4B3RM

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3rM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3rM02
4X66M 2UU9M 3SATA 4AQYM 2UUAM 1PJJA 2OQ4A 1L1ZA 1Z59A 2UXBM 2E5LM 1Q3BA 1N34M 4NXMM 1HNXM 4DR4M 2XZUA 1MU5A 2F5SA 4JI4M 4NRWA 3VK8A 4GKJM 1N32M 1K3XA 3JR5A 5IT9S 1Q3CA 3GQ5A 3GP1A 3U6SA 3TWKA 5ITRA 5ITQA 1K82A 1IBMM 4LF5M 4G4QA 4X62M 4DR6M 2UXCM 4PCZA 1I94M 4GKKM 1Z5CA 5ITXA 4DR1M 4DV1M 4DV4M 3J81S 3J7AS 2ZM6M 3GQ3A 4G4OA 4DR3M 3J80S 1N33M 3U6OA 1EE8A 2F5NA 4JV5M 4DV7M 1L2BA 1Z5BA 4DV5M 1R2YA 4JYAM 4X65M 4DV6M 1XMOM 1N36M 4OX9M 1IBKM 4G4NA 1Q39A 4JI1M 5FLXS 2ZBKB 3OTOM 1J5EM 4DV0M 1XNQM 3GO8A 5ITTA 2Q2EB 4LFBM 4PDIA 2UXDM 1Z5AA 2HKJA 3T1YM 4LF9M 2XZFA 4G4RA 4CISA 1FJGM 4DV3M 3U6MA 1MX0A 3T1HM 2HHHM 4LF8M 1KFVA 1L2CA 1HR0M 4NXNM 4JI3M 2UUBM 4LFCM 3A42A 3C58A 1R2ZA 4YHHM 3SAUA 5ITYA 3A46A 1L1TA 3U6LA 4MB7A 3DOAA 1L2DA 4PDGA 2F5OA 3GPXA 4JI5M 3JR4A 3U6CA 4JI7M 4DR7M 5BR8M 4B3TM 3GPYA 1HNWM 3VK7A 4DUZM 2OPFA 4ITQA 2VQFM 3U6QA 4JI8M 4LF6M 2F5PA 4DR5M 1XC8A 3SASA 4LF4M 1TDHA 1XMQM 4JI0M 1TDZA 4B3RM 4LFAM 3GQ4A 4DUYM 4X64M 5LMNM 2VQEM 4K0KM 2F4VM 2F5QA 4JI6M 3JAMS 3U6DA 4B3MM 3GPPA 3TWMA 1HNZM 4YY3M 3TWLA 3GPUA 2UUCM 1NNJA 3U6EA 3SBJA 3A45A 3SAWA 4B3SM 4KHPM 5ITXE 5ITUA 2EA0A 4PD2A 4DV2M 3W0FA 5LMUM 1PM5A 4NRVA 4DR2M 1IBLM 3U6PA 1PJIA 1K3WA 3SARA 4LF7M 3SAVA 5IWAM 1XNRM 4JI2M 5A2QS
chains in the Genus database with same CATH superfamily
2EKKA 3W67A 2D7GA 1E32A 2P5TA 4QOZC 2OQ4A 1Z59A 2K0BX 3VDPA 2XZUA 1MU5A 1KYIA 1NNUC 2F5SA 1VDDA 1XXHB 4GKJM 3WHKA 5IT9S 2KRKA 5FTKA 4BB9A 1OIZA 1EFUB 1VDLA 2QHOB 2O01F 5DYIA 5ITQA 3SMPA 1V92A 3FE3A 1L8QA 2K6BA 2KXEA 5KQDA 1K82A 1QUTA 1IBMM 1IXZA 1OJLA 3R9XB 4RNAA 2FH0A 4QHSA 2UXCM 1QDTA 4PCZA 1JB0F 3KSJA 1YSYA 3U5ZB 4D80A 4DR1M 4II7A 2JA2A 3CGWA 2WSFF 1HT2E 1QVRA 3UZUA 1LTMA 1J7KA 3MHVC 4HLQA 1L2BA 1R2YA 4JYAM 1XMOM 2R18A 1VEJA 1S3SA 3ZH9B 3VFDA 1Q39A 3AJIB 1DGBA 3NBXX 2ZBKB 4IBFA 2H1RA 4P17A 3OTOM 1IN4A 1HQYE 5FTJA 2N35A 4EIWA 4MGYE 1NHWC 1Q02A 2DKLA 3D8BA 3I01M 4Z8XA 4PDIA 3FUWA 2MROB 3T15A 4IBDA 4LF9M 2FE8A 5C18A 4HL4A 3I4VA 3H4MA 4IBCA 1T3TA 4CGYB 1WHCA 1MX0A 3BOSA 3TPZA 4I81A 5KQ8A 1HR0M 1IQPA 3I4YA 5IREB 2OOBA 2KNZA 2QQ8A 2XFTA 2KW0A 2L4EA 3KOWE 3HJ8A 3SAUA 5ITYA 2BWEA 1L1TA 1NJFA 1WXQA 1ZV1A 3DOAA 4B7GA 4M9SA 2JUJA 3TL4X 2CHVA 1D0MA 3FKEA 1L2DA 3GLFB 3FUUA 3JR4A 7CATA 2YQZA 4M9XA 4XK8F 4D82A 4B3TM 4HEOA 3SC3A 2JWSA 2VDBB 2JY5A 4MGZE 4W5WA 1IXSA 1BVSA 3KS4A 4GH9A 4GITA 4LCBA 4DBGB 3FTFA 3AL0C 3L25A 3AV0A 1OKSA 3D8LA 4AW4A 3B7QA 2QCUA 2EUCA 4RF1A 2R44A 1SXJD 2DAMA 4GIPA 1P3QQ 3U6DA 3KFUG 2B3TA 1EIJA 3FUTA 1MN3A 4FWDA 1NNJA 4FWHA 2KRUA 3SMSA 3IECA 3K9PA 1IFYA 2V6ZM 1TH3A 4B3SM 2BJVA 2ZANA 5ITXE 1DGFA 4DV2M 3W0FA 5LMUM 3LMMA 1PJIA 1GL6A 2LVOC 3SARA 4LF7M 2D7HA 2Z4SA 2K47A 3KS8A 1IN5A 3VKGA 2L6OA 2J5YA 5IWAM 1XNRM 4AZFA 1WGLA 4IBJA 2GQFA 2C9CA 2G8LA 5A2QS 3GLFE 2JZ1A 2O25A 3IG8A 4WP2A 3U60B 1IY0A 1ZMWA 3HWSA 3SATA 2LBCA 3AOEC 4R7GA 3QWLA 1PJJA 5EXPA 5L8RF 3SFZA 1TGUA 2CUZA 2G5GX 4I5SA 4R71A 4LY6A 5EXTA 1D2NA 4JI4M 1N32M 4GC5A 1TF0B 2R65A 2DZNB 1QAOA 3B89A 1K3XA 5JI2E 1AUAA 1SXJB 3HHWA 3FUVA 3FUXA 3K9OA 3GP1A 3U6SA 1R7RA 3GLGE 2XSZA 4L6V6 5ITRA 1R5LA 2A5YB 2KA6B 1SG9A 1HJPA 4LF5M 3QAUA 4LRTA 5EQTA 1A5TA 1OFIA 3GLGA 4LG2A 1I94M 4GKKM 3HU3A 2AHMA 2LXEA 4BLCA 2Y0QA 4TUWA 2R0IA 4DV1M 2ERCA 1OAOC 1TR8A 2JXNA 3PVSA 4B08A 2DAKA 3K2LA 3V76A 5H37D 3U6OA 4JV5M 2ZTDA 3FTCA 2H5XA 3L2AA 4DV7M 5EP2A 1T43A 3K92A 4WW0A 2DWZB 3FTDA 1N36M 2MH8A 3HHZA 4Y28F 4G4NA 2QSFX 1PJQA 2CV0A 3KXEC 3GRVA 5FLXS 2R46A 4GHAA 4NL4H 1CUKA 4LJ8A 2WSEF 3E46A 3UMMA 2CEAA 2DHRA 3PFIA 3U61B 2YNMD 4FCTA 2WZJA 1GO5A 3SYLA 2MGWA 3T1YM 3HY5A 4M0WA 1XB2B 1GKIA 1J09A 1SXJE 3GLIB 4DV3M 4JXJA 1UFZA 3U6MA 1DGHA 5F3WA 3SHGB 2FS1A 1OQYA 2KNVA 4NXNM 1YUBA 4JI3M 4FCWA 3C58A 4L15A 1QZEA 2JY7A 2KNAA 3C3DA 1G71A 3B7NA 3HZJA 1QZMA 2DVWB 2CP8A 3B74A 