1XNRM

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnrM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnrM02
4G4OA 3SAUA 3TWKA 3A45A 1N32M 4DV1M 2UXDM 3A46A 3JR4A 4B3MM 2F5NA 4LF5M 4NXMM 2F4VM 4JV5M 2Q2EB 4DR5M 3U6EA 4DR4M 4K0KM 1R2ZA 4DV4M 4PD2A 4PCZA 1PJIA 3T1YM 4LFAM 1K82A 3W0FA 4X62M 3U6MA 2F5SA 4B3SM 4YY3M 4ITQA 4JI3M 3C58A 2XZFA 1PJJA 4G4QA 4GKKM 4NXNM 5A2QS 3GQ5A 3GO8A 4DV6M 1L2BA 1NNJA 1L1TA 2HHHM 3SARA 4LF8M 3J80S 1N36M 5ITXA 1K3XA 1J5EM 3U6OA 3T1HM 1L1ZA 4DR7M 1IBLM 3GPUA 3TWLA 1Z5CA 1EE8A 1Q3CA 2ZM6M 3GP1A 5ITXE 5LMNM 3GPYA 4G4NA 2HKJA 3U6SA 2EA0A 2UUBM 1HNXM 3U6CA 1Z5AA 1IBMM 4AQYM 3J81S 2XZUA 4DV3M 2UXBM 3SAVA 3GPXA 3VK8A 4JI2M 3OTOM 4KHPM 3SATA 4CISA 3U6DA 4X64M 4DV5M 2UUAM 4DV0M 4JI1M 2OQ4A 4PDGA 2ZBKB 1TDHA 2UU9M 3U6QA 4JI8M 3U6LA 5FLXS 4LFBM 1Q39A 3GQ3A 1KFVA 5ITQA 4DR6M 3VK7A 1Z59A 5ITYA 1XNQM 1L2CA 1TDZA 4LF7M 1Q3BA 3SASA 3DOAA 4NRVA 4JI0M 4X65M 2VQEM 4DV7M 3JAMS 4JI6M 4OX9M 4YHHM 3SAWA 2F5OA 4JI7M 4DR1M 4LF4M 4DUZM 5IT9S 5ITUA 2F5QA 1HNZM 2OPFA 1K3WA 1IBKM 1R2YA 4G4RA 5IWAM 3A42A 1N34M 1XNRM 4DV2M 5LMUM 1HNWM 1I94M 1FJGM 5ITRA 4MB7A 4JI4M 2VQFM 1XC8A 2UXCM 1XMOM 3U6PA 1MU5A 4B3TM 1HR0M 5BR8M 4B3RM 3JR5A 1N33M 2UUCM 4LFCM 1MX0A 1PM5A 3J7AS 1Z5BA 2E5LM 3GPPA 4JYAM 1XMQM 4LF6M 4NRWA 4PDIA 4DR2M 4X66M 4LF9M 4DUYM 1L2DA 5ITTA 3TWMA 3GQ4A 4JI5M 4DR3M 2F5PA 3SBJA 4GKJM
chains in the Genus database with same CATH superfamily
3AOEC 1DV0A 2WSEF 1DGHA 1E9SA 4FD2A 2HWJA 3HY5A 2UXDM 1NHGC 5C18A 3A46A 1TH3A 3KSJA 3MJ5A 4GMQA 3SYLA 3JR4A 1L8QA 3FE3A 2C99A 4NC6A 5F3WA 4L8RC 1PGYA 4IJEA 1ZMVA 1I4WA 2RRUA 3E4RA 1KYIA 1YLAA 3IHPA 3T6PA 1QUTA 1WHCA 2I7PA 4JN6A 1N75A 4IBJA 2Z3XA 2C5RA 1OKSA 1DO2A 4LJ8A 4GH9A 4IBIA 1NJGA 5DYIA 1LV7A 2Z4SA 2QCUA 2D7EA 2DI0A 1JQJC 2HL7A 3ZC7B 1T43A 1R5LA 4NXNM 3KP0E 5A2QS 2JY6B 2FOIC 4I5SA 1L1TA 4GC5A 2HHHM 2QQ8A 4IBDA 3FUTA 3HU2A 1N36M 4FWGA 4I8OA 3V76A 3GLGB 3PNYA 3U6OA 1J5EM 4DR7M 5EXSA 1R6BX 2JY7A 3FUWA 1QQWA 3GP1A 4AKIA 3KOWE 5EJCA 2CV2A 1VDDA 3KW6A 3MMPA 3MHVC 5FTJA 2HKJA 2P5TA 4MGYE 2CHVA 3GLHB 3J81S 5FTKA 2KZSA 3AOGA 3B74A 4MM3B 1V92A 4D80A 2OO9A 3FD9A 3HJQA 4CHTB 4GC9A 2V1UA 3U6DA 4X64M 4DV5M 3VLFB 4WURA 2UU9M 2LVPC 2EKFA 2YQZA 4FW9A 5FLXS 2DKLA 1HT2E 3WHLA 5BPVA 4DR6M 2MROB 2QBYA 5ITYA 2KHHA 2CFOA 2KDLA 3KOZE 3L27A 2VF8A 3ZCBB 1TDZA 1Q3BA 4IJFA 4QHTA 3K9OA 2HCBA 3K2LA 3K9PA 2DAKA 3JAMS 2XFSA 4FVMA 1V33A 4FWDA 3CF6E 3D8LA 1PJTA 3E9SA 3FTCA 4GEWA 2W82A 2CE7A 4LF4M 5IT9S 1G59A 3NBXX 1K3WA 4IIWA 2LWXA 3HX3A 4GITA 2DAIA 1CUKA 3A42A 1N34M 3AL0C 3KFUG 4NL4H 1VQ1A 1OIPA 5LMUM 1IXZA 5ITRA 2MH8A 2GQFA 2R46A 2JY5A 2YNMD 1XMOM 1X37A 3KSXA 1MU5A 3Q8XA 4B3TM 3M7GA 5EP1A 1D0KA 2FS1A 4JXJA 4UN2B 1QDRA 2UUCM 3GLIB 4LFCM 1PM5A 1Z5BA 3E46A 1E94E 5IZ7D 1XMQM 2E5LM 3FYDA 4R71A 4HLQA 4PDIA 1XXHE 1IN6A 2CUZA 2Y0QA 2Y21A 3TWMA 2WZJA 2V1CA 4NSRA 2F5PA 4M0DA 3SBJA 2EKKA 3KP1E 2L6OA 1DGBA 3TWKA 3QYEA 4AKHA 1T6OA 5KPTA 2F5NA 3R8FA 2ERCA 2L4FA 1AIPC 1GL6A 1SXJA 1PRBA 3LQRA 2LBCA 2R65A 3D8BA 3KOXE 3QAUA 4G6ZA 1XXHB 2Q2EB 3U6EA 2QSFX 4B7GA 2YFQA 3HJ8A 3SMSA 5FTLA 3GLIE 1TR8A 5KQ8A 2D7GA 4M0WA 2QHOB 3FTDA 3UMMA 1TH2A 4MGZE 3U6MA 3SFZA 2F5SA 4B3SM 3A98B 4ITQA 2CWBA 1QUSA 1D0LA 1WIVA 2DWZB 3C58A 4F2LA 2JA2A 3B7ZA 4MH0E 4OVZB 4REZA 1PJJA 3FYCA 2Y0TA 3HHYA 2C98A 2DENA 4GKKM 3PFIA 2YR0A 2K9DA 3LW5F 1VEGA 4MGHA 3GQ5A 3PVSA 2DVWB 3B9PA 3W68A 1G4AE 4LF8M 1PJSA 3GRRA 2R4EA 2C9CA 1IN8A 1QANA 4RNAA 2J7OA 1IBLM 4NSOB 2CRUA 1A5TA 4HL4A 1Q3CA 3GPUA 3TL4X 1TF0B 4PT5A 3HU3A 4QNMA 2KRKA 3HHXA 4L16A 4LJ9A 1HQCA 2JXNA 4M9XA 3CTWB 3RFWA 4CIZA 2EA0A 4MGIE 2DAGA 4B7HA 3U6CA 5JI3E 4DV3M 3SAVA 3H4MA 4OVZA 4JI2M 3OTOM 4AG6A 3IECA 3THGA 3C3EA 1WR1B 2DWLA 3E21A 3NWLA 3L2AA 4CISA 3HGIA 1XWIA 2MGWA 3DA1A 4DV0M 4JI1M 1GLNA 3EIHA 4RKUF 2X8AA 1QAOA 3CF2A 2QENA 5EP4A 2XSZD 1VEJA 2DHYA 2V6ZM 2KA6B 3KVWA 4FCVA 3U6QA 4JI8M 3T38A 2KZUA 4P16A 3AV0A 3SHFA 