3FTCA

Crystal structure of a. aeolicus ksga at 1.72-angstrom resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
234
Chain Sequence
LLVSEGVLKKIAEELIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 70
structure length 234
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftcA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftcA01
2IIPA 2VZ9A 3O7WA 2N47A 1H1DA 1V39A 4FT2A 2YTZA 5GOZA 3TMAA 3P2EA 3MB5A 5EIWA 5GIPE 3ER9A 3GRUA 1O9GA 1JQ3A 4GC9A 1R8YA 3A27A 3CJTA 3DH0A 5EMKA 1QYRA 1FPQA 1VE3A 2ERCA 3TPZA 2DULA 2EJTA 2YQZA 3HCBA 4V0RA 4CXMA 3OU2A 4AZWA 4ER3A 2IH5A 3FPGA 5K8VA 5CVDA 4RYLA 1XJ5A 3DLIA 3VSEA 5EC8A 4RVDA 2I9KA 5HZMA 4YUZA 1Z3CA 2YXLA 3EVBA 4U7PB 3CJQA 2R6ZA 2AN5A 4C05A 4DCGA 4HGYA 2P35A 2O0LA 1UFKA 4AZSA 1QAQA 4EKIA 5HOQA 3EGVA 2XVAA 2DPMA 4EQZA 4RTSA 5CD1A 1EJ0A 3BGVA 2Z6AA 5G02A 5K05A 4AUKA 3G89A 3EEOA 4PIPA 2P41A 3FPHA 3CKKA 3IHTA 1N2XA 5FWAA 3KQMA 3UBTA 2Z6QA 1P1BA 4M7RA 5P8WA 1P39A 4Y30A 4RWZA 4UOEA 4XUEA 4RTLA 4X60A 2ZWAA 3TR6A 4OQEA 3EMBA 2FCAA 3CJRA 1AQIA 5ICFA 1ZGJA 3GDHA 5E9WA 3M6XA 5CIYA 2JHPA 2PXAA 5ICGA 2ZIEA 3AWIA 1KYZA 3LCCA 1NBIA 4QDJA 3JWGA 4RTOA 5F2OA 3ANXA 1NW5A 2B2CA 4RX1A 4P7KA 3EVZA 1FP2A 3KR9A 5E9JA 4LECA 3EMDA 3TQSA 1R00A 2IDJA 3EVGA 5KVAA 4FGZA 3E05A 2IH2A 2JH8A 3TM5A 3PFGA 1SQFA 3GWZA 3RW9A 2IP2A 3PX3A 2BH2A 4Y2HA 3LL7A 2PT6A 1HMYA 3KU1A 3P9IA 5C9ZA 5HILA 3FPEA 5E8JA 3SX0A 1BC5A 3TKYA 2Y1WA 3HVKA 4FT4A 3TRKA 1JTFA 5CCBA 1YF3A 3C6MA 3HNRA 3SVZA 5K0EA 3GRYA 1NW6A 4YMHA 1MJFA 5LQAA 4QQKA 1L9KA 2PSSA 2AZTA 1VLMA 4M37A 4Z2YA 3HP7A 3BWYA 2CWWA 4HTFB 4LG1A 2OYRA 3TKAA 2PKWA 1NV9A 2ZFUA 3O31A 4RTPA 3NWEA 3SGLA 4AZVA 4CTKA 4PYJA 2I6GA 4HG2A 1M0EA 3PVCA 2OZVA 1XCJA 2BR5A 3M6VA 3EVDA 5CM2Z 1M6YA 3SM3A 3DMGA 2PXCA 2PY6A 3DXZA 4KWCA 4PYQA 5BW5A 2AVNA 2AOTB 5E2AA 5E8RA 3OZTA 2QY6A 1L1EA 1INLA 3G8AA 3LBFA 2C7PA 3OZSA 3G7UA 4ER0A 4BP3A 2JHAA 2XYRA 3KQTA 3UJ9A 5BP7A 2G1PA 4HGZA 3F4KA 5K0FA 5KS2A 4BP1A 3IEIA 5E1OA 3SR4A 3GXOA 2UYHA 2FK7A 4PYMA 4PCAA 4DQ0A 2PT9A 3UA3A 4K6MA 1IXKA 2NNWB 2OY0A 3CVOA 3AXTA 2PX8A 1EJ6A 5DX1A 2VDVE 3LBYA 1SG9A 3A4TA 3UJCA 2EJUA 3KQQA 3M6WA 5BW4A 3V97A 2IFTA 4O29A 4RTMA 3T0IA 1X19A 5LQRA 2C7OA 5LR6A 3QOXA 4PYKA 1O9HA 2O57A 4DKJA 4C4AA 2ZCJA 4X63A 2HNKA 5FTWA 3G2PA 5F2NA 2ZTHA 5M5BA 5JR3A 5EEHA 4MTLA 3KQVA 1VL5A 4H0NA 1VIDA 1Y8CA 5DM1A 5EGSA 5ICEA 4QTTB 5DSTA 2WA1A 4QTUB 3AJDA 1VQ1A 5DM0A 2V74B 1JR4A 1PJZA 3BZBA 3R6TA 3CBGA 5GWXA 4DZRA 4PINA 2G70A 5E1DA 3DTNA 4DM3A 1JSZA 3NW9A 5DM4A 5DTMA 2PGXA 3NDJA 5EMLA 3NJRA 1NKVA 5DX0A 3NVKI 2OPBA 1B42A 1DUSA 2A14A 2EG5A 4MIKA 3M70A 4OA8A 2P7IA 2Y1XA 2B25A 3B3JA 4DCMA 4EMSA 4PCLA 5K0JA 1RJFA 1I9GA 3D2LA 3PLAE 3BUSA 1FP1D 4GOMD 2F8LA 3ME5A 3B3FA 2PX5A 1JQEA 3DUWA 1ZG3A 1L3CA 5CCXA 4RTRA 1DL5A 3R0QA 1PRYA 4R6WA 3FTDA 2AOXA 3EGEA 3P9CA 3BT7A 3OZRA 3KQSA 3DR5A 4RVGA 4KW7A 2AOWA 2NP6A 1QZZA 3DXYA 4E33A 4ER7A 3GCZA 1XCLA 5EMMA 1NE2A 4FP9A 1O54A 3SSOA 3LDGA 4OA5A 5LQCA 2YVLA 5H02A 2HR1A 4F84A 3GIWA 3HM2A 3KQWA 5HIMA 1EAMA 5KQSA 3NTVA 1WXWA 2P40A 3P8ZA 3OU7A 3EPPA 3UWPA 1VP9A 3GRZA 4PGGA 3ELYA 3LDUA 1WY7A 2NXCA 4KDRA 5DXAA 1VP3A 3NMUF 1KPIA 2IDKA 2OB2A 5EQJB 4RVHA 5K0GA 5E2BA 2HV9A 3HA7A 3CCFA 3HA3A 3K6RA 5EZSA 3ERCA 2PBFA 2QE6A 1D2HA 3X0DA 3P2KA 1R18A 3GJYA 1AQJA 3AXSA 2VS1A 3BXOA 1X1BA 3REOA 3NDIA 4LWPA 3FRHA 1RI1A 2HWKA 2HMYB 2I62A 1ZKDA 5DRTA 2CMHA 1NT2A 5DXJA 3FPJA 4CTJA 2FPOA 4PGHA 2NXJA 3JWJA 4QPPA 5ERGB 3FUTA 2AN4A 4P58A 4CKEA 3DMFA 3HCEA 1ZHFA 5EHGA 2ZW9A 1JSXA 3EVAA 2GA9A 1KR5A 1RJDA 4A6DA 5LQNA 2XVMA 2QM3A 4GEKA 3PT9A 3DMHA 4LWOA 1Q0SA 3VC1A 2UYCA 1IM8A 4PYNA 3MCZA 2NP7A 2JH9A 5DSXA 1M6EX 3G88A 5CVUA 2K4MA 3LKZA 4FZVA 5K0BA 3GU3A 2AOVA 5HEKA 3AY0A 1NW7A 1RI5A 3TM4A 3A25A 3VC2A 2Z6UA 1G38A 2ZBPA 4IKPA 3CC8A 1AF7A 2PXXA 3ELUA 10MHA 5DLYA 2ONZA 2QRVB 3KR1A 5EOVA 3LHDA 5K03A 4PYLA 3GRVA 1R6AA 2BR4A 3SSMA 3Q87B 5GINE 3G2MA 4C06A 3UA4A 3T7TA 3HTXA 1YZ3A 3B5IA 1JG2A 1KIAA 3MGGA 1XVAA 5ICCA 3E23A 3UJ6A 3A7DA 2YXDA 3HVIA 3OE5A 5EHIA 5FCDA 5HFJA 4C04A 1ORHA 4BY9E 1F3LA 3HEMA 5DTRA 1KP9A 2BM8A 4PYIA 1RI4A 4RVFA 4YV0A 5DTQA 5EKXA 4PIMA 3C3YA 4KDCA 5HIIA 3U81A 1RI2A 2P7HA 3I9FA 5T64A 5FQNA 2QYOA 2B3TA 9MHTA 2BM9A 2PVCA 3LGAA 3KR0A 4F86A 3CGGA 2FRXA 2GH1A 4E70A 1NW3A 3I58A 3ORHA 4X61A 4E2ZA 4X41A 5BXYA 3E8SA 4U7TB 5GM2A 1YFLA 1N7JA 2C7QA 1WG8A 2GB4A 1R74A 4L7VA 2OKCA 5EPEA 4GOND 2VDUE 4IWNA 1DCTA 5HIJA 2GS9A 3HCDA 2H11A 3I64A 4P7FA 4BLUA 4BLWA 5EVJA 2OBFA 5EZQA 3G5TA 4GOLD 1JG1A 3ER8A 5GP1A 1EIZA 5FQOA 3P71T 1YUBA 3LCUA 3LCVB 5U4XA 4PWYA 3QOWA 2ADMA 3UZUA 3C6KA 3DP7A 3KPWA 4R6XA 5DWQA 1SQGA 4QQNA 4E2XA 1XDZA 4GC5A 4PONA 2JG3A 5T67A 1QANA 2EFJA 1G6Q1 1KPHA 3R9XB 1OR8A 4ATNA 2ORED 2OB1A 4G56A 1D2GA 2IPXA 4OBWA 3FTEA 3KQYA 2GPYA 3MTEA 1NBHA 4X1OA 4EVIA 2VDWA 4MHTA 5LQUA 3FYDA 2G71A 4RTJA 2O06A 3HCCA 3IYLW 3B3GA 3G8BA 1SVUA 4ZTBA 4ER5A 4DF3A 2GLUA 5EMJA 1XXLA 2H1RA 3HVJA 1WZNA 5GM1A 3ELDA 1BOOA 3MQ2A 3NVMB 4YUVA 3TLJA 4C07A 5LSAA 3GRRA 1NV8A 1X1AA 5T6BA 4RTKA 4CWAA 1KXZA 1IY9A 3K0BA 3MERA 4WXHA 3EVCA 3LPMA 2JHCA 3QV2A 