4B3RM

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3rM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3rM02
3GPPA 2OPFA 2XZUA 1EE8A 1L1TA 1PM5A 4PDIA 1L2BA 3JR5A 5ITTA 5BR8M 4G4RA 4JI5M 4LF8M 4LFAM 4DV6M 1XMOM 4JI3M 1L1ZA 3C58A 4G4QA 4X66M 3SATA 1N36M 2UUCM 1Q39A 3J80S 4B3MM 2F5OA 2F4VM 5A2QS 4DR1M 3U6DA 1KFVA 3SAUA 3U6MA 3SAWA 1Z5CA 4LF5M 5ITXE 1Z5BA 5ITXA 1PJIA 3DOAA 3OTOM 3J7AS 4X65M 4NXNM 2UXDM 4PDGA 3SASA 1J5EM 4LFBM 4DR5M 1R2YA 4G4NA 3U6OA 1TDHA 3TWKA 4PD2A 3GQ5A 4DV3M 1MX0A 4ITQA 1HR0M 3GO8A 4LF7M 4G4OA 1R2ZA 4NRWA 1XNRM 4K0KM 4DV7M 2F5QA 1XNQM 2Q2EB 4NRVA 1Z59A 2UUBM 3A46A 3U6CA 1K3XA 4OX9M 2ZM6M 2F5PA 2UXCM 4GKJM 4JI8M 1HNWM 4B3SM 4KHPM 2XZFA 5FLXS 1IBMM 4DR3M 2E5LM 4DV0M 1MU5A 4DV4M 3TWMA 3U6SA 3U6EA 3SAVA 4DR6M 1HNXM 4YHHM 2HHHM 4PCZA 1TDZA 2HKJA 1XMQM 3VK7A 4B3TM 3W0FA 2VQEM 1PJJA 4LF4M 1FJGM 4DR7M 4DV2M 1XC8A 3SBJA 4DR4M 5ITUA 3U6LA 4GKKM 4MB7A 4DV5M 1K82A 5ITYA 3VK8A 4YY3M 5LMUM 4X62M 4DR2M 5ITRA 3A45A 1Q3CA 1NNJA 2ZBKB 2UU9M 3GPXA 4JI4M 4NXMM 1IBLM 4JV5M 4LF6M 3GP1A 4JI2M 4JI1M 1I94M 3JR4A 3U6QA 2UUAM 2F5SA 4LFCM 4DUYM 5IT9S 4LF9M 4CISA 4JYAM 4DV1M 4JI7M 1HNZM 3T1HM 1Z5AA 4DUZM 3J81S 2UXBM 2VQFM 2EA0A 5ITQA 1N32M 3GQ4A 3GQ3A 4X64M 3GPYA 1K3WA 3T1YM 1Q3BA 4B3RM 1N33M 3JAMS 3SARA 2OQ4A 1N34M 2F5NA 5IWAM 1L2CA 4JI0M 3U6PA 3A42A 5LMNM 4AQYM 1IBKM 1L2DA 3TWLA 3GPUA 4JI6M
chains in the Genus database with same CATH superfamily
3GRRA 4IBCA 2VDBB 4I8OA 4PDIA 2F5NA 2Z8YM 4QOZC 2C9CA 1GKIA 2VF7A 2EUCA 1LTMA 4BBAA 4X66M 1QDRA 3K1JA 4BB9A 3SFZA 3GLFA 2EKKA 3GLGE 1V92A 4M9XA 3SAUA 1NO1A 4NSRA 3EIHA 3U6MA 1Z5CA 2XGNA 3D8LA 4LF5M 2AHMA 1Z5BA 2JP7A 3HU2A 1NJFA 3FUUA 5ITXA 2JUJA 5FTNA 1PJIA 1NV8A 1ZAEA 3MK6A 5FTLA 4X65M 4AKIA 2Z4SA 4IIWA 4NXNM 1G8PA 2ZAMA 1N75A 1JR3D 4FWGA 3FE3A 3GLFB 2JWSA 3V76A 2LVAA 2J7NA 1R2YA 3GLIA 2KEBA 2QP9X 2QZ4A 3IECA 1TDHA 4NL4H 