3FTCA

Crystal structure of a. aeolicus ksga at 1.72-angstrom resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
234
Chain Sequence
LLVSEGVLKKIAEELIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 70
structure length 234
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftcA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftcA01
2IBSA 2B2CA 2P35A 4E31A 2NYUA 4IV0A 3UBTA 2AVDA 2PT9A 5HIMA 1U2ZA 3LHDA 3UJ8A 3FPGA 2ZIFA 4AZTA 3BZBA 4EKIA 5LR6A 4PYKA 1PRYA 3G5TA 4GEKA 3FUVA 1JSZA 4ZTBA 3GRUA 2UYCA 1TW2A 4AUKA 5JR3A 3SSNA 4C03A 5EQJB 1SVUA 2BZGA 4QPPA 2R3SA 2Z6UA 1XJ5A 2IH5A 2VDUE 4YUVA 3P9NA 2QY6A 5K0LA 4YMHA 3GRYA 2OXTA 5HIIA 1VP3A 2I62A 4MHTA 1UFKA 5BP7A 1XVAA 4LWOA 1L9KA 1G55A 2I6GA 2HWKA 4KIFA 5ERGB 5CM2Z 1UWVA 1X1AA 5K01A 1R8YA 3T0IA 3VYWA 5BW4A 4KDCA 4NECA 1NBIA 3TFWA 4YMGA 3L8DA 1YB2A 3FUXA 5FWDA 2PBFA 2ZZNA 3CVOA 2ZBQA 1KIAA 3HCEA 3P8ZA 2FPOA 4E2WA 1ZQ9A 2CKDA 2QYOA 2WK1A 3EGIA 3FUUA 1EIZA 3DMHA 5KS2A 3G2OA 1INLA 3AJDA 2YVLA 3DR5A 1RJFA 3H2BA 5EKXA 2V7EA 3DP7A 2HTEA 1NT2A 2PX5A 3E8SA 3PB3A 4FSDA 2G1PA 2PV0A 3P97A 1KPIA 5MHTA 2OBFA 3KQOA 3LBFA 3MCZA 4ER5A 1MHTA 2P3OA 1NBHA 3GDHA 4R6WA 1R6AA 1G60A 3EMBA 4A6EA 4C06A 2IIPA 3C3YA 3CC8A 4U7PB 2B78A 3A7DA 5HZMA 1XTPA 3PX2A 1NW5A 1OR8A 3KQTA 3EPPA 2NXJA 3EVAA 5HILA 2NXCA 3HVHA 2PXXA 3EVEA 1P1BA 3LPMA 2OB1A 2AZTA 2P8JA 1AF7A 4HC4A 4RV9A 4X60A 5E2BA 5U4XA 5K0EA 3UJ6A 2BM9A 3ER9A 3SVZA 1VBFA 1KR5A 2BM8A 3ELDA 5FA8A 1JG3A 2ESRA 2CWWA 2AN5A 4DCGA 2B25A 3BWMA 3G2MA 1V39A 1EG2A 4QVGA 4RTOA 1N7JA 4OQDA 2I9KA 5FADA 2PX4A 1KXZA 3JWJA 5K0NA 4YV0A 2EJUA 2Y1WA 3I58A 3SMQA 1RJDA 4BLVA 1UIRA 4OX9Y 3T7SA 5E2AA 3M6UA 3IHTA 4GQBA 3EVBA 4ER0A 4GOOD 3R6TA 2ZBRA 3GIWA 2DULA 1DCTA 2WA2A 3CJRA 3TKYA 1G8SA 5FHRA 4RTJA 3SXJA 2IDKA 3TM4A 5GM1A 2NP6A 3NDJA 2O07A 4KVZA 2FCAA 3B3FA 3B89A 5E1MA 3FTFA 4ISCA 4X63A 5B1SA 3OFJA 1T43A 4MQ4A 5DTMA 3AXTA 2IGTA 3G2PA 1WS6A 1ZG3A 5DLYA 5EEGA 5FQOA 3KQQA 4EVIA 5K0BA 2ZTHA 3HCCA 3OE4A 5IH3A 4CKEA 2Q41A 3B3GA 1QYRA 3NVKI 4P7JA 2O0LA 4HGYA 4YUZA 1RJGA 2P1DA 3KKZA 3OU2A 3OZTA 1HNNA 2O57A 2OY0A 4GC9A 3HCBA 4M36A 5K0CA 2R6ZA 3MAGA 5E1DA 5DXJA 5FTWA 5GIPE 3GRZA 1JSXA 2UYHA 3P2KA 3BWCA 3JWGA 3FYCA 1VQ1A 4YUWA 2N47A 2GPYA 3G8AA 2YX1A 2IFTA 3FPFA 1O54A 3LGAA 4O29A 3THSA 5FQNA 4AZVA 2XBMA 3KR2A 4F84A 4V0QA 2NXNA 3ID6C 1VL5A 2QM3A 4E2YA 5DM1A 2V74B 3K0BA 4GC5A 3KPJA 4C4AA 5EHGA 4HSGA 5KVAA 2XYRA 4QPNA 5EMJA 3LECA 3TOSA 1ZGAA 3KQMA 9MHTA 2BR5A 3P2EA 2OYRA 2P7IA 2A14A 3HTXA 3C6KA 2PXAA 2ZSUA 3P9CA 8MHTA 3I64A 1FP2A 4DZRA 4RSRA 4GOMD 3LDUA 1YUBA 1L3BA 4FT2A 5DSTA 4PYJA 4RTRA 2G71A 2ZVJA 4EKGA 5FCDA 1Z3CA 4QTUB 2JG3A 2IBTA 2VDWA 2VP3A 3OU6A 3BKWA 5EG5A 5K0FA 1X1DA 4QDKA 1IY9A 3GRRA 5E1OA 4PCAA 4PYLA 5T6BA 3UJ9A 1RI2A 1B42A 2PWPA 2VS1A 1VLMA 3DULA 4OBWA 4CTJA 1ORIA 5CVDA 1R18A 5D1HA 3I9FA 5C0OE 1F38A 3E05A 2Z6QA 2DPMA 4YV1A 5LQJA 1RI3A 4IV8A 2XVAA 3HVJA 1WZNA 3A25A 3M33A 3KPWA 5E1BA 5P8WA 4AZWA 4DQ0A 2C7RA 3EVGA 3MTIA 4E2ZA 1XDZA 5K0JA 5K0GA 4CXMA 3ELUA 4FGZA 3QOWA 5HFJA 5ICCA 5ICGA 1JQEA 3OU7A 4U7TB 1G8AA 3EEOA 3SGLA 3CCFA 3PFGA 1M6YA 4P7FA 4L7VA 3SM3A 3MTEA 5HIKA 5LQAA 3ERCA 3C3PA 3IEIA 3HVIA 1RJEA 3NJRA 3PVCA 1M6EX 2EFJA 3FTEA 5LQUA 1TW3A 2IH2A 2AN3A 2JH8A 3AXSA 3GU3A 3OZSA 3FRIA 3MGGA 3QV2A 2ADMA 2ZIGA 5E8RA 5T64A 5DX0A 1VPTA 2CL5A 5DM0A 2VZ9A 3EGVA 1XDSA 1NW6A 3EVFA 4C07A 1JR4A 1PJZA 2OB2A 1DUSA 1NKVA 4XUDA 1JQDA 3P71T 4KWCA 4RVFA 3KU1A 2ZCJA 5DTQA 3EVZA 4E30A 10MHA 3A7EA 1Q0SA 3EVCA 3G89A 1SG9A 3UJAA 5FUBA 4RTLA 1D2GA 1R74A 4PWYA 4YUYA 5JUWA 3AWIA 2PGXA 3A27A 1SUIA 5FULA 4OA8A 2ZBPA 5ICFA 2E5WA 2CMHA 3ANXA 1NV8A 4ATNA 2OZVA 2O06A 3GWZA 3LCVB 4OA5A 1AQJA 1AV6A 4GBED 4GUAA 5G02A 3PT9A 4RTPA 2ZIEA 2LD4A 3KPYA 2QRVB 3O4FA 4HTFB 3DMFA 4X61A 3ELWA 1KPHA 1BKYA 3U81A 4BP3A 2PSSA 2O05A 1JG1A 4LWPA 4PGGA 2I7CA 2ONZA 5EMMA 3MB5A 4QQKA 4AZSA 3UA4A 4XCXA 5CIYA 4FS8A 4WVLA 3VC1A 4OBXA 3B5IA 4X41A 2EG5A 2P7HA 3DMGA 1YF3A 3RODA 4RWZA 1L1EA 4ER3A 2JJQA 2XYVA 2YUIA 3G8BA 3T7RA 3DXXA 4CKCA 3AY0A 3B7PA 5E9JA 3BGIA 3MERA 3RIEA 1N7IA 4HH4A 2GA9A 3UJBA 5LSAA 7MHTA 3P9KA 1YZHA 5DM4A 5DX8A 4X1OA 5BW5A 5K03A 4PIMA 3THRA 1XCLA 5EEHA 5FWAA 1O9GA 3CBGA 3Q7EA 3ER8A 3MHTA 5GWXA 4DKJA 1RI5A 4HGZA 5EHIA 4R8RA 4KRGA 3UJDA 1QANA 4E33A 1BHJA 2UYOA 2AOTB 3DOUA 4KW7A 2NNWB 1SQGA 3E7PA 1N2XA 3UZUA 1QAMA 2EX4A 3G5LA 3ORHA 4K6MA 5DSXA 3O31A 5EGSA 5M5BA 4EQZA 3TQSA 4EK9A 2OKCA 3GRVA 3FTDA 4BLWA 2B9EA 3UWPA 3BT7A 2K4MA 2HNKA 2PKWA 1KP9A 1I4WA 4QTTB 1YFLA 2IDJA 1P1CA 3HCAA 2G70A 2FK8A 3R3HA 3P9IA 1QAQA 3NWBA 1AQIA 2PT6A 2PX2A 2XVMA 4PYMA 4RVGA 5D1NA 3UFBA 1YFJA 2G8NA 3HP7A 1KYWA 3KPUA 1IM8A 3KQPA 2AOXA 1VE3A 3DLCA 1X1BA 3TM5A 2FHPA 3FPHA 2GAFA 2AN4A 1I1NA 3KHKA 5HIJA 3R0QA 2VDVE 3DXYA 5EMKA 3GJYA 5DT2A 4BY9E 4GOND 4UOEA 2OO3A 2AR0A 3DUWA 3EMDA 1YZ3A 3PS9A 1L3CA 3HNRA 4RTNA 3OZRA 2PY6A 1R00A 3KQYA 4G56A 5F2OA 4PNEA 5C9ZA 4PYIA 3G2QA 4WXHA 4M7RA 5BXYA 3HVKA 4P7KA 3NW9A 2YXEA 5DXAA 3M6VA 1KYZA 2F8LA 3O7WA 3LDFA 3LCCA 2PWYA 2ERCA 5GINE 4MIKA 5F2NA 5T67A 4RVDA 1R8XA 4A6DA 3SSMA 2H00A 