2I7NA 3VK7A 2L7HA 3FUVA 2FNAA 1L2CA 4AZFA 3KDSE 1VEKA 1OAOC 2CHGA 2EO2A 2VDBB 2XEPA 2VQEM 4DV7M 5DNYA 4YHHM 4L78A 2N35A 3GLGA 2Z8YM 3F92A 2O25A 1OAIA 4GRIA 4JI7M 4DR1M 1IXRC 4DUZM 2LNHC 2XGNA 3GLGE 4AW4A 1XB2B 2MJ5B 1Y8GA 3I4VA 1IFYA 2XFTA 1IBKM 3UJNA 2KNZA 1SXJC 3LVVA 2JY8A 2O5RA 4LZJA 3FKEA 1EIJA 3LCUA 1Z6TA 3B7NA 4M9SA 4CGYB 4D82A 1I94M 1HNWM 1NSFA 3CF0A 2BJVA 1XC8A 4L15A 2J7NA 4IBEA 3DZDA 4M9ZA 1RU3A 2R18A 1H6UA 4FWHA 4IBFA 2XH9A 1HR0M 4OW0A 2G3QA 4R7GA 1N77A 2GNOA 4TUWA 1MX0A 1OJLA 3J7AS 4JYAM 2LH0A 3GPPA 1YSYA 4BLCA 2M60A 3B89A 4NRWA 5EXPA 4XK8F 4LF9M 4DUYM 1GJSA 2K6BA 5KPZA 3SHGB 1P3QQ 2QNJA 3L28A 3Q8GA 2DZOB 2R44A 3SAUA 3VKGA 1TH4A 1N32M 3M0EA 3LCVB 1C7YA 1IXSB 2FFJA 2R4JA 3J7BA 1ZMUA 4HEOA 4QHSA 2VIIA 2DWNA 3K92A 4B3MM 2Z4RA 4NXMM 2ZTDA 2LXEA 3GLFA 2J5YA 3RGSA 1JB0F 2LVNC 2K47A 4DR5M 4DR4M 5DFLA 4K0KM 4RF0A 4ZPXA 3EIEA 4LJ4A 1R2ZA 4PD2A 4PCZA 1PJIA 1BVSA 2JZ1A 5KQDA 2OOBA 1OIZA 3HKPA 2BWBA 1OFIA 2C96A 4EIWA 3L26A 4JI3M 3FTEA 1SXJE 2WSFF 3U61B 1F4IA 3CGWA 3L25A 2LTUA 2LVAA 7CATA 4CJ6A 4QOZC 1LTMA 2H5XA 3NBIA 4G3OA 1IM2A 1NNJA 3J80S 1NO1A 2KXEA 1QVRA 5EP2A 2XLJA 1K3XA 3T1HM 1L1ZA 1R4GA 3TWLA 8CATA 1DGFA 1HQYE 5KO3A 2ZM6M 3U5ZA 1JR3A 2JUJA 1UFZA 4IBCA 2QBYB 4AKGA 3DFZA 5LMNM 1YE9A 3U60A 1VDLA 2AHMA 2UUBM 3TQSA 1NY6A 1HNXM 4LGMA 3FUXA 2XZUA 3T15A 4B08A 4LRSA 3W0LB 1D0MA 5FSWA 3SATA 1WGNA 3C9PA 3SYKA 1JR3D 1W5SA 3GRYA 1PJQA 2OQ4A 1OTRA 1TTEA 1YUBA 2ZBKB 4XGIA 4LJAA 2LHCA 3TPZA 1J09A 4LFBM 1KFVA 3GQ3A 1NHWC 2DAMA 3KS4A 3VFDA 5ITQA 2HAKA 2L7IA 1EFUB 1TGUA 3J27B 3KOYE 2KRUA 4XBOA 4DBGB 3U5ZB 4LF7M 3SASA 3DOAA 4NRVA 4JI0M 4X65M 3PNVA 4LG2A 3K8ZA 4OX9M 3SAWA 2QZ4A 1NVMA 2CHQA 2R45A 3K1JA 5E6JA 1G8PA 1T3TA 1DGHB 2RKOA 3I51A 3FUUA 2CP8A 3M6AA 4L6V6 2EUCA 4A3VB 5JI2E 4NOOB 1IY1A 3GRUA 1D2NA 3W67A 1R2YA 2L4EA 1WXQA 1MN3A 3HU1A 3I4YA 4LZZA 4G4RA 5IWAM 4DV2M 2XF3A 2LVQD 4B7FA 2CV1A 2R0IA 1GO5A 4MB7A 5IREB 2VQFM 4JI4M 1JR3E 1OQYA 1NJFA 3TE6A 1J7KA 4D81A 5C1BA 3GLHE 3FRIA 5EXTA 4GKJM 1SG9A 1E32A 4Z6YA 3U6PA 2DXIA 2DWMA 4B3RM 2XSZA 2ZAOA 1IXSA 4IBKA 1ZQ9A 5BR8M 3JR5A 4IBGA 2X49A 3UK6A 3I01M 4I81A 1V34A 4LF6M 3U60B 3FTFA 2H1RA 4X66M 4BB9A 1L2DA 5ITTA 2VF7A 3J2PB 3HHZA 4JI5M 3LMMA 3UZUA 4I4LA 3GLHA 4GHLA 4LY6A 3AJIB 4LJ6A 4G4OA 1IY0A 1DGGA 4RF1A 3A45A 4AG5A 4DV1M 1HT1E 3VDPA 2LVOC 4OU7A 4F1IA 3RE8A 4LF5M 2F4VM 3HWSA 3AFHA 1GJTA 2JNHA 2JP7A 4L4UA 3SC3A 4ANRA 2O01F 3GLIA 4JV5M 4S12A 3BOSA 3MK6A 4WP2A 4MGKE 4DV4M 2KNAA 3R9XB 1W5TA 2Y20A 3IG5A 3T1YM 4LFAM 1K82A 2RGHA 4FCWA 2NQ8C 4QOSA 3W0FA 4X62M 1G71A 1WGLA 4QNRA 4W5WA 1NV8A 4YY3M 2R6FA 2XZFA 2G5GX 2BJWA 2L2DA 2A5YB 1XHBA 4LJ7A 2KW0A 4G4QA 1IN5A 5H37D 2Z7JA 2KNVA 3QWLA 3H4JA 3ZQJA 3GO8A 1DO0A 2DHRA 3L29A 3HHWA 5L8RF 4DV6M 1L2BA 1NY5A 4Z8XA 2DNAA 4KO8A 4P17A 3SARA 4KT0F 1GL7A 1XXHA 2OOAA 3IG8A 5ITXA 1NV9A 2KEBA 4LGYA 1SXJD 2DZLA 4R3DA 1AUAA 1Z5CA 1EE8A 5ITXE 4LRTA 1IY2A 5EP3A 3AOEA 2BNKA 2MR9A 4KODA 1QZMA 3GPYA 4G4NA 4WW0A 1ZV1A 3U6SA 3GRVA 3FRHA 1IBMM 1Z5AA 4AQYM 2LHGA 3LQQA 1Q02A 2UXBM 2DZNB 3AKZA 2D7HA 3QYBA 1QYRA 3GPXA 3VK8A 4KHPM 1HJPA 4LJ5A 1QZEA 1E9RA 2X4AA 3ZH9B 2QPAA 3WHKA 2UUAM 4AI6A 1ZAEA 4PDGA 1ZMWA 1KSFX 2WSCF 3VKHA 3GLFB 1QDTA 1TDHA 2B3TA 1QAMA 2FE8A 3U61A 3U6LA 4GIPA 4KLNA 1G3IA 1GKIA 1Q39A 4Y28F 5GKNA 3UGJA 1Z59A 2G8LA 1XNQM 1ORYB 3HZJA 1MJGM 2EJSA 4JI6M 2M5ZA 5DYGA 2F5OA 2JZ0A 4FCTA 3BBZA 3VDUA 1NNUC 1WJ7A 2C9OA 1VG5A 5E26A 1IQPA 5ITUA 3KXEC 5KPRA 2F5QA 1HNZM 4GHAA 4LCBA 2OPFA 4Q7JA 3GLFE 2QP9X 2ZTCA 3C3DA 4BBAA 1OFHA 3HJSA 2K0BX 3BXWA 3ILKA 1UM8A 4IBBA 3RGPA 1XNRM 3KS8A 1N78A 1GABA 2RGOA 2CV0A 1FNNA 1FJGM 1SXJB 1IN4A 1QAQA 3B7QA 2UXCM 2L09A 3SMPA 2APLA 5FTMA 5FTNA 2ZANA 1IN7A 1S3SA 5EQTA 1N33M 1G41A 1R7RA 3I04M 2CEAA 5EXXA 2BWEA 3LVWA 1C1KA 2DAEA 2FH0A 4DR2M 3GQ4A 4II7A 3PXGA 4DR3M 2JWSA 2ZAMA 1GVNA 2R62A
chains in the Genus database with same CATH topology