3R24A 3A26A 4V0QA 1QAOA 5FHQA 4E32A 4YUYA 2IGTA 3FUXA 4PYOA 2G72A 1KYWA 2UYQA 3G2QA 5DX8A 5FA5A 3PB3A 3MHTA 4KVZA 4RV9A 3T7SA 2B9EA 3SMQA 4C08A 4E30A 5MHTA 5C0OE 3DLCA 3DXXA 2V7EA 2YXEA 4OQDA 5FULA 2E5WA 5K0CA 1BHJA 3LDFA 5EKUA 1TW3A 5IH3A 2VP3A 3DULA 4XUCA 3ELWA 5B1SA 8MHTA 4AZTA 2LD4A 3KPYA 4DMGA 3L8DA 5FWDA 3EGIA 5HIKA 5FADA 3SXJA 3R3HA 1F38A 3OCJA 3B7PA 3UJBA 2ZVJA 4E2YA 5K01A 1L3BA 1UIRA 4XUDA 1AV6A 2AR0A 1ZQ9A 2WK1A 3V8VA 4C03A 4PNEA 4QVGA 5CVJA 2OXTA 4YMGA 1RI3A 1RJEA 4XCXA 3FZGA 3FUUA 5CVVA 2P3LA 3KR2A 2IBSA 5LQJA 3VYWA 1VPTA 2FHPA 4B17A 1X1DA 2YR0A 4QDKA 3NWBA 5EEGA 1EG2A 3JWIA 3G5LA 4OBXA 2P3QA 3EEYA 1ZGAA 3OFKA 3P97A 4ISCA 3FTFA 3T7RA 3GGDA 5CUQA 4M36A 1N7IA 3UFBA 4FSXA 1ORIA 2PV0A 3KHKA 2PX4A 1FBNA 3BGIA 3TFWA 2ZLBA 1JQDA 1VBFA 2CMGA 2XYQA 3KPVA 3P9NA 5D1HA 4EKGA 1T43A 3MAGA 3PTAA 5F2KA 2AOTA 1BKYA 2NYUA 3UJ7A 3ID6C 3A7EA 3BKXA 1YZHA 3HA5A 3LSTA 1JTEA 4R8SA 2Q41A 2XBMA 3S68A 1TPYA 3IV6A 3BKWA 3EVEA 3LECA 3LKDA 2AOUA 3M6UA 5FUBA 3UJDA 4KRGA 1JG4A 4CKCA 1TW2A 4GQBA 2PLWA 2ZULA 1SUIA 4WVLA 1EQAA 5FA8A 1G60A 2B78A 3DOUA 1R8XA 1G8SA 3P9KA 3M33A 4FSDA 4QPNA 1YFJA 5DRYA 5E9QA 2NXEA 2ZSUA 4GUAA 3WSTA 3GNLA 4M38A 5D1NA 1G8AA 1SUSA 4MQ4A 2AVDA 2FK8A 2I7CA 2UYOA 2PWPA 4HSGA 2BZGA 4F85A 1YB2A 2H00A 2AOUB 5DPMA 1WXXA 4P7GA 5KYGA 5K0LA 1I1NA 3KPJA 2XYVA 4NECA 5CVEA 2FYTA 2KW5A 4POOA 2JJQA 2YX1A 4KIGA 5E1BA 2GAFA 2ZWVA 2P8JA 2CKDA 3BGDA 1X1CA 3HCFA 3M4XA 4HC4A 1D2CA 4P7JA 3C0KA 3FTCA 5EG5A 3RIEA 5IKMA 3KQOA 1SKMA 4QVKA 3MCTA 3MTIA 3FYCA 1HNNA 2ZBQA 3UJ8A 2ZZKA 5DM2A 5JUWA 3PX2A 4YV2A 2OO3A 5DT2A 1XDSA 1UWVA 3TOSA 1FJXA 4MWZA 1NW8A 5GIOE 3HCAA 4JXJA 4FS8A 4HRAA 4YUWA 4RTNA 2YUIA 3FUWA 4GBED 3I53A 4HTFA 4CKBA 2P1DA 1XDUA 2WA2A 1P91A 4E31A 1JG3A 2NXNA 3I5UA 4OX9Y 4DA4A 2AS0A 1XTPA 3PS9A 4GF5A 2HTEA 3EVFA 2ZBRA 4KIFA 3UJAA 4A6EA 3P2IA 1RJGA 3JWHA 2ZIGA 3BWBA 5EIFA 1U2ZA 3LX6A 2O07A 3KQPA 3FRIA 3PFHA 1WS6A 3THSA 2P3OA 4AX8A 5FHRA 3O4FA 4ER6A 4YV1A 4YUXA 1L3IA 3SSNA 3KKZA 3GO4A 2R3SA 4EK9A 3OU6A 2PJDA 2G8NA 2ZZNA 4E2WA 4R8RA 2BR3A 3Q7EA 2O05A 4GOOD 3FPFA 3OPNA 2CL5A 3E7PA 2ZIFA 4BLVA 3BWMA 1MHTA 3H2BA 5K0NA 2ONYA 3BWCA 2C7RA 2ZZMA 3OFJA 4IV0A 2AN3A 4FR0A 1I4WA 3OE4A 7MHTA 3HVHA 4RTQA 2QRVA 4HH4A 3C3PA 1KHHA 4R05A 3THRA 3KPUA 2UZ4A 5K09A 5KQRA 2EX4A 3G2OA 4IV8A 2ESRA 3FUVA 1G55A 2PWYA 1P1CA 1KPGA 2PX2A 4RSRA 5C1IA 2IBTA 1Q0TA 3B89A 3RODA 1QAMA 5LQKA 5E1MA 2IH4A
chains in the Genus database with same CATH superfamily
2JFYA 4NXNB 3SSAA 2ZPUA 4WOCA 2AUMA 2Y1LA 2I65A 4AECA 1KAMA 5E6JA 2UKDA 1NNSA 1T4MA 1M2KA 3W0LB 2UZ1B 2PJUA 4FWIB 1XD8A 5BR7A 1IOLA 3KLPX 3QEMA 4XLZA 4YH1A 1ML3A 2IHKA 5B37A 3WADA 4ZCMA 2DWUA 2EC5A 3CIFA 3I0ZA 4R7ZA 1N1EA 1V96A 3KJFA 3HCRA 4H27A 4MAAA 4ZVMA 4W5OA 4H0FA 4YT4A 1AQNA 1UXGA 2D8AA 4X94A 3ZX5A 4EH1A 4A6XA 4A8TA 4EAAA 1BG6A 5AM5A 4XLTA 5F1KA 4DRXB 3W5SA 3PNOA 1MJGA 1PR2A 2FN8A 3O4VA 4QECA 2GZDA 4BQEA 3AETA 3L6UA 5KQLA 4LEIA 4UE3S 5FXMA 4ZYVA 4TGLA 5KREA 1DC8A 4DV5M 1FUKA 5F3RA 4C2UA 3EQ9A 4RDXA 3HJUA 3FZQA 4XD7D 2EP5A 3OECA 1T2UA 2R44A 4B46A 4PN7A 1Q74A 2X8LA 3FLMA 2IZZA 3EZLA 3LUGA 4RXMA 3WE7A 3IHTA 4DGQA 2WJHA 1KI6B 5DNUA 4AY6A 1Q6ZA 3I39X 5I51A 3L26A 3L1KA 4F12A 3U7JA 3OURA 4JOQA 2WFAA 3QU5A 3R6WA 1JQKA 4HFJA 2DUJA 2FH0A 1W59A 1VCOA 3FKSD 3QVTA 2XRFA 2DHQA 1Y7TA 4OOFA 1PX0A 4YWJA 4HDRA 2FUG6 2H57A 2GTHA 1T24A 4QU9A 2JZNA 2VATA 1HE3A 1KYZA 1QH8B 3DAPA 4BDTA 1SJ9A 4BNMA 1ZXBA 3H1FA 3RWMB 2PD6A 1NW5A 3E3OA 1R2YA 4P7KA 1USVA 4RF5A 1XDWA 1UMDA 2I2CA 4GAEA 4XA8A 1FUUA 1XWFA 2KI5A 3EVGA 3UMMA 4PLGA 1SEPA 2Q46A 1ENPA 2GXAA 4CIDA 5JC8A 4GZ6A 2XUJA 2EP8A 3BE5A 1NSFA 3PFGA 4JC5A 3EXHA 2QN8A 5TSDA 4R2HA 3W3AH 2XMRA 1IATA 3AT1A 4FJ0A 3EUAA 2QW1A 1DFIA 3GGOA 3R40A 4RDIA 4CUKA 4JI6M 3N0VA 4AJKA 3RB8A 4WP2A 1ZW6A 4N18A 1YF3A 4IL5A 4LF7B 5F4ZA 1DWPA 4J76A 4EL0A 4GBJA 5LQAA 4MRAA 3ADKA 4V0SA 4LGYA 1JAXA 2FMFA 2Q3BA 2EGUA 2WLSA 1M7BA 4IDEA 2XXAA 5HUJA 4EF6A 1DRKA 3PEEA 2OCIA 4HAUA 3IKVA 4Q9NA 1U99A 2WSMA 3GJ5A 3HC7A 1VHDA 2PMKA 4GP9A 1ZH6A 5CM9C 1YVRA 4AZVA 2Z7JA 2P67A 4EGFA 3U6KA 1U63A 4FKZA 2VBGA 3R0ZA 4G0YA 5JBQA 1T1SA 1X1EA 3MMNA 2BR5A 1HKUA 2Q99A 4NDZA 4WFKA 4J8PA 1UADA 1M2JA 3ICPA 5AW9A 1W46A 5DFLA 4Q6BA 2RJOA 2NO1A 4EJSA 3QW2A 1ENOA 2W43A 3DG9A 2NU7A 3KQTA 3ZE0B 4MO2A 1SUWA 3WRYA 3T95A 4FLEA 1PR0A 2VSNA 4WXYB 1MVLA 2J09A 4J2OA 4P08A 3BBPA 3K96A 4OH1A 1XCBA 1H69A 2HEIA 2NNWB 3CVOA 3IE2A 5CH5A 3LLMA 3ZTYA 2ZTSA 2GUGA 1CUUA 3T38A 1K75A 4KSYA 4O2BF 1L8QA 1RFLA 2D7JA 4NXMM 2WSBA 1D1QA 1GKIA 2WWRA 3DEKA 4WFJA 5LQRA 5AMXA 5IEJA 2UV8A 2OWDA 3BHIA 5IYZB 2HNKA 2QGZA 4HLQB 3N7UA 3RASA 3HO8A 5IJ9A 1SU4A 1X7YA 4BO4A 2LBPA 1N7HA 2ZTHA 2GBCA 3JZFA 4K9KA 1A5BB 2CNWD 3ZQKA 2XAUA 4Z53A 4HAOA 1XRSB 2R1VB 1TGUA 1ZK3A 2FE4A 4HRVA 2PFSA 3PJFA 2FPUA 2C5EA 3HJRA 4IR7A 4C4RA 2H54A 4E5UA 5IPFA 4PAWA 4ZOQI 4BQNA 3DLPX 1IJBA 1ENZA 4HYTA 4RH0A 4RVUA 1JSZA 4U3JA 2B83A 1Z45A 3RC7A 3M5DA 5AVXA 4RHTA 3AOEC 3ZHTA 5DX0A 3ETGA 4FSHA 3SC2A 2A9PA 1PIWA 3ZJ4A 3SLGA 4OJKA 1E0DA 3HDQA 4TTRA 4Z9BA 2EG5A 1CZOA 4ZFNA 3F67A 2XCTB 5KAMA 1EKXA 1HT0A 