3FTCA

Crystal structure of a. aeolicus ksga at 1.72-angstrom resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
234
Chain Sequence
LLVSEGVLKKIAEELIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 70
structure length 234
sequence length 235
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftcA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftcA01
3FUWA 2AOXA 1IXKA 3U81A 3VC2A 4PYMA 5GWXA 1D2CA 1NW6A 1XTPA 2AOWA 1O9HA 2YUIA 3HP7A 4ZTBA 2ZVJA 4E30A 3PX2A 1YF3A 1AF7A 2WA2A 3DULA 3NDJA 3PB3A 3FPHA 5GOZA 3FUTA 5HZMA 1WY7A 3BUSA 4MHTA 5EZQA 4G56A 2IDJA 1XDZA 3SSNA 4EKIA 5CIYA 2G1PA 4HTFB 3KQTA 1ORHA 2JHAA 3LGAA 4MIKA 5IH3A 4YUVA 2G70A 4KIGA 3UJ6A 4CTKA 4RTKA 2UYCA 2E5WA 1DUSA 1KP9A 3EVEA 4XUEA 2PWYA 3FUVA 1YZ3A 1JR4A 3PTAA 1F38A 2CL5A 3F4KA 1QAQA 2PT6A 3G5TA 3KQOA 5HFJA 2IFTA 4M38A 5B1SA 7MHTA 4C4AA 5CCBA 1WG8A 5EOVA 1WXWA 2XYQA 2EX4A 3GU3A 2HR1A 4RVFA 5FA8A 5K01A 3HVIA 1I9GA 1JG2A 5F2OA 3MCTA 2O05A 4GBED 4QDJA 2ZULA 3UA4A 4DMGA 1HMYA 10MHA 4RVDA 5FCDA 2EJTA 4C05A 2ZSUA 2H11A 2ZW9A 4PWYA 3M33A 3TR6A 3THRA 5EMKA 3SGLA 4IV8A 3FPGA 4PGHA 1KPIA 1R8YA 3SSOA 3GRVA 5K05A 3T7SA 2I62A 3TRKA 1TW2A 1XJ5A 2Q41A 4E33A 2XYVA 1KIAA 5JUWA 3GRZA 2JJQA 3HCDA 5BW4A 1RI1A 3I9FA 1JQ3A 2FYTA 3AY0A 3E7PA 3K0BA 2I6GA 4PGGA 5F2NA 4E32A 3KKZA 5FTWA 3B7PA 4DCGA 2O06A 2PBFA 3ELWA 3PS9A 1RI2A 3UA3A 3OU6A 4RTLA 4PYOA 1FJXA 4CKCA 3P71T 3FTDA 2QY6A 4KW7A 1DCTA 1Y8CA 3R6TA 3UJDA 2EG5A 3Q7EA 3TFWA 4RWZA 2NXCA 3CGGA 4RYLA 3KPJA 2Z6QA 1EAMA 2GH1A 2IBSA 3AXTA 3ER8A 4DCMA 4PYNA 3VC1A 5CVUA 3DLIA 4B17A 3LCVB 3FTEA 4Y2HA 3RW9A 2YXDA 2V74B 2I7CA 5G02A 2QM3A 3I53A 3OU2A 2OKCA 5BW5A 2PX8A 5BP7A 4QQKA 1FPQA 4RTJA 5E2BA 2WA1A 4K6MA 2GA9A 2CKDA 1UIRA 4OX9Y 5HIIA 4F86A 1VBFA 4YMGA 1NW3A 5FHRA 1H1DA 2IH2A 2ZZNA 2P1DA 3CBGA 3ORHA 4RX1A 1KHHA 2B78A 2GS9A 3IEIA 3UJAA 3KU1A 4BLVA 3T7RA 1IM8A 3TLJA 3TPZA 3EVBA 5DM1A 4P58A 4GC5A 2PSSA 3FUXA 3JWIA 3NVMB 3ERCA 2OB1A 2DULA 4RTQA 2P7HA 3O4FA 2PX5A 3HCBA 3IV6A 2ZBPA 3ELUA 2GAFA 1KPGA 3C0KA 3LDFA 3R3HA 3R24A 5C0OE 2OO3A 4E2YA 4M36A 5P8WA 3A4TA 5HIKA 3GWZA 1IY9A 4CKBA 5DSTA 3MQ2A 5H02A 2PX4A 3PFHA 5HIJA 3UJCA 3P9CA 5K09A 1YFJA 3TKYA 3DMHA 3BZBA 3HM2A 1RI5A 1JG4A 2XYRA 2G71A 2PY6A 1NW7A 9MHTA 3BWCA 1QAMA 3OE5A 4WXHA 3BGIA 3SVZA 4ER5A 3HVHA 4C03A 5CVEA 2ERCA 2IIPA 2OY0A 2Y1WA 3AJDA 3GNLA 5EHGA 4C07A 4BLUA 3P9KA 1G55A 3FUUA 4QTTB 3GRUA 3EVZA 2OB2A 2LD4A 3UJ9A 3EMBA 3DUWA 1VL5A 3EVAA 2PX2A 4KRGA 2OZVA 3A25A 4GOMD 1WXXA 3P2EA 3PT9A 4PYQA 1X1CA 2BR3A 2R6ZA 4V0RA 5DLYA 1M6EX 3DTNA 1RJGA 3I58A 2NYUA 5ERGB 5FA5A 1NBIA 1SQFA 5DWQA 3E23A 5DM4A 3RIEA 3UFBA 5KQSA 4OA5A 1M0EA 2C7PA 4GEKA 3KQMA 5K0EA 1KYZA 2V7EA 3SXJA 4EKGA 5FQOA 4X63A 4CWAA 4HSGA 2P7IA 3NW9A 4AUKA 2BR5A 3HA3A 5DM0A 5GP1A 2BH2A 2B2CA 3BWMA 3PFGA 3G2PA 3FYDA 1VQ1A 3G2QA 5EHIA 4QQNA 2UYQA 4F84A 1QANA 4FZVA 3A7DA 4RTNA 2NXEA 4ER6A 4OQDA 1RJFA 1N2XA 5DX0A 5FULA 3THSA 2BM9A 4FS8A 1L3CA 1L9KA 4BP3A 5K0CA 2PKWA 2P35A 3BKXA 1MHTA 3IYLW 3KQWA 4LECA 4UOEA 2ONZA 3VSEA 2I9KA 2IH5A 3R9XB 2FHPA 2XVMA 4X1OA 5LQRA 4CKEA 4PYIA 4PIPA 5DRTA 2YVLA 2P3QA 3P2IA 1BOOA 2VS1A 1VE3A 2ZFUA 3KPUA 3LDUA 1JTFA 5FQNA 2YXLA 2P3LA 5E2AA 4EVIA 3BKWA 3B3GA 2FK8A 3H2BA 4P7FA 3HVKA 3QOWA 2C7OA 2IP2A 3MTEA 1G38A 2EJUA 2HMYB 3B89A 1XXLA 5EC8A 4QVGA 3OCJA 2ZCJA 3UZUA 1VPTA 1R18A 2F8LA 3FPFA 3LBYA 3M6WA 3MGGA 2PVCA 1G8AA 3MB5A 3G2MA 4IWNA 5DPMA 5EIFA 3SM3A 3FYCA 3OZRA 3EMDA 5EZSA 2KW5A 3LCCA 2XVAA 1I4WA 1QYRA 2QE6A 4HC4A 3TM4A 5CCXA 1EJ0A 1I1NA 2PXXA 3HTXA 8MHTA 4DQ0A 5DXAA 3DLCA 5EGSA 1T43A 3UJ8A 5ICGA 2BM8A 2AOUB 4ER0A 5M5BA 1NT2A 1ZHFA 3FRHA 4PNEA 2ZLBA 3JWGA 2AOTB 2IH4A 3DXXA 2ZTHA 2ZWAA 3KQVA 3CJTA 3BGVA 3G8AA 4GOLD 3TQSA 3V97A 5LQCA 3MHTA 5K0NA 3HCFA 4E2ZA 4RTPA 3NJRA 3KPYA 3SSMA 4A6DA 1ZGAA 4AX8A 2Z6AA 3DOUA 4GOND 4PONA 1ZQ9A 3G89A 4ER3A 2C7RA 1VLMA 2OPBA 4MWZA 4FGZA 3ER9A 4E2XA 4DA4A 4BP1A 1YB2A 2PWPA 1WZNA 1R00A 4XCXA 3KR2A 4P7JA 3CJRA 3FTFA 1G8SA 5D1NA 5LR6A 2B9EA 3JWHA 5K0FA 1RI3A 4YUZA 3LCUA 3A27A 4OA8A 4PCAA 3UJ7A 3M70A 2NP6A 4DF3A 3OPNA 1NV9A 3OFJA 3G7UA 1M6YA 2YR0A 4FSXA 4M7RA 5DM2A 4CTJA 1KR5A 2UYOA 3Q87B 2Z6UA 4HGZA 2YQZA 4HTFA 4Y30A 4Z2YA 2H1RA 3RODA 1SUIA 4FT2A 3BXOA 3DXZA 2N47A 4XUDA 5KQRA 3LHDA 1ZGJA 5EEHA 3C3PA 5LQAA 3SMQA 4EQZA 3KQYA 3P9NA 4OQEA 2B3TA 2AR0A 3A26A 1PRYA 2AN3A 3GDHA 5GINE 5E1OA 3T0IA 2ZZMA 2P8JA 3CKKA 3E8SA 2PGXA 1SKMA 5ICCA 2NXNA 1JG3A 1EQAA 4WVLA 4FT4A 5IKMA 3OU7A 4DM3A 1FP1D 1VP3A 1X1DA 3GCZA 3LX6A 3IHTA 4HGYA 3HCAA 3EVFA 5FWAA 4KDRA 3S68A 4A6EA 5MHTA 3SR4A 4PYLA 4JXJA 2CMHA 3LPMA 3DXYA 5K0LA 2WK1A 3GO4A 4KIFA 1O54A 3GGDA 2NP7A 2B25A 1XCJA 2YXEA 3FPEA 1G6Q1 2BR4A 4MQ4A 1NW5A 1JSXA 4QTUB 1D2HA 3G8BA 5EKUA 1SVUA 5CVJA 2YX1A 2PXAA 2HTEA 4GQBA 1NV8A 2ESRA 1NE2A 2GB4A 3ELDA 1BKYA 3LBFA 3PVCA 1RJDA 1RJEA 1SQGA 3MCZA 3G2OA 5EMMA 2JH8A 3GRYA 3X0DA 4FP9A 2OXTA 4F85A 5CD1A 4RTOA 1XVAA 2PXCA 3JWJA 3HCEA 1G60A 2ZWVA 3KPWA 3CC8A 2PLWA 2ZIGA 5EKXA 4AZWA 3FPJA 5ICEA 2ZBRA 5E1MA 5GIPE 2FK7A 4YV0A 3G88A 3DR5A 3REOA 4QVKA 5LQNA 4KDCA 4KVZA 5JR3A 3CCFA 4PIMA 2ZBQA 