3AOEC 4FD2A 1DGHA 1E9SA 2UXDM 1NHGC 5C18A 3A46A 1TH3A 3KSJA 3MJ5A 4GMQA 3SYLA 3JR4A 1L8QA 2C99A 5F3WA 4L8RC 4IJEA 1I4WA 3E4RA 1KYIA 2I7PA 4JN6A 1N75A 4IBJA 2Z3XA 2C5RA 1DO2A 4LJ8A 4GH9A 4IBIA 1NJGA 5DYIA 1LV7A 2Z4SA 2QCUA 2D7EA 1JQJC 2HL7A 3ZC7B 4NXNM 3KP0E 5A2QS 2FOIC 4I5SA 1L1TA 4GC5A 2HHHM 4IBDA 3FUTA 1N36M 4FWGA 4I8OA 3GLGB 3PNYA 3U6OA 1J5EM 4DR7M 5EXSA 1R6BX 3FUWA 1QQWA 3GP1A 4AKIA 3KOWE 5EJCA 2CV2A 1VDDA 3KW6A 3MHVC 5FTJA 2HKJA 2P5TA 4MGYE 2CHVA 3GLHB 3J81S 5FTKA 2KZSA 3AOGA 4MM3B 4D80A 3FD9A 3HJQA 4CHTB 4GC9A 2V1UA 3U6DA 4X64M 4DV5M 3VLFB 4WURA 2UU9M 2YQZA 4FW9A 5FLXS 1HT2E 3WHLA 5BPVA 4DR6M 2QBYA 5ITYA 2CFOA 3KOZE 3L27A 1TDZA 3ZCBB 1Q3BA 4IJFA 4QHTA 2HCBA 3K2LA 3JAMS 2XFSA 4FVMA 4FWDA 3CF6E 3D8LA 3E9SA 3FTCA 2W82A 2CE7A 4LF4M 5IT9S 1G59A 1K3WA 4IIWA 2LWXA 4GITA 3A42A 1N34M 3AL0C 3KFUG 4NL4H 5LMUM 1IXZA 5ITRA 2R46A 2YNMD 1XMOM 1X37A 3KSXA 1MU5A 3Q8XA 4B3TM 3M7GA 5EP1A 4JXJA 2UUCM 3GLIB 4LFCM 1PM5A 1Z5BA 5IZ7D 1E94E 2E5LM 1XMQM 3FYDA 4HLQA 4PDIA 1IN6A 2CUZA 2Y0QA 2Y21A 3TWMA 2V1CA 4NSRA 2F5PA 4M0DA 3SBJA 3KP1E 2L6OA 1DGBA 3TWKA 4AKHA 5KPTA 2F5NA 3R8FA 2ERCA 1GL6A 1SXJA 3LQRA 2R65A 3D8BA 3KOXE 3QAUA 4G6ZA 1XXHB 2Q2EB 3U6EA 4B7GA 2YFQA 3HJ8A 3SMSA 5FTLA 5KQ8A 2D7GA 4M0WA 3FTDA 3UMMA 1TH2A 4MGZE 3U6MA 3SFZA 2F5SA 4B3SM 3A98B 4ITQA 2DWZB 3C58A 2JA2A 1PJJA 4MH0E 4OVZB 4REZA 3FYCA 2Y0TA 3HHYA 2C98A 4GKKM 3PFIA 2YR0A 3GQ5A 4MGHA 3PVSA 2DVWB 3B9PA 4LF8M 1G4AE 3GRRA 2R4EA 2C9CA 1IN8A 1QANA 4RNAA 2J7OA 1IBLM 4NSOB 3GPUA 4HL4A 1Q3CA 3TL4X 4PT5A 3HU3A 4QNMA 2KRKA 3HHXA 4L16A 4LJ9A 1HQCA 4M9XA 3CTWB 3RFWA 2EA0A 4MGIE 4B7HA 3U6CA 5JI3E 4DV3M 3SAVA 3H4MA 4OVZA 4JI2M 3OTOM 4AG6A 3THGA 2DWLA 3NWLA 3L2AA 4CISA 3HGIA 1XWIA 3DA1A 4DV0M 4JI1M 1GLNA 3EIHA 2X8AA 1QAOA 3CF2A 2QENA 5EP4A 2XSZD 2V6ZM 3KVWA 4FCVA 2KA6B 3U6QA 4JI8M 3T38A 2KZUA 4P16A 3AV0A 3SHFA 2I7NA 3VK7A 2L7HA 3FUVA 2FNAA 1L2CA 4AZFA 3KDSE 2CHGA 2EO2A 2VQEM 2XEPA 4DV7M 5DNYA 4YHHM 4L78A 3GLGA 4GRIA 4JI7M 4DR1M 1IXRC 4DUZM 2LNHC 2XGNA 4AW4A 3I4VA 2XFTA 1IBKM 3UJNA 3LVVA 1SXJC 2O5RA 4LZJA 3FKEA 1Z6TA 4M9SA 4CGYB 4D82A 1I94M 1HNWM 1NSFA 3CF0A 2BJVA 1XC8A 4L15A 2J7NA 4IBEA 3DZDA 4M9ZA 4FWHA 2R18A 1H6UA 4IBFA 2XH9A 1HR0M 4OW0A 4R7GA 1N77A 4TUWA 1MX0A 1OJLA 3J7AS 4JYAM 2LH0A 3GPPA 1YSYA 4BLCA 2M60A 4NRWA 5EXPA 4LF9M 4DUYM 5KPZA 3SHGB 3L28A 2DZOB 3SAUA 3VKGA 1TH4A 1N32M 3M0EA 1IXSB 2FFJA 2R4JA 3J7BA 4QHSA 2VIIA 2DWNA 3K92A 4B3MM 2Z4RA 4NXMM 2LXEA 3GLFA 3RGSA 2K47A 4DR5M 4DR4M 4K0KM 4RF0A 4ZPXA 3EIEA 4LJ4A 1R2ZA 4PD2A 4PCZA 1PJIA 5KQDA 4EIWA 3HKPA 1OFIA 2C96A 3L26A 4JI3M 3FTEA 1SXJE 3U61B 3L25A 7CATA 4QOZC 3NBIA 1IM2A 1NNJA 3J80S 2KXEA 1QVRA 5EP2A 2XLJA 1K3XA 3T1HM 1L1ZA 3TWLA 8CATA 2ZM6M 1DGFA 1HQYE 5KO3A 3U5ZA 1JR3A 4IBCA 4AKGA 2QBYB 3DFZA 5LMNM 1YE9A 3U60A 2AHMA 2UUBM 3TQSA 1NY6A 1HNXM 4LGMA 3FUXA 2XZUA 3T15A 4B08A 4LRSA 3W0LB 5FSWA 3SATA 3SYKA 1JR3D 1W5SA 3GRYA 2OQ4A 1YUBA 2ZBKB 4XGIA 4LJAA 3TPZA 1J09A 4LFBM 1KFVA 3GQ3A 1NHWC 3VFDA 3KS4A 5ITQA 2L7IA 1TGUA 3J27B 3U5ZB 3KOYE 2KRUA 4XBOA 4LF7M 3SASA 3DOAA 4NRVA 4JI0M 4X65M 3PNVA 4LG2A 3K8ZA 4OX9M 3SAWA 2QZ4A 1NVMA 2CHQA 2R45A 3K1JA 5E6JA 1G8PA 1T3TA 1DGHB 3I51A 2RKOA 1GVNA 3FUUA 3M6AA 2EUCA 4A3VB 5JI2E 4NOOB 1IY1A 3GRUA 1D2NA 1R2YA 1WXQA 3HU1A 3I4YA 4LZZA 4G4RA 5IWAM 4DV2M 2XF3A 4B7FA 2CV1A 4MB7A 5IREB 2VQFM 4JI4M 3TE6A 1NJFA 4D81A 1J7KA 4GKJM 5C1BA 5EXTA 1E32A 4Z6YA 3U6PA 2DXIA 2DWMA 4B3RM 2XSZA 2ZAOA 4IBKA 5BR8M 1ZQ9A 3JR5A 4IBGA 2X49A 3UK6A 4I81A 4LF6M 3U60B 3FTFA 2H1RA 4X66M 4BB9A 1L2DA 5ITTA 3HHZA 3J2PB 4JI5M 3LMMA 3UZUA 4I4LA 3GLHA 4GHLA 4LY6A 3AJIB 4LJ6A 4G4OA 1IY0A 1DGGA 4RF1A 3A45A 4AG5A 4DV1M 1HT1E 3VDPA 4OU7A 3RE8A 4LF5M 2F4VM 3HWSA 3AFHA 3SC3A 3GLIA 4L4UA 4JV5M 4S12A 3BOSA 3MK6A 4MGKE 4DV4M 3R9XB 1W5TA 2Y20A 3IG5A 3T1YM 4LFAM 1K82A 2RGHA 4FCWA 2NQ8C 4QOSA 3W0FA 4X62M 4QNRA 4YY3M 4W5WA 2XZFA 2G5GX 2BJWA 2A5YB 1XHBA 4LJ7A 2KW0A 4G4QA 1IN5A 5H37D 2Z7JA 3QWLA 3GO8A 1DO0A 