4P16A 3M6AA 1GL6A 5EXSA 3HHYA 3B89A 3TWKA 2QBYB 2DNAA 4FWHA 1MX0A 4DV3M 3FTEA 3GO8A 1OQYA 3E9SA 3Q8GA 1R2ZA 3L26A 1XNRM 3SHFA 4DV7M 2F5QA 2Q2EB 2DZLA 2H1RA 1OFIA 3J7BA 2X4AA 4L6V6 4NRVA 3W0LB 4FCWA 1OTRA 3T15A 3GLIB 2QPAA 1WGNA 3RFWA 2UUBM 5FTKA 2CV1A 1WJ7A 1K3XA 4ANRA 2WSFF 4GITA 3M0EA 4LJ7A 2F5PA 2DAKA 2KZUA 1MJGM 1T6OA 4B3SM 2EJSA 3I4VA 2W82A 2XZFA 1IBMM 1MU5A 1V33A 3SAVA 1PJSA 1X37A 2R46A 3AV0A 3VDPA 2C5RA 1HNXM 4DR6M 1GLNA 1J7KA 2Y0TA 3RGPA 4GC9A 2R18A 4LF4M 2L2DA 3L27A 3FKEA 1OIPA 2EO2A 3SBJA 5ITUA 3U6LA 3K9PA 2MJ5B 4CJ6A 5EP2A 4DV5M 1T43A 2LXEA 2NQ8C 4S12A 2I7PA 1QZEA 3HGIA 4AW4A 3M7GA 1IM2A 3IHPA 1D0MA 4YY3M 4X62M 3LQRA 5LMUM 4TUWA 2R6FA 2R44A 3BBZA 4MGHA 1OAOC 3UMMA 4JN6A 2ZBKB 3U61A 1FNNA 3GPXA 3PNYA 2DWLA 1AUAA 4LJ5A 4LF6M 2K0BX 3HHXA 4JV5M 4JI2M 1G71A 3JR4A 3U6QA 2RGHA 4JXJA 3FYDA 2F5SA 3HWSA 4LRTA 1QVRA 4LF9M 1G3IA 1AIPC 4FWDA 1NSFA 4JYAM 4B7GA 2GQFA 1NVMA 3FYCA 3AJIB 2ERCA 2JY7A 3B7ZA 1SXJA 2VQFM 1W5TA 3KP0E 3EIEA 3GQ3A 3GLHB 3GQ4A 2LNHC 1C1KA 2XF3A 4B3RM 2DKLA 4WW0A 4OU7A 3C3DA 1YE9A 1TH3A 1L2DA 2C9OA 2FFJA 1SXJB 2C99A 5EXPA 2XZUA 1L1TA 1PRBA 4CHTB 1OKSA 4FCVA 5DFLA 1PJTA 3KOZE 3GLHE 5H37D 1DGHB 3JR5A 5BR8M 4G4RA 4BLCA 2YQZA 3CF6E 3K92A 4DV6M 1E94E 1D2NA 1E9RA 1WR1B 1ZMVA 4G4QA 2JY5A 3IG5A 3FTCA 4FCTA 2KDLA 1N36M 2R4JA 5KQDA 4MGZE 3RE8A 2MH8A 5A2QS 3GLGA 1A5TA 2O25A 4R3DA 2YFQA 5FTJA 4DR1M 3SMSA 4CGYB 4IBGA 1JB0F 3DOAA 3KW6A 2APLA 1OFHA 3L28A 4LGYA 2Z3XA 4OW0A 4AKGA 1VEKA 2DI0A 3WHLA 3VKHA 4RF1A 1DGGA 4D81A 2H5XA 3KVWA 3ZH9B 3SASA 3QYEA 4HLQA 5EP1A 3TE6A 5F3WA 2CV0A 5EP4A 4LFBM 4I81A 3GLGB 3VKGA 3LVWA 4RNAA 3WHKA 1IN6A 4LF7M 4LY6A 1NY6A 4QNMA 5KPZA 1IN8A 5EJCA 1IXZA 4XK8F 1Z59A 4AI6A 1PJQA 1WGLA 1IN4A 4MGIE 1JQJC 4D80A 5JI2E 3AOEC 1VDLA 2ZANA 2DZNB 2CEAA 2DAEA 1T3TA 1TR8A 4KLNA 2QBYA 3K2LA 2DHYA 4JI8M 3R9XB 4L8RC 4IBKA 4KHPM 4WURA 4FD2A 3HJQA 3I4YA 