1XNRM

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xnrM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xnrM02
3GQ4A 2VQFM 4CISA 4G4NA 1L2CA 1L2DA 3U6PA 3TWLA 3GPUA 3GPYA 2EA0A 3U6QA 3A46A 4NXNM 4DV5M 4JI4M 2F4VM 3U6CA 3GPPA 1XC8A 2UU9M 2UUCM 3W0FA 1Z5BA 5ITRA 1N34M 4LF5M 4JV5M 1MX0A 3SBJA 2F5PA 3A45A 2UXDM 4JI3M 4KHPM 3T1HM 4JI5M 4OX9M 5IT9S 3U6MA 4LF9M 4YHHM 1IBMM 5ITYA 4GKJM 1TDHA 3JR5A 4DV4M 1MU5A 2Q2EB 1Z5AA 5BR8M 1J5EM 2UXBM 1PM5A 1L2BA 4MB7A 3SAUA 3J7AS 1L1TA 4B3MM 4DV2M 5A2QS 2VQEM 4DV7M 4DR5M 2F5OA 1EE8A 3J80S 4DV0M 2XZFA 3OTOM 4NXMM 3GQ5A 2F5QA 5ITTA 4NRWA 1HR0M 1K3XA 4DV6M 3U6DA 1Q39A 4DR2M 4G4QA 3VK7A 2UUBM 1N32M 4DR6M 4DV1M 4LF4M 4PDGA 4X65M 5ITQA 2F5NA 4JI2M 3VK8A 5LMUM 1N36M 1HNWM 4DV3M 1N33M 1HNXM 4LFAM 1XMQM 3SATA 1HNZM 4LFBM 1FJGM 4DUYM 4X66M 4JI6M 4NRVA 4LFCM 3U6EA 3U6SA 3GQ3A 5ITUA 4X64M 1NNJA 1K3WA 4JI1M 4LF7M 4YY3M 3SAWA 2HKJA 4B3SM 3SAVA 1R2YA 2XZUA 4DR7M 3GPXA 4JYAM 3TWMA 3A42A 1Q3BA 5IWAM 2UXCM 4PCZA 1Z5CA 4LF8M 3DOAA 5ITXA 4DR4M 1L1ZA 2ZM6M 4PD2A 3TWKA 2OPFA 1TDZA 4PDIA 1IBKM 1R2ZA 3T1YM 4ITQA 4LF6M 4JI8M 4K0KM 3U6LA 1I94M 3GO8A 4X62M 4JI7M 4JI0M 3U6OA 4DUZM 3SASA 4B3TM 4DR1M 1Q3CA 1XNRM 3C58A 4G4OA 1K82A 1Z59A 1IBLM 2HHHM 2E5LM 1KFVA 1PJIA 4DR3M 3J81S 1XNQM 1XMOM 3SARA 1PJJA 2OQ4A 5ITXE 2F5SA 4GKKM 4G4RA 4AQYM 3JAMS 2ZBKB 5FLXS 4B3RM 2UUAM 3GP1A 5LMNM 3JR4A
chains in the Genus database with same CATH superfamily
4AZFA 2EJSA 4Z6YA 2DKLA 1K3XA 4ANRA 2LTUA 1L2DA 3U6PA 2UUAM 3GPUA 1SXJA 3KP1E 1HJPA 1NNUC 1SXJD 4NXNM 3GLGA 1IN4A 2O25A 2VDBB 2XEPA 3GPPA 2UUCM 4FW9A 4LJ9A 2KNVA 4UN2B 4GHAA 4JV5M 3FRHA 2F5PA 1DO0A 4L78A 2UXDM 5EP1A 4JI3M 3HU2A 5IT9S 4YHHM 5ITYA 4CJ6A 2Z8YM 1NHGC 1VEKA 1C7YA 1KYIA 1FNNA 5IREB 2I7NA 4HEOA 1Z5AA 4IBDA 4IIWA 4RNAA 2JZ1A 3W68A 1L2BA 1F4IA 1SXJB 4ZPXA 3J7AS 2OOBA 2LHCA 1ZAEA 3D8LA 4IJFA 5A2QS 1N75A 2B3TA 4NL4H 1TH2A 4DR5M 2Z4SA 1OIZA 3L28A 2H1RA 4MM3B 4AG5A 5C18A 5KQDA 3OTOM 3GQ5A 3M0EA 4NXMM 3HY5A 4DR2M 2KRKA 4G4QA 2G5GX 1N32M 3J7BA 3FTDA 4AW4A 3B9PA 5EJCA 1JR3D 2J7OA 3FUUA 3UGJA 3UMMA 1G59A 2QBYA 2CV0A 3GRRA 1XB2B 4GH9A 1QAOA 3KS4A 2R46A 3SFZA 2CP8A 2LVAA 1HNWM 3RFWA 1XHBA 1QUTA 1GL7A 4LFAM 4B7GA 5EP4A 7CATA 2OO9A 4QOZC 2JY7A 4I4LA 2CHVA 4F1IA 4DUYM 1S3SA 3HKPA 4IBBA 2CHGA 2ZAOA 1D0LA 4X64M 3GLIA 2L09A 3AL0C 5FTLA 2QP9X 3U5ZA 4B3SM 1NHWC 2KEBA 2XZUA 2CUZA 1QAQA 3A42A 4REZA 2WZJA 3FUTA 2ZTCA 3KOZE 1QZMA 4PCZA 2V1CA 3I4YA 1L1ZA 2DAIA 3T15A 1TDZA 2EO2A 2DWMA 3DFZA 2XFSA 1ZV1A 2QBYB 2LXEA 2VF8A 3KVWA 2L6OA 3VDUA 2DXIA 1G4AE 1XXHE 3IG5A 1TGUA 4K0KM 2KZUA 3HJ8A 4X62M 2DAEA 2KXEA 2RRUA 3U6OA 4DUZM 1N78A 5KPRA 4XBOA 5KPZA 2XH9A 3MK6A 4DR1M 3AKZA 3C58A 2G3QA 3C3EA 2HHHM 1GVNA 3FTEA 1KFVA 3KP0E 1TH4A 1PJIA 2C9CA 4LZZA 3J81S 3H4MA 2BJWA 1E32A 3J2PB 4FD2A 4MGKE 1H6UA 4G4RA 4AQYM 2DHRA 2R6FA 4AKHA 3HGIA 2CV1A 2X4AA 5LMNM 2FE8A 1WJ7A 1WR1B 3HJSA 1IN7A 3HHWA 4CISA 2KRUA 2MROB 4G4NA 1V33A 2LHGA 2RGOA 2ZANA 2M60A 1G41A 3B7QA 3TWLA 3ILKA 1X37A 3Q8XA 1OQYA 4FCWA 2VIIA 3A46A 1N77A 1GL6A 2F4VM 3L25A 4D80A 3TE6A 1ZQ9A 4JXJA 4OW0A 3U6CA 2C99A 4S12A 2APLA 2DI0A 1Z5BA 2P5TA 2MR9A 3CF0A 5ITRA 5IZ7D 1J7KA 1TTEA 2R45A 3UK6A 4MGIE 4L6V6 2YNMD 3WHLA 2L4FA 3K1JA 4Q7JA 2JA2A 3DA1A 4M9XA 3T1HM 4AG6A 4MGYE 4OVZA 1TDHA 1VQ1A 1BVSA 3WHKA 1NO1A 1MU5A 1J5EM 2JP7A 4I8OA 4MB7A 4Y28F 1ZMVA 4IJEA 3SAUA 1G3IA 3GLFB 3GLGE 1L1TA 2L4EA 5EXPA 2LH0A 4MGHA 1MN3A 2FFJA 4IBEA 3ZQJA 2Z3XA 1EIJA 1IM2A 2F5OA 1IXZA 3FTFA 2MJ5B 1IN6A 5ITTA 1ZMWA 1DGBA 4HLQA 3HHZA 1NVMA 1E9SA 3HU1A 1T3TA 5JI2E 4WURA 4NSOB 3ZCBB 4LG2A 2R4EA 3LVVA 4PT5A 3L26A 3KSJA 4PDGA 2JY5A 1HR0M 1R4GA 1GKIA 1T6OA 3VK8A 5LMUM 4OVZB 4DV3M 1Z6TA 2LVOC 1N33M 1VG5A 2DWNA 2V1UA 1LTMA 4L15A 1XMQM 1GJSA 1HNZM 4QNRA 1L8QA 4FCTA 4RF1A 3RGPA 3GLHE 2YQZA 1SG9A 1VDLA 3C3DA 3LCUA 4X66M 1IY1A 2R4JA 3AOGA 1KSFX 3U6EA 1YE9A 4LRTA 3GQ3A 5FTNA 3PXGA 3B7NA 3I01M 3W67A 4YY3M 3B74A 3SAWA 