2DHRA 3L29A 3HHWA 4DV6M 1L2BA 3SARA 1NY5A 4Z8XA 4KO8A 1GL7A 1XXHA 3IG8A 5ITXA 2KEBA 4LGYA 1SXJD 4R3DA 1Z5CA 1EE8A 5ITXE 4LRTA 1IY2A 5EP3A 3AOEA 2BNKA 4KODA 1QZMA 3GPYA 4G4NA 4WW0A 3U6SA 3GRVA 1IBMM 1Z5AA 4AQYM 3LQQA 2UXBM 2DZNB 3AKZA 2D7HA 3GPXA 1QYRA 3VK8A 4KHPM 4LJ5A 1E9RA 2X4AA 3ZH9B 2QPAA 3WHKA 2UUAM 4AI6A 1ZAEA 4PDGA 3VKHA 1KSFX 3GLFB 1TDHA 1QAMA 2FE8A 3U61A 3U6LA 4GIPA 4KLNA 1G3IA 1GKIA 1Q39A 5GKNA 3UGJA 1Z59A 2G8LA 1XNQM 1ORYB 4JI6M 2M5ZA 5DYGA 2F5OA 4FCTA 3VDUA 1NNUC 2C9OA 5E26A 5ITUA 1IQPA 3KXEC 5KPRA 2F5QA 1HNZM 4GHAA 4LCBA 2OPFA 2QP9X 4BBAA 1OFHA 3HJSA 3ILKA 3RGPA 1XNRM 1UM8A 4IBBA 1N78A 3KS8A 2RGOA 2CV0A 1FNNA 1FJGM 1SXJB 1IN4A 1QAQA 2UXCM 2L09A 3SMPA 5FTMA 5FTNA 2ZANA 1IN7A 1S3SA 5EQTA 1N33M 1G41A 1R7RA 2CEAA 5EXXA 3LVWA 1C1KA 4DR2M 3GQ4A 4II7A 3PXGA 4DR3M 2ZAMA 3HU2A 2R62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4O A;  3SAU A;  3TWK A;  3A45 A;  1N32 M;  4DV1 M;  2UXD M;  3A46 A;  3JR4 A;  4B3M M;  2F5N A;  4LF5 M;  4NXM M;  2F4V M;  4JV5 M;  2Q2E B;  4DR5 M;  3U6E A;  4DR4 M;  4K0K M;  1R2Z A;  4DV4 M;  4PD2 A;  4PCZ A;  1PJI A;  3T1Y M;  4LFA M;  1K82 A;  3W0F A;  4X62 M;  3U6M A;  2F5S A;  4B3S M;  4YY3 M;  4ITQ A;  4JI3 M;  3C58 A;  2XZF A;  1PJJ A;  4G4Q A;  4GKK M;  4NXN M;  5A2Q S;  3GQ5 A;  3GO8 A;  4DV6 M;  1L2B A;  1NNJ A;  1L1T A;  2HHH M;  3SAR A;  4LF8 M;  3J80 S;  1N36 M;  5ITX A;  1K3X A;  1J5E M;  3U6O A;  3T1H M;  1L1Z A;  4DR7 M;  1IBL M;  3GPU A;  3TWL A;  1Z5C A;  1EE8 A;  1Q3C A;  2ZM6 M;  3GP1 A;  5ITX E;  5LMN M;  3GPY A;  4G4N A;  2HKJ A;  3U6S A;  2EA0 A;  2UUB M;  1HNX M;  3U6C A;  1Z5A A;  1IBM M;  4AQY M;  3J81 S;  2XZU A;  4DV3 M;  2UXB M;  3SAV A;  3GPX A;  3VK8 A;  4JI2 M;  3OTO M;  4KHP M;  3SAT A;  4CIS A;  3U6D A;  4X64 M;  4DV5 M;  2UUA M;  4DV0 M;  4JI1 M;  2OQ4 A;  4PDG A;  2ZBK B;  1TDH A;  2UU9 M;  3U6Q A;  4JI8 M;  3U6L A;  5FLX S;  4LFB M;  1Q39 A;  3GQ3 A;  1KFV A;  5ITQ A;  4DR6 M;  3VK7 A;  1Z59 A;  5ITY A;  1XNQ M;  1L2C A;  1TDZ A;  4LF7 M;  1Q3B A;  3SAS A;  3DOA A;  4NRV A;  4JI0 M;  4X65 M;  2VQE M;  4DV7 M;  3JAM S;  4JI6 M;  4OX9 M;  4YHH M;  3SAW A;  2F5O A;  4JI7 M;  4DR1 M;  4LF4 M;  4DUZ M;  5IT9 S;  5ITU A;  2F5Q A;  1HNZ M;  2OPF A;  1K3W A;  1IBK M;  1R2Y A;  4G4R A;  5IWA M;  3A42 A;  1N34 M;  1XNR M;  4DV2 M;  5LMU M;  1HNW M;  1I94 M;  1FJG M;  5ITR A;  4MB7 A;  4JI4 M;  2VQF M;  1XC8 A;  2UXC M;  1XMO M;  3U6P A;  1MU5 A;  4B3T M;  1HR0 M;  5BR8 M;  4B3R M;  3JR5 A;  1N33 M;  2UUC M;  4LFC M;  1MX0 A;  1PM5 A;  3J7A S;  1Z5B A;  2E5L M;  3GPP A;  4JYA M;  1XMQ M;  4LF6 M;  4NRW A;  4PDI A;  4DR2 M;  4X66 M;  4LF9 M;  4DUY M;  1L2D A;  5ITT A;  3TWM A;  3GQ4 A;  4JI5 M;  4DR3 M;  2F5P A;  3SBJ A;  4GKJ M; 
#chains in the Genus database with same CATH topology
 3AOE C;  1DV0 A;  2WSE F;  1DGH A;  1E9S A;  4FD2 A;  2HWJ A;  3HY5 A;  2UXD M;  1NHG C;  5C18 A;  3A46 A;  1TH3 A;  3KSJ A;  3MJ5 A;  4GMQ A;  3SYL A;  3JR4 A;  1L8Q A;  3FE3 A;  2C99 A;  4NC6 A;  5F3W A;  4L8R C;  1PGY A;  4IJE A;  1ZMV A;  1I4W A;  2RRU A;  3E4R A;  1KYI A;  1YLA A;  3IHP A;  3T6P A;  1QUT A;  1WHC A;  2I7P A;  4JN6 A;  1N75 A;  4IBJ A;  2Z3X A;  2C5R A;  1OKS A;  1DO2 A;  4LJ8 A;  4GH9 A;  4IBI A;  1NJG A;  5DYI A;  1LV7 A;  2Z4S A;  2QCU A;  2D7E A;  2DI0 A;  1JQJ C;  2HL7 A;  3ZC7 B;  1T43 A;  1R5L A;  4NXN M;  3KP0 E;  5A2Q S;  2JY6 B;  2FOI C;  4I5S A;  1L1T A;  4GC5 A;  2HHH M;  2QQ8 A;  4IBD A;  3FUT A;  3HU2 A;  1N36 M;  4FWG A;  4I8O A;  3V76 A;  3GLG B;  3PNY A;  3U6O A;  1J5E M;  4DR7 M;  5EXS A;  1R6B X;  2JY7 A;  3FUW A;  1QQW A;  3GP1 A;  4AKI A;  3KOW E;  5EJC A;  2CV2 A;  1VDD A;  3KW6 A;  3MMP A;  3MHV C;  5FTJ A;  2HKJ A;  2P5T A;  4MGY E;  2CHV A;  3GLH B;  3J81 S;  5FTK A;  2KZS A;  3AOG A;  3B74 A;  4MM3 B;  1V92 A;  4D80 A;  2OO9 A;  3FD9 A;  3HJQ A;  4CHT B;  