4PGHA 1EAMA 3EVDA 4C05A 1Y8CA 4E32A 3REOA 2IPXA 3GNLA 3TLJA 5GIOE 3LX6A 3V8VA 5DX1A 5EPEA 3DLIA 5K09A 2HR1A 3BXOA 4RTSA 4E70A 4DM3A 3K6RA 1XCJA 4ER7A 4F85A 4ER6A 5K05A 1BC5A 3DXZA 1G6Q1 3R9XB 1SUSA 1TPYA 3NDIA 3LDGA 3LBYA 5EIFA 2P3LA 3HCFA 2AOUB 3BWYA 4IKPA 1M0EA 3IV6A 2JHCA 5HOQA 3OFKA 3ELYA 4RTQA 3FUTA 3FTCA 4PINA 2EJTA 2FYTA 3NVMB 2WA1A 1XXLA 5EC8A 3UJ7A 5DPMA 2GS9A 5ICEA 5K8VA 3WSTA 2ZFUA 1KPGA 4RVHA 4CWAA 3B3JA 5C1IA 1WXXA 2AOTA 5EZSA 3BWBA 5E8JA 1KHHA 3DTNA 5GP1A 1H1DA 2AVNA 2ZULA 4LG1A 2AOWA 1WY7A 5EIWA 5F2KA 2HV9A 1QAOA 2GLUA 4B17A 4MWZA 5DRYA 4EMSA 5KQSA 1JG2A 5LQCA 1FJXA 2AS0A 4FP9A 1ZKDA 5LQNA 3Q87B 1X1CA 3G7UA 4PIPA 1MJFA 4BLUA 4C04A 3PTAA 1ZHFA 2KW5A 3KPVA 3OCJA 3PX3A 3NTVA 2NP7A 4P58A 2P40A 1NW7A 4HRAA 4QVKA 1NE2A 4C08A 3X0DA 2PXCA 3A26A 2ZZMA 1D2CA 5EVJA 5CCXA 2BR4A 3UA3A 1X19A 4PYOA 1WXWA 5EOVA 3HA3A 3LL7A 5IKMA 5KQRA 3M4XA 3RW9A 1P91A 3TRKA 2YR0A 2ZWAA 3BGDA 3FRHA 1F3LA 2UYQA 4Z2YA 1L3IA 3HM2A 2B3TA 2PX8A 3E23A 3MQ2A 4DCMA 5HEKA 3S68A 3VSEA 4YV2A 5GM2A 4M38A 4RTKA 3GCZA 3G88A 5CVEA 4E2XA 3HA5A 1VIDA 3NWEA 4CTKA 2JHAA 2PJDA 4PCLA 4XUEA 3LCUA 3KR9A 3I5UA 3CKKA 3FPJA 4CKBA 2Z6AA 3PFHA 3F4KA 3SX0A 4IWNA 2YXDA 5DM2A 4Y2HA 3UJCA 1JG4A 5EKUA 4V0RA 3KQSA 3GXOA 3BGVA 1D2HA 1DL5A 2BH2A 4QQNA 4Y30A 2C7PA 1FPQA 4P7GA 4R6XA 4MTLA 3FUWA 4XUCA 2YQZA 2BR3A 1FP1D 3C6MA 4FT4A 3MCTA 4RX1A 5H02A 3KR0A 3TPZA 2JH9A 3OPNA 1ORHA 2P3QA 5GOZA 3NMUF 3A4TA 4FR0A 5CVVA 5KYGA 2FRXA 1I9GA 1XDUA 3GGDA 3GO4A 3D2LA 3M6XA 3TR6A 4POOA 2UZ4A 3SSOA 4H0NA 1EJ6A 2GB4A 2ONYA 3P2IA 3FZGA 2AOUA 3JWHA 2QE6A 5CD1A 3FYDA 5DWQA 1JTEA 4KDRA 1JQ3A 2PLWA 4PYQA 4FSXA 2G72A 2JHPA 3JWIA 3SR4A 3FPEA 3HEMA 4LECA 2OPBA 1O9HA 1NW8A 1FBNA 3ME5A 4PONA 4R05A 1NV9A 3LSTA 3PLAE 2CMGA 2ZLBA 3BUSA 1ZGJA 1P39A 1BOOA 3DH0A 3KQVA 5CCBA 3LKZA 1EJ0A 3CJQA 2IH4A 2C7OA 5EZQA 1QZZA 2AOVA 4QDJA 3T7TA 4JXJA 1EQAA 2ORED 4GOLD 1SKMA 4FZVA 4DA4A 5E9WA 1WG8A 4AX8A 3TKAA 4R8SA 1IXKA 3IYLW 2C7QA 1G38A 5CUQA 4F86A 1VP9A 2YXLA 4DF3A 2XYQA 5E9QA 5FHQA 3OE5A 3VC2A 2NXEA 3KR1A 3LKDA 3M6WA 3EEYA 2QRVA 5LQRA 4YUXA 4HTFA 3EGEA 3QOXA 3C0KA 1NW3A 2FK7A 2Y1XA 2ZW9A 2GH1A 4PYNA 1RI1A 5DRTA 5CVJA 2YTZA 2PVCA 3BKXA 2HMYB 4KIGA 4DMGA 3HCDA 3KQWA 3CGGA 2ZWVA 3R24A 2H1RA 5CVUA 4HG2A 4RYLA 1HMYA 2IP2A 4RTMA 3HA7A 5EMLA 5DTRA 3CJTA 4OQEA 3TMAA 5FA5A 3I53A 4GF5A 4M37A 2ZZKA 5LQKA 2H11A 1JTFA 1SQFA 3M70A 3V97A 1RI4A 1Q0TA 2P41A 4BP1A
chains in the Genus database with same CATH superfamily
3H97A 4E31A 1T8YA 4G9EA 2YV3A 4C3VA 3HO6A 1XP8A 1K7YA 4PD2A 4E6PA 4ZDIA 1V2HE 4I1IA 2JDIA 2Q45A 3IVXA 4C29A 5E38A 1I2BA 3KE8A 4AX4A 1GFIA 5JJCA 4JQOA 1VKZA 3H6GA 4MMXB 2O8EA 4OJNA 2ICAA 1KMIY 1JDNA 3BE8A 4Y2JA 5HILA 3N7TA 4BMZA 2IHBA 4RVUA 4S0XA 1G21E 2ZB4A 2Z4RA 2QD3A 4H6XA 3O7MA 1SOWA 1RP1A 4C4SA 4V2IA 3KUCA 4DY6A 2D2IA 2RHGB 4JLUA 2REQB 1VOTA 4MROA 3IHLA 1CUJA 3DHNA 3E15A 1YC2A 4BJ5A 3QEJA 3QFTA 3RYCB 1JJFA 1Z4LA 4GL4A 2FWPA 3CG0A 5EUCA 2YN4A 3PRKE 4TMWA 2E5LB 3Q0EA 4IH1A 2BSAA 1Z6ZA 4M6WA 3OZAA 4RORA 1YI1A 5A3VA 3BCHA 3CF2A 4DSUA 2PGNA 1PR3A 1FTWA 1PZGA 5BMVF 1IIRA 4E3WA 4FIDA 4L08A 5ELMA 1I30A 3ODPA 2OR3A 2L4FA 4KDEA 1UPBA 1AKTA 2NTYC 2J6BA 1V9SA 1IAVA 3HO8A 3FFAA 3C6QA 2P0EA 3PHJA 5TY0A 5E4TA 4F93B 2X13A 2DVWB 2Y3IA 4N76A 5J4VA 3AL3A 4KPUA 2CXTA 6REQA 3WYCA 3I0MA 1Z4IA 5K3DA 3UICA 1RXCA 1EE9A 2CLLB 2GN8A 1CY0A 2RSLA 3D0RA 10MHA 4FONA 4M83A 1D0LA 1PFKA 2QPTA 1ESNA 1D09A 1D7AA 2GX6A 5AJYA 4JNCA 2HHJA 5IJWA 2Q6IA 3JYPA 4D8YA 4G36A 3GJ6A 3DEZA 2JIOA 1OYVA 3HABA 3H7AA 4AZSA 1F6BA 2Q4DA 5I4BA 3RAFC 4JXXA 2P7HA 3DTYA 3G85A 4BQIA 3TYXA 1KK1A 4CHGA 5BYJA 4YCJA 3P9KA 1E20A 1SKBA 4KAAA 4WSOA 4CN9A 4DRXA 4W63A 1QB7A 3MA0A 1K27A 2GXSA 1FYFA 2QE7D 2DUWA 3DEKA 3ECAA 1W59A 3O8QA 2QG6A 5M5BA 1HZZA 3HNOA 2YMPA 1VYTA 5AMXA 3FAZA 2RAVA 5JZMA 2ID4A 4DLPA 1XBTA 2QN9A 4ARCA 1ND6A 4B09A 5JNVA 2F5NA 1E1DA 2BF7A 2Y05A 2AN4A 3FYHA 4INJA 5HIJA 4D4KA 4QLBA 1DIRA 3OLWA 5B4UA 3LUBA 2VTVA 2HADA 5BSMA 3LUJA 2V0CA 2B1IA 13PKA 4DVGA 5F2NA 1E9SA 2GCGA 3I6ZA 4BYGA 3Q0TA 3ICWA 5EJEA 3IG5A 4F71A 2QSZA 3WNCA 1Q1ZA 2WHXA 4Z6KA 3HLTA 2WC1A 1NVKA 2GJ9A 2QYSA 5K2MA 4IWXA 5FEUA 4Q7MB 4P80A 1NBOA 2CC2A 1PJ8A 4P58A 1DXYA 4BCDA 1D0KA 4IUCS 4G2TA 3HCRA 4OHUA 1VL0A 1PX2A 4PLFA 4B75A 2BT4A 2GBFA 3ZCVA 5CFNA 2JAXA 1ETHA 4Q4JA 4U7FA 3SBXA 5EPUA 1B0UA 1AZWA 1SA0B 3VR4A 4XRRA 3RSOA 2I78A 2JFYA 4JVOA 3H1AA 3ADPA 2FP4B 4K46A 1ZRNA 4DA7A 1EM8B 4N5IX 3FNIA 5CB4F 5D5QA 1W5FA 4QG3A 5LPNA 1TLLA 3KT6A 1S1MA 4OL0A 1NO1A 4JUAA 1EXWA 2XDAA 1T8WA 5U4QA 1GUYA 4YY3B 1LNQA 3GDOA 3ANMA 3OX1A 1EFKA 4OK3A 1JHDA 1CUCA 1LDMA 2BMAA 1XE3A 4C78A 4HX9A 3RFUA 3ZNPA 3IG8A 1KORA 1EDZA 3OT5A 2FW0A 2FW8A 4AZTA 4EYGA 2GT1A 5E6UB 2ZM6M 6LDHA 1IDOA 2WJ6A 1KEEA 2WIKA 2TSYB 4PRYA 4HQOA 1K4YA 3I72A 2QL9A 1S96A 3ZWBA 2I1QA 4YRTA 3ZZNA 1P2BA 3E35A 1UMDA 1NT2A 2OORA 1UMBB 3TS1A 1KDZA 1JLKA 2DPYA 4OB6A 5SZHB 2ZTMA 2GHTA 1HDRA 3BE4A 5TV2A 3L1JA 1B41A 3LWNA 1WHSB 4FNMA 2CWWA 3DAPA 3G5MA 4YI3A 1KJWA 1QIKA 5DVZA 4BLCA 1T9DA 1JHZA 5B1HA 2C4HA 4A3VB 1E1QD 3ZCXA 5CIQA 1JW9B 5CFPA 5FBVB 3SHFA 1CR1A 