3FTCA

Crystal structure of a. aeolicus ksga at 1.72-angstrom resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
234
Chain Sequence
b'LLVSEGVLKKIAEELIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 70
structure length 234
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftcA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftcA01
4GOLD 3TKAA 4QDKA 5G02A 3UZUA 3P9KA 4HRAA 5F2NA 2P41A 3MTIA 4QDJA 3KPVA 5C1IA 1AQJA 4P7GA 1L3IA 1ZKDA 4YMGA 1QAOA 4E2XA 1NW7A 2PLWA 1AQIA 5GM2A 4E70A 5BW5A 4PIPA 2VDWA 3C0KA 3A25A 4X41A 5HIKA 3O4FA 3TKYA 5EZSA 5FUBA 3O7WA 2OKCA 3UJDA 2P8JA 3OE5A 1G8AA 2Q41A 3OCJA 3NW9A 3UJCA 3R0QA 5CD1A 2G1PA 2G71A 1JSZA 1RJFA 5EG5A 5T67A 2H00A 2IBTA 2YTZA 3FPJA 3GIWA 3KR2A 4MWZA 4AZSA 3M70A 1P91A 1SQGA 1VP9A 5C9ZA 2ZVJA 4AZTA 2AOTB 5K03A 2OPBA 3PS9A 1D2HA 2YUIA 1RI4A 1U2ZA 3G5TA 3LL7A 4E30A 4EMSA 4HH4A 2FHPA 3KQSA 2ZIGA 5EIWA 1JSXA 3HEMA 3KR0A 2WK1A 3SVZA 5E1BA 3L8DA 4RTMA 1I4WA 3FPEA 3BWMA 2GB4A 2GS9A 3I5UA 3MB5A 4DMGA 1G6Q1 3DLCA 2NXEA 1IY9A 5E9QA 5EHGA 2PVCA 2ZZNA 3LGAA 2NP6A 2P1DA 4LWPA 1PRYA 5LQNA 1YFLA 1EQAA 3ELDA 3ANXA 1FPQA 2UZ4A 1N7JA 2ONYA 1I1NA 1NW3A 1SQFA 4WXHA 2YXDA 5DTRA 3CVOA 3P9CA 1MJFA 4GC5A 2HMYB 5LQCA 3A26A 3KQOA 3NWEA 1XDZA 3HTXA 3OU6A 2OB2A 3PFGA 4BLVA 3RW9A 5T64A 3HCFA 2I7CA 2AN5A 3EPPA 1V39A 4LWOA 5GP1A 2I6GA 3CBGA 3G7UA 3SR4A 3GRYA 4FT4A 4BY9E 4AZVA 1G8SA 3BUSA 1M0EA 3A7EA 4ZTBA 3G88A 3PT9A 4X61A 5H02A 1JTFA 2GAFA 3BKXA 3UJ6A 3PLAE 2EJUA 1XXLA 3Q7EA 3NJRA 3GGDA 3SSOA 4YUYA 3GCZA 5LQKA 3FTEA 4RTSA 3B7PA 3UWPA 3LX6A 2G72A 3CGGA 4OBXA 5DTQA 4EKIA 2XVMA 3MERA 2Z6QA 2AVNA 1QANA 3GXOA 4PINA 3UJ9A 4DKJA 4R8SA 3AY0A 3UA3A 1ZGAA 1MHTA 1ZGJA 2JHPA 2WA1A 4E33A 2VDUE 9MHTA 3R6TA 5GIPE 2K4MA 3DOUA 3DTNA 2FK8A 4DM3A 3BKWA 4HTFB 5CVVA 4HC4A 4JXJA 1JTEA 2AOTA 2OO3A 2AN4A 3M4XA 3M6UA 2PKWA 3R3HA 2BR4A 4FR0A 1ZG3A 1F38A 2NXCA 3LBFA 3FRIA 3LKZA 3B3FA 3R9XB 3EVFA 3LECA 2XBMA 2UYCA 4A6EA 3SMQA 2C7QA 4PIMA 5GOZA 3T0IA 1VP3A 2I62A 5DT2A 1FP2A 3SX0A 4AUKA 4RTNA 1VPTA 1O9HA 3HA5A 5FCDA 2OZVA 3IYLW 5DM0A 1BOOA 4AZWA 4RVGA 3KQWA 3PVCA 2ZCJA 1YB2A 3GRRA 4OX9Y 4M38A 1P1BA 4M37A 3NVMB 4PYMA 3DUWA 4DA4A 3MHTA 3REOA 1NKVA 3EGEA 4OA5A 1NT2A 2HR1A 5EPEA 2YXEA 1SVUA 2ZIEA 5LQJA 3UA4A 3TRKA 2PY6A 1R74A 1NW8A 4R05A 4E2WA 1IXKA 3TR6A 2XYQA 2B9EA 4L7VA 1ORHA 2UYOA 3OZSA 4PYOA 2Y1WA 5K05A 3LDFA 3UJAA 3QOWA 4HSGA 4MQ4A 1YF3A 3EGIA 4PYLA 2GPYA 5F2KA 2JH9A 4RYLA 4BP3A 1SUSA 1G60A 2EFJA 4CWAA 3ER8A 1JQ3A 4RTLA 4OBWA 4CKEA 4QPNA 2XYVA 4GOMD 3RODA 2IPXA 4XCXA 2CWWA 3LPMA 3PB3A 3VYWA 4DCMA 4YUWA 2OB1A 10MHA 1QYRA 1RI2A 3I58A 1AF7A 5DX1A 2Y1XA 1RJDA 1QAMA 3E8SA 3ELYA 4KRGA 3QOXA 1FJXA 3BT7A 1X1CA 3G2QA 2ONZA 4FT2A 4RV9A 1D2CA 2ZSUA 3KPWA 4P7FA 5EMMA 4M7RA 2O0LA 5DLYA 2VP3A 2ZWVA 5U4XA 2AN3A 5K0FA 3K6RA 2PXAA 3AXTA 1FP1D 3C3YA 3G2OA 4CKCA 3BZBA 5E9JA 3FUWA 1L1EA 4HTFA 3OE4A 1WZNA 3Q87B 2YX1A 3TMAA 4C4AA 5FHQA 4P7KA 1KPGA 3LDUA 2PXXA 4V0QA 4FSDA 3NDJA 5DRTA 5E8JA 8MHTA 3AJDA 3CCFA 4X1OA 4M36A 2AOXA 2EX4A 3P9NA 4PYNA 2PSSA 5LQAA 4MIKA 3H2BA 1NW6A 4RSRA 5K0GA 2IP2A 3ME5A 4KDCA 3O31A 5DRYA 2P3QA 4RX1A 5B1SA 4XUCA 3F4KA 5DM4A 1KXZA 4GC9A 1VLMA 2A14A 5E9WA 5HIMA 3KQYA 2G70A 2PJDA 1VE3A 2IFTA 2ERCA 3JWHA 4DCGA 1D2GA 3B89A 1IM8A 1QAQA 4GOND 2ZBQA 2P7IA 2P3OA 1PJZA 1R8YA 1TPYA 3HM2A 4K6MA 2AOVA 1G38A 4FSXA 3GU3A 4GF5A 2PX2A 3DULA 2VZ9A 4MTLA 3EVAA 5D1HA 2PBFA 2Z6AA 4RTOA 3HVKA 1NW5A 3HNRA 4CXMA 3DLIA 5KYGA 5GWXA 3SSNA 4RWZA 4EQZA 5HIJA 2NP7A 3LHDA 5KVAA 5K8VA 5EC8A 2P7HA 4ER3A 3D2LA 5GM1A 3DXZA 4YUZA 3ORHA 5ICEA 3DR5A 3HVJA 3OFKA 3ERCA 4DZRA 4C04A 1UWVA 4KIFA 2PWYA 1NV9A 3UBTA 5LQUA 5DWQA 5F2OA 3BGIA 3BWYA 3HCCA 3RIEA 5LQRA 2ZULA 3B3JA 3THRA 3HCBA 5FQOA 5HZMA 5ICCA 1KPHA 2AOWA 2N47A 3JWJA 2ZTHA 5K09A 2ZWAA 5EOVA 1RI1A 5JR3A 2CMHA 3DP7A 1EJ6A 2JHAA 2YQZA 3EMBA 4ISCA 5FWAA 3MCTA 5IH3A 2HNKA 4PYJA 5K0BA 4RTJA 2GLUA 4IKPA 2PT9A 5EKUA 5DXJA 3LBYA 3FUUA 3PX3A 5DX0A 3FTFA 1H1DA 1X1BA 1JG1A 4KW7A 3FTCA 2O07A 3P2IA 3P9IA 3TM4A 3AXSA 1XVAA 5K0JA 4X60A 3PFHA 4XUDA 5EVJA 4PGHA 2H11A 4FS8A 1ZHFA 1FBNA 2BR5A 4RVDA 2FRXA 5ICGA 3A7DA 2BM9A 1O9GA 5GINE 1SG9A 2IDJA 1NBIA 3EVGA 5HFJA 3IV6A 5DPMA 1Q0SA 3G89A 5EEHA 2PV0A 5C0OE 1WG8A 4U7PB 4OA8A 3NTVA 4QVGA 3U81A 5DSXA 2BH2A 1BC5A 4KDRA 4YV1A 2VDVE 4PYKA 1VQ1A 2OBFA 3P2EA 4GUAA 3P2KA 3V8VA 4YUVA 3SGLA 5CM2Z 3SM3A 4YUXA 1RJGA 1XTPA 2NYUA 5EQJB 2ADMA 3T7TA 4R6WA 4GQBA 1JR4A 1JG3A 4PGGA 4XUEA 3TOSA 3FPHA 3GNLA 3VC2A 5IKMA 2PWPA 1EG2A 2CMGA 5KQSA 1O54A 3KPJA 5K01A 2R3SA 1XDSA 2PX5A 4NECA 4E32A 2IH2A 3PX2A 3G8AA 3FTDA 2NXNA 3AWIA 1Y8CA 2PX8A 2O05A 4KIGA 4X63A 3UJ7A 4F86A 3TFWA 3GRVA 4DQ0A 1T43A 3V97A 2IDKA 5T6BA 1NBHA 5P8WA 2QE6A 5EMJA 1RJEA 3THSA 3LCUA 3HCAA 4P58A 2ZZMA 4RTQA 4O29A 1QZZA 1XDUA 3CC8A 1WXXA 5DM1A 5EEGA 4QTUB 5EZQA 4C07A 4RTPA 1OR8A 1Z3CA 1N2XA 2HTEA 2AR0A 2BM8A 2QY6A 3CKKA 1AV6A 1G55A 2V7EA 4CTKA 1DL5A 3C6KA 4QQNA 3BWCA 5HIIA 3HA7A 5CVUA 5HILA 3UJ8A 3B3GA 5D1NA 5CVJA 3T7SA 5BXYA 2GH1A 3KPYA 3BXOA 4PCAA 5DXAA 3E23A 3DH0A 2NNWB 2C7RA 3FYDA 2OY0A 4V0RA 3SSMA 1M6YA 5K0NA 