4X61A 4RVHA 3NWEA 2UZ4A 3HVJA 3GXOA 2GLUA 3AXSA 3LL7A 4R6XA 1D2GA 3R0QA 1JSZA 3GRRA 2ZIEA 2JHPA 5DRYA 4C06A 3EEOA 2ZZKA 3ANXA 1X1AA 4RSRA 4AZSA 3C6KA 3UJBA 5E9JA 4QPNA 3CJQA 4X60A 5C1IA 2BZGA 1FBNA 2HV9A 5U4XA 4AZTA 3NMUF 1X1BA 2R3SA 3B3FA 4V0QA 1EG2A 3M6VA 2NNWB 3TMAA 2P41A 5EMJA 5K8VA 2CWWA 5CVVA 5LSAA 1ZKDA 2OYRA 4YUWA 2AOTA 5KVAA 3NVKI 2IPXA 1TW3A 5C9ZA 1MJFA 3MAGA 5T6BA 3D2LA 3MERA 4GC9A 1QZZA 3FRIA 5K0JA 3HA5A 1AQJA 4DZRA 3KR1A 2VDUE 3DMGA 2XBMA 5DTMA 3ELYA 2QRVB 5E1DA 4YUXA 3EGIA 3PX3A 3TM5A 2ONYA 3UBTA 3KPVA 1L1EA 1JTEA 4GF5A 2VP3A 5E8JA 2JHCA 3KQPA 3NWBA 4PCLA 3E05A 4R8SA 1WS6A 4L7VA 4U7PB 5E9WA 3C6MA 3ID6C 3HNRA 4RV9A 4GOOD 4KWCA 3BWYA 4XUCA 3DMFA 4YV2A 1N7JA 2ORED 5CVDA 1UWVA 3M6XA 5EIWA 3TOSA 1P1CA 3M6UA 4LWOA 4P7KA 4BY9E 3P97A 3QV2A 4IV0A 3M4XA 2HWKA 5F2KA 3EPPA 5EEGA 1NW8A 4C04A 3O7WA 1R6AA 1Z3CA 2FPOA 1L3BA 4E2WA 4MTLA 5E9QA 2H00A 5T64A 1AQIA 2AN5A 2IDKA 3B5IA 2FRXA 3QOXA 4ATNA 3HCCA 5DX1A 1KPHA 4E31A 5GM1A 5E8RA 4YV1A 2AVDA 1Q0TA 4EK9A 3AWIA 3OFKA 1KXZA 1JQDA 3CVOA 1YUBA 2G8NA 3SX0A 3V8VA 4POOA 2Y1XA 2GPYA 5KS2A 4FR0A 5HILA 2AN4A 3HEMA 3BT7A 4LWPA 5DT2A 2HNKA 2K4MA 4HRAA 4YUYA 5LQKA 4O29A 4YMHA 3OZSA 5ICFA 5DTRA 2QRVA 3NTVA 1EJ6A 2AZTA 4M37A 3P8ZA 5EPEA 1FP2A 1V39A 3EVGA 2EFJA 3GIWA 4NECA 4RVGA 1ZG3A 4X41A 2O57A 1VP9A 2PJDA 4LG1A 3KR9A 1P39A 2VZ9A 4QDKA 5KYGA 5LQUA 5GM2A 3BWBA 1P91A 2YTZA 4RTMA 1INLA 3EVCA 2PT9A 3LDGA 4DKJA 3EEYA 4R8RA 5T67A 2QYOA 3T7TA 3LECA 3LKZA 5CM2Z 1XDSA 4HG2A 1ORIA 2P40A 3KQSA 1SUSA 1BC5A 3EGVA 5FWDA 2A14A 2UYHA 4OBXA 1UFKA 2CMGA 2P3OA 3DP7A 3OE4A 4OBWA 2PV0A 5DSXA 4H0NA 5HIMA 3VYWA 4HH4A 3EVDA 5GIOE 3KQQA 3KR0A 4U7TB 4IKPA 3UWPA 2G72A 4R05A 2O0LA 1DL5A 3TKAA 5CUQA 5FADA 1XCLA 3BGDA 3GJYA 2NXJA 3MTIA 5EVJA 4AZVA 1QAOA 3OZTA 2AS0A 1VIDA 1AV6A 3K6RA 1OR8A 1U2ZA 1NKVA 1SG9A 2AOVA 1RI4A 3EGEA 5BXYA 3PLAE 4PINA 5D1HA 4EMSA 2OBFA 3KHKA 1R74A 1X19A 2DPMA 1KYWA 2IGTA 5K0BA 4C08A 3FTCA 1NBHA 4CXMA 4PYKA 4RTSA 5FHQA 1YFLA 5HOQA 3P9IA 1F3LA 4ISCA 1EIZA 3FZGA 5DX8A 3DH0A 1R8XA 3WSTA 1XDUA 5K0GA 2ZIFA 4QPPA 3C3YA 1L3IA 1N7IA 5EG5A 2ADMA 2C7QA 1B42A 2IBTA 3O31A 3P2KA 1JQEA 3I5UA 2JG3A 3ME5A 5EMLA 2AOUA 2VDVE 5DTQA 5E1BA 3L8DA 4P7GA 2FCAA 3NDIA 5K03A 3A7EA 4BLWA 1YZHA 3LKDA 3G5LA 2AVNA 4PYJA 4E70A 1Q0SA 1TPYA 1HNNA 1O9GA 4R6WA 2O07A 5LQJA 5DXJA 5FUBA 2JH9A 5EQJB 1P1BA 4RTRA 3B3JA 3I64A 1BHJA 5HEKA 3LSTA 4FSDA 2VDWA 4ER7A 1PJZA 3HA7A 1JG1A 4GUAA
chains in the Genus database with same CATH superfamily
2AOXA 2V55B 1AM4D 1FFGA 3N87A 3PXBA 3U81A 3H13A 2B4TO 3D5QA 4PYMA 5GWXA 1NOIA 4CU2A 2IP1A 3KTOA 4O4HA 3T1YM 3GZ4A 1RYHA 4QXOA 5JXWA 3GRFA 3E3OA 2PR7A 1QK5A 5HQTA 3FI0A 2AN9A 2Y1KA 2C2KA 3KXIA 1GPNA 5CIYA 4WLEA 1GCAA 2FNAA 4FWGA 1PLLA 3LSYA 4IDPA 1N33B 2YWCA 3G8DA 3LA6A 3P9PA 3CUYA 3CW8X 4HNVA 1T10A 5JXIA 3LT1A 3QVGA 5TR9A 5EPUA 3UB3A 2OGSA 4F8YA 1ZN2A 5LZ5A 4IGAA 2F5OA 3CZRA 3P9QA 4C4AA 4DDWA 1U3TA 1OJLA 4ZAWA 4P2BA 3L27A 4NMLA 4A2QA 4FHCA 4DR2B 2BMVA 2XYQA 1Y8AA 5G40A 1YK1A 3VXKA 2QI9C 1ZW1A 4RGYA 1IHUA 2Y76A 4QDJA 1R3UA 2HSEA 1P3JA 1H0HA 2YWDA 3MBIA 3SZRA 1IOZA 1V5WA 2W8BB 4JBGA 2G0AA 4MUJA 2GBIA 4I9UA 1K86A 2HJHA 3ETLA 5T57A 5ITXE 3RC7A 2IOQA 2PIDA 1ZK3A 3SSOA 4D02A 2XWQA 7ABPA 5E95A 2CE2X 5KINB 1ECFA 1EHCA 4QATA 1XI2A 8LDHA 1GT91 3F74A 1VC2A 3N76A 4IIJB 4UTXA 4Q5IA 1RLJA 4TL6A 4PCZA 2H59A 3GJSA 3L1VA 3DEHA 3CIFA 3FF4A 2RIPA 3AV0B 2HWXA 3IOCA 4KQXA 3IIEA 4AQYB 1ZL2A 1QRUA 2FFHA 4M9RA 4DR7B 3B7PA 5JCJD 4F56A 1RMYA 4GPIB 3MPOA 3SYTA 3KYBA 4RTLA 4GBMA 3G2LA 3FZNA 1LTKA 4TOIA 5JMWA 1P33A 4PSAA 1IAVA 1WPXA 4GOXA 4PZ0A 4C0LA 2AXPA 1DIBA 2JCGA 4RYLA 4XH9B 4M98A 3ZXYA 5IJZA 3EWAA 4MW9A 4UVIA 3EASA 1Z0KA 2LXNA 4MWDA 1TD9A 2NU9B 5IT4A 2BELA 1LJLA 3LCVB 4ES6A 3FOEC 4IIDA 2V74B 3W67A 2RGXA 4PQFA 2AJ8A 2AFHA 2Z5GA 3TOVA 2H8GA 2I91A 5JAZA 4BWFB 1UIRA 3W7VA 5MN5A 1CB7A 4I50B 4W82A 1DKUA 1NW3A 1XZAA 2DG2A 3B52X 3TCKA 2DFLA 1PRBA 3CYFA 3DD5A 3THXA 1MDFA 2HREA 3SLKA 4BNHA 3H9GA 2B78A 3K2QA 2WG1A 4BLVA 4WE3A 1UKCA 4O33A 1YFZA 1IY0A 3LYLA 2VRCA 1AY0A 3LAWA 2MSDB 4ZODA 3TPZA 1H6BA 2DKFA 4B81A 4P58A 2BMFA 2W4QA 3NVMB 3WL8A 4EVQA 5JXJA 4J90A 4M21A 2WD8A 5E6UA 2LVAA 3NOOA 4YRGA 1QUEA 4K8OA 5IT9S 3ICPA 4D8TA 3PGJA 2XR1A 5B3JC 1RWKA 3LDFA 3VHLB 2WSMA 1TJNA 1SU7A 4U9HS 4JP1A 4OXIA 5A7GA 4CEHB 2VSNA 5K09A 1EWRA 1P75A 3UK6A 4GKJB 3U80A 1M8JA 4ZQBA 3Q8XA 3LZDA 5H7XA 5M34A 1ML4A 2RJ3A 3VHXB 3EISA 3C6YA 5JSQA 5JV5A 2NV2B 4EPVA 3KFUG 1OXMA 3DEIA 3HDGA 1P19A 1OWPA 2CCGA 1KJZA 1U81A 2IYSA 1U0OC 4MHOA 3D8BA 1LDYA 3ZY3A 1Y6FA 1A82A 5DT9A 5FX2A 3AV3A 1IB0A 2FSSA 1V9CA 1V6SA 2QR5A 4KWTA 1TEZA 3EMBA 1Y5LA 2B1RA 4ZANA 2WUVA 4A8TA 2I1WA 4FW8A 4BP9A 2QL6A 1U8AA 4JYBA 3GFTA 5E4FA 1ZGGA 4W5QA 2QUBA 1ONSA 4Y6OA 5DWQA 5KCMA 4MCJA 4UOZA 3BH0A 1K7YA 3QENA 4IS2A 4OHVA 3SHTA 4FKZA 3HHYA 3JQ7B 3LKBA 1L2TA 4QRDA 3BRSA 4QYMA 4KR7A 4XGIA 1P1IA 3B6EA 4EHNA 4BC1A 4RW0A 2EW1A 1EFKA 1XZHA 1C8VB 2G1AA 2ROQA 1U5CA 4PZPA 2GO1A 1VQ1A 3AL0C 1YCGA 2X0IA 3NHAA 1XEWX 4IGIA 2WMYA 4G5FA 2D06A 1JVNA 1RXVA 4KXYA 2D6FA 1U94A 2BRUA 1MHTA 1K97A 1FXWF 4OSPA 