4GC9 A;  2V1U A;  3U6D A;  4X64 M;  4DV5 M;  3VLF B;  4WUR A;  2UU9 M;  2LVP C;  2EKF A;  2YQZ A;  4FW9 A;  5FLX S;  2DKL A;  1HT2 E;  3WHL A;  5BPV A;  4DR6 M;  2MRO B;  2QBY A;  5ITY A;  2KHH A;  2CFO A;  2KDL A;  3KOZ E;  3L27 A;  2VF8 A;  3ZCB B;  1TDZ A;  1Q3B A;  4IJF A;  4QHT A;  3K9O A;  2HCB A;  3K2L A;  3K9P A;  2DAK A;  3JAM S;  2XFS A;  4FVM A;  1V33 A;  4FWD A;  3CF6 E;  3D8L A;  1PJT A;  3E9S A;  3FTC A;  4GEW A;  2W82 A;  2CE7 A;  4LF4 M;  5IT9 S;  1G59 A;  3NBX X;  1K3W A;  4IIW A;  2LWX A;  3HX3 A;  4GIT A;  2DAI A;  1CUK A;  3A42 A;  1N34 M;  3AL0 C;  3KFU G;  4NL4 H;  1VQ1 A;  1OIP A;  5LMU M;  1IXZ A;  5ITR A;  2MH8 A;  2GQF A;  2R46 A;  2JY5 A;  2YNM D;  1XMO M;  1X37 A;  3KSX A;  1MU5 A;  3Q8X A;  4B3T M;  3M7G A;  5EP1 A;  1D0K A;  2FS1 A;  4JXJ A;  4UN2 B;  1QDR A;  2UUC M;  3GLI B;  4LFC M;  1PM5 A;  1Z5B A;  3E46 A;  1E94 E;  5IZ7 D;  1XMQ M;  2E5L M;  3FYD A;  4R71 A;  4HLQ A;  4PDI A;  1XXH E;  1IN6 A;  2CUZ A;  2Y0Q A;  2Y21 A;  3TWM A;  2WZJ A;  2V1C A;  4NSR A;  2F5P A;  4M0D A;  3SBJ A;  2EKK A;  3KP1 E;  2L6O A;  1DGB A;  3TWK A;  3QYE A;  4AKH A;  1T6O A;  5KPT A;  2F5N A;  3R8F A;  2ERC A;  2L4F A;  1AIP C;  1GL6 A;  1SXJ A;  1PRB A;  3LQR A;  2LBC A;  2R65 A;  3D8B A;  3KOX E;  3QAU A;  4G6Z A;  1XXH B;  2Q2E B;  3U6E A;  2QSF X;  4B7G A;  2YFQ A;  3HJ8 A;  3SMS A;  5FTL A;  3GLI E;  1TR8 A;  5KQ8 A;  2D7G A;  4M0W A;  2QHO B;  3FTD A;  3UMM A;  1TH2 A;  4MGZ E;  3U6M A;  3SFZ A;  2F5S A;  4B3S M;  3A98 B;  4ITQ A;  2CWB A;  1QUS A;  1D0L A;  1WIV A;  2DWZ B;  3C58 A;  4F2L A;  2JA2 A;  3B7Z A;  4MH0 E;  4OVZ B;  4REZ A;  1PJJ A;  3FYC A;  2Y0T A;  3HHY A;  2C98 A;  2DEN A;  4GKK M;  3PFI A;  2YR0 A;  2K9D A;  3LW5 F;  1VEG A;  4MGH A;  3GQ5 A;  3PVS A;  2DVW B;  3B9P A;  3W68 A;  1G4A E;  4LF8 M;  1PJS A;  3GRR A;  2R4E A;  2C9C A;  1IN8 A;  1QAN A;  4RNA A;  2J7O A;  1IBL M;  4NSO B;  2CRU A;  1A5T A;  4HL4 A;  1Q3C A;  3GPU A;  3TL4 X;  1TF0 B;  4PT5 A;  3HU3 A;  4QNM A;  2KRK A;  3HHX A;  4L16 A;  4LJ9 A;  1HQC A;  2JXN A;  4M9X A;  3CTW B;  3RFW A;  4CIZ A;  2EA0 A;  4MGI E;  2DAG A;  4B7H A;  3U6C A;  5JI3 E;  4DV3 M;  3SAV A;  3H4M A;  4OVZ A;  4JI2 M;  3OTO M;  4AG6 A;  3IEC A;  3THG A;  3C3E A;  1WR1 B;  2DWL A;  3E21 A;  3NWL A;  3L2A A;  4CIS A;  3HGI A;  1XWI A;  2MGW A;  3DA1 A;  4DV0 M;  4JI1 M;  1GLN A;  3EIH A;  4RKU F;  2X8A A;  1QAO A;  3CF2 A;  2QEN A;  5EP4 A;  2XSZ D;  1VEJ A;  2DHY A;  2V6Z M;  2KA6 B;  3KVW A;  4FCV A;  3U6Q A;  4JI8 M;  3T38 A;  2KZU A;  4P16 A;  3AV0 A;  3SHF A;  2I7N A;  3VK7 A;  2L7H A;  3FUV A;  2FNA A;  1L2C A;  4AZF A;  3KDS E;  1VEK A;  1OAO C;  2CHG A;  2EO2 A;  2VDB B;  2XEP A;  2VQE M;  4DV7 M;  5DNY A;  4YHH M;  4L78 A;  2N35 A;  3GLG A;  2Z8Y M;  3F92 A;  2O25 A;  1OAI A;  4GRI A;  4JI7 M;  4DR1 M;  1IXR C;  4DUZ M;  2LNH C;  2XGN A;  3GLG E;  4AW4 A;  1XB2 B;  2MJ5 B;  1Y8G A;  3I4V A;  1IFY A;  2XFT A;  1IBK M;  3UJN A;  2KNZ A;  1SXJ C;  3LVV A;  2JY8 A;  2O5R A;  4LZJ A;  3FKE A;  1EIJ A;  3LCU A;  1Z6T A;  3B7N A;  4M9S A;  4CGY B;  4D82 A;  1I94 M;  1HNW M;  1NSF A;  3CF0 A;  2BJV A;  1XC8 A;  4L15 A;  2J7N A;  4IBE A;  3DZD A;  4M9Z A;  1RU3 A;  2R18 A;  1H6U A;  4FWH A;  4IBF A;  2XH9 A;  1HR0 M;  4OW0 A;  2G3Q A;  4R7G A;  1N77 A;  2GNO A;  4TUW A;  1MX0 A;  1OJL A;  3J7A S;  4JYA M;  2LH0 A;  3GPP A;  1YSY A;  4BLC A;  2M60 A;  3B89 A;  4NRW A;  5EXP A;  4XK8 F;  4LF9 M;  4DUY M;  1GJS A;  2K6B A;  5KPZ A;  3SHG B;  1P3Q Q;  2QNJ A;  3L28 A;  3Q8G A;  2DZO B;  2R44 A;  3SAU A;  3VKG A;  1TH4 A;  1N32 M;  3M0E A;  3LCV B;  1C7Y A;  1IXS B;  2FFJ A;  2R4J A;  3J7B A;  1ZMU A;  4HEO A;  4QHS A;  2VII A;  2DWN A;  3K92 A;  4B3M M;  2Z4R A;  4NXM M;  2ZTD A;  2LXE A;  3GLF A;  2J5Y A;  3RGS A;  1JB0 F;  2LVN C;  2K47 A;  4DR5 M;  4DR4 M;  5DFL A;  