2OYRA 3X0DA 2EJTA 2H1RA 1WS6A 2ZIFA 3EEOA 4EK9A 2FYTA 3ELWA 3KQVA 5K0CA 2ZFUA 2BZGA 1XJ5A 3C6MA 5JUWA 4QQKA 4CKBA 3G2PA 4GEKA 3DMGA 4ER0A 3LDGA 3I64A 4IWNA 1SKMA 2PT6A 2IH4A 3I9FA 5EKXA 2HWKA 2P3LA 1BHJA 3G2MA 3OZTA 3G5LA 2PXCA 3OFJA 3GO4A 4C08A 3DXYA 1RI3A 3TLJA 1KIAA 5MHTA 2CL5A 4HGZA 4U7TB 1R00A 3MTEA 3EMDA 4YMHA 5EIFA 3HA3A 4PNEA 1JQDA 3M6WA 7MHTA 3FYCA 1TW2A 5K0EA 2JHCA 1L3CA 1VL5A 3P71T 3KQMA 4R6XA 1INLA 2FPOA 3KU1A 3DMFA 2P40A 3TM5A 3FUVA 1KP9A 4H0NA 3VSEA 5DTMA 4DF3A 2DULA 4RTKA 4QPPA 4BP1A 5LSAA 1BKYA 3I53A 1YZ3A 2IIPA 2XYRA 5E2BA 1RI5A 4AX8A 3KPUA 3TQSA 2JH8A 5E1OA 4KWCA 3FPGA 1UFKA 3OPNA 2QYOA 3KQTA 2JG3A 3FUTA 1L3BA 1X1AA 2VS1A 3LCCA 4E2ZA 2ORED 3B5IA 1N7IA 1HMYA 1YZHA 4PYIA 5ICFA 5CVDA 5BW4A 5FADA 4IV0A 3GDHA 4E2YA 3R24A 4FP9A 5BP7A 5DSTA 1KPIA 4EVIA 3BWBA 3KR1A 1X1DA 5GIOE 4GOOD 1R18A 2V74B 2ESRA 3MCZA 3A4TA 3OZRA 4ER7A 1P39A 5CUQA 4FGZA 1JQEA 4C05A 2BR3A 3GRZA 1HNNA 3NMUF 3JWGA 5E2AA 4RVHA 5FA5A 2FCAA 5FWDA 1I9GA 4YV2A 3DMHA 5FQNA 2Z6UA 4Y2HA 2AVDA 3CJQA 3LSTA 1M6EX 1ZQ9A 2ZW9A 2AOUB 3E7PA 4LECA 2F8LA 2ZBPA 2XVAA 5ERGB 3HVIA 5FHRA 5CCBA 4ER6A 1SUIA 5E1DA 3DXXA 5FA8A 1F3LA 3LKDA 4CTJA 4PWYA 3G8BA 2G8NA 2YXLA 2QRVB 3IHTA 5DX8A 3FRHA 2OXTA 4BLWA 4QTTB 1EAMA 3WSTA 3NVKI 1UIRA 1JG2A 4RVFA 4POOA 2CKDA 2B78A 1EJ0A 3M6VA 4C03A 4HGYA 4KVZA 3ER9A 3CJRA 2I9KA 3OU7A 1KR5A 5K0LA 1R6AA 2C7PA 3FUXA 1VIDA 2B25A 3EVDA 4PCLA 2FK7A 5KQRA 2E5WA 1R8XA 3TPZA 1Q0TA 4F85A 4WVLA 1YUBA 5KS2A 3E05A 1KYZA 2R6ZA 4PONA 1P1CA 4HG2A 5CCXA 1YFJA 3S68A 3KQQA 5HEKA 2PGXA 3QV2A 1NV8A 3T7RA 3CJTA 3KR9A 2UYHA 2B2CA 3EGVA 4R8RA 4C06A 3P97A 3KHKA 3NDIA 1ORIA 3EVCA 3LCVB 1WXWA 5DM2A 4A6DA 5CVEA 3JWIA 4FZVA 5E1MA 4B17A 1KHHA 2DPMA 4Z2YA 1KYWA 4GBED 5EMLA 3UFBA 4ER5A 2B3TA 3M33A 4BLUA 2EG5A 3PTAA 1XCLA 3ELUA 2AZTA 4MHTA 2ZZKA 3EVZA 3IEIA 3M6XA 3GRUA 1L9KA 3MQ2A 2IGTA 3SXJA 4G56A 1DCTA 2NXJA 2ZLBA 3FPFA 3ID6C 1EIZA 2HV9A 3EVEA 3MGGA 4QVKA 4RTRA 2YVLA 2ZBRA 3HP7A 4LG1A 3FZGA 3OU2A 4EKGA 4YV0A 5EGSA 5EHIA 2GA9A 5EMKA 3VC1A 3BGDA 4ATNA 1TW3A 3HCEA 2IBSA 1JG4A 3HVHA 3EEYA 2C7OA 4OQEA 5FTWA 2AOUA 2LD4A 4PYQA 3UJBA 2IH5A 4E31A 2O06A 1WY7A 5CIYA 4P7JA 2QM3A 4Y30A 3P8ZA 1B42A 2KW5A 2UYQA 2AS0A 3BGVA 3K0BA 4OQDA 4IV8A 1VBFA 3GWZA 4UOEA 5M5BA 2P35A 2WA2A 3KKZA 3NWBA 3GJYA 3MAGA 3KQPA 2PX4A 2O57A 3EVBA 3HCDA 5HOQA 1NE2A 2JJQA 2QRVA 5LR6A 3A27A 1X19A 3C3PA 5FULA 4F84A 1XCJA 2YR0A 1DUSA 5E8RA
chains in the Genus database with same CATH superfamily
1JXAA 3IA7A 1JFTA 1NUTA 2C59A 3MTIA 5ALQA 2X76A 2WZCA 3H5NA 4TMKA 4C0LA 4D4LA 1XZNA 5D01A 5F76A 5ELMA 4BGVA 2IDMA 3UTCA 2JLYA 5KMGB 4OHOA 5BMVB 1KQGA 3CTMA 2G67A 4S2UA 2UZ1B 1G4UR 1LFDB 1YB5A 1NWHA 5EHGA 1NUAA 3EFOB 5DHTA 2JF0A 1N1DA 4MGKE 1EX9A 4KN5A 4QARA 4NL4H 3L26A 4MWTA 3EDQA 3MTQA 1KEEB 3VSDA 1N5RA 3G0DA 4IGIA 2WNSA 4LJ7A 1A9PA 3ACDA 3EF1A 1Q3CA 2XE4A 2AMJA 3A28A 3GEIA 3TLGA 2DWLA 3VVBA 1NC3A 4JBHA 4Z9AA 1K5DA 3EGEA 4OA5A 3KBOA 3O3MB 1HX7A 5K05A 3OZSA 4DR2B 3H5WA 3FDFA 1P3JA 4RENA 4CWAA 3O8QB 4AJPA 5I48A 3INTA 1XELA 1UPBA 2V7UA 1AMOA 3EEQA 4LKOA 3IPXA 2P6MA 1H6UA 3DNPA 1NA5A 1DBPA 5EJAA 3FUWA 1MW9X 4XSGA 3NU1A 1KE2A 2F90A 4XDHA 1XF9A 3RFCA 2ERXA 3ME5A 2HJRA 1KH3A 1VYHA 3DMRA 3K73O 4MKXA 2Y27A 3SBDA 2PX2A 2BFBA 3L0PA 2CSXA 2Q2EB 3RC2A 3VDUA 4M1EA 3NTOA 3M34A 2PUCA 1E79A 1YQUA 4TSFA 5TC4A 4L5YA 1YA8A 1DNPA 1R15A 4E46A 3R7AA 1XI2A 2CT8A 5KKCA 2ATVA 2I99A 4G1MB 1EB8A 3CUEF 1JKJB 4Y28F 5DW3A 2GAJA 2VF7A 1Y4DE 3HYNA 4QASA 4OX9B 5LXTF 4MZDA 5JNWA 4AY4A 1R88A 2PO7A 2EAUA 1RACA 3VNAA 3GJZA 4YV1A 3HSSA 4NMMA 5C46F 3CISA 4KQHA 2NU9B 4YAOA 1UC4B 1T9GS 5U1PA 5HZHA 3T6PA 3T1VA 4NFYA 3D5QA 1V41E 1W30A 4OP1A 1IUNA 3L1UA 5HILA 2BGWA 3UV3A 5JBNA 3KV3O 4QL3A 5FPYA 5K0NA 4CR7A 3RGSA 1L6IA 2ZYGA 1OLXA 4OGLA 4RPLA 4XTCS 4MPDA 4BVFA 3O8NA 1EHIA 2XZTA 4N8DA 2GD1O 4YJGB 3FOWA 5MGBA 4X7RA 1UPXA 2FN4A 5ITWA 1GRRA 1YVEI 1CS4C 1X1DA 1G21B 3HXTA 1RC0A 3FIUA 2P0EA 2C2WA 1JKFA 2W2XA 1NVMB 4EW3A 3ZVMA 1YO6A 1ZH2A 3P7MA 3GJ4A 5JAPA 4KG7A 1Z59A 2G8NA 1RQGA 2EJVA 2P9JA 5AW5A 5TVGA 4QWWA 4C03A 3T7AA 5IHPA 1CUHA 3PF8A 2A94A 2FZGA 4P2GA 3H2IA 1QH0A 3UH1A 4PAOA 3AL3A 1UMDA 1WUKS 4AN1A 5IT5A 4KB5A 1UDBA 2B2CA 4KLAA 4EARA 5F3DA 5DM2A 3SJCA 2HMSA 1X38A 3OPYB 1JZTA 4PAGA 1DEKA 3LY5A 2ZZKA 3MCVA 1HOTA 4S1TA 1YJ5A 1NUQA 3ZZTA 2ZBRA 4WE3A 2DJIA 3W6NA 1WD5A 1Z2AA 4HS9A 5I7EA 4IY1A 3W78A 1TQ6A 2MMCA 1S96A 3UIEA 2OFFA 2F17A 1I1HA 1GCGA 3EY9A 4I4TF 4BNIA 4DR5M 1N75A 3H99A 4B8WA 1W2HA 3MAJA 1DKQA 1DWQA 2H5LA 3LXXA 2Q7XA 5CT5A 1L5QA 1QHXA 3AF4A 1E9FA 3RVRA 3W8NA 4CIDA 3H5TA 1TKCA 4R3WA 4XAQA 3T3DA 1RZVA 3QWFA 1R3UA 5B1EA 4LF8B 2YASA 3L8DA 3HDTA 4QT0A 4O2AA 3ICVA 4BQIA 3IUNA 3ZIAA 1TU4A 3U3JA 3ZK7A 5KWJA 5J2TB 2XX3A 4P81A 1JSRA 2IYAA 2ABWA 1BWPA 1SVKA 1CIPA 8AT1A 3FWKA 3A2MA 1L5HA 3ZJ5A 2Z6QA 2VP9A 5E6SA 5FV7A 4NLLA 4V0NA 1XUOA 3TJRA 3X2SA 2GTIA 2Z5GA 3WDLA 4BMYA 2EKFA 3LW8A 4KL8S 2GTPA 4NDAA 3UPDA 1UWCA 1Z6QA 3REOA 1Z74A 3WGUA 3KJXA 3ZE7A 3G0HA 4JBNA 4L7VA 4Y9SA 3ETCA 3FE3A 3VU3A 3AR3A 4YJ3F 3ROQA 4RTLA 1XNRB 1X7HA 1U5BB 3GJ7A 3SG0A 2RD2A 4C4XA 