2DWZB 3DFZA 3U6EA 2V6ZM 2R65A 3HZJA 4IBEA 4RF0A 2LTUA 5EXTA 4YHHM 1XXHE 4PCZA 2R62A 3I51A 2VQEM 2YR0A 1FJGM 1NJGA 4IBIA 2D7GA 4DR7M 1OIZA 2XSZD 3HY5A 4FVMA 2XFTA 2KZSA 3VDUA 1DV0A 4GKKM 1TTEA 1Q02A 3SC3A 3HJSA 1K82A 3FTFA 1ZMWA 1IXRC 3K9OA 1QDTA 1TGUA 2Y0QA 2XEPA 1G41A 2M60A 3KOXE 4AG6A 5C18A 3LCUA 5ITRA 2G8LA 4M0DA 2DVWB 3J2PB 4JI4M 3LQQA 2BNKA 2KW0A 1IBLM 2JNHA 1DO2A 3SHGB 3LMMA 1NHWC 1IY2A 3KDSE 4IBBA 1VQ1A 2DHRA 2BJVA 4D82A 4LFCM 3B74A 1R5LA 2L7HA 2P5TA 5C1BA 2V1CA 1VEGA 4JI7M 5DYIA 3DZDA 4OVZB 1GL7A 2XLJA 2HWJA 4X64M 4W5WA 3T1YM 2R4EA 2KRUA 2L09A 3FUWA 3SARA 2CWBA 1TH2A 1DO0A 4JI0M 3LCVB 1NV9A 3TL4X 2QCUA 5LMNM 2R45A 2Z4RA 3FUVA 4RKUF 1XB2B 2G5GX 3TWLA 3AOGA 3GPUA 1D0LA 2YNMD 3T6PA 3GPPA 2OPFA 1L2BA 5ITTA 4CIZA 2FS1A 4M0WA 3GLHA 4B08A 2K47A 4JI5M 1QAOA 4LF8M 4LFAM 2JXNA 4LRSA 1XMOM 1G4AE 4NOOB 1L1ZA 2FOIC 2QHOB 3KFUG 3SATA 3FRIA 3PXGA 1OJLA 1Q39A 2CRUA 1NHGC 3J80S 2F4VM 5E6JA 1QUSA 3CF0A 1QAMA 1E9SA 4GHLA 7CATA 3HKPA 4LJ9A 1DGHA 2D7EA 2FH0A 2LH0A 2DWNA 3OTOM 3J7AS 3HJ8A 2KNVA 1C7YA 1IQPA 4PDGA 1IXSA 1R7RA 4GC5A 1J5EM 3MJ5A 3B7QA 5KO3A 5DNYA 4G4NA 3U6OA 1JR3E 4QHTA 2CP8A 3CGWA 1QUTA 4PD2A 3LW5F 4LZJA 4ITQA 3B7NA 4MGYE 3IG8A 1EFUB 3FD9A 3T38A 2R0IA 5FSWA 3KS4A 4AZFA 4G4OA 3AOEA 2QENA 2CFOA 4K0KM 1XNQM 1N78A 1IXSB 4M9ZA 3E21A 4KT0F 3U60B 2JZ1A 4GRIA 1L8QA 3FTDA 4L16A 3D8BA 1TF0B 3RGSA 2A5YB 1J09A 4KO8A 4OX9M 4NC6A 1IFYA 2ZM6M 1NNUC 3L25A 3CF2A 2K6BA 1XWIA 3L2AA 2L4EA 4LG2A 4Z8XA 4P17A 1IN5A 3K8ZA 3BOSA 3C9PA 3HHWA 4DV4M 3TWMA 1QYRA 1V34A 2RGOA 3MHVC 4ZPXA 2CV2A 2CHGA 1HQYE 5EP3A 1KYIA 2WSCF 1OAIA 1TDZA 2LHCA 1XXHA 1HJPA 2HKJA 2XH9A 4B3TM 3GRYA 5GKNA 4HL4A 1PGYA 4L78A 3VLFB 5DYGA 4F2LA 2CE7A 1PJJA 1XHBA 2N35A 3KXEC 4F1IA 4DV2M 2B3TA 1E32A 2Z7JA 3SMPA 4DBGB 4DR4M 2LVPC 4MB7A 3A98B 2DAIA 2OO9A 1NY5A 3THGA 1QAQA 4MH0E 1XXHB 5BPVA 3I01M 1R6BX 1TH4A 4IJEA 1MN3A 1R4GA 3A45A 