA 1PJIA 1TGUA 3SASA 5EP3A 2RGHA 1NY5A 2CV0A 4DUZM 1HT1E 3AOGA 2H1RA 3A46A 3D8LA 1IN4A 1HQYE 1H6UA 1N75A 2LH0A 3FYCA 3DZDA 3DA1A 4AI6A 3OTOM 4NRVA 4JI5M 2Z7JA 3L25A 1HR0M 3KVWA 1LV7A 2LWXA 2ZBKB 1XWIA 4CISA 5KQDA 4X66M 3I4VA 4LY6A 3SMSA 4OX9M 1Z5AA 2X4AA 3WHKA 3KOYE 4GH9A 2DWMA 1IN8A 4NSRA 5EQTA 5EP1A 2BJWA 4IBFA 4CGYB 3FUWA 3ZCBB 1XNQM 3KXEC 4B3MM 5KPZA 3L26A 2X8AA 4MGIE 4B7GA 2V6ZM 4B7FA 3SATA 4M9ZA 3TWMA 1TH2A 4K0KM 1R2ZA 3PNYA 1N34M 2CV1A 2KRKA 3TL4X 3SYLA 4D81A 5JI2E 1D2NA 3W0FA 2VIIA 1XMQM 4LJ4A 4FVMA 5ITUA 3L27A 1J09A 4FWDA 4WURA 1XMOM 4DV0M 1L2BA 4L16A 2YNMD 1TDZA 2M5ZA 4OW0A 3CF0A 4FW9A 4G6ZA 1QYRA 3VKGA 5FLXS 5IWAM 3FUVA 2Q2EB 4EIWA 4LF4M 1G41A 3TWKA 4DR2M 4GHAA 2C9OA 2D7HA 1DGFA 3L29A 3IG5A 2E5LM 2C9CA 5DYGA 3TE6A 4JN6A 2Y0TA 2UUCM 2R4EA 2CE7A 4GITA 3FTFA 3UK6A 1T3TA 4CHTB 3DFZA 4M9XA 1XHBA 1DGGA 1XC8A 3AOEA 2J7NA 3EIHA 3GQ3A 1K82A 2QPAA 4DR6M 1JR3A 2ERCA 4FCVA 4LZZA 5DYIA 1N77A 4AKGA 3UZUA 1Z5CA 3HU1A 4XGIA 1I4WA 2C5RA 4IBCA 1IY1A 4JI8M 1GKIA 4I8OA 1NVMA 3GLHB 5KPRA 2QZ4A 4FWGA 1IM2A 3LVVA 4D80A 3GLHA 1R6BX 3M7GA 4QNRA 4TUWA 4REZA 5ITYA 2UXBM 3HJSA 4GMQA 5C1BA 3LQQA 4JI4M 1SXJD 3MJ5A 1ZQ9A 1JQJC 2UXDM 3AFHA 1TH4A 4RF0A 1YUBA 4DV1M 4DV4M 4PD2A 4GC5A 1DO2A 3SC3A 4OVZB 3U6OA 4Z6YA 3J7AS 1NJGA 4KO8A 4LJ6A 4OVZA 5EP4A 3VKHA 1DGBA 4DR4M 4MGHA 1PM5A 1WXQA 1Q39A 4P16A 2R65A 4JV5M 1N78A 2UU9M 4X62M 3CF6E 3T1YM 1KYIA 1J5EM 1YSYA 2D7GA 3J2PB 4LG2A 2DHRA 3GPUA 3GO8A 1MU5A 4LFBM 1VDDA 3HHWA 3HJQA 2C99A 3AL0C 1G8PA 3DOAA 1IBLM 2EUCA 5FTNA 1EE8A 3ILKA 3PXGA 3VDUA 4LF9M 4M9SA 1E32A 3KOZE 3Q8XA 3HKPA 1QAMA 2F4VM 1S3SA 1IN7A 2FOIC 1PJJA 4FWHA 4BBAA 3AV0A 1NHGC 3CTWB 3GPXA 1IBMM 3HHZA 4MGYE 2DWNA 4FCTA 2L6OA 4IBIA 4B7HA 2R62A 1HT2E 3QWLA 1W5TA 2QENA 5FTMA 5DNYA 3E4RA 5EXSA 4QOSA 1R2YA 2KEBA 5ITQA 4I81A 3GPPA 4QHSA 1HNWM 4YY3M 2EO2A 3L28A 3GQ4A 4WW0A 3HGIA 5LMNM 4IBBA 2XZUA 3RFWA 3LMMA 4R3DA 2UUBM 1IY0A 1KSFX 4JI0M 3W0LB 2Y20A 3L2AA 5ITRA 3SAUA 1SXJC 2BJVA 1KFVA 5KPTA 3GRYA 4LJ9A 2OQ4A 3SHFA 3TQSA 4IBJA 3SAWA 2XSZA 4GKJM 3VLFB 1TDHA 1R7RA 3QAUA 1IQPA 4IBDA 3ZC7B 1E94E 3T15A 4DV6M 4AG6A 4G4RA 5BPVA 4GC9A 1QAQA 3NBIA 4L78A 1HNXM 4LF5M 2V1CA 4NOOB 4GRIA 1HNZM 2Z4SA 3R9XB 3SAVA 1IXRC 1J7KA 3E9SA 2Z4RA 2JA2A 2ZAMA 1Q3CA 4ITQA 3I4YA 4M0DA 1FJGM 2XZFA 4KLNA 4W5WA 3WHLA 2V1UA 4FCWA 2F5NA 2CEAA 2W82A 1I94M 2QBYB 2QBYA 4MB7A 2C98A 5IZ7D 2I7PA 1K3XA 5C18A 4MGKE 2DXIA 2DVWB 3U6EA 1N33M 2F5SA 3KSJA 4JI1M 4LF6M 5F3WA 3UMMA 3HJ8A 4DV3M 4QOZC 5EXPA 3C58A 3RGSA 4DV7M 3SBJA 2M60A 3JR4A 4PDGA 1SXJE 4LRTA 4JYAM 4AZFA 4YHHM 4NL4H 4GIPA 3MHVC 5EXTA 1G3IA 1ORYB 2FNAA 2XF3A 4FD2A 3U6MA 2A5YB 4IJEA 3M0EA 4LJ8A 3KSXA 2F5PA 2EA0A 4AQYM 1G59A 1QAOA 3SHGB 2XLJA 2CHQA 1QVRA 3FUUA 2CFOA 2HHHM 3KW6A 4OU7A 4BLCA 3GLFB 4JI6M 1W5SA 3SFZA 4Z8XA 1DO0A 1OFHA 4QNMA 4LFAM 2XGNA 3GLFA 3VK8A 1NHWC 1NJFA 3NWLA 4JI2M 1N36M 2Y0QA 1DGHB 1NY6A 4QHTA 1DGHA 1NSFA 3D8BA 3UGJA 