4G3OA 3MJ5A 2J7OA 3HJQA 1N78A 2DWLA 4FW9A 5E6JA 4DR7M 3AOEA 2Z3XA 1ZMUA 3GPYA 2OPFA 5E26A 2YFQA 4ITQA 2VQFM 3U6QA 3K8ZA 3RGPA 4JI8M 1IN8A 4DR5M 2D7EA 1TDHA 1XXHE 1XMQM 2LVAA 2OOAA 3A98B 4I4LA 2Y21A 4JI0M 1TH2A 1RU3A 5EXSA 4B7HA 2HL7A 2LWXA 1IXRC 4RKUF 4L8RC 4DUYM 3NBIA 4X64M 4IJFA 4K0KM 1XXHA 2DZOB 2JNHA 1NSFA 2LHGA 2I7NA 3PNYA 4Z6YA 3C3EA 4AG6A 2DWMA 3Q8XA 4JI6M 4LJAA 3KP0E 2XGNA 2UUCM 3EIEA 4PT5A 2RRUA 3TQSA 3M7GA 3GPUA 2QBYB 3SBJA 2L7HA 3A45A 2LNHC 4UN2B 5KO3A 3KOYE 2RGOA 3BXWA 4Q7JA 3U5ZA 1PM5A 2DI0A 2ZTCA 1IBLM 3ZC7B 4A3VB 3U6PA 4KODA 1K3WA 3THGA 3UJNA 2NQ8C 4NSOB 4CIZA 1GABA 4R3DA 5DYGA 4KLNA 1GL7A 1XHBA 3KDSE 1GJSA 1D0KA 1NV8A 4LGYA 2QENA 4X66M 2JY6B 3L29A 1HQCA 4FCVA 4AQYM 1W5SA 4IBEA 2Y20A 3LVVA 2UUAM 1E9SA 2EO2A 4G6ZA 4JN6A 2KDLA 1L1ZA 4MGHA 2UXBM 2E5LM 1ORYB 4NXMM 4DR4M 1PJTA 3LCUA 2XEPA 3UGJA 1PRBA 2L09A 3EIHA 3VK8A 4NRWA 2VIIA 4OVZB 3JR5A 1Q3CA 3LW5F 3GQ5A 1LV7A 5FSWA 3IHPA 1G41A 2M5ZA 3TWKA 8CATA 1IY2A 1N77A 2EJSA 1SXJC 1JR3D 4IBBA 2KZUA 1DO0A 3GRRA 3HU2A 3HX3A 3PNVA 4S12A 4X62M 3L27A 1I4WA 2DXIA 2KHHA 4DR6M 3HKPA 4GRIA 2L4FA 4M9ZA 4B7FA 1X37A 4P16A 1UM8A 1Z5CA 5EXXA 2C9OA 2C99A 2CRUA 2DAEA 5ITXA 3HHXA 2DAGA 1IM2A 1Z6TA 4GHLA 2CV1A 3J7AS 2ZM6M 3MMPA 2CHQA 3T6PA 4L16A 4DR3M 2QBYA 2V1UA 3J80S 4AG5A 1EE8A 2F5NA 1G59A 1R4GA 3GLFA 3FTEA 1Z5BA 4X65M 4DV6M 4OX9M 1IBKM 1ZMVA 3AKZA 5GKNA 1OFHA 3CF6E 5KPTA 1R6BX 2DENA 1XNQM 2R4JA 5FTNA 4FD2A 1DV0A 4LFBM 2UXDM 1E9RA 1QAQA 3VKHA 1HT1E 2HKJA 3NWLA 1QUSA 2RKOA 1QAMA 2XZFA 2CV2A 1VQ1A 2CE7A 3GLHB 1IN7A 1NY5A 1FJGM 3T1HM 1YLAA 2KEBA 3RE8A 2HHHM 2HWJA 3M0EA 4LF8M 2LTUA 2J7NA 3DFZA 1PGYA 2WSCF 3CF0A 3DZDA 3I51A 5FTMA 3SHFA 3HJSA 1IY1A 1AIPC 1NJGA 1G4AE 5IZ7D 1ZQ9A 4LFCM 4XGIA 3A46A 3U6LA 4MB7A 3IG5A 1QYRA 3VDUA 3LQRA 1QQWA 2DZLA 3GPXA 3U6CA 5EP3A 2YR0A 1G3IA 4QNRA 3ZQJA 3KOXE 5DFLA 3W68A 1GLNA 5DNYA 3U60A 4LF6M 2F5PA 1XC8A 2W82A 3SASA 4LF4M 4GC9A 4IBGA 4D81A 4NC6A 4IBKA 3F92A 4KO8A 2R6FA 1NV9A 2CFOA 2X8AA 2QZ4A 3CF2A 2F4VM 1WIVA 2LH0A 1TH4A 2F5QA 1NO1A 4NSRA 1SXJA 2QP9X 2Z8YM 4LRSA 1JR3E 3GLHE 4LZJA 4QHTA 3JAMS 3KOZE 2C96A 1T6OA 1KSFX 4F2LA 3GPPA 3TWLA 2ZAMA 1GJTA 4LJ7A 1VEGA 3SAWA 1JR3A 2EA0A 3GLHA 3GRYA 1PJSA 2FNAA 4L78A 3FYDA 4ANRA 4PD2A 4NRVA 5ITUA 4DR2M 3SYKA 1WR1B 3J7BA 3KVWA 4CJ6A 2ZAOA 4I8OA 4LJ6A 3CTWB 5KPRA 1N75A 3RFWA 4GEWA 2UU9M 4QNMA 3TE6A 3WHLA 2C5RA 2LVQD 2JP7A 4RF0A 2X49A 1IXSB 4REZA 4LJ9A 1Q3BA 1N34M 3QYEA 4IBIA 1HNXM 3BBZA 1JQJC 3LCVB 4BBAA 1C1KA 3FYCA 2QNJA 2CWBA 3GLIE 3U61A 3J27B 3RGSA 4AKHA 1YE9A 2FOIC 4IIWA 1V33A 4AKGA 2XSZD 3GLIA 4LGMA 2R45A 4G4QA 1G8PA 3KSXA 2QPAA 1GVNA 2MR9A 2V1CA 2DHYA 3FRHA 4KT0F 2M60A 4MM3B 2GNOA 3MK6A 1VG5A 1Y8GA 4DV4M 2BWBA 2CHGA 2VF8A 3J81S 2DAIA 3GQ3A 4G4OA 2KZSA 3L28A 4F1IA 2HAKA 1N33M 2DWNA 3FD9A 1FNNA 3HHYA 3W0LB 2BJWA 4DV5M 2VF7A 4FVMA 1W5TA 3K1JA 1IN6A 4JI1M 1MJGM 1OAIA 4IJEA 3LQQA 3DA1A 1J5EM 5BPVA 4DV0M 5JI3E 4MGIE 3GO8A 1NHGC 1OIPA 1TTEA 5ITTA 2Q2EB 1WJ7A 1Z5AA 1D0LA 2Z7JA 3ILKA 3H4JA 2R4EA 4OU7A 1H6UA 1NVMA 4XBOA 4G4RA 4CISA 2FFJA 2R62A 2XH9A 4ZPXA 1OTRA 1KFVA 1L2CA 2DNAA 2XLJA 3GLGB 3M6AA 1WGNA 2UUBM 3A42A 2LVNC 1R2ZA 4YHHM 3QYBA 3LVWA 2O5RA 1E94E 1DO2A 4LZZA 3UK6A 3E4RA 5FTLA 2BNKA 3AOGA 3J2PB 3PXGA 4AKIA 3I04M 2L2DA 2HCBA 3C9PA 3HU1A 3KW6A 4PDGA 2F5OA 4JI5M 1F4IA 1NY6A 2G3QA 3Q8GA 4JI7M 2XF3A 2JY8A 1QANA 4GMQA 5EP4A 5BR8M 3VK7A 4DUZM 1HNWM 2JZ0A 3FRIA 4M0DA 4FWGA 3T38A 4NOOB 1ZAEA 4CHTB 3L26A 2Z4RA 4AI6A 1TDZA 3GRUA 4B3RM 4LFAM 3GQ4A 3AFHA 4LJ4A 4MGKE 5EJCA 3B7ZA 5LMNM 2VQEM 2LHCA 4WURA 1VEKA 4QOSA 3VLFB 1XWIA 4OVZA 2EKFA 2RGHA 2MJ5B 3B9PA 1DGHB 4MH0E 2XFSA 4B3MM 2OO9A 3E9SA 4L4UA 3KP1E 3TWMA 3HGIA 4YY3M 1HNZM 1C7YA 3U6EA 2C98A 2K9DA 5EP1A 2I7PA 2L7IA 3E21A 4KHPM 4OW0A 2Y0TA 1V34A 3R8FA 4LJ5A 3ZCBB 5C1BA 1DGGA 3SAVA 2X4AA 5KPZA 1QDRA 2APLA 4JI2M 2LVPC
chains in the Genus database with same CATH topology