3KSJA 4B7FA 4B7HA 1NNJA 1HT2E 2OOBA 1LV7A 2LHGA 3C3EA 3AKZA 4LJ6A 4PT5A 2QQ8A 1QANA 2BJWA 2HAKA 4G6ZA 4LGMA 1I94M 4AKHA 1Y8GA 2UUAM 4QOSA 5L8RF 4DUYM 1UM8A 3HU1A 2ZTDA 1DGBA 3PNVA 1YUBA 1IY1A 4DV1M 2K9DA 3NBXX 4IBFA 3UZUA 1UFZA 2LVOC 1VEJA 2UXBM 5JI3E 4IBJA 2EA0A 2BWEA 1YSYA 5EQTA 3GRVA 5ITQA 1G59A 5EXXA 1CUKA 2QNJA 4LZZA 1N33M 3HHZA 1QQWA 4IBDA 1GJTA 2MGWA 4L15A 3KSXA 3KOYE 4NSOB 1RU3A 3KS8A 4M9SA 4JI6M 2DAGA 1EE8A 1HT1E 3FRHA 5KPTA 1PM5A 2JY6B 4OVZA 2FE8A 3W68A 2WSEF 2ZAOA 3CTWB 4LJ8A 4QHSA 3SYKA 2CUZA 2MROB 2C98A 4KODA 8CATA 1EIJA 2LBCA 1WHCA 1ORYB 1SXJD 2I7NA 3H4MA 4JI3M 2VF8A 1QZMA 3C58A 2RKOA 2KXEA 3F92A 2KHHA 4GEWA 3GLFE 2UUCM 2XFSA 4B3MM 2F5OA 3U6DA 4XGIA 1KFVA 2Y20A 3UK6A 1W5SA 3SAWA 2X8AA 1GVNA 3B9PA 5ITXE 2G3QA 1YLAA 3VFDA 2O5RA 2QSFX 4II7A 2LVQD 2RRUA 1IY0A 4UN2B 4GHAA 2UXDM 1GJSA 5KPRA 2MR9A 3FUXA 1H6UA 3GLIE 4DR5M 3E46A 3KP1E 1JR3A 3GRUA 3UJNA 4MM3B 3GQ5A 1I4WA 1ZMUA 1HR0M 4R7GA 4NRWA 3MMPA 4EIWA 1KSFX 2HL7A 3KOWE 3QAUA 4GIPA 4Z6YA 2JZ0A 3FUTA 4FW9A 4G3OA 2XSZA 2C96A 1DGFA 5FTMA 3A46A 4GMQA 2FNAA 2LWXA 3TQSA 3U6CA 2J7OA 2KRKA 2OOAA 3NWLA 3PFIA 2UXCM 4GKJM 2BWBA 1HNWM 3UGJA 2ZTCA 4WP2A 1P3QQ 5FLXS 4DR3M 3AL0C 2E5LM 2DZOB 2M5ZA 4DV0M 2CHQA 2L6OA 2DWMA 3TPZA 5IREB 5KQ8A 3U6SA 3U60A 4A3VB 3U5ZA 2DXIA 2HHHM 1Z6TA 2JY8A 3AFHA 1WIVA 2GNOA 3QYBA 3W67A 2J5YA 2KNZA 3VK7A 1XMQM 3U61B 3BXWA 1BVSA 4REZA 4IJFA 4XBOA 3W0FA 3L29A 2V1UA 1IN7A 2O01F 1XC8A 4I5SA 2Y21A 1WXQA 4MGKE 2EKFA 1VDDA 4LCBA 3ZCBB 4LJ4A 3U5ZB 2DAMA 2HCBA 5ITYA 3VK8A 3DA1A 1ZQ9A 4DR2M 2CHVA 3I04M 3ILKA 1Q3CA 2D7HA 2UU9M 1SG9A 4NXMM 2L4FA 3R8FA 3GP1A 4AG5A 4JI1M 5IZ7D 1GO5A 1VG5A 3ZC7B 1S3SA 3PVSA 5IT9S 2X49A 1F4IA 1N77A 4CISA 1HNZM 2JA2A 3NBIA 4Y28F 3T1HM 1Z5AA 4DUZM 1SXJE 4LJAA 4QNRA 3J81S 2KNAA 2DENA 3HU3A 3QWLA 1N32M 4Q7JA 3GPYA 4HEOA 5E26A 4L4UA 1K3WA 1D0KA 1ZV1A 1Q3BA 2KA6B 3JAMS 1HQCA 2VIIA 2L7IA 3J27B 2OQ4A 5IWAM 3E4RA 3ZQJA 1N34M 1L2CA 3SYLA 3H4JA 3U6PA 2WZJA 1SXJC 3A42A 3HX3A 3Q8XA 4AQYM 1IBKM 1GABA 4I4LA 4R71A 3LVVA 2LVNC 4GH9A
chains in the Genus database with same CATH topology
3GRRA 4IBCA 4I8OA 4PDIA 4QOZC 2C9CA 1GKIA 2EUCA 4BBAA 4X66M 3K1JA 4BB9A 3SFZA 3GLFA 4M9XA 3SAUA 4NSRA 3EIHA 3U6MA 1Z5CA 2XGNA 3D8LA 4LF5M 2AHMA 1Z5BA 3HU2A 5ITXA 1NJFA 3FUUA 1PJIA 5FTNA 4AKIA 1ZAEA 3MK6A 5FTLA 4X65M 2Z4SA 4IIWA 4NXNM 1G8PA 2ZAMA 1N75A 1JR3D 4FWGA 3GLFB 2J7NA 1R2YA 3GLIA 2KEBA 2QP9X 2QZ4A 4NL4H 1TDHA 4P16A 3TWKA 3M6AA 1GL6A 5EXSA 3HHYA 2QBYB 4FWHA 4DV3M 1MX0A 3FTEA 3GO8A 3E9SA 1R2ZA 3L26A 1XNRM 3SHFA 4DV7M 2F5QA 2Q2EB 2H1RA 1OFIA 3J7BA 2X4AA 4NRVA 3W0LB 4FCWA 3T15A 3GLIB 2QPAA 2UUBM 3RFWA 5FTKA 2CV1A 1K3XA 4GITA 3M0EA 4LJ7A 2F5PA 2KZUA 4B3SM 3I4VA 2W82A 2XZFA 1IBMM 1MU5A 3SAVA 2C5RA 1X37A 2R46A 3AV0A 3VDPA 1HNXM 4DR6M 1GLNA 1J7KA 2Y0TA 3RGPA 4GC9A 2R18A 4LF4M 3L27A 3FKEA 2EO2A 3SBJA 5ITUA 3U6LA 5EP2A 4DV5M 2LXEA 2NQ8C 4S12A 2I7PA 3HGIA 4AW4A 3M7GA 1IM2A 4YY3M 5LMUM 4X62M 3LQRA 4TUWA 4MGHA 3UMMA 4JN6A 2ZBKB 3U61A 1FNNA 3GPXA 3PNYA 2DWLA 4LJ5A 4JV5M 4LF6M 3HHXA 4JI2M 3JR4A 3U6QA 2RGHA 4JXJA 3FYDA 2F5SA 3HWSA 4LRTA 1QVRA 4LF9M 1G3IA 4FWDA 1NSFA 4JYAM 4B7GA 1NVMA 3FYCA 3AJIB 2ERCA 1SXJA 2VQFM 1W5TA 3KP0E 3EIEA 3GQ3A 3GLHB 3GQ4A 2LNHC 1C1KA 2XF3A 4B3RM 4WW0A 4OU7A 1YE9A 1TH3A 1L2DA 2C9OA 2FFJA 1SXJB 2C99A 5EXPA 2XZUA 1L1TA 4CHTB 4FCVA 3KOZE 5H37D 3JR5A 1DGHB 5BR8M 4G4RA 4BLCA 2YQZA 3CF6E 3K92A 4DV6M 1E94E 1D2NA 1E9RA 4G4QA 3IG5A 3FTCA 4FCTA 1N36M 2R4JA 5KQDA 4MGZE 3RE8A 5A2QS 3GLGA 5FTJA 4R3DA 4DR1M 2YFQA 3SMSA 4CGYB 4IBGA 3DOAA 3KW6A 1OFHA 3L28A 4LGYA 2Z3XA 4OW0A 4AKGA 3VKHA 3WHLA 4RF1A 1DGGA 4D81A 3KVWA 3ZH9B 3SASA 5EP1A 4HLQA 2CV0A 3TE6A 5F3WA 4LFBM 5EP4A 4I81A 3GLGB 3VKGA 3LVWA 4RNAA 3WHKA 1IN6A 4LF7M 4LY6A 1NY6A 4QNMA 5KPZA 1IN8A 5EJCA 1IXZA 4AI6A 1Z59A 1IN4A 