3HU2A 2DZNB 4JI3M 5KO3A 5IT9S 4LZJA 1C1KA 3KOWE 2LXEA 1QQWA 3U6CA 2DWZB 2XSZD 3CF2A 1L2DA 2CHGA 2ZAOA 1IXZA 2R18A 5GKNA 4B08A 4GKKM 4LF7M 3EIEA 2DWLA 4XBOA 3PFIA 1GLNA 5IREB 2YQZA 5ITXE 2J7OA 2UUAM 4BB9A 4G4QA 3K8ZA 4D82A 3U6LA 2P5TA 3GRVA 1UM8A 2L09A 1L1TA 1Q3BA 4DUYM 3A42A 2VQEM 4G4NA 5E6JA 3GLGB 3U6PA 1L2CA 2LNHC 2R45A 4LJAA 3GLGA 3AKZA 7CATA 2F5OA 5FTKA 4PCZA 3KP1E 1QZMA 3RGPA 2KXEA 3HHXA 5H37D 3FUXA 2CHVA 1L8QA 2R4JA 1JR3D 3KS4A 3BOSA 5EP2A 2L7HA 1Z5BA 1SXJB 1ZAEA 3J7BA 4I5SA 4ZPXA 3TPZA 3A98B 1SXJA 5FTJA 2QCUA 3LQRA 4G4OA 4KHPM 2XFTA 3HWSA 3GRUA 4GHLA 2KA6B 3SYKA 1OJLA 2NQ8C 1MX0A 4IJFA 3ZH9B 5LMUM 4JI7M 1IBKM 3GLIB 3GQ5A 3U60B 4L8RC 4X64M 2AHMA 2G5GX 4L15A 3GLIA 1OFIA 3U60A 4AKIA 2KZSA 1K3WA 3FTEA 2FE8A 3FUTA 1L1ZA 4IBKA 3TWLA 3IG8A 3FTDA 4PDIA 1Z59A 4DR3M 3H4MA 3GRRA 1X37A 2RGOA 4AW4A 4DV2M 2D7EA 2KW0A 4IIWA 4IBGA 3T38A 1XNRM 3RE8A 5FTLA 4RNAA 3AJIB 3MK6A 3K1JA 2L7IA 3GPYA 2QP9X 4I4LA 3KDSE 1TH3A 5ITXA 1IN6A 4PT5A 3UJNA 1HQCA 4B3RM 1Z6TA 3M6AA 3U6DA 3KS8A 2CUZA 3K2LA 3U5ZB 3B9PA 3JAMS 4HL4A 3JR5A 2O5RA 5BR8M 3U5ZA 2XH9A 4LJ5A 8CATA 2HKJA 4LFCM 2I7NA 3K92A 4LCBA 3KFUG 2R46A 3KP0E 5EXXA 1GL7A 1FNNA 1IN5A 3AOEC 4LF8M 2XEPA 3THGA 3R8FA 2X49A 1YE9A 3GP1A 2VQFM 4MM3B 4S12A 4LJ7A 2KZUA 1E9RA 2F5QA 3A45A 2CV2A 2ZANA 5ITTA 3VK7A 5A2QS 1IY2A 1G4AE 4JXJA 3FKEA 3PNVA 3HHYA 4LGMA 4LRSA 1IXSB 3SARA 1XXHB 4DR1M 2Y21A 4KODA 4AG5A 1XXHA 4IBEA 4MH0E 4M0WA 4A3VB 4NRWA 4HLQA 5FSWA 3KOXE 4R7GA 3PVSA 2FFJA 2BNKA 3J27B 2Z3XA 3U61B 3J81S 3FYDA 4AKHA 1GL6A 2YFQA 1NNUC 2K47A 3U61A 2OPFA 4MGZE 2UXCM 3FD9A 3J80S 2ZM6M 1N32M 3HU3A 2XFSA 2G8LA 3I51A 1QANA 3VFDA 4LGYA 4DR5M 4DR7M 4B3SM 3LVWA 1E9SA 3U6SA 2KRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITQ A;  4G4O A;  4KHP M;  1NNJ A;  1FJG M;  5ITY A;  4X65 M;  2UXB M;  4B3T M;  5LMU M;  1MX0 A;  2XZF A;  4NXN M;  3T1H M;  4JI4 M;  4JI7 M;  3U6Q A;  1IBK M;  4DV5 M;  4NXM M;  2UXD M;  3GQ5 A;  4X64 M;  4DV1 M;  4DV4 M;  2F5N A;  4PD2 A;  1PJI A;  3SAS A;  1I94 M;  4DUZ M;  3A46 A;  4MB7 A;  3U6O A;  1K3W A;  3J7A S;  1L1Z A;  3TWL A;  4DR4 M;  1PM5 A;  1K3X A;  1Q39 A;  4JV5 M;  3OTO M;  4PDI A;  4NRV A;  4JI5 M;  1Z59 A;  4X62 M;  4DR3 M;  3U6E A;  1J5E M;  3T1Y M;  1HR0 M;  2F5S A;  2UU9 M;  1N33 M;  2ZBK B;  4DV2 M;  4JI1 M;  4CIS A;  4LF6 M;  1XNR M;  3GPU A;  4X66 M;  3GO8 A;  4DV3 M;  1MU5 A;  4LFB M;  4OX9 M;  1Z5A A;  3C58 A;  3GPY A;  4DV7 M;  3SBJ A;  3JR4 A;  4PDG A;  3DOA A;  1IBL M;  4JYA M;  1EE8 A;  5ITX A;  4LF9 M;  4YHH M;  1XNQ M;  4B3M M;  4B3R M;  3U6M A;  3U6D A;  2F4V M;  3JAM S;  2F5P A;  2EA0 A;  1PJJ A;  4AQY M;  3SAT A;  3GPX A;  3JR5 A;  3TWM A;  1IBM M;  5BR8 M;  4K0K M;  1R2Z A;  2HHH M;  1N34 M;  4JI6 M;  2HKJ A;  4LFC M;  3W0F A;  1XMQ M;  4LFA M;  5ITU A;  3VK8 A;  4JI2 M;  1N36 M;  1R2Y A;  5ITQ A;  1XMO M;  3GPP A;  4DV0 M;  4LF8 M;  1L2B A;  