2D7GA 1E32A 2P5TA 4QOZC 2OQ4A 1Z59A 3VDPA 2XZUA 1MU5A 1KYIA 1NNUC 2F5SA 1VDDA 1XXHB 4GKJM 3WHKA 5IT9S 2KRKA 5FTKA 4BB9A 5DYIA 5ITQA 3SMPA 1L8QA 2KXEA 5KQDA 1K82A 1IBMM 1IXZA 1OJLA 3R9XB 4RNAA 4QHSA 2UXCM 4PCZA 3KSJA 1YSYA 3U5ZB 4D80A 4DR1M 4II7A 2JA2A 1HT2E 1QVRA 3UZUA 4HLQA 1J7KA 3MHVC 1L2BA 1R2YA 4JYAM 1XMOM 2R18A 1S3SA 3ZH9B 3VFDA 1Q39A 3AJIB 1DGBA 2ZBKB 4IBFA 2H1RA 3OTOM 1IN4A 1HQYE 5FTJA 4EIWA 4MGYE 1NHWC 3D8BA 4PDIA 4Z8XA 3FUWA 3T15A 4LF9M 4IBDA 2FE8A 5C18A 4HL4A 3I4VA 3H4MA 4IBCA 1T3TA 4CGYB 1MX0A 3BOSA 3TPZA 4I81A 5KQ8A 1HR0M 1IQPA 3I4YA 5IREB 2XFTA 2KW0A 3KOWE 3HJ8A 3SAUA 5ITYA 1L1TA 1NJFA 1WXQA 3DOAA 4B7GA 4M9SA 3TL4X 2CHVA 3FKEA 1L2DA 3GLFB 3FUUA 3JR4A 7CATA 2YQZA 4M9XA 4D82A 4B3TM 3SC3A 4MGZE 4W5WA 3FTFA 3KS4A 4LCBA 4GH9A 4GITA 3AL0C 3L25A 3AV0A 3D8LA 4AW4A 2QCUA 2EUCA 4RF1A 1SXJD 4GIPA 3U6DA 3KFUG 3FUTA 4FWDA 1NNJA 4FWHA 2KRUA 3SMSA 2V6ZM 1TH3A 4B3SM 2BJVA 2ZANA 5ITXE 1DGFA 4DV2M 3W0FA 5LMUM 3LMMA 1PJIA 1GL6A 3SARA 4LF7M 2D7HA 2Z4SA 2K47A 3KS8A 1IN5A 3VKGA 2L6OA 5IWAM 1XNRM 4AZFA 4IBJA 2C9CA 2G8LA 5A2QS 3IG8A 3U60B 3SATA 1IY0A 3HWSA 3AOEC 4R7GA 3QWLA 1PJJA 5EXPA 3SFZA 1TGUA 2CUZA 2G5GX 4I5SA 4LY6A 5EXTA 1D2NA 4JI4M 1N32M 4GC5A 1K3XA 2R65A 2DZNB 1QAOA 5JI2E 1SXJB 3HHWA 3FUVA 3FUXA 3GP1A 3U6SA 1R7RA 2XSZA 5ITRA 2A5YB 2KA6B 4LF5M 3QAUA 4LRTA 5EQTA 1OFIA 3GLGA 4LG2A 1I94M 4GKKM 3HU3A 2AHMA 2LXEA 4BLCA 2Y0QA 4TUWA 4DV1M 2ERCA 3PVSA 4B08A 3K2LA 5H37D 3U6OA 4JV5M 3FTCA 3L2AA 4DV7M 5EP2A 3K92A 4WW0A 2DWZB 3FTDA 1N36M 3HHZA 4G4NA 2CV0A 3KXEC 3GRVA 5FLXS 2R46A 4GHAA 4NL4H 4LJ8A 3UMMA 2CEAA 2DHRA 3PFIA 3U61B 2YNMD 4FCTA 3SYLA 3T1YM 4M0WA 1GKIA 1J09A 1SXJE 3GLIB 4DV3M 4JXJA 3U6MA 1DGHA 5F3WA 3SHGB 4NXNM 1YUBA 4JI3M 4FCWA 3C58A 4L15A 1QZMA 2DVWB 3MJ5A 2J7OA 3HJQA 1N78A 2DWLA 4FW9A 5E6JA 4DR7M 3AOEA 2Z3XA 3GPYA 2OPFA 5E26A 2YFQA 4ITQA 2VQFM 3U6QA 3K8ZA 3RGPA 4JI8M 1IN8A 4DR5M 2D7EA 1TDHA 1XMQM 4JI0M 3A98B 4I4LA 5FTLA 2Y21A 1TH2A 5EXSA 4B7HA 2HL7A 2LWXA 1IXRC 4L8RC 4DUYM 3NBIA 4X64M 4IJFA 4K0KM 1XXHA 2DZOB 1NSFA 4Z6YA 2I7NA 3PNYA 4AG6A 2DWMA 3Q8XA 4JI6M 4LJAA 3KP0E 2XGNA 2UUCM 3EIEA 4PT5A 3TQSA 3GPUA 3M7GA 2QBYB 3SBJA 2L7HA 3A45A 2LNHC 5KO3A 3KOYE 2RGOA 3U5ZA 1PM5A 1IBLM 3ZC7B 4A3VB 3U6PA 4KODA 1K3WA 3THGA 3UJNA 2NQ8C 4NSOB 4R3DA 5DYGA 4KLNA 1GL7A 1XHBA 3KDSE 4LGYA 2QENA 4X66M 3L29A 1HQCA 4FCVA 4AQYM 1W5SA 4IBEA 2Y20A 3LVVA 2UUAM 1E9SA 2EO2A 4G6ZA 4JN6A 1L1ZA 2UXBM 4MGHA 2E5LM 1ORYB 4NXMM 4DR4M 2XEPA 3UGJA 4NRWA 2L09A 3EIHA 3VK8A 2VIIA 4OVZB 3JR5A 1Q3CA 3GQ5A 1LV7A 5FSWA 1G41A 2M5ZA 3TWKA 8CATA 1IY2A 1N77A 4IBBA 1SXJC 1JR3D 2KZUA 1DO0A 3GRRA 3HU2A 3PNVA 4S12A 2DXIA 4X62M 3L27A 1I4WA 4DR6M 3HKPA 4GRIA 4M9ZA 4B7FA 1X37A 4P16A 1UM8A 1Z5CA 5EXXA 2C9OA 2C99A 5ITXA 4GHLA 3HHXA 1IM2A 1Z6TA 2CV1A 3J7AS 2ZM6M 2CHQA 4L16A 4DR3M 2QBYA 2V1UA 3J80S 4AG5A 1EE8A 2F5NA 1G59A 3GLFA 3FTEA 1Z5BA 4X65M 4DV6M 4OX9M 1IBKM 3AKZA 5GKNA 1OFHA 3CF6E 5KPTA 1R6BX 1XNQM 2R4JA 5FTNA 4FD2A 4LFBM 2UXDM 1E9RA 1QAQA 3VKHA 1HT1E 2HKJA 3NWLA 2RKOA 1QAMA 2XZFA 2CV2A 3GLHB 2CE7A 1IN7A 1NY5A 1FJGM 3T1HM 2KEBA 3RE8A 2HHHM 3M0EA 4LF8M 2J7NA 3DFZA 3DZDA 3CF0A 3I51A 5FTMA 3SHFA 3HJSA 1IY1A 5IZ7D 1NJGA 1G4AE 4LFCM 1ZQ9A 4XGIA 3A46A 3U6LA 4MB7A 3IG5A 1QYRA 3VDUA 3LQRA 1QQWA 3GPXA 3U6CA 5EP3A 2YR0A 1G3IA 4QNRA 3KOXE 1GLNA 5DNYA 3U60A 4LF6M 2F5PA 1XC8A 2W82A 3SASA 4LF4M 4GC9A 4IBGA 4D81A 4IBKA 4KO8A 2CFOA 2X8AA 2QZ4A 3CF2A 2F4VM 2LH0A 1TH4A 2F5QA 4NSRA 1SXJA 2QP9X 4LRSA 4LZJA 4QHTA 3JAMS 3KOZE 2C96A 3GPPA 1KSFX 3TWLA 2ZAMA 4LJ7A 3SAWA 1JR3A 3GLHA 3GRYA 2FNAA 4L78A 4PD2A 3FYDA 5ITUA 2EA0A 4NRVA 4DR2M 3SYKA 3J7BA 3KVWA 2ZAOA 4I8OA 4LJ6A 3CTWB 5KPRA 1N75A 3RFWA 2UU9M 4QNMA 3TE6A 3WHLA 2C5RA 4RF0A 2X49A 1IXSB 4REZA 4LJ9A 1Q3BA 1N34M 4IBIA 1HNXM 1JQJC 4BBAA 1C1KA 3FYCA 3U61A 3J27B 3RGSA 4AKHA 1YE9A 2FOIC 4IIWA 4AKGA 2XSZD 3GLIA 4LGMA 2R45A 4G4QA 1G8PA 3KSXA 2QPAA 1GVNA 2V1CA 2M60A 4MM3B 3MK6A 4DV4M 3J81S 2CHGA 3GQ3A 4G4OA 