1HT2E 4II7A 4LF7M 3SYKA 4MH0E 1R2YA 1GJTA 4DR7M 4LGYA 3TWMA 1Q3BA 2QCUA 1IFYA 1WHCA 1JR3A 2LNHC 3HHXA 4L16A 5ITXA 4CHTB 2HL7A 3CTWB 1PJQA 2L7IA 2OOAA 4F2LA 1TH3A 5DNYA 5EXTA 1WXQA 1LV7A 1RU3A 4G3OA 3T1YM 4R71A 2YR0A 1OIPA 1UM8A 1MJGM 3HWSA 1A5TA 2DWZB 2GQFA 3SASA 3FTCA 4B3TM 4LJ6A 4GIPA 2X49A 3C9PA 2R18A 3NWLA 1AIPC 4G4OA 2DZLA 1J09A 1R7RA 2JY6B 2BJVA 3FYDA 2Y0QA 3AOEA 4LJ8A 4R3DA 3GLIE 1OAOC 3MJ5A 1XNQM 2BWEA 3PNYA 3QWLA 5EP2A 5C1BA 2LBCA 2R62A 1XMOM 3SARA 1PJJA 4AKGA 2JUJA 2Z4RA 2ZBKB 5FLXS 2V6ZM 1IY2A 2LWXA 3B89A 2RKOA 3JR4A 4IBJA 2EKKA 2R65A 4Z8XA 3THGA 3GQ4A 5EXSA 2VQFM 1G8PA 1HQCA 1WGLA 2JNHA 1L2CA 1NY6A 1QAMA 1QYRA 2ERCA 1I4WA 4M0DA 2J7NA 3GRUA 1ORYB 2XF3A 1W5TA 3BBZA 1DGHA 3U6QA 3PVSA 3FD9A 4IBGA 2K6BA 3K9PA 4DV5M 4JI4M 4L4UA 4B3MM 1XC8A 3PFIA 4LJ4A 4M9ZA 4B08A 3U60A 2UU9M 3E46A 4QOSA 3W0FA 3VKGA 4RF0A 2NQ8C 3CF6E 1N34M 1AUAA 3KOWE 2QPAA 2DAKA 4DBGB 3K92A 4LF5M 5KQ8A 2L2DA 1OFIA 5JI3E 3D8BA 3J27B 1VEJA 3E4RA 3IG8A 4JI5M 2FS1A 1IBMM 4GKJM 3EIEA 1NJFA 3ZC7B 3JR5A 5BR8M 1QQWA 2JY8A 4KODA 3AFHA 4NOOB 3TPZA 4B7FA 2C98A 1PM5A 1PJTA 2CEAA 3QYEA 1DGHB 2LVNC 2O5RA 3SHFA 3GLFA 4DV7M 1EE8A 1YLAA 1D2NA 1VDDA 2XZFA 3U60B 2WSCF 2MH8A 5EP3A 4NRWA 4QHSA 5L8RF 1NV8A 1VEGA 2BWBA 2WSEF 2ZTDA 3AJIB 3MMPA 1Q39A 4GC9A 3HHYA 4FVMA 4B7HA 3QAUA 2UUBM 4DR6M 2KA6B 4G6ZA 5DYGA 1GO5A 4QNMA 2A5YB 3R9XB 2R0IA 4BB9A 4CGYB 3LMMA 4MGZE 2ZAMA 4X65M 2F5NA 2DAMA 1PGYA 4JI2M 4LJ7A 4AKIA 1WIVA 1N36M 3HJQA 1HNXM 4D82A 2DWLA 3KDSE 1IXSA 4LJAA 4OU7A 2CWBA 1SXJE 3I4VA 4GRIA 1QANA 4IBFA 1OTRA 1FJGM 1NV9A 4GITA 4JI6M 1DV0A 4NRVA 4LFCM 1JQJC 3VLFB 2QQ8A 1DGGA 2LVPC 3CF2A 2HKJA 5E6JA 2Y0TA 3LQQA 3SAVA 3GRVA 3GPXA 1IN8A 2CE7A 3HZJA 2VF7A 3KOYE 3FRIA 2ZM6M 4PD2A 2O01F 3TWKA 3RE8A 3UJNA 2OPFA 1D0KA 2KNAA 3GRYA 4PDIA 1IBKM 2BNKA 4RKUF 1CUKA 2D7GA 4KT0F 3TQSA 4JI8M 4KO8A 1P3QQ 2QHOB 3U6LA 2DZOB 1I94M 4LRSA 3KS8A 4JI7M 1IXSB 4WW0A 3R8FA 1IXRC 4LGMA 3FUXA 4L8RC 2DAGA 3A98B 4EIWA 4R7GA 3TL4X 1XNRM 4KLNA 1JB0F 1Z59A 2X8AA 1NJGA 1SXJC 4LCBA 4JN6A 2R44A 3E21A 3I51A 4FCVA 3K8ZA 2D7EA 4W5WA 1JR3E 1QVRA 5ITXE 1T43A 2F5SA 3VKHA 3JAMS 1W5SA 4B3RM 3PNVA 4I81A 4DV4M 1DGFA 2Y20A 4BLCA 4JI1M 1R6BX 3NBXX 4A3VB 2JXNA 2WSFF 3L27A 4WP2A 5EQTA 2QSFX 4IBCA 1EFUB 2XFTA 4FWDA 2RGHA 2C9OA 2FNAA 4LJ5A 1HT1E 2XGNA 3GPYA 3SMSA 2EA0A 3L2AA 2C5RA 3H4JA 4FWHA 3GLGB 1IN5A 3GLHA 3MHVC 1IQPA 4AI6A 1GABA 1YSYA 2LVQD 3BXWA 3IECA 2KNZA 1V92A 3BOSA 2EKFA 1MX0A 2QNJA 1DO2A 3LW5F 4GEWA 4LZJA 3SBJA 3AV0A 4LY6A 3IHPA 3KW6A 2K0BX 4IBIA 3DZDA 2QZ4A 5KPTA 1QUSA 3A45A 2Y21A 4GMQA 1D0MA 2DENA 4P16A 4QHTA 4KHPM 4OX9M 1OKSA 2L7HA 3U6MA 4LF9M 2DZNB 3L29A 3KFUG 4I5SA 4TUWA 4HL4A 5E26A 5FSWA 2Q2EB 2UXBM 2Z7JA 1TR8A 2M5ZA 2N35A 3LQRA 5FTMA 5FTKA 3FUVA 3E9SA 2HCBA 3RGSA 4DV2M 3CGWA 2AHMA 3GLHB 2DNAA 2VQEM 3J80S 2I7PA 3KSXA 4IBKA 1ZMUA 4DV0M 3U61A 1QDRA 2F5QA 3T38A 2EUCA 4P17A 4BBAA 2YFQA 3KXEC 4DV6M 3U6DA 2CFOA 2JZ0A 3AOEC 2K9DA 3VK7A 1XWIA 4M0WA 4GC5A 2HAKA 3HX3A 4DV1M 2DVWB 3VFDA 3HU3A 4LF4M 1HQYE 2DHYA 2K47A 1V34A 1OJLA 2KZSA 2W82A 2XLJA 5ITQA 2XSZA 2KW0A 3KOXE 3K2LA 4D81A 4XGIA 8CATA 3K9OA 5FTJA 1XXHA 4XK8F 5KO3A 2XSZD 3V76A 1GLNA 2QENA 3T6PA 3SATA 2CRUA 3M6AA 4LFBM 3SHGB 3GLFE 2CV2A 3ZH9B 5DFLA 3U6SA 3GLIB 5ITUA 1NNJA 1K3WA 3B7ZA 4FWGA 3U61B 3U5ZB 2JWSA 2KDLA 5F3WA 5BPVA 4JYAM 2CHQA 2FH0A 1NY5A 1IY0A 1OAIA 1PJSA 3QYBA 4NC6A 5IWAM 2UXCM 1Z5CA 1QZEA 3DOAA 4LF8M 2KHHA 1Y8GA 2MGWA 4DR4M 1OFHA 3EIHA 4NSRA 1QDTA 3SC3A 1R2ZA 3FYCA 4ITQA 4LF6M 1PRBA 3FUWA 3W0LB 1XXHB 5H37D 2C96A 1E94E 1C1KA 1YUBA 3SMPA 3GO8A 4GHLA 4JI0M 3NBIA 1G71A 1NSFA 2GNOA 5GKNA 2FOIC 3LCVB 2H5XA 3I04M 4M9SA 1Q3CA 2J5YA 2G8LA 4CIZA 1K82A 2HWJA 5EXXA 1IBLM 1UFZA 3VDPA 3LVWA 3UZUA 2E5LM 3M7GA 1E9RA 3F92A 4DR3M 5DYIA 1WGNA 3FKEA 2OQ4A 4GKKM 2D7HA 3Q8GA 1R5LA 3FE3A 1TF0B 3SYLA 1Q02A 3GP1A
chains in the Genus database with same CATH topology