1QSGA 3EG9A 4QUBA 3RK1A 3KQWA 4LECA 3UW3A 3W9UA 5GGXA 3R9XB 2IXTA 5JHGB 2FWBA 2RH5A 5B7GA 5F4BA 1CIJA 3OVMA 5JAMA 1RM0A 1XOIA 4I4TB 5E3HA 1BMFD 4L95C 4M53A 3A6PC 4V0SA 1JEEA 1OBOA 1GG2A 1H3NA 4ILKA 3WDMA 4ZOEA 3EODA 4CI9A 4DCUA 3GR6A 4DA0A 1CQJA 4BFXA 2P3LA 2PCLA 3AEQA 3UCEA 3OP1A 5E2AA 1I5OA 1LJUA 1U9YA 1QRAA 5BXQC 1BXGA 4L08A 1UJBA 2QW8A 2XMSA 3VJLA 1TTHA 4G4SO 1V2HE 5DHTA 1O94C 3IDFA 4PRKA 2G08A 2OCAA 3IAHA 4O4HF 3FPFA 4PQEA 3L4BC 3NHLA 4N8SA 2QZSA 4R3WA 5AVRA 2PVCA 4QSMA 1IWBB 1NHWA 2AG6A 3FMIA 4HHEA 4KXFB 1ZIDA 4URHA 5I3CA 3BDIA 4PLYA 4OF4A 2I2BA 1KNXA 1JA9A 2A3NA 2WIKA 3BE4A 5CCXA 2HLDA 3KSAC 3HYLA 1WVMA 3OQMA 3HH8A 4DV6B 2OAP1 2Q7XA 3M82A 1TUBA 3X1KA 4LSGA 5L3QA 2MT9A 3AY7A 3P5BA 4OKSA 2AFHE 2H92A 3I0ZA 5KQGA 2J0QA 4GICA 3TW6A 5C3MA 2A86A 3LBNA 4KMOA 4CMJA 4EYQA 4YJKA 1OA0A 1VA5A 4DIEA 4TQ9A 3SHWA 4G5OA 2Y0QA 1Z5OA 2HAEA 3AONB 3ZUPA 1YI0A 3JR7A 2FMTA 1JDVA 4G4RA 4NARA 1DBWA 3M81A 4DNXA 1I01A 2JY5A 1PF7E 3SU8A 4FE7A 3MWFA 2X7XA 4LRSB 4A6DA 4MGEA 1Z8DA 2ZI5A 4G8DA 1MXHA 4NL4H 4N01A 3A9WA 2GI4A 3MOGA 2AC2A 1ZVJA 3QJYA 4ZOCA 4ZZ2A 5TDHA 1A5BB 3B85A 3GT4A 1D2NA 3HYSA 5AI5A 5GVSA 5HNKA 3GNSA 4LW8A 3CZAA 1OJ7A 2XDWA 1BWPA 4KPUB 1K3XA 3ILXA 4FYYA 1G8SA 4DMKA 2BH9A 4XSGA 5E7IA 2YJTD 1BU5A 4TMVA 3H5WA 3W5AA 1G0NA 3M70A 5FYQA 2HKJA 4K2AA 4TV8A 3VVCA 1CFJA 3RADC 4FWTA 1IXZA 4HB3A 3HR4A 4P93A 3NP9A 3ZWKA 4EI9A 1EQ2A 4P1ZA 1W25A 2FY8A 4F2WA 2WTBA 1J7JA 3HHPA 2H1RA 1U7PA 2FLWA 3TD2A 4A0HA 1A2OA 4CKBB 3AX6A 3BXOA 1WXDA 2N47A 5HF5A 1FMFA 3OTGA 1SG6A 3BA6A 4KGZA 3SFTA 4UTRA 5ADWA 3QV1A 2P68A 3AEUA 3RG2A 1BXRA 1UBMS 3VHQA 4ZAZA 2EX0A 2ZYIA 3MJVA 4NVRA 4NZPA 2HU7A 3X1DA 1K6IA 2HDWA 1FK8A 1ZRNA 1M10A 1VM6A 3JD0A 3MRXA 2ZM6M 4YJHA 2ID8A 4OAOA 5ICCA 1WEHA 1W4RA 1DV2A 1O5TA 2FH5B 2RBKA 1G1AA 3R7FA 3JQ8B 1G42A 3IJ5A 2R68A 3ZNPA 3VH3A 2RHJA 2JB9A 1QZMA 3S68A 3CQ9A 5FWYA 2EP5A 2GM3A 2H4JA 2WK1A 4KIFA 4IJEA 1BXZA 2OWEA 5ER9A 5TGDA 4LDRA 1QMPA 1KH2A 4TQAA 3QEJA 2C2HA 3RIXA 3TAUA 3VI4B 3GP5A 1POXA 4XWOA 5HMLA 4GNRA 3UH0A 4K0KM 5EE1A 1B15A 1QZXA 2EF1A 2V7QA 3W0FA 1VHTA 3B1VA 3QNWA 4IYJA 4P36A 3LBFA 4QOGA 2Y6UA 3E53A 4MUBA 3HZHA 4GLOA 5K2OA 1W2GA 3X0DA 3RKUA 5JWRA 4LOIA 1LS6A 1PK9A 4GDMA 1JKJA 4TS3A 4YAJA 3GPLA 1D03A 2VYQA 2FGKA 2FXVA 5EKXA 2R1ZA 4OYYA 4KDFA 2B8NA 5A7FA 1E79D 1LLCA 2OBXA 4JP5A 5IZ7D 4ZT4A 4H60A 4YV0A 1N9GA 2RDMA 3G88A 1URPA 1B74A 3DR5A 4L9SA 1PQ4A 1AGXA 2R6DA 4LQCA 3QF4B 2Q7OE 2C1XA 4XWKA 1K8XB 2VF4X 3RHSA 3HVJA 1XMPA 1HYQA 2GLUA 2JW5A 3FGOA 1UBRS 1JR2A 2XY4A 3R9KA 1ZUNB 4D8XA 4IKOA 2P2SA 1GGVA 2FZWA 2FHSA 3KEFA 4OAPA 4HWPA 2HK9A 1EA7A 1QG6A 3OHSX 4K6CA 4Z9XA 5G41A 2FQYA 3ZDYB 3VSAA 3OQ1A 5KI6A 2PO7A 3I34X 2M1XA 4RZ3A 2ZOSA 2KZUA 3KE8A 1N5RA 2NU8B 3OUZA 2OV1A 3GUCA 3IDAA 1FBNA 4NWIA 3R0IA 5DGIA 5K3FA 4ENWA 3L7OA 4S3MA 2C9DA 1SKYE 5B3JA 4URWR 4YJ3F 4AY2A 2EJSA 4P4SB 3AFHA 5K6TA 4XVHA 3BJIC 4R9NA 4HDRB 3BTOA 2Q27A 1MABB 2B6HA 2IPXA 5K4AA 1YR2A 2FFQA 3KTFA 1OX6A 4DJ5X 3U3OA 1FXUA 1P45A 1QZZA 3EXIA 2WJ6A 2O3QA 3OETA 4WUTA 3AVXA 2RAPA 4E5DA 5KC8A 4KN9S 1A4XA 3IQXA 1UEXC 5AOAA 4AJJA 4EG0A 1VSVA 2QN7A 3CBQA 1L5VA 1EVKA 3SDBA 5JD6A 3E0XA 1VEGA 1YRAA 2OCPA 1UMBA 5JCOA 1I80A 1ST2A 2CJPA 2HK8A 1NQXA 2IF0A 1K7SN 1KY4A 1DO8A 2II6A 3KSUA 4Y6SA 3RRXA 2WAOA 3ZCXA 3OJWA 2ZBGA 1CJSA 4L7VA 5DFAA 4M1EA 5KQMA 1RKBA 4ZI5A 1JIXA 4KWCA 2GEDA 4Z4EA 2HU2A 1A50B 1CUGA 4CQMD 6GPBA 2VH5R 3FDIA 3TJZA 3KIPA 4JBYA 1V8PA 1A71A 2ZXUA 1FXWA 3LUAA 3KP1A 4L22A 2P65A 1T3ZA 3MM4A 1LS1A 1B26A 4RKUF 4W63A 3MS2A 3L8YA 1NJGA 4HWOA 1Q7TA 4EIWA 2XTMA 3QVXA 4Q9JA 4MPPA 4AQYM 4LA4A 1KPHA 4MPTA 4OLJA 3ZDEA 1CTQA 1T2NA 3L1JA 4P82A 3LH5A 3OFKA 3FPLA 4LF4M 1QHEA 4F2LA 5BW6B 4UAJA 5KTRA 1E8DA 1M1NB 3EMVA 3DMTA 5FTNA 3OIYA 1SCJA 4KI0A 4PRZA 3P9ZA 5LP6F 5CDGA 1JLKA 1Q84A 2MDTA 1AKRA 3F6BX 4BLOA 4I2VA 3W6OA 3OTQA 3V76A 4B3TM 1ZONA 2Q5OA 3ZHXA 4BNVA 4EQ6B 4JJZA 3IOYA 1X7YA 4KN5A 3B1ZA 3CRQA 4O4LA 4PHTA 5IC6A 1KBOA 2JJ8A 4D4LA 1A97A 3DVSX 2Q8NA 3FLEA 3LVQE 2AJCA 1INLA 1MHPA 4UHDA 3TLCA 2DECA 3C3JA 3N58A 2O8BB 3CW2A 5T67A 4B73A 4DADA 3CLHA 1NQVA 2RC5A 4PZCA 3ZIUA 1SEPA 4LRTA 3TL4X 1SCBA 4HG2A 2CL7X 4HGQA 3W9BA 4C88A 3JZAA 1ONBA 3KQSA 4LTNA 4C4TA 2DC1A 1YKGA 1J5PA 2WU4A 3FPKA 1BCRA 1HSOA 2OCIA 1VG1A 3IUPA 3IULA 4G5QA 3IP7A 4XQCA 1SVKA 1PVDA 2PJUA 1IEXA 1QK3A 1NSFA 3KYCB 1OAAA 3GHHA 1LRKA 3G2JA 2EKZA 1TMOA 1M8FA 4MR9A 4CDGA 2R6CA 3D0QA 4KQCA 5HZHA 3T6KA 5ADHA 4CHGA 3F6SA 1QMGA 3HCPA 3PJEA 2ZVDA 3B48A 1X7GA 4HVAA 4LHEA 3X43A 2FPGB 3ETDA 1M34A 3G2NA 5CT8A 1GZ7A 1J8VA 2LCFA 4BNNA 4P0TA 2JC3A 3QWFA 4KMSA 2XAAA 3GP3A 1NBHA 4HNHA 5HG0A 3D7MA 3ZWCA 3F7MA 2N42A 5ES3A 1DKMA 3I4CA 4FYHA 5AJZA 3FZGA 2DJ5A 1A9OA 1YCHA 3K94A 3GJ6A 3WMFA 5KO2A 4B44A 4BV2A 3KUXA 1L3IA 1TGYA 1TK2A 2P75A 2I3GA 2R60A 3A4VA 3AFMA 3QFCA 4NC9A 1E3TA 1GLNA 3SXUA 3W2FA 3FDXA 1Y8ZA 5EXSA 1FFAA 3IALA 4I4LA 4GLJA 3QBEA 2L7HA 5GTDA 1AK9A 1M7HA 3Q0EA 2LCQA 5C8YA 2GD0A 4LAFA 4WLFA 2JJ1D 3DD1A 1R6UA 3I30X 4M0PA 1HNNA 1EK0A 4R6WA 3TSCA 3EIEA 1DZ3A 5TQ2B 5B7PA 3I64A 4MWBA 1M5TA 1ORVA 3LUDA 2QQ8A 2GO7A 3JQGB 3MUNA 4CKWB 