2KZSA 3L28A 1N33M 2DWNA 3FD9A 1FNNA 3HHYA 3W0LB 2BJWA 4DV5M 4FVMA 1W5TA 3K1JA 1IN6A 4JI1M 4IJEA 3LQQA 3DA1A 1J5EM 5BPVA 4DV0M 5JI3E 4MGIE 3GO8A 1NHGC 5ITTA 2Q2EB 1Z5AA 2Z7JA 3ILKA 2R4EA 4OU7A 1H6UA 1NVMA 4XBOA 4G4RA 4CISA 2FFJA 2R62A 2XH9A 4ZPXA 1KFVA 1L2CA 2XLJA 3GLGB 3M6AA 2UUBM 3A42A 1R2ZA 4YHHM 3LVWA 2O5RA 1E94E 1DO2A 4LZZA 3UK6A 3E4RA 2BNKA 3AOGA 3J2PB 3PXGA 4AKIA 3HU1A 2HCBA 4PDGA 2F5OA 3KW6A 4JI5M 1NY6A 4JI7M 2XF3A 4GMQA 1QANA 5EP4A 5BR8M 1HNWM 3VK7A 4DUZM 4M0DA 4FWGA 3T38A 4NOOB 1ZAEA 4CHTB 3L26A 2Z4RA 4AI6A 1TDZA 3GRUA 4B3RM 4LFAM 3GQ4A 3AFHA 4LJ4A 4MGKE 5EJCA 5LMNM 2VQEM 4WURA 4QOSA 3VLFB 1XWIA 4OVZA 2RGHA 3B9PA 1DGHB 4MH0E 2XFSA 4B3MM 3E9SA 4L4UA 3TWMA 3KP1E 1HNZM 3HGIA 4YY3M 3U6EA 2C98A 5EP1A 2I7PA 2L7IA 4KHPM 4OW0A 2Y0TA 3R8FA 4LJ5A 3ZCBB 5C1BA 1DGGA 3SAVA 2X4AA 5KPZA 4JI2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 M;  2UU9 M;  3SAT A;  4AQY M;  2UUA M;  1PJJ A;  2OQ4 A;  1L1Z A;  1Z59 A;  2UXB M;  2E5L M;  1Q3B A;  1N34 M;  4NXM M;  1HNX M;  4DR4 M;  2XZU A;  1MU5 A;  2F5S A;  4JI4 M;  4NRW A;  3VK8 A;  4GKJ M;  1N32 M;  1K3X A;  3JR5 A;  5IT9 S;  1Q3C A;  3GQ5 A;  3GP1 A;  3U6S A;  3TWK A;  5ITR A;  5ITQ A;  1K82 A;  1IBM M;  4LF5 M;  4G4Q A;  4X62 M;  4DR6 M;  2UXC M;  4PCZ A;  1I94 M;  4GKK M;  1Z5C A;  5ITX A;  4DR1 M;  4DV1 M;  4DV4 M;  3J81 S;  3J7A S;  2ZM6 M;  3GQ3 A;  4G4O A;  4DR3 M;  3J80 S;  1N33 M;  3U6O A;  1EE8 A;  2F5N A;  4JV5 M;  4DV7 M;  1L2B A;  1Z5B A;  4DV5 M;  1R2Y A;  4JYA M;  4X65 M;  4DV6 M;  1XMO M;  1N36 M;  4OX9 M;  1IBK M;  4G4N A;  1Q39 A;  4JI1 M;  5FLX S;  2ZBK B;  3OTO M;  1J5E M;  4DV0 M;  1XNQ M;  3GO8 A;  5ITT A;  2Q2E B;  4LFB M;  4PDI A;  2UXD M;  1Z5A A;  2HKJ A;  3T1Y M;  4LF9 M;  2XZF A;  4G4R A;  4CIS A;  1FJG M;  4DV3 M;  3U6M A;  1MX0 A;  3T1H M;  2HHH M;  4LF8 M;  1KFV A;  1L2C A;  1HR0 M;  4NXN M;  4JI3 M;  2UUB M;  4LFC M;  3A42 A;  3C58 A;  1R2Z A;  4YHH M;  3SAU A;  5ITY A;  3A46 A;  1L1T A;  3U6L A;  4MB7 A;  3DOA A;  1L2D A;  4PDG A;  2F5O A;  3GPX A;  4JI5 M;  3JR4 A;  3U6C A;  4JI7 M;  4DR7 M;  5BR8 M;  4B3T M;  3GPY A;  1HNW M;  3VK7 A;  4DUZ M;  2OPF A;  4ITQ A;  2VQF M;  3U6Q A;  4JI8 M;  4LF6 M;  2F5P A;  4DR5 M;  1XC8 A;  3SAS A;  4LF4 M;  1TDH A;  1XMQ M;  4JI0 M;  1TDZ A;  4B3R M;  4LFA M;  3GQ4 A;  4DUY M;  4X64 M;  5LMN M;  2VQE M;  4K0K M;  2F4V M;  2F5Q A;  4JI6 M;  3JAM S;  3U6D A;  4B3M M;  3GPP A;  3TWM A;  1HNZ M;  4YY3 M;  3TWL A;  3GPU A;  2UUC M;  1NNJ A;  3U6E A;  3SBJ A;  3A45 A;  3SAW A;  4B3S M;  4KHP M;  5ITX E;  5ITU A;  2EA0 A;  4PD2 A;  4DV2 M;  3W0F A;  5LMU M;  1PM5 A;  4NRV A;  4DR2 M;  1IBL M;  3U6P A;  1PJI A;  1K3W A;  3SAR A;  4LF7 M;  3SAV A;  5IWA M;  1XNR M;  4JI2 M;  5A2Q S; 
#chains in the Genus database with same CATH topology
 2EKK A;  3W67 A;  2D7G A;  1E32 A;  2P5T A;  4QOZ C;  2OQ4 A;  1Z59 A;  2K0B X;  3VDP A;  2XZU A;  1MU5 A;  1KYI A;  1NNU C;  2F5S A;  1VDD A;  1XXH B;  4GKJ M;  3WHK A;  5IT9 S;  2KRK A;  5FTK A;  4BB9 A;  1OIZ A;  1EFU B;  1VDL A;  2QHO B;  2O01 F;  5DYI A;  5ITQ A;  3SMP A;  1V92 A;  3FE3 A;  1L8Q A;  2K6B A;  2KXE A;  5KQD A;  1K82 A;  1QUT A;  1IBM M;  1IXZ A;  1OJL A;  3R9X B;  4RNA A;  2FH0 A;  4QHS A;  2UXC M;  1QDT A;  4PCZ A;  1JB0 F;  3KSJ A;  1YSY A;  3U5Z B;  4D80 A;  4DR1 M;  4II7 A;  2JA2 A;  3CGW A;  2WSF F;  1HT2 E;  1QVR A;  3UZU A;  1LTM A;  1J7K A;  3MHV C;  4HLQ A;  1L2B A;  1R2Y A;  4JYA M;  1XMO M;  2R18 A;  1VEJ A;  1S3S A;  3ZH9 B;  3VFD A;  1Q39 A;  3AJI B;  1DGB A;  3NBX X;  2ZBK B;  4IBF A;  2H1R A;  4P17 A;  3OTO M;  1IN4 A;  1HQY E;  5FTJ A;  2N35 A;  4EIW A;  4MGY E;  1NHW C;  1Q02 A;  2DKL A;  3D8B A;  3I01 M;  4Z8X A;  4PDI A;  3FUW A;  2MRO B;  3T15 A;  4IBD A;  4LF9 M;  2FE8 A;  5C18 A;  4HL4 A;  3I4V A;  3H4M A;  4IBC A;  1T3T A;  4CGY B;  1WHC A;  1MX0 A;  3BOS A;  