4AZFA 4Z6YA 1L2DA 3U6PA 2UUAM 3GPUA 1SXJA 3KP1E 1NNUC 1SXJD 4NXNM 3GLGA 1IN4A 2XEPA 3GPPA 2UUCM 4FW9A 4LJ9A 4GHAA 4JV5M 2F5PA 1DO0A 4L78A 2UXDM 5EP1A 4JI3M 3HU2A 5IT9S 4YHHM 5ITYA 1NHGC 1KYIA 1FNNA 5IREB 2I7NA 1Z5AA 4IBDA 4IIWA 4RNAA 1L2BA 1SXJB 4ZPXA 3J7AS 3D8LA 1ZAEA 4IJFA 5A2QS 1N75A 4NL4H 1TH2A 4DR5M 2Z4SA 3L28A 2H1RA 4MM3B 4AG5A 5C18A 5KQDA 3OTOM 3GQ5A 3M0EA 4NXMM 4DR2M 2KRKA 4G4QA 2G5GX 1N32M 3J7BA 3FTDA 4AW4A 3B9PA 5EJCA 1JR3D 2J7OA 3FUUA 3UGJA 3UMMA 1G59A 2QBYA 2CV0A 3GRRA 4GH9A 1QAOA 3KS4A 2R46A 3SFZA 1HNWM 3RFWA 1XHBA 1GL7A 4LFAM 4B7GA 5EP4A 7CATA 4QOZC 4I4LA 2CHVA 4DUYM 1S3SA 3HKPA 4IBBA 2CHGA 2ZAOA 4X64M 3GLIA 2L09A 3AL0C 5FTLA 2QP9X 3U5ZA 4B3SM 1NHWC 2KEBA 2XZUA 2CUZA 1QAQA 3A42A 4REZA 3KOZE 3FUTA 4PCZA 1QZMA 2V1CA 3I4YA 1L1ZA 3T15A 1TDZA 2EO2A 2DWMA 3DFZA 2XFSA 2QBYB 2LXEA 3KVWA 2DXIA 2L6OA 3VDUA 1G4AE 3IG5A 1TGUA 4K0KM 2KZUA 3HJ8A 4X62M 2KXEA 3U6OA 1N78A 4DUZM 5KPRA 4XBOA 5KPZA 2XH9A 3MK6A 4DR1M 3AKZA 3C58A 2HHHM 1GVNA 3FTEA 1KFVA 3KP0E 1TH4A 1PJIA 2C9CA 4LZZA 3J81S 3H4MA 2BJWA 1E32A 3J2PB 4FD2A 4MGKE 1H6UA 4G4RA 4AQYM 2DHRA 4AKHA 3HGIA 2CV1A 2X4AA 5LMNM 2FE8A 3HJSA 1IN7A 3HHWA 4CISA 2KRUA 4G4NA 2RGOA 2ZANA 2M60A 1G41A 3TWLA 3ILKA 1X37A 3Q8XA 4FCWA 2VIIA 3A46A 1N77A 1GL6A 2F4VM 3L25A 4D80A 3TE6A 1ZQ9A 4JXJA 4OW0A 3U6CA 2C99A 4S12A 1Z5BA 2P5TA 3CF0A 5ITRA 5IZ7D 1J7KA 2R45A 3UK6A 4MGIE 2YNMD 3WHLA 3K1JA 2JA2A 3DA1A 4M9XA 3T1HM 4AG6A 4MGYE 4OVZA 1TDHA 3WHKA 1MU5A 1J5EM 4I8OA 4MB7A 3SAUA 4IJEA 1G3IA 3GLFB 1L1TA 4B3MM 5EXPA 2LH0A 4MGHA 2FFJA 4IBEA 2Z3XA 1IM2A 2F5OA 1IXZA 3FTFA 1IN6A 5ITTA 1DGBA 4HLQA 3HHZA 1NVMA 1E9SA 3HU1A 1T3TA 5JI2E 4WURA 4NSOB 3ZCBB 4LG2A 2R4EA 3LVVA 4PT5A 3L26A 3KSJA 4PDGA 1GKIA 3VK8A 5LMUM 4OVZB 4DV3M 1Z6TA 1N33M 2DWNA 2V1UA 4L15A 1XMQM 1HNZM 4QNRA 1L8QA 4FCTA 4RF1A 3RGPA 2YQZA 4X66M 1IY1A 2R4JA 3AOGA 1KSFX 3U6EA 1YE9A 4LRTA 3GQ3A 5FTNA 3PXGA 4LF7M 4YY3M 3SAWA 1HT2E 4II7A 3SYKA 4MH0E 1R2YA 4DR7M 4LGYA 3TWMA 1Q3BA 2QCUA 1JR3A 2LNHC 3HHXA 4L16A 5ITXA 4CHTB 2HL7A 3CTWB 2L7IA 1TH3A 5DNYA 5EXTA 1WXQA 1LV7A 3T1YM 2YR0A 1UM8A 3HWSA 2DWZB 3SASA 3FTCA 4B3TM 4LJ6A 4GIPA 2X49A 2R18A 3NWLA 4G4OA 1J09A 1R7RA 2BJVA 3FYDA 2Y0QA 3AOEA 4LJ8A 4R3DA 3MJ5A 1XNQM 3PNYA 3QWLA 5EP2A 5C1BA 1XMOM 4AKGA 2R62A 3SARA 1PJJA 2Z4RA 2ZBKB 5FLXS 2V6ZM 1IY2A 2LWXA 2RKOA 3JR4A 4IBJA 2R65A 4Z8XA 3THGA 3GQ4A 2VQFM 5EXSA 1G8PA 1HQCA 1L2CA 1NY6A 1QYRA 1QAMA 2ERCA 1I4WA 4M0DA 2J7NA 3GRUA 1ORYB 2XF3A 1W5TA 1DGHA 3U6QA 3PVSA 3FD9A 4IBGA 4DV5M 4JI4M 4L4UA 1XC8A 3PFIA 4LJ4A 4M9ZA 4B08A 3U60A 2UU9M 4QOSA 3W0FA 3VKGA 4RF0A 2NQ8C 3CF6E 1N34M 3KOWE 2QPAA 4LF5M 3K92A 5KQ8A 1OFIA 5JI3E 3D8BA 3J27B 3E4RA 3IG8A 4JI5M 1IBMM 4GKJM 3EIEA 1NJFA 3ZC7B 3JR5A 5BR8M 1QQWA 4KODA 3AFHA 4NOOB 3TPZA 4B7FA 2C98A 1PM5A 2CEAA 1DGHB 2O5RA 3SHFA 3GLFA 4DV7M 1EE8A 1D2NA 1VDDA 2XZFA 3U60B 5EP3A 4NRWA 4QHSA 1HR0M 3AJIB 4GC9A 4B7HA 1K3XA 1Q39A 3HHYA 3QAUA 2UUBM 4DR6M 2KA6B 4G6ZA 5DYGA 4QNMA 2A5YB 3R9XB 4BB9A 4CGYB 3LMMA 4MGZE 2ZAMA 4X65M 2F5NA 4JI2M 4LJ7A 4AKIA 1N36M 3HJQA 1HNXM 4D82A 2DWLA 3KDSE 4LJAA 4OU7A 1SXJE 3I4VA 4GRIA 1QANA 4IBFA 1FJGM 4GITA 4JI6M 4NRVA 4LFCM 1JQJC 3VLFB 1DGGA 3CF2A 5E6JA 2HKJA 2Y0TA 3LQQA 3SAVA 3GRVA 3GPXA 1IN8A 2CE7A 3KOYE 2ZM6M 4PD2A 3TWKA 3UJNA 3RE8A 2OPFA 4PDIA 3GRYA 1IBKM 2BNKA 2D7GA 3TQSA 4JI8M 4KO8A 3U6LA 2DZOB 1I94M 4LRSA 3KS8A 4JI7M 1IXSB 4WW0A 3R8FA 1IXRC 4LGMA 3FUXA 4L8RC 3A98B 4EIWA 4R7GA 3TL4X 1XNRM 4KLNA 1Z59A 2X8AA 1NJGA 1SXJC 4LCBA 4JN6A 3I51A 4FCVA 3K8ZA 2D7EA 4W5WA 1QVRA 5ITXE 2F5SA 3VKHA 3JAMS 1W5SA 4B3RM 3PNVA 4I81A 4DV4M 2Y20A 1DGFA 4BLCA 4JI1M 1R6BX 4A3VB 3L27A 5EQTA 4IBCA 2XFTA 4FWDA 2RGHA 2C9OA 2FNAA 4LJ5A 1HT1E 2XGNA 3GPYA 3SMSA 2EA0A 3L2AA 2C5RA 4FWHA 3GLGB 1IN5A 3GLHA 3MHVC 1IQPA 4AI6A 1YSYA 3BOSA 1MX0A 1DO2A 3SBJA 4LZJA 3AV0A 4LY6A 3KW6A 4IBIA 5KPTA 3DZDA 2QZ4A 3A45A 2Y21A 4GMQA 4P16A 4QHTA 4KHPM 4OX9M 2L7HA 3U6MA 4LF9M 2DZNB 3L29A 3KFUG 4I5SA 4TUWA 4HL4A 