3BUSA 4DWVA 1HDOA 1U80A 3CR8A 1HK7A 4GI1A 4XVHA 2H3EA 2CVHA 1I4TD 4X8OA 3RVDA 1OAOA 1PRYA 4JDPA 1BYUA 4PNHA 4BMOB 2ZTLA 1NYQA 4R69A 1CV2A 2DTXA 2W8ZA 1AMNA 1HR0B 4K2AA 2IYEA 5H8WA 5H7XA 1FFSA 5A03A 3U7GA 5K3BA 2ZI7A 3IJRA 3QLVC 4JR1A 2BN4A 4MULA 3UF0A 2Y4OA 3H18A 2V3VA 4EY3A 1N5OX 1JR3E 3WKEA 1EUYA 3T0FA 3V4ZA 1V16A 3UMSA 2C9BA 3BB1A 3ETHA 3K0KA 1ZSVA 3MVEA 3PKZA 4CCWA 4F84A 2H4JA 3NTVA 1W36C 2D2EA 2A94A 1C1XA 2WF5A 3I28A 3KWJA 3OQVA 2I3ZA 4LW8A 3T5TA 1E7RA 2AEFA 2H1VA 2F67A 5IK2D 2IY7A 2ODPA 2P79A 4MV4A 2ZJBA 1RP1A 4F4JA 1PK8A 5K4AA 3CO5A 2WM9B 3HDJA 3L7NA 1NU8A 5FTLA 1YO6A 2J67A 3CSUA 1E3WA 4FR2A 1VI2A 2JCBA 3D59A 3QWIA 4KO3S 3IQGX 4C0HA 2P0YA 3JSXA 1R64A 1FYFA 3UFXB 1TCCA 1R18A 3EA0A 3A1WA 3GJYA 1TCAA 1V71A 4G24A 4F93B 1CJKC 2Q8NA 2XDQB 3UW1A 5JXWA 4RANA 1JVSA 1WD5A 4B3XA 3JAMS 1I10A 2D59A 4J3FA 2H1HA 4X20B 1KK3A 4J0IA 4KQ2A 4CGYA 1XZQA 5AW1A 5A0FA 2X2FA 1NBEA 1Z6ZA 2V45A 5I48A 2R6DA 4MVCA 4DDWA 3HJHA 2Y67A 3HRHA 1NVEA 1HNZM 2XJ9A 2GA9A 2XE6A 3H17A 1MOZA 2ZSDA 4LJ6A 2YWJA 1K06A 1U7ZA 4UATA 1XQ9A 2NYVA 2OHVA 2X58A 3OOJA 5CIWA 4LGVA 3NYIA 3C4QA 3MCZA 3PVZA 2JJ1D 4OJQA 1G5IA 3REGA 5CVUA 4DADA 3LKZA 4D25A 3A6HA 3EXIA 1BMFD 1M5TA 2P62A 1S96A 3D4BA 4JJKA 3VC2A 4A5SA 1EXDA 1N2CE 3PEYA 4OB6A 1E9VA 1P1KA 3CRZA 1JMVA 2GD0A 3GROA 3QX9A 4HPXB 5GTDA 3OJ0A 4XM1A 2P6UA 5DGHA 5A3VA 3A4NA 2NG1A 4FNGA 4MKXA 1Y6FA 3QEBZ 4BO9A 5EP3A 5JE8A 5BPFA 3TR0A 5LYYA 2WY2D 1B1CA 3BZUA 4MUJA 2IHTA 2CXNA 5DISB 2PUFA 2A35A 3MUFA 1KH1A 3BXEA 2E82A 3JD2A 3A9CA 3JQGA 3BSYA 3RNLA 4V3CA 3VYRB 4GMQA 1C2YA 4Y1EA 2BKAA 4LZOA 3RT7A 1NI4B 2WOOA 4IGKA 3S3TA 1DU4A 2KHHA 1WW3A 4LNUB 5I5GA 1IBRA 5K6TA 1KY3A 2QRNA 2YHUA 4P3KA 3PI6A 2PX3A 3P0IA 5LXTB 1KZHA 4E70A 4Q3CA 3F98A 2A9QA 1SB9A 1RCFA 2Z2JA 2ECKA 1UEJA 3Q3EA 4U7TB 2OHFA 1LK0A 4JI4B 4AJEA 1O0BA 1J2EA 1MHPA 2B0CA 2VDUE 4YFVA 1XHBA 1ZYUA 4G67A 4HATA 3CRNA 4GKJM 1HYHA 3B9RA 3D4PA 4JYPA 4P7FA 4UNRA 1SZPA 1H1LA 1TKAA 1FP6A 1WWKA 2OV6A 2X3YA 4MARA 4GX0A 2A3RA 3DV0B 4RJJA 4DDUA 2C0PA 4ZQBA 2I2DA 1L8XA 4D57A 1RQ7A 1R6TA 2NV0A 3K0HA 4B3HA 1MQ8B 1Q1EA 1C8LA 4QC2A 5IANA 4X90A 5KUTA 1GYRA 4BV3A 4TYYA 5KYVA 1LSOA 3ZNNA 3WLOA 1QANA 3AJIB 2UUOA 3BWXA 1S8OA 3I6QA 1Y8GA 4WZ6A 3RKSA 3V1KA 1JIJA 2WJ3A 4G56A 4YRAA 3TTVA 2IPXA 1N0HA 2Z2KA 4RIHA 1YIAA 3U37A 4Y7CA 4HRXA 2AJDA 4I99A 2ZR8A 4HZIA 1VKNA 1PT8A 4NJMB 4JB3A 2JI6A 4HDNA 4ZVRA 3VH2A 2IYLD 4O2BA 3OPQA 5ESRA 3ZCTA 3OT4A 3V2GA 1K3UB 1PR6A 2GGSA 3IAM6 3LVQE 2FF5A 4EPTA 1MDFA 3G1WA 4FGJA 3VKGA 2EKQA 2HOQA 1SG0A 2Q3JA 3NVMB 4YUVA 2PO7A 2JLRA 2CEKA 2RHGB 2TS1A 3IUPA 4E2FA 1MU5A 3TRDA 3P4XA 3K0EA 3N07A 5EJAA 3I0NA 5LA6B 2XTZA 3OD5A 2D5IA 1QAOA 3D3WB 1M1XB 1XGKA 4CIVA 4EFNA 1OXVA 1U7TA 1G0OA 1KFJB 4TPKA 2OK7A 1TECE 3PFCA 2XRYA 3AL3A 4RV9A 3VMMA 4UDNA 2CFOA 1TVCA 1ZMOA 2OUIA 3EEIA 1GRNA 1UBUS 2BM0A 3OESA 3DZHA 3OEED 2CE7A 1KVTA 2X0IA 3CZ9A 1BDMA 1IHUA 4GIPA 1ORWA 1E7QA 3GGSA 4UJ5A 2WSSA 1M83A 5BV7A 5FADA 4ETWA 4LBZA 4IG9A 4OATA 4OX9B 1JS1X 1CZHA 1OLUB 2R6GA 5ETJA 2HXYA 3EOAI 5EN4A 5KI6A 2JCVA 4YJ2A 1E9FA 3WLLA 3KIPA 3MJRA 1XJCA 3P0HA 2X0FA 4BXOB 1RI3A 3ZD9A 2G6TA 4E1VA 4EWLA 1J2JA 5CVVA 3NP9A 4BQSA 2PKRA 1PGQA 3JYPA 4DG8A 4S2UA 1KEEA 1FNCA 2P1RA 5E4YA 5AUOB 4TVSA 5CB4F 4FD2A 1CLEA 5LQJA 2O2GA 1V47A 4M0LA 3ER9A 4Z3OA 5JISA 2G3YA 4U7FA 3IPLA 3UAXA 4H1TA 3NAGA 2J9FB 521PA 4NK4A 2GK7A 2CXPA 1J1ZA 3D3JA 4N7JA 5SYMA 3DOAA 2UVPB 3DZFA 1L5MA 2GETA 5HW0A 2PS1A 4E5KA 2PV0A 4FCTA 2RB5A 4R9NA 4Y7DA 1ULUA 4U5QA 4YT5A 3WQSB 3FBGA 5EQTA 2IXEA 2YMMA 5F2KA 4M1QA 2QJRA 1M8FA 3DBOB 2NYUA 1PLLA 3W5IA 4PD2A 2FLKA 2O8VA 1LS6A 4EJSB 2QZJA 3L8EA 2C20A 4EI9A 5FO0A 4QUJA 1F6BA 2NO4A 2EVWX 5LWHA 4G0PA 1OVGA 1PNVA 1RT9A 2A9FA 2C57A 3A1VA 4J1NA 3OPYI 4Q1VA 2ZULA 4UUMA 1YI1A 1ZD3A 3ADPA 1DRVA 2V6FA 3AKZA 3DOUA 1BZYA 1KY5A 1D8TA 4L6V6 4OAPA 2AHOA 1XUOA 4YJ3F 2QXTA 3V1UA 2ADOA 4KXNA 4R71A 4ZAGA 4H1WA 3ZV3A 1KAHA 4XRGA 3EIOA 3I4VA 1T2DA 2AV6A 1HO3A 3DT8A 4HUTA 1CZUA 2CRUA 1P5RA 1GUDA 3HZRA 3T3MB 3SQMA 2AOUB 4BNTA 3MTAA 4EQ6B 2C00A 4FXOA 1MGOA 5CVEA 1LNQA 1XTSA 2ZT5A 4MSUA 2FHSA 4CQLA 1XLVA 4D3ZA 1Y1PA 2G04A 3EQ6A 5B53A 2N1BA 3PCRB 1G98A 3RAPR 2OZLA 5F51A 3H9UA 2HHCA 4YFYA 3TAUA 5ESWA 3KP1A 3A6FA 3MTIA 1PJ8A 3QVGB 4OMDA 4US1R 4QBHA 4DR7B 2KNAA 1UF9A 1WMBA 2FMIA 2Z2YA 3KUKA 1POWA 1XDSA 1YR9A 2NSJA 3D8NA 3G0DA 4KB5A 3X3HA 4MVJI 1SZDA 4O4LB 1GCOA 4CMEC 2W9XA 2G3QA 1I2ZA 4V0MA 5A1TA 3WB1A 2UXDB 1IZZA 2J5RA 2NO5A 1E5LA 3VR2D 1HGXA 3LF2A 1G4HA 1RHUA 3F5DA 3MWKA 2YCBA 4H18A 4HTFA 4I9FA 4DL9A 1Y6QA 2OMKA 3N74A 2J1LA 4V24A 1W581 4E31A 3MOIA 4B3MB 3DM5A 3PENA 1IL0A 4J0EA 3ZGYA 4IBOA 1WHTA 3CNBA 1II9A 1E3EA 1QQ7A 4LSZA 5IVIA 3GQBB 1CSEE 3JVVA 3OZWA 4NOKA 3G85A 4K03A 4RPKA 2XVYA 2XA2A 1XEXB 5TF4A 3RANA 1E94E 2EJVA 3ZW8A 5JROA 4MPDA 5DYIA 5JAPA 2CDCA 3SYKA 4EHHA 4LXXA 4J4TA 5J4HA 2XA9A 2VO1A 3IXLA 2QLLA 1R6BX 3GO4A 3PDHA 4R8LA 4CN9A 5C7LO 2AKYA 3U19A 3KDAA 4DXHA 5CXQA 1FXSA 2YJTD 3B1WA 4QTZA 5AOCA 1CNEA 1GV0A 5CBPA 1ECPA 1Y3DE 2BEUA 4MAMA 1YR3A 3HV2A 3M4JA 4GOOD 1COWD 1RLUA 1YJAA 2VYNA 1Q7TA 3OQOA 4FCVA 1V41E 