4JI3 M;  5IT9 S;  1HNW M;  4YY3 M;  3GP1 A;  2VQF M;  3U6C A;  1TDZ A;  1L2D A;  3GQ4 A;  5LMN M;  2F5Q A;  3A45 A;  4GKK M;  5ITT A;  2XZU A;  4LF7 M;  5FLX S;  5IWA M;  3VK7 A;  5A2Q S;  2Q2E B;  4LF4 M;  2UUB M;  4DR2 M;  3TWK A;  4JI0 M;  5ITR A;  3SAU A;  2E5L M;  5ITX E;  3SAR A;  2UUA M;  4G4Q A;  4DR1 M;  3U6L A;  1KFV A;  1L1T A;  1Q3B A;  2UUC M;  4DUY M;  3A42 A;  2VQE M;  2OQ4 A;  4G4N A;  4NRW A;  3U6P A;  1L2C A;  3SAW A;  4GKJ M;  1TDH A;  4DV6 M;  4G4R A;  3J81 S;  3GQ3 A;  1XC8 A;  1K82 A;  4DR6 M;  2F5O A;  4PCZ A;  2OPF A;  2UXC M;  1HNX M;  4LF5 M;  3J80 S;  1Z5C A;  2ZM6 M;  1N32 M;  1HNZ M;  3SAV A;  4DR5 M;  1Z5B A;  4DR7 M;  4B3S M;  4JI8 M;  3U6S A;  1Q3C A; 
#chains in the Genus database with same CATH topology
 4RF1 A;  2C96 A;  2HL7 A;  1GAB A;  5E26 A;  3VDP A;  2DZO B;  2YR0 A;  1NNJ A;  4NSO B;  1EIJ A;  2HCB A;  5KQ8 A;  4X65 M;  4B3T M;  5EJC A;  4NXN M;  3T1H M;  2QSF X;  1GVN A;  2LVQ D;  3U6Q A;  4DV5 M;  4NXM M;  2RKO A;  4II7 A;  3SMP A;  3FTC A;  5JI3 E;  4L4U A;  1PJI A;  1TGU A;  3FE3 A;  3SAS A;  5EP3 A;  3CGW A;  2RGH A;  1NY5 A;  2CV0 A;  1NV8 A;  1HT1 E;  3AOG A;  4DUZ M;  2H1R A;  3A46 A;  3B7N A;  1IN4 A;  3D8L A;  1HQY E;  1H6U A;  1N75 A;  2LH0 A;  2OO9 A;  3FYC A;  3DZD A;  3DA1 A;  4AI6 A;  3OTO M;  4NRV A;  4JI5 M;  2Z7J A;  3L25 A;  1HR0 M;  3KVW A;  1LV7 A;  2LWX A;  2ZBK B;  3H4J A;  1F4I A;  1XWI A;  4CIS A;  5KQD A;  4X66 M;  3I4V A;  4LY6 A;  3SMS A;  4OX9 M;  1Z5A A;  2X4A A;  3WHK A;  3KOY E;  4GH9 A;  2DWM A;  1IN8 A;  4NSR A;  2ZTC A;  5EQT A;  5EP1 A;  2BJW A;  4IBF A;  4CGY B;  3FUW A;  3ZCB B;  1XNQ M;  3KXE C;  1ZMV A;  3GLH E;  4B3M M;  5KPZ A;  3L26 A;  1XXH E;  2X8A A;  4MGI E;  4B7G A;  1ZMU A;  2V6Z M;  4B7F A;  3SAT A;  4M9Z A;  3TWM A;  1QDT A;  1TH2 A;  4K0K M;  1R2Z A;  2VF7 A;  3PNY A;  1N34 M;  2CV1 A;  2KRK A;  3T6P A;  3TL4 X;  3SYL A;  4D81 A;  5JI2 E;  1D2N A;  3W0F A;  2VII A;  1XMQ M;  4LJ4 A;  4FVM A;  5ITU A;  2K6B A;  3L27 A;  1J09 A;  4FWD A;  4WUR A;  1XMO M;  2N35 A;  4DV0 M;  4RKU F;  1L2B A;  4L16 A;  4Q7J A;  2WSC F;  2YNM D;  2JZ1 A;  1TDZ A;  2DAM A;  2M5Z A;  4OW0 A;  3CF0 A;  2DNA A;  4FW9 A;  1OIZ A;  4G6Z A;  1QYR A;  3VKG A;  2JWS A;  5IWA M;  5FLX S;  3FUV A;  2Q2E B;  4EIW A;  4LF4 M;  1G41 A;  3TWK A;  4DR2 M;  4GHA A;  2C9O A;  2D7H A;  1DGF A;  3L29 A;  3IG5 A;  2E5L M;  2C9C A;  5DYG A;  2ZTD A;  3TE6 A;  1Q02 A;  4JN6 A;  2Y0T A;  3QYE A;  2R4E A;  2CE7 A;  4GIT A;  2UUC M;  3FTF A;  3UK6 A;  1T3T A;  4CHT B;  3DFZ A;  4M9X A;  1XHB A;  1DGG A;  1EFU B;  3LW5 F;  1MJG M;  3B89 A;  1XC8 A;  3AOE A;  2J7N A;  3EIH A;  3GQ3 A;  1K82 A;  2QPA A;  4DR6 M;  2EJS A;  1JR3 A;  1QZE A;  2ERC A;  4FCV A;  4LZZ A;  5DYI A;  1N77 A;  1LTM A;  3UZU A;  1Z5C A;  4AKG A;  2MJ5 B;  3HU1 A;  4XGI A;  1I4W A;  2C5R A;  4IBC A;  1IY1 