5E26A 5FSWA 2Q2EB 2UXBM 2Z7JA 2M5ZA 3LQRA 5FTMA 5FTKA 3FUVA 3E9SA 2HCBA 3RGSA 4DV2M 3GLHB 2AHMA 2VQEM 3J80S 2I7PA 3KSXA 4IBKA 4DV0M 3U61A 2F5QA 3T38A 2EUCA 4BBAA 2YFQA 3KXEC 4DV6M 3U6DA 2CFOA 3AOEC 3VK7A 1XWIA 4M0WA 4GC5A 4DV1M 2DVWB 3VFDA 3HU3A 4LF4M 1HQYE 2K47A 2W82A 1OJLA 2KZSA 2XLJA 5ITQA 2XSZA 2KW0A 3KOXE 3K2LA 4D81A 4XGIA 8CATA 5FTJA 1XXHA 5KO3A 2XSZD 1GLNA 2QENA 3SATA 3M6AA 4LFBM 3SHGB 2CV2A 3ZH9B 3U6SA 3GLIB 5ITUA 1NNJA 1K3WA 5F3WA 4FWGA 3U61B 3U5ZB 5BPVA 4JYAM 2CHQA 1NY5A 1IY0A 5IWAM 2UXCM 1Z5CA 4LF8M 3DOAA 4DR4M 1OFHA 3EIHA 4NSRA 3SC3A 1R2ZA 3FYCA 4ITQA 4LF6M 3FUWA 3W0LB 1XXHB 5H37D 2C96A 1E94E 1C1KA 1YUBA 3SMPA 3GO8A 4GHLA 4JI0M 3NBIA 1NSFA 5GKNA 2FOIC 4M9SA 1Q3CA 2G8LA 1K82A 5EXXA 1IBLM 3VDPA 3LVWA 3UZUA 2E5LM 3M7GA 1E9RA 4DR3M 5DYIA 3FKEA 2OQ4A 4GKKM 2D7HA 3SYLA 4FVMA 3GP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ4 A;  2VQF M;  4CIS A;  4G4N A;  1L2C A;  1L2D A;  3U6P A;  3TWL A;  3GPU A;  3GPY A;  2EA0 A;  3U6Q A;  3A46 A;  4NXN M;  4DV5 M;  4JI4 M;  2F4V M;  3U6C A;  3GPP A;  1XC8 A;  2UU9 M;  2UUC M;  3W0F A;  1Z5B A;  5ITR A;  1N34 M;  4LF5 M;  4JV5 M;  1MX0 A;  3SBJ A;  2F5P A;  3A45 A;  2UXD M;  4JI3 M;  4KHP M;  3T1H M;  4JI5 M;  4OX9 M;  5IT9 S;  3U6M A;  4LF9 M;  4YHH M;  1IBM M;  5ITY A;  4GKJ M;  1TDH A;  3JR5 A;  4DV4 M;  1MU5 A;  2Q2E B;  1Z5A A;  5BR8 M;  1J5E M;  2UXB M;  1PM5 A;  1L2B A;  4MB7 A;  3SAU A;  3J7A S;  1L1T A;  4B3M M;  4DV2 M;  5A2Q S;  2VQE M;  4DV7 M;  4DR5 M;  2F5O A;  1EE8 A;  3J80 S;  4DV0 M;  2XZF A;  3OTO M;  4NXM M;  3GQ5 A;  2F5Q A;  5ITT A;  4NRW A;  1HR0 M;  1K3X A;  4DV6 M;  3U6D A;  1Q39 A;  4DR2 M;  4G4Q A;  3VK7 A;  2UUB M;  1N32 M;  4DR6 M;  4DV1 M;  4LF4 M;  4PDG A;  4X65 M;  5ITQ A;  2F5N A;  4JI2 M;  3VK8 A;  5LMU M;  1N36 M;  1HNW M;  4DV3 M;  1N33 M;  1HNX M;  4LFA M;  1XMQ M;  3SAT A;  1HNZ M;  4LFB M;  1FJG M;  4DUY M;  4X66 M;  4JI6 M;  4NRV A;  4LFC M;  3U6E A;  3U6S A;  3GQ3 A;  5ITU A;  4X64 M;  1NNJ A;  1K3W A;  4JI1 M;  4LF7 M;  4YY3 M;  3SAW A;  2HKJ A;  4B3S M;  3SAV A;  1R2Y A;  2XZU A;  4DR7 M;  3GPX A;  4JYA M;  3TWM A;  3A42 A;  1Q3B A;  5IWA M;  2UXC M;  4PCZ A;  1Z5C A;  4LF8 M;  3DOA A;  5ITX A;  4DR4 M;  1L1Z A;  2ZM6 M;  4PD2 A;  3TWK A;  2OPF A;  1TDZ A;  4PDI A;  1IBK M;  1R2Z A;  3T1Y M;  4ITQ A;  4LF6 M;  4JI8 M;  4K0K M;  3U6L A;  1I94 M;  3GO8 A;  4X62 M;  4JI7 M;  4JI0 M;  3U6O A;  4DUZ M;  3SAS A;  4B3T M;  4DR1 M;  1Q3C A;  1XNR M;  3C58 A;  4G4O A;  1K82 A;  1Z59 A;  1IBL M;  2HHH M;  2E5L M;  1KFV A;  1PJI A;  4DR3 M;  3J81 S;  1XNQ M;  1XMO M;  3SAR A;  1PJJ A;  2OQ4 A;  5ITX E;  2F5S A;  4GKK M;  4G4R A;  4AQY M;  3JAM S;  2ZBK B;  5FLX S;  4B3R M;  2UUA M;  3GP1 A;  5LMN M;  3JR4 A; 
#chains in the Genus database with same CATH topology
 4AZF A;  2EJS A;  4Z6Y A;  2DKL A;  1K3X A;  4ANR A;  2LTU A;  1L2D A;  3U6P A;  2UUA M;  3GPU A;  1SXJ A;  3KP1 E;  1HJP A;  1NNU C;  1SXJ D;  4NXN M;  3GLG A;  1IN4 A;  2O25 A;  2VDB B;  2XEP A;  3GPP A;  2UUC M;  4FW9 A;  4LJ9 A;  2KNV A;  4UN2 B;  4GHA A;  4JV5 M;  3FRH A;  2F5P A;  1DO0 A;  4L78 A;  2UXD M;  5EP1 A;  4JI3 M;  3HU2 A;  5IT9 S;  4YHH M;  5ITY A;  4CJ6 A;  2Z8Y M;  1NHG C;  1VEK A;  1C7Y A;  1KYI A;  1FNN A;  5IRE B;  2I7N A;  4HEO A;  1Z5A A;  4IBD A;  4IIW A;  4RNA A;  2JZ1 A;  3W68 A;  1L2B A;  1F4I A;  1SXJ B;  4ZPX A;  3J7A S;  2OOB A;  2LHC A;  1ZAE A;  3D8L A;  4IJF A;  5A2Q S;  1N75 A;  2B3T A;  4NL4 H;  1TH2 A;  4DR5 M;  2Z4S A;  1OIZ A;  3L28 A;  2H1R A;  4MM3 B;  4AG5 A;  5C18 A;  5KQD A;  3OTO M;  3GQ5 A;  3M0E A;  4NXM M;  3HY5 A;  4DR2 M;  2KRK A;  4G4Q A;  2G5G X;  1N32 M;  3J7B A;  3FTD A;  4AW4 A;  3B9P A;  5EJC A;  1JR3 D;  2J7O A;  3FUU A;  3UGJ A;  3UMM A;  1G59 A;  2QBY A;  2CV0 A;  3GRR A;  1XB2 B;  4GH9 A;  1QAO A;  3KS4 A;  2R46 A;  3SFZ A;  2CP8 A;  2LVA A;  