3ONFA 5IK2A 5EMHA 4RJIA 2Q5QA 3MM4A 1QYRA 1XQ9A 2I1VB 3ZU6A 1HTWA 2I6XA 3WNBA 1ZM9A 1HDIA 2HMTA 5CK4A 2WFAA 3UV3A 4CI9A 3LP8A 4MR9B 4ANFA 4L5IA 4BZWA 2A14A 1LPAB 3JAKB 3LDUA 3ZV4A 5J63A 4AP6A 3QK7A 3KJGA 3HVJA 2N1BA 4X94A 4HEA1 4RIGA 3RC8A 4LPSA 3FRIA 3K30A 1E6KA 2QYTA 1VEJA 3B36A 2WTEA 3P71T 3T1YB 3PC7A 1MB3A 1C4OA 2WWTA 1LXCA 4MUHA 1B6GA 3HFGA 1JWBB 4E1BA 3MGBA 2QWXA 3V4OA 5CT8A 4HTFB 1C1KA 3K5WA 5TB5A 2Q6TA 1V5FA 3RYFB 1NZDA 1BWPA 4NZZA 5BR7A 3FD9A 1MJGA 4J2TA 3V2IA 3OIYA 5KTMA 3L82B 1SCUA 3EPRA 4NU8X 1QF7A 4GOXA 1SHJA 3GL9A 3K31A 1TDHA 4CGYA 1QQBA 4EKNB 2G36A 1P9LA 1MO6A 2JJYA 3G2HA 5BRJA 3LMMA 3EEBA 1SGWA 3BMCA 3I9MA 1DARA 3FPHA 3PUYA 5EMKA 3K6SB 3UQZA 4G41A 3IPXA 4G0VA 1T1IA 3ZGNA 5F7ZA 4CMGA 2CE2X 1XJQA 1EUDA 4P7KA 4FS3A 2ZE5A 1YRAA 2H0RA 4X62M 2TMKA 3QSYA 4B3MM 1WCWA 2W0MA 2PIDA 4F8YA 5E6JA 3UBMA 2CFOA 2CXSA 2MYPA 3D2AA 4KO2S 2F62A 1TPYA 1THTA 2FX2A 4IIGA 1F6WA 3IV6A 1EDEA 1JWLA 4R98A 2GEUA 5FTJA 1GPJA 3UMFA 1D4ZA 4DDUA 3ZOZA 1R2QA 2MMCA 1G21B 5JXJA 2JGIA 3DVRX 1FJXA 1HQYE 1MJFA 3PX3A 3AR4A 1WLSA 1N7GA 1V41E 5C81A 2W00A 5C7IO 5KI6A 3NHKA 4WI1A 3RS8A 1NF3A 1XKQA 5B4VA 2WB2A 1D0IA 1N32M 3KR9A 5H4HA 3JQAD 2D7JA 1HNZM 3W8NA 4JN6A 3LK7A 1GRVA 2B92A 3L8ZA 2GK3A 2ORYA 3MCTA 5JZOA 4TLCA 3TZBA 2UUPA 4AMGA 3VU8A 1QYVA 4YV7A 3HKCA 4F7WA 3FPEA 4YT8A 4I50B 2PGDA 2DY0A 3QU2A 5F9HA 4D8VA 4BVKA 4B74A 3NALA 1OFGA 5LLSA 4P9NA 1X92A 2YJNA 4YTEA 4CTNA 1SXJC 1VKNA 3BRWD 4RFVA 3JAMA 3AZQA 3QKUA 2OOAA 4IZ6A 1VB5A 4BMVA 5CH3A 4YT2A 3TW0A 1K92A 5AVRA 3TW8A 1LJLA 2QSJA 3M5PA 3GQVA 4L4YA 3A3YA 2Z6UA 2WWGA 4AYWA 3GRYA 4Q3NA 5COAA 1PO7A 3P9SA 4MEAA 4LQLA 1TCCA 3ABQB 1N6NA 4GDFA 3GD5A 3HZHA 5JEEA 1BSVA 5KS2A 4UU8A 4DKXA 1UM8A 3P97A 3TNFA 4B33A 2RGCA 2J5RA 2YJGA 1QKJA 3P0JA 1JNYA 4QBIA 2GZ3A 3U4CA 4R9UC 3VKWA 2DRIA 2IUUA 3CMMA 3F67A 1US8A 3WLIA 3BM5A 4ZOBA 3SHGB 2E82A 1XTIA 1F17A 3R41A 4D9IA 4KXMA 4H7HA 1WZIA 4F06A 2YNMD 4R3NA 2C9OA 3DMNA 4GYWA 5B1EA 1T4GA 2RB4A 1CRLA 3ZWVA 5E2IA 2D5CA 5DTIA 5TARA 5J47A 4X5OA 3GLGE 4PS1A 3VK7A 3WWOA 4RD1A 5HQ3B 1PJJA 3C8MA 8LDHA 2FH5B 4HDOB 4WWHA 2ZVJA 3T8YA 4PBRA 1WP9A 5HF9A 1W36B 1NJ2A 4MLDA 4D46A 4FCCA 3WNDA 1VIVA 4DB2A 2DPMA 3D0OA 1XV5A 3HXMA 4FLFA 4RS3A 2A9RA 1NGSA 3A9SA 2REOA 4D99A 5BNTA 2VSQA 2JD1A 4X1IA 3HNPA 4KMSA 5AUNB 2W5UA 1HE1C 5LQUA 3PQCA 4CL0A 4DIUA 1C7JA 1P17A 3WBJA 4AN0A 5SICE 3ZVRA 3KTFA 1AB5A 4UKDA 4J0DA 2ZYUX 3EVFA 2QMEA 3KU4A 1E9VA 4DLLA 4RVFA 3CRMA 3MF4A 2MR9A 2CJWA 3F6RA 2BGUA 3V4FA 3RU9A 2Q3HA 3NAQA 2BFEA 1Z9BA 2JZ1A 2WVJA 1T5TA 2FZWA 4MM3B 3M34A 2IKSA 1PG2A 1ZV1A 5JO9A 1IJKA 5JS1A 4LDAA 3EWAA 3PPIA 1NBEA 4YP6A 3G9QA 4QODA 3G23A 5EWMA 2OBYA 3P20A 3GBVA 5IJXA 4JJZA 3FZYA 4LFBB 4EK9A 3COVA 2QVYX 3H5VA 1DJNA 1XUOA 2H31A 1I33A 2O6HA 3R3HA 2ECPA 2QM7A 2G8NA 1Q3TA 3HP7A 1IM5A 3AFNA 3IOBA 1O0BA 4BY9E 4JI0B 1JDZA 4QJBA 2Y1CA 1W4BA 1O6CA 1SXIA 3H9EO 1FS4A 3KD2A 1R8XA 5D3QA 1L7RA 2QMUA 1UPXA 4XJXA 3VUEA 1NP6A 3CH6A 3PE6A 3KSXA 3WL5A 1S2OA 4P0PB 1NPDA 2P9FA 4JI8M 3RT1A 2D1FA 1Q0LA 4YNBA 2IZZA 4FOLA 3I9V6 3D2BA 4N7JA 3PGKA 2AVNA 1QAOA 2PMDA 2W6JA 3BMOA 3G7UA 5T3YA 2R86A 3ZWDA 4MXDA 3NVAA 5JY1A 3PD0A 4MV6A 4XCVA 2UYQA 2ZUSA 3ABZA 2ODTX 3PHCA 3ACBA 1XZCA 4O1MA 4FFPA 1GKUB 4WT7A 1W5TA 4J7XA 2ATEA 2GD6A 4JEMA 2QLFA 1L2BA 4ANRA 3ITEA 2PRJA 3H8WA 2XODA 1AN9A 3F0TA 1LLUA 1CHNA 2ZYIA 1U3TA 2DCMA 2RC6A 3EDYA 2UUCM 1ATIA 1Y34E 2V7TA 1Z25A 4Z9YA 3SR4A 3VSCA 2O3RA 1A0OA 3FPSA 2JVIA 1ZGJA 3KSUA 1T29A 1IONA 2FPGA 5EIEA 3PF8A 2NO7A 2R1VB 1SXQA 1BMFD 5G3YA 5BN3A 2JK1A 3WXMA 3N5CA 2ZUUA 3QOXA 2Y1XA 3NJ8A 1L8OA 4HDQB 1RLOA 1YVPA 1QYDA 4GKVA 2AX3A 1T5SA 1S2LA 1QUFA 3MWDA 4MI3A 4C0QC 1QFXA 4NFHA 1C8VB 1M8PA 5CYGA 2GTPA 4CM8B 1XNJA 3RLIA 1NMSA 4H77A 2LXNA 4ZCIA 4IJEA 3DOIA 3LUPA 1R6BX 4PZLA 4WXPA 2Y66A 2H1SA 1S02A 4DQXA 5T4FA 2XGNA 4EB8A 1SCDA 2GAOA 4XB1A 4IILA 4KP7A 2CUNA 2CD7A 2H9IA 4MKHA 3EWSA 1Y7IA 2X4AA 3R76A 3FSGD 5BOSA 1E7RA 5THXA 1E2QA 2O59A 3GLHA 1H5NA 3MC1A 4PQRA 5CXUA 4GH9A 2NXJA 2GEFA 4I9NA 1JHOA 3M4NA 5DTEA 2G82A 3W3AA 4CQNA 1N6LA 2XW6A 2E89A 2OD2A 2JXNA 1QHGA 3H5TA 5I9TA 3VDRA 4B2YA 3I01A 2P9JA 1YASA 4KV7A 5ISMA 1VLJA 4L0CA 4KFTA 1XMJA 4J16A 1G16A 5JCJD 4YPOA 2WB4A 4ABTA 3HGIA 4RLFA 3EEQA 2ODBA 3BG5A 5KVAA 2IZ1A 3SN6A 2XQVA 4JJAA 4UCQA 5F73A 1ONSA 1Z3CA 5CTAA 3VYRB 5GPBA 3LQYA 1PG0A 1VKOA 1SCQA 4IHJB 2WQ7A 2C88A 2YRWA 4PRKA 2KYRA 1X74A 4IBOA 3L4KA 2WYOA 5EP3A 4LF8M 2HDWA 4WASA 1TW3A 3FHJA 1TM5E 3RG8A 2VP5A 4AI6A 3H0KA 1W34A 4NE2A 5JMPA 2RGHA 3KUUA 4C07A 2JCVA 4O6VA 1JQDA 3G17A 4YCCA 1ST3A 2IEDA 1I51A 1T5IA 4IIBA 2MWMA 3VTZA 3R6LA 4QDOA 4W7SA 5FEMA 4S05A 5LB4A 4NXMB 4LQCA 2I7CA 4C4TA 1Z83A 3E0XA 2ZRIA 4WVLA 1GTL1 4X41A 2IYTA 3B2EA 1E5TA 1LTMA 4LMRA 3NAMA 4IDQA 3DXXA 5L3ZA 3HMQA 3I45A 1OFUX 3VISA 3LVQE 1CZKA 4LSZA 3ER8A 2JRCA 3C1AA 1JPUA 3QUQA 2HPAA 1DFHA 5AK3A 3SZOA 2XVXA 4HSEA 2V7GA 3NRJA 2YOHA 3LL4A 3UWPA 3GJZA 2OC4A 3QNMA 4O4IB 3A46A 5BV0A 3LF2A 4QUHA 5K3CA 3RUEA 4BB6A 3FLMA 1CUWA 4BC1A 4RF1A 1H5QA 3WGVA 2R5FA 4DR2M 3SATA 1XRPA 3TJMA 4C05A 3T3PB 3L7CA 3Q40A 4NBSA 2JEZA 1U2DC 2NU9A 