3BWMA 4DJTA 5DN6A 1LX6A 2X1HA 4B6FA 3V4OA 1RXVA 5I7RA 5DGXA 5JVDA 3CQ9A 4DR5B 1VHWA 1CJSA 3JQAB 2O3TA 1EFKA 1TKCA 1IXSB 4PHGA 2ORIA 4D9IA 2GK4A 4PS0A 2PNJA 3W1VA 1OU0A 4EDFA 4F5YA 1YFZA 2Q0XA 1GGJA 4IV8A 3SS7X 3T5CA 1V3VA 2HPVA 4ZHSA 1OXKB 1P7YA 5LLSA 3O82A 1IPFA 4P16A 4DV4B 5F7ZA 1ZEMA 2QN3A 5IUJC 1SXHA 1FFXA 5DTJA 2ZUFA 1JQLB 4Z54A 3KEMA 1GYQA 5KTNA 1FMLA 2VDQB 3OA2A 5IJ9B 2XSZD 1Q14A 5H70A 3V42A 1PVDA 3GRUA 3C74A 4Q34A 4GSYA 4CMHA 3BE4A 1V8ZA 2O1EA 4L5AA 2ERCA 3TPZA 1TM4E 1VKHA 3MS7A 4GT1A 3L1JA 3IAFA 3KZNA 5E7JA 4P4LA 4K9OA 3LW5F 1P0QA 4FFNA 4MV8A 1ZK2A 2PGDA 1MTOA 4WZBA 2H08A 3PUYA 3PFNA 1W5BA 1GAWA 4H3SA 2W2OA 4TS3A 2E85A 1B6TA 1J56A 4EG6A 2WZJA 1RYMA 1XVIA 3BFVA 2HYIC 4R8VA 5A0VA 3VDXA 4ZYUA 5BMVA 3OX1A 3P9PA 4EEXA 4YCLA 3ZG6A 5LIRA 4JHXA 4OEHA 2IEIA 2VDWB 1H2YA 3B1ZA 3EGVA 4PC7A 4KXWA 4WKOA 4B31A 4W7IA 4Q15A 1XNQB 5JSFA 1FNNA 5G02A 5H3CA 1T9KA 2QZPA 4QDTA 4DIBA 2B4AA 5KJ1A 3FPHA 1ZBDA 5DEIA 2JBAA 3V4SA 4Y30A 3MMXA 4HXYA 2HMSA 2RAFA 2I29A 3GUYA 2WAMA 2E4WA 3ZCPA 3PEWA 3DVLA 5EHZA 2P2GA 3SFVA 4I9HA 1OPXA 2V7XA 2VJYA 3CUSA 3AUKA 3TR6A 4GITA 1UDBA 2LVPC 3DAFA 4B7AA 1FTGA 2QK4A 1AQIA 3OQMA 2JHPA 1QOQB 4PHCA 1Q16A 5C8YF 5JXHA 1RPNA 4MVJG 5FV4A 3JWGA 1VRWA 4ARZB 1DGFA 1Y8RB 4EO4A 5JPDA 2B2CA 4LDRA 1IBSA 4L6AA 3EPRA 4QULA 3UV6A 1G21B 3ICVA 4R1PA 4U00A 1R00A 1A97A 1GU1A 1WB6A 4NCXA 4ZREA 3K9QO 4CF5A 1HRDA 1W25A 1XN1A 1O87A 2XEXA 5A2QS 1PL6A 4MLZA 4OYHA 3AKYA 3EWNA 4XR9A 3AQIA 5KO2A 1TFRA 5DWVA 2RGOA 1RKUA 5JBIA 1CR6A 1V7QA 3E5NA 3TKYA 3V48A 1A7AA 4QXQA 3ZVMA 3ZC7B 1H1TA 4P93A 1E3IA 1F8GA 1TZKA 1MEOA 2IZ5A 5E95A 5BNWA 1U94A 8ADHA 4M3NA 4JJFA 1U6JA 2O0JA 4D81A 3U17A 3THOA 3GZNA 1GR1A 2PUTA 3ZDBA 1SURA 2H1FA 2YWBA 1OJ7A 2GRUA 4DV4M 2PVPA 1LPMA 2A59A 3Q6MA 1DC4A 2XWSA 4I66A 1AMOA 2EUCA 2A33A 1A27A 1K4MA 2A67A 2D06A 4LJ4A 2PIAA 3AY6A 4ZVUA 3IC5A 3NKLA 3SEAA 3DS8A 4PW0A 2PZLA 1U4SA 5H9WA 1FXWF 2VP0A 4NZNA 4NU8X 1X3SA 2E89A 5LD2B 5AKIA 2IITA 3C98A 3EARA 1ENYA 2GT1A 2PBRA 3DQZA 1SVLA 5DHPA 5AKXA 1O0SA 5FTNA 3TE7A 1ETHA 1Q0PA 3U39A 2C99A 1T0PA 1PJRA 2SCUB 5B3KA 3QF4A 2EFHB 2VPIA 3HNPA 3OKPA 3B82A 2YWXA 3IEIA 1DUVG 3C58A 5BQXA 1F20A 1JX6A 2X8WA 3LO5A 3RU3A 3TW0A 1YK0A 2OL4A 3MWEA 5IJ0B 1MOQA 2R8XA 2XTAA 1NVUQ 3GVCA 3L1HA 4CDMA 3WFZA 3PCXA 4EY7A 1B76A 3KXIA 4L0DA 1BHSA 1F1JA 1OYOA 4EW1A 1Z5OA 2DPYA 1ZGCA 5TMPA 1LH0A 3AKEA 3ANNA 3QPWA 3TSWA 1SKUA 4CLHA 2HBYA 2ZAGA 3M1IA 1TZBA 4N5DA 3FOFC 2GAAA 3ET5A 4HJXA 4TMZA 3TG8A 4FWHA 5M5BA 4TUYA 3ZZTA 3ZKWA 1V1MA 4Y2TA 5DM70 1TH3A 3FOEC 5DE3A 1EVJA 1BN7A 1DAKA 3AHJA 1DBVO 4QTTB 3LOUA 1PZXA 5BN5A 3K6SB 5JYEA 4ENTA 2VHXA 4V1CB 1EU1A 2RHRA 5DHRA 4AZ3A 3DR3A 2AI3A 3GVHA 4DZRA 1JAYA 1S2OA 3CNNA 4RE6A 1D4ZA 2DPHA 1PQWA 4U2BA 2PL3A 1EK6A 3NIFB 1CY7A 5IAGA 1HL3A 3OBBA 4MW9A 3GLGE 1RAGA 2Y1KA 3NJRA 5KQPA 3WK7A 2XUAA 4OK5A 3E35A 1Q1ZA 1CY1A 4H1HA 3WGOA 1QDTA 4CR7A 3QWFA 2HMWA 2VJOA 3KOYE 1RM5A 3K2IA 4MVJD 3MEQA 2A14A 2FEOA 2J31A 1TKRA 1TA4A 4MIKA 4BQRA 3QZUA 5JTTA 1YQ9A 1U1FA 1NQAO 2BH9A 1PJTA 3TQCA 5KMGB 5JNWA 5K2MA 5CYPA 1GPYA 3M5WA 5HJ2A 3TIXB 3VR0A 1N2JA 2WU3A 4AJJA 1G7TA 2QU8A 3QKSB 3VYSB 3DL4A 3PWZA 2XB9A 3Q3CA 2P75A 4GEGA 4NJMA 4ZICA 4ZZ1A 3CNQS 2KXEA 2BGIA 3G8CA 3ORYA 4TS9A 1T29A 4H4CA 3LCMA 4DOMA 1CUYA 5KOJB 1II8A 1G2IA 1U3DA 4PLWA 4YRFA 1MB4A 2P5TB 4D45A 4MB7A 2OGUA 5T4HA 1TZJA 1GV1A 2QB5A 1F2DA 5J5CA 3GBSA 1EXMA 3I2IA 1YCGA 1QRRA 1RBMA 1TTTA 4JFAA 1PR4A 1PL8A 3UMFA 1ZJ6A 2FZWA 4D9JA 3KE8A 4RK1A 2I1VB 3NMUF 5K0GA 4TZKA 4PTLA 4UBJA 2C9OA 3HRIA 1DV2A 1XRRA 5FLXS 4JZKA 2YWDA 1YVUA 2OZEA 3KKNA 3TZQA 3W06A 4BFXA 2WJYA 5JASA 2QE6A 2WILA 3Q7TA 3CT4A 4N0EA 2YMLA 1JDVA 4WWHA 4AYXA 1YL5A 4DJ5X 3QHPA 5IDXA 5HNKA 3HKDA 1OFUA 2EKFA 2Y1CA 4A0GA 4DCVA 4URFA 1RI1A 3WV5A 4LJ5A 5DNYB 4GMXA 4J07A 4U9HS 3W04A 5IVHA 1O3YA 3CF4G 2JLVA 3HR4A 3DWEX 3ZGNA 2G36A 1MAVA 4NMWA 1PT6A 4AIRA 1NNUA 3RSGA 2VC2B 3FPCA 4AM8A 2KB0A 4CMEA 1XL0A 2IK8A 3KZKA 1Z2AA 1ZHFA 9LDTA 2PL9A 3FFWA 3EVAA 3NEYA 5D5HA 3TSCA 2GTIA 2UXCB 1QYWA 4J0CA 1XZMA 1GL9B 4EKNB 3DPSA 4EL5A 1JF8A 3L6BA 4L28A 2B0JA 1DQNA 2OCAA 4DWWA 5K0BA 4Y2VA 1QH1A 1M1UA 1VC2A 3ZE8A 4D79A 3SIPA 1MORA 1DKOA 1Y80A 3LHSA 1AF7A 3LY7A 1XMQM 3L49A 3LQYA 5CDFA 1A9XA 5DNEA 1YBVA 3FIJA 3Q8XB 4KN9S 4OHUA 2FMKA 3F5FA 3RBVA 4XIIA 5K03A 4P0QB 2W48A 4NNOA 4DTCA 4K81B 4MGIR 5F3DA 3KZOA 4BV9A 2VQFM 1KI1A 3A1FA 1KOGA 3HP4A 2JATA 3A7DA 3LT5A 2YQ4A 3SDBA 1L5FA 4BY9E 4UBNA 3GOHA 1A7UA 4OK6A 1RI4A 3KFVA 3ZZUA 3U6BA 1FTWA 4EG7A 2ONJA 1T5SA 1BJTA 1SM4A 2UYGA 3P7MA 5KWJA 1L2CA 4KQJA 2BZ0A 1U1GA 2DBQA 4P3XA 3TNJA 3HVRA 2BM9A 4GHAA 2PVCA 1UKBA 2Q1YA 3OMWA 3GA7A 1HBJA 1NR1A 3R3JA 1E3MA 3L1IA 3JAWA 5L53A 3QENA 1FZTA 3CLRC 3HB0A 1I8TA 1VKRA 3HH8A 3II6X 2KBEA 1GTL1 3VNUA 1JN0A 4YNBA 3IIEA 4IEFB 5HK8A 2GKSA 2AXQA 2RSLA 2PZGA 3VHXA 5ICSA 2QTRA 3Q8WA 4IHJA 4X8MA 5LFAA 4DQDA 2NQ2C 2CHVA 2BY4A 3DZIA 3WGHA 1IHOA 3GLTA 1SQSA 1C50A 4RHUA 3WWYA 3TOCA 2H31A 1IHYA 2G4VA 1XYYA 3QXJA 4UCXA 3TFQA 1DPGA 3AR5A 4Q93A 4DVJA 2X7HA 3ZZMA 2MTBA 3OE7D 4YLEA 3S7ZA 3B48A 4YJGA 1GPMA 3EA4A 3FLAA 1X0XA 3SF0A 4G5YA 