A;  4JI8 M;  1GKI A;  4I8O A;  1NVM A;  3GLH B;  5KPR A;  2QZ4 A;  4FWG A;  1IM2 A;  1R5L A;  3LVV A;  2LHC A;  4D80 A;  3GLH A;  1R6B X;  3M7G A;  3NBX X;  2OOB A;  4QNR A;  4REZ A;  5ITY A;  4TUW A;  3HJS A;  4GMQ A;  5C1B A;  2UXB M;  3LQQ A;  4DBG B;  1SXJ D;  3MJ5 A;  4JI4 M;  1ZQ9 A;  1JQJ C;  2UXD M;  2EKK A;  1WR1 B;  3AFH A;  1TH4 A;  4RF0 A;  1YUB A;  4DV1 M;  4DV4 M;  3ZQJ A;  4PD2 A;  3I04 M;  4GC5 A;  1DO2 A;  3SC3 A;  4OVZ B;  2WSE F;  3U6O A;  4Z6Y A;  3J7A S;  1NJG A;  4KO8 A;  4LJ6 A;  4OVZ A;  5EP4 A;  4R71 A;  3VKH A;  1DGB A;  2LVP C;  4DR4 M;  4MGH A;  1PM5 A;  1WXQ A;  1Q39 A;  4P16 A;  1RU3 A;  2R65 A;  4JV5 M;  1N78 A;  2EKF A;  1GJS A;  2UU9 M;  4X62 M;  3CF6 E;  3T1Y M;  1KYI A;  1J5E M;  1YSY A;  2D7G A;  3J2P B;  3HZJ A;  4LG2 A;  2DHR A;  2KNZ A;  3GPU A;  3GO8 A;  2K9D A;  1MU5 A;  4CIZ A;  4LFB M;  1NV9 A;  1VDD A;  3HHW A;  3HJQ A;  2C99 A;  2JY7 A;  3AL0 C;  1G8P A;  2DAI A;  3DOA A;  1IBL M;  2EUC A;  2JY8 A;  5FTN A;  1EE8 A;  3ILK A;  3PXG A;  3VDU A;  4LF9 M;  4M9S A;  1E32 A;  1PGY A;  3KOZ E;  3Q8X A;  3HKP A;  1QAM A;  2F4V M;  1S3S A;  4Y28 F;  1IN7 A;  2FOI C;  1PJJ A;  4FWH A;  4BBA A;  3AV0 A;  1NHG C;  2MH8 A;  2R6F A;  3CTW B;  3GPX A;  1IBM M;  2FH0 A;  4MGY E;  3HHZ A;  3HX3 A;  2DWN A;  4FCT A;  2L6O A;  4IBI A;  4B7H A;  2R62 A;  1HT2 E;  1JR3 E;  1W5T A;  3QWL A;  1OAI A;  2QQ8 A;  3E46 A;  2QEN A;  5FTM A;  5DNY A;  3E4R A;  5EXS A;  4QOS A;  1R2Y A;  2KEB A;  2FS1 A;  3FRI A;  5ITQ A;  4I81 A;  3GPP A;  2CP8 A;  1PJS A;  2Z8Y M;  2DZL A;  4QHS A;  2G3Q A;  1HNW M;  4YY3 M;  2EO2 A;  3L28 A;  3GQ4 A;  4WW0 A;  3HGI A;  5LMN M;  4IBB A;  2XZU A;  3RFW A;  2LTU A;  3LMM A;  4R3D A;  2UUB M;  1IY0 A;  1KSF X;  4JI0 M;  3W0L B;  2MR9 A;  2Y20 A;  3L2A A;  5ITR A;  3SAU A;  1SXJ C;  3E21 A;  2BJV A;  2B3T A;  1KFV A;  5KPT A;  3GRY A;  2JXN A;  1P3Q Q;  4LJ9 A;  4NC6 A;  2OQ4 A;  3SHF A;  3TQS A;  4IBJ A;  3SAW A;  2XSZ A;  4GKJ M;  3VLF B;  1TDH A;  1R7R A;  3QAU A;  1IQP A;  4IBD A;  3ZC7 B;  1E94 E;  3T15 A;  4DV6 M;  4AG6 A;  4G4R A;  5BPV A;  4GC9 A;  1QAQ A;  3NBI A;  4L78 A;  1HNX M;  4LF5 M;  1OTR A;  2JNH A;  2V1C A;  4NOO B;  3C9P A;  4GRI A;  1HNZ M;  2Z4S A;  3R9X B;  3SAV A;  1IXR C;  1J7K A;  3E9S A;  2Z4R A;  1C7Y A;  2JA2 A;  2ZAM A;  1Q3C A;  1TF0 B;  4ITQ A;  3I4Y A;  4M0D A;  1PJT A;  1FJG M;  1VEJ A;  2XZF A;  2QHO B;  2DEN A;  4KLN A;  4W5W A;  3WHL A;  2V1U A;  4FCW A;  2KDL A;  4G3O A;  2F5N A;  2CEA A;  2QNJ A;  2W82 A;  1I94 M;  2QBY B;  3W67 A;  1GO5 A;  2QBY A;  4MB7 A;  2DAE A;  2RRU A;  2C98 A;  3LCU A;  5IZ7 D;  2I7P A;  2OOA A;  2VDB B;  3C3D A;  1K3X A;  3GLG E;  5C18 A;  3I01 M;  4MGK E;  2DXI A;  3B74 A;  1AIP C;  2DVW B;  3U6E A;  1N33 M;  2F5S A;  3KSJ A;  2KNV A;  4JI1 M;  4CJ6 A;  2JY5 A;  1QUS A;  4LF6 M;  5F3W A;  3UMM A;  2L4F