1M1YA 4PN3A 4QBFA 1WMFA 2ZSJA 1V0JA 3PKJA 3EJWA 3R7NA 5C35A 1HQKA 4CRWB 1OGYA 3PC4A 2QJWA 4QASA 5JDCC 1DWUA 4ISBA 2AJLI 3U13A 5ALLA 3MQ2A 3VR6D 2R1TA 3I30X 1EDBA 3L8HA 3RV4A 1NHWC 1VDZA 1OA0A 2OO7A 4QYIB 4P7GA 3CRZA 3TEFA 4TV9B 5H02A 1NZJA 1QV6A 3S7TA 5FXMA 2QK4A 2DLNA 3DTVD 4N5LA 3CRVA 5JO0A 3L40A 4H6PA 2LVNC 4ZZ1A 3UOAB 1WRBA 4A7PA 2VXOA 4B7CA 1TQ4A 3AUXA 4ZVPA 5IULC 4JUBA 3N2KB 1SKMA 2OD7A 4P82A 1PKEA 1SIUA 4Y6SA 1KKLA 4IRMA 2NYRA 4KZKA 4RMHA 1FVHA 1P1KA 1HT1E 3PZRA 5FBQB 1X7YB 4LY9A 2M60A 3GT3A 1YRWA 4ARVA 2GFQA 2QLBA 1KIMA 3ND6A 2P4EA 1C1XB 2EKKA 2C3UA 1PGQA 5A7HA 3SVTA 5JS6A 4AJHA 4N03A 3WNQA 1CR6A 4U6NA 4AF7A 1I2MA 4G0OA 5EQJB 2I62A 3QEKA 1CS0B 4QWMA 4OBBA 1LLCA 5CA0B 1E64A 5CTJA 4AJ4A 1R3DA 4D2IA 3VH1A 2AI1A 2XA1A 1PUIA 4WZ6A 3A1SA 1P5RA 2JAUA 5KDOA 4DLSA 4GX2A 1OR8A 3Q8XA 3VHLB 3GLVA 3H19A 5B4TA 3DE1X 2DT8A 1TM7E 2GPJA 4ZMRA 4YP5A 4J4HA 4ZZIA 2RGDA 1P75A 3W77A 3G2MA 3LOUA 1BZYA 3JRWA 3H17A 2ZTVA 3AVOA 3SBEA 1DQPA 4OQXA 2OGTA 4PC1A 4E88A 1SCNE 1YV9A 4EVIA 4CLOA 2LKCA 5A1JA 4GQIA 4AM8A 1BHO1 1QIFA 2C98A 1ZUNB 4GBJA 3TEMA 5DXJA 3UATA 4AF6A 3FKJA 3FPFA 4LVCA 1STOA 1BO6A 2VDQB 3D64A 4ZJUA 4HSGA 4RNCA 1YH3A 4FINA 1D5CA 4W9MC 1KWKA 2ONKA 2HAEA 3TOVA 4FT2A 3AH8A 1AIPA 4QTUB 4JMLA 1B42A 1LRKA 1N3IA 4LXXA 2JGRA 5JHGB 1P4JA 1Z4MA 3GY0A 5E1BA 2C5EA 3CKYA 3F6YA 1BVUA 2I1WA 4AJJA 1CNEA 1UJ2A 2WSLA 5AK4A 4YHBA 4TYYA 1K97A 3VVBA 3LX4A 5IVPA 1MO2A 3ZCPA 3GJ5A 4TWAA 3OZUA 1X37A 2AZ4A 2JUJA 1K7EB 5I4IA 1XTSA 5H37D 2IVZA 5DCLA 3MBIA 3DYVA 3HN6A 2FH0A 1L7PA 3E2IA 2W6QA 2PGXA 3BL5A 1A4UA 5D01A 4OXKA 4RPHA 4XM2A 3OP4A 3L41A 1XXHE 2OM2A 1IAQA 3FB4A 4DSOA 2WMYA 4G26A 5DP1A 4C76A 1ISSA 4Z51A 5IZCA 3TLCA 4PZPA 4B3RM 1PHPA 1L7QA 3SYMA 4UDOA 1XFDA 3U37A 2AKEA 3U3JA 3LM8A 3N70A 3CVXA 3AONB 5D7BA 3TBFA 3OZBA 1OBHA 4TYWA 1XAIA 3ZWMA 4HHEA 4MRVA 4WK2B 2VHZA 4BQFA 4CM7A 1RHUA 2IXAA 2C4VA 5A62A 2BTQB 1PNRA 4RE6A 1X8LA 2PUWA 5AW3A 3AESA 2D2VA 1WSDA 4MKIA 1FNSA 4F38A 3R6DA 1EFVA 4GOND 2O2ZA 4J9UE 4C14A 5SYMA 1R4AA 2AZXA 5KVQA 5JCOA 4AMUA 2AMVA 2PLFA 1PEAA 1FP6A 5A71A 2CF5A 3I4CA 1GABA 5HOQA 1F5NA 1EWQA 3TIFA 2F3RA 3INRA 1FDUA 2R85A 5JMOA 3O3MB 5C1IA 1KHHA 3SS7X 2H8GA 3V1LA 2WJYA 4KQEA 5SYNA 1IEVA 2DF8A 1TL7C 1UAGA 2OHOA 3LL7A 4Z2AA 4O1HA 3P4YA 3K7EA 3EK2A 4IRXA 3NETA 3EYAA 3G88A 5KAPA 2XFSA 4XQCA 5JNSA 1WF3A 1GQRA 4OQ4A 4FR2A 2YWRA 4WCDA 2ZUBA 5KYUA 1GWNA 3Q3HA 3QX7A 3DP9A 3TMYA 4POOA 4MV1A 3Q9NA 4FHFA 1K63A 4ZHQA 3D1VA 5CA1F 4MGZE 1OJLA 2DBQA 4G84A 3ANSA 1N0WA 2E21A 4NG5A 4AX8A 4UEWA 2H1OA 4MB7A 2Q28A 4ZTUB 4DR6M 4LF4M 4ASUD 1NM5C 4RYLA 1FS5A 5LP6B 3NAGA 2G09A 1Q19A 3LLCA 4RA6A 2GJSA 3AB7A 3A1FA 4RFLA 1CVLA 4OVZA 4RHFA 1NR7A 3OLZA 2QIOA 4K05A 2HZ7A 4K5QA 3I39X 5LIRA 5A06A 1QGED 3FAKA 1L7XA 4OUKX 1NBMA 4Y2VA 3IUPA 5ALWA 3T0IA 1O8BA 3RBXA 1AGXA 4JR1A 4UHHA 3DE6X 2VP2A 1KSFX 4S1NA 3WGHA 1K4KA 3MAAC 4L0DA 1KJQA 1UJCA 1ZESA 5EJAA 3FOEC 3CC8A 1JAYA 1XTTA 1NMZA 1ESCA 1KQPA 3EPPA 4L9SA 4MA0A 1A82A 2ESRA 2YY5A 3W5BA 1RWVA 1SR8A 3IHTA 3DF9A 3VZCA 5JD6A 1G8SA 4URXR 3L1IA 2ZK7A 4WY5A 1TYEB 1VFNA 2JF0A 4LV6A 1WBBA 3E22B 1YWGO 2NUTB 2WQ6A 5D85A 3Q6IA 4NL4H 4TUYA 3VBCA 4P5EA 4LE0A 4AUEA 4B5LA 4Z7OB 3QLJA 1T8TA 1EINA 5FTLA 3VJRA 5TPZA 3Q6NA 1ADGA 3CVWA 1MU5A 1ZSVA 4DBZA 4ZVVA 5F1KA 3CXRA 4KHPM 3HEAA 5DSTA 4HNAB 3ML1A 1E9EA 1ZITA 1PX0A 3RT9A 4FN4A 6PFKA 4RBNA 4D0SA 4EM6A 5HKKA 3HSKA 3HL0A 3ZGVA 4MR8A 3Q15C 2WD7B 3EEOA 3CCFA 3I6QA 2LP4Y 1K8ZB 4R0MA 3SMPA 1GVHA 4LMAA 3SLKA 4FBMA 4L5CA 3H0EA 4HGRA 5K4HA 2Z1NA 3C3AA 1UF9A 3IE1A 4IZIA 4ARZA 4MW7A 3VTAA 3TXAA 4AMVA 1DKMA 2CMHA 5BSGA 4CNQA 3B48A 2O06A 1OAKA 1GUDA 1AQJA 2BHLA 1KDOA 4EHLA 4NCXA 2JGLA 1QR2A 2K87A 5I6DA 4TYNA 1YF3A 3DD1A 4EBBA 2FMFA 1VIYA 4GNKA 3UH1A 5DM4A 1PZEA 2IXDA 1UKBA 4DCNA 1TZBA 4OQYA 4D45A 3REGA 2MSEB 2W11A 3PQ7A 2F8TA 5IBQA 1SKQA 1O96A 2RHMA 1XL0A 1Y8QA 4ZJZA 2IZ5A 4DDMA 4RWEA 5B58C 3KJEA 1DGFA 1IWPB 1RRFA 3IJ5A 2R6DA 3H1PA 4C43A 1ZNYA 2F4VM 4Z4GA 3WLQA 2EC5A 3JQ9A 3O1JC 5BUZA 1GN8A 1B26A 2GZ2A 3HVUA 3RNLA 2JEYA 2R5WA 2OXRA 3D3WB 2AJCA 5CNMA 4WN9A 1YDFA 2UXDM 3O5AA 1SKYE 4UBOA 4N48A 1C0LA 2PL1A 1DIAA 4LF9M 3T1OA 2CLMB 4HI0E 1X70A 2HFJA 4GR5A 3AUFA 3JARB 2EKLA 5KMGB 5J2TA 4YREA 2VQDA 3LQKA 5LB2A 2O8BA 4XR9A 1RC0A 5HR5A 1XALA 4PZEA 4CF5A 1WXWA 5AVSA 1ZJYA 4M1EA 4KQFA 4F1JA 3SHVA 2ZR9A 4KYVA 1GN9A 4NBKA 2FKAA 4RDHA 4P7BA 1MKYA 5LZ9A 2VDMB 3ZX5A 2WKPA 4TQ9A 3F9RA 1TKCA 3JQRA 1WA5A 3CZCA 1NRIA 1WBDA 1CJTC 3EYWA 5GKNA 1BS9A 5K51A 2G88A 1KEUA 1IHDA 4ZT3A 1UQUA 2JATA 4HMPA 1QPBA 2PM8A 3L2OB 3LCJA 5HWSA 4QDJA 4UNSA 1CUGA 1LFDB 5DWVA 3WA7A 3ZH2A 1OFTA 1GILA 3K73O 2G4LA 1NULA 3CKMA 3W5VA 2VT2A 4IDEA 3RLFA 2BBSA 3IAHA 2QD2A 4GO1A 1VB3A 2X77A 3QNWA 1YFKA 4XIYA 3DJYA 5BPHA 1AO3A 4KL8S 1ECGA 2YMMA 4W82A 1YZFA 2BSQA 1XXHB 1W73A 1V7CA 5F64A 4H31A 1RQNA 3C43A 5F3RA 1XTJA 4XM1A 4CDNA 1C3OA 5KTOA 4Y98A 4ZEVA 3GJ0A 5KBYA 2QQ5A 3KQTA 3FDXA 1N7HA 4WINA 4M3NA 3M9WA 3A05A 3PIDA 2ZVPX 3GZNA 2P9ZA 3WBBA 1OROA 4DXHA 1EJ2A 3ABOB 4JCOA 3GEBA 5FSWA 3G68A 1Y8RA 3VZSA 3K16A 3AERA 4Y2YA 1HSZA 2QRKA 4XA8A 4DGSA 4LKRA 