4PR3A 1RYZA 3LDAA 5TRTA 2UU9B 1IBLB 2ES4A 4U02A 4Y2PA 3HA7A 1V7CA 3OPMA 4WY5A 3EA0A 3H86A 2PU5A 3LUGA 1IBKB 5BQPA 1G0OA 5GPBA 2QQ0A 4YAKA 5B2ZA 3UAGA 4ZV4A 5TQ0A 3V4VB 1I7DA 1J2JA 1NM5C 2D3TA 1AKMA 2YZNA 3DEFA 3H19A 1JLRA 1RTTA 4WK0B 3V8QA 2OP0A 5AVVA 1WY7A 4LXIA 4U2DA 4IDNA 2QMUA 4BRZA 3WGLA 5KDLA 2PUBA 4BX2A 1IPFA 3CXUA 3LQ2A 1N4DA 3CB2A 5IXJA 3Q8MA 1S8NA 1E1DA 1MNQA 4RXTA 4W9NC 5HE8A 4RTKA 3NEJA 4PTZA 2IU4A 4IUBS 2HMVA 4QQ8A 2V7GA 5DASA 3SZUA 4Z51A 2CRUA 1OAOC 1W0JD 4BMOB 1N92A 3U3JA 5JARA 3NTUA 3FCAA 4NBRA 3JQAA 1YB6A 1SVSA 4GIPA 1CCWA 3BCUA 5B1SA 3QVLA 2PGDA 1A8UA 2HRCA 4YRFA 1V4BA 4B4KA 4DOMA 4CLEA 1RRPA 3QU9A 2XCUA 5U9CA 3FIUA 5JANA 1E5TA 1G18A 1JDBC 1E96A 1O6FA 1PJ3A 1CJMA 1QTNA 1QGAA 2BSAA 2MYTA 4L2IB 1NYTA 2R6R1 5AXAA 2HCRA 1LQTA 2XXJA 3A9VA 3AW9A 5G4KA 5JMOA 4JOCA 2AQHA 1E0KA 5KYKA 1N5IA 1W73A 1UZAA 3HBAA 3QVUA 3ZH2A 5EIEA 2QDXA 1CJTC 1COWA 2QTFA 2JGDB 3QW4B 5KTMA 3RUIA 1S3SA 2IZOA 2K87A 2Y05A 1H22A 1F8GA 2GOYA 1KJIA 2V4ZA 3BZUA 1CQWA 3F47A 4JUBA 3IHWA 4QFBA 1YQGA 4JJEA 4RJ2A 5FUVA 5H3CA 3USCS 4P0PB 1OXXK 1TEXA 1QIEA 1GSAA 3DEAA 1EQUA 1P62B 4GPBA 4QUDA 1QU3A 3NB0A 3B7GA 3QEAZ 1I3KA 4LF6B 4COOA 4TSFA 2QRUA 3VA7A 4PAWA 3AETA 1D6MA 4ZAXA 5JJIA 1G8GA 3MK31 3IUMA 3JZFA 1TRKA 4V3CA 4ID9A 1J4AA 3IO3A 4EUSA 1DX4A 2FUKA 4G0VA 4ZT6A 2FJ0A 4O2BB 4EB0A 5KPTA 2QXUA 4XPIB 3UJDA 3U4MA 3COWA 4JKIA 2QJTA 4EPTA 1E9BA 1WDKA 1ZJ6A 3ZHYA 2I8CA 3STTA 2R1TA 1AO3A 4FIZA 5CTJA 1WKVA 4TV9B 1XUOA 3MNFA 5SYMA 1K5PA 3C45A 5B57C 3ZVRA 3PGXA 4QDOA 1PR3A 2OKCA 2O2JA 5BW5A 2OQIA 4I8XA 1G21A 1NWHA 2PUVA 3ON5A 5E2BA 2UYYA 3WMWA 1XXHA 3BZWA 4E51A 4FYWA 4JYAM 3GPYA 1FNDA 1ZMOA 4MS1B 1V7ZA 4YMGA 2CHUA 3W05A 4M9XA 1GG5A 2VH2A 3N3BC 4OGKA 1A8PA 5F52A 1KHHA 3IEIA 2QW0X 1DHTA 3WRVA 1HNZB 4C6TA 1HQKA 1XVLA 4KPUA 4U5QA 1CDDA 1XRRA 1G1MA 3I92A 4LE1A 1AKEA 1LI5A 2A3RA 2JLAA 2ZT8A 4R83A 3TLJA 5ALSA 3M2PA 3TZCA 3VC7A 1X8LA 5JAIA 1PJ4A 1KSFX 1LBTA 3ZCUA 3BDAA 2BGJA 3R2JA 4A1OA 1JW9B 4B6RA 2QPLA 2Y1FA 3T3DA 1KZ1A 3BFKA 4RD0A 7MDHA 3H1PA 4HAUA 1AMUA 1I7QB 3QZUA 4LXXA 3OF3A 4CKBA 3DZ8A 2XLJA 3MQ2A 3FBTA 3KS8A 1FFSA 2TMKA 1OROA 2WT9A 4G5YA 1T15A 5JDIA 4NEGA 4YV1A 4KK3A 5EZ5A 3UICA 3ZXSA 2XYRA 1IZYA 5JU6A 3OZUA 4XRGA 3ZUGA 1YVPA 4OREX 3WGHA 2J3KA 1Q3BA 4LJSA 1W5SA 2BY4A 5AKEA 1KDTA 5F7XA 1KSJA 1KYVA 4R4JA 1R3DA 3TOZA 2NTYC 2XEPA 1G55A 1GTSA 2NVBA 1PQPA 2B2XA 3T7AA 3WHKA 2GJSA 3CTWB 2HJRA 2J85A 4JGIA 3VPAA 2L69A 4PRLA 3IECA 1CHNA 3ND9A 1T29A 1XTIA 2QKYA 4MLZA 4DBZA 5D6NA 1XMVA 1T1JA 5AJVB 2CZGA 2QVCA 1HO3A 3UPDA 4NZZA 3T61A 2GEJA 1L2DA 2E4YA 3DZKA 3E3MA 4CF4A 4CMGA 2J32A 5BNWA 1KOJA 1JAHA 3EOZA 3D3EA 3QJ5A 1IWOA 3KSMA 1R9MA 3NUQA 4OHPA 4AJHA 3GQ5A 2P6UA 5H5JA 1Z88A 5TX7A 1SC4A 2DFKB 2ZBUA 3FUCA 3JTEA 3I04A 2CLLB 4OK5A 3K5IA 2QAGB 4BO9A 3JQGA 2WJHA 1F8YA 4J1TC 3PFGA 4QBHA 1FJHA 1ZESA 2FMFA 4AO6A 3PHHA 5CLFA 3IL2A 1QANA 4FZVA 3A7DA 4AJ9A 1ZMUA 1M2KA 1XPOA 4I5DA 4IINA 2W58A 1C4XA 3GMSA 1JDJA 2JA1A 3VHXA 1JR3A 1WMBA 4QTZA 3IYLW 4QXPA 4S0XA 1SHJA 1L5MA 2AXEA 2DM6A 3STWA 3T34A 4ESEA 5LVAA 4Y1RB 5EKSA 1UOOA 3LQYA 4DLYA 3CF2A 3FY4A 1JKJB 2PT7A 3HCWA 4W1PA 4YRBA 1PE0A 1R4MB 3SXUB 3RS4A 3KQNA 1NXVA 2D1RA 5AK0A 1KAQA 1WX1A 1XCOA 3TL3A 1QGED 2GZRA 3EZYA 5G2OA 1E2KA 3RYIA 1B23P 2TSYB 4R2XA 5HDBB 1T5TA 3H5AA 1GRQA 1VGVA 2R7NA 2VJLA 2JLRA 2ZJYA 4CIZA 1EHYA 4RZUA 2CLFB 3QOWA 1PSZA 3T54A 1F48A 4FE3A 1O58A 2FN9A 3TD9A 1Y8RB 3NBQA 4BYGA 4PLVA 5BSHA 4XA8A 1MO6A 1QR6A 1VMAA 1CSEE 1IBKM 1IULA 2OCYC 3A0UA 4WAUA 2ZM5A 1BS2A 3N2KA 3B6ZA 3KX2A 5AW1A 1L5GB 1Y9DA 4BNJA 5K8TA 5CB0A 3UBMA 2DR0A 5JBNA 4UU1A 3TM4A 4D0GA 3FJ1A 2QTWB 1EJ0A 2HTFA 4E5PA 3IIJA 2DCUA 3NHWA 3T6PA 2YWEA 3MJ5A 2J4CA 5F7OA 4K1LA 3PKZA 2WKQA 2VP5A 3NORA 1XAJA 2AI3A 4NDZA 1WB5A 1YS4A 4JX9A 3A6HA 4JNKA 1FE8A 1R0SA 4GOLD 1JSRA 2GEVA 1ZH8A 3DP9A 3TNDA 1N6NA 1XZJA 3B1FA 3CNQS 5JJCA 1JQAA 1KYXA 4YB8A 3GBPA 5E6UB 5I45A 3U61B 1OKKD 3PQ3A 1I33A 4GKBA 3LMMA 1S7GA 3VPBA 4YPOA 4Q03A 3VNSA 2XDQB 1N77A 4LE0A 1YS7A 2A4KA 3HYRA 1CW2B 1CETA 1UPCA 1KAOA 5C7IO 5KTTA 1REQA 2EERA 4KO8A 4AG6A 1RI3A 2YASA 3HV2A 3QVVA 3WRXA 1VHLA 1AZLA 2VEDA 3A27A 1EBUA 2P5SA 3IPLA 3P0FA 2MWMA 3OKPA 5IHPA 5LDDC 4KO3S 4ENRA 2OEPA 5F35A 2O0MA 4I1IA 4D1YA 3Q87B 4AZ3A 2GJ4A 3R0XA 1VEKA 5D2CA 4INJA 4HTFA 2DFTA 2JFPA 1YE8A 3W0LB 3FAKA 3M6FA 2MJ5B 1H0RA 4UNNA 4UTOA 5A1TA 4DFDA 1M7GA 4C0HA 1JQKA 1F51E 3ZWBA 4IMRA 1HEYA 1Z16A 3G23A 3B7WA 3VHRA 4OQMA 2W8BA 5IPFA 2OWDA 1CUWA 5AVSA 1F14A 4MRMB 8ATCA 2MHCA 3GDHA 3WLSA 2JZCA 2R96A 4Q6BA 2LHGA 2YJ5A 3V7FA 4PGAA 2HAKA 2WIAA 4CEJB 3E8SA 3ISVA 3OICA 3V4LA 1GYRA 4FIDA 1KZ9A 4O4LB 2EYUA 4FT4A 2NSLA 5EA2A 3RVPA 3GFQA 4R71A 2J9GA 4X97A 2GD6A 2P5YA 4WJZA 2I2AA 3HCAA 4RL4A 5FWAA 3SJAA 3TQHA 4AN4A 2V5VA 4G4IA 3IDOA 4JXJA 4JH0A 4NRWA 3DXYA 3MG9A 2IXBA 3JVVA 1HDGO 3GLIE 4L4XA 4MQ4A 4O4JB 3VVMA 4UXHA 3A1CA 2H57A 4ZZ0A 4TWJA 4JJIA 2K7FA 3U7QA 2RHGB 1VLLA 3L7LA 1M1UA 4X90A 4BVGA 3PR2B 3QE2A 4KAXA 3SJBA 1M2VB 1RJDA 1Z2CA 2P30A 4TQGA 1I5RA 1NLYA 2HA7A 3IFSA 3GRYA 3HU2A 1GXSB 1OTYA 2RHHA 4IIXA 4XDGA 3I42A 5ALRA 1JPVA 4BFLA 4F85A 