1HNW M;  3RFW A;  1XHB A;  1QUT A;  1GL7 A;  4LFA M;  4B7G A;  5EP4 A;  7CAT A;  2OO9 A;  4QOZ C;  2JY7 A;  4I4L A;  2CHV A;  4F1I A;  4DUY M;  1S3S A;  3HKP A;  4IBB A;  2CHG A;  2ZAO A;  1D0L A;  4X64 M;  3GLI A;  2L09 A;  3AL0 C;  5FTL A;  2QP9 X;  3U5Z A;  4B3S M;  1NHW C;  2KEB A;  2XZU A;  2CUZ A;  1QAQ A;  3A42 A;  4REZ A;  2WZJ A;  3FUT A;  2ZTC A;  3KOZ E;  1QZM A;  4PCZ A;  2V1C A;  3I4Y A;  1L1Z A;  2DAI A;  3T15 A;  1TDZ A;  2EO2 A;  2DWM A;  3DFZ A;  2XFS A;  1ZV1 A;  2QBY B;  2LXE A;  2VF8 A;  3KVW A;  2L6O A;  3VDU A;  2DXI A;  1G4A E;  1XXH E;  3IG5 A;  1TGU A;  4K0K M;  2KZU A;  3HJ8 A;  4X62 M;  2DAE A;  2KXE A;  2RRU A;  3U6O A;  4DUZ M;  1N78 A;  5KPR A;  4XBO A;  5KPZ A;  2XH9 A;  3MK6 A;  4DR1 M;  3AKZ A;  3C58 A;  2G3Q A;  3C3E A;  2HHH M;  1GVN A;  3FTE A;  1KFV A;  3KP0 E;  1TH4 A;  1PJI A;  2C9C A;  4LZZ A;  3J81 S;  3H4M A;  2BJW A;  1E32 A;  3J2P B;  4FD2 A;  4MGK E;  1H6U A;  4G4R A;  4AQY M;  2DHR A;  2R6F A;  4AKH A;  3HGI A;  2CV1 A;  2X4A A;  5LMN M;  2FE8 A;  1WJ7 A;  1WR1 B;  3HJS A;  1IN7 A;  3HHW A;  4CIS A;  2KRU A;  2MRO B;  4G4N A;  1V33 A;  2LHG A;  2RGO A;  2ZAN A;  2M60 A;  1G41 A;  3B7Q A;  3TWL A;  3ILK A;  1X37 A;  3Q8X A;  1OQY A;  4FCW A;  2VII A;  3A46 A;  1N77 A;  1GL6 A;  2F4V M;  3L25 A;  4D80 A;  3TE6 A;  1ZQ9 A;  4JXJ A;  4OW0 A;  3U6C A;  2C99 A;  4S12 A;  2APL A;  2DI0 A;  1Z5B A;  2P5T A;  2MR9 A;  3CF0 A;  5ITR A;  5IZ7 D;  1J7K A;  1TTE A;  2R45 A;  3UK6 A;  4MGI E;  4L6V 6;  2YNM D;  3WHL A;  2L4F A;  3K1J A;  4Q7J A;  2JA2 A;  3DA1 A;  4M9X A;  3T1H M;  4AG6 A;  4MGY E;  4OVZ A;  1TDH A;  1VQ1 A;  1BVS A;  3WHK A;  1NO1 A;  1MU5 A;  1J5E M;  2JP7 A;  4I8O A;  4MB7 A;  4Y28 F;  1ZMV A;  4IJE A;  3SAU A;  1G3I A;  3GLF B;  3GLG E;  1L1T A;  2L4E A;  5EXP A;  2LH0 A;  4MGH A;  1MN3 A;  2FFJ A;  4IBE A;  3ZQJ A;  2Z3X A;  1EIJ A;  1IM2 A;  2F5O A;  1IXZ A;  3FTF A;  2MJ5 B;  1IN6 A;  5ITT A;  1ZMW A;  1DGB A;  4HLQ A;  3HHZ A;  1NVM A;  1E9S A;  3HU1 A;  1T3T A;  5JI2 E;  4WUR A;  4NSO B;  3ZCB B;  4LG2 A;  2R4E A;  3LVV A;  4PT5 A;  3L26 A;  3KSJ A;  4PDG A;  2JY5 A;  1HR0 M;  1R4G A;  1GKI A;  1T6O A;  3VK8 A;  5LMU M;  4OVZ B;  4DV3 M;  1Z6T A;  2LVO C;  1N33 M;  1VG5 A;  2DWN A;  2V1U A;  1LTM A;  4L15 A;  1XMQ M;  1GJS A;  1HNZ M;  4QNR A;  1L8Q A;  4FCT A;  4RF1 A;  3RGP A;  3GLH E;  2YQZ A;  1SG9 A;  1VDL A;  3C3D A;  3LCU A;  4X66 M;  1IY1 A;  2R4J A;  3AOG A;  1KSF X;  3U6E A;  1YE9 A;  4LRT A;  3GQ3 A;  5FTN A;  3PXG A;  3B7N A;  3I01 M;  3W67 A;  4YY3 M;  3B74 A;  3SAW A;  1HT2 E;  4II7 A;  4LF7 M;  3SYK A;  4MH0 E;  1R2Y A;  1GJT A;  4DR7 M;  4LGY A;  3TWM A;  1Q3B A;  2QCU A;  1IFY A;  1WHC A;  1JR3 A;  2LNH C;  3HHX A;  4L16 A;  5ITX A;  4CHT B;  2HL7 A;  3CTW B;  1PJQ A;  2L7I A;  2OOA A;  4F2L A;  1TH3 A;  5DNY A;  5EXT A;  1WXQ A;  1LV7 A;  1RU3 A;  4G3O A;  3T1Y M;  4R71 A;  2YR0 A;  1OIP A;  1UM8 A;  1MJG M;  3HWS A;  1A5T A;  2DWZ B;  2GQF A;  3SAS A;  3FTC A;  4B3T M;  4LJ6 A;  4GIP A;  2X49 A;  3C9P A;  2R18 A;  3NWL A;  1AIP C;  4G4O A;  2DZL A;  1J09 A;  1R7R A;  2JY6 B;  2BJV A;  3FYD A;  2Y0Q A;  3AOE A;  4LJ8 A;  4R3D A;  3GLI E;  1OAO C;  3MJ5 A;  1XNQ M;  2BWE A;  3PNY A;  3QWL A;  5EP2 A;  5C1B A;  2LBC A;  2R62 A;  1XMO M;  3SAR A;  1PJJ A;  4AKG A;  2JUJ A;  2Z4R A;  2ZBK B;  5FLX S;  2V6Z M;  1IY2 A;  2LWX A;  3B89 A;  2RKO A;  3JR4 A;  4IBJ A;  2EKK A;  2R65 A;  4Z8X A;  3THG A;  3GQ4 A;  5EXS A;  2VQF M;  1G8P A;  1HQC A;  1WGL A;  2JNH A;  1L2C A;  1NY6 A;  1QAM A;  1QYR A;  2ERC A;  1I4W A;  4M0D A;  2J7N A;  3GRU A;  1ORY B;  2XF3 A;  1W5T A;  3BBZ A;  1DGH A;  3U6Q A;  3PVS A;  3FD9 A;  4IBG A;  2K6B A;  3K9P A;  4DV5 M;  4JI4 M;  4L4U A;  4B3M M;  1XC8 A;  3PFI A;  4LJ4 A;  4M9Z A;  4B08 A;  3U60 A;  2UU9 M;  3E46 A;  4QOS A;  3W0F A;  3VKG A;  