1O5TA 2BISA 2WV9A 1F2TA 1TUIA 2FS1A 1VHTA 4C4AA 1BD3A 3LECA 2OYRA 4EF4A 3OQ1A 5EE9A 5ED4A 1N2CA 1XB2A 2XNDD 3ZDQA 2BUBA 3OM1A 4BRZA 1VKHA 1JIQA 4EA9A 4U2EA 4RZUA 4A5SA 4QTYA 4IVPA 3VZRA 3VPAA 4IHAA 1F12A 1SQ5A 5AVXA 1KE2A 3GU3A 3KKLA 4H6WA 3M7IA 4EAAA 1PJZA 1XTKA 1O3YA 3A10A 3FFBA 3D4BA 1HR0B 3AWIA 3L05A 3AR8A 3O4GA 4Y6LA 2A8YA 3D6UA 4KAXA 3RIGA 2H7CA 5K6TA 1E2JA 4LMBA 3UFXB 4PCVA 4XWGA 4TL9A 1N3YA 3SYKA 2PK3A 2COKA 1CFJA 3HKDA 1PZMA 4C7KA 4DV4M 1T5LA 3HHPA 2FSVA 3TTWA 3EY9A 1RJ9B 5K03A 5I51A 3TOZA 3FWYA 1YJBA 2D0PB 2W71A 5BMVB 1AK2A 1DMSA 1Z0FA 4B3TM 2A9KA 1OT5A 1PAUA 2AUTA 5JOQA 1IHOA 4YRAA 4YJKA 3DVLA 2V6MA 2HJSA 4G1BA 4YRKA 1A95A 3FKSD 1P7WA 1H22A 4N4AA 5IJ9A 3I76A 4XWKA 1Z37A 3U6SA 2WUVA 3BQMB 3YASA 4MS3A 2WJHA 4UBKA 7YASA 4YB8A 2QTAA 1KFCB 2P90A 3W5DA 1MNAA 5LBUA 1W36D 1XA3A 3A45A 1M7GA 1PT7A 2OHXA 3FWHA 3H13A 4WEQA 4UCXA 1XMQM 1X42A 4LOKA 2PZGA 5ALZA 1P3JA 3H9UA 3T0GA 3V4VB 1IRIA 2ZVDA 1TTEA 1KZ6A 4GWGA 3RVKA 3R5XA 4MVJP 3HUDA 4BX2A 3WHIA 4X44A 4MYCA 4QUAA 1QLWA 4NICA 1LCIA 2VP9A 3AP3A 2VTDA 5IG2A 3Q1KA 2H1HA 1N36M 2I65A 2AEEA 1OOEA 1DC5A 3VR2D 4CG3A 3A2MA 2CVQA 1LPPA 5GJBA 4G4RA 3JYNA 2H1LA 3TLAA 1Z5VA 3LKZA 4F2GA 3AC0A 4WTOA 1T3GA 4Q37A 1YU9A 3B5EA 5DW0A 3RO7A 1Z2PX 3NBFA 5B6IA 1BNCA 3BIOA 1DJMA 2GYVA 4Q7JB 1HJPA 4DEYA 1OW3B 1OILA 3G5UA 2QD4A 5D3MB 1P72A 3J81A 4OIFA 2GCOB 4L51A 2WP8J 4GKJM 2QSFX 5SY9A 2MR5A 3PPYA 3AFIA 2WWRA 4OMDA 3T7IA 5LR6A 3QWIA 3U6LA 2FOXA 1KP3A 1ZNQO 5CX1A 5AQ1A 1L7AA 5F98A 1GQOA 4QYWA 4ZZ0A 4A8JB 1BX3A 1FFCA 2OQ2A 3WB0A 3LVBA 1RFGE 4DUPA 5HYVA 3H16A 3L0PA 4U2DA 2EF0A 3RVJA 3AV3A 4DHEA 2OBFA 3KQOA 2V7QD 3I8XA 2A88A 1PSWA 2HWJA 1K4MA 3QY9A 1IN6A 4PV7A 2X8JA 1U7UA 6GPBA 4K6FA 1FDSA 4RJTA 5CB4B 4TKUB 4W5NA 1F2VA 3FSJX 1J23A 4U0KA 4LJ5A 1S2DA 1ODJA 1EHYA 2CHFA 3B6EA 3L6OO 5E1MA 1MVOA 4YP7A 3DOCA 3L6EA 2BCEA 3NM5A 2IIVA 3PUHA 4BLQA 1XKTA 1JFFB 4H4DA 1ONNA 5JPDA 3RJ9A 4XASA 1EHIA 3ONVA 1SKYB 2WSSD 2NZJA 4MGYE 2V7PA 1RQGA 2QTCA 4D9BA 2XPCA 1J09A 4K87A 1LQTA 2QSUA 4NU0A 3OP1A 3RUIA 4YRBA 4Q12A 3WTBA 5C0OE 4YV1A 1YZVA 5E3JA 2H08A 1E0AA 4EFMA 4LK2A 4C22A 1T26A 2D7DA 3W2FA 3JQCA 1Y4DE 5AH0A 4ZK6A 3PL5A 1H4SA 1LDGA 1AS0A 1YZQA 1J7JA 5DKFA 1F7UA 4LOAA 1J0DA 2I9PA 3PI6A 1NVGA 2HQSA 2A7QA 3DAHA 3EVZA 4FE7A 4LDQA 3R1IA 4CMIB 3KVWA 3PL1A 3QY0A 2CNWD 2X0EA 3WGMA 3PT9A 4MZDA 1O1YA 5JWOA 1ANKA 1YQWA 4X61A 1KFBB 3TXYA 4BV9A 5AVTA 2NMVA 1WMAA 1O97D 1GU1A 2YH2A 4G4QA 1P5ZB 5F33A 2XHEA 4K0KB 4N18A 5AVWA 1L1EA 1WLYA 2OZLB 3GP8A 3QVKA 5GVSA 4R1MA 2VVTA 2P5YA 4F72A 1IHPA 1NP7A 5DCYA 4UFNA 3NCHA 3PR3A 4I4IA 2NNWB 4IYJA 1XDWA 5ETJA 3BDVA 3ZHVA 4CUJA 3RYTC 2OKCA 5MN5A 5J59A 2QTTA 2EZ8A 2ZQYA 4C20A 4YRZA 5BV1A 3G2KA 2QA5A 1Z5AA 4KGDA 1P2SA 3GLQA 3PQ5A 1XEFA 3AJIB 1QIDA 3PPWA 3GBSA 1MOSA 2G40A 4WLVA 2P65A 1VGQA 3EG9B 3ER6A 4N54A 3LFUA 4BTVA 2E7ZA 5LC1A 1Z82A 9ATCA 1GLVA 1WGLA 2PUGA 2QU8A 3R7SA 3KP0E 3DB2A 3G59A 4A1OA 2EJTA 4HEA6 2UUOA 5CLJA 1X1RA 5CDFA 5KQSA 3GEMA 4M1ZA 1CQJA 3CEAA 3H18A 4ZT2A 2GM5A 2Q4RA 5ESWA 1LRLA 1ITZA 2NO9A 4UNQA 4Z8XA 1E62A 1AMOA 5F52A 3FCCA 5ITQA 5DK4A 4NCNA 2D8AA 5JAHA 4BNFA 2C7PA 4XQGA 2YIMA 4D25A 1X80A 4LCEA 3IVRA 4EY8A 1ABBA 3ETJA 3EOBI 1YS9A 3HKEB 1L2TA 5B1IA 3PLAE 3DH0A 2E1PA 2Y4OA 3VR3A 1N4DA 1QM5A 3O8CA 1AM4D 3SHWA 2R1UA 2CL6X 1TVEA 4ZGWA 4CLHA 1TK9A 4Q21A 1KRXA 1RCFA 3SJAA 4M0PA 3IOYA 4MLCA 2QW0X 4G0UA 3AEUA 1AHIA 1GZUA 2QROA 1OI4A 4B47A 3CO5A 2IZ7A 3N8HA 2D1RA 1WHTB 1UDWA 1ZWLA 3EQ7A 4OLHA 4B76A 1LSOA 3OQNA 1PKXA 4AKIA 1M34B 3JU3A 4JJIA 3TFWA 3FUXA 521PA 2DERA 2ZI4A 3QJYA 2C4UA 1L1RA 3U44B 3E8SA 2D1SA 2OV3A 1KJJA 1NBHA 2X2FA 3NBQA 3EQ6A 1OI3A 2B4RO 1HKHA 3V7FA 1WO8A 3T6PA 2SHKA 4JITA 4CCSA 3X2SA 5JEDA 1N7JA 4LSWA 3U4AA 3KC2A 3HYNA 4E4YA 1QZUA 3PDUA 1SHUX 3P2OA 1MG0A 4IMJB 2R60A 3O4HA 2GASA 3ON5A 3INGA 5AW9A 3G2PA 1ZG3A 3QYJA 2XYHA 2WV7A 5H9WA 5E3HA 2O1XA 5FBKA 4NCKA 1ADFA 5GIPE 2EZUA 2VBCA 4LC1A 2N47A 4P08A 2AA3A 5L51A 4DA8A 5CBKA 3LAWA 2WU1A 1J06A 4HPJB 1QTNA 2R25B 3AI2A 4TN5A 2VP3A 3H05A 3GYGA 2VS1A 4OBWA 4ZCTA 1KOLA 5EGNA 3TD2A 3IIJA 1XZLA 1RTTA 2XTAA 3FDIA 4NBTA 2EFGA 1RXWA 1VKJA 5CFZA 5ITZA 1GRNA 1RRVA 1XDSA 2FW7A 1HRKA 4GMHA 3H99A 3TVDA 1FRZA 1ODTC 4DR7M 2YICA 1TT5B 4UM7A 3DFUA 1ZIYA 3GWZA 2FSSA 1LK7A 2BFFB 1JBQA 2QRVB 4KVGA 1YJXA 4HAUA 4UXJA 1IY8A 2DENA 4WXEA 3QIVA 1J9GA 1NXTA 2V4UA 4XOIA 1VSTA 4J29A 3GRAA 1A71A 3AUAA 1ZR4A 1JEDA 5CFLA 3BXXA 1KO8A 3QKTA 1G63A 5FI5A 3FA2A 3KS8A 2Y0CA 2H4WA 3CA8A 5LWQA 1C50A 2VEDA 3HB1A 4BMDA 2JLBA 3THXB 4KYIB 3RAEC 2X86A 1A9XA 2G70A 1QFJA 2PT6A 2Y1LA 1TM2A 1FFAA 2OYSA 3E1KA 1DAFA 1L4UA 3VH2A 3TQQA 1KO5A 5MN4A 1BXZA 2E2WA 1X3LA 3RSHA 4C6HA 2IQ5A 1UJ5A 4MPRA 4PYIA 3K1YA 5FPKA 3O84A 2YVKA 5EP4A 1N6PA 1M2VA 1UWKA 4XBOA 2JIDA 1N5OX 3ZWKA 1TGVA 2GRJA 4KK4A 1M0EA 1OTYA 1F8FA 4LC9A 3N7UA 3IQZA 4ZREA 1IN5A 5KPRA 3WYBA 1Y82A 1FP4A 1E7MA 2V6FA 4BKPA 3H2IA 3IAS1 2P40A 4HRAA 1QK5A 3MTDA 2KBFA 1IY0A 1KDYA 1BS1A 2YR0A 5HEKA 3IH5A 3GPLA 3Q1LA 5GM2A 3U0BA 3GYBA 3C70A 3QI7A 3BJZA 3HYLA 5CBPA 4GPTA 1CEQA 1VECA 3TLKA 7ADHA 3BA6A 1JLSA 3HDJA 2I55A 