4WNIA 1FSPA 4EJFA 3GL9A 4N5MA 2R2GA 3MTQA 1G41A 1DMRA 3EWIA 4EVIA 1DELA 1FP7A 1EGQA 3KYIB 2QNJA 3ESRA 3PE6A 5IAJA 5J3JA 2MYPA 1QPBA 4B3TM 2HCJB 3AIKA 3ENQA 2ODWA 1SO8A 1XB2A 2XOXA 4X1KA 2DY0A 5AVJA 5TV2A 3BILA 2VYVA 4TMWA 1E5DA 1ZRNA 3SXUB 2WSFF 2VPPA 3IERA 1NSYA 2DTEA 2CD9A 5EIAA 3S0JA 4RTKA 1YR7A 1FMFA 1IY9A 4LF9M 1D04A 1VB3A 2JHCA 3LPMA 2INGX 4R54A 4UW9A 4YRTA 2X8AA 2VJQA 5ARDA 5LIPA 3DWIA 3WYDA 3W0FA 2JFBA 5KKAA 4E5YA 1Y6GA 3UK2A 4C08A 4EGJA 5C0OE 2UYYA 4AP6A 3GF4A 2WU8A 3LX5A 3OM1A 3T1TA 3CEHA 5BV8A 2OM6A 5A02A 2VP3A 3ANTA 2V8BA 3I9KA 4IBCA 3WGZA 1CRWG 4OVZA 4EEKA 3OLWA 4Y28F 5AHWA 3LU1A 2IKQA 2JZ0A 3KB1A 4BKRA 1OX4B 2JIMA 2DWNA 1JIIA 3EIUA 4N12A 1L3BA 4BNFA 2V6GA 2BBWA 1KJYA 1AGYA 8OHMA 2QSUA 1YULA 5AJWA 4PNEA 3EW7A 2VQEM 1UMBB 1USIA 5CVJA 1SVKA 3FZGA 3ICCA 1U2QA 3ENZA 3OTHA 4N8DA 5KSYA 4EENA 4R68A 2PFGA 4TV9B 2FQYA 4CMAA 3NGMA 1QO9A 4KQ1A 1Q3CA 1N2IA 4M89A 3WAGA 2PZ8A 3C14C 4CM5A 4R40A 1IEVA 5AJHA 1DSSG 1U0JA 4FR5A 2IJGX 1K6MA 1L4BA 1VE1A 3FTQA 1LF5A 3OIWA 5ERXA 5TS2A 4B2YA 1ZUNA 1G7CA 1VBFA 1H66A 1YJQA 2XYQA 3SZUA 1PZEA 1M6WA 1KTVA 2AOTA 4HEJA 4QWMA 1G1MA 1JTEA 2VQFB 2I3GA 1LQ2A 1JB0F 2IELA 2WIJA 2VAXA 3IV6A 4G3XA 2OCBA 2ZVDA 3BKWA 4UVDA 5FUBA 5KC9A 2R5FA 2A7XA 2QD4A 2HKJA 4X45A 5F5XA 1ZJWA 4XD7A 2EQ5A 2ZJ5A 1F5NA 1MJGM 2WIBA 4DR3B 1Z4IA 4F5WA 3BRWD 1MEEA 4HYQA 2A1UB 4JXXA 1C3LA 4CDRA 2I54A 4M38A 4DAOA 1WB9A 2EEZA 3UMGA 4LYDA 1K9VF 1T2EA 5KNDA 4RZQA 3X1ZA 1DXYA 1Q15A 1E5VA 3VR5A 3GY0A 4F6LA 1V92A 1RMYA 1UAYA 1UOPA 2DUNA 3E22B 3VR6D 3N53A 4A23A 4AJIA 1RBQA 4UHEA 2ZB7A 5BURA 2HAKA 1CE8B 2R7LA 3R09A 3RV3A 3KTAA 5DMHA 1IY2A 2CJPA 4ZCQA 2W2LD 2AIRA 3NVKI 4P7JA 3WOVA 3C0KA 3EN0A 1TPZA 4NQRA 1K8QA 1WE2A 4MI1A 2H5XA 3D4OA 4OLBA 5T4BA 3MLBA 5EXDA 1SCUA 3AVYA 2DKOA 1E3QA 2F4NA 3HCAA 4PX9A 1UPXA 2A78A 4OPMA 3U4DA 4A92A 2UUBB 5D84A 1CUVA 1EFCA 1K3TA 2B69A 3EAQA 4INOA 1RVV1 4K9MA 4CKBA 2FDRA 3KAJA 1ND6A 1P72A 4RMIA 4K87A 2R0QC 4OX9Y 1JEJA 3CZQA 2FW1A 4I46A 4O4JA 3STUA 2ONCA 4N54A 1OFTA 1D7AA 4FGSA 4HH0A 4B33A 1M8GA 4FWBA 3GYBA 5EIFA 2G1JA 1MB2A 4K6CA 1QYXA 4FLMA 3C3KA 3A1SA 1I7NA 4LRUA 3PF8A 3Q8GA 3NH9A 1AH2A 4RV4A 2RGEA 1LDNA 3AM1A 2PJDA 4M86A 3W90A 1MJNA 2C5SA 3ACCA 1BCRB 5IJAA 1ZSYA 2TMDA 4C4TA 3DTVB 2F55A 2V6ZM 1PFUA 1AKVA 2BEVB 4XIYA 2FRVA 1O8BA 2HMVA 3PQEA 4G0NA 5J2UB 3USCS 3WB9A 3X1XA 5CA0A 5JW6A 5A5EA 2HA3A 4PLTA 4F9GA 5EPUA 3H2BA 3EAFA 1CW2B 1TK3A 1A4UA 1EDOA 4ND8B 4QNMA 2AD1A 4H7IA 3R1IA 4MGZR 2BMFA 2RHWA 4ZI3A 1ZISA 2V1XA 4P17A 1TKBA 3ANSA 1XJWA 4CV2A 4RAOA 3V32A 5I7HA 4HUQB 2PLAA 2PZJA 3EXHC 4NMLA 4K9PA 2C96A 2VSFA 3AFHA 3DMPA 1VLZA 1ZZEA 2Q3LA 2GD1O 2ILVA 3MBKA 4BX3A 2AZ4A 1E9DA 3HN2A 4L5JA 2JD2A 3K9OA 4IIJB 3UUGA 1Z0SA 3K1JA 1IMOA 3UYKA 2R4JA 3M6LA 1JXQA 3AOEA 1XD2B 2IIPA 3I01A 1SVNA 3DPIA 3PGVA 3NEAA 2EX0A 4F2PA 3X1MA 3RSHA 4GC9A 1MH1A 3TWOA 1I3MA 4Q7QA 1WMSA 1QYRA 4CXMA 5F2EA 4QAQA 1CVIA 4KAAA 4KR3A 1NVMB 1P7ZA 2OHHA 3LY5A 4EVQA 5TJ9A 4HQ6A 1MOPA 2XB6A 4EGAA 4E88A 2GM4A 5DN6D 3HMQA 5A9SB 2I2BA 5T3UA 1BSVA 1NVXQ 1TMGE 2O6HA 3DE1X 3NKFA 5EIBD 1YJCA 1TAQA 2FFHA 3ZZNA 1VE7A 3G1UA 3IT1A 5HKLA 5A5DA 3CJQA 2BP7A 4YMSA 3W78A 5JSHA 1UFVA 4MP8A 3KYCB 4G4SP 5TMDA 2O0LA 3J7AS 1NAIA 4TLCA 4XRRA 4ZGWA 1CIPA 4D4HA 1QAQA 1Z34A 3GFTA 2AFVA 4IX1A 2RCNA 4RS3A 2FZCA 2LWIA 2XVAA 3HXKA 3KLBA 4GD3Q 3DMNA 5DT9A 5AOBA 4FYKA 3MMZA 1GDTA 1AO0A 3JQPA 4M8NE 5G41A 1K5HA 1W4AA 2X15A 3GB9A 3NLLA 5I5EA 3K2EA 1JNYA 4M7RA 1NZJA 3S2ZA 4GECA 3WIUA 5BSFA 1R4MA 4LYJA 1CP2A 3C97A 4X60A 4DV3B 2H9YA 1QZEA 3G7NA 1GGHA 1TDHA 1X14A 5L7TA 1XVTA 3SBJA 2XXJA 3SATA 4NBLA 2VDRB 2HXSA 4LFCB 5JXIA 4B08A 5ICGA 3QBTA 3ZOZA 4RQAA 1JEYB 1F06A 2PWZA 1SA0A 3QKUA 1DGHA 4LECA 2C3PA 2CBXA 3EMDA 4IDCA 4WMLA 4WL0A 1KEWA 3TLAA 1CNMA 4QU5A 3WBKA 1YUNA 3AIIA 1Z0ZA 4TLEA 2X2PA 1KSFX 3GWZA 2B92A 5LWQA 2HRZA 1T9CA 2H59A 4RHCA 4DLPA 3ITNA 4JP5A 3CVUA 1VCHA 1G8JA 1L4GA 1PJ3A 2R8PA 2ZUBA 4V1CA 1KWKA 1UBMS 3RVNA 1TM7E 4FT4A 3S28A 5KYWA 1I2MA 4DRYA 3A1DA 4KQFA 5AJZA 2Y2VA 4ZCPA 2CV2A 3B3AA 3PUHA 1P4AA 5HP4A 5C5DA 2AZTA 1WGNA 1U7XA 3P9XA 4YJKA 3B74A 2DHYA 1U8FO 2JP7A 1HZZC 1E4EB 2D2VA 3BWYA 4CIZA 1M2NA 1MGPA 1P60A 1RAFA 1Z28A 2CWWA 4LG1A 2Q49A 4MWBA 4XLLA 5K51A 3PHLA 4CKBB 1UOEA 3QUQA 3KVVA 5KWVA 1XNQM 3LKBA 3LPCA 4C9BA 2EZ9A 2P2CA 2XFSA 4GUDA 5LA6A 5TGTA 4QYXA 3RG8A 1R0KA 3LNTA 4N3AA 4O4IA 5ARCA 1BGXT 2QLNA 2FX5A 4IXDA 1E3WB 4XB1A 3DMTC 4BNNA 1JQBA 2QW0X 5M34A 4ZEVA 3ICEA 1NN1A 3LK7A 3A6LA 3O95A 4E0BA 1EZ1A 4KWHA 1M1ZA 4O5AA 1D4FA 4MLDA 2QTCA 4CNQA 4XE5A 1KOFA 1HEYA 1SQ6A 3OTWA 2NO7A 1M2HA 2I71A 4EJ0A 4MI3A 3GUVA 4FCCA 4CETA 4BP1A 1CY4A 3DT9A 3R8XA 2Z8ZA 3SR4A 3JD4A 4IMPA 3E8MA 3WVNA 2OHJA 1LVHA 4P3YA 3K70D 3HFSA 1WZEA 2IL1A 2GXUA 3KSXA 1YZYA 2GO7A 3IIMA 4OJNA 1N78A 1OLSB 2FW6A 4QYWA 4F3KA 5D85A 1WMAA 1A8IA 3OZAA 3U44A 1AV6A 3LOPA 1G18A 1BH6A 3T0IA 4DLZA 1P33A 2C7OA 4D44A 1UMBA 3GPYA 1U2EA 1KJNA 4JR2A 1A2OA 4TKUB 4D8XA 2GAOA 2YC2C 4ESHA 1X7XA 2JI9A 2QVYX 4MQUA 4JXKA 4C5BA 2R00C 1WIWA 3MRVA 1UKYA 3UYLA 1LRJA 1XA4A 2WHQA 3VOBA 3T12A 5KEIA 5JWRA 5BVHA 3ODPA 1GTJ1 