A;  3HJ8 A;  1TTE A;  4DV3 M;  1PJQ A;  4QOZ C;  2GNO A;  5EXP A;  4GEW A;  2VF8 A;  3RGS A;  3C58 A;  4DV7 M;  3SBJ A;  2M60 A;  3JR4 A;  4PDG A;  1SXJ E;  4LRT A;  1OQY A;  4JYA M;  4AZF A;  4YHH M;  2CRU A;  4NL4 H;  4GIP A;  3MHV C;  5EXT A;  1G3I A;  1ORY B;  1VQ1 A;  2FNA A;  2XF3 A;  4FD2 A;  2A5Y B;  3U6M A;  4IJE A;  3M0E A;  4LJ8 A;  3KSX A;  2F5P A;  2EA0 A;  4AQY M;  1G59 A;  1QAO A;  1R4G A;  3SHG B;  3W68 A;  2HAK A;  2XLJ A;  2CHQ A;  1QVR A;  3FUU A;  2CFO A;  2HHH M;  3KW6 A;  2JZ0 A;  3B7Q A;  4OU7 A;  4BLC A;  3GLF B;  4JI6 M;  2LVN C;  1W5S A;  3SFZ A;  4Z8X A;  1DO0 A;  1OFH A;  2KNA A;  3LCV B;  2JUJ A;  2XGN A;  4QNM A;  2R44 A;  1NHW C;  1NJF A;  3NWL A;  4LFA M;  3GLF A;  3VK8 A;  1N36 M;  2Y0Q A;  4JI2 M;  1DGH B;  4XK8 F;  1G71 A;  1NY6 A;  4QHT A;  3FRH A;  1DGH A;  1NSF A;  2LHG A;  3D8B A;  3UGJ A;  3HU2 A;  2DZN B;  4F2L A;  1WIV A;  4JI3 M;  5KO3 A;  2LBC A;  5DFL A;  5IT9 S;  4LZJ A;  1C1K A;  1JB0 F;  2LVA A;  1QQW A;  1VDL A;  2DWZ B;  2LXE A;  2XSZ D;  3CF2 A;  2CHG A;  3KOW E;  3U6C A;  2ZAO A;  1L2D A;  2HWJ A;  1IXZ A;  2R18 A;  5GKN A;  4B08 A;  4GKK M;  4LF7 M;  3EIE A;  1TR8 A;  1VEG A;  2DWL A;  2DHY A;  4XBO A;  1T43 A;  3PFI A;  1GLN A;  1BVS A;  1D0M A;  3HY5 A;  5IRE B;  2YQZ A;  5ITX E;  2J7O A;  2UUA M;  4L6V 6;  1MN3 A;  4BB9 A;  4G4Q A;  3K8Z A;  4D82 A;  3U6L A;  1V33 A;  2P5T A;  2MRO B;  1UM8 A;  3GRV A;  3K9O A;  2L09 A;  4F1I A;  1L1T A;  1Q3B A;  4DUY M;  3A42 A;  2VQE M;  5L8R F;  4G4N A;  2JY6 B;  5E6J A;  3GLG B;  3U6P A;  1L2C A;  2LNH C;  3Q8G A;  2R45 A;  4LJA A;  3GLG A;  4HEO A;  2WSF F;  1T6O A;  3AKZ A;  7CAT A;  2F5O A;  5FTK A;  4PCZ A;  3KP1 E;  1QZM A;  3RGP A;  1PRB A;  2KXE A;  3HHX A;  3K9P A;  2MGW A;  5H37 D;  4UN2 B;  1UFZ A;  1D0L A;  3FUX A;  2CHV A;  1L8Q A;  2R4J A;  1JR3 D;  3KS4 A;  3BOS A;  5EP2 A;  2L7H A;  1Z5B A;  1SXJ B;  1ZAE A;  2BWB A;  3J7B A;  4I5S A;  4ZPX A;  3TPZ A;  3A98 B;  1SXJ A;  5FTJ A;  2QCU A;  2J5Y A;  3LQR A;  4G4O A;  4KHP M;  2XFT A;  3HWS A;  3GRU A;  4GHL A;  2DKL A;  2KA6 B;  3SYK A;  1OJL A;  1QDR A;  2NQ8 C;  1MX0 A;  4IJF A;  3ZH9 B;  5LMU M;  4JI7 M;  1IBK M;  3IEC A;  2K0B X;  3GLI B;  3GQ5 A;  3U60 B;  4L8R C;  4X64 M;  2AHM A;  2G5G X;  4L15 A;  3QYB A;  3GLI A;  1D0K A;  1OFI A;  3U60 A;  4AKI A;  1A5T A;  2JP7 A;  3GLF E;  2KZS A;  1K3W A;  3FTE A;  2FE8 A;  3FUT A;  1ZV1 A;  1L1Z A;  4IBK A;  3TWL A;  3IG8 A;  3FTD A;  1OAO C;  4PDI A;  1YLA A;  1Z59 A;  4DR3 M;  3F92 A;  3H4M A;  3GRR A;  1X37 A;  2RGO A;  4ANR A;  4AW4 A;  2D7E A;  2KW0 A;  4IIW A;  4DV2 M;  4IBG A;  1OIP A;  3T38 A;  1XNR M;  3RE8 A;  2KHH A;  5FTL A;  1ZMW A;  4RNA A;  3AJI B;  3MK6 A;  3K1J A;  2L7I A;  3GPY A;  1CUK A;  2QP9 X;  4I4L A;  1Y8G A;  3KDS E;  1TH3 A;  4KT0 F;  5ITX A;  1IN6 A;  2BWE A;  4PT5 A;  3UJN A;  1HQC A;  