3TPZ A;  4I81 A;  5KQ8 A;  1HR0 M;  1IQP A;  3I4Y A;  5IRE B;  2OOB A;  2KNZ A;  2QQ8 A;  2XFT A;  2KW0 A;  2L4E A;  3KOW E;  3HJ8 A;  3SAU A;  5ITY A;  2BWE A;  1L1T A;  1NJF A;  1WXQ A;  1ZV1 A;  3DOA A;  4B7G A;  4M9S A;  2JUJ A;  3TL4 X;  2CHV A;  1D0M A;  3FKE A;  1L2D A;  3GLF B;  3FUU A;  3JR4 A;  7CAT A;  2YQZ A;  4M9X A;  4XK8 F;  4D82 A;  4B3T M;  4HEO A;  3SC3 A;  2JWS A;  2VDB B;  2JY5 A;  4MGZ E;  4W5W A;  1IXS A;  1BVS A;  3KS4 A;  4GH9 A;  4GIT A;  4LCB A;  4DBG B;  3FTF A;  3AL0 C;  3L25 A;  3AV0 A;  1OKS A;  3D8L A;  4AW4 A;  3B7Q A;  2QCU A;  2EUC A;  4RF1 A;  2R44 A;  1SXJ D;  2DAM A;  4GIP A;  1P3Q Q;  3U6D A;  3KFU G;  2B3T A;  1EIJ A;  3FUT A;  1MN3 A;  4FWD A;  1NNJ A;  4FWH A;  2KRU A;  3SMS A;  3IEC A;  3K9P A;  1IFY A;  2V6Z M;  1TH3 A;  4B3S M;  2BJV A;  2ZAN A;  5ITX E;  1DGF A;  4DV2 M;  3W0F A;  5LMU M;  3LMM A;  1PJI A;  1GL6 A;  2LVO C;  3SAR A;  4LF7 M;  2D7H A;  2Z4S A;  2K47 A;  3KS8 A;  1IN5 A;  3VKG A;  2L6O A;  2J5Y A;  5IWA M;  1XNR M;  4AZF A;  1WGL A;  4IBJ A;  2GQF A;  2C9C A;  2G8L A;  5A2Q S;  3GLF E;  2JZ1 A;  2O25 A;  3IG8 A;  4WP2 A;  3U60 B;  1IY0 A;  1ZMW A;  3HWS A;  3SAT A;  2LBC A;  3AOE C;  4R7G A;  3QWL A;  1PJJ A;  5EXP A;  5L8R F;  3SFZ A;  1TGU A;  2CUZ A;  2G5G X;  4I5S A;  4R71 A;  4LY6 A;  5EXT A;  1D2N A;  4JI4 M;  1N32 M;  4GC5 A;  1TF0 B;  2R65 A;  2DZN B;  1QAO A;  3B89 A;  1K3X A;  5JI2 E;  1AUA A;  1SXJ B;  3HHW A;  3FUV A;  3FUX A;  3K9O A;  3GP1 A;  3U6S A;  1R7R A;  3GLG E;  2XSZ A;  4L6V 6;  5ITR A;  1R5L A;  2A5Y B;  2KA6 B;  1SG9 A;  1HJP A;  4LF5 M;  3QAU A;  4LRT A;  5EQT A;  1A5T A;  1OFI A;  3GLG A;  4LG2 A;  1I94 M;  4GKK M;  3HU3 A;  2AHM A;  2LXE A;  4BLC A;  2Y0Q A;  4TUW A;  2R0I A;  4DV1 M;  2ERC A;  1OAO C;  1TR8 A;  2JXN A;  3PVS A;  4B08 A;  2DAK A;  3K2L A;  3V76 A;  5H37 D;  3U6O A;  4JV5 M;  2ZTD A;  3FTC A;  2H5X A;  3L2A A;  4DV7 M;  5EP2 A;  1T43 A;  3K92 A;  4WW0 A;  2DWZ B;  3FTD A;  1N36 M;  2MH8 A;  3HHZ A;  4Y28 F;  4G4N A;  2QSF X;  1PJQ A;  2CV0 A;  3KXE C;  3GRV A;  5FLX S;  2R46 A;  4GHA A;  4NL4 H;  1CUK A;  4LJ8 A;  2WSE F;  3E46 A;  3UMM A;  2CEA A;  2DHR A;  3PFI A;  3U61 B;  2YNM D;  4FCT A;  2WZJ A;  1GO5 A;  3SYL A;  2MGW A;  3T1Y M;  3HY5 A;  4M0W A;  1XB2 B;  1GKI A;  1J09 A;  1SXJ E;  3GLI B;  4DV3 M;  4JXJ A;  1UFZ A;  3U6M A;  1DGH A;  5F3W A;  3SHG B;  2FS1 A;  1OQY A;  2KNV A;  4NXN M;  1YUB A;  4JI3 M;  4FCW A;  3C58 A;  4L15 A;  1QZE A;  2JY7 A;  2KNA A;  3C3D A;  1G71 A;  3B7N A;  3HZJ A;  1QZM A;  2DVW B;  2CP8 A;  3B74 A;  4G3O A;  3MJ5 A;  2J7O A;  3HJQ A;  1N78 A;  2DWL A;  4FW9 A;  5E6J A;  4DR7 M;  3AOE A;  2Z3X A;  1ZMU A;  3GPY A;  2OPF A;  5E26 A;  2YFQ A;  4ITQ A;  2VQF M;  3U6Q A;  3K8Z A;  3RGP A;  4JI8 M;  1IN8 A;  4DR5 M;  2D7E A;  1TDH A;  1XXH E;  1XMQ M;  2LVA A;  2OOA A;  3A98 B;  4I4L A;  2Y21 A;  4JI0 M;  1TH2 A;  1RU3 A;  5EXS A;  4B7H A;  2HL7 A;  2LWX A;  1IXR C;  4RKU F;  4L8R C;  4DUY M;  3NBI A;  4X64 M;  4IJF A;  4K0K M;  1XXH A;  2DZO B;  2JNH A;  1NSF A;  2LHG A;  2I7N A;  3PNY A;  4Z6Y A;  3C3E A;  4AG6 A;  2DWM A;  3Q8X A;  4JI6 M;  4LJA A;  3KP0 E;  2XGN A;  2UUC M;  3EIE A;  4PT5 A;  2RRU A;  3TQS A;  3M7G A;  3GPU A;  2QBY B;  3SBJ A;  2L7H A;  3A45 A;  2LNH C;  4UN2 B;  5KO3 A;  3KOY E;  2RGO A;  3BXW A;  4Q7J A;  3U5Z A;  1PM5 A;  2DI0 A;  2ZTC A;  1IBL M;  3ZC7 B;  4A3V B;  3U6P A;  4KOD A;  1K3W A;  3THG A;  3UJN A;  2NQ8 C;  4NSO B;  4CIZ A;  1GAB A;  4R3D A;  5DYG A;  4KLN A;  1GL7 A;  1XHB A;  3KDS E;  1GJS A;  1D0K A;  1NV8 A;  4LGY A;  2QEN A;  4X66 M;  2JY6 B;  3L29 A;  1HQC A;  4FCV A;  4AQY M;  1W5S A;  4IBE A;  2Y20 A;  3LVV A;  2UUA M;  1E9S A;  2EO2 A;  4G6Z A;  4JN6 A;  2KDL A;  1L1Z A;  4MGH A;  2UXB M;  2E5L M;  1ORY B;  4NXM M;  4DR4 M;  1PJT A;  3LCU A;  2XEP A;  3UGJ A;  