3NHWA 2B4YA 2VP3A 2ZJ5A 1ZJYA 4YCBA 1U0EA 1U3DA 1AS2A 1VKNA 3AEUB 1CUJA 2G1UA 2GM3A 5ARDA 4AO7A 1QTRA 1VLMA 4WCDA 3WDSA 4BFTA 4CJXA 4E0BA 3D8HA 2QJRA 3C74A 1ZINA 5B2ZA 2VZ9A 1L2DA 3CN9A 2Z6AA 2XB8A 4KR2A 4NXMB 3L49A 4QYXA 521PA 2FX3A 2ZKLA 4JC8A 5ICEA 2ATIA 4JI3M 1OYOA 1RKQA 1JPVA 3NNDA 4IIJF 4IZOA 3THRA 5J4LA 4BZQA 1FTQA 4NEGA 1QWSA 3F6RA 5CGZA 4XARA 2G40A 5EKUA 1HT0A 4CT4B 2HHCA 2KYRA 1Y5MA 3R0XA 3PUYA 2C88A 2PFSA 1H05A 4HN2A 1XZEA 3SS8A 4IBKA 4DZZA 3GRCA 2Z3WA 3H4TA 3WA6A 2OBFA 4GUAA 2IS2A 4BKPA 1K3UB 4NATA 3FF1A 3D43A 4WLVA 3FVWA 2VNKA 4ESHA 3PD0A 2WPNA 1PL8A 1PVOA 2VA9A 3SARA 4XI9A 3E0XA 2XDQB 1YBHA 5BNIA 3O2QB 3W5HA 3K4QA 5EWJB 4EGFA 1CQPA 4N3NA 3P9YA 1BCSA 4KMRA 1EA7A 3JQAD 2B4TO 3ICOA 2C58A 1JA0A 3BHMA 4G0QA 3T1YB 4AMYA 4E5SA 1C0LA 2C5AA 2DUWA 3GELA 5NLLA 3KTAB 4LSMA 3TLJA 1R6TA 4AS1A 2B5VA 2BE7A 3LE8A 2QI9C 3HN6A 3D3KA 2QTCA 4XX0B 4NFSA 2DH5A 4EENA 4FPXA 4EDHA 4DF3A 2ID4A 2RGYA 4CQMB 5IDQA 1WHTA 2BBWA 5HW0A 1VRCA 3MPOA 2UXBM 4HL6A 3PPYA 3IESA 1MNAA 2PU5A 4QUKA 2QD4A 4DRXA 1KJZA 4MGYE 1QOPB 5D51S 4B3HA 4IEFB 3CJQA 4CLOB 4AMVA 3UNXA 3RUIA 5DEIA 3RROA 3MJEA 2BDUA 4ZI7A 4DDTA 3NVKI 3ROMA 4Z3KA 4TTVA 4IKEA 3GCDA 4Z4GA 3LCRA 3AUTA 3MWFA 4NKRA 3KOYE 4U1RA 1SC9A 2FPSA 2KEBA 5IJ9A 3FCEA 3FGNA 1MB9A 4F5YA 5HRCA 4W1PA 4QYTA 3BHNA 1JYSA 1D6JA 1DQSA 1RQ2A 2XZLA 4KRYA 1IC6A 1CD5A 2BFWA 1Y1PA 1RYDA 2JPDA 2RHWA 3NWBA 3DOHA 4IHJF 3Q9SA 4MCHA 1QQ6A 1CUWA 3GAMA 3OI7A 3O9VA 4JNCA 3Q9LA 2BGRA 1HNWM 3M8KA 4ZHSA 5D3MA 3DZBA 2C9OA 4RACA 4L0CA 4Z1MA 4JI7B 3G5UA 1NKSA 2PCLA 1IXSA 1M0SA 1Y1KE 1VI5A 4U6SA 2VXCA 3I6BA 3FNFA 2FHPA 4FHEA 3Q1KA 1KBQA 3A4MA 3THXA 4P8RA 1YULA 1GQSA 2XUAA 1YBAA 2VZ0A 3CVOA 2DQSA 1Y5RA 1AB5A 4AF8A 4KE7A 1DDGA 4NCBA 2E82A 3R3SA 1G8SA 3O73A 3QQ5A 4JLBA 1VYUA 3AJAA 3CW2A 4KPGA 2AFIE 4PHCA 4CKWA 1D4OA 3ZC3A 3KYCB 1E92A 2WFMA 5DCWA 1U99A 3ABOB 3ZTYA 3BKWA 1DAFA 3GEDA 3FRIA 1UJ4A 4U6QA 3B9BA 2F5OA 4DG8A 1E61A 3IPCA 3S28A 1N33M 1Z2PX 1RMTA 1USVA 2Q0QA 4NRWA 1ZH8A 4O2RA 5A9TA 1J8MF 1W96A 4MJ3A 1B0AA 2OXIA 2JH9A 1F48A 1GV1A 2EP5A 2IX9A 1EFAA 3VH4A 3WDMA 4ZC8A 3K4PA 3E8SA 1QAMA 4DM4A 2R751 5BN4A 1THGA 4XDGA 4BX8A 4CMEC 4NU6A 4B2PA 1OFVA 5F7JA 1OSNA 3ZXYA 3ND8A 1UEJA 3EXEA 4GKJM 1W8DA 1LTKA 2QRJA 1TLLA 5JD4A 2FEAA 5H37D 1JWAB 1YCGA 1OTYA 4EG3A 1ULTA 5FI1B 3NATA 4CQJA 4Y9UA 3MMSA 1DRUA 4MULA 2HU7A 3OOEA 3PGVA 1OPRA 4F7WA 2P3SA 5K09A 2YJGA 5EOVA 5EA2A 5LN1A 1TE2A 4M9UA 2WTUA 2QE7A 4ARZB 4ZK6A 3FRJA 1ZA1A 3ZZNA 3B60A 3PP8A 4MRVA 4J75A 4JJFA 1U3FA 1OBCA 4MW5A 4G4NA 1OFUX 3RH0A 3EZ7A 3ADPA 4RH1A 1T29A 4FD2A 2CEKA 3A3PA 3IOEA 4RMNA 5LB4A 4EYSA 4MRSA 2CMGA 1A9YA 4WBNF 1PT5A 3E3AA 3FKQA 2QT1A 2UZ3A 1RQLA 2AUNA 2WEKA 1ZVJA 1Z7YA 4P58A 1XMIA 1HT1E 1PF7E 2ZWIA 2NU6B 2AR0A 1VLJA 2WG1A 3A0RB 1Q7TA 4WJZA 1GKIA 2PYZA 3ELWA 2DLDA 2R6FA 1PJTA 1WX1A 3G2PA 2CDAA 1QKJA 2VOJA 2XUZA 1C7YA 2VRCD 4EA8A 2KMLA 1GZ3A 2R68A 2H5IA 1OX4A 4MMYB 2JEZA 2PSJA 2HJHA 3S44A 2DLNA 2NO0A 3PUKA 4ARBA 1H2BA 4GBGA 3RSCA 1UEXC 4DV1B 2CNLA 2CDRA 4COOA 2NUAA 1LPOA 2W90A 3FHLA 4RMJA 2XQFA 1ESDA 1UQUA 3TR0A 4B7HA 5T8KA 4CDGA 1JQEA 2G0AA 1RWQA 2HMTA 4BKQA 2PLNA 4B4KA 1NVVR 1QRRA 1AKWA 3HVIA 4EF4A 4XJVA 4AI6A 4I6JA 3O2NA 1RPJA 3A0UA 1J2TA 2FFHA 3NGMA 2ZB3A 8OHMA 5C4IA 1G8YA 1ISMA 4IJ5A 2J3LA 2I6SA 4L78A 4NZPA 8ADHA 4YCMA 3MLBA 3BCRA 2OXEA 5D3KA 1IN6A 2DE0X 4MAAA 2ANBA 3ZGVA 4ZCSA 4BEBA 1NVKA 3FPFA 4JB3A 1W5SA 3FF4A 1G42A 1VPDA 1UMKA 3EODA 4C6HA 1RFGE 3UJBA 4DC9A 4IOLA 3WHLA 2V5UA 2BYTA 4A9AA 3U48A 4L6CA 4KN6A 3GLHB 5JS2A 4JASB 1G4AE 1WDLA 3JVVA 4OHVA 3PKJA 2JIBA 5CLHA 2B1RA 5IAJA 4HX5A 3G9TA 2D59A 3O84A 3THOA 5K3FA 3DMPA 1P3QQ 1T36A 3R2JA 2GN0A 3K70B 3R0JA 1XTJA 5B3KA 5CFRA 3QK7A 3CX4A 3CW9A 2ZZNA 1W9HA 1ZI8A 2BGTA 3GGGA 1K4KA 1JJIA 4F56A 1QIMA 1C8KA 2B94A 3LQ2A 1E1RD 3F74A 3W5JA 1V39A 1Q0PA 4Y18A 3AG6A 1N7HA 3HGMA 3OT1A 3A7EA 4ETWA 1ID1A 2RHJA 2D5LA 4MVXA 3PRKE 2WJ6A 3AY0A 1LV7A 1XC8A 3AF2A 1JU3A 3DOUA 1DV0A 3WP0A 2OBMA 2UUPA 3GBSA 3Q11A 5L95A 4PIMA 3MGAA 2DF8A 3P0IA 3QITA 1BOOA 4L02A 3EULA 1P1BA 1PW7A 5TIIA 5CNIA 2K7FA 4ZEOA 3WADA 1SXJA 4G85A 1CF9A 1KYVA 3AKEA 4D98A 2Y1WA 4L75A 5AKYA 4RZ3A 5KDDA 3CMCO 3MTGA 4M0EA 4KFCA 2ODWA 2VDNB 2CWWA 4BWVA 5JAOA 3I5XA 5CLLA 4GOXA 4PTYA 4JU8A 3DGFC 3NIGB 3G2OA 1G5IA 1I2AA 2QX9A 1NXVA 1NIPA 3RFUA 2IYEA 4L0MA 5DRTA 3PEWA 4LNHA 3RVBA 2FWRA 4EYOA 3HJSA 2DP4E 1CEXA 1L5YA 2WWIA 5FOUA 3HEBA 4NNOA 1D2GA 4QRIA 3MJHA 1ZK4A 2GMWA 3AJEA 3TZBA 5CAEB 3HLTA 4J2TA 1H1LA 4JFRA 1WGLA 2Q0HA 3UHJA 1K7EB 1DXHA 1KJ9A 3S2FA 3QVKA 3WK9A 3HFJA 1S2LA 2MHCA 1TZBA 2QMEA 1GKYA 3RVDA 5C32A 1QF9A 1EP3B 5K3DA 4JV5B 4RY9A 4D9EA 2ATXA 4NE2A 1FNMA 2O1SA 5CM2Z 4DR3B 4R6WA 3B9PA 3EGXA 1ADYA 2H0AA 3F46A 3G8AA 2NXNA 2PKYX 3PD1A 4P80A 3JD4A 1E7RA 5IK2D 3MJCA 3UT5A 2IYWA 1WMFA 4EL5A 5CXQA 3CZPA 3U56A 5DMXA 4ACBA 5CVJA 2ZRNA 4DR7M 3VNVA 1M5TA 3E9NA 3AJ8A 4MINA 5FUWA 1XKLA 4TN5A 1VJ0A 2G1KA 2H1FA 3GN2A 3INRA 2H92A 2CL5A 1K8XB 3TVTA 4YXWD 4DKXA 1T0PA 4WESB 2IHVA 5EXTA 3HXKA 1EJ2A 3LWZA 4ZIRA 3GAAA 1MB2A 2ZWPA 3BJMA 4YJ2B 4EB0A 4CIYA 3LQFA 1TQ8A 1KMMA 3BIJA 4EAAA 