2APL A;  4B3R M;  1Z6T A;  2DAG A;  3M6A A;  3U6D A;  2H5X A;  3BBZ A;  2CUZ A;  3K2L A;  3U5Z B;  4WP2 A;  3KS8 A;  3B9P A;  3JAM S;  1HJP A;  4HL4 A;  2GQF A;  3JR5 A;  2O5R A;  5BR8 M;  3U5Z A;  2XH9 A;  1V34 A;  1WHC A;  4LJ5 A;  8CAT A;  2HKJ A;  4LFC M;  2I7N A;  3K92 A;  4LCB A;  3KFU G;  2R46 A;  3C3E A;  1IFY A;  3KP0 E;  1WGN A;  3BXW A;  5EXX A;  1GL7 A;  1AUA A;  1FNN A;  1IN5 A;  2R0I A;  2DAK A;  2DI0 A;  3AOE C;  4LF8 M;  2XEP A;  3THG A;  3R8F A;  2X49 A;  1YE9 A;  3GP1 A;  2VQF M;  4MM3 B;  4S12 A;  4LJ7 A;  2KZU A;  1E9R A;  1OKS A;  3A45 A;  2CV2 A;  2F5Q A;  2ZAN A;  1WJ7 A;  5ITT A;  3VK7 A;  5A2Q S;  1IY2 A;  1G4A E;  2WZJ A;  2O01 F;  4JXJ A;  3FKE A;  3PNV A;  3HHY A;  3MMP A;  4LGM A;  4LRS A;  1IXS B;  3SAR A;  3GLI E;  1XXH B;  4DR1 M;  2Y21 A;  4KOD A;  1VG5 A;  4AG5 A;  1IXS A;  1XXH A;  2O25 A;  4IBE A;  4MH0 E;  4M0W A;  4A3V B;  4NRW A;  1WGL A;  4HLQ A;  1NO1 A;  5FSW A;  3KOX E;  4R7G A;  3PVS A;  2FFJ A;  2BNK A;  3J27 B;  4P17 A;  1XB2 B;  2LVO C;  3J81 S;  2Z3X A;  2CWB A;  1V92 A;  2L2D A;  3FYD A;  3U61 B;  1GL6 A;  4AKH A;  2YFQ A;  1NNU C;  2K47 A;  3U61 A;  2OPF A;  4MGZ E;  1SG9 A;  2UXC M;  1QUT A;  2L4E A;  1DV0 A;  3FD9 A;  3J80 S;  2ZM6 M;  1GJT A;  1N32 M;  3HU3 A;  2XFS A;  2G8L A;  1VEK A;  1QAN A;  3I51 A;  3VFD A;  4LGY A;  4DR5 M;  4DR7 M;  4B3S M;  3LVW A;  1E9S A;  3V76 A;  3U6S A;  3B7Z A;  3IHP A;  2KRU A; 
#chains in the Genus database with same CATH homology
 4RF1 A;  2C96 A;  2HL7 A;  5E26 A;  3VDP A;  2DZO B;  2YR0 A;  1NNJ A;  4NSO B;  2HCB A;  5KQ8 A;  4X65 M;  4B3T M;  5EJC A;  4NXN M;  3T1H M;  1GVN A;  3U6Q A;  4DV5 M;  4NXM M;  2RKO A;  4II7 A;  3SMP A;  3FTC A;  5JI3 E;  4L4U A;  1PJI A;  1TGU A;  3SAS A;  5EP3 A;  2RGH A;  1NY5 A;  2CV0 A;  4DUZ M;  1HT1 E;  3AOG A;  2H1R A;  3A46 A;  3D8L A;  1IN4 A;  1HQY E;  1H6U A;  1N75 A;  2LH0 A;  3FYC A;  3DZD A;  3DA1 A;  4AI6 A;  3OTO M;  4NRV A;  4JI5 M;  2Z7J A;  3L25 A;  1HR0 M;  3KVW A;  1LV7 A;  2LWX A;  2ZBK B;  1XWI A;  4CIS A;  5KQD A;  4X66 M;  3I4V A;  4LY6 A;  3SMS A;  4OX9 M;  1Z5A A;  2X4A A;  3WHK A;  3KOY E;  4GH9 A;  2DWM A;  1IN8 A;  4NSR A;  5EQT A;  5EP1 A;  2BJW A;  4IBF A;  4CGY B;  3FUW A;  3ZCB B;  1XNQ M;  3KXE C;  4B3M M;  5KPZ A;  3L26 A;  2X8A A;  4MGI E;  4B7G A;  2V6Z M;  4B7F A;  3SAT A;  4M9Z A;  3TWM A;  1TH2 A;  4K0K M;  1R2Z A;  3PNY A;  1N34 M;  2CV1 A;  2KRK A;  3TL4 X;  3SYL A;  4D81 A;  5JI2 E;  1D2N A;  3W0F A;  2VII A;  1XMQ M;  4LJ4 A;  4FVM A;  5ITU A;  3L27 A;  1J09 A;  4FWD A;  4WUR A;  1XMO M;  4DV0 M;  1L2B A;  4L16 A;  2YNM D;  1TDZ A;  2M5Z A;  4OW0 A;  3CF0 A;  4FW9 A;  4G6Z A;  1QYR A;  3VKG A;  5FLX S;  5IWA M;  3FUV A;  2Q2E B;  4EIW A;  4LF4 M;  1G41 A;  3TWK A;  4DR2 M;  4GHA A;  2C9O A;  2D7H A;  1DGF A;  3L29 A;  3IG5 A;  2E5L M;  2C9C A;  5DYG A;  