4MGIE 1JQJC 4D80A 5JI2E 3AOEC 2ZANA 2DZNB 2CEAA 1T3TA 4KLNA 2QBYA 3K2LA 3R9XB 4JI8M 4L8RC 4IBKA 4KHPM 4WURA 4FD2A 3HJQA 3I4YA 2DWZB 3DFZA 3U6EA 2V6ZM 2R65A 4IBEA 4RF0A 5EXTA 4YHHM 4PCZA 2R62A 3I51A 2VQEM 2YR0A 1FJGM 1NJGA 4IBIA 2D7GA 4DR7M 2XSZD 4FVMA 2XFTA 2KZSA 3VDUA 4GKKM 3SC3A 3HJSA 1K82A 3FTFA 1IXRC 1TGUA 2Y0QA 2XEPA 1G41A 2M60A 3KOXE 4AG6A 5C18A 5ITRA 2G8LA 4M0DA 2DVWB 3J2PB 4JI4M 3LQQA 2BNKA 2KW0A 1IBLM 1DO2A 3SHGB 3LMMA 1NHWC 1IY2A 3KDSE 4IBBA 2DHRA 2BJVA 4D82A 4LFCM 2L7HA 2P5TA 5C1BA 2V1CA 4JI7M 5DYIA 3DZDA 4OVZB 1GL7A 2XLJA 4X64M 4W5WA 3T1YM 2R4EA 2KRUA 2L09A 3FUWA 3SARA 1TH2A 1DO0A 4JI0M 3TL4X 2QCUA 5LMNM 2R45A 2Z4RA 3FUVA 2G5GX 3TWLA 3AOGA 3GPUA 2YNMD 3GPPA 2OPFA 1L2BA 5ITTA 4M0WA 3GLHA 4B08A 2K47A 4JI5M 1QAOA 4LF8M 4LFAM 4LRSA 1XMOM 1G4AE 4NOOB 1L1ZA 2FOIC 3KFUG 3SATA 3PXGA 1OJLA 1Q39A 3J80S 1NHGC 2F4VM 5E6JA 3CF0A 1QAMA 1E9SA 4GHLA 7CATA 3HKPA 4LJ9A 1DGHA 2D7EA 2LH0A 2DWNA 3OTOM 3J7AS 3HJ8A 1IQPA 4PDGA 4GC5A 1R7RA 1J5EM 3MJ5A 5KO3A 5DNYA 4G4NA 3U6OA 4QHTA 4PD2A 4ITQA 4LZJA 4MGYE 3T38A 3IG8A 3FD9A 5FSWA 4G4OA 3KS4A 4AZFA 3AOEA 2QENA 2CFOA 4K0KM 1XNQM 1N78A 1IXSB 4M9ZA 3U60B 4GRIA 1L8QA 3FTDA 4L16A 3D8BA 3RGSA 2A5YB 1J09A 4KO8A 4OX9M 2ZM6M 1NNUC 3L25A 3CF2A 1XWIA 3L2AA 4LG2A 4Z8XA 1IN5A 3K8ZA 3BOSA 3HHWA 4DV4M 3TWMA 1QYRA 2RGOA 3MHVC 4ZPXA 2CV2A 2CHGA 1HQYE 5EP3A 1KYIA 1TDZA 1XXHA 2HKJA 2XH9A 4B3TM 3GRYA 5GKNA 4HL4A 3VLFB 4L78A 1PJJA 5DYGA 2CE7A 1XHBA 3KXEC 4DV2M 1E32A 2Z7JA 3SMPA 4DR4M 4MB7A 3A98B 1NY5A 3THGA 1QAQA 4MH0E 1XXHB 5BPVA 1R6BX 1TH4A 4IJEA 4B7FA 3A45A 3KSJA 4B7HA 1NNJA 1HT2E 1LV7A 3AKZA 4LJ6A 4PT5A 1QANA 2BJWA 4G6ZA 4LGMA 1I94M 4AKHA 2UUAM 4QOSA 4DUYM 1UM8A 3HU1A 1DGBA 3PNVA 1YUBA 1IY1A 4DV1M 4IBFA 3UZUA 2UXBM 5JI3E 4IBJA 2EA0A 1YSYA 5EQTA 3GRVA 5ITQA 1G59A 5EXXA 4LZZA 1N33M 3HHZA 1QQWA 4IBDA 4L15A 3KSXA 3KOYE 4NSOB 3KS8A 4M9SA 4JI6M 1EE8A 