2Z4RA 2ZRLA 3H18A 1SC9A 4J1NA 5KPJA 3QEMB 1XIVA 3FPJA 1XJQA 2D1SA 4B3SM 1GITA 2FW1A 4DCSA 1XKXA 5IDQA 1W1UA 3KK0A 2BFDB 3HEAA 1DBPA 2RGCA 2RGEA 1THMA 1FLDA 4BATA 2QBYB 1N8TA 4CIAA 3GCDA 3FOFC 4IKEA 4IX1A 3V1KA 5DGCA 4Z99A 4LPSA 3O1IC 3OFNA 4BFWA 2V7BA 2JHPA 1FYEA 1W59A 1C0PA 1KI6A 1NGSA 2F43B 2ORIA 1E1CB 3Q3HA 4H35A 4KLZA 3FDZB 1UZLA 2CXNA 1UP7A 2AX3A 2PN1A 3JALA 4YQEA 1B2LA 1TYZA 2WTEA 4OVZA 3EEIA 4R41A 3U7HB 2W71A 4O2RA 1XU7A 4KMMA 3WJ1A 1PVOA 2GRAA 1FF9A 4MGYR 1C30B 3OM1A 4LRYA 2I03A 3DPUA 2A9VA 3DE3X 1KF0A 1NJ1A 4YECA 4JI7M 2K0BX 3U17A 3FPSA 3KTAA 2CZCA 4GXNA 5LSAA 1LNSA 5AIAA 2ZQZA 3DDOA 4MUXA 2WJ3A 2R2AA 1KFEB 5KSYA 4JZKA 5ICMA 3PUIA 1WPQA 4YJ2B 1YONA 2TS1A 2ZWPA 4Q1EA 4A8JA 3HA5A 5GJBA 3Q3EA 2J0VA 3HL4A 1FLVA 1GU0A 4PGFA 5HA5A 1AQJA 2PZEA 5KQ8A 4ZI7F 4Z53A 4LXTA 1LBSA 3IP6A 1AE1A 1W581 2YRWA 3UBTA 3KPVA 5FIUA 3SC3A 1GCOA 1HLDA 2L0XA 3T1HB 2JHCA 1Y7PA 4LE2A 4LOJA 4ZOAA 4F71A 1ICIA 3CN7A 3FWHA 4QPCA 3H5RA 4W6ZA 5BSVA 3HNRA 3G0IA 1VPEA 3SQMA 4DEVA 2G04A 3G9QA 1BTOA 2D2EA 1TKAA 4E09A 2FDRA 1Y3IA 3UMSA 2YVKA 4EZEA 4O4IB 3V48A 4NZYA 1Y37A 1WMFA 2YL2A 4ROTA 3PUYA 1LU9A 3NBAA 2K47A 4Q4AA 5CA0B 4MO2A 1EI9A 1DNPA 4MK4A 4DLXA 5B6JA 3P27A 3RUPA 4X64B 2PLFA 1AGNA 3PC7A 4ER3A 1XRJA 4CKYA 3HSSA 4F6LA 3R7LA 1A9ZA 1IBRA 2P78A 1C3VA 1DEXA 2IYFA 2IHJA 4HNSA 4RHEA 2XNDD 5LMUB 2GN8A 3ND7A 3CVOA 5HRAA 5M29A 2UUAM 3PXAA 1JR6A 2RGNA 2ZRNA 1J9EA 1DGHB 4EPRA 4DNPA 3T4EA 2VTEA 2K4MA 4HBGA 3GLFB 3QKRA 5JSYA 3OZSA 4WA8A 5EPEA 3NBUA 1E63A 4LJLA 2H8KA 4M6WB 2A1IA 1IJBA 2DYKA 4CQMB 5BW8A 1N6LA 1H2WA 2LZ0A 4U8HA 1C0KA 5FPPA 4EJSA 4CUZA 1ZIYA 1V96A 2GUWA 2IHZA 5KYGA 5CBPB 2VDQB 3B1KA 3N2EA 2LBPA 2Y0CA 1BW9A 2X14A 2M2IA 1CR4A 2PX0A 4U7FA 5T8KC 5TEWA 2NVUB 1OBFO 3R74A 1Y6QA 2Z98A 4R69A 1II8A 3URMA 1X14A 3IODA 4AB1A 4X71A 4CKXA 2H63A 3M5DA 5FBHA 4DY6A 3O83A 3T4XA 5DBGA 1H85A 1SUSA 4XYGA 2PMBA 1MAWA 3TLEA 4QJ5A 2EATA 4C14A 3AHIA 3C5CA 3OEWA 4NE7A 2X6RA 2FFJA 3B3QA 2GPTA 2XITA 3FXAA 4X7BA 3H7AA 1KOLA 3CVYA 1IK6A 2WFLB 4M76B 1XHBA 4BO0A 2FSVC 4IHAA 1Z25A 2WJAA 3AM3A 4HDCA 1QAOA 1G2OA 1C29B 1W4ZA 1YRQA 2TMYA 2YQ5A 4IIHA 1SUFA 1C7ZA 1VL0A 4TYMA 1N2CE 3SZOA 4Z7JA 5A7HA 3F2IA 2QTCA 3AEZA 3IBFA 3OQJA 4YEDA 4HFRA 3T06B 4C89A 5LFAA 4V24A 2O3SA 1M2NA 2OBFA 3AM5A 5U1PA 3Q3VA 4X65B 4NHEA 1QX4A 1Z17A 3PPVA 4B3CA 1R5JA 2VI5A 2WT8A 1SO8A 1CY2A 1NTOA 3LK6A 1TJ5A 1G7RA 4TRJA 4CFSA 2WHPB 3P9IA 2A5YB 4ZV7A 1ZISA 3MSXA 4QUKA 2HU5A 3Q5DA 3WLQA 1K7EB 1NYQA 3QIAA 4ANRA 2CWBA 1EEHA 4BB5A 4QE3A 1F17A 1F4VA 3QVSA 1P60A 5BV1A 2ZRJA 2C7QA 4TTVA 1ISMA 1ZOSA 5EJ5A 3TWMA 2ZUWA 4EFLA 1XAGA 1NVUQ 2JLYA 5H70A 1PJQA 1JDTA 1NVVR 3ND8A 3UH1A 5FUWA 2BEJA 2FCAA 4L5CA 1QDUA 4GP9A 2QIPA 4A8HA 3LKDA 2A9JA 1Q0LA 4TKUB 1L4YA 1W93A 2AVNA 2H0QA 3BE8A 5GV7A 3CLTC 3GG9A 4WKOA 3TEJA 3G7NA 4UPVA 1SXJE 3J80S 1O9GA 1T24A 4L3VA 1E2NA 5EJAA 4CNBA 5KJCA 4E08A 3ZD6A 2CUTA 1GPJA 4KWIA 3L9WA 3I72A 3KTDA 3PJFA 1W88B 3E1SA 2VDWA 4U2FA 1CEXA 3MUFA 4K9RA 4U1RA 4IRMA 4B45A 5B3KA 4MPRA 3I61A 2EGUA 2WYIA 1ULHA 4N4AA 1FRQA 1BXGB 4BJ3A 2C5AA 5LA6F 1A5ZA 1MH9A 4MDHA 3FUWA 2AEJA 2B4AA 2VZ8A 3IEKA 4RQBA 3UHOA 4BBPA 5KTKA 2QR3A 1KVTA 4PU0A 4HQOA 3MWKA 1U5BB 4TV9A 4ND8B 4OQLA 4ZTBA 2WWGA 4NU6A 4OQZA 5KNBA 2R47A 4PCVA 3IB3A 721PA 4M0MA 1AZWA 3UAYA 4ZYZA 1XLUA 5JRDS 3N5CA 3PEVA 2HJVA 4R1TA 4KHZA 4O02B 2OENG 1XTTA 1W4LA 1ZDMA 4OXQA 1G2IA 4M0DA 4A3VB 4CEIB 1TT5A 1RVDA 4RFSB 2VNSA 1N2CB 2V4MA 3C3DA 3QYEA 3JQEA 3O2JA 4ZO9A 3ETHA 3H11B 3HGQA 3T3HA 3KQOA 3KOZE 2V97A 3IJRA 2IFTA 4M1KA 2QOEA 3EJWA 1MO4A 2GBCA 3FBGA 1GD1O 2C3OA 2FETA 2QE7A 2QMZA 2WLTA 3RCBA 3T3MB 3T8YA 3VR3D 5EOVA 4MGIE 3VOBA 1YVUA 4CQNA 4B3BA 4H3HB 1X42A 2W2QA 2G9UA 4A8JB 1AHHA 5A06A 1LWOA 4Z7NB 1AUOA 4U4AA 1JG2A 4KO1S 1F6DA 1MFZA 3MCTA 3VGJA 1T2UA 3ZDDA 2MIIA 4JODA 3CX6A 3UHFA 4BL5A 1JPUA 3PVSA 1H6AA 4F7DA 3WK5A 1G7TA 3HJGA 3JARB 3NU1A 5EMKA 4IV8A 4OBBA 3UYLA 1KPIA 4M0LA 5AKKA 2IK8A 2UUBM 2JCYA 5A3JA 5K05A 3S1AB 1MAUA 5C8XA 3T9DA 4BJ6A 1BDIA 3ZY6A 3ROTA 1HYBA 6YASA 4RNDB 2GN1A 1JNYA 1DC7A 3QFTA 2AW5A 5DIFA 3BTVA 1G3RA 1AUAA 1OFUA 1RI1A 2NX2A 1UDXA 2WJPA 1DQSA 1DIGA 2CN1A 2WIGA 3ND6A 3AY0A 3WBJA 3T1NA 5C2JB 3DLAA 3K71B 4DCOA 1GPUA 2X4IA 3ZEAA 5I4KA 5FTWA 2I66A 4L1KA 2O06A 4ZI7A 1T35A 3UWMA 1NDHA 1R16A 4AO8A 2QRKA 3U4QB 5C18A 3GRAA 2BW0A 4HQ0A 4DJTA 2Q2OA 1RLTA 2NWQA 3LT4A 2IYUA 2JNHA 2ZWOA 3USES 4KC0A 4JLUA 1B7GO 4ZOLF 5G0UA 1DGBA 2PAAA 4CEHA 4D79A 1YGPA 2DE0X 3WLEA 4BEJA 2W90A 1NUSA 1ZCFA 3I9V1 4GWGA 3MVEA 2WYVA 3IQFA 3EVTA 4QYIA 4ZK2A 4M8LA 4DSOA 4IVRA 5T4HA 3KE9A 4KQKA 1IEVA 1L5SA 1R0YA 4BGIA 1RJ9A 4Q4AB 5CA0A 1ADBA 4F04A 1AUVA 3HI6A 1MB2A 4JMLA 1SD1A 1K89A 5IHXA 4ZPXA 4PQRA 3LXUX 2KMLA 4ZCRA 4A6PA 4OX9Y 4WK6A 1J22A 5A3VA 2ZR0A 1J21A 4REMA 4F86A 3WSWA 3WIUA 2P1DA 1VPLA 1XTJA 3BB1A 2FR1A 1Z5UA 4D8UA 1NBMD 4RLFA 1U7UA 2M32A 3H5NA 3Q4GA 1PZGA 3E7FA 4OHZA 2CNKA 3RDPA 1FYWA 4AS3A 3WP1B 3H5TA 2GLXA 5DM1A 3U7RA 2Y0DA 4EFMA 3OKAA 2PSSA 1DXQA 1A9XA 3ZN2A 3ANNA 2JI6A 2F3SA 1T4BA 3DV9A 2QMYA 1IAQA 3OMXA 4NBUA 5CCDA 5LZ8A 5CYFA 1PTKA 4Q7KA 3BA1A 4MZDA 4UAUA 