4RF0 A;  2NQ8 C;  3CF6 E;  1N34 M;  1AUA A;  3KOW E;  2QPA A;  2DAK A;  4DBG B;  3K92 A;  4LF5 M;  5KQ8 A;  2L2D A;  1OFI A;  5JI3 E;  3D8B A;  3J27 B;  1VEJ A;  3E4R A;  3IG8 A;  4JI5 M;  2FS1 A;  1IBM M;  4GKJ M;  3EIE A;  1NJF A;  3ZC7 B;  3JR5 A;  5BR8 M;  1QQW A;  2JY8 A;  4KOD A;  3AFH A;  4NOO B;  3TPZ A;  4B7F A;  2C98 A;  1PM5 A;  1PJT A;  2CEA A;  3QYE A;  1DGH B;  2LVN C;  2O5R A;  3SHF A;  3GLF A;  4DV7 M;  1EE8 A;  1YLA A;  1D2N A;  1VDD A;  2XZF A;  3U60 B;  2WSC F;  2MH8 A;  5EP3 A;  4NRW A;  4QHS A;  5L8R F;  1NV8 A;  1VEG A;  2BWB A;  2WSE F;  2ZTD A;  3AJI B;  3MMP A;  1Q39 A;  4GC9 A;  3HHY A;  4FVM A;  4B7H A;  3QAU A;  2UUB M;  4DR6 M;  2KA6 B;  4G6Z A;  5DYG A;  1GO5 A;  4QNM A;  2A5Y B;  3R9X B;  2R0I A;  4BB9 A;  4CGY B;  3LMM A;  4MGZ E;  2ZAM A;  4X65 M;  2F5N A;  2DAM A;  1PGY A;  4JI2 M;  4LJ7 A;  4AKI A;  1WIV A;  1N36 M;  3HJQ A;  1HNX M;  4D82 A;  2DWL A;  3KDS E;  1IXS A;  4LJA A;  4OU7 A;  2CWB A;  1SXJ E;  3I4V A;  4GRI A;  1QAN A;  4IBF A;  1OTR A;  1FJG M;  1NV9 A;  4GIT A;  4JI6 M;  1DV0 A;  4NRV A;  4LFC M;  1JQJ C;  3VLF B;  2QQ8 A;  1DGG A;  2LVP C;  3CF2 A;  2HKJ A;  5E6J A;  2Y0T A;  3LQQ A;  3SAV A;  3GRV A;  3GPX A;  1IN8 A;  2CE7 A;  3HZJ A;  2VF7 A;  3KOY E;  3FRI A;  2ZM6 M;  4PD2 A;  2O01 F;  3TWK A;  3RE8 A;  3UJN A;  2OPF A;  1D0K A;  2KNA A;  3GRY A;  4PDI A;  1IBK M;  2BNK A;  4RKU F;  1CUK A;  2D7G A;  4KT0 F;  3TQS A;  4JI8 M;  4KO8 A;  1P3Q Q;  2QHO B;  3U6L A;  2DZO B;  1I94 M;  4LRS A;  3KS8 A;  4JI7 M;  1IXS B;  4WW0 A;  3R8F A;  1IXR C;  4LGM A;  3FUX A;  4L8R C;  2DAG A;  3A98 B;  4EIW A;  4R7G A;  3TL4 X;  1XNR M;  4KLN A;  1JB0 F;  1Z59 A;  2X8A A;  1NJG A;  1SXJ C;  4LCB A;  4JN6 A;  2R44 A;  3E21 A;  3I51 A;  4FCV A;  3K8Z A;  2D7E A;  4W5W A;  1JR3 E;  1QVR A;  5ITX E;  1T43 A;  2F5S A;  3VKH A;  3JAM S;  1W5S A;  4B3R M;  3PNV A;  4I81 A;  4DV4 M;  1DGF A;  2Y20 A;  4BLC A;  4JI1 M;  1R6B X;  3NBX X;  4A3V B;  2JXN A;  2WSF F;  3L27 A;  4WP2 A;  5EQT A;  2QSF X;  4IBC A;  1EFU B;  2XFT A;  4FWD A;  2RGH A;  2C9O A;  2FNA A;  4LJ5 A;  1HT1 E;  2XGN A;  3GPY A;  3SMS A;  2EA0 A;  3L2A A;  2C5R A;  3H4J A;  4FWH A;  3GLG B;  1IN5 A;  3GLH A;  3MHV C;  1IQP A;  4AI6 A;  1GAB A;  1YSY A;  2LVQ D;  3BXW A;  3IEC A;  2KNZ A;  1V92 A;  3BOS A;  2EKF A;  1MX0 A;  2QNJ A;  1DO2 A;  3LW5 F;  4GEW A;  4LZJ A;  3SBJ A;  3AV0 A;  4LY6 A;  3IHP A;  3KW6 A;  2K0B X;  4IBI A;  3DZD A;  2QZ4 A;  5KPT A;  1QUS A;  3A45 A;  2Y21 A;  4GMQ A;  1D0M A;  2DEN A;  4P16 A;  4QHT A;  4KHP M;  4OX9 M;  1OKS A;  2L7H A;  3U6M A;  4LF9 M;  2DZN B;  3L29 A;  3KFU G;  4I5S A;  4TUW A;  4HL4 A;  5E26 A;  5FSW A;  2Q2E B;  2UXB M;  2Z7J A;  1TR8 A;  2M5Z A;  2N35 A;  3LQR A;  5FTM A;  5FTK A;  3FUV A;  3E9S A;  2HCB A;  3RGS A;  4DV2 M;  3CGW A;  2AHM A;  3GLH B;  2DNA A;  2VQE M;  3J80 S;  2I7P A;  3KSX A;  4IBK A;  1ZMU A;  4DV0 M;  3U61 A;  1QDR A;  2F5Q A;  3T38 A;  2EUC A;  4P17 A;  4BBA A;  2YFQ A;  3KXE C;  4DV6 M;  3U6D A;  2CFO A;  2JZ0 A;  3AOE C;  2K9D A;  3VK7 A;  1XWI A;  4M0W A;  4GC5 A;  2HAK A;  3HX3 A;  4DV1 M;  2DVW B;  3VFD A;  3HU3 A;  4LF4 M;  1HQY E;  2DHY A;  2K47 A;  1V34 A;  1OJL A;  2KZS A;  2W82 A;  2XLJ A;  5ITQ A;  2XSZ A;  2KW0 A;  3KOX E;  3K2L A;  4D81 A;  4XGI A;  8CAT A;  3K9O A;  5FTJ A;  1XXH A;  4XK8 F;  5KO3 A;  2XSZ D;  3V76 A;  1GLN A;  2QEN A;  3T6P A;  3SAT A;  2CRU A;  3M6A A;  4LFB M;  3SHG B;  3GLF E;  2CV2 A;  3ZH9 B;  5DFL A;  3U6S A;  3GLI B;  5ITU A;  1NNJ A;  1K3W A;  3B7Z A;  4FWG A;  3U61 B;  3U5Z B;  2JWS A;  2KDL A;  5F3W A;  5BPV A;  4JYA M;  2CHQ A;  2FH0 A;  1NY5 A;  1IY0 A;  1OAI A;  1PJS A;  3QYB A;  4NC6 A;  5IWA M;  2UXC M;  1Z5C A;  1QZE A;  3DOA A;  4LF8 M;  2KHH A;  1Y8G A;  2MGW A;  4DR4 M;  1OFH A;  3EIH A;  4NSR A;  1QDT A;  3SC3 A;  1R2Z A;  3FYC A;  4ITQ A;  4LF6 M;  1PRB A;  3FUW A;  3W0L B;  1XXH B;  5H37 D;  2C96 A;  1E94 E;  1C1K A;  1YUB A;  3SMP A;  3GO8 A;  4GHL A;  4JI0 M;  3NBI A;  1G71 A;  1NSF A;  2GNO A;  5GKN A;  2FOI C;  3LCV B;  2H5X A;  3I04 M;  4M9S A;  1Q3C A;  2J5Y A;  2G8L A;  4CIZ A;  1K82 A;  2HWJ A;  5EXX A;  1IBL M;  1UFZ A;  3VDP A;  3LVW A;  3UZU A;  2E5L M;  3M7G A;  1E9R A;  3F92 A;  4DR3 M;  5DYI A;  1WGN A;  3FKE A;  2OQ4 A;  4GKK M;  2D7H A;  3Q8G A;  1R5L A;  3FE3 A;  1TF0 B;  3SYL A;  1Q02 A;  3GP1 A; 