1HT1E 5KPTA 1PM5A 4OVZA 2FE8A 2ZAOA 3CTWB 4LJ8A 4QHSA 3SYKA 2CUZA 2C98A 4KODA 8CATA 4JI3M 1ORYB 1SXJD 2I7NA 3H4MA 3C58A 1QZMA 2RKOA 2KXEA 2UUCM 2XFSA 4B3MM 2F5OA 3U6DA 4XGIA 1KFVA 2Y20A 3UK6A 1W5SA 3SAWA 2X8AA 1GVNA 3B9PA 5ITXE 3VFDA 2O5RA 4II7A 1IY0A 4GHAA 2UXDM 5KPRA 3FUXA 1H6UA 4DR5M 3KP1E 1JR3A 3GRUA 3UJNA 4MM3B 3GQ5A 1I4WA 1HR0M 4R7GA 4NRWA 4EIWA 1KSFX 2HL7A 3KOWE 3QAUA 4GIPA 4Z6YA 3FUTA 4FW9A 2XSZA 2C96A 1DGFA 5FTMA 3A46A 4GMQA 2FNAA 2LWXA 3TQSA 3U6CA 2J7OA 2KRKA 3NWLA 3PFIA 2UXCM 4GKJM 1HNWM 3UGJA 5FLXS 4DR3M 3AL0C 2E5LM 2DZOB 2M5ZA 4DV0M 2CHQA 2L6OA 2DWMA 3TPZA 5IREB 5KQ8A 3U6SA 3U60A 4A3VB 3U5ZA 2DXIA 2HHHM 1Z6TA 3AFHA 1XMQM 3VK7A 3U61B 4REZA 3W0FA 4IJFA 4XBOA 3L29A 2V1UA 1IN7A 1XC8A 4I5SA 2Y21A 1WXQA 4MGKE 4LCBA 1VDDA 3U5ZB 3ZCBB 4LJ4A 2HCBA 5ITYA 3VK8A 3DA1A 1ZQ9A 4DR2M 2CHVA 3ILKA 1Q3CA 2D7HA 2UU9M 4NXMM 3R8FA 3GP1A 4AG5A 4JI1M 5IZ7D 3ZC7B 1S3SA 3PVSA 5IT9S 2X49A 1N77A 4CISA 1HNZM 2JA2A 3NBIA 3T1HM 1Z5AA 4DUZM 1SXJE 4LJAA 4QNRA 3J81S 3HU3A 3QWLA 1N32M 3GPYA 5E26A 4L4UA 1K3WA 1Q3BA 2KA6B 3JAMS 1HQCA 2VIIA 2L7IA 3J27B 2OQ4A 5IWAM 3E4RA 1N34M 1L2CA 2F5NA 3SYLA 3U6PA 3A42A 1SXJC 3Q8XA 4AQYM 1IBKM 4I4LA 3LVVA 4GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPP A;  2OPF A;  2XZU A;  1EE8 A;  1L1T A;  1PM5 A;  4PDI A;  1L2B A;  3JR5 A;  5ITT A;  5BR8 M;  4G4R A;  4JI5 M;  4LF8 M;  4LFA M;  4DV6 M;  1XMO M;  4JI3 M;  1L1Z A;  3C58 A;  4G4Q A;  4X66 M;  3SAT A;  1N36 M;  2UUC M;  1Q39 A;  3J80 S;  4B3M M;  2F5O A;  2F4V M;  5A2Q S;  4DR1 M;  3U6D A;  1KFV A;  3SAU A;  3U6M A;  3SAW A;  1Z5C A;  4LF5 M;  5ITX E;  1Z5B A;  5ITX A;  1PJI A;  3DOA A;  3OTO M;  3J7A S;  4X65 M;  4NXN M;  2UXD M;  4PDG A;  3SAS A;  1J5E M;  4LFB M;  4DR5 M;  1R2Y A;  4G4N A;  3U6O A;  1TDH A;  3TWK A;  4PD2 A;  3GQ5 A;  4DV3 M;  1MX0 A;  4ITQ A;  1HR0 M;  3GO8 A;  4LF7 M;  4G4O