3F5FA 3R4CA 5DYNA 4U5XA 5DJ5A 3EBLA 2MYPA 1N7HA 4P0QB 4CQLB 2CJFA 2VK1A 2QV7A 1S2LA 4UBOA 1DGQA 1TECE 1TTEA 2R5FA 4UJ3A 4X1KB 4EF6A 2BZ0A 3TKYA 4B6JA 3BZBA 1Y42X 1E4OA 1U2DC 4EP1A 1A4RA 1T1IA 1JFLA 2OFOA 2VHZA 3C6ZA 1DUIA 4D3FA 4DEXA 3M7GA 3ROGA 1QK4A 4ML3A 1MV8A 4EYOA 4C03A 3HN7A 2PEYA 4ZDIA 2VSFA 2OY0A 3N0WA 1V11A 4YRQA 3U16A 5EINA 1YZNA 2MMCA 3PHCA 4NDAA 4W1SA 3VKHA 4DXHA 5L4LA 4LNHA 4JYZA 3IXLA 1RCFA 5CT4A 2MR6A 2C9OA 4EEZA 1NLZA 4EATA 3DUWA 1JVSA 4V2IA 5CH5A 2JEOA 2PX2A 5DB4A 3UWPA 1FW6A 1GLVA 3MMZA 3PQ8A 1L5NA 1USWA 2CLEB 2C3YA 1PR0A 1F0NA 2Z83A 3H75A 1WUJS 4WGGA 1AKWA 2VJMB 3R5KA 3BK1A 4L2IA 2AI2A 4LY0A 5U4QA 2AHOA 1JYSA 1FXSA 1NR7A 4E4RA 1AURA 3C14C 1AKVA 1N3LA 1XZQA 3HKCB 4EHJA 4I9NA 4DNFA 3T5AA 1PFUA 4JT8A 3MWEA 5FQOA 2VRNA 3OBIA 2V1XA 2X49A 3WR5A 3Q7TA 3DOOA 3CNLA 1V1MA 4BUZA 3VVBA 3EXFA 3HLYA 1CY4A 1AT1A 1Z75A 1NUTA 5AWFC 1Q39A 2QZPA 5AHOA 4J16C 5CT5A 5FO1A 1E1KA 2KBEA 1WCIB 1U1DA 1N2XA 4BMDA 3ASUA 1NMYA 1YRHA 2BM9A 4DLKA 2C3PA 4ZTUB 1E62A 4EI2A 1CWUA 2P35A 4B5LA 4ZO4A 2PYDA 3UG6A 1D0MA 4QD3A 4KTVE 2FU5C 5JXGA 2PRYA 2VF5X 3OX4A 4MVJD 1JB9A 4BUJA 1DAFA 2XVMA 2C7BA 2HL6A 3BXFA 3KUUA 4H6VA 2ZRHA 3WB1A 3ZIAA 3V3TA 3OP4A 4QNNA 2H5IA 1FRVA 4XYLA 1FYDA 3MJSA 4GBGA 1F3OA 1KYIA 2WG0A 4CLOA 3BIJA 4PZYA 5H80A 1JBEA 4WSOA 1NSYA 1MORA 1P3DA 1XNJA 3GK3A 2PFGA 1RWBA 1JZSA 1FVFA 2C8KA 2V65A 3B3GA 3BKWA 4X20A 5KAPA 2PKQP 3HACA 2SKCA 2VYNA 4MW0A 3G6WA 5T4EA 2A2ZA 4TLBA 4DV0M 3SEAA 2EJUA 3FZEA 3B89A 2ZCJA 1Q1QA 4NSNA 5ECDA 5IW8A 3SM9A 1XRSB 3OU2A 2GXUA 1R8QA 3T15A 2K6BA 3KZCA 4NFHA 1OBVA 4F5ZA 2COKA 3OZRA 4W8HA 2VC2B 2WVHA 3R75A 4RLSA 2WZCA 1J06A 3TZQA 1U8EA 3NKVA 3L2OB 3O4IA 1OASA 3U9LA 1IZ7A 1MPXA 4Y9TA 4C5BA 5B4VA 3M83A 1MU0A 3NZEA 5PGMA 1IUNA 4EVRA 5L4NA 4OJTA 4KFCA 4TLLB 3TVDA 2GHIA 5BVHA 4CL8A 1OLUA 4AWAA 3Q8LA 5BYKA 5G1OA 3RYHA 3ZCQA 2BBOA 4B3XA 1QF9A 2HRBA 1XMOB 2BV3A 3LX4A 3ZZ1A 2QD5A 3NV7A 4JLDA 1UPFA 4JVLA 4MUMA 2C7RA 3WZ2A 3ORRA 4FGZA 3KJNA 1KC3A 1BHQ1 4YDQA 3G49A 4PFKA 3ZY5A 2AW3A 2PDAA 3RVKA 4DG9A 1DEKA 4OHCA 4RYDA 3GP8A 5LR6A 4RMGA 4G5XA 1Z4LA 4RE6A 2NVOA 1PHRA 3NRBA 2XBUA 2ZRQA 3OFJA 1PUIA 4LXQA 2FPPA 3CLSC 5HCUA 2QRLA 1KR5A 4CM7A 2XYGA 3S8MA 1J90A 2HYIC 4PSVA 5D3ZA 5LQSA 1W44A 2NZJA 3QOYA 4G4QA 1SUIA 2PRIA 4JKOA 3RVQA 1UPAA 1WOMA 4RH1A 4LXGA 2XADA 2EKDA 2AZMA 1Q95A 1Q7RA 5K4GA 2GYYA 1RKXA 1SOAA 3KQYA 2UVPA 4OQEA 1PRYA 1JDBB 1ZS9A 1WW8A 1I0LA 2IYXA 3T0IA 2MYNA 1QYWA 4OJMX 3OZEA 3WWZA 5MDHA 1O96B 2N35A 1B3BA 1YR1A 1JJFA 4RPGA 4CM8B 1HX7A 1CP2A 1UMCA 1XHEA 3MAJA 3MMNA 3AM1A 5CM8B 4OHRA 4D0NA 5CA0F 2GDJA 5HSGA 3LNCA 5FWYB 1I4LD 2XLCA 3GGJA 1FUKA 3G2KA 4R9UC 4YDHB 3RTAA 3ZNOA 1MMFB 4F4HA 9LDBA 2H08A 3S4YA 2MSEB 2R4JA 2FE1A 2JCXA 1QDEA 3GFVA 4CMBA 1O5IA 1XXHB 2Q4RA 1NW5A 1XP5A 1QM5A 2MSCB 3NTRA 1H2FA 5KYUB 2NIPA 4MAFA 1T3SA 1YDFA 2HTEA 2WFMA 1QKKA 3AVQA 4FOLA 2X8JA 1BKYA 2BBSA 2PWAA 1SQGA 1JLMA 1V71A 3CNOA 2QM8A 3U3XA 3LHKA 4AUMA 1JEJA 1MIHA 4DG5A 1YULA 3JWJA 5DN6A 3AI7A 3OCCA 4EKDA 1Y48E 2DAEA 2ZIGA 3O2SB 2PZLA 3DFKA 1P2TA 3U4QA 4YWHA 1KDYA 3BIOA 4F4DA 1F6WA 3S2FA 5IC4A 3L7CA 4KDCA 4X61A 1RQ2A 4RSGA 2OFPA 5JSZA 2RONA 5L7YA 2UZ4A 2OAGA 1NDQA 1R6VA 2V54A 2J0UA 1R0LA 1D9XA 3HDTA 3IVGA 4Q3AA 1V43A 3PXGA 1L5ZA 3D4OA 1T0UA 3E03A 4D9KA 3PEWA 4DRYA 3G9XA 5DLQC 5DRYA 2VP2A 2JFOA 1E3JA 3K0CC 1AH2A 1Y4SA 4DANA 3O4RA 5E2IA 3ZU4A 4LHYA 5K8LA 1PK8A 3IHLA 4LS3A 4AYTA 1HEIA 4DIFA 1N6KA 5FAXA 1FTQA 1DX9A 1MG0A 3GEHA 4X95A 5L8VA 4K28A 4I4TF 3A31A 4HX5A 1AGPA 3UGQA 1GDTA 4EBBA 3MLAA 1QNLA 1PN3A 1QYCA 2VA9A 4L73A 3TMAA 3SOZA 3D7NA 2NGRA 4Z54A 3W34A 3EZXA 4J7AA 3BH7A 4KFSA 5ALVA 2FEWB 2YICA 3O6VA 4CIXA 4MMZB 4H1VA 2QENA 1YC5A 2PUHA 4J1SA 1ECBA 2O5EA 1HSZA 5K0JA 2A1TS 2IZ7A 2EKKA 2XBMA 3TN7A 4X8LA 1K2VN 2VJCA 1ZIOA 4G9BA 5I4CA 3QX3A 4MIOA 3EDQA 4JOQA 4C2AA 4N9QA 1WXFA 1G3QA 2NPIA 2V6GA 3VI3B 2P2YA 4ZDWA 3Q3CA 4B33A 1SBYA 3ECCA 3OHPA 4E88A 3VKVA 1IM2A 2BGUA 3R9WA 3MINB 2H0RA 3OLWA 4MS1A 3C48A 3DG9A 5I7VA 4NENA 4WZAA 4IJQA 2JK0A 2F48A 3BXEA 4PG6A 5B12A 4FFVA 4YIKA 3IESA 4HGNA 3RVSA 5JEEA 3AHEA 5FLYA 1K6EA 3SPXA 2IOHA 2RJNA 4IHKA 1AZSC 3PXEA 5J40A 3F4LA 2WYOA 3BRWA 3DF7A 3I37X 4MX8A 5T64A 2X77A 1M0WA 1BA2A 2ADOA 4DIUA 2Q62A 3LFHA 5GM1A 3G0DA 4NPHA 4BO1A 2QN1A 1EDEA 1YCDA 4IIJF 1SC6A 1TAQA 1YQEA 4N5MA 4OFXA 3GLQA 4IBCA 2RGNC 1G20A 2E6UX 3L8MA 4ENPA 1V4VA 3JD4A 4R1SA 3W7AA 3QFRA 4RMIA 4O29A 1TAGA 4YJHB 2IOYA 4XLLA 4DUYM 1S6YA 4UEJA 4ZXFA 1O6CA 3AI3A 2YWRA 5AUPB 4X41A 3MGKA 2H4HA 3H9UA 3EWNA 5FPTA 1JDUA 4IL5A 4HLDA 5FBWB 3L43A 4B3FX 3OQOA 2JCBA 1YQWA 3BWBA 4JA2A 2JBWA 1FU4A 4G1CA 1K27A 4G5GA 5D8DA 5DTJA 3LDGA 1PGPA 2BMAA 2C8VA 2Y71A 3M1YA 3O9ZA 5DBEX 1LK7A 1TQ8A 3K0FA 1XZLA 5EJEA 4MJ3A 4R8RA 3AEKA 3IE1A 2XH9A 3RSLA 1QF6A 2J7NA 4JI4B 2CXXA 4I6GA 1H2EA 1CF9A 4M0EA 5CM2Z 4X6XA 1D07A 3AUTA 4EL0A 5JYEA 3DBRB 4KX5A 3RYHB 1GA1A 3B8EA 1WNTA 3RR2A 5HIMA 5CVTA 3OEHA 1ONOA 2P0EA 1N2HA 1DI0A 1XC7A 3BFXA 3B9RA 2JVIA 4LMPA 1GSIA 4ZI7B 1QORA 4YT5A 4JT9A 2VDRB 1CK4A 1TYEB 1V25A 3HEBA 5HFAA 3W4IA 1K8YB 3ZE6A 1KBQA 2JLUA 1U63A 3KFXA 4ZJZA 5HKOA 