5FXMA 4CISA 3DLPX 3TD6A 3EZFA 1BS2A 4IUCS 4UUMA 4BN4A 1QPGA 2DAMA 5ALPA 2OLJA 4X1IA 2D7GA 4UAJA 3CF6E 3LKDA 2O2YA 2IY9A 4ZOLF 2ZJYA 5TY0A 1TT5A 2AG0A 5K0LA 1A97A 3NM4A 4S2EA 2R60A 3UOAB 5CCXA 4DB4A 1VB3A 1HLDA 2RFLA 1LDYA 4TXLA 1ZGCA 5TGTA 3N8HA 1MR3F 3ADDA 1SRQA 2P6NA 4REMA 1OAAA 2LRHA 1EGAA 4N5DA 4QE3A 5I8PA 4IKOA 4UOEA 2WA2A 5FBZA 1AXGA 3OQVA 2VZEA 1K2WA 2Q3BA 1WUJS 2ZBFA 3HYLA 1E9CA 3A9UA 5SZHB 4LYJA 2Z4SA 2CZQA 2CZCA 3O2JA 3ZWKA 1THMA 2VBFA 5JNUA 5AXCA 4DSTA 2Q2OA 3KVYA 3LA8A 4UXJA 1SZCA 5EIWA 2B4RO 1TU3A 3QE4A 1I4WA 4CQMD 4PLFA 1KTIA 1OLSB 4RJTA 1JYEA 4IBFA 2OTCA 3EPKA 3N2GA 1ZH4A 1C7RA 2NPOA 3S7TA 4ME6A 1PAUA 3A8TA 1JQLB 2OE2A 3IXLA 3HRKA 4LRWA 5T3YA 1IRXA 4R8SA 4NOLA 5I3CA 3F8WA 2UYYA 4OHWA 3WO1A 1QHEA 3DMTA 2AOTA 3R74A 2PGJA 2A3NA 2J6CA 2NXCA 1RXCA 4CI9A 2PA0A 5I9LA 4EHLA 2PMEA 5A9RA 1X7WA 3GEMA 4JJEA 4MI9A 3FDIA 4RGBA 2A33A 3QOWA 4HSGA 3ROXA 4BP3A 4TROA 2BEWA 4M8IA 1MX5A 4NBVA 1F3OA 4YY3M 1KI6A 1Z36A 4JXKA 2OZPA 2WD7A 1C1DA 4XQGA 4WXMA 1NPTO 3I4LA 1FFAA 4REZA 2Q0SA 4RF3A 3ST7A 4C5BA 2QR5A 3RS5A 3V2UA 1WABA 5HIMA 1E3EA 5BWNA 3HV2A 1JNXX 3HVKA 1TCCA 1KY5A 3SE0A 3LHKA 4OQMA 3SN6A 3G2HA 3TCXB 5LBUA 1Y8RA 1KPHA 2OGZA 3FHJA 4DDVA 5EXEA 2X8AA 3RIHA 1CRQA 3EGDB 2BRUA 2HSGA 5K3AA 5FTNA 5C3UA 1V96A 2ZSIA 3UQYS 1Q7GA 3DD5A 1I2ZA 1XYYA 4QFDA 1UP7A 3QV1A 4FMCF 3INNA 3P2KA 5B37A 1N5MA 1XZQA 1YC5A 1NSYA 4EHBA 5IKMA 1A3CA 2ZIUB 2PZLA 4ALKA 2FV8A 4EATA 2OHGA 4I9HA 3MPUA 2NO9A 5EJ9A 5I5GA 2EGUA 2LVNC 3CUWA 1KFBB 2C84A 3PQ6A 4IZHA 4DMMA 2AXEA 3A4LA 4CIZA 1KQFA 3BL5A 2HUNA 2NNWB 3SSMA 4FM9A 4FFMA 3H4JA 4EK9A 4Z8XA 3K96A 3LC0A 4ND6A 1W2GA 1KAEA 4GH5A 3AKZA 1ZVMA 1EVJA 2HQBA 4OLHA 3T9EA 2C4NA 3PR3A 4HD8A 1NOKA 5KPTA 4K7JA 2DULA 1BDIA 3PENA 3GEGA 1U5AA 1KWGA 4QEDA 5IDVA 2FX2A 3PK0A 1QM5A 4G4RA 5KSZA 1F7UA 2DYKA 4JJIA 4LUCA 5B57C 1QB7A 5LPNA 3WV4A 3VSCA 1PR5A 3M5DA 1YI0A 2PMDA 2ZRHA 2AVDA 1SY7A 4H3VA 3B53X 2PMBA 1H2EA 4X1YB 3DHWC 3B6IA 1Z8NA 2FE4A 1QIJA 3LNCA 1JXMA 1JLSA 1F3LA 3SYRA 3KSDO 4DJDC 4FVTA 4DR5B 3AOGA 3F3YA 3NTQA 1R6AA 1M83A 4MW2A 4OXKA 3A3NA 2DFLA 3WWDA 3HKCA 3L4SO 2PMWB 1KKLA 1UOQA 1NV8A 1FNBA 1YR1A 3MWKA 4G8DA 1NYTA 3SI7A 5B64A 2VQSA 3EW7A 4FZVA 5C51B 2VSNA 2V6MA 2C97A 4YWJA 4DRXB 3N2YA 3FVVA 3BDVA 1LZLA 4CT5A 4W5TA 3IHKA 2MJLA 3A32A 3BQMB 3DEHA 4J4BA 3COVA 5DKFA 1Z5AA 5KUTA 3PLRA 1VSBA 4EB8A 1OX6A 3T9FA 3KZ1E 3TKAA 3P9KA 1GG9A 2D1YA 3D81A 1LPMA 3DWGA 3OKFA 1SOWA 4BO2A 4GQIA 1E2EA 5DYTA 5EYPB 4MVCA 2Z57A 4PLGA 3REFA 1XV5A 1RZRA 4GXQA 1WTAA 1XL1A 2WIKA 2UUBM 1ZUWA 1EEHA 4MEAA 5CVCA 3GA0A 3QEJA 2VXOA 1XDZA 4C7OA 1Q83A 2AN5A 4TXMA 1VG0B 4I3FA 4PM4A 4JBXA 2QNRA 1FP7A 1F4IA 4HDRA 3W1WA 4NICA 3O47A 1MFZA 2AUMA 2VJDA 4FK8A 3ON5A 3NBUA 3HVRA 5BXQC 4FI3F 1YFZA 3BIWA 4ZMRA 5JW6A 4INPA 3HJRA 4ZVTA 2I62A 2R1VB 4M87A 3UWMA 1V11B 4PYOA 3RLIA 4Y98A 4JI3B 4S1OA 4UTNA 3TWKA 5C2JB 4OHZA 1B8UA 4AF7A 3QE0A 1GRQA 1MB4A 1HBJA 2C0PA 4ZAGA 2GOYA 4ALJA 4TYNA 1KEZA 1EUZA 3ICEA 1FNNA 1B0PA 3HZRA 4UU7A 1FQOA 1VCIA 1YQQA 4QOFA 1ZLXA 2G70A 4M0CA 2EDCA 1WMEA 2P6PA 4A3SA 1QBKC 2JFFA 4CF5A 5AHWA 2X7XA 2KZSA 1II8A 3JR4A 1PR6A 3OEHD 3GNQA 1D0VA 4MMZB 4QNRA 4US1R 1E2UA 3HK2A 2RHHA 2PUWA 4XUDA 2I34A 1IZ8A 1GJTA 1RMQA 4UPEA 4FILA 5CT6A 5IDXA 4PTLA 4ZEMA 4JVOA 1BC5A 2PGLA 2L69A 3K9HA 2ZAIA 4N54A 3UW3A 1HKHA 5K4AA 3WOHA 5CYFA 3V00A 5K01A 2GEFA 5DSZA 4WA8A 3IQZA 2UXBB 4X63A 4DJAA 4KR0A 4R3DA 3TI7A 5P8WA 1NASA 5AM4A 2MSLA 3RIMA 3ZZ1A 4BAGA 4XYLA 1TKAA 1OAOA 3EXIB 4FE3A 4ZRNA 2D0IA 1OR8A 3MBOA 1P8AA 3ZDXB 4M9CA 1R6BX 4ZOBA 1ZIYA 4HF7A 2OYRA 2VJYA 1VSTA 4Q7MB 5DNEA 3F1LA 3PL5A 5GJWC 1YB1A 1D6NA 3A1NA 1RD4A 3K2IA 4UTOA 1BD4A 1QK5A 4KPUA 1WTCA 1YMUA 1Q0QA 2Z08A 3GLFA 4FQ7A 2GLTA 1QHFA 1Q2UA 1PIWA 1MOZA 1TYBE 3GRZA 3ZDZB 3UQZA 2P2CA 1KJJA 4ER6A 4P3NA 4L8LA 1UBOS 1HNWB 1KMIY 4E11A 4PIVA 3AP1A 1TPZA 4R8VA 3PVSA 4EFDA 5ITVA 4J0FA 1L7VC 5AHKA 2HQ1A 4DC0A 4JI2M 4H15A 1NYQA 1KHHA 3GFQA 4OSEA 4C3ZA 3A10A 3U37A 1PYOA 1M2JA 4JQYA 4TPKA 3JAMS 1PD1A 1Z37A 1SU7A 3PI6A 2G36A 5EMKA 5BMOA 3K8YA 5FP0A 2F55A 2F64A 3EW9A 4XDYA 1ND5A 1FRVA 1E79D 1JHDA 4TSFD 1H5QA 4GE3A 1PTJA 4BVJA 2O57A 3E9RA 1E2KA 5BOSB 1QF7A 3K5IA 4U63A 3HDQA 1EXDA 2MSKA 4BUCA 1Z2OX 1J49A 2QZJA 3JQ8A 2QORA 1EU1A 3C45A 1YV9A 3MJRA 1XSEA 3JQ6A 1V3TA 3OJFA 4D9NA 3EAQA 1N33B 3EAFA 3K0CA 2ONYA 1JDBC 1MRZA 1R8SA 4C21A 2G77B 4I5DA 4CDMA 1AOXA 3SJAA 5LQCA 3WRVA 2F67A 3WNVA 3PC2A 2BEUA 4B3RM 2DY1A 4E5KA 2KXEA 3IAFA 5KQLA 4IBJA 3QOYA 2X0JA 3UMGA 5ENVA 2HL7A 1E7SA 1ZSNA 2AEFA 3ZDAA 1VHQA 5K3FB 2JLBA 2MYTA 2QN7A 1SCDA 1ENOA 2QHOB 1UJNA 3HFRA 4XYBA 2UV8A 4GKJB 1EGHA 4U3JB 2W2MA 3LGXA 1EINA 2ZCJA 2YOGA 4KUGA 5K8JB 1HEIA 1GNLA 3L4BA 2VYVD 5HFAA 3NXSA 1ZRSA 3GD7A 4H1TA 1VMDA 3GT3A 1M9NA 1UQTA 1OOEA 2XR1A 4IIEA 1E63A 2E4ZA 2PQ2A 4MUIA 2Q1XA 4QPNA 1YJ8A 1G59A 2GF2A 3BICA 1M54A 2VAMA 1WAMA 5FLXA 3ZN2A 4EZIA 3RTGA 4Q9LA 2YFQA 3UM9A 2ZWVA 2PR2A 1ZGBA 1Q1QA 2K5UA 3GYGA 1L1EA 5KHAA 4KDEA 3VPGA 1WXEA 3RQIA 3KHUA 5BNZA 1BE8A 4RSRA 3D1VA 4RXMA 2JGLA 3GOHA 4EBFA 5DN6A 3R6WA 1JDNA 4K6MA 4ZPJA 2PBFA 2ERYA 4RTOA 3K72B 4GMDA 