4K0K M;  4RF0 A;  4ZPX A;  3EIE A;  4LJ4 A;  1R2Z A;  4PD2 A;  4PCZ A;  1PJI A;  1BVS A;  2JZ1 A;  5KQD A;  2OOB A;  1OIZ A;  3HKP A;  2BWB A;  1OFI A;  2C96 A;  4EIW A;  3L26 A;  4JI3 M;  3FTE A;  1SXJ E;  2WSF F;  3U61 B;  1F4I A;  3CGW A;  3L25 A;  2LTU A;  2LVA A;  7CAT A;  4CJ6 A;  4QOZ C;  1LTM A;  2H5X A;  3NBI A;  4G3O A;  1IM2 A;  1NNJ A;  3J80 S;  1NO1 A;  2KXE A;  1QVR A;  5EP2 A;  2XLJ A;  1K3X A;  3T1H M;  1L1Z A;  1R4G A;  3TWL A;  8CAT A;  1DGF A;  1HQY E;  5KO3 A;  2ZM6 M;  3U5Z A;  1JR3 A;  2JUJ A;  1UFZ A;  4IBC A;  2QBY B;  4AKG A;  3DFZ A;  5LMN M;  1YE9 A;  3U60 A;  1VDL A;  2AHM A;  2UUB M;  3TQS A;  1NY6 A;  1HNX M;  4LGM A;  3FUX A;  2XZU A;  3T15 A;  4B08 A;  4LRS A;  3W0L B;  1D0M A;  5FSW A;  3SAT A;  1WGN A;  3C9P A;  3SYK A;  1JR3 D;  1W5S A;  3GRY A;  1PJQ A;  2OQ4 A;  1OTR A;  1TTE A;  1YUB A;  2ZBK B;  4XGI A;  4LJA A;  2LHC A;  3TPZ A;  1J09 A;  4LFB M;  1KFV A;  3GQ3 A;  1NHW C;  2DAM A;  3KS4 A;  3VFD A;  5ITQ A;  2HAK A;  2L7I A;  1EFU B;  1TGU A;  3J27 B;  3KOY E;  2KRU A;  4XBO A;  4DBG B;  3U5Z B;  4LF7 M;  3SAS A;  3DOA A;  4NRV A;  4JI0 M;  4X65 M;  3PNV A;  4LG2 A;  3K8Z A;  4OX9 M;  3SAW A;  2QZ4 A;  1NVM A;  2CHQ A;  2R45 A;  3K1J A;  5E6J A;  1G8P A;  1T3T A;  1DGH B;  2RKO A;  3I51 A;  3FUU A;  2CP8 A;  3M6A A;  4L6V 6;  2EUC A;  4A3V B;  5JI2 E;  4NOO B;  1IY1 A;  3GRU A;  1D2N A;  3W67 A;  1R2Y A;  2L4E A;  1WXQ A;  1MN3 A;  3HU1 A;  3I4Y A;  4LZZ A;  4G4R A;  5IWA M;  4DV2 M;  2XF3 A;  2LVQ D;  4B7F A;  2CV1 A;  2R0I A;  1GO5 A;  4MB7 A;  5IRE B;  2VQF M;  4JI4 M;  1JR3 E;  1OQY A;  1NJF A;  3TE6 A;  1J7K A;  4D81 A;  5C1B A;  3GLH E;  3FRI A;  5EXT A;  4GKJ M;  1SG9 A;  1E32 A;  4Z6Y A;  3U6P A;  2DXI A;  2DWM A;  4B3R M;  2XSZ A;  2ZAO A;  1IXS A;  4IBK A;  1ZQ9 A;  5BR8 M;  3JR5 A;  4IBG A;  2X49 A;  3UK6 A;  3I01 M;  4I81 A;  1V34 A;  4LF6 M;  3U60 B;  3FTF A;  2H1R A;  4X66 M;  4BB9 A;  1L2D A;  5ITT A;  2VF7 A;  3J2P B;  3HHZ A;  4JI5 M;  3LMM A;  3UZU A;  4I4L A;  3GLH A;  4GHL A;  4LY6 A;  3AJI B;  4LJ6 A;  4G4O A;  1IY0 A;  1DGG A;  4RF1 A;  3A45 A;  4AG5 A;  4DV1 M;  1HT1 E;  3VDP A;  2LVO C;  4OU7 A;  4F1I A;  3RE8 A;  4LF5 M;  2F4V M;  3HWS A;  3AFH A;  1GJT A;  2JNH A;  2JP7 A;  4L4U A;  3SC3 A;  4ANR A;  2O01 F;  3GLI A;  4JV5 M;  4S12 A;  3BOS A;  3MK6 A;  4WP2 A;  4MGK E;  4DV4 M;  2KNA A;  3R9X B;  1W5T A;  2Y20 A;  3IG5 A;  3T1Y M;  4LFA M;  1K82 A;  2RGH A;  4FCW A;  2NQ8 C;  4QOS A;  3W0F A;  4X62 M;  1G71 A;  1WGL A;  4QNR A;  4W5W A;  1NV8 A;  4YY3 M;  2R6F A;  2XZF A;  2G5G X;  2BJW A;  2L2D A;  2A5Y B;  1XHB A;  4LJ7 A;  2KW0 A;  4G4Q A;  1IN5 A;  5H37 D;  2Z7J A;  2KNV A;  3QWL A;  3H4J A;  3ZQJ A;  3GO8 A;  1DO0 A;  2DHR A;  3L29 A;  3HHW A;  5L8R F;  4DV6 M;  1L2B A;  1NY5 A;  4Z8X A;  2DNA A;  4KO8 A;  4P17 A;  3SAR A;  4KT0 F;  1GL7 A;  1XXH A;  2OOA A;  3IG8 A;  5ITX A;  1NV9 A;  2KEB A;  4LGY A;  1SXJ D;  2DZL A;  4R3D A;  1AUA A;  1Z5C A;  1EE8 A;  5ITX E;  4LRT A;  1IY2 A;  5EP3 A;  3AOE A;  2BNK A;  2MR9 A;  4KOD A;  1QZM A;  3GPY A;  4G4N A;  4WW0 A;  1ZV1 A;  3U6S A;  3GRV A;  3FRH A;  1IBM M;  1Z5A A;  4AQY M;  2LHG A;  3LQQ A;  1Q02 A;  2UXB M;  2DZN B;  3AKZ A;  2D7H A;  3QYB A;  1QYR A;  3GPX A;  3VK8 A;  4KHP M;  1HJP A;  4LJ5 A;  1QZE A;  1E9R A;  2X4A A;  3ZH9 B;  2QPA A;  3WHK A;  2UUA M;  4AI6 A;  1ZAE A;  4PDG A;  1ZMW A;  1KSF X;  2WSC F;  3VKH A;  3GLF B;  1QDT A;  1TDH A;  2B3T A;  1QAM A;  2FE8 A;  3U61 A;  3U6L A;  4GIP A;  4KLN A;  1G3I A;  1GKI A;  1Q39 A;  4Y28 F;  5GKN A;  3UGJ A;  1Z59 A;  2G8L A;  1XNQ M;  1ORY B;  3HZJ A;  1MJG M;  2EJS A;  4JI6 M;  2M5Z A;  5DYG A;  2F5O A;  2JZ0 A;  4FCT A;  3BBZ A;  3VDU A;  1NNU C;  1WJ7 A;  2C9O A;  1VG5 A;  5E26 A;  1IQP A;  5ITU A;  3KXE C;  5KPR A;  2F5Q A;  1HNZ M;  4GHA A;  4LCB A;  2OPF A;  4Q7J A;  3GLF E;  2QP9 X;  2ZTC A;  3C3D A;  4BBA A;  1OFH A;  3HJS A;  2K0B X;  3BXW A;  3ILK A;  1UM8 A;  4IBB A;  3RGP A;  1XNR M;  3KS8 A;  1N78 A;  1GAB A;  2RGO A;  2CV0 A;  1FNN A;  1FJG M;  1SXJ B;  1IN4 A;  1QAQ A;  3B7Q A;  2UXC M;  2L09 A;  3SMP A;  2APL A;  5FTM A;  5FTN A;  2ZAN A;  1IN7 A;  1S3S A;  5EQT A;  1N33 M;  1G41 A;  1R7R A;  3I04 M;  2CEA A;  5EXX A;  2BWE A;  3LVW A;  1C1K A;  2DAE A;  2FH0 A;  4DR2 M;  3GQ4 A;  4II7 A;  3PXG A;  4DR3 M;  2JWS A;  2ZAM A;  1GVN A;  2R62 A; 