1U2ZA 2ZPTX 4N18A 2HMWA 3ASYA 3TE7A 5AVQA 3IDZA 4O08A 3HFJA 1PWZA 4PINA 3VR6H 4B34A 5KX5A 4D2IA 4YQZA 4MJXA 4RHCA 2WDZA 1QF7A 3PUHA 1G8FA 2EVWX 1NJ8A 2BIFA 3KJEA 2NMVA 3FDFA 2FRVA 2MTBA 4ID3A 5FHQA 4ZXPA 4YO8A 1T6ZA 2FQWA 3L0PA 4KGXA 3WSTA 3GFFA 2KB0A 3LRXA 4TMFA 1LBIA 5F51A 3W9SA 3CSUA 2H9IA 4Y2QA 1B14A 2I4TA 3MXOA 2IYWA 1JQEA 3EXEA 2AOUA 2XTAA 2ZVQX 2XUGA 3I39X 3J7AS 3L8DA 4UHCA 2P91A 4DGSA 4U6NA 3RKSA 5K03A 4NOLA 2G5CA 2QYTA 1YZHA 1GKYA 5EIBC 3ZZUA 2ZBVA 3K4HA 2JVJA 3EOBI 3HBLA 1DGHA 1ZVMA 1Z0JA 1QDTA 1C7JA 3I2GA 4JB3A 5GONB 4DDTA 1OI4A 1YDGA 2VJAA 3JD1A 4MI1A 2BZ1A 3ESXA 4BZWA 2OCKA 2ZBEA 5BOVA 3W77A 3OC6A 2ZIVB 1TJ3A 2WSIA 4HH0A 3GN2A 3RSHA 3TE6A 1ZN8A 3LPDA 2YS6A 3F5MA 2X0FA 5KAMA 2Q7DA 3WKBA 5I8WA 3LDHA 3SWWA 3GLRA 1M6WA 1FTYA 2G9NA 3VZSA 1XZGA 4AKSA 2ECPA 1GTL1 1ZBDA 3QHPA 3QYAA 1T4GA 4JL5A 5ERYA 3VZPA 3VJRA 1KEPA 2OESA 4BQNA 5A3SA 5CA1B 4GQAA 4MB7A 4RCYA 3PX2A 4ARZA 4KNVA 4W9RA 3EWIA 4LFCB 5J2TF 1KZHA 4CLRB 2GR9A 1TB4A 4KR9A 3PJGA 1ZI6A 3IVCA 3SQXA 3OM8A 1VSBA 4PZAA 1FSFA 2PMKA 4HTFB 3LGAA 4C0JA 2OC9A 3IURA 2KPOA 3PT5A 4IXNA 1PZHA 1RACA 2GHRA 1WHCA 4JQYA 2E5WA 4XUEA 3AKCA 1XQWA 5HGJA 4BNDA 3G5TA 4OUKX 5DWDA 2I2CA 3K9NA 5FL7D 3MMSA 4YV7A 5AYVA 1WJ7A 2O5RA 2ZGVA 4F2DA 3E18A 1FU8A 1T3HA 2OZPA 4H3VA 5EKTA 4TWIA 4JELA 2TYSB 2QROA 4P32A 3REGA 4CCYB 3FVWA 1IYZA 3PQ2A 4JP2A 5CB6A 3BC1A 4GBED 3UA4A 3EFOA 3L8FA 4HWGA 3S7ZA 1B8OA 2EZ4A 3U4HA 4HZUB 2OCDA 4QOFA 4W1QA 1E2FA 3BF8A 2CJWB 3I9OA 1ADCA 3M6AA 4ZPJA 3D4LA 3S2GA 4PGHA 1NVEA 2F9LA 3BXZA 4XGKA 2ZDHA 3GRVA 3D6MA 2ZM6B 1K3TA 5JJLA 4PHCA 2IU6A 3VNBA 2ASEA 4K3VA 2G40A 4QG3A 1Y1QA 2I62A 4ND3A 1Z5AA 2J7OA 4HJRA 2CBGA 4AK9A 5IVHA 3H4VA 1PGYA 1HZZC 1KIAA 1NRJB 2ORVA 2XYVA 3HCDA 4GKAA 3RVJA 4DR1B 3CPJB 5CNKA 3D6VA 3S99A 1ZCAA 2I29A 4BN4A 3DAGA 4F6CA 2JBAA 2B37A 3ICWA 2C00A 4DCGA 2PBFA 3HKPA 2H9AA 2QSJA 1RI2A 2CY0A 3QYJA 1DFGA 1VCMA 1GUYA 1MKYA 1IOVA 2C8JA 2EP8A 1VCNA 4QJ3A 2N1MA 5AKJA 4INZA 5JS8A 2BFOA 3C41J 5BR7A 1VSUA 3U1VA 4HZIA 4CGYB 2YRFA 1M7BA 4JUDX 4D8VA 1P4SA 4TGLA 3FI9A 4RKEA 2F2TA 4AJ1A 2V7VA 4BXOA 1L5FA 1SVLA 2GH1A 3QE3A 4JD5A 4LVNA 3IQIX 4FXOA 4O4IA 3VR5D 1QPGA 3ITDA 1U7WA 4B17A 3FTEA 1ORWA 5FPQA 2WZQA 1J0AA 2B7BA 3LC1O 3B70A 1QWSA 1L5RA 3I53A 3SQWA 3RVOA 2LVQD 3PCTA 4M99A 4ZVMA 3R7SA 1ETUA 2XH8A 4F0JA 1UMDA 4F4UA 2AR7A 1RHMA 3MCAA 3WK8A 3OZWA 3ZQUA 3REFA 3ZQ4A 2ZZNA 1QTIA 3RK4A 4G0MA 2QVBA 2H5JA 4CMAA 1KOFA 1PHPA 4R40A 5EHNA 3EXAA 2N75A 1C0IA 3D59A 5BORA 5JJ5A 1L6IA 4YJ2A 3FB4A 4NRVA 2OVFA 4V0ME 3FUXA 4JENA 1GOTA 3TB6A 5KOHA 1Z0ZA 2HMTA 1NOJA 1HM5A 3HJBA 3NTXA 5BPFA 1L7BA 2CF6A 4PCUA 1QIJA 1U0TA 4OMDA 1E1QD 1TO1E 4GXTA 4E2YA 4B2IA 3BRQA 4BQRA 3FZQA 1DLIA 4JA0A 4P81A 5ALYA 5DSTA 3P9CA 4J0FA 5GQSA 5TGTA 1RI5A 2QPOA 2B1QA 2ZKLA 4OI4A 4XJSA 5JQGB 1DC5A 4F72A 3TQQA 3TZKA 2OQVA 4X8MA 5EHXA 2IYTA 4ZAVA 5I5GA 5JFOA 5K3BA 1HNWM 4HDKA 2JWSA 2BGNA 5FFFA 2ZJ4A 1J49A 2PGOA 2P2LA 3H5OA 4LBZA 3ZD8A 5CB4B 2AFIE 5LUAA 1ZZEA 2ZJ7A 4E5KA 4LFAM 3Q2KA 2BGLA 2J5BA 1VMDA 4XVRA 3OCYA 1JHVA 2O4UX 4EO4A 1VL5A 3CCBA 1P4HA 3K9WA 4O59O 3RPEA 3U4AA 2P27A 5FORA 1JPNA 4YH1A 5AW4A 3FE2A 2WYHA 2ZS9A 4ZVVA 3HHEA 3U13A 3GLGA 1EFRD 3CPEA 1WP4A 5ITWA 2W6CX 1SKYB 2JS7A 1I2CA 1U2PA 4N5LA 1IPHA 4NCNA 2YXBA 3O7MA 5G0TA 1VG0B 3N28A 4IRXA 3UENA 1T1EA 2P7IA 1HT1E 2Q1WA 4XARA 2RHRA 2YH2A 2ZT6A 4ZFNA 3G2PA 4D46A 4AY5A 2EAUA 3LT2A 1YGYA 4DYVA 5DP1A 1EXVA 4HZGA 3LKVA 3CUVA 1ZMBA 3DNMA 1Q0HA 4ZCSA 3WIOA 1HT3A 4CPDA 3R3XA 4QLAA 4JYCA 3V4RA 2Q07A 3RFCA 1H65A 3D7KA 3O4JA 3VJKA 3KP0E 2Q3LA 4TKUA 1BE1A 4BVFA 2VFAA 1Q12A 4CF3A 1U98A 1X1SA 1ZXXA 1UC8A 1V8OA 2BCJQ 2C83A 1M8PA 1V45E 1IJEA 4FFSA 4LYJA 3RHTA 1HURA 4Y67A 4L4ZA 1QO0D 3KPUA 1EVYA 4EJMA 3DS8A 5ALEA 3ZBTA 2OAQ1 3RC2A 1DX6A 4HWKA 2W2MA 3UQZA 4DS3A 1ZW6A 3ANSA 3P2JA 4PSDA 4UEWA 3A70A 2X8BA 4NG4A 5LYYA 4BNLA 4TKVB 1KQOA 2ZTLA 3OE1A 3QA3E 4ZC8A 2BEUB 3IP9A 3EG9B 1KGSA 2BFFA 3IERA 4D97A 5DCWA 2ZTMA 3FYCA 1FSSA 2FQ1A 4YRTA 2QE6A 1YIAA 2AXNA 4D80A 3KWLA 4I36A 4L4SA 3K4PA 1M2FA 3C39A 2PYZA 5CRIA 8MHTA 4BNFA 1T43A 1JEOA 5GZ1A 1EK5A 2KA6B 2BM8A 3OX2A 4ER0A 3G7SA 3QPBA 4ED9A 4L8LA 4XYEA 2APJA 4RHUA 1AG9A 4WCDA 5E6RA 3WSVA 4G4NA 3BIXA 3COYA 4Q3BA 4PEVA 5AUQA 4BKMA 2WIDA 4QLBA 2AD5A 3HLKA 3TRJA 3KPYA 2BUBA 1V8ZA 3NAGA 3OY2A 4C3OB 3CA8A 5SYAA 3JPWA 4LPKA 2OPBA 3VTZA 4JV5M 3HSKA 2ONCA 5F33A 3HGTA 4BX0A 1N25A 3ZK8A 1JQBA 2B0CA 3A3KA 3NM4A 3LXMA 2R8RA 3R3JA 4TVOA 3U3MA 3UK1A 3W5SA 3WL4A 5DGDA 5REQA 2CNNA 4EG1A 4B75A 2FA9A 3O9MA 4M0FA 1KY2A 1H6DA 3HYTA 3K16A 1SXJA 1CVRA 2YWHA 2XXAA 2E5LM 1DC8A 2V6ZM 2BEUA 4FMBB 5ARBA 1ADJA 4GMDA 4I3GA 4PRYA 5NULA 2O3JA 4QAJA 2ZSBA 3J7TA 3FYUC 3UWDA 4R1LA 4KIWA 3M6MD 5BN1A 5C1DA 3WLNA 1RE1A 3KL2A 4FEAA 2QTBA 4WWHA 1A88A 5LPNA 4DJAA 3WNBA 3VDUA 2AR9A 1V8FA 4G1UC 3MMPA 4XUDA 2IYNA 4AI6A 2OG1A 2QNBA 2W00A 3PGLA 5K6RA 3FB1A 1P9LA 4AS1A 1CNFA 1YZKA 4H31A 2IVFA 2VHJA 4IHJF 2IA5A 2VT7A 3D3KA 3G5AA 5EWMB 4WXPA 2B3TA 1R0RE 5AI8A 2IW1A 2G76A 4HN9A 5E1OA 2FWJA 5LP6A 3HS3A 4IH4A 4DLVA 1TEVA 5LBUA 4I19A 1DBQA 4IR7A 1WSAA 3FMVA 1DKQA 3H42B 1PW5A 