1QOQB 2HI0A 1ZICA 4DAOA 3AB7A 4YUZA 5A62A 1L5LA 2VPIA 4DBGB 2YS7A 1E3WB 1QONA 2HAEA 1JDTA 1Z5UA 3BJIC 3O7MA 1RI1A 3VR2A 2JHAA 1UOPA 2D5CA 4LF7M 1P6UA 4HWKA 1M1XB 1DGHA 1E0KA 2RKBA 2ODQA 2M2IA 4R1SA 2BZ1A 3IR7A 5H3CA 3ZWPA 5KQGA 3LT1A 4EI8A 1C7EA 2ODPA 4OY3A 4QM6A 1YR3A 3JWEA 3LHSA 5CHYA 1FXWF 1XEFA 1R9MA 1MD9A 1XLUA 1ZOIA 4GSLA 1NMXA 1QV9A 2HMVA 4FYIA 4OHKA 4FYHA 4O4IB 2H4JA 4DA9A 3HO6A 3JQEA 4BVHA 4AAYA 2UZAA 1RVDA 5EINA 1ML3A 1SHJA 2QRZA 2ID7A 4AUEA 1HYHA 4B6EA 2XTAA 1GT91 1WS6A 5LD2C 4D0NA 3JY6A 1G8GA 5HG0A 5EKXA 1ECGA 4DBLC 1SBIA 1BHJA 5CJJA 5EIHA 5GZ6A 5F52A 4GHAA 1DRJA 1PR4A 2QVBA 1VZ2A 3R7WB 2ZSKA 4NSRA 1SUFA 2QL9A 1DIAA 5JHGB 3QFRA 2EA0A 5MFZA 4I2NA 4JJ4A 2RDMA 4YP5A 3NMUF 2XQKA 2FR8C 3SJZA 4OB6A 5KTRA 2ZJZA 2GETA 5AK6A 1CJUC 2D1TA 3KOZE 4BV2A 1DLIA 5CFLA 1AE1A 4YI5A 4BASA 1YACA 4OQXA 4BLPA 2R00A 4FGUA 2VWHA 3K94A 1Z0SA 1WQ4A 4E13A 1Z17A 5LQDA 3HY6A 4LRXA 4QJ4A 1SVMA 2OECA 4E7OA 2J07A 1T4DA 4RA9A 6YASA 3USES 1VLZA 4PC2A 3M33A 2I76A 3FDXA 2Z8ZA 1YDEA 1ZD2P 1Y6RA 4QUAA 1I4LD 2GBLA 4GI7A 1DHRA 4L9RA 1I13A 2WM2A 3I30X 4QIHA 1WCXA 5HBRA 4K40A 1WW2A 2EEPA 3UWKA 4RVSA 5HOQA 3CUTA 3CVVA 2YDXA 1KI7A 1OC4A 4TMXA 1P2VA 4CEIB 4I55F 3EYAA 3BJZA 7AT1A 4BQQA 2DG2A 4RH0A 3W68A 3TOCA 3KZMA 2CJXA 3LO5A 3G5TA 4ZT2A 4F8EA 3HDJA 1JSXA 2CC2A 3KOWA 3FTPA 4BFUA 4X7MA 2VKQA 2FSIA 2RH8A 4HUQA 1GCAA 1E1DA 3H04A 4L2IA 3FI0A 1S1CA 3EX7C 2QLJA 2P2ZA 1ZNYA 4UCWA 3NDPA 4B0OA 3JZMA 2FU5C 2B3DA 4BV3A 1GG8A 2VSQA 4J1TC 4CW7A 3GCGA 1FNCA 2DBRA 1XXLA 5SZIA 4ZP1A 1PSZA 2KPOA 4OO3A 3CEAA 3E9MA 4BZXA 1W4ZA 2VPZA 4PZYA 5GIPE 3H4MA 4P22A 1MIOB 5LU8A 1NPDA 4JOBA 3DUFA 1A50B 4JL8A 3T3OA 1H3NA 3ORYA 3H3JA 2OOBA 1X8JA 5A4KA 1N2ZA 2L42A 1ZMUA 4HYTA 1T2FA 2ZJBA 1TFUA 2FETA 5DNCA 2PY6A 3IXMA 1PL7A 3C58A 2C0QA 4J91A 4MUJA 3BHJA 2PUBA 2YYSA 1Z3IX 4KGVA 3LUJA 4D82A 1X1CA 2D1SA 1P0QA 5BYKA 1AXEA 2J09A 5E4TA 3DEKA 1EHYA 4WCFA 3B2QA 4EPRA 1PEKE 3DBHB 5JANA 5K6AA 4NBKA 3QI2A 5FNVB 2J5QA 2FSVA 4U0JA 3ZKWB 2P68A 2FHSA 3EVAA 3GVXA 1QRUA 1C3OA 4LY9A 3U1VA 1J22A 1TL7C 5C1BA 1M33A 5LQUA 4IUYA 2FY8A 3DTTA 4HVLA 5GGXA 3OQ6A 1EI9A 1F7VA 3JWJA 1PZNA 1I32A 5AD1A 5L4SA 1PBTA 1KI6B 1OBOA 2WWWA 1AA9A 5E26A 4DR7B 2QN3A 1GILA 3PHGA 3ZGXA 3OIDA 3RSSA 2X8BA 3VAAA 3OUUA 1CLUA 4AJ2A 1JG3A 5DE3A 3I39X 3FJOA 3TIFA 1UFRA 3UY4A 3P5BA 3GQVA 1A9TA 1BKSB 2DFKB 2WWHA 1DQRA 1U4NA 4F2PA 2F62A 1ZMXA 4D41A 2IPLA 4Z1OA 2A1IA 1T8TA 1K5PA 3NCTA 3GF4A 1OV6A 4HNAA 3ZX5A 5FI5A 4HEA1 1JPNA 1T6ZA 5ADHA 1N2IA 5I7OA 2XRYA 3JPYA 3DEFA 2P3LA 4II2A 1Z73A 5CEFA 5KYVA 3GI1A 4D44A 3NETA 1SR8A 1X42A 1NSTA 1RADA 1F0YA 3TQSA 4PBRA 2IOHA 2OO5A 2I3ZA 4RFSB 5D5HA 2G07A 3GP8A 4M86A 2XRFA 3G1WA 4UMDA 1EM8B 4US2R 3CNOA 3K6JA 5CCBA 4XTRA 3RHSA 4WEOA 3E21A 1UBCA 4EEZA 5KYWA 3ANMA 1ODSA 2BKEA 1GSOA 4HDMA 1RWWA 2O8CB 6REQB 1KZGB 5A3QA 4K5QA 2OV8A 3VKHA 2RJOA 4U9IS 3E9QA 5K99A 4MVJF 3ZUPA 2QUZA 4QQ8A 1VHLA 4MM3B 1XWFA 2VHQA 4NOKA 2FPUA 3BXPA 1ZCJA 2H7CA 1X39A 5GZ3A 5A71A 1FUKA 3IHPA 2REBA 3KU4A 2BCGY 3R23A 2XYGA 2AOUA 3AU8A 5B6PA 3AHDA 1N6HA 1UKVY 3ZHQA 1EWQA 5TS2A 2XZFA 3BCHA 4CLHA 4TZ0A 2I4NA 1S3FA 5C1IA 2QE7D 1YGPA 3W5DA 4E70A 3KTDA 3RRBA 3A25A 1PD0A 1A8PA 1IM5A 1SCNE 4V3BA 2JY7A 3H0CA 4Z6YA 4GBJA 1IJKA 1I6LA 3WMWA 4IIWA 2ZAOA 3L7DA 4RD1A 1PJ3A 2NO4A 1QK3A 3UCEA 2ZBGA 5CFZA 3ZHSA 2OMKA 1XNQM 5LDDC 3L8MA 3D02A 3ZI0A 1IB0A 3ORFA 1U2TA 3KSMA 3ABQB 3DBLA 2BI4A 3L0SA 2EXXA 2RGUA 4PC6A 4YY3B 3VKWA 3U7IA 5KOIA 3CWZA 5IJWA 2B6HA 1VRWA 1KYYA 3IUQA 4HQFA 2NV2B 4AWAA 2UYCA 2H2WA 3ZDYB 1TTPB 2XHZA 1XZCA 3FPSA 1GR0A 4V38A 3OCWA 3GJ8A 3QG1A 1VGQA 4DQXA 3WMGA 4Q12A 1GHTA 1XRQA 3AERA 1TUEA 4MKZA 1IBSA 3SHVA 4Y2SA 3T5BA 4EG6A 2HDOA 4BP8A 4AT1A 3RUPA 1SK8A 3DZDA 3DHEA 4E3WA 1YQXA 2ZSUA 2C54A 2OOAA 2F2TA 2PT5A 5IDWA 1ZLYA 821PA 3WGGA 3SOPA 3ZBPA 3QPVA 5CDFA 3VV3A 2V96A 3R9XA 3CE6A 5I7WA 4MV5A 3HKDA 2GKGA 5FUQA 1B2LA 1N5JA 1NNI1 2IPNA 4S1WA 2IFTA 2V59A 4GOJA 3DAPA 3MWGA 4V2IA 2CXUA 3P52A 5GWXA 3SSNA 1Z0FA 1JEAA 1POWA 2I71A 3FSJX 4Y0NA 3LLMA 1J56A 3HCWA 2G9NA 2PJZA 1UBSB 3Q1LA 4WIAA 5TQJA 2O54A 3FUUA 5EWLA 1EMDA 5E7MA 3B36A 3A45A 2PEZA 2D00A 4RM2A 3LY9A 1AV7A 3FB1A 4C7BA 3LOQA 2BI7A 2BKLA 4BGUA 2QAIA 3I9MA 1RPAA 1RRKA 1QH1B 1DWOA 1WUYA 2GK7A 3FPHA 4Y7DA 1IN8A 1PWHA 4X92A 4H4DA 3IT1A 1RRCA 2X3UA 3ZWCA 6ADHA 2C5HA 1QH8A 4MJXA 2YC4C 2E4AA 4JZKA 5EJGA 3TE6A 1E94E 3GGCA 3OQPA 2RHLA 3RT1A 1G7RA 1NFFA 1GZ4A 1DBWA 4EJSC 4FZJA 3ZHVA 5FOWA 2DHEA 5DWVA 1UINA 1YJAA 4TKVA 5F1PA 3W04A 4EVSA 1OBVA 3I34X 4KQ1A 3CX3A 4S3MA 1RJWA 1U7OA 3R9WA 4DR4M 3K9GA 5DNVA 4A0RA 2WQ6A 1FDOA 1Z0UA 4ZQGA 5TQ2A 4MLPA 5HCIA 5JWRA 4GX5A 3RK0A 1PYGA 2XUFA 1BOFA 1SXJD 3RSQA 3PQDA 4NCKA 2GVDC 1GUYA 3I9V6 1NVFA 3A37A 3BQ9A 4WDQA 3UGKA 2F1KA 1GPJA 3TUZC 3FUXA 4QUJA 1JPUA 1B0ZA 2VUTA 3KJNA 1I10A 3E05A 1ECFA 4HRVA 4ASUA 1XCOA 5FSWA 1T25A 4ZTUB 2CBGA 3E84A 121PA 1W5BA 2L2QA 3HJHA 4KC0A 4RHCA 5TB5A 2DPMA 2K6GA 3TVYA 3IEUA 4Y1FA 1OXBB 1LCIA 3S8MA 3IEIA 2QY9A 1C14A 2NAFA 3NZEA 4I6GA 4L3WA 2BEJA 3BH7A 2EG9A 3KOUA 3DO8A 2UUBB 4O4LA 2LUOA 4RGYA 5KVVA 4WMLA 3L6DA 4Z4CA 4HAVA 5JI2E 