#chains in the Genus database with same CATH homology
 3AOE C;  4FD2 A;  1DGH A;  1E9S A;  2UXD M;  1NHG C;  5C18 A;  3A46 A;  1TH3 A;  3KSJ A;  3MJ5 A;  4GMQ A;  3SYL A;  3JR4 A;  1L8Q A;  2C99 A;  5F3W A;  4L8R C;  4IJE A;  1I4W A;  3E4R A;  1KYI A;  2I7P A;  4JN6 A;  1N75 A;  4IBJ A;  2Z3X A;  2C5R A;  1DO2 A;  4LJ8 A;  4GH9 A;  4IBI A;  1NJG A;  5DYI A;  1LV7 A;  2Z4S A;  2QCU A;  2D7E A;  1JQJ C;  2HL7 A;  3ZC7 B;  4NXN M;  3KP0 E;  5A2Q S;  2FOI C;  4I5S A;  1L1T A;  4GC5 A;  2HHH M;  4IBD A;  3FUT A;  1N36 M;  4FWG A;  4I8O A;  3GLG B;  3PNY A;  3U6O A;  1J5E M;  4DR7 M;  5EXS A;  1R6B X;  3FUW A;  1QQW A;  3GP1 A;  4AKI A;  3KOW E;  5EJC A;  2CV2 A;  1VDD A;  3KW6 A;  3MHV C;  5FTJ A;  2HKJ A;  2P5T A;  4MGY E;  2CHV A;  3GLH B;  3J81 S;  5FTK A;  2KZS A;  3AOG A;  4MM3 B;  4D80 A;  3FD9 A;  3HJQ A;  4CHT B;  4GC9 A;  2V1U A;  3U6D A;  4X64 M;  4DV5 M;  3VLF B;  4WUR A;  2UU9 M;  2YQZ A;  4FW9 A;  5FLX S;  1HT2 E;  3WHL A;  5BPV A;  4DR6 M;  2QBY A;  5ITY A;  2CFO A;  3KOZ E;  3L27 A;  1TDZ A;  3ZCB B;  1Q3B A;  4IJF A;  4QHT A;  2HCB A;  3K2L A;  3JAM S;  2XFS A;  4FVM A;  4FWD A;  3CF6 E;  3D8L A;  3E9S A;  3FTC A;  2W82 A;  2CE7 A;  4LF4 M;  5IT9 S;  1G59 A;  1K3W A;  4IIW A;  2LWX A;  4GIT A;  3A42 A;  1N34 M;  3AL0 C;  3KFU G;  4NL4 H;  5LMU M;  1IXZ A;  5ITR A;  2R46 A;  2YNM D;  1XMO M;  1X37 A;  3KSX A;  1MU5 A;  3Q8X A;  4B3T M;  3M7G A;  5EP1 A;  4JXJ A;  2UUC M;  3GLI B;  4LFC M;  1PM5 A;  1Z5B A;  5IZ7 D;  1E94 E;  2E5L M;  1XMQ M;  3FYD A;  4HLQ A;  4PDI A;  1IN6 A;  2CUZ A;  2Y0Q A;  2Y21 A;  3TWM A;  2V1C A;  4NSR A;  2F5P A;  4M0D A;  3SBJ A;  3KP1 E;  2L6O A;  1DGB A;  3TWK A;  4AKH A;  5KPT A;  2F5N A;  3R8F A;  2ERC A;  1GL6 A;  1SXJ A;  3LQR A;  2R65 A;  3D8B A;  3KOX E;  3QAU A;  4G6Z A;  1XXH B;  2Q2E B;  3U6E A;  4B7G A;  2YFQ A;  3HJ8 A;  3SMS A;  5FTL A;  5KQ8 A;  2D7G A;  4M0W A;  3FTD A;  3UMM A;  1TH2 A;  4MGZ E;  3U6M A;  3SFZ A;  2F5S A;  4B3S M;  3A98 B;  4ITQ A;  2DWZ B;  3C58 A;  2JA2 A;  1PJJ A;  4MH0 E;  4OVZ B;  4REZ A;  3FYC A;  2Y0T A;  3HHY A;  2C98 A;  4GKK M;  3PFI A;  2YR0 A;  3GQ5 A;  4MGH A;  3PVS A;  2DVW B;  3B9P A;  4LF8 M;  1G4A E;  3GRR A;  2R4E A;  2C9C A;  1IN8 A;  1QAN A;  4RNA A;  2J7O A;  1IBL M;  4NSO B;  3GPU A;  4HL4 A;  1Q3C A;  3TL4 X;  4PT5 A;  3HU3 A;  4QNM A;  2KRK A;  3HHX A;  4L16 A;  4LJ9 A;  1HQC A;  4M9X A;  3CTW B;  3RFW A;  2EA0 A;  4MGI E;  4B7H A;  3U6C A;  5JI3 E;  4DV3 M;  3SAV A;  3H4M A;  4OVZ A;  4JI2 M;  3OTO M;  4AG6 A;  3THG A;  2DWL A;  3NWL A;  3L2A A;  4CIS A;  3HGI A;  1XWI A;  3DA1 A;  4DV0 M;  4JI1 M;  1GLN A;  3EIH A;  2X8A A;  1QAO A;  3CF2 A;  2QEN A;  5EP4 A;  2XSZ D;  2V6Z M;  3KVW A;  4FCV A;  2KA6 B;  3U6Q A;  4JI8 M;  3T38 A;  2KZU A;  4P16 A;  3AV0 A;  3SHF A;  2I7N A;  3VK7 A;  2L7H A;  3FUV A;  2FNA A;  1L2C A;  4AZF A;  3KDS E;  2CHG A;  2EO2 A;  2VQE M;  2XEP A;  4DV7 M;  5DNY A;  4YHH M;  4L78 A;  3GLG A;  4GRI A;  4JI7 M;  4DR1 M;  1IXR C;  4DUZ M;  2LNH C;  2XGN A;  4AW4 A;  3I4V A;  2XFT A;  1IBK M;  3UJN A;  3LVV A;  1SXJ C;  2O5R A;  4LZJ A;  3FKE A;  1Z6T A;  4M9S A;  4CGY B;  4D82 A;  1I94 M;  1HNW M;  1NSF A;  3CF0 A;  2BJV A;  1XC8 A;  4L15 A;  2J7N A;  4IBE A;  3DZD A;  4M9Z A;  4FWH A;  2R18 A;  1H6U A;  4IBF A;  2XH9 A;  1HR0 