4FMBB 4LBYA 4QREA 3VAAA 2JY7A 4BLRA 3K0CC 3CBGA 4HLUA 1Y8AA 2J9RA 4EMBA 4F7DA 3SZ3A 2BE7A 1UPUA 3NDJA 3R7DA 3MJ5A 1XC8A 3MAAC 1A9TA 3EULA 5CJPA 1AF4A 3PC8A 2IWHA 3UHJA 2A9KA 5C34B 4F4UA 1B42A 5BWOA 4CGYB 2PYZA 5IHXA 1IQUA 5K0JA 3FKQA 1K7SN 4OGLA 4XWOA 4LYYA 3NOQA 4LY9A 3REQB 4IHKA 3SOPA 4B34A 1QYCA 1N36M 1WULS 2JIOA 2XIQA 3K6JA 4D9BA 1QB7A 2F8LA 4J0DA 5HF5A 4R1QA 1ATIA 1V5EA 3CG0A 2ZDGA 3QJYA 2NUAA 2OSVA 2PXHA 4I5DA 3TQHA 1V9CA 2WRZA 2B4YA 2RGWA 2AOWA 3QYAA 1VSQA 1LSUA 3FWYA 1NP3A 5BR4A 1ZK0A 1PU2A 4ZAXA 2PAFA 4F4HA 2Y99A 3L8GA 5EMMA 1XCLA 2ZRKA 5H3HA 5H4HA 1NE2A 5IW8A 2JGRA 3SN6A 2BF4A 2OFPA 4MUIA 3HCOA 4N7MA 4OA5A 5JYBA 1B23P 1X0VA 1XMJA 4XYGA 3NQ41 5FR2A 4UOZA 1WUKS 3UWPA 3OCUA 3OU7A 2RHDA 3GPPA 2ZBDA 3LDUA 3JVEA 5DXAA 1CD5A 3DE5X 4OKIA 1JDUA 2IYRA 1E1LA 1Q91A 2OB2A 4QRDA 3EW9A 1JFSA 1LBEA 5ESXA 2PSHA 4RYDA 1PNTA 1GFSA 3G13A 1NHWC 3U4IA 3P0JA 3NDRA 3FVRA 2CHGA 1USWA 4X44A 2XNSA 1EHYA 2G0TA 5KTKA 1HQKA 4LKRA 1SXJE 3FOZA 1GQYA 1KGSA 1D0SA 5JD4A 3E7WA 3JYOA 1KY4A 4ALNA 2FZVA 2QLBA 3A6ZA 3BRSA 3FMGA 3UAYA 2HT1A 1XL1A 3O38A 1QDRA 2EF1A 3LKVA 2XFTA 1P2FA 1T1RA 3WJ7A 1JE0A 1IEWA 2E5LM 5JZBA 3CHYA 3FHOA 2HB6A 4C3UA 1U7OA 3ITKA 3KK0A 3SM9A 1RJDA 2I2FA 4XWGA 4EHDA 4LYEA 3F3KA 5B4TA 1WVIA 3DQPA 2H4ZA 4QBGB 4NNJA 1ISHA 1ZI6A 1QYDA 1L1RA 2C3OA 3BK1A 3CNHA 4H16A 5C51B 2FFRA 1J0DA 1PLJA 2I4OA 4K2HA 2KSQA 4OYRA 4UHFA 4BLPA 2ZBPA 3IMFA 4JEMA 4ZANA 4A26A 1PUIA 4DYHA 4TM7A 4ZYTA 5C5CA 1ODKA 3FHCB 1ZJ4A 3NASA 5ITYA 1PWZA 1U65A 1XE3A 2BGJA 4I4TF 3UY4A 2FLVA 1JSLA 1HQCA 3LHKA 2JVIA 2IYSA 2ZRQA 1Z22A 1ULBA 1ORYB 5J9FA 1E99A 3G2MA 3OJEA 3SYLA 4RFSA 3DBLA 3HTXA 4Q12A 4ZT3A 4HF7A 1QTNA 1C4OA 4LAFA 1MA3A 4AY5A 5F76A 1NMXA 4MQ6A 1ZZGA 1QZUA 2QHXA 1KQPA 3B13B 3PDIA 3PXXA 3K4PA 1OYWA 2HX1A 5BRNA 3T3NA 1SVWA 3EAGA 4JFRA 4MV7A 3W6PA 4GL4A 5J58A 2VHZA 1CUBA 1EDBA 2B9VA 4RVFA 1W30A 3O2NA 4CFZA 5A6SA 5CA1F 3RREA 5JJCA 3FHTA 4H7HA 5JANA 1G66A 2P7HA 5EQDA 2XCQA 4TN5A 4HMQA 2VYVD 1L2BA 4BO3A 4COKA 1L7RA 3KQUA 1OTYA 3JZAA 1NTOA 2FRXA 1J8YF 2G0AA 3HDGA 1SOMA 1JJIA 4E2ZA 3CF6R 5BW8A 3O1IC 3E8SA 1NLUA 2C2HA 3JQCA 1VDLA 2RGNA 1ZUIA 4D97A 4U7HA 4L7VA 3BF7A 3TRIA 5KNBD 1KI8A 4PCZA 3C6ZA 5A04A 2GWHA 3ZJYA 1AZLA 3B9QA 2BP7B 4QEKA 4CT5A 1R15A 1J2YA 1QJ4A 2R8EA 4JI7B 3L7DA 4NE9A 1UJ6A 2A1UA 4R3NA 1AQYA 1KMMA 3I01M 5LMUM 3TZEA 2OPHA 4D0NA 1DTWB 1Y5MA 4HWRA 1GVHA 4EHBA 1P0MA 1GGEA 2VAVA 3FGOA 2XIJA 1P5FA 4P36A 4Z4GA 5LMZA 1OZ0A 3KPWA 5GGXA 3EZXA 2PA3A 2YWEA 4ND3A 2X4LA 3EEFA 4QBIA 3RU7A 4BKMA 1DCFA 5LM3A 4C0KA 5LDGA 3OTOB 2JG3A 5E6UB 2DR3A 1VG8A 3OBIA 1KPHA 1OR8A 4ATNA 1C9MA 2ORED 1GDHA 1NBMA 3KV1A 3GLHB 1D2GA 4DLUA 4YQZA 5FORA 3WGYA 3PUIA 2XHZA 2Q9AA 2QENA 1GARA 4TSFD 1UM8A 1DG9A 3MGCA 4QYIA 1O9BA 2O06A 1D0VA 5IJZA 4KGVA 2R7KA 4NENB 3RHTA 3WGJA 2IA5A 3OQHA 1Q50A 2BLNA 1KQOA 3C48A 4HNSA 4IIUA 1WZNA 1NQVA 4PE5B 4L8WB 2C92A 4WJZA 3E18A 3T9FA 2R18A 4EHKA 3CB4A 3QVXA 4OFWA 1UT8A 4Y8VA 3UOWA 2UXBM 4QE3A 4U6QA 4WX2B 1U28A 1D4OA 1PS9A 3EUEA 5YASA 2JVKA 4COOA 4P82A 1LB1B 3A26A 1YBFA 1ZITA 4WNCA 4V0QA 3OM8A 2YZNA 2G72A 3ULKA 2Y68A 1PL7A 4KMSA 5EGNA 1HNWM 1JLKA 1I33A 3FJOA 4PZLA 5FUMA 3T1YM 2B9EA 5AP9A 3SMQA 3WICA 4D8VA 1RQRA 4TS4A 5KOIA 1IEXA 1SOVA 1DKNA 3ZIAA 4AN0A 4Q4HB 3KZVA 1C3OA 5FTMA 2YINC 1HG1A 4MCHA 3SYRA 2LDBA 6Q21A 4E5MA 3EFBA 1J9EA 3TBFA 3U62A 1R8JA 4JJ4A 4DM7A 2J32A 2WT8A 1QXSA 4HQNA 4XIJA 3FPLA 3BXFA 1ZMTA 4BQQA 2PTGA 4JR0A 1GU7A 3AF0A 1QBGA 1GO2A 3DMDA 3M8KA 1ZQ9A 4XUDA 3S2SA 2FWJA 3DDHA 4QVGA 4WK2B 4XCXA 2C1ZA 1ZC4A 2GD2A 1D0LA 3GJRA 2PGIA 3K2BA 4PG4A 1MO4A 1R37A 1T3LA 3E27A 1XJ0A 4JGGA 1I6MA 1NY5A 4UXHA 3SCZA 3TTSA 2YR0A 1E4EA 1O6ZA 2H7VA 3DOOA 2VPXA 4XKJA 4YO7A 4UVGA 5ITZB 3WZ2A 3IT0A 4YTEA 2P3QA 5TVGA 4JI2M 1F2UA 2CLHB 3HXTA 3KWFA 4H15A 4WAUA 1T6XA 2XBUA 3QGMA 5F73A 2ZUTA 3RGGA 5T5QA 2VQSA 3I6IA 3VAZA 4PGFA 5LP6A 2NZJA 5ITSA 1TJPB 2G40A 4DCPA 1SOAA 3LPAA 4FX2A 3FG9A 4LRSB 2IS6A 1K27A 2X5KO 3EE6A 1M2EA 1TK9A 4L5BA 4MQFB 2W70A 3EDYA 3ZNQA 4F2HA 4MPPA 4JI0M 4ZO4A 4WVLA 2ZSBA 3GT3A 4ZYXA 1R0ZA 1SPBS 4FSDA 3VSDA 2QOEA 5AFSA 1UFQA 1AHHA 4IQ0A 3VDUA 2P90A 2L69A 3EQZA 4LXQA 3WSTA 3M3PA 4GMKA 4DCCA 4EHLA 3OFVA 3HZHA 2Q0HA 1JQJC 5AK4A 4FOTA 2HF2A 4Y6GB 2UXDM 2RKOA 4F85A 1JJFA 3W8RA 2VUSA 3TO5A 1WSBA 3QLJA 1EZ4A 2XLBA 5TJHA 4DIFA 4LF8M 4FIDA 1MVOA 2ZCUA 3KEOA 1EUDA 2WKWA 2HDHA 3IAXA 4MIEA 2NWQA 5E1BA 4ZALA 2B94A 5IMBA 5IAOA 1RWBA 1UJ5A 5HJEA 3IOMA 3NP7A 4C0LA 1YBHA 4FGKA 1TEXA 3GRFA 1U6IA 3U0VA 1C0LA 3TDMA 1UZAA 3H2GA 4XGKA 1FUEA 1ZKMA 1EVIA 2C4NA 2ZPTX 3KJEA 3GFVA 3PUJA 4FYHA 4GXTA 4NATA 4RD1A 4ZZ0A 3ENKA 2I91A 1V3QE 3AC0A 1Q22A 2UZ3A 3DHYA 5F1PA 4JLUA 4L22A 3EDRA 3ZUGA 1XMSA 1ODFA 3OTOM 1XZJA 4GGPA 5CB4B 2R1UA 1H2BA 1GCAA 3KTOA 1KJWA 3C3XA 1NU6A 4N0PA 5KHAA 4E15A 4G4QA 1AIPC 4JROA 4KO2S 2RARA 4N3GA 3Q0EA 3T9CA 3EVTA 4QUDA 3RKRA 2ZIGA 3N5KA 3PPIA 1VKOA 2ETVA 4D80A 2G77B 3O4GA 1VJRA 3UWMA 3ZWPA 5A3JA 4GDFA 2X9LA 2I4LA 1JJVA 3TD6A 3PFHA 4IUYA 3VU0A 1GGMA 5B3LA 3QM1A 3DL2A 2R3SA 2A0FA 3PI7A 1BU8A 4HUQA 2P9HA 2Z3ZA 3GLHE 2WNHA 4ILKA 5JWHA 3ZCSA 4J0KA 2ZIWB 