3TWLA 1CIVA 4MTCA 3L0CA 2X4DA 4RJLA 3O7WA 1T15A 3EXHA 3ETGA 2BWBA 1ARZA 1W59A 3SAJA 1M6VB 3OO0A 5TS3A 1VBKA 5KNBH 4FI3C 4ZREA 4ZHQB 3CNQS 5C35A 3FPEA 2NP6A 3Q6MA 1E9EA 4MIEA 4W1RA 1W0KD 1ADBA 1Z35A 1MGPA 5EXPA 1U1EA 3C3WA 1ZR2A 3MWYW 3WK8A 1M8GA 4PNZA 3PXDA 2MR6A 2IY8A 2QN8A 1N77A 4DTCA 3S55A 1DXOA 3QUSA 1PCXA 4OJTA 4XEHA 3HCRA 2CLIB 3MQ4A 4YX9A 3I72A 5CVVA 4JXJA 1V1MB 2GBIA 5B30A 2Y92A 4XVCA 1VL0A 1C7ZA 4M49A 4DBLE 1HT3A 3D7MA 2BGKA 3IR5A 4EJ0A 3TRKA 3ZGOA 1U31A 5BWOA 3EH2A 4CIAA 4LNUA 4J6FA 2JAWA 4IH9A 2GPYA 4P82A 5AKZA 1NUHA 4F12A 3DTVA 3CNEA 4Z4IA 2I2XB 1WP9A 1H2ZA 3LPMA 2COUA 4ETNA 2V3WA 2R0IA 1GITA 3LK7A 2N1BA 3RHFA 1GTZA 3W6OA 1ZN7A 4HTFA 4ZYTA 3U3DA 2OUIA 1FX1A 4R3NA 4BVEA 2ZDQA 3RWOA 1K7CA 1TO2E 3SICE 4MUHA 4PCVA 1G38A 1B2RA 1G8JA 4IF4A 2EQ5A 4DNQA 1GR1A 3CURA 2C8VA 1M2GA 4WPGA 2O8FB 1KO8A 3U6BA 3THYA 1QPBA 1MABA 2XD4A 3MRVA 2DWCA 5KI6A 4FCCA 1KAMA 3PXEA 4JN6B 2ZRJA 3IKMB 4ND7A 2A5LA 4ZJPA 3FA2A 1JKIA 4WD3A 4A5OA 4AW4A 1MDBA 2H4YA 3A6JA 4GM0A 3Q4GA 2DVMA 3PQ2A 4F2DA 2Q2QA 1KFJB 3VDRA 1NTRA 2F8MA 4DLBA 4RAOA 1JPJA 5DYIA 2B37A 2HPAA 4N18A 3FG9A 4G36A 5FLYA 2LGJA 4OPMA 4DYDA 4W82A 3K1AA 2H5JA 1UMBA 4UAUA 4DWJA 3WNCA 2FMXA 4RANA 4HN4B 3GH1A 1K3WA 4IZ6A 2EJTA 3CVWA 2ACEA 2G9RA 4XM2A 4E1AA 2WWFA 1CQJB 4MRRA 2X1LA 4Y7CA 2GZSA 1EUQA 2IYZA 3RK1A 1OXTA 2FMHA 3G2LA 2O0KA 3Q98A 1VL5A 1Z45A 4G8JA 1P9NA 2DXIA 1KP9A 9GPBA 2AC2A 1O95A 2PMFA 3SM9A 4JI2B 3SNKA 1JHAA 3H8WA 1DP4A 5FOXA 1U8EA 2HCBA 1TQ4A 4EPXA 3ASUA 3VYVA 1U8UA 4YP6A 3WLJA 3R3WA 4S1VA 4JYAM 2AN9A 3HNOA 4Q15A 4OB8A 2XUKA 4KSYA 3AFHA 2PL9A 3SC2B 3HYCA 2B78A 1K66A 2I4MA 4X91A 1K3XA 5FH9A 1T3LA 2HNBA 2W2TA 4UAVA 1OVGA 2JIOA 1Y6ZA 4C20A 1E2MA 4LWQA 1J21A 4B47A 2ZR9A 3MTAA 4TWIA 4DLTA 4RTRA 1L8QA 2Z2ZA 4FGWA 4C7MA 5IT0A 3H2SA 3V6MA 2WPDA 2XA9A 1OGYA 2ZTSA 2FEKA 4B3RB 1XCJA 3Q41A 2YRWA 1DUIA 4QDTA 4GL4A 3MGCA 1OWPA 4LF5M 1XCMA 3E5NA 2HJWA 1CNEA 1IQPA 4O8ZA 2FF7A 1P5FA 3F7TA 2EIXA 4JGBA 1PK7A 1VL1A 4G0UA 3BAFA 3TLGB 2DJ5A 3ELBA 3GQ4A 2YMPA 3RG2A 3TTSA 2DENA 4I2VA 4LS3A 2DAKA 5IH7A 1Z7BA 2G6BA 3U6LA 4LYAA 2IIQA 3AM5A 1K7XB 3H7IA 4BZZA 4KTTE 3SIWA 3IELA 3W9SA 4BGIA 3R8CA 1HDYA 8ABPA 1W5AA 3G88A 3I2HA 1SK9A 2B1JA 2EP7A 2FDCA 4GIBA 1UBKS 2VDUE 1JHYA 3AB3A 4QOEA 4YAJA 5TMDA 3H97A 3HYRA 1Z0DA 4GF5A 2X3FA 4MS3A 4JQOA 1YAHA 3O82A 2KBEA 1C8LA 5DHFA 2BW0A 4F5WA 5BR8M 2BFBB 1HZZA 5JFTA 2MU1A 2QSUA 1NP3A 5BNTA 2R47A 4RYDA 5DHSA 3OM1A 2GYVA 1TNDA 2WJYA 2VAXA 4PLPA 4YQYA 4QG3A 1L7AA 2CXTA 4CPDA 4P86A 3RS9A 2QRHA 1B41A 2CLHB 4RM3A 4LF7B 3GWGA 3DD1A 4YLEA 2CYAA 4NU0A 3ZGNA 2QMUA 4XM0A 1GUDA 2JLRA 3PNLA 1QUEA 3AETA 1N36M 2WC1A 3B7WA 4Q9KA 1TKBA 2ZYSA 4GC9A 2BY4A 1E5QA 1CVRA 1L7BA 5HKLA 3QWAA 2ORIA 2HW8A 4OIFA 2X8LA 3MJVA 1O58A 1K82A 3R5HA 3IPLA 3HJAA 2O4UX 3C48A 5C31A 1VZ3A 2GBFA 4UBKA 3OHMA 4GPAA 3V8NA 2WWYA 1BEEA 2W2QA 2FMKA 4HNGA 1VLHA 2ECKA 5G4KA 1OLXB 1PUIA 3K5WA 1URPA 2RG7A 3VZDA 4UQPA 1IFYA 2G9UA 2VJOA 4BBAA 1J5XA 4DVJA 4IUBS 2Y0CA 1C0PA 3EXFA 1Z83A 4IBOA 5C8YF 1RZRD 2UDPA 1K75A 1F20A 2OAQ1 3FIJA 2JLSA 3WOVA 4RTPA 4QQNA 3E3OA 4LTDA 1V5EA 2NZVG 3LAWA 4RS4A 2ZTCA 4WZBA 4GLJA 5BPVA 2TECE 2UXDM 3K09A 2JXNA 3STTA 5B53A 2I33A 2JIMA 3OPXA 4HNVA 1IVSA 2FQXA 2FZCA 5L4LA 1B43A 3B1KA 1UMDB 3I04A 4ZD6A 3FUVA 1PHRA 4DOMA 1Z6AA 3ZCQA 1XLWA 3AFIA 3DAOA 3I2YX 3FUTA 2VS1A 2ORED 4JENA 4WNYA 1HMYA 3RRJA 3W7BA 3S2IA 3QY9A 4BLTA 2ZPUA 2B21A 4G1CA 1O6GA 1PYDA 2COKA 4AS2A 2QZ4A 1JV2B 3ORSA 4GBMA 3V1LA 4G5QA 5IM4A 1GOTA 2AYZA 1QMPA 3NHLA 4RF1A 4EHHA 2QJOA 3T8YA 7YASA 5BRAA 1SOUA 4PX5A 3D31A 4D46A 3FSEA 1VYVA 3QFSA 5FR1A 2XGNA 4GGMX 2DHQA 4RPCA 5IC4A 1XALA 4DM7A 5GONF 2ACKA 3IAEA 1P62B 2P0YA 3N28A 2H08A 5B3AA 1XK7A 2F00A 4F5EA 2B3TA 1FCJA 4YMTA 1R6DA 3ICQB 2Z4RA 2DPLA 5LOVA 5AVJA 5IYZF 1ND6A 1X94A 3EEYA 3FTNA 4O2AB 1WU7A 5EKDA 3L41A 3Q7RA 4GZ6A 3FNEA 4E3ZA 1SBNE 2RJ3A 2RGDA 4ZU1X 2VF2A 5IBCA 3CRZA 1PFKA 3ETHA 3KAKA 1N2JA 1CERA 3A58B 4KCGA 1L5HB 2XZUA 5E6SB 1SCBA 1HDEA 2CFCA 3KKLA 3PCTA 4B80A 3Q0TA 2YBEA 1D2HA 1EDOA 2KJQA 3RTDA 4B2IA 1G2OA 1ECCA 1QZEA 1R4AA 1UBNA 1Z75A 2WU4A 5DGTA 5B7NA 4JSTA 3WLOA 4CFYA 3I61A 2PRYA 3O3CA 1X1QA 4U7DA 2NZWA 1XEXA 1XTUA 2QW0X 4NCXA 4DCUA 5HWSA 3PQCA 1T5HX 1UJCA 3BUSA 2IOFA 2V45A 2G63A 2G06A 3AZOA 3BKXA 4Q03A 4B2YA 4J9VA 3D6JA 3C16C 4W63A 3GXOA 5CLFA 2HLDA 3IVMA 1P7PA 2E21A 3RGWS 2ZI5A 3CZ5A 3KWJA 3H5IA 1UR5A 4OREX 2H1CA 5FB3A 1A9QA 1PUJA 5EJ5A 2C77A 2NNLD 5H83A 1O7JA 5JDCA 2R18A 4LNAA 1S4QA 2PBRA 1NNLA 3G8DA 1FTGA 1FU8A 4C76A 1P2DA 1TVCA 3SASA 1GM5A 3TD9A 2PO5A 4TUWA 1YZTA 3RODA 3FYUA 3CLRD 1PQYA 3PEYA 3WQRA 3H8SA 3ZC7B 2EZ8A 2W2LD 5B6JA 1NAHA 4JVMA 3W2EA 1W46A 5AI4A 3C7TA 4M36A 3ND9A 2EWWA 1WY5A 5FUXA 4OK6A 5TRTA 4OGGA 3HBMA 1RIIA 1UXOA 1YDWA 2Y0DA 3C2QA 1LPAB 1FRNA 1IU9A 2ZRMA 5H16A 1UF9A 2J6BA 1Q2XA 4LYGA 5K51A 1FDWA 1GABA 2X8WA 4REOA 4JJZA 1RE0A 1BCSB 3DP7A 1BE0A 3C87A 4L16A 1WZIA 4E5MA 1IMOA 5EVJA 4DFDA 2IKSA 3AQIA 1VMEA 2Q3JA 1E3SA 5ECDA 3T7KA 2EVWX 1PLKA 4ILKA 3IERA 1U0BB 1BXKA 2BONA 1BVRA 3JD2A 3DL0A 1JR4A 1LPSA 3IVXA 1WHTB 1O6ZA 2WWGA 2IH2A 3DONA 4DA6A 