M;  4OW0 A;  4R7G A;  1N77 A;  4TUW A;  1MX0 A;  1OJL A;  3J7A S;  4JYA M;  2LH0 A;  3GPP A;  1YSY A;  4BLC A;  2M60 A;  4NRW A;  5EXP A;  4LF9 M;  4DUY M;  5KPZ A;  3SHG B;  3L28 A;  2DZO B;  3SAU A;  3VKG A;  1TH4 A;  1N32 M;  3M0E A;  1IXS B;  2FFJ A;  2R4J A;  3J7B A;  4QHS A;  2VII A;  2DWN A;  3K92 A;  4B3M M;  2Z4R A;  4NXM M;  2LXE A;  3GLF A;  3RGS A;  2K47 A;  4DR5 M;  4DR4 M;  4K0K M;  4RF0 A;  4ZPX A;  3EIE A;  4LJ4 A;  1R2Z A;  4PD2 A;  4PCZ A;  1PJI A;  5KQD A;  4EIW A;  3HKP A;  1OFI A;  2C96 A;  3L26 A;  4JI3 M;  3FTE A;  1SXJ E;  3U61 B;  3L25 A;  7CAT A;  4QOZ C;  3NBI A;  1IM2 A;  1NNJ A;  3J80 S;  2KXE A;  1QVR A;  5EP2 A;  2XLJ A;  1K3X A;  3T1H M;  1L1Z A;  3TWL A;  8CAT A;  2ZM6 M;  1DGF A;  1HQY E;  5KO3 A;  3U5Z A;  1JR3 A;  4IBC A;  4AKG A;  2QBY B;  3DFZ A;  5LMN M;  1YE9 A;  3U60 A;  2AHM A;  2UUB M;  3TQS A;  1NY6 A;  1HNX M;  4LGM A;  3FUX A;  2XZU A;  3T15 A;  4B08 A;  4LRS A;  3W0L B;  5FSW A;  3SAT A;  3SYK A;  1JR3 D;  1W5S A;  3GRY A;  2OQ4 A;  1YUB A;  2ZBK B;  4XGI A;  4LJA A;  3TPZ A;  1J09 A;  4LFB M;  1KFV A;  3GQ3 A;  1NHW C;  3VFD A;  3KS4 A;  5ITQ A;  2L7I A;  1TGU A;  3J27 B;  3U5Z B;  3KOY E;  2KRU A;  4XBO A;  4LF7 M;  3SAS A;  3DOA A;  4NRV A;  4JI0 M;  4X65 M;  3PNV A;  4LG2 A;  3K8Z A;  4OX9 M;  3SAW A;  2QZ4 A;  1NVM A;  2CHQ A;  2R45 A;  3K1J A;  5E6J A;  1G8P A;  1T3T A;  1DGH B;  3I51 A;  2RKO A;  1GVN A;  3FUU A;  3M6A A;  2EUC A;  4A3V B;  5JI2 E;  4NOO B;  1IY1 A;  3GRU A;  1D2N A;  1R2Y A;  1WXQ A;  3HU1 A;  3I4Y A;  4LZZ A;  4G4R A;  5IWA M;  4DV2 M;  2XF3 A;  4B7F A;  2CV1 A;  4MB7 A;  5IRE B;  2VQF M;  4JI4 M;  3TE6 A;  1NJF A;  4D81 A;  1J7K A;  4GKJ M;  5C1B A;  5EXT A;  1E32 A;  4Z6Y A;  3U6P A;  2DXI A;  2DWM A;  4B3R M;  2XSZ A;  2ZAO A;  4IBK A;  5BR8 M;  1ZQ9 A;  3JR5 A;  4IBG A;  2X49 A;  3UK6 A;  4I81 A;  4LF6 M;  3U60 B;  3FTF A;  2H1R A;  4X66 M;  4BB9 A;  1L2D A;  5ITT A;  3HHZ A;  3J2P B;  4JI5 M;  3LMM A;  3UZU A;  4I4L A;  3GLH A;  4GHL A;  4LY6 A;  3AJI B;  4LJ6 A;  4G4O A;  1IY0 A;  1DGG A;  4RF1 A;  3A45 A;  4AG5 A;  4DV1 M;  1HT1 E;  3VDP A;  4OU7 A;  3RE8 A;  4LF5 M;  2F4V M;  3HWS A;  3AFH A;  3SC3 A;  3GLI A;  4L4U A;  4JV5 M;  4S12 A;  3BOS A;  3MK6 A;  4MGK E;  4DV4 M;  3R9X B;  1W5T A;  2Y20 A;  3IG5 A;  3T1Y M;  4LFA M;  1K82 A;  2RGH A;  4FCW A;  2NQ8 C;  4QOS A;  3W0F A;  4X62 M;  4QNR A;  4YY3 M;  4W5W A;  2XZF A;  2G5G X;  2BJW A;  2A5Y B;  1XHB A;  4LJ7 A;  2KW0 A;  4G4Q A;  1IN5 A;  5H37 D;  2Z7J A;  3QWL A;  3GO8 A;  1DO0 A;  2DHR A;  3L29 A;  3HHW A;  4DV6 M;  1L2B A;  3SAR A;  1NY5 A;  4Z8X A;  4KO8 A;  1GL7 A;  1XXH A;  3IG8 A;  5ITX A;  2KEB A;  4LGY A;  1SXJ D;  4R3D A;  1Z5C A;  1EE8 A;  5ITX E;  4LRT A;  1IY2 A;  5EP3 A;  3AOE A;  2BNK A;  4KOD A;  1QZM A;  3GPY A;  4G4N A;  4WW0 A;  3U6S A;  3GRV A;  1IBM M;  1Z5A A;  4AQY M;  3LQQ A;  2UXB M;  2DZN B;  3AKZ A;  2D7H A;  3GPX A;  1QYR A;  3VK8 A;  4KHP M;  4LJ5 A;  1E9R A;  2X4A A;  3ZH9 B;  2QPA A;  3WHK A;  2UUA M;  4AI6 A;  1ZAE A;  4PDG A;  3VKH A;  1KSF X;  3GLF B;  1TDH A;  1QAM A;  2FE8 A;  3U61 A;  3U6L A;  4GIP A;  4KLN A;  1G3I A;  1GKI A;  1Q39 A;  5GKN A;  3UGJ A;  1Z59 A;  2G8L A;  1XNQ M;  1ORY B;  4JI6 M;  2M5Z A;  5DYG A;  2F5O A;  4FCT A;  3VDU A;  1NNU C;  2C9O A;  5E26 A;  5ITU A;  1IQP A;  3KXE C;  5KPR A;  2F5Q A;  1HNZ M;  4GHA A;  4LCB A;  2OPF A;  2QP9 X;  4BBA A;  1OFH A;  3HJS A;  3ILK A;  3RGP A;  1XNR M;  1UM8 A;  4IBB A;  1N78 A;  3KS8 A;  2RGO A;  2CV0 A;  1FNN A;  1FJG M;  1SXJ B;  1IN4 A;  1QAQ A;  2UXC M;  2L09 A;  3SMP A;  5FTM A;  5FTN A;  2ZAN A;  1IN7 A;  1S3S A;  5EQT A;  1N33 M;  1G41 A;  1R7R A;  2CEA A;  5EXX A;  3LVW A;  1C1K A;  4DR2 M;  3GQ4 A;  4II7 A;  3PXG A;  4DR3 M;  2ZAM A;  3HU2 A;  2R62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...