1PRB A;  2L09 A;  3EIH A;  3VK8 A;  4NRW A;  2VII A;  4OVZ B;  3JR5 A;  1Q3C A;  3LW5 F;  3GQ5 A;  1LV7 A;  5FSW A;  3IHP A;  1G41 A;  2M5Z A;  3TWK A;  8CAT A;  1IY2 A;  1N77 A;  2EJS A;  1SXJ C;  1JR3 D;  4IBB A;  2KZU A;  1DO0 A;  3GRR A;  3HU2 A;  3HX3 A;  3PNV A;  4S12 A;  4X62 M;  3L27 A;  1I4W A;  2DXI A;  2KHH A;  4DR6 M;  3HKP A;  4GRI A;  2L4F A;  4M9Z A;  4B7F A;  1X37 A;  4P16 A;  1UM8 A;  1Z5C A;  5EXX A;  2C9O A;  2C99 A;  2CRU A;  2DAE A;  5ITX A;  3HHX A;  2DAG A;  1IM2 A;  1Z6T A;  4GHL A;  2CV1 A;  3J7A S;  2ZM6 M;  3MMP A;  2CHQ A;  3T6P A;  4L16 A;  4DR3 M;  2QBY A;  2V1U A;  3J80 S;  4AG5 A;  1EE8 A;  2F5N A;  1G59 A;  1R4G A;  3GLF A;  3FTE A;  1Z5B A;  4X65 M;  4DV6 M;  4OX9 M;  1IBK M;  1ZMV A;  3AKZ A;  5GKN A;  1OFH A;  3CF6 E;  5KPT A;  1R6B X;  2DEN A;  1XNQ M;  2R4J A;  5FTN A;  4FD2 A;  1DV0 A;  4LFB M;  2UXD M;  1E9R A;  1QAQ A;  3VKH A;  1HT1 E;  2HKJ A;  3NWL A;  1QUS A;  2RKO A;  1QAM A;  2XZF A;  2CV2 A;  1VQ1 A;  2CE7 A;  3GLH B;  1IN7 A;  1NY5 A;  1FJG M;  3T1H M;  1YLA A;  2KEB A;  3RE8 A;  2HHH M;  2HWJ A;  3M0E A;  4LF8 M;  2LTU A;  2J7N A;  3DFZ A;  1PGY A;  2WSC F;  3CF0 A;  3DZD A;  3I51 A;  5FTM A;  3SHF A;  3HJS A;  1IY1 A;  1AIP C;  1NJG A;  1G4A E;  5IZ7 D;  1ZQ9 A;  4LFC M;  4XGI A;  3A46 A;  3U6L A;  4MB7 A;  3IG5 A;  1QYR A;  3VDU A;  3LQR A;  1QQW A;  2DZL A;  3GPX A;  3U6C A;  5EP3 A;  2YR0 A;  1G3I A;  4QNR A;  3ZQJ A;  3KOX E;  5DFL A;  3W68 A;  1GLN A;  5DNY A;  3U60 A;  4LF6 M;  2F5P A;  1XC8 A;  2W82 A;  3SAS A;  4LF4 M;  4GC9 A;  4IBG A;  4D81 A;  4NC6 A;  4IBK A;  3F92 A;  4KO8 A;  2R6F A;  1NV9 A;  2CFO A;  2X8A A;  2QZ4 A;  3CF2 A;  2F4V M;  1WIV A;  2LH0 A;  1TH4 A;  2F5Q A;  1NO1 A;  4NSR A;  1SXJ A;  2QP9 X;  2Z8Y M;  4LRS A;  1JR3 E;  3GLH E;  4LZJ A;  4QHT A;  3JAM S;  3KOZ E;  2C96 A;  1T6O A;  1KSF X;  4F2L A;  3GPP A;  3TWL A;  2ZAM A;  1GJT A;  4LJ7 A;  1VEG A;  3SAW A;  1JR3 A;  2EA0 A;  3GLH A;  3GRY A;  1PJS A;  2FNA A;  4L78 A;  3FYD A;  4ANR A;  4PD2 A;  4NRV A;  5ITU A;  4DR2 M;  3SYK A;  1WR1 B;  3J7B A;  3KVW A;  4CJ6 A;  2ZAO A;  4I8O A;  4LJ6 A;  3CTW B;  5KPR A;  1N75 A;  3RFW A;  4GEW A;  2UU9 M;  4QNM A;  3TE6 A;  3WHL A;  2C5R A;  2LVQ D;  2JP7 A;  4RF0 A;  2X49 A;  1IXS B;  4REZ A;  4LJ9 A;  1Q3B A;  1N34 M;  3QYE A;  4IBI A;  1HNX M;  3BBZ A;  1JQJ C;  3LCV B;  4BBA A;  1C1K A;  3FYC A;  2QNJ A;  2CWB A;  3GLI E;  3U61 A;  3J27 B;  3RGS A;  4AKH A;  1YE9 A;  2FOI C;  4IIW A;  1V33 A;  4AKG A;  2XSZ D;  3GLI A;  4LGM A;  2R45 A;  4G4Q A;  1G8P A;  3KSX A;  2QPA A;  1GVN A;  2MR9 A;  2V1C A;  2DHY A;  3FRH A;  4KT0 F;  2M60 A;  4MM3 B;  2GNO A;  3MK6 A;  1VG5 A;  1Y8G A;  4DV4 M;  2BWB A;  2CHG A;  2VF8 A;  3J81 S;  2DAI A;  3GQ3 A;  4G4O A;  2KZS A;  3L28 A;  4F1I A;  2HAK A;  1N33 M;  2DWN A;  3FD9 A;  1FNN A;  3HHY A;  3W0L B;  2BJW A;  4DV5 M;  2VF7 A;  4FVM A;  1W5T A;  3K1J A;  1IN6 A;  4JI1 M;  1MJG M;  1OAI A;  4IJE A;  3LQQ A;  3DA1 A;  1J5E M;  5BPV A;  4DV0 M;  5JI3 E;  4MGI E;  3GO8 A;  1NHG C;  1OIP A;  1TTE A;  5ITT A;  2Q2E B;  1WJ7 A;  1Z5A A;  1D0L A;  2Z7J A;  3ILK A;  3H4J A;  2R4E A;  4OU7 A;  1H6U A;  1NVM A;  4XBO A;  4G4R A;  4CIS A;  2FFJ A;  2R62 A;  2XH9 A;  4ZPX A;  1OTR A;  1KFV A;  1L2C A;  2DNA A;  2XLJ A;  3GLG B;  3M6A A;  1WGN A;  2UUB M;  3A42 A;  2LVN C;  1R2Z A;  4YHH M;  3QYB A;  3LVW A;  2O5R A;  1E94 E;  1DO2 A;  4LZZ A;  3UK6 A;  3E4R A;  5FTL A;  2BNK A;  3AOG A;  3J2P B;  3PXG A;  4AKI A;  3I04 M;  2L2D A;  2HCB A;  3C9P A;  3HU1 A;  3KW6 A;  4PDG A;  2F5O A;  4JI5 M;  1F4I A;  1NY6 A;  2G3Q A;  3Q8G A;  4JI7 M;  2XF3 A;  2JY8 A;  1QAN A;  4GMQ A;  5EP4 A;  5BR8 M;  3VK7 A;  4DUZ M;  1HNW M;  2JZ0 A;  3FRI A;  4M0D A;  4FWG A;  3T38 A;  4NOO B;  1ZAE A;  4CHT B;  3L26 A;  2Z4R A;  4AI6 A;  1TDZ A;  3GRU A;  4B3R M;  4LFA M;  3GQ4 A;  3AFH A;  4LJ4 A;  4MGK E;  5EJC A;  3B7Z A;  5LMN M;  2VQE M;  2LHC A;  4WUR A;  1VEK A;  4QOS A;  3VLF B;  1XWI A;  4OVZ A;  2EKF A;  2RGH A;  2MJ5 B;  3B9P A;  1DGH B;  4MH0 E;  2XFS A;  4B3M M;  2OO9 A;  3E9S A;  4L4U A;  3KP1 E;  3TWM A;  3HGI A;  4YY3 M;  1HNZ M;  1C7Y A;  3U6E A;  2C98 A;  2K9D A;  5EP1 A;  2I7P A;  2L7I A;  3E21 A;  4KHP M;  4OW0 A;  2Y0T A;  1V34 A;  3R8F A;  4LJ5 A;  3ZCB B;  5C1B A;  1DGG A;  3SAV A;  2X4A A;  5KPZ A;  1QDR A;  2APL A;  4JI2 M;  2LVP C; 