5A7FA 4ENUA 5DT9A 4AQYM 3U3XA 1TGUA 3QX8A 1K06A 3ZX4A 3JYLA 3VR5A 2JFZA 5JSFA 3HWSA 2XNJA 3BWCA 1DO8A 3TIIA 1NM5A 1JZSA 4XB6B 4M1QA 2C4HA 3RABA 3NKVA 4CL8A 3PA6A 4ZI7B 2RE8A 4LK2A 4GPBA 1D0SA 1GSIA 1YKSA 3C5VA 1NQVA 4LRQA 1LA2A 3BN3A 1UKEA 4KK4A 3MTEA 5IC6A 1E5LA 2R9VA 3X43A 1TZMA 2WHYA 1FVOA 2QTRA 1JIKA 2C2KA 3KSJA 3H5AA 1JHQA 2YCBA 2DTXA 2QYOA 4JL5A 2QR3A 3UMJA 3ONFA 5IJ9B 3D6FA 1T4CA 1B4DA 5IJZA 1IN5A 3U9SA 2BR3A 1QWOA 4YV2A 2NSDA 2A57A 4OMUA 4JSYA 1U9JA 2OHHA 5JAHA 3SFZA 3IAM1 4ZU6X 3HHZA 2H17A 4KR3A 2C3OA 3KL2A 3IEMA 2C8JA 3L6EA 5D3MB 5CLJA 3G3EA 4B4UA 1V0JA 1NY5A 4LVCA 1DZ3A 1IXSB 1V2GA 3RRMA 2G7MC 2X14A 4KQ6A 3BRSA 3SBEA 1VE7A 2H7VA 3ORQA 1S8FA 2GXSA 2QN6A 4I1SA 4BYGA 3THXB 4AKTA 5DN6D 2P2GA 1DG3A 3SC3A 1I4DD 1RVV1 1H8EA 4Y30A 2IQIA 3QE9Y 4WJLA 1XNQB 3HHEA 4Z7QB 4KV9A 1WP4A 2VP4A 5A3RA 2YW2A 4OU7A 1C4XA 3QU9A 3PNYA 1XGKA 4Y2QA 4L4YA 3P0FA 3NHPA 3VR2D 1DKRA 4CKWB 5JXIA 3N74A 2PGDA 4HS4A 1T0BA 3KO8A 4X84A 1VHTA 1EQ2A 1YJCA 1O8BA 2INGX 2IZ1A 3A1EA 2JJ8A 4MWZA 1ULHA 1P91A 5DYNA 1YZNA 5K6RA 3B7GA 4MP8A 4NFHA 1YUMA 1BMTA 1TDHA 3H75A 3BX1A 4E4TA 3ZZMA 1IHPA 1OZ0A 3I4YA 3W4IA 4H7EA 1EKXA 2VN8A 1Z6XA 3WGYA 2P75A 3DOFA 3C5EA 3C5CA 5HS6A 3E53A 2DT8A 2PNJA 1L7NA 3ZTTA 3RYHA 2Y1DA 1EFDN 4FQ8A 3D8UA 2GKOA 5BN4B 5FPSA 3DFUA 5J58A 3WL6A 1JIIA 4JQCA 1GL9B 2IEDA 3S7ZA 1E6MA 2ZUTA 5IKPA 4W6ZA 2YJZA 1IWPB 3LECA 3T9DA 4IVQA 1VP3A 3EXEB 5LZ8A 4KFRA 1VPTA 2WHEA 1UM8A 3PJRA 1DEHA 2OQIA 1Z62A 2QRGA 3I52A 1KVSA 4TWJA 4FWBA 5CT4A 1NT2A 1QSGA 2R8ZA 4MK4A 1GFWA 2J85A 3DZ8A 2EKLA 4RSMA 3A9WA 5F9FA 1QG0A 1E6EA 4Q01A 2Q2NA 3EGIA 4EA7A 1Q50A 1J07A 1Q16A 5IVDA 2I7XA 1Z7GA 1X7DA 1ADCA 1A5SB 2AG1A 4DHEA 3V8BA 5LYJA 3CZ4A 2PBZA 3GK3A 4ZJUA 1IFXA 5REQA 1Y8GA 1GCOA 1ZIOA 2WW8A 2IYVA 2XUGA 1E4EA 3NXKA 2Q5OA 5IVHA 5KSYA 3HJCA 4Q47A 2W43A 2VPPA 4HDAA 4HQ0A 2P3QA 2YHSA 5DBEX 4U7GA 2PGAA 3GLGA 3HM2A 4MV0A 2H29A 1N2BA 4KQ2A 4D9BA 4RPKA 5LLSA 4B0PA 4H59A 3V4FA 1TQDA 1KSJA 2ZVQX 2J4DA 1Q7CA 4PLWA 4M0DA 2GLUA 4IKPA 1J20A 3PTZA 3DL7A 1EUDA 4MP3A 3WGHA 3DAYA 1NBIA 1ZI6A 4MGZR 1IBMM 3U44A 4EGCB 5F4ZA 4N03A 3ZLBA 1AVTA 4HXFB 4Q9AA 2FFQA 1OX4B 2JCXA 1HDOA 3L46A 5A6SA 1GTJ1 1E3DA 2NUAB 4DR4B 2R48A 1AC5A 1R0KA 4UM7A 4G3XA 3CEHA 1T35A 4GD3Q 4ZARA 5FWYA 1NU6A 3JQGA 3GPIA 3M3HA 5D1NA 4XZ3A 1WD7A 5LZ9A 2IHBA 1SKQA 1JL3A 3KJEA 2AEEA 1C7FA 2JKZA 3CLHA 5JQWA 2CNWA 4IWNA 3G2MA 3OZTA 5C7YA 4RPGA 4BL5A 1PDVA 3FYCA 1FFBA 4GU5A 2J9RA 2YJ3A 5HRAA 4AX8A 1Q92A 3DM5A 1UFKA 3NTLA 2CJYA 3VKUA 2GPBA 1E2PA 1UBTS 3JZIA 2W11A 3MSXA 2ZYVX 1I80A 4AY2A 3JWGA 3A3OA 5E2AA 4QJBA 4UNRA 1IZYA 5I9TA 5U4QA 2YYZA 4C7VA 4PHGA 2C57A 1WIWA 4JB0A 4XQ9A 3N9IA 1ZK1A 3B6EA 3ULKA 1Q20A 3K9WA 3HWWA 2E7ZA 1OCEA 3RSHA 2ZUCA 3LMKA 2EQBA 1T36B 3D8SA 3LVRE 4KX3A 3G9ZA 1TAHA 3A11A 4F46A 1AKUA 4NY1A 1RRMA 3W5CA 3NBAA 4LJLA 2IGTA 3DDSA 1ABBA 1DCTA 1DAEA 1M7GA 4XGKA 1SVSA 4RHTA 4GXNA 1L2BA 4YMUA 4J1SA 3VBCA 3D2AA 4PG5A 4WZAE 4G25A 4YNBA 2HJSA 2X23A 3OT1B 1QQ7A 2J3HA 1AB6A 4TLAA 1TU0A 1G8MA 3OZWA 3I5MA 3IQHX 2WZBA 3L7NA 4TZTA 1TIKA 1U7TA 5M04A 3ICWA 2V54A 5KEIA 3QPDA 3ZHYA 4J0DA 3BMCA 2V03A 9ATCA 1NP6A 3U6QA 4GI3A 3V5NA 1ISPA 1GAXA 3ZU4A 1J8YF 3SEZA 5FTMA 2Q49A 4O4JF 2QL7A 1T9ZA 1SXJB 4BGEA 3UGTA 4BQFA 1COZA 3OCUA 2NSJA 1DXYA 1Y3CE 4KAJA 5A03A 4LJRA 1LBIA 2O52A 2O2CA 4B46A 3GCZA 1XZMA 2XOXA 4P4LA 2AXQA 2YWXA 3ZV3A 4QTXA 2BTOA 1IJEA 5IULC 2KRUA 2XBMA 3TVDA 4C2TA 2I7TA 3D7RA 2XOKA 1H0RA 3ADKA 1OGIA 1HQDA 2NN3C 4RNAA 4KWTA 4C5AA 1EX6A 1MG0A 2HIAA 3FOZA 4ZI3A 4LGMA 2QLMA 2DVWB 3WFZA 3C4QA 5BURA 1AK9A 2RB4A 2CCKA 1H1LB 5D3ZA 4ZT5A 1EQUA 3ZIAD 5EKSA 3H65A 2CLSA 4KQGA 2P4QA 3I58A 1EWYA 1W48A 1DADA 3CN7A 1S7GA 2PKCA 4BCCA 2VIIA 3K92A 2LXNA 4H35A 3H18A 1ECLA 4G97A 2AN1A 2XA1A 2Z1MA 2OBBA 4GR5A 5CFPA 4F9TA 5THQA 4LJSA 4N7JA 5SZKB 5H5JA 4RV4A 3GY0A 1C9YA 1VKHA 2HDWA 3HZHA 1T3GA 3NLLA 1UC9A 2OWDA 1ZK3A 2QUAA 3EGXB 5BR4A 4AULA 3BM5A 4G5HA 2M5ZA 3G5MA 1G6KA 4U00A 2W6PA 1ZGGA 3C6ZA 4Y9RA 3UT5B 2CF6A 2YZ2A 4XDZA 3E3MA 1FRFS 2GWHA 4EB3A 3ICPA 2FWMX 5IH3A 4U2GA 4IGAA 3MJ4A 3MCTA 4MX8A 4G4IA 2TYSB 3RKSA 1Z0AA 4IXWA 3U80A 2JKYA 1S02A 3ZXIA 3MBKA 1XDWA 1X13A 3NT2A 5LA6A 3SEQA 4ED9A 3T5MA 2SNIE 1QTNA 2K2QB 3S2YA 5J5CA 3B1XA 4ZIRB 4LIPD 4ESVA 2O3JA 3J7AS 4AIRA 5A4FS 1XMQM 2P1ZA 1J0EA 1FZQA 1AHNA 1GKUB 3SJ7A 2EERA 4B83A 1LFAA 1P0IA 4ZI5A 1OX5A 2YZGA 4JYAB 1GZVA 2C7RA 1YI8A 1JAHA 5DYGA 4X1IB 3SYTA 4AZ0A 1I2BA 3EGOA 3ZWQA 1WOMA 1XJ5A 4FFLA 1FA9A 1TT5B 1TCVA 1YRLA 2WWRA 1K27A 4P4NA 2LVBA 1CUVA 1DRWA 2VJBA 2AMVA 3GD5A 3N2EA 4W1QA 1Q0LA 4ND2A 2F59A 4HNTA 3KLNA 2OCAA 3UHAA 4C4RA 1A7JA 3ESQA 3OHSX 1UM9A 1OB5A 2JG3A 5KTNA 4URVR 1B1CA 3DAFA 4YMVA 4Q21A 5JCOA 3ZDBA 1J0AA 2N0SA 1I51A 5BWBA 3GGJA 4QPCA 3P27A 1CULC 2OM2A 1TLTA 3IV9A 4PZPA 2I4TA 1H3EA 1U2GA 1B3BA 4MGHA 4C7KA 1XU9A 3GJ3A 3OFNA 2FP4A 3TRFA 5HMLA 4LCJA 4LF5B 4XXHA 1JTVA 4FOSA 3FWZA 2P27A 2ZP1A 2PT7A 2JD0A 2D7EA 1W93A 4B6GA 1X1RA 1T5DX 1J8FA 4XVQA 2I87A 1JU9A 2XPCA 2FG5A 2AT1A 2GASA 2Y99A 3U6SA 3S2SA 3P1JA 3KB1A 1S89A 3QKRA 2RGXA 1B8VA 2ETXA 4BX0A 2MYNA 3EZGA 4NJEA 4D8XA 