#chains in the Genus database with same CATH homology
 4AZF A;  4Z6Y A;  1L2D A;  3U6P A;  2UUA M;  3GPU A;  1SXJ A;  3KP1 E;  1NNU C;  1SXJ D;  4NXN M;  3GLG A;  1IN4 A;  2XEP A;  3GPP A;  2UUC M;  4FW9 A;  4LJ9 A;  4GHA A;  4JV5 M;  2F5P A;  1DO0 A;  4L78 A;  2UXD M;  5EP1 A;  4JI3 M;  3HU2 A;  5IT9 S;  4YHH M;  5ITY A;  1NHG C;  1KYI A;  1FNN A;  5IRE B;  2I7N A;  1Z5A A;  4IBD A;  4IIW A;  4RNA A;  1L2B A;  1SXJ B;  4ZPX A;  3J7A S;  3D8L A;  1ZAE A;  4IJF A;  5A2Q S;  1N75 A;  4NL4 H;  1TH2 A;  4DR5 M;  2Z4S A;  3L28 A;  2H1R A;  4MM3 B;  4AG5 A;  5C18 A;  5KQD A;  3OTO M;  3GQ5 A;  3M0E A;  4NXM M;  4DR2 M;  2KRK A;  4G4Q A;  2G5G X;  1N32 M;  3J7B A;  3FTD A;  4AW4 A;  3B9P A;  5EJC A;  1JR3 D;  2J7O A;  3FUU A;  3UGJ A;  3UMM A;  1G59 A;  2QBY A;  2CV0 A;  3GRR A;  4GH9 A;  1QAO A;  3KS4 A;  2R46 A;  3SFZ A;  1HNW M;  3RFW A;  1XHB A;  1GL7 A;  4LFA M;  4B7G A;  5EP4 A;  7CAT A;  4QOZ C;  4I4L A;  2CHV A;  4DUY M;  1S3S A;  3HKP A;  4IBB A;  2CHG A;  2ZAO A;  4X64 M;  3GLI A;  2L09 A;  3AL0 C;  5FTL A;  2QP9 X;  3U5Z A;  4B3S M;  1NHW C;  2KEB A;  2XZU A;  2CUZ A;  1QAQ A;  3A42 A;  4REZ A;  3KOZ E;  3FUT A;  4PCZ A;  1QZM A;  2V1C A;  3I4Y A;  1L1Z A;  3T15 A;  1TDZ A;  2EO2 A;  2DWM A;  3DFZ A;  2XFS A;  2QBY B;  2LXE A;  3KVW A;  2DXI A;  2L6O A;  3VDU A;  1G4A E;  3IG5 A;  1TGU A;  4K0K M;  2KZU A;  3HJ8 A;  4X62 M;  2KXE A;  3U6O A;  1N78 A;  4DUZ M;  5KPR A;  4XBO A;  5KPZ A;  2XH9 A;  3MK6 A;  4DR1 M;  3AKZ A;  3C58 A;  2HHH M;  1GVN A;  3FTE A;  1KFV A;  3KP0 E;  1TH4 A;  1PJI A;  2C9C A;  4LZZ A;  3J81 S;  3H4M A;  2BJW A;  1E32 A;  3J2P B;  4FD2 A;  4MGK E;  1H6U A;  4G4R A;  4AQY M;  2DHR A;  4AKH A;  3HGI A;  2CV1 A;  2X4A A;  5LMN M;  2FE8 A;  3HJS A;  1IN7 A;  3HHW A;  4CIS A;  2KRU A;  4G4N A;  2RGO A;  2ZAN A;  2M60 A;  1G41 A;  3TWL A;  3ILK A;  1X37 A;  3Q8X A;  4FCW A;  2VII A;  3A46 A;  1N77 A;  1GL6 A;  2F4V M;  3L25 A;  4D80 A;  3TE6 A;  1ZQ9 A;  4JXJ A;  4OW0 A;  3U6C A;  2C99 A;  4S12 A;  1Z5B A;  2P5T A;  3CF0 A;  5ITR A;  5IZ7 D;  1J7K A;  2R45 A;  3UK6 A;  4MGI E;  2YNM D;  3WHL A;  3K1J A;  2JA2 A;  3DA1 A;  4M9X A;  3T1H M;  4AG6 A;  4MGY E;  4OVZ A;  1TDH A;  3WHK A;  1MU5 A;  1J5E M;  4I8O A;  4MB7 A;  3SAU A;  4IJE A;  1G3I A;  3GLF B;  1L1T A;  4B3M M;  5EXP A;  2LH0 A;  4MGH A;  2FFJ A;  4IBE A;  2Z3X A;  1IM2 A;  2F5O A;  1IXZ A;  3FTF A;  1IN6 A;  5ITT A;  1DGB A;  4HLQ A;  3HHZ A;  1NVM A;  1E9S A;  3HU1 A;  1T3T A;  5JI2 E;  4WUR A;  4NSO B;  3ZCB B;  4LG2 A;  2R4E A;  3LVV A;  4PT5 A;  3L26 A;  3KSJ A;  4PDG A;  1GKI A;  3VK8 A;  5LMU M;  4OVZ B;  4DV3 M;  1Z6T A;  1N33 M;  2DWN A;  2V1U A;  4L15 A;  1XMQ M;  1HNZ M;  4QNR A;  1L8Q A;  4FCT A;  4RF1 A;  3RGP A;  2YQZ A;  4X66 M;  1IY1 A;  2R4J A;  3AOG A;  1KSF X;  3U6E A;  1YE9 A;  4LRT A;  3GQ3 A;  5FTN A;  3PXG A;  4LF7 M;  4YY3 M;  3SAW A;  1HT2 E;  4II7 A;  3SYK A;  4MH0 E;  1R2Y A;  4DR7 M;  4LGY A;  3TWM A;  1Q3B A;  2QCU A;  1JR3 A;  2LNH C;  3HHX A;  4L16 A;  5ITX A;  4CHT B;  2HL7 A;  3CTW B;  2L7I A;  1TH3 A;  5DNY A;  5EXT A;  1WXQ A;  1LV7 A;  3T1Y M;  2YR0 A;  1UM8 A;  3HWS A;  2DWZ B;  3SAS A;  3FTC A;  4B3T M;  4LJ6 A;  4GIP A;  2X49 A;  2R18 A;  3NWL A;  4G4O A;  1J09 A;  1R7R A;  2BJV A;  3FYD A;  2Y0Q A;  3AOE A;  4LJ8 A;  4R3D