3LT1A 3OY2A 3F3YA 2UXCM 1G5HA 2Y27A 3IHWA 3FPFA 3PNSA 3ZCUA 1QNLA 4NXMB 3O83A 3TEJA 5AI5A 5JDIC 1HKHA 2CLSA 1Y48E 4YBZA 1MHTA 1ZOSA 2A0KA 5TQ0B 2BTQB 4KH1A 3QITA 4IIWA 4ND7A 3KHTA 1XZ8A 1KJIA 2WMYA 3KAPA 4DXAA 7MHTA 3FNIA 4ECEA 1Z62A 4RTQA 4JC0A 4JJAA 3THRA 1FX1A 3U6QA 3UG7A 3WMRA 4CV1A 1RZRD 4HNAB 2JXNA 1EA7A 4XX0A 5K7SA 3IE1A 2ESRA 1XB2B 1DC6A 2PWYA 1M76A 1I7LA 4DA7A 4JJGA 3D7RA 4MCAA 1W5AA 4RSRA 5A4KA 3E4RA 3EPHA 1KERA 4F5DA 4W5RA 2OOBA 1QQ6A 3RODA 3N7TA 1E63A 3GMIA 3T8YA 4UOEA 4N6OA 3KOZE 1EMDA 4PSAA 4FT2A 5GOZA 1UBLS 4TZTA 3H5AA 5EIWA 1YKFA 3ZXSA 1NBWB 2Q4DA 4IRMA 4PAMA 4CM6A 2HRBA 2VQDA 2GDZA 3ZHSA 1UZNA 3OFND 1YI0A 2D0IA 5CW2A 3OO0A 1S89A 2IYAA 1K3XA 4TKUA 2WPDD 3WLMA 5AD1A 2HHLA 2R1TB 2E1RA 1U3GA 2JARA 3FCCA 1ZQ1A 4G63A 3IPYA 3JAKB 1B6GA 2VIIA 3NH6A 1VFPA 3D6VA 1L8AA 3DBIA 1NATA 3EVBA 3OZCA 4MS3B 2WIGA 2GBGA 4Q18A 2OGWA 4QYSA 5M3BA 3GJ7A 1H8HA 4DIEA 5HRUA 3AUUA 3N2ZB 1ZJZA 2EGGA 1BGVA 4RZSA 1M34B 1LDBA 2QV7A 1NQXA 4LFCM 1V16B 2QXUA 2RGGA 2W6JD 2ZJ3A 3JYHA 4FX5A 3KZXA 4M1TA 1BIFA 3D0RA 4RCZA 5G3ZA 3TW8A 2HPAA 1K8XB 3G5MA 4B2PA 4CMKA 3L40A 3CKKA 4YCBA 2FN7A 5FWAA 4QOGA 1CEQA 2ZRIA 3K6SA 4PLFA 1JR6A 3DC7A 5BN5B 5JCZA 4FZ3A 2Y05A 5ALUA 2JIDA 3JR5A 4K6FA 4D3FA 2HU5A 2ZQZA 5E9AA 1HRKA 4OQEA 5I9TA 1ZGJA 2XZPA 5KX5F 2NUTA 3CRMA 4YECA 4MYDA 4TS1A 5JO0A 1KK2A 4CUJA 1SXJB 3ZWBA 5F2OA 2HU2A 4JI2B 1DBQA 4OYLA 3NRBA 2FSVA 4XSHA 3QYFA 1O5IA 5CXUA 4KO1S 1OB2A 1F9EA 3VDNB 2CGEA 5DHSA 2HA7A 1YS9A 1TC2A 2J5QA 1EBBA 5IKPA 2VF4X 1LRLA 1SVIA 4I4TB 4NZOA 3EH1A 2CF5A 4G5XA 1AQUA 1VG0B 4BVEA 3B1VA 3T7AA 1Q6YA 3CLKA 2Q28A 4Z9YA 3UJ3X 1GG9A 4E5NA 1O89A 1WM1A 4M0CA 2G7MC 2VK4A 3HNRA 5B5SA 3GRYA 4B6JA 4DJEC 1X15A 3HL0A 1N2HA 4KNYA 1HE1C 2NUBA 3GAMA 1Z83A 4EO9A 1RAEA 1SY7A 1Y9DA 2P6PA 2X8JB 3E9NA 1IJKA 1FDRA 1NFRA 2Y6VA 3P27A 4JKOA 5LUAA 4O4HF 1ADYA 3V4PB 5FAKA 1SKYE 4EX7A 4WZZA 5GPBA 1C3EA 2ZEJA 1YXMA 3LXXA 3QFFA 2D1YA 3ZDEA 5IS2A 4EPRA 3RJ9A 1TO2E 2EBUA 1RAIA 3QVKA 4HUJA 5C8XA 3KOUA 4WSOA 1IDOA 2AVNA 4WBNF 1GM5A 1J0EA 3TKLA 3H2IA 1IYZA 4M83A 2QY6A 4P81A 1LWOA 4D4MA 4BAZA 4EI2A 3QFTA 3TDKA 3G82C 3R44A 4QT4A 5EMHA 2XMSA 3K4HA 4TUWA 3PNVA 2VI5A 4LZNA 3NVAA 1C29B 3AZPA 2HTFA 4FYIA 3MD0A 5CT6A 5EIOA 4BJHB 1UT6A 2QN7A 3H05A 4DDTA 2QA5A 3UA3A 1JU9A 3I83A 2VDOB 1KU0A 1DAMA 4WZAA 2I6FA 3RWOA 3WFIA 4YJDA 4Z4FA 2R7NA 4TVKA 3E81A 2J33A 3N2IA 1VJDA 3V97A 2WYOA 1Q0UA 1TMKA 1XCOA 1C1DB 1ZH8A 4JQCA 3ETDA 5BV2P 3RVMA 3QOXA 3V6MA 3L7JA 2UUAB 2IW3A 3IUYA 5FNVB 4DMFA 1KS9A 4FMCF 4DV1B 1Z5AA 2YNMC 5B6PA 1P17A 3B8EA 4IJMA 3PC6A 3OJXA 1HWYA 3NHLA 4RGQA 1P80A 1XO1A 1IE3A 1I1QB 2ZJ7A 4QTUB 2P4QA 3EIWA 4QU8A 1XTQA 3HFGA 4WY2A 5HF9A 3VR4A 1ZXXA 3A1UA 1IPHA 4MB2A 4MAFA 4ZT4A 3U7RA 3ZGZA 1E6WA 1K2WA 2BHSA 2I3BA 4Q0MA 3NJ4A 3I9MA 4LGCA 5HMLA 3VA7A 3QYPA 2VDJA 1NI5A 2X5XA 2ATVA 2O0KA 5FP0A 4PLVA 1OTRA 3KFUG 4D9NA 1A2KC 4CQJA 2OXEA 5JS6A 4GZ5A 2WFLA 1RTTA 5C8YB 4PLZA 5EWMB 1FJGB 4LF5B 3KT3A 3AERA 4IIHA 4J29A 3MTDA 5CP8A 4UN2B 1FJGM 2DH6A 3MT8A 2XYPA 4L0QA 4NPCA 1XKXA 1YACA 1WB5A 5EXSA 1RJWA 3O91A 4X1KB 5IBRA 1O58A 3PK0A 3I9JA 2PX5A 4TKMA 4UNQA 1PGJA 3O0TA 5IH7A 2P0AA 1VCNA 1E9CA 3U6PA 1T5OA 2QTVA 1NUSA 2JJ2D 2RGBA 2CNOA 3NBKA 3G0BA 4G0ZA 4IIJA 4LOAA 1WPGA 1EFVA 4S24A 2NMVA 2F5PA 4ARCA 3DXYA 1N5LA 5SYNA 1LLUA 2ZOSA 4B6RA 2CSUA 2AI1A 4BZWA 4BMSA 2HA4A 1O54A 3SSOA 2QYHA 3D0OA 2QUAA 3AYXB 5KQSA 7MDHA 3K1YA 4MRRA 1OZFA 4IW3B 1U0FA 3GRZA 4IJVA 1WY7A 2IEAA 4KFUA 3ECCA 2PH1A 2IDKA 1R4ZA 3NX4A 2CFRA 4ND2A 5TVKA 4DCJA 4EHNA 5AW2A 5T7BA 3N9IA 1MUUA 3NTXA 4JI6B 4X65M 1MT0A 2XNHA 2JJYA 4M7PA 4RY0A 2HRRA 3KEGA 2C9CA 4UVHA 4TX1A 2Z9DA 3N3AC 3RYHA 3W67A 2OK8A 4ZAWA 4E3ZA 2VA8A 1QQBA 3X44A 2Z3XA 2Y6UA 1JHMA 1UMCA 5U1PA 3TX2A 4I8OA 4O4HB 3IIJA 3SS8A 1EA5A 2J87A 1FLDA 2WFZA 3AESB 2Q2EB 2LIVA 2O2SA 4G09A 4GX1A 4LC0A 4N65A 5CNMA 4B0OA 4EW2A 4CKCB 2YFYA 4QPPA 3K9HA 1PE0A 5ALDA 4PXYA 5TDHA 1RABA 3CLTC 3UMBA 4ITUA 1Q0RA 1YMVA 3UM9A 1OFUX 2DFPA 4WCFB 4L8GA 3CX8A 1OXSC 4F9FA 1UXIA 1LPBB 5B4UA 1N4DA 3TAHA 1C7IA 4LCJA 2FOIA 1IM8A 4EG1A 2J08A 3FW1A 1P4JA 3SC3A 3A58B 4L57A 1CBUA 3TOVA 1U0GA 3WRYC 4KPUB 4E4YA 1NE7A 1B93A 3LIIA 4UNSA 4DMRA 3CC8A 4J9UE 1B8NA 3BJIC 3ELUA 4LWQA 4KE8A 4MOWA 3STTA 1SIWA 3J27B 1YZQA 4EA8A 3OZIA 4ZOLA 4KTVE 2L7IA 1EX7A 1IK4A 3GPIA 2VCEA 3BMQB 3OOSA 1KIAA 1P6QA 1QCYA 2J5KA 4W63A 5EZYB 2QMZA 4KUHA 5JZVA 1NNEA 2GJ9A 5K20A 1T25A 3FHJA 1UPFA 1IZYA 2YXDA 1FRFS 1Q3HA 1WMDA 2QR3A 1M1YE 3MA0A 4QOJA 4BP8A 1NI3A 2BSAA 3PGMA 4G23A 1CF9A 4YV0A 5LP6B 5G4KA 4C3ZA 1VI5A 4A0SA 3U81A 4OFXA 2VTBA 1VPDA 3AUJB 3E03A 3VUFA 3PQ5A 4ITRC 2QL7A 4XDHA 3ZDFA 2HADA 2IYXA 4KQ6A 5BXYA 3IKLA 5A9TA 3ROGA 1OA1A 3IAHA 3VPCA 4QUIA 3I5XA 4BWYA 2GCOB 3C8DA 5BO5A 4ZI7B 4AS1A 4I55F 3AFMA 5HIJA 2X4GA 4UM9B 2ZREA 4LTDA 1QS0A 1TAGA 2SECE 2X6TA 3JVIA 4S1PA 1HETA 2GLXA 3G5TA 4HGQA 3TJMA 4LZJA 1ZD8A 2ZE6A 2PJZA 2W2MA 3GQVA 3JZIA 4RY9A 3K70B 3LVFO 1GTRA 1V9SA 3AG5A 3DB2A 2OV2A 3SZMA 1QH0A 1ZFNA 1H5NA 2X2OA 3DKIA 1T3TA 3UZUA 3L2AA 1SKAA 1VI6A 1AA9A 1KA9H 2PZFA 3KVYA 5LP1A 4FUTA 4R41A 4X7RA 4X64B 1KDPA 