3JX9A 2P3QA 4GXNA 3L29A 3GO4A 3O3NB 4AZ3A 2GDZA 1GCIA 4FHGA 2AOUA 2PYZA 3FHTA 1EZZA 1J8FA 4MKZA 3PU6A 5FUWA 2HV8A 1G0OA 4D26A 3B52X 2Y93A 1G19A 1VCNA 1V4VA 4E5NA 1HFEL 1Y6JA 4ECEA 2ZS8A 4P6VF 4LJ9A 1QE0A 4L74A 3ZHUA 2JGDA 4O08A 4MARA 3DW1X 1E3MA 4PYRA 5AKZA 2EKPA 4RSHA 2GRUA 1ZOSA 2IBMA 1DBIA 1V1RA 2ZR0A 2A92A 1O95D 1PQUA 2O2SA 1O6GA 2R7LA 3TTUA 4LXTA 1HQDA 2FE1A 1WXHA 4PX9A 4Q24A 4TT3D 3DL2A 1D0MA 2UXCM 3AW8A 3VKFA 1KVRA 1MZPA 1ZQ9A 2H9AA 2ZROA 1XC7A 3ROMA 1VMEA 2AFRA 3X1JA 1KVSA 4D92A 4RPKA 2L17A 1WZCA 4JASB 3G1WA 3BEOA 3G7NA 2AZTA 4YR7A 4ONEA 1C9JA 1M54A 3FYUC 3EPLA 3PWTA 4FK8A 4V0LA 2NUAB 3RC3A 4JI3B 3WL6A 4AW4A 1ZD5A 3WMGA 4UE2A 3ZHBA 2P30A 3NT5A 2HYIC 3GFRA 3H1EA 3PXUA 3TQFA 3C98A 1JN0A 3OLCX 3P2KA 3IRVA 1IOWA 5A5VA 4I55A 4GT1A 3LCRA 3DBRB 3U4HA 6CHYA 1JEEA 4IJKA 1IBKB 2OGUA 3B38A 2FGKA 3QQPA 4XD7A 2HCFA 1BE6A 5G1OA 1SBZA 4D3FA 3BTSA 3L0SA 5I8PA 2RHRA 2PPVA 4Q01A 3QUSA 1YQGA 3I9LA 5AFSA 4MEBA 1W76A 1HM5A 4L2IB 1CIPA 4B7AA 1RJEA 5CW2A 4XYEA 3OQHA 2O2GA 4K86A 2X8BA 5KTPA 1YIDA 1WMDA 2FSUA 5ERYA 3EQ9A 3B8HA 4KO1S 4JQZA 1R8SA 1K8RA 4AF8A 5ALSA 5A02A 4ENPA 1W49A 1VFPA 2JI9A 2Q4EA 4EHKA 2J4DA 4QYXA 3OEHA 5AKIA 2BM1A 2YWHA 1UM9B 4FGWA 3VDMA 4JEIA 2J3DA 3DR3A 3RJMA 4QQKA 5HXAA 2Q3BA 3U60B 2Y2VA 4KQXA 1X8KA 4LDPA 2CP8A 4GSKA 3BGIA 4DR1B 4EG6A 2O1SA 1ECJA 3CBGA 2DHYA 1JLLB 1E79D 2YMQA 3E7PA 5JAMA 1D3AA 5IPFA 2QM8A 1WP4A 1WL8A 1Z2NX 1N1DA 1U7DA 1YBMA 3VMMA 3RNOA 1VDDA 2EXXA 3L1KA 2GBIA 1X1BA 4ZWNA 5CFRA 4XQEA 1XCMA 1QH9A 1BA2A 2C5AA 3KM0A 1UKYA 2FMUA 2YXEA 1I10A 1EP1B 4L0QA 5GINE 1I7SB 1UPUA 1N2ZA 4OH7A 4K2AA 3PHIA 4HDRA 5CFMA 2X1HA 1N8TA 4OIMA 3CINA 4Z4FA 3MXTA 2DBVO 3FNGA 3U3MA 2EHJA 3NH6A 2O7SA 4OJYA 4GE0A 1KPGA 4DWWA 2NADA 5EXEA 3WLJA 1V8PA 4ND1A 3I1YA 1HA3A 3HJ8A 3EUWA 4KR2A 5T57A 4I8DA 4TRJA 4MR7A 4DCMA 2ZAGA 3I6BA 3N86A 5E7IA 5KKNB 4NENA 2CKMA 2H0QA 2BBWA 3L8YA 1JKXA 2OWDA 2XMQA 4I8XA 2FEPA 2W2PA 2UUAB 4KCGA 3IDSA 2QRPA 2WLTA 4FHCA 4DV2B 4LQDA 2GPNA 3T9EA 4RY0A 3K1AB 4FGLA 2HSGA 1JMVA 4DIEA 3UMJA 2G7ZA 1R16A 4R9SA 2KPOA 4J0GA 1FFXA 4YJFA 5CB8A 3HKBA 3RUHA 1KC3A 3TR5A 5ECWA 3CHYA 4NSNA 4KQHA 4X6XA 5TS2A 2HU5A 2EFEB 2AFVA 1ZI6A 2HLPA 5BSVA 3EXEA 1W0JD 4ND4A 1QRUA 1PVVA 5C1DA 4WXRA 1VSUA 2YXPX 4R9RA 5AIAA 5IBCA 3HI4A 2ZDGA 4HLQB 1V1MA 3UWOA 2INGX 3SARA 5JFGA 1IOLA 2CWBA 2I6GA 1P8AA 3PXAA 5IUJC 1WJ7A 5CYFA 3WNVA 1U63A 4YC7A 1LA2A 1U1FA 1PJ3A 2HJRA 1PLJA 1LSUA 4EGJA 2XIJA 1H3EA 4C01A 1KFJB 3TI9A 5JSYA 2R44A 5IU6A 4JLDA 3ER9A 4X66M 4MV7A 2CJPA 3VV2A 4IOMA 1E3IA 3X1ZA 4CHTB 2YOFA 5JV5A 4CV2A 2FZ5A 1W88B 3EFBA 4HB2A 1Y37A 5LOVF 5F35A 4PF1A 2RI0A 1EM6A 3RSLA 3TXXA 3L6UA 5DTMA 2ZTHA 1JB0F 3ICPA 3UJNA 4WD3A 2C78A 5CT4A 1TAUA 4NNOA 5JDIC 1SXJE 2BKUA 4DV7M 1E98A 1RD4A 1TD9A 2CB0A 3KR2A 2G7MC 1U0HC 1R4GA 3PTLA 2LNDA 8MHTA 1EP3B 5KCMA 2JFZA 4G5QA 3IGFA 3L2AA 2VRCD 3DS8A 4OP2A 4OHBA 5IT0A 3RFVA 1EIWA 1WB4A 4YJGA 3VPGA 3MFQA 2BRUA 4UVIA 4DZZA 1NUQA 4QA9A 4IDHA 3PUVA 1OWNA 4P4SA 1XDBA 5K8LA 4I19A 3RYHB 2YWEA 5LQAA 3IUQA 3FTEA 2GEBA 1FPMA 2WJWA 3R3JA 2R96A 5DM0A 1Z0IA 2E0IA 1AKRA 1LWOA 3V1TC 2XKJE 5EQDA 3MRSA 4B3JA 3MIZA 2WG0A 5LQMA 1MPXA 1Z12A 2GBGA 1FE8A 2HCRA 4H08A 2SKCA 3I9JA 1Z0UA 1EUCA 5CIYA 4DUZM 2CV1A 4N9QA 3GPXA 4KVFA 2HXGA 4X64B 2JD2A 1VJRA 5GWXA 1BHJA 1ZOIA 5EGSA 3O31A 1FUUA 4LKOA 4FGUA 2CD9A 4EI2A 4C4YA 1JZTA 1OZFA 2YVUA 3IB6A 1TMOA 2C7BA 4MWDA 4X6LA 3PGVA 4ILKA 4ZOLF 1YJCA 3BWXA 4M21A 1VLVA 2EGGA 4MRNA 4MGZR 1FX0A 1SUPA 1LVHA 3LCCA 4RK1A 4F91B 5IT9A 4FE3A 3SF0A 1QVWA 2MR6A 4HNHA 3PGXA 2P75A 3LOQA 1TVMA 3LBYA 3BWYA 4L3VA 1UFQA 1SHLA 2VCHA 1K6XA 2GETA 3KXLA 3AR7A 2ZBKB 4FMCF 2GHQA 3IAFA 1HYHA 3UKOA 2CXOA 5JJKA 2NP7A 2XZLA 4ENWA 5AJHA 4V0NA 1FC0A 1KY4A 1P29A 5FWYA 1ZJZA 1ZOLA 1DRUA 3ZE7A 4G4NA 1DBQA 3TWKA 4Q9AA 3VVMA 2APLA 2Q7XA 4YRCA 4DJFC 2XLJA 5GMOA 4MQEB 5B36A 3WB2A 2EWVA 1XGKA 2FRDA 2JNHA 1G3IA 2QRJA 1C1DB 2O8FA 2VAVA 1WVIA 2ODEA 3ZCTA 2PL9A 1J2EA 2WAYA 2QRLA 4G0MA 5BSUA 1RM3A 5CCBA 2CL7X 4CL8A 4EECA 2XE6A 2DTXA 2VQ3A 5T4EA 2HK6A 2EZ9A 4WERA 2FK7A 4U8HA 1WX1A 1PJBA 5EMLA 3CE6A 3CJTA 3HDQA 1IEQA 4FVTA 1RI4A 3WSWA 3Q3IA 3O73A 2NYUA 4GLJA 1NNJA 1OLUA 1T9GS 3PFFA 2NGRA 4RZSA 3BMXA 3GUUA 2QVZX 4O5OA 5KTRA 1G55A 5FUMA 4QT0A 1MTZA 3AX6A 4P3PA 3CVOA 3KFVA 1H2BA 3TVYA 3LNCA 2OK8A 4MX8A 2HK7A 3TZHA 3T1HB 3ZTTA 4D0RA 1UPCA 1KZYC 2C42A 4B0PA 4JI1M 1YRQA 4UHFA 3WZMA 3NRBA 4QUGA 2HBRA 2OFPA 4E11A 5CA1B 1WKVA 1V11A 1IZZA 2EJUA 5A2QS 4R84A 4OX9Y 4NPAA 2Q5JA 3V48A 1NVXQ 2QTLA 5ALMA 2JKZA 2CUTA 3KK0A 2O07A 1JYEA 3FCSB 1J42A 5IH3A 3NHPA 4PCZA 1OHHD 4NRVA 3J7TA 3V00A 5FTWA 1NVDA 2ZBGA 1LBQA 2L6OA 3DFKA 1JEOA 5KPZA 3LGAA 1CULC 1P9WA 3SDZA 1NG1A 4F3KA 3OIVA 1ODKA 3KPJA 2W82A 2HSWA 4NMLA 3TNLA 2QUIA 1JE0A 1V8OA 3GDFA 2FFRA 4FWGA 4JYAM 3HJBA 3PGA1 1FTGA 3FD8A 3OBIA 5CDHA 1WE2A 2FPMA 4KBGA 4A6XA 1NXWA 3E7DA 3BSFA 3QX9A 4TTSA 4QZVA 4FW8A 4CKXA 2VSFA 1KZ9A 1XCBA 4CCYB 4X8MA 3OIFA 4PLPA 2B3DA 2TMGA 1TK3A 3VKVA 5KOYA 4HO1X 5HF5A 4ZVNA 3SS9X 3H2JA 5KOHA 2YUTA 5CW1A 3EGOA 3R5SA 3RTAA 1E77A 2EEPA 4NBWA 4PU0A 2R7AA 1VLQA 2FV8A 3PHGA 3N87A 