#chains in the Genus database with same CATH homology
 2D7G A;  1E32 A;  2P5T A;  4QOZ C;  2OQ4 A;  1Z59 A;  3VDP A;  2XZU A;  1MU5 A;  1KYI A;  1NNU C;  2F5S A;  1VDD A;  1XXH B;  4GKJ M;  3WHK A;  5IT9 S;  2KRK A;  5FTK A;  4BB9 A;  5DYI A;  5ITQ A;  3SMP A;  1L8Q A;  2KXE A;  5KQD A;  1K82 A;  1IBM M;  1IXZ A;  1OJL A;  3R9X B;  4RNA A;  4QHS A;  2UXC M;  4PCZ A;  3KSJ A;  1YSY A;  3U5Z B;  4D80 A;  4DR1 M;  4II7 A;  2JA2 A;  1HT2 E;  1QVR A;  3UZU A;  4HLQ A;  1J7K A;  3MHV C;  1L2B A;  1R2Y A;  4JYA M;  1XMO M;  2R18 A;  1S3S A;  3ZH9 B;  3VFD A;  1Q39 A;  3AJI B;  1DGB A;  2ZBK B;  4IBF A;  2H1R A;  3OTO M;  1IN4 A;  1HQY E;  5FTJ A;  4EIW A;  4MGY E;  1NHW C;  3D8B A;  4PDI A;  4Z8X A;  3FUW A;  3T15 A;  4LF9 M;  4IBD A;  2FE8 A;  5C18 A;  4HL4 A;  3I4V A;  3H4M A;  4IBC A;  1T3T A;  4CGY B;  1MX0 A;  3BOS A;  3TPZ A;  4I81 A;  5KQ8 A;  1HR0 M;  1IQP A;  3I4Y A;  5IRE B;  2XFT A;  2KW0 A;  3KOW E;  3HJ8 A;  3SAU A;  5ITY A;  1L1T A;  1NJF A;  1WXQ A;  3DOA A;  4B7G A;  4M9S A;  3TL4 X;  2CHV A;  3FKE A;  1L2D A;  3GLF B;  3FUU A;  3JR4 A;  7CAT A;  2YQZ A;  4M9X A;  4D82 A;  4B3T M;  3SC3 A;  4MGZ E;  4W5W A;  3FTF A;  3KS4 A;  4LCB A;  4GH9 A;  4GIT A;  3AL0 C;  3L25 A;  3AV0 A;  3D8L A;  4AW4 A;  2QCU A;  2EUC A;  4RF1 A;  1SXJ D;  4GIP A;  3U6D A;  3KFU G;  3FUT A;  4FWD A;  1NNJ A;  4FWH A;  2KRU A;  3SMS A;  2V6Z M;  1TH3 A;  4B3S M;  2BJV A;  2ZAN A;  5ITX E;  1DGF A;  4DV2 M;  3W0F A;  5LMU M;  3LMM A;  1PJI A;  1GL6 A;  3SAR A;  4LF7 M;  2D7H A;  2Z4S A;  2K47 A;  3KS8 A;  1IN5 A;  3VKG A;  2L6O A;  5IWA M;  1XNR M;  4AZF A;  4IBJ A;  2C9C A;  2G8L A;  5A2Q S;  3IG8 A;  3U60 B;  3SAT A;  1IY0 A;  3HWS A;  3AOE C;  4R7G A;  3QWL A;  1PJJ A;  5EXP A;  3SFZ A;  1TGU A;  2CUZ A;  2G5G X;  4I5S A;  4LY6 A;  5EXT A;  1D2N A;  4JI4 M;  1N32 M;  4GC5 A;  1K3X A;  2R65 A;  2DZN B;  1QAO A;  5JI2 E;  1SXJ B;  3HHW A;  3FUV A;  3FUX A;  3GP1 A;  3U6S A;  1R7R A;  2XSZ A;  5ITR A;  2A5Y B;  2KA6 B;  4LF5 M;  3QAU A;  4LRT A;  5EQT A;  1OFI A;  3GLG A;  4LG2 A;  1I94 M;  4GKK M;  3HU3 A;  2AHM A;  2LXE A;  4BLC A;  2Y0Q A;  4TUW A;  4DV1 M;  2ERC A;  3PVS A;  4B08 A;  3K2L A;  5H37 D;  3U6O A;  4JV5 M;  3FTC A;  3L2A A;  4DV7 M;  5EP2 A;  3K92 A;  4WW0 A;  2DWZ B;  3FTD A;  1N36 M;  3HHZ A;  4G4N A;  2CV0 A;  3KXE C;  3GRV A;  5FLX S;  2R46 A;  4GHA A;  4NL4 H;  4LJ8 A;  3UMM A;  2CEA A;  2DHR A;  3PFI A;  3U61 B;  2YNM D;  4FCT A;  3SYL A;  3T1Y M;  4M0W A;  1GKI A;  1J09 A;  1SXJ E;  3GLI B;  4DV3 M;  4JXJ A;  3U6M A;  1DGH A;  5F3W A;  3SHG B;  4NXN M;  1YUB A;  4JI3 M;  4FCW A;  3C58 A;  4L15 A;  1QZM A;  2DVW B;  3MJ5 A;  2J7O A;  3HJQ A;  1N78 A;  2DWL A;  4FW9 A;  5E6J A;  4DR7 M;  3AOE A;  2Z3X A;  3GPY A;  2OPF A;  5E26 A;  2YFQ A;  4ITQ A;  2VQF M;  3U6Q A;  3K8Z A;  3RGP A;  4JI8 M;  1IN8 A;  4DR5 M;  2D7E A;  1TDH A;  1XMQ M;  4JI0 M;  3A98 B;  4I4L A;  5FTL A;  2Y21 A;  1TH2 A;  5EXS A;  4B7H A;  2HL7 A;  2LWX A;  1IXR C;  4L8R C;  4DUY M;  3NBI A;  4X64 M;  4IJF A;  4K0K M;  1XXH A;  2DZO B;  1NSF A;  4Z6Y A;  2I7N A;  3PNY A;  4AG6 A;  2DWM A;  3Q8X A;  4JI6 M;  4LJA A;  3KP0 E;  2XGN A;  2UUC M;  3EIE A;  4PT5 A;  3TQS A;  3GPU A;  3M7G A;  2QBY B;  3SBJ A;  2L7H A;  3A45 A;  2LNH C;  5KO3 A;  3KOY E;  2RGO A;  3U5Z A;  1PM5 