1V35A 3NXSA 3OT1B 2EU8A 4P4TA 5LMNB 4DABA 1JHDA 3FI9A 2KQUA 4AKGA 2WV9A 4V39A 5GGYA 3DL0A 3UCFA 1QC5A 1YBAA 2QEQA 1P2DA 4C78A 1D6MA 1FVOA 1Z6TA 4MJXA 3WNCA 2H5JA 5AW7A 1ITZA 4X66B 1WPXA 2VDLB 1EFRA 1TE2A 3FWKA 3F96A 4FN5A 4FWGA 2C2XA 3ASZA 1OZAA 4BFUA 1NPYA 2HRQA 3EC7A 3M2TA 3RS3A 2ADFA 1JL3A 2FH5B 1Q1NA 3GD7A 1IRXA 3G17A 3H5LA 4DILA 2J0UA 5IKEA 2ACWA 5HQJA 3BH6A 2YWGA 4IHJF 1X74A 1CCWA 2J85A 2RC6A 2XDQA 4YJ2B 5AICA 5CA0B 4Y2SA 4QFBA 2O2HA 2IV3A 4QM7A 2FWRA 3NYWA 4BXOA 2FKAA 1G5FA 4I2VA 4LRYA 4PAGA 4S1TA 1HLPA 1YS2X 4IDDA 4OB8A 5EKUA 1TW3A 3B60A 2NU9B 4FDAA 3C3AA 3DZKA 4MJ7A 4ILEA 5CCDA 3KPYA 5HZGA 2O8FA 3IJPA 4B4UA 3RAJA 1VE6A 1R4GA 2VK8A 3WZMA 2QQ0A 2QTGA 3ACDA 1M2GA 4UTZA 4JYAM 1M72A 3VR3A 1O08A 2XT6A 1UIRA 4DZTA 3BORA 3QNMA 3V8VA 5LBUA 4JWTA 3P9ZA 4Z99A 4ZJPA 3KFLA 1KO7A 1E2LA 2RKBA 3PQ7A 5CFRA 1FDSA 3R3WA 5KYNA 1OWNA 4P9NA 4F4DA 1V1JA 1ZOPA 3SEZA 3L6RA 5A5GA 2XE4A 3DJFA 5EEGA 2VH5R 2W2KB 3T5AA 2RGDA 4U4AA 5ALXA 3TUIC 1D2MA 4HRYA 3IV7A 3HY6A 1CETA 3GCXA 3QTTA 3GLKA 2C8KA 5DGIA 6PFKA 4B3BA 1EXWA 2HCFA 2NYAA 4IBIA 3EUWA 4YA6A 1TMOA 2K87A 1WR8A 1IONA 1UK7A 4X97A 1OY1A 4L0CA 3P4UA 5HK9A 5I7VA 4OQPA 5DOZA 4LRWA 2C84A 3OEYA 1U8YA 5NLLA 5DKFA 2ANCA 1CIVA 5HG0A 1W9MA 5DNCA 3M6UA 1TVMA 1OXMA 5AI6A 3QV1A 4R0NA 4WLFA 3H16A 1JFLA 1EX9A 4OHVA 2I4RA 3AVPA 3COPA 4N9WA 4OO3A 4TMKA 2V03A 3EGDB 4J3JA 3CR7A 1JV2B 1F6WA 2JIZA 3CUWA 3OH8A 4M98A 2ECQA 1ZOIA 3EGXA 3BBZA 1NDQA 5SZIA 5CFOA 2V7VA 2ZSUA 3PHCA 1QP4A 3C24A 1CUGA 4PF1A 2QTLA 5EHNA 4ASUA 5I3ZA 2YW2A 3S70A 2AVDA 1G42A 3A6EA 5K8CA 5EIXA 3COJA 2CWBA 1NM5C 2JJ2A 3UVEA 4ZI2A 3U4CA 1YQEA 4NRDA 3O4IA 1K98A 2PQ0A 3GCWA 3NT2A 1FSGA 4QBKA 4Q9DA 3RS9A 1CJCA 2PL1A 2JLZA 1Y3HA 2JJQA 3TZKA 3FB1A 2ZJZA 1VJGA 1GEGA 1JXMA 1ZJJA 2BC9A 3OA0A 3PP8A 3QXHA 4FB4A 2YIJA 3K32A 2NADA 1PS8A 1XRQA 2YWFA 3MHVC 1I4LD 3MGAA 4QVKA 1FU8A 1LPSA 3W5CA 5TQ2A 4C14A 1V33A 2ZRAA 2ZZKA 2MYUA 4GPAA 4LV6A 2ZETA 4ZODA 3UXEA 4BLQA 3TOSA 3I6MA 4CCYB 4CIBA 4MWZA 4REOA 2RRUA 3UC5A 4UHDA 3FDJA 3IDSA 3GZNB 4JN6A 2J9FA 3BEDA 5DW3A 4D0RA 4J0HA 4DC1A 1KVUA 1S3IA 3O1HB 4XGNA 1WBBA 5NULA 3HACA 5KWSA 2KJQA 1QX3A 4M1YA 2C7BA 2QRKA 4ENUA 4QJ5A 1TX4B 4L8YA 5EAIA 1J90A 5AHOA 3DW3X 3ZE2B 1AKWA 3GO8A 4BKOA 3R9IA 3TE6A 4KPFC 4AQDA 5LDHA 2VJBA 1XK6A 5L3QA 3ZV7A 1I9CA 1QHSA 2GEJA 1DBSA 1HTBA 1BS2A 5E4TA 1KTIA 2WDPA 3E9QA 4BVGA 4ER6A 4AX8A 3U0BA 1L5HB 3GCDA 3KWMA 5FHRA 3TOZA 1H94A 4EJMA 3EYAA 3C7AA 3CX3A 3HO6A 4LYAA 4NLLA 2RH8A 2YWHA 5DNYA 4KLZA 3VH4A 1KKLA 4R83A 4B32A 5JCPA 1XLUA 4YQFA 4ZVNA 2GEBA 3RK1A 3Q7EA 1YE9A 3MUOA 4JH0A 4TWZA 3E2PA 1Y7LA 2HU7A 1FFBA 3G9QA 4G8DA 3W6ZA 1X7DA 1A8UA 4TUYF 1NZFA 2BEVA 1SPXA 3X1YA 1QU2A 2VYCA 3FSRA 2P4SA 1LLCA 2PRZA 1N0IA 2AMFA 2GSWA 2FSVC 3SHQA 1NLYA 2W11A 1U2PA 4UPEA 2FSIA 1ZUD1 1SULA 1JKJB 4RKEA 3E1KA 3VNSA 4R05A 4YCDA 5IT4A 4XGRA 5BQ5A 1R3UA 4WZAB 1IZ9A 2QORA 2VT3A 1A1SA 1X94A 1AHIA 3OJLA 5C7OO 4W9MC 3SASA 1TF0B 2DLDA 3AM5A 3VH3A 1CJBA 3HHXA 5HE9A 1YONA 2Q6LA 1BW9B 3FD9A 2QM8A 2RAUA 2DBYA 4TSKA 4GVPA 1QKIA 2R8BA 5ALNA 3L82B 4MMZB 1GGKA 2C2YA 5EE0A 4O25A 3MB5A 5FBZA 2VNHA 5ITVA 3DH0A 3R3SA 3TSOA 2JZOA 1VE3A 1P2UA 4PGMA 2XT9A 1W48A 2GNAA 3CEAA 5FI0B 2M2IA 2V7QA 2BHTA 2MSLA 1QQ5A 1XT6A 3LTEA 3RTAA 2K5UA 1FRVA 4U02A 5JATA 4PDIA 1JDZA 2ATIA 1RC0A 1NG9A 2G83A 4YAWA 1Z59A 1JAHA 4BNLA 1M67A 3AB8A 2H52A 4ETMA 5ECWA 2CUZA 5C52B 2YRFA 4GGMX 3ZZ0A 1ZL2A 4C4ZA 1YH3A 4KXFB 2VF7A 1GOTA 1PZNA 1ZU5A 1K97A 3HJAA 3R6DA 5EUQB 1J1IA 2H8KA 4MDFA 1JI0A 2OBMA 3PQFA 3PC2A 3LUPA 1JDBC 4H59A 5F9HA 4JYAB 4AMBA 2HLDA 5B2ZA 4HTAA 4MRMA 1CQIB 1XEWX 1QONA 3ZI7A 1U9IA 1RLJA 4XOUA 3LVVA 1QQTA 4O2AA 4D3YA 1LLQA 3DJYA 3SAVA 1LTQA 1T4DA 4XDGA 3A8TA 3P2MA 4Z1OA 2XZUA 2RJNA 3NEPX 3H0EA 3TK1A 4E14A 2H4WA 1BS9A 3BD7A 3W2EA 1WDMA 3A3OA 1GPH1 3GR6A 1BWPA 2NT4A 2A5JA 2EWMA 2XGOA 3ASUA 3IEKA 4TXLA 5ALRA 1H8HD 3S1AA 1Q95A 1HUQA 2R1ZA 1UJ4A 4WHMA 2W6PA 2JFPA 4BRSA 2DJIA 2O48X 1UKCA 3OPYB 3IAUA 1PP4A 3ANXA 4JODA 5DBEX 3BE6A 4BFTA 3GAFA 3IPAA 4RX1A 3EVZA 3ETJA 2QJWA 4Y0AA 3QNUA 2JFWA 1GUZA 3WNBA 3DNPA 1OTXA 2Z95A 2L82A 1SQFA 1UWLA 3HP1A 2B4QA 3GQBA 1TDJA 4AU1A 3OT1A 4BFZA 4B3RB 2CXUA 2VXYA 3N3BC 3FPEA 3E21A 1J33A 4M0MA 4KG7A 3LLUA 3DONA 4MVJP 3DFKA 5C7IO 1YTLA 1TQ4A 3GN1A 1RQNA 3G9UA 2CFIA 1W6UA 3I4LA 3GZJA 3QI2A 5KSOA 1N8TA 4M37A 4G86A 3FNQA 2Z43A 3SLRA 3RVKA 4QLOA 2WR8A 1HFJA 1JR3A 5AKEA 1AURA 1SZCA 1N3BA 1U2GC 1TH4A 1K6XA 4JI3M 2X4IA 3DOFA 3GVXA 3NWEA 4LIPD 3VISA 4CTKA 4CHTA 1RZRA 3K09A 2JIBA 4QUKA 2DUUA 1JHPA 5BSRA 4OU7A 5HGJA 5G53C 4KWCA 2GOYA 3U80A 2EBFX 3G23A 4WN9B 4JLDA 2NSYA 2Z6VA 2WQ6A 2LV8A 4PFKA 3ZHZA 3OZSA 1RS0A 2I2AA 2HWUA 2N3ZA 3AWDA 2P5TA 4OHKA 4ER0A 5JAMA 4AP9A 2BKUA 3SICE 1L4LA 4GWLA 4BC0A 16PKA 2R5NA 4MDYA 5HQ3B 4U8HA 3LPLA 4C7OA 4JBNA 5C1OA 3WYFA 4DE5A 4DARA 2GPSA 2ZDHA 2PX8A 3GLGA 1U1IA 3ND7A 4KR0A 4S1WA 1TF5A 4JT2A 5AXAA 4B6PA 5EHXA 3Q3JB 2EJUA 4B7FA 3M6WA 5ABPA 3KOMA 1OWMA 3QQ5A 1H5UA 2Q0SA 4RNCA 4EUHA 3LC0A 1SH7A 2EFEB 1C1HA 5JSKA 1W4RA 3L07A 1GZ6A 1XMPA 1WNTA 2IZ1A 5SV2A 3TZ6A 2VT2A 4QLAA 2LVBA 1SWVA 1RQGA 5FBHA