A;  3MJ5 A;  1XNQ M;  3PNY A;  3QWL A;  5EP2 A;  5C1B A;  1XMO M;  4AKG A;  2R62 A;  3SAR A;  1PJJ A;  2Z4R A;  2ZBK B;  5FLX S;  2V6Z M;  1IY2 A;  2LWX A;  2RKO A;  3JR4 A;  4IBJ A;  2R65 A;  4Z8X A;  3THG A;  3GQ4 A;  2VQF M;  5EXS A;  1G8P A;  1HQC A;  1L2C A;  1NY6 A;  1QYR A;  1QAM A;  2ERC A;  1I4W A;  4M0D A;  2J7N A;  3GRU A;  1ORY B;  2XF3 A;  1W5T A;  1DGH A;  3U6Q A;  3PVS A;  3FD9 A;  4IBG A;  4DV5 M;  4JI4 M;  4L4U A;  1XC8 A;  3PFI A;  4LJ4 A;  4M9Z A;  4B08 A;  3U60 A;  2UU9 M;  4QOS A;  3W0F A;  3VKG A;  4RF0 A;  2NQ8 C;  3CF6 E;  1N34 M;  3KOW E;  2QPA A;  4LF5 M;  3K92 A;  5KQ8 A;  1OFI A;  5JI3 E;  3D8B A;  3J27 B;  3E4R A;  3IG8 A;  4JI5 M;  1IBM M;  4GKJ M;  3EIE A;  1NJF A;  3ZC7 B;  3JR5 A;  5BR8 M;  1QQW A;  4KOD A;  3AFH A;  4NOO B;  3TPZ A;  4B7F A;  2C98 A;  1PM5 A;  2CEA A;  1DGH B;  2O5R A;  3SHF A;  3GLF A;  4DV7 M;  1EE8 A;  1D2N A;  1VDD A;  2XZF A;  3U60 B;  5EP3 A;  4NRW A;  4QHS A;  1HR0 M;  3AJI B;  4GC9 A;  4B7H A;  1K3X A;  1Q39 A;  3HHY A;  3QAU A;  2UUB M;  4DR6 M;  2KA6 B;  4G6Z A;  5DYG A;  4QNM A;  2A5Y B;  3R9X B;  4BB9 A;  4CGY B;  3LMM A;  4MGZ E;  2ZAM A;  4X65 M;  2F5N A;  4JI2 M;  4LJ7 A;  4AKI A;  1N36 M;  3HJQ A;  1HNX M;  4D82 A;  2DWL A;  3KDS E;  4LJA A;  4OU7 A;  1SXJ E;  3I4V A;  4GRI A;  1QAN A;  4IBF A;  1FJG M;  4GIT A;  4JI6 M;  4NRV A;  4LFC M;  1JQJ C;  3VLF B;  1DGG A;  3CF2 A;  5E6J A;  2HKJ A;  2Y0T A;  3LQQ A;  3SAV A;  3GRV A;  3GPX A;  1IN8 A;  2CE7 A;  3KOY E;  2ZM6 M;  4PD2 A;  3TWK A;  3UJN A;  3RE8 A;  2OPF A;  4PDI A;  3GRY A;  1IBK M;  2BNK A;  2D7G A;  3TQS A;  4JI8 M;  4KO8 A;  3U6L A;  2DZO B;  1I94 M;  4LRS A;  3KS8 A;  4JI7 M;  1IXS B;  4WW0 A;  3R8F A;  1IXR C;  4LGM A;  3FUX A;  4L8R C;  3A98 B;  4EIW A;  4R7G A;  3TL4 X;  1XNR M;  4KLN A;  1Z59 A;  2X8A A;  1NJG A;  1SXJ C;  4LCB A;  4JN6 A;  3I51 A;  4FCV A;  3K8Z A;  2D7E A;  4W5W A;  1QVR A;  5ITX E;  2F5S A;  3VKH A;  3JAM S;  1W5S A;  4B3R M;  3PNV A;  4I81 A;  4DV4 M;  2Y20 A;  1DGF A;  4BLC A;  4JI1 M;  1R6B X;  4A3V B;  3L27 A;  5EQT A;  4IBC A;  2XFT A;  4FWD A;  2RGH A;  2C9O A;  2FNA A;  4LJ5 A;  1HT1 E;  2XGN A;  3GPY A;  3SMS A;  2EA0 A;  3L2A A;  2C5R A;  4FWH A;  3GLG B;  1IN5 A;  3GLH A;  3MHV C;  1IQP A;  4AI6 A;  1YSY A;  3BOS A;  1MX0 A;  1DO2 A;  3SBJ A;  4LZJ A;  3AV0 A;  4LY6 A;  3KW6 A;  4IBI A;  5KPT A;  3DZD A;  2QZ4 A;  3A45 A;  2Y21 A;  4GMQ A;  4P16 A;  4QHT A;  4KHP M;  4OX9 M;  2L7H A;  3U6M A;  4LF9 M;  2DZN B;  3L29 A;  3KFU G;  4I5S A;  4TUW A;  4HL4 A;  5E26 A;  5FSW A;  2Q2E B;  2UXB M;  2Z7J A;  2M5Z A;  3LQR A;  5FTM A;  5FTK A;  3FUV A;  3E9S A;  2HCB A;  3RGS A;  4DV2 M;  3GLH B;  2AHM A;  2VQE M;  3J80 S;  2I7P A;  3KSX A;  4IBK A;  4DV0 M;  3U61 A;  2F5Q A;  3T38 A;  2EUC A;  4BBA A;  2YFQ A;  3KXE C;  4DV6 M;  3U6D A;  2CFO A;  3AOE C;  3VK7 A;  1XWI A;  4M0W A;  4GC5 A;  4DV1 M;  2DVW B;  3VFD A;  3HU3 A;  4LF4 M;  1HQY E;  2K47 A;  2W82 A;  1OJL A;  2KZS A;  2XLJ A;  5ITQ A;  2XSZ A;  2KW0 A;  3KOX E;  3K2L A;  4D81 A;  4XGI A;  8CAT A;  5FTJ A;  1XXH A;  5KO3 A;  2XSZ D;  1GLN A;  2QEN A;  3SAT A;  3M6A A;  4LFB M;  3SHG B;  2CV2 A;  3ZH9 B;  3U6S A;  3GLI B;  5ITU A;  1NNJ A;  1K3W A;  5F3W A;  4FWG A;  3U61 B;  3U5Z B;  5BPV A;  4JYA M;  2CHQ A;  1NY5 A;  1IY0 A;  5IWA M;  2UXC M;  1Z5C A;  4LF8 M;  3DOA A;  4DR4 M;  1OFH A;  3EIH A;  4NSR A;  3SC3 A;  1R2Z A;  3FYC A;  4ITQ A;  4LF6 M;  3FUW A;  3W0L B;  1XXH B;  5H37 D;  2C96 A;  1E94 E;  1C1K A;  1YUB A;  3SMP A;  3GO8 A;  4GHL A;  4JI0 M;  3NBI A;  1NSF A;  5GKN A;  2FOI C;  4M9S A;  1Q3C A;  2G8L A;  1K82 A;  5EXX A;  1IBL M;  3VDP A;  3LVW A;  3UZU A;  2E5L M;  3M7G A;  1E9R A;  4DR3 M;  5DYI A;  3FKE A;  2OQ4 A;  4GKK M;  2D7H A;  3SYL A;  4FVM A;  3GP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...