3TE6 A;  4JN6 A;  2Y0T A;  2UUC M;  2R4E A;  2CE7 A;  4GIT A;  3FTF A;  3UK6 A;  1T3T A;  4CHT B;  3DFZ A;  4M9X A;  1XHB A;  1DGG A;  1XC8 A;  3AOE A;  2J7N A;  3EIH A;  3GQ3 A;  1K82 A;  2QPA A;  4DR6 M;  1JR3 A;  2ERC A;  4FCV A;  4LZZ A;  5DYI A;  1N77 A;  4AKG A;  3UZU A;  1Z5C A;  3HU1 A;  4XGI A;  1I4W A;  2C5R A;  4IBC A;  1IY1 A;  4JI8 M;  1GKI A;  4I8O A;  1NVM A;  3GLH B;  5KPR A;  2QZ4 A;  4FWG A;  1IM2 A;  3LVV A;  4D80 A;  3GLH A;  1R6B X;  3M7G A;  4QNR A;  4TUW A;  4REZ A;  5ITY A;  2UXB M;  3HJS A;  4GMQ A;  5C1B A;  3LQQ A;  4JI4 M;  1SXJ D;  3MJ5 A;  1ZQ9 A;  1JQJ C;  2UXD M;  3AFH A;  1TH4 A;  4RF0 A;  1YUB A;  4DV1 M;  4DV4 M;  4PD2 A;  4GC5 A;  1DO2 A;  3SC3 A;  4OVZ B;  3U6O A;  4Z6Y A;  3J7A S;  1NJG A;  4KO8 A;  4LJ6 A;  4OVZ A;  5EP4 A;  3VKH A;  1DGB A;  4DR4 M;  4MGH A;  1PM5 A;  1WXQ A;  1Q39 A;  4P16 A;  2R65 A;  4JV5 M;  1N78 A;  2UU9 M;  4X62 M;  3CF6 E;  3T1Y M;  1KYI A;  1J5E M;  1YSY A;  2D7G A;  3J2P B;  4LG2 A;  2DHR A;  3GPU A;  3GO8 A;  1MU5 A;  4LFB M;  1VDD A;  3HHW A;  3HJQ A;  2C99 A;  3AL0 C;  1G8P A;  3DOA A;  1IBL M;  2EUC A;  5FTN A;  1EE8 A;  3ILK A;  3PXG A;  3VDU A;  4LF9 M;  4M9S A;  1E32 A;  3KOZ E;  3Q8X A;  3HKP A;  1QAM A;  2F4V M;  1S3S A;  1IN7 A;  2FOI C;  1PJJ A;  4FWH A;  4BBA A;  3AV0 A;  1NHG C;  3CTW B;  3GPX A;  1IBM M;  3HHZ A;  4MGY E;  2DWN A;  4FCT A;  2L6O A;  4IBI A;  4B7H A;  2R62 A;  1HT2 E;  3QWL A;  1W5T A;  2QEN A;  5FTM A;  5DNY A;  3E4R A;  5EXS A;  4QOS A;  1R2Y A;  2KEB A;  5ITQ A;  4I81 A;  3GPP A;  4QHS A;  1HNW M;  4YY3 M;  2EO2 A;  3L28 A;  3GQ4 A;  4WW0 A;  3HGI A;  5LMN M;  4IBB A;  2XZU A;  3RFW A;  3LMM A;  4R3D A;  2UUB M;  1IY0 A;  1KSF X;  4JI0 M;  3W0L B;  2Y20 A;  3L2A A;  5ITR A;  3SAU A;  1SXJ C;  2BJV A;  1KFV A;  5KPT A;  3GRY A;  4LJ9 A;  2OQ4 A;  3SHF A;  3TQS A;  4IBJ A;  3SAW A;  2XSZ A;  4GKJ M;  3VLF B;  1TDH A;  1R7R A;  3QAU A;  1IQP A;  4IBD A;  3ZC7 B;  1E94 E;  3T15 A;  4DV6 M;  4AG6 A;  4G4R A;  5BPV A;  4GC9 A;  1QAQ A;  3NBI A;  4L78 A;  1HNX M;  4LF5 M;  2V1C A;  4NOO B;  4GRI A;  1HNZ M;  2Z4S A;  3R9X B;  3SAV A;  1IXR C;  1J7K A;  3E9S A;  2Z4R A;  2JA2 A;  2ZAM A;  1Q3C A;  4ITQ A;  3I4Y A;  4M0D A;  1FJG M;  2XZF A;  4KLN A;  4W5W A;  3WHL A;  2V1U A;  4FCW A;  2F5N A;  2CEA A;  2W82 A;  1I94 M;  2QBY B;  2QBY A;  4MB7 A;  2C98 A;  5IZ7 D;  2I7P A;  1K3X A;  5C18 A;  4MGK E;  2DXI A;  2DVW B;  3U6E A;  1N33 M;  2F5S A;  3KSJ A;  4JI1 M;  4LF6 M;  5F3W A;  3UMM A;  3HJ8 A;  4DV3 M;  4QOZ C;  5EXP A;  3C58 A;  3RGS A;  4DV7 M;  3SBJ A;  2M60 A;  3JR4 A;  4PDG A;  1SXJ E;  4LRT A;  4JYA M;  4AZF A;  4YHH M;  4NL4 H;  4GIP A;  3MHV C;  5EXT A;  1G3I A;  1ORY B;  2FNA A;  2XF3 A;  4FD2 A;  3U6M A;  2A5Y B;  4IJE A;  3M0E A;  4LJ8 A;  3KSX A;  2F5P A;  2EA0 A;  4AQY M;  1G59 A;  1QAO A;  3SHG B;  2XLJ A;  2CHQ A;  1QVR A;  3FUU A;  2CFO A;  2HHH M;  3KW6 A;  4OU7 A;  4BLC A;  3GLF B;  4JI6 M;  1W5S A;  3SFZ A;  4Z8X A;  1DO0 A;  1OFH A;  4QNM A;  4LFA M;  2XGN A;  3GLF A;  3VK8 A;  1NHW C;  1NJF A;  3NWL A;  4JI2 M;  1N36 M;  2Y0Q A;  1DGH B;  1NY6 A;  4QHT A;  1DGH A;  1NSF A;  3D8B A;  3UGJ A;  3HU2 A;  2DZN B;  4JI3 M;  5KO3 A;  5IT9 S;  4LZJ A;  1C1K A;  3KOW E;  2LXE A;  1QQW A;  3U6C A;  2DWZ B;  2XSZ D;  3CF2 A;  1L2D A;  2CHG A;  2ZAO A;  1IXZ A;  2R18 A;  5GKN A;  4B08 A;  4GKK M;  4LF7 M;  3EIE A;  2DWL A;  4XBO A;  3PFI A;  1GLN A;  5IRE B;  2YQZ A;  5ITX E;  2J7O A;  2UUA M;  4BB9 A;  4G4Q A;  3K8Z A;  4D82 A;  3U6L A;  2P5T A;  3GRV A;  1UM8 A;  2L09 A;  1L1T A;  1Q3B A;  4DUY M;  3A42 A;  2VQE M;  4G4N A;  5E6J A;  3GLG B;  3U6P A;  1L2C A;  2LNH C;  2R45 A;  4LJA A;  3GLG A;  3AKZ A;  7CAT A;  2F5O A;  5FTK A;  4PCZ A;  3KP1 E;  1QZM A;  3RGP A;  2KXE A;  3HHX A;  5H37 D;  3FUX A;  2CHV A;  1L8Q A;  2R4J A;  1JR3 D;  3KS4 A;  3BOS A;  5EP2 A;  2L7H A;  1Z5B A;  1SXJ B;  1ZAE A;  3J7B A;  4I5S A;  4ZPX A;  3TPZ A;  3A98 B;  1SXJ A;  5FTJ A;  2QCU A;  3LQR A;  4G4O A;  4KHP M;  2XFT A;  3HWS A;  3GRU A;  4GHL A;  2KA6 B;  3SYK A;  1OJL A;  2NQ8 C;  1MX0 A;  4IJF A;  3ZH9 B;  5LMU M;  4JI7 M;  1IBK M;  3GLI B;  3GQ5 A;  3U60 B;  4L8R C;  4X64 M;  2AHM A;  2G5G X;  4L15 A;  3GLI A;  1OFI A;  3U60 A;  4AKI A;  2KZS A;  1K3W A;  3FTE A;  2FE8 A;  3FUT A;  1L1Z A;  4IBK A;  3TWL A;  3IG8 A;  3FTD A;  4PDI A;  1Z59 A;  4DR3 M;  3H4M A;  3GRR A;  1X37 A;  2RGO A;  4AW4 A;  4DV2 M;  2D7E A;  2KW0 A;  4IIW A;  4IBG A;  3T38 A;  1XNR M;  3RE8 A;  5FTL A;  4RNA A;  3AJI B;  3MK6 A;  3K1J A;  2L7I A;  3GPY A;  2QP9 X;  4I4L A;  3KDS E;  1TH3 A;  5ITX A;  1IN6 A;  4PT5 A;  3UJN A;  1HQC A;  4B3R M;  1Z6T A;  3M6A A;  3U6D A;  3KS8 A;  2CUZ A;  3K2L A;  3U5Z B;  3B9P A;  3JAM S;  4HL4 A;  3JR5 A;  2O5R A;  5BR8 M;  3U5Z A;  2XH9 A;  4LJ5 A;  8CAT A;  2HKJ A;  4LFC M;  2I7N A;  3K92 A;  4LCB A;  3KFU G;  2R46 A;  3KP0 E;  5EXX A;  1GL7 A;  1FNN A;  1IN5 A;  3AOE C;  4LF8 M;  2XEP A;  3THG A;  3R8F A;  2X49 A;  1YE9 A;  3GP1 A;  2VQF M;  4MM3 B;  4S12 A;  4LJ7 A;  2KZU A;  1E9R A;  2F5Q A;  3A45 A;  2CV2 A;  2ZAN A;  5ITT A;  3VK7 A;  5A2Q S;  1IY2 A;  1G4A E;  4JXJ A;  3FKE A;  3PNV A;  3HHY A;  4LGM A;  4LRS A;  1IXS B;  3SAR A;  1XXH B;  4DR1 M;  2Y21 A;  4KOD A;  4AG5 A;  1XXH A;  4IBE A;  4MH0 E;  4M0W A;  4A3V B;  4NRW A;  4HLQ A;  5FSW A;  3KOX E;  4R7G A;  3PVS A;  2FFJ A;  2BNK A;  3J27 B;  2Z3X A;  3U61 B;  3J81 S;  3FYD A;  4AKH A;  1GL6 A;  2YFQ A;  1NNU C;  2K47 A;  3U61 A;  2OPF A;  4MGZ E;  2UXC M;  3FD9 A;  3J80 S;  2ZM6 M;  1N32 M;  3HU3 A;  2XFS A;  2G8L A;  3I51 A;  1QAN A;  3VFD A;  4LGY A;  4DR5 M;  4DR7 M;  4B3S M;  3LVW A;  1E9S A;  3U6S A;  2KRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...