3VR1A 2I3ZA 4R7ZA 4NKRA 4WGFA 4DLTA 3CN9A 1CF2O 2UVPB 1JQJC 3ZV6A 2QQEA 7MHTA 2H52A 2RAFA 1YK0A 4NCHA 3U5ZA 3QPVA 1MEJA 5KO2A 3AFMA 3VR5H 1Z5WA 2EX4A 1M5RA 1ZCJA 5LL6P 4QM7A 2HQOA 1GRRA 2K4MA 4OYYA 1PM5A 3ROKA 1HXHA 3M6IA 4MRMB 3KV3O 1W0CA 1XCGB 5DEIA 5A3SA 5ITUA 2BMVA 4LSMA 2PS1A 3EXG2 1N2HA 1O94C 1A8HA 2H5LA 4AZFA 3CT4A 3RBAA 3K72B 4DPMA 3ESZA 5K09A 4ZGBA 5BR4A 3EIOA 1PWEA 3DXZA 4TVBA 2ORWA 3U3XA 1XOIA 3SKYA 1I80A 5F1OA 5GONA 3HJRA 2J3JA 4BXOA 2IXTA 4LEIA 5EIWA 5IM5A 5LQNA 5ARDA 1E6UA 1OWMA 4JYCA 1TD1A 1T5OA 3FKEA 1NXOA 2DUMA 3NHWA 4IIFA 2EO2A 5HCIA 4GXTA 1H6BA 1B3RA 2FN7A 5EIAA 5K6AC 4WNIA 5LD2C 2M1XA 1EWTA 1IBLB 4RTKA 2PBRA 4CKBA 3NIGB 3T5AA 3SX0A 3KZKA 4PFKA 4DMUB 1SXJB 1TEVA 4MQ5A 3B7GA 2VRWA 2NNLD 4RKQA 4MVJG 2W6NA 2PGLA 4JLOA 3QE9Y 1WXQA 3T4UA 1QH1B 1OLOA 1K88A 2Q6LA 4PAQA 5IM4F 2Q8QA 3LP5A 2ZBFA 3EZ7A 4RADA 4ENVA 3F78A 3UTCA 1NW3A 2QTMA 3UW3A 4QDZA 3OO1A 1DQYA 4I1SA 2ZGVA 5EWJB 4UM5A 4HV4A 4M37A 2A9PA 2HA7A 4YWJA 3JQBA 1H1TA 4J2OA 1Z2DA 1LD3A 2H8KA 3E8MA 3P9NA 1CRZA 5BP7A 3THYA 3M3HA 5DJ5A 1O0SA 1GTZA 5C5EA 4PSCA 3ZGLA 2AQKA 4GKKM 2XDYA 5B7QA 1ZXBA 4IJMA 2FN8A 3K4PA 4DA6A 4F3YA 2V7EA 3LUCA 2PXHA 2A5GA 1QX3A 5TEWA 2IS2A 4DLXA 4DV5B 2PIAA 3E3MA 1GEEA 4JC8A 4XDYA 1TF0B 1MQ9A 3WWCA 1A2QA 4INAA 5BWOA 1DCFA 3RRBA 5FA8A 3DZHA 5C1PA 4EATA 3E03A 4IH9A 3TCKA 3JRNA 2VP4A 4QHYA 3U9LA 2G17A 3M6UA 1N1EA 4RMNA 2HREA 4BCBA 4BTLA 4KQJA 3HFJA 5AI9A 1OTRA 1TUBB 4KX5A 3UC5A 1ZD8A 3WKAA 3BN3A 1AGNA 4FXOA 1AJEA 2M9MA 4YJ3A 4LOJA 3KQKA 2LCFA 2VJMB 3F6PA 3ND7A 4AC9A 2ZAMA 3LW7A 3GP5A 1WMBA 4BFVA 4FLEA 1DADA 4DADA 3HI6A 1A1SA 2ZWIA 3I32A 3KALA 2R0IA 4K9NA 3FYUB 2YN0A 2P4HX 1JF8A 2AGVA 1ENYA 2FVYA 2VUHB 1LZKA 5LQJA 5LYJB 4S1WA 1JHAA 1ZBDA 3QF4B 3MTAA 4RKUF 3Q5EA 4Z0NA 4Z3OA 1JQEA 4OP3A 2CHVA 1Z7BA 1ISFA 1X9IA 2C0CA 5LZ5A 2IF2A 5K4GA 4CLRA 3PFWO 2JLWA 5G4KB 4Q34A 1I0IA 3MBOA 4PR0A 3ZIUA 1M0WA 3S29A 4E0BA 3CUVA 1XTRA 4DNPA 1C3XA 1YXMA 3UAOA 3KCNA 1Z0ZA 4XI9A 3LY8A 1EFDN 5HGJA 3OZXA 3J2PB 5G3ZA 4Y28F 3MB5A 3BFPA 3F9IA 1ZEMA 3BMNA 2Q5IA 3K9HA 3GB9A 4WUTA 3KXIA 3PNBA 5AICA 3K4HA 2FSIA 2FMHA 1F4IA 3FR7A 4FSHA 4ALNA 2AK2A 4DNXA 4P32A 1JHMA 4QX6A 4C7MA 2EJBA 1PJQA 4MUYA 5AK5A 5KJCA 3O90A 4AG3A 2P0AA 4QDXA 3B3AA 2FK8A 3PRHA 2ORVA 1SQ6A 1DDOA 4IIEA 5IYZA 2WJGA 3WGOA 3L1VA 3AVWA 2C7GA 3QYBA 4G56A 2JI8A 4EGAA 2IIQA 4MIKA 3Q3CA 3U6MA 3AUTA 3MN1A 3OJCA 5BWLA 3JQ8B 3STXA 1XMVA 1IVYA 3GK3A 5T6MA 5JU6A 4IUDS 4MCJA 5JAPA 2P9HA 2IXGA 2FMXA 1BJRE 3KZXA 4QOGA 3X3HA 1PZXA 1X6VA 2V03A 3OFND 3B6KA 4DA9A 2RE8A 1DTWA 3SAWA 2W0SA 2WVAA 3DBOB 4PG6A 2CVPA 2DHEA 2HU2A 1NW7A 3PA8A 3ZEAA 3TWLA 3UA3A 1WABA 5MDHA 1P1IA 2V5AA 4HRXA 1K5DA 4QARA 3RS9A 3PVSA 1Q5PA 1UC9A 5IVHA 2IUEA 4XUEA 3R8FA 4RZIA 2O50A 4R3UC 2VJPA 1FFHA 3SE0A 1HQCA 2HU7A 5HKLA 1OXVA 4BIIA 1UH5A 2JLRA 4QULA 2ZSFA 5HZHA 1QZMA 3IOMA 1C7ZA 2F3PA 3TD6A 1L7VC 1HC7A 5JH7F 3CJQA 5D2CA 3VPSA 1Z7WA 1D2EA 5LJLA 3I34X 3JZMA 4HUQA 2IY8A 4G4IA 1DO2A 1Y9EA 3S1SA 2FE8A 2RGGA 1E7SA 2XYPA 4Q6WA 2EJVA 1V9LA 4ARSA 3UG6A 5A9SA 2B2CA 4O8CA 4XSGA 5SZJA 1E1RD 5TMBA 2IELA 1XJ5A 1YHZA 3CZ9A 2O0MA 1JI3A 2F4NA 3IPCA 5INTA 2WU0A 3BJEA 1UXHA 1ZKMA 4XIJA 4LIPD 1FMJA 3ASUA 4RK0A 1MIOB 3G0GA 5A6SB 4RH3A 4WCFA 1ULTA 1UEJA 1G60A 1T2EA 3ZNNA 1TZ2A 2NQ8C 2GFIA 1M34E 4MI6A 2YZNA 1JG3A 1Q0UA 5AXBA 3UW1A 2FEWB 5K0NA 1CP2A 4BLVA 2P9BA 2W6ZA 4M1SA 3OH8A 5D5HA 1L7MA 3U4QB 5FTNA 3PJFA 4WAUA 4AJNA 1V9CA 1JQAA 3CCBA 4C87A 3WLKX 1IG0A 3EDQA 3QITA 3P96A 3SXUB 3D1LA 1HNNA 1V35A 4B82A 1BS2A 4QLOA 1IXYA 3SMVA 3W6NA 2BKAA 3BWCA 3AUKA 3ZE2B 2XBMA 1KAEA 4CL3A 5DYNA 3IUNA 5NLLA 4TMFA 3IKVA 2F6RA 3TX6A 3OLQA 1RZUA 1U5AA 2XF8A 1DKOA 2EX0A 4RIIA 1NR1A 2C2MA 2L7IA 3S81A 1JA1A 2G28A 1EE1A 1QIMA 3JQPA 4W1RA 2DH6A 2C4KA 3ESQA 2CV0A 5LN1A 4JEHA 3C1OA 1RKXA 3QPAA 1BDIA 3QUCA 1KJIA 3TWOA 2P67A 4I3GA 2F5SA 5C32A 3DOEA 3Q7TA 4U8GA 4JI6M 3ZHTA 4X71A 5JQGA 4N7RA 5BNWA 4DV0M 3L7JA 1VKRA 3A1UA 1JJVA 4IO1A 4MQLA 2PSSA 3AKDA 3O1IC 4I1VA 2BIFA 3T5DA 3AFGA 3RODA 3BHJA 4EF6A 1NXQA 3CGWA 5DGDA 2FSGA 2YRXA 4RCZA 5FUQA 4OYHA 2RI6A 4I6JA 1F48A 4DC1A 3Q7EA 3E1SA 2WWWA 4XQ9A 2WSCF 2ATXA 4TYQA 1V33A 2LHCA 5A6VA 3TDMA 3F73A 3JVUA 3FMOB 4XPIA 2GAFA 3AG6A 2ZBEA 1AUVA 3O03A 3KQYA 3ZZTA 1PRBA 4PZCA 4EHNA 5EAIA 3LUDA 2WJVA 3IVGA 5IAGA 1Z5NA 3CZMA 1CR4A 4L9RA 1LPSA 4IKPA 3EODA 4TTAA 4OHOA 2FP3A 4ZZ3A 2J7PD 4IFIA 3L4SO 2FYTA 4ZQCB 3QELA 1EQ2A 5BMOA 5H59A 3DE0X 1XK6A 5K8JB 5B3JC 4MJLA 4A03A 2CDAA 4LDRA 4FYHA 1E2DA 1AXEA 2VDPB 1TLTA 4IOLA 3ABIA 4ND7A 3RK0A 3TUIC 1O77A 4KR3A 2ACVA 3O8DA 1OGIA 3Q3JB 1NJ5A 1P7ZA 2ANCA 1N6KA 5G4LA 2WICA 3IA2A 3UT5A 4ZQHA 3NBAA 3ZE9A 2GZDA 3L0BA 1X1QA 3VX4A 4JDPA 3PXXA 4R3WA 1SEVA 2HNAA 5AESA 3OT1B 2C7OA 1A7AA 1BXGB 1WM1A 3SWWA 2JK0A 4LRTA 4HL4A 3NC1C 2FF7A 4GPD1 3AZOA 1K86A 2IYQA 2X19A 2YL2A 1HDGO 2G1JA 1XJWA 4JNKA 1XX6A 4OW0A 2QRZA 4GD3Q 2BN4A 2BEWA 3LUGA 3JAWA 1F8UA 1KTIA 5AJVB 4K0RA 1VCOA 2Q2VA 1TDZA 4P36A 2W6IA 4E7OA 5KNLA 1SOAA 4I4TA 2R3SA 1QP8A 1KWGA 1L9KA 5BSKA 4DMKA 3I4VA 1BA3A 2OO5C 2AEFA 1SELA 3L28A 1RWOA 4CMKA 4RDCA 2ZXEA 4IY1A 5LXTF 