3N2GB 4XX1A 2AFHE 4LE0A 1T2EA 4LZJA 4CGZA 3K2BA 5C18A 1V1JA 4FW9A 1M2FA 3FKSA 4LX8A 2DAEA 2QSJA 1TFRA 1X7ZA 1FQKA 4EYQA 3PSAA 1KVRA 2XE6A 3ESDA 4R3UC 4EG7A 4K8RB 1BMFA 1VP9A 2AOTB 3O38A 1PS0A 1U2ZA 1PTKA 4AJNA 2CDCA 2WK1A 2D1QA 4UHBA 2GS9A 2QGFA 2G5PA 2YN0A 4LZWA 4BC0A 4OQQA 2J5XA 2JJ2A 1X7WB 1AJEA 3HKPA 4YRAA 1O57A 4W7IA 1R5LA 5BR8B 2R2AA 3B9QA 2HN9A 5I47A 4GMHA 4MROA 4IVPA 1RXUA 2BEWB 4JUFA 2DQYA 3M0EA 3SSOA 3VR4A 2GGSA 3UWPA 1P5JA 3TGPA 2WD7B 1C1DB 3CZCA 3GPPA 3E15A 4EPYA 1J0CA 3UN1A 3PWKA 4HC4A 1N36B 3MK6A 3KK0A 4Z1MD 2HLHA 3OE7A 4A6EA 5TJHA 4M1YA 2I4LA 1MJHA 4HDOB 1YSYA 5JROA 3VYUB 1XYGA 4ZT7A 1DAKA 2CUNA 5BW8A 3SZRA 4A6XA 4RWEA 4MVJE 4GOKA 2JCYA 4L4SA 2O0HA 3NBXX 4HSEA 1Y8RB 5FI3A 1RNLA 1J0BA 2XB6A 2DKFA 3B74A 2GLXA 1OLUA 2AEJA 5FJJA 3QYFA 2BFFA 3LWNA 1BDHA 3RTBA 4NV0A 1BAPA 5DM4A 2RK4A 5DGCA 1X8XA 4IG4A 4DN6A 3OQBA 5AT1A 1PN3A 5A2QS 2NP7A 1RAGA 2YRFA 2C2BA 1ODJA 3VR3A 3NTXA 1EM6A 3G9UA 1BXGA 1JJFA 5LQRA 4Z6KA 4F93B 3FYUB 4GH9A 1GT6A 1PV1A 3EJWA 3OQ1A 3TLZA 1AZWA 1TRHA 2E6UX 1ZN2A 1K4YA 3JQ7A 2UXDB 1E2GA 5D6OA 5HFJA 4OYLA 1G5TA 1ZL0A 2HU2A 1L4UA 1L4FA 1UBJS 3NC0C 1K7FB 3TQQA 3AU9A 1F8XA 3DV0A 1IY8A 3OQIA 2H8GA 3A4NA 1ZJ6A 1GAEO 1KZHA 3MJSA 4F86A 1UANA 4RELA 4WY8A 1YRAA 4CR8A 4NMXB 2JA2A 1U4OA 4XVHA 1Q1EA 1SZJG 1T6XA 4UTZA 5T4BA 4Q37A 4U02A 2ZAMA 1ZNQO 5GADl 2LVQD 1G98A 1V26A 4OAOA 2I78A 3RYTC 1X0XA 4QQKA 1KFKB 2LDXA 4MHSA 4D74A 3EAGA 1DIHA 2V1XA 4II7A 4J6EA 2P2YA 3V48A 3DZCA 1C1HA 2J0UA 2VZLA 4NG5A 3TLYA 3FFAA 3HKCB 1P3Y1 5L6LB 4OSPA 2JK1A 1DMSA 2QG6A 4X71A 3W1VA 2ODEA 2I2AA 2O0MA 3OEEA 5DTJA 3TPFA 1G8FA 1KKUA 2Q27A 3DMYA 2A9QA 2QAGC 5FWDA 3DFIA 1CUIA 5ITRA 4L4ZA 1ZISA 2B99A 1AD2A 4KQMA 4DV6M 4MV6A 2IDZA 2GKSA 4MGYR 1NRWA 4EM6A 3L0YA 1PT9A 2VXBA 3C85A 2WT8A 2JD2A 2HWYA 1WXGA 3ZE6A 3CUVA 1U6IA 3IDAA 3CKLA 2LNHC 2E49A 3HDYA 4WVFA 3EIEA 2NO6A 3Q8LA 2QZZA 3ZI7A 4Y0VA 3DDNA 4JH0A 3ELUA 4QUIA 4ZOCA 1T0IA 4D6PA 1G3UA 1XKXA 1NNUC 2IBSA 3DWEX 5DNYA 3W8FA 4C7OB 4IINA 5G1OA 2I66A 3O8BA 2D2FA 3EZXA 3AR4A 4X3PA 2P41A 4FYWA 3ZQ4A 4HDRB 1C2YA 1J1IA 4MCAA 5F1YA 3TB6A 5LC1A 1QGUA 4EO4A 1WEHA 4A36A 1MH1A 1YL6A 4L50A 1OYYA 3ZLTA 5HM6A 3WB2A 4RK5A 2H63A 1LQUA 3ZJTA 2DSNA 3L25A 5EZYA 1J90A 2FPPA 5T57A 4FUQA 4D4HA 2ZYHA 3B3QA 3F2IA 2QQEA 1NAIA 4H2DA 4NYIQ 1X9IA 4KLRA 1HLGA 1K98A 1WBJB 1NXTA 4G4GA 4BY9E 3DL4A 4AZVA 2B7BA 2BC9A 4P92A 3QPUA 3B6JA 2XBLA 3HZZA 1X2EA 1J39A 1ZRNA 1B6GA 3QXHA 5G1NA 1CUXA 2A59A 2XWBF 2X6TA 3SMQA 1PL0A 4AUKA 3IRVA 5DM0A 1F8UA 1O95D 4BNYA 3ZPXA 1CW2B 2JCBA 1Q22A 2OBXA 4JOSA 5ALMA 1R74A 1PZMA 4YLGA 4UMFA 2BFCA 2HRCA 1II8B 3C4VA 4CG3A 3VO2A 3QHQA 2X4GA 4JGIA 3MZ0A 4FT2A 4PCZA 1Y9JA 4O08A 4TLEA 5DLDA 3RU7A 5ELXA 3VPFA 4AL4A 3NUZA 5GJBA 4GHLA 1QUTA 1X15A 4WOPA 1BS1A 5G41A 4KFTA 2Q3HA 3DA8A 2MINA 3JQFA 4JT4A 1VXOA 3U09A 4BKOA 5EERA 4B74A 4LA4A 1NVAA 1BN6A 3UF0A 2DTDA 4KU4A 4AQYB 2HHAA 1BDJA 3EHDA 5CNJA 5EJEA 2CK3A 1QBGA 4CN8A 1V7CA 1AIPC 2WPDD 3NAZA 5BPFA 5REQB 3OZEA 3RARA 5EY5B 5AK0A 3JSXA 5CURA 1JRLA 1E4EB 1GPH1 1K86A 4TLLB 5EEHA 4O2BA 1SVWA 5JJKA 3ZW7A 2RBEA 3QLVA 1YH3A 3TBKA 3T7TA 4GQBA 4KPUB 4Q6WA 2X8JA 4IMIB 2QTWB 3OMXA 2R2GA 3A2LA 3VXKA 3GLFB 4PVCA 1I7NA 1NBHA 1EXMA 4HWTA 4B71A 4O33A 5LZ7A 3HA7A 1CY0A 3G59A 4M9ZA 4Q3BA 4WUVA 4AFNA 1ZD4A 1A8IA 4ZVLA 4L8WB 1LQTA 3EDOA 4G2TA 1KZ9A 3U44B 1I33A 2WU1A 3H0KA 3U6PA 4OGWA 3QLTA 2XF2A 3IURA 1LBHA 3A6ZA 5GV7A 3KPUA 1UT5A 2FP3A 1R4GA 1TVKA 3PWZA 1MX3A 2IZOA 4KJXA 3QXCA 4MYHA 1T34A 1IXRC 3JQGB 2ZSEA 3R3XA 2PFKA 1SUIA 4B7UA 5C80A 2O8NA 3ORRA 2GCIA 2OXTA 4FHZA 4PYRA 1EJ0A 4D0SA 3KT6A 3D4OA 4LCBA 3VMFA 2IKQA 3U7GA 3FCUB 3JAKA 2MT9A 1GIAA 4G5SA 3HGQA 5AM2A 2UYHA 3JQ8B 3UB4A 5KQPA 2EYQA 1K6IA 3U3MA 4DUZM 2YFYA 1SURA 3GLIE 4A4DA 3O26A 1R0RE 1TW3A 3LVVA 1AXRA 3GVPA 4TOIA 3MLAA 4LV8B 3FDZA 3MAGA 4GP7A 2BEUB 4ADSG 2BD0A 3TE7A 3ZWBA 2ZE7A 4BDTA 1N3IA 1EGVB 3VZCA 1QIGA 2DFPA 2CFOA 2BMEA 3QE3A 2P8JA 2PM8A 4XIYA 4MQUA 2DZNB 1T1IA 2J7KA 3TLAA 4H08A 4YV7A 1Z6GA 3KJIA 5A7HA 2O5CA 2BFEA 5KX5A 3SNHA 3QYBA 4DNXA 2ZQYA 1EP9A 2VDRB 1ANKA 1VEJA 1K9SA 4KNYA 2H9IA 2VP2A 1KZ6A 4KGZA 4ARAA 4Y6PA 3UK6A 4GLFA 1TRKA 3L4KA 3EZ9A 3OKPA 1OBHA 1KH2A 4IDPA 1DIBA 3AX6A 1C80A 3D3NA 1GCUA 1JXOA 2WAOA 2XCOA 2FK8A 1YA4A 1PG0A 1GZ6A 5CNMA 5HF8A 2XUHA 1DI0A 2LBCA 3GUUA 2J67A 1CHNA 5FCDA 5I7SA 2GPTA 1WPQA 1KZ7B 5FI0B 1ESCA 3BJRA 2I3BA 1Z6ZA 4MPRA 3TLEA 2QVGA 3AB8A 1ZU5A 2ZXUA 1IUKA 1SUSA 3DNFA 2EFJA 1GLNA 3ER8A 2CYBA 2IXBA 1S2OA 2QMOA 1E89A 4D8YA 1N1EA 1M72A 1OFIA 1EX7A 1MF7A 2Y20A 3P0HA 4A8JC 1DGHB 1LF0A 1W47A 3WB9A 2J9YB 2R5WA 2ZATA 4HVAA 1UT6A 3FM9A 1IBMB 1X87A 2FSGA 5C3MA 1GA6A 1CJBA 4CU2A 1DC8A 2WM9B 3VUFA 5FUVA 2BJHA 3DULA 2AC7A 3U3ZA 2WKRA 3D6AA 5KYNA 4REQA 5ALWA 3ESYA 1F4VA 5AMXA 3JVUA 1W85A 2OBLA 4UEKA 1S4MA 1X77A 1RKUA 4M3NA 1HI9A 4KW7A 1T3TA 3QLUA 4GO1A 3BVPA 4HB3A 2HXSA 4UCXA 3C5HA 1A4IA 4KPEC 3DYVA 2BH2A 1HWYA 2VTDA 3E5MA 4GKAA 1N2OA 2XGMA 3P32A 1D0KA 4B44A 1QFYA 421PA 2W6JA 2D2EA 3HPQA 3SQLA 4A23A 4K03A 2ZR8A 1U98A 2P91A 4H3KB 3VU8A 2FVYA 3KVVA 4YGYA 3ZXUB 1KF0A 5EEGA 2VG8A 2WIGA 5ITQA