A;  1IBL M;  3ZC7 B;  4A3V B;  3U6P A;  4KOD A;  1K3W A;  3THG A;  3UJN A;  2NQ8 C;  4NSO B;  4R3D A;  5DYG A;  4KLN A;  1GL7 A;  1XHB A;  3KDS E;  4LGY A;  2QEN A;  4X66 M;  3L29 A;  1HQC A;  4FCV A;  4AQY M;  1W5S A;  4IBE A;  2Y20 A;  3LVV A;  2UUA M;  1E9S A;  2EO2 A;  4G6Z A;  4JN6 A;  1L1Z A;  2UXB M;  4MGH A;  2E5L M;  1ORY B;  4NXM M;  4DR4 M;  2XEP A;  3UGJ A;  4NRW A;  2L09 A;  3EIH A;  3VK8 A;  2VII A;  4OVZ B;  3JR5 A;  1Q3C A;  3GQ5 A;  1LV7 A;  5FSW A;  1G41 A;  2M5Z A;  3TWK A;  8CAT A;  1IY2 A;  1N77 A;  4IBB A;  1SXJ C;  1JR3 D;  2KZU A;  1DO0 A;  3GRR A;  3HU2 A;  3PNV A;  4S12 A;  2DXI A;  4X62 M;  3L27 A;  1I4W A;  4DR6 M;  3HKP A;  4GRI A;  4M9Z A;  4B7F A;  1X37 A;  4P16 A;  1UM8 A;  1Z5C A;  5EXX A;  2C9O A;  2C99 A;  5ITX A;  4GHL A;  3HHX A;  1IM2 A;  1Z6T A;  2CV1 A;  3J7A S;  2ZM6 M;  2CHQ A;  4L16 A;  4DR3 M;  2QBY A;  2V1U A;  3J80 S;  4AG5 A;  1EE8 A;  2F5N A;  1G59 A;  3GLF A;  3FTE A;  1Z5B A;  4X65 M;  4DV6 M;  4OX9 M;  1IBK M;  3AKZ A;  5GKN A;  1OFH A;  3CF6 E;  5KPT A;  1R6B X;  1XNQ M;  2R4J A;  5FTN A;  4FD2 A;  4LFB M;  2UXD M;  1E9R A;  1QAQ A;  3VKH A;  1HT1 E;  2HKJ A;  3NWL A;  2RKO A;  1QAM A;  2XZF A;  2CV2 A;  3GLH B;  2CE7 A;  1IN7 A;  1NY5 A;  1FJG M;  3T1H M;  2KEB A;  3RE8 A;  2HHH M;  3M0E A;  4LF8 M;  2J7N A;  3DFZ A;  3DZD A;  3CF0 A;  3I51 A;  5FTM A;  3SHF A;  3HJS A;  1IY1 A;  5IZ7 D;  1NJG A;  1G4A E;  4LFC M;  1ZQ9 A;  4XGI A;  3A46 A;  3U6L A;  4MB7 A;  3IG5 A;  1QYR A;  3VDU A;  3LQR A;  1QQW A;  3GPX A;  3U6C A;  5EP3 A;  2YR0 A;  1G3I A;  4QNR A;  3KOX E;  1GLN A;  5DNY A;  3U60 A;  4LF6 M;  2F5P A;  1XC8 A;  2W82 A;  3SAS A;  4LF4 M;  4GC9 A;  4IBG A;  4D81 A;  4IBK A;  4KO8 A;  2CFO A;  2X8A A;  2QZ4 A;  3CF2 A;  2F4V M;  2LH0 A;  1TH4 A;  2F5Q A;  4NSR A;  1SXJ A;  2QP9 X;  4LRS A;  4LZJ A;  4QHT A;  3JAM S;  3KOZ E;  2C96 A;  3GPP A;  1KSF X;  3TWL A;  2ZAM A;  4LJ7 A;  3SAW A;  1JR3 A;  3GLH A;  3GRY A;  2FNA A;  4L78 A;  4PD2 A;  3FYD A;  5ITU A;  2EA0 A;  4NRV A;  4DR2 M;  3SYK A;  3J7B A;  3KVW A;  2ZAO A;  4I8O A;  4LJ6 A;  3CTW B;  5KPR A;  1N75 A;  3RFW A;  2UU9 M;  4QNM A;  3TE6 A;  3WHL A;  2C5R A;  4RF0 A;  2X49 A;  1IXS B;  4REZ A;  4LJ9 A;  1Q3B A;  1N34 M;  4IBI A;  1HNX M;  1JQJ C;  4BBA A;  1C1K A;  3FYC A;  3U61 A;  3J27 B;  3RGS A;  4AKH A;  1YE9 A;  2FOI C;  4IIW A;  4AKG A;  2XSZ D;  3GLI A;  4LGM A;  2R45 A;  4G4Q A;  1G8P A;  3KSX A;  2QPA A;  1GVN A;  2V1C A;  2M60 A;  4MM3 B;  3MK6 A;  4DV4 M;  3J81 S;  2CHG A;  3GQ3 A;  4G4O A;  2KZS A;  3L28 A;  1N33 M;  2DWN A;  3FD9 A;  1FNN A;  3HHY A;  3W0L B;  2BJW A;  4DV5 M;  4FVM A;  1W5T A;  3K1J A;  1IN6 A;  4JI1 M;  4IJE A;  3LQQ A;  3DA1 A;  1J5E M;  5BPV A;  4DV0 M;  5JI3 E;  4MGI E;  3GO8 A;  1NHG C;  5ITT A;  2Q2E B;  1Z5A A;  2Z7J A;  3ILK A;  2R4E A;  4OU7 A;  1H6U A;  1NVM A;  4XBO A;  4G4R A;  4CIS A;  2FFJ A;  2R62 A;  2XH9 A;  4ZPX A;  1KFV A;  1L2C A;  2XLJ A;  3GLG B;  3M6A A;  2UUB M;  3A42 A;  1R2Z A;  4YHH M;  3LVW A;  2O5R A;  1E94 E;  1DO2 A;  4LZZ A;  3UK6 A;  3E4R A;  2BNK A;  3AOG A;  3J2P B;  3PXG A;  4AKI A;  3HU1 A;  2HCB A;  4PDG A;  2F5O A;  3KW6 A;  4JI5 M;  1NY6 A;  4JI7 M;  2XF3 A;  4GMQ A;  1QAN A;  5EP4 A;  5BR8 M;  1HNW M;  3VK7 A;  4DUZ M;  4M0D A;  4FWG A;  3T38 A;  4NOO B;  1ZAE A;  4CHT B;  3L26 A;  2Z4R A;  4AI6 A;  1TDZ A;  3GRU A;  4B3R M;  4LFA M;  3GQ4 A;  3AFH A;  4LJ4 A;  4MGK E;  5EJC A;  5LMN M;  2VQE M;  4WUR A;  4QOS A;  3VLF B;  1XWI A;  4OVZ A;  2RGH A;  3B9P A;  1DGH B;  4MH0 E;  2XFS A;  4B3M M;  3E9S A;  4L4U A;  3TWM A;  3KP1 E;  1HNZ M;  3HGI A;  4YY3 M;  3U6E A;  2C98 A;  5EP1 A;  2I7P A;  2L7I A;  4KHP M;  4OW0 A;  2Y0T A;  3R8F A;  4LJ5 A;  3ZCB B;  5C1B A;  1DGG A;  3SAV A;  2X4A A;  5KPZ A;  4JI2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...