1JG3A 2NQ8A 2OQ4A 1E2EA 2W2PA 4RF3A 4YMWA 1GQSA 3A6LA 3OU7A 3GA0A 2ZP1A 3VO9A 5K1ZA 2DFDA 3LX6A 2XUDA 4A6EA 1XZPA 2BL4A 2C58A 1CUUA 3AEXA 2PKYX 1I3CA 3O2NA 4B8WA 2O7RA 1C9JA 3IPXA 2LVNC 4REZA 5BR1A 5FDFA 2Q1YA 3K8QA 4KAAA 1WCIA 3BILA 3M3PA 4D4JA 1EUCB 1UDCA 2BR4A 5BQXA 2JK1A 4BX8A 1K7XB 1DU4A 2Y66A 1MZVA 4IQ4A 1BXRB 1DJNA 3GPBA 3DKKA 3P96A 4YACA 1R15A 2O2CA 1CUAA 2AMVA 1RYYA 2JIMA 3BE5A 4TZTA 3LM8A 2PO5A 1VKNA 3A3PA 3WLRA 2OL4A 2XGNA 1NVDA 1QOZA 3T4PA 3WV5A 3DOAA 4FP9A 2OXTA 2CB0A 2WFAA 1X8XA 2A0YA 3LHSA 4FGWA 5CDSA 3AHFA 1P2GA 2YYYA 1RHUA 1F8FA 1OWLA 1ST3A 2BSXA 4AT1A 1Z0IA 4FEEA 1N33M 5DGXA 3REOA 1BDBA 4KVZA 4EJFA 3CLTD 4UDNA 1PX0A 3CCFA 1ZGHA 1NXXA 2WR8A 4NXNM 1MO2A 1JHYA 1KBZA 1PZMA 4RA6B 3CLUD 3FKQA 2HCJB 4XI9A 1Z28A 4JI0B 4P3KA 2QX7A 1QHHB 2KBFA 1O97D 4TV9F 2XCQA 4ODIA 5LMNM 4CM4A 4C06A 2IHKA 1OV4A 4YPVA 3EEOA 3PC3A 4RSRA 5D3KA 5FOXA 1RU3A 4CM6A 1HKUA 2BDEA 1TVMA 3BAFA 3EIFA 4B6FA 3DZFA 4UM8B 5FL3A 4BCDA 2YXNA 1VCOA 2CLOB 4I1UA 1XZNA 4ZCIA 3GEPA 5U4XA 2YY7A 3PIDA 3VPSA 4AZTA 4HYYA 2EW8A 1SUWA 3L18A 2OOBA 1SKBA 2EJVA 3EQZA 1ZBQA 1T2CA 1WHTA 3EGDA 4FZ5A 4TN1A 4FYVA 2BVNA 4PIVA 4YYZA 5IDWA 2I4OA 2WJJA 4YXWD 1YIOA 2V7QD 5CFZA 4EA7A 3GBSA 3QYPA 5FOSA 5T6BA 5A0VA 3MERA 4GC9A 4K9PA 1RMTA 1FDIA 4GT1A 2X58A 1I8TA 3KR1A 1Z62A 1WUIS 4KRXA 3ELYA 1XMQM 4M6WA 1UBOS 4URZR 1WCWA 2VJDA 3X1JA 2V7UA 4BYMA 1OIZA 2JFWA 3AHCA 1A9YA 1PD0A 1CZOA 1P31A 2FEOA 3ZEIA 4X85A 1HOTA 4PCLA 5L40A 1D1PA 2DGDA 2W4MA 1J6UA 1DBRA 1JZTA 4CTNA 3VPGA 5FTKA 2OO5C 1UT8A 3W8FA 3QX9A 4V0NA 3TEFA 4C2BA 4EGQA 1P1CA 4TWZA 5BUCA 4G25A 3WGGA 1TTQB 2YMPA 5KPDA 2BHLA 2GMWA 1DCFA 1J8MF 1NM5A 1GPWB 1W4CA 5HJ2A 1BKDR 3HJRA 4BVLA 4E3ZA 4GSYA 4Z1OA 1XGKA 2XB9A 4GPAA 4KIUA 5AJTA 5A0FA 1ECLA 4QFCA 2VH1A 1JE1A 3EYAA 3MTBA 4NV1A 1LGYA 2BUCA 5BUSA 4R8VA 4HLNA 2VRWA 3DDWA 1N2OA 3EHEA 1MR3F 4M7OA 2H2WA 3PFWO 3GPXA 2FRDC 5J2UB 1K63A 2E89A 1KJWA 2HQSA 1QO7A 3HN6A 3M3DA 1IHOA 2VDJA 3LUHA 3RUDA 3WA7A 2NZ2A 3KM0A 2EG9A 3D0KA 5FSWA 1JB1A 3FCEA 4X9XA 4EY8A 4YX9A 4NOKA 2L4EA 2R11A 2AJBA 3IR6A 3V3KA 3C7DB 3W7BA 3FDJA 3QPVA 4BEVA 2GZMA 1WABA 2W11A 1ZJZA 1HH4A 3ESZA 3EZ6A 3B60A 4RQUA 3JRXA 5DEIA 3K7EA 3JAKA 3AI1A 4RA9B 3K9OA 1WTAA 3E6AA 3R3ZA 1SOUA 2IHVA 4TLCA 4GSKA 1EMDA 3JU3A 3LC2O 3LECA 4GITA 1XMSA 3NWPA 2M1ZA 4KITB 1THTA 3IUSA 4IOMA 1E64A 1BC5A 3R9IA 4LNUA 4QGSA 1YACA 2IIVA 4Y9DA 2K9DA 1YZQA 2PV0A 3U7EB 4XD2A 4JC8A 3ET5A 4C9BA 4MS3B 3VUFA 5CX4A 1QX3A 3ETCA 2AMLA 1XCLA 4HATA 2F1JA 3MTIA 3K1JA 2ZPUA 1NONA 4MR9B 2GZHA 3K72B 3OZTA 5DEOA 3WGMA 3EPHA 1MX5A 4BRWA 2UXCM 3P2OA 4JI6B 4M9ZA 2QS9A 1RCUA 1Q5PA 1NTRA 2HWUA 5BXYA 4GECA 5LYJF 4HDNA 3RGGA 1OC4A 4KNWA 4I81A 4DSUA 3HV0A 3T5TA 1UFQA 5CYOA 2PUEA 3K8OE 2ZAGA 5K4HA 1A9PA 3A9TA 1A96A 5H82A 4PYKA 3PEEA 5T5QA 3BMQB 1AV7A 3AG6A 3K9PA 2AGVA 1ZU4A 1XD8A 3EQ7A 4KQ1A 2DZLA 4UVGA 3OD5A 2ASVA 4ISCA 4TTSA 4UUOA 3RS8A 4LFAB 3C5WP 7AT1A 1AS3A 2FFAA 3JYOA 4LTDA 1OZHA 3DDHA 2FG7C 2PV7A 2HU8A 4IDGA 4LRUA 4RA9A 2VBGA 4CLOB 1UWCA 4AW9A 5ERXA 4UKDA 4QULA 1EK1A 3FM9A 1DRKA 4JUAA 1KEEA 1DARA 2DUJA 3DHNA 4QTXA 3I8SA 1R5LA 2YOHA 2CKMA 3ZQ6A 3EPKA 1GGMA 2G83A 4E70A 2Z7JA 1VXOA 1ZFNA 4PZLA 2Z2YA 4HYQA 1D6NA 2JFGA 5EQJB 3ZXUB 3IIKA 4HDQB 3HCNA 2X41A 3K1ZA 1FMLA 4M87A 3LSTA 3RU7A 1L4GA 1DRVA 2YHSA 3QE4A 3DA1A 5HF9A 2WTXA 2HBQA 1BS9A 4NEQA 5FFMA 1JG1A 2O8FB 4C7KA 1YB5A 2EUCA 4OW0A 2IZZA 2Q4TA 3AZOA 3E7WA 3OG9A 4IIFA 3ZVLA 4Y7DA 1KRHA 3IOEA 2ENUA 3TGLA 1EXDA 3EYWA 1D2CA 1WHTB 4K46A 4NY1A 3ROEA 4E5NA 3ABRB 1TD1A 1TA4A 2F55A 3KJXA 2ONKA 2HA4A 3KJQA 3NDJA 4DWJA 5HZMA 4EG5A 1Z2AA 3ZDRA 2XUAA 2GCNA 5D3QA 2QEQA 2IDJA 4NSRA 3C87A 3T41A 1TVKA 4F96A 4LBWA 3HKBB 2BAGA 1HFJA 4G4JA 4MARA 2DPGA 5EJ7A 1KP9A 2G80A 3PXCX 1YZ3A 4D43A 1QQWA 4RGVA 3DHVA 1Z4IA 1K8QA 5AVYA 1COZA 3HY6A 2ID7A 2M9MA 1KSHA 1T9KA 2V96A 3LUCA 1K9SA 5B64A 1NQTA 2EX4A 3PJDA 4H3KB 2R2GA 5I9NA 2REXB 5F2OA 4IO0A 3VM6A 1L7XA 2IW3A 4O4LF 4KQWA 2AQIA 5FCDA 4LYFA 3RGSA 2EJBA 2BKXA 5THQA 2OK8A 3UOGA 1DB3A 4Y2TA 3OKFA 3N8HA 3FPGA 2SICE 1XNGA 1V48A 3C15C 1ZM3A 3M9WA 3D6TB 4WNIA 2DP4E 1XRNA 3SX4A 2R44A 3D5TA 3P0IA 3TH5A 4C4XA 2A5DA 4P5DA 3CIOA 4FMCF 1S1CA 3LUBA 2PSJA 3DLPX 1LFAA 3BBPA 3PUWA 3VNQA 1UP6A 2GCOA 1WU7A 5FEUA 3D2AA 4MQ6A 4DC1A 1UFVA 2FGJA 4C4YA 4FCWA 3PC4A 1E7QA 2AE2A 3HXKA 4RY8A 3IAXA 3P0JA 3OU6A 2P5TB 5GKNA 1T4CB 3C98A 5ALJA 1MIOB 2YJ3A 4B4WA 3OOYA 1U9IC 3Q6MA 4KEAA 3UK7A 3WMRA 2E85A 3SE0A 4DMFA 2DLCX 1Y7LA 1E2BA 4LGCA 3USZA 2FZVA 2VYCA 2RFLA 1H6CA 3RSQA 2XFSA 3CGGA 1Y33E 1BOFA 4IOLA 4IZHA 1KEZA 1YU6A 4MVYA 4YJFA 3W04A 2EF0A 4HLUC 4MRNA 3QLUC 2H4FA 4K9KA 4X65M 4IZ6A 3RSFA 1P29A 5GY7A 2WPDA 1TTPB 4Q12A 3DTYA 4NU0A 4QU5A 3FH0A 4LVUA 2UV8A 4HUJA 1W2WB 3N70A 4ZCTA 5JWOA 1BE0A 2WA1A 1IIBA 4Y8VA 1GP2A 1M2GA 5K9ZA 3DMNA 1IBMB 1I51A 1IG0A 3JQFC 4I4NA 2Z5FA 5FT9A 1ECCA 5JD4A 1RHQA 1EFRA 1NJ2A 3A1FA 2ALJA 2VDBB 3T7RA 4FDVA 3KO8A 1RRKA 4NF2A 2PGLA 3AJ9A 2GBGA 1EP2B 4FONA 3VMFA 2QN3A 4BEBA 4EJ0A 3K30A 2DHYA 4HMPA 1Q6ZA 3TNLA 5CPFA 4DMLA 5JZSA 3CKYA 3P4YA 2O6LA 4MVJE 1BD3A 1DELA 3PX7A 3D4BA 4KFUA 4D42A 2Q0XA