2LV8A 3RHTA 3HXTA 3FIJA 5FOTA 3KDPA 3AR2A 5I7UA 2OCGA 4AURA 5I47A 3AB3A 2QVLA 1DUIA 3KSDO 3GD7A 5ESXA 3CVUA 1TOAA 3QXXA 4WADA 1OASA 4DLVA 1DTEA 1RKBA 3MMXA 3RGSA 1RJGA 3O9ZA 3WK8A 3K53A 4Y6PA 3NDBB 1GNLA 4E09A 2GK6A 4AJLA 3PFIA 3V1YA 2N42A 4AJEA 3K9WA 1ODIA 1MEOA 1U28A 3W5JA 1K0UA 4QD3A 3W9BA 1H8HA 1KI3A 2HYDA 2POCA 3IVCA 3GEPA 2XA2A 2IPAB 4S0ZA 1JL3A 3U4IA 5CDUA 4JWKA 3ELUA 2NUPB 4J07A 3GJRA 3U39A 3R0XA 4MVCA 4ARIA 1JU3A 2ECQA 4HNUA 3E9YA 5EZYF 2DAPA 3L5OA 2H4JA 2Z9CA 3WK7A 4CT0A 1VDMA 4JLPA 2IV3A 3FE2A 3MUFA 4PBTA 3EVCA 5JXGA 4J9VA 3K1JA 4TMVA 3ANXA 1NV8A 4LY3A 4B73A 2ZUEA 1E5DA 4ZQBA 1JMKC 4UBMA 2C4NA 4MVXA 3OJWA 5JNTA 5CLLA 1CQPA 4BNJA 1E4VA 1V16B 4HX2A 1FNBA 4DCPA 1P19A 3CPJB 3T61A 4M46A 3ZHRA 2X0NA 1BFUA 5FWAA 3BFXA 3OURA 4E1AA 5JMTA 5DI9A 1I6KA 3C7TA 5JIBA 1MEEA 1P4GA 3D8LA 1CWUA 2R18A 3IUBA 3NC0C 3CZQA 2JBAB 1RHJA 1KYWA 4ZD6A 3CSUA 2R46A 4OI2A 3ZZ1A 3L6BA 1TVCA 3PI7A 1Q12A 1PR0A 2HSDA 3G2QA 1NMQA 4A36A 5IKOA 3O7WA 2JZOA 3R7WB 4D9NA 5ECYA 5FOVA 3DLIA 4DLBA 1A5SB 1ZRSA 1VCHA 3GUVA 4WZAA 1OQAA 2JIMA 2OBNA 5SY4A 1WXXA 2B35A 3QVXA 1E2FA 3T94A 2VWQA 2FPIA 3LC0A 4IDCA 4ZAVA 5EOVA 4QYSA 1C9DB 2RHDA 2I76A 1IN7A 4F3RA 4G5FA 4ME6A 1YVEI 2DCUA 1YMQA 2JHAA 4PS0A 1ORDA 4MDYA 1LSJA 2YXDA 3H9GA 2OESA 5G2OA 2GHRA 4DEVA 2OCAA 1XVIA 3Q9LA 5AXCA 1I9GA 4PLTA 2VQEB 4WK0B 1IC6A 4G24A 3KVYA 1BW9A 4PYQA 3RSGA 2VOEA 3M7GA 2FW6A 2V96A 1YR8A 2KS6A 4G67A 1D1PA 1ZISA 1EFUA 1XZHA 5CJJA 2DWOA 5A9RA 2PRIA 3F8SA 2O2YA 4UREA 3S2SA 3KB2A 5KJ6A 1S5PA 2O0KA 3MGAA 4KN9S 4B7GA 3N2ZB 1F0NA 3LG2A 3OM8A 2IP2A 5A4IS 1T91A 4GF5A 4UE3S 2LIVA 3WL7A 3DKVA 1NZFA 2MDTA 4BNKA 2OWEA 3UXEA 1QIGA 4JP5A 2AK3A 1VMAA 3FN4A 1XPOA 4LGVA 2VF7A 3H4VA 2GJ4A 3QLVC 4KTTE 3Q8MA 1TAGA 2QY6A 2PEYA 2VYND 2KI5A 2FFQA 3EARA 3T15A 5DF1A 1N2JA 4ZT6A 2QVCA 3L8CA 4RA9B 4EG3A 2E18A 3JRXA 3DR5A 4CT5A 5JSUA 4K7JA 4YVFA 2XVYA 3IAS6 5EZ5A 4TLLB 4FZ3A 2HF8A 3C14C 4OFXA 3OKAA 4ROSA 1ZIPA 5H3CA 2W98A 1KJNA 1T0PA 1X3SA 4P4TA 1ZWKA 4JI2M 3WRXA 1C81A 2PKYX 2B25A 1MABB 3KW6A 2CF6A 2CNKA 5J5CA 4UHKA 1H8ED 2FCRA 2RC5A 3R3YA 4U1RA 4PQEA 3RBZA 4I6GA 1N77A 3EH2A 5JVDA 5JCZA 4J75A 4MQ4A 1PT9A 3JZFA 3LQ1A 2B2NA 4KWHA 3K8ZA 2WT8A 1EX1A 4RW0A 3B53X 1I01A 1PUXA 1X7ZB 3NBZC 4I1UA 5CXXA 2V8BA 1JR3E 2OXIA 3DFFA 4O29A 3H5NA 4BJ3A 3NJ4A 4HD8A 1S4QA 2X4GA 5JW6A 1VPEA 3L77A 1T1SA 5AK6A 3D4IA 2R6AA 3SY8A 1Z2EA 5K2OA 5FF9A 3OU6A 5K0FA 3FHCB 5YASA 1HO3A 4D4IA 3EXIB 3OJFA 1FMCA 5TQJA 1XG5A 3I9FA 2PUCA 1OCEA 1K68A 4UUBA 1M9NA 4DIKA 3FMPB 2WAMA 1XCOA 3SZMA 3MLBA 4WOJA 2C8LA 3UHPA 1TKBA 4ZIRA 5GGYA 3OOYA 1LPNA 2EG9A 4D56A 4W4TA 2PMWB 3E2MA 4L27A 1KTVA 2CXXA 4W5HA 3FMFA 5E8RA 1V37A 1Y33E 1C0EA 2IXBA 4OLAA 5ICFA 2I7VA 3KTDA 1AV6A 1XWIA 2BGKA 3NHJA 3FGNA 2X23A 5BSTA 4N40A 3MHPA 3SZGA 4QDUA 4GM1A 1NC3A 3LT0A 4JYPA 5EHXA 2PZBA 4BNGA 1WSAA 2HXSA 3OETA 5KYXA 3OY2A 3ORQA 3EA4A 3MQ4A 3FOBA 1RSZA 3OPYA 4RHTA 2DT5A 2UYOA 5IFLA 1RQPA 1XSEA 4DM7A 5A9TA 3VKGA 3W9UA 3IEPA 2P6MA 4DREA 4KI7A 4S04A 5JISA 3L7AA 4UD2A 1HDCA 4CEIA 4IV5A 1L4LA 4PHGA 2LKDA 3R9KA 4FGJA 1RMQA 3K0CC 5EY5B 4ZAZA 2OA0A 2DFNA 1QO9A 4DYVA 5CB0A 3C5HA 5MFPA 5KSPA 3FROA 1QV9A 1U3CA 4IDOA 4QEDA 4EGFA 1QX4A 1D2MA 3T5BA 2C5LA 221PA 1JEYB 2QZJA 2AOTA 2V6BA 1IULA 2JGFA 5AJTA 2NO5A 1FVXA 2AUMA 1QO7A 2IU4A 1EWYA 3T4PA 4HZUA 4Q6BA 3Q7SA 3RF6A 4N0MA 2IOFA 3RH0A 2AYXA 3AOEC 4OGGA 3A6GA 4CKWB 2VL7A 1BYIA 3M1YA 5FWXB 2CNNA 2V7UA 5DYTA 1KETA 1EESA 4NYJR 3MD9A 1ZINA 5L7TA 5CMLA 4DJDC 5GOZA 4DV1B 2BI4A 4D3YA 5I7HA 2BY4A 3FI9A 2QAIA 4IJ5A 4DLNA 1I36A 2O8CB 3K9FC 1EIJA 4LHVA 2PCJA 1JJIA 2QNJA 5BUQA 2KRUA 4D9CA 1M5UA 4KXYA 1QHYA 4ECAA 2N0SA 1MC4A 1BJKA 2QAJA 1OV6A 1IBRA 3C6ZA 4J6FA 3USES 3TPFA 4LXYA 2QPLA 3RRFA 2QNBA 1B43A 1JTFA 4TRRA 1XIVA 3OE1A 1CP3A 1R66A 4PAGA 5ALFA 3PE3A 1GU7A 3GUYA 2HWYA 4TMKA 4RE5A 4QPPA 3A2LA 1J9ZA 3ENKA 3HB4X 5JS2A 3G8CA 3ZN2A 4RH1A 7GPBA 3OO0A 4NPHA 3C5WP 3DMHA 4R1PA 3MTGA 4ZO8A 4P83A 5KJFA 3AU9A 4A6EA 3T3EA 4C0XA 4BU1A 3F46A 1LH0A 3CRW1 2AHMA 1TM1E 2B8EA 3DQQA 4LYJA 4YO8A 1T36A 2OG1A 1MC8A 4MV8A 2OCKA 4C7OA 4J4TA 4TT8A 1Z75A 5DBOA 5IJZA 4UTNA 3JWPA 1IFXA 4A8HA 4IGIA 2X0DA 2CJYA 2Q5HA 3S2ZA 4MUNA 4NF2A 3CNQS 3Q85A 1SXJD 1U5BA 4H7FA 2HKIA 4RMJA 3F3KA 4QO8A 2IV2X 3ASZA 1AXRA 1R9JA 3W6UA 4I9UA 2PUBA 1FUKA 3KZVA 9LDTA 1SVSA 7AT1A 1R6VA 3DULA 1RI3A 5BN4B 3VSDA 3ZW7A 1FTNA 1XDZA 4DM4A 2HLNA 1G7TA 2D7HA 1QJ4A 3OPYI 3ZWNA 5FPHA 3WISA 3FPCA 3FGZA 2HLDA 1WIVA 1H4VB 4FDUA 3DMPA 4JYBA 1FJGB 3QMPA 4QGFA 3P2YA 3GGOA 1C1YA 2C3PA 3AF5A 3ICCA 5LOVB 5TF4A 4MW2A 4P5PA 2A7XA 2GCPA 3B7WA 1FQOA 2BBOA 4KXLA 3OPMA 4REQB 3GAAA 2PKQO 3K5HA 2QW8A 1MGOA 1K3UB 4V0ME 4X93A 1HTBA 2A1UB 3AR3A 2A3NA 1PN3A 3OZVA 1ADJA 1YA4A 4KJXA 5CAEA 6YASA 5KO3A 4MKGA 1KNQA 4GR4A 2V5UA 1U65A 3HH8A 4WBNF 2V1XA 1NX9A 3EFHA 1D4FA 3V5NA 1A4RA 3MUNA 1E32A 5DNCA 4UUAA 3UTDA 1QK3A 1YFLA 4UUPA 1E8DA 2HGSA 1XZPA 2HJGA 1L5NA 4QSHA 3WP1B 5M7EA 4M1OA 4X1KB 1KI6A 4XGIA 4XWWA 4DLWA 3LA8A 4WJLA 2UUBB 3A1TA 4UHEA 4AO7A 1PQPA 2NVOA 1I7NA 1LDBA 3OA0A 1ZH4A 2GEJA 3LGXA 3R9XB 1DJLA 2I4TA 4IS3A 1OFUA 3WIUA 1AUXA