A;  1R2Z A;  4NRW A;  1XNR M;  4K0K M;  4DV7 M;  2F5Q A;  1XNQ M;  2Q2E B;  4NRV A;  1Z59 A;  2UUB M;  3A46 A;  3U6C A;  1K3X A;  4OX9 M;  2ZM6 M;  2F5P A;  2UXC M;  4GKJ M;  4JI8 M;  1HNW M;  4B3S M;  4KHP M;  2XZF A;  5FLX S;  1IBM M;  4DR3 M;  2E5L M;  4DV0 M;  1MU5 A;  4DV4 M;  3TWM A;  3U6S A;  3U6E A;  3SAV A;  4DR6 M;  1HNX M;  4YHH M;  2HHH M;  4PCZ A;  1TDZ A;  2HKJ A;  1XMQ M;  3VK7 A;  4B3T M;  3W0F A;  2VQE M;  1PJJ A;  4LF4 M;  1FJG M;  4DR7 M;  4DV2 M;  1XC8 A;  3SBJ A;  4DR4 M;  5ITU A;  3U6L A;  4GKK M;  4MB7 A;  4DV5 M;  1K82 A;  5ITY A;  3VK8 A;  4YY3 M;  5LMU M;  4X62 M;  4DR2 M;  5ITR A;  3A45 A;  1Q3C A;  1NNJ A;  2ZBK B;  2UU9 M;  3GPX A;  4JI4 M;  4NXM M;  1IBL M;  4JV5 M;  4LF6 M;  3GP1 A;  4JI2 M;  4JI1 M;  1I94 M;  3JR4 A;  3U6Q A;  2UUA M;  2F5S A;  4LFC M;  4DUY M;  5IT9 S;  4LF9 M;  4CIS A;  4JYA M;  4DV1 M;  4JI7 M;  1HNZ M;  3T1H M;  1Z5A A;  4DUZ M;  3J81 S;  2UXB M;  2VQF M;  2EA0 A;  5ITQ A;  1N32 M;  3GQ4 A;  3GQ3 A;  4X64 M;  3GPY A;  1K3W A;  3T1Y M;  1Q3B A;  4B3R M;  1N33 M;  3JAM S;  3SAR A;  2OQ4 A;  1N34 M;  2F5N A;  5IWA M;  1L2C A;  4JI0 M;  3U6P A;  3A42 A;  5LMN M;  4AQY M;  1IBK M;  1L2D A;  3TWL A;  3GPU A;  4JI6 M; 
#chains in the Genus database with same CATH topology
 3GRR A;  4IBC A;  2VDB B;  4I8O A;  4PDI A;  2F5N A;  2Z8Y M;  4QOZ C;  2C9C A;  1GKI A;  2VF7 A;  2EUC A;  1LTM A;  4BBA A;  4X66 M;  1QDR A;  3K1J A;  4BB9 A;  3SFZ A;  3GLF A;  2EKK A;  3GLG E;  1V92 A;  4M9X A;  3SAU A;  1NO1 A;  4NSR A;  3EIH A;  3U6M A;  1Z5C A;  2XGN A;  3D8L A;  4LF5 M;  2AHM A;  1Z5B A;  2JP7 A;  3HU2 A;  1NJF A;  3FUU A;  5ITX A;  2JUJ A;  5FTN A;  1PJI A;  1NV8 A;  1ZAE A;  3MK6 A;  5FTL A;  4X65 M;  4AKI A;  2Z4S A;  4IIW A;  4NXN M;  1G8P A;  2ZAM A;  1N75 A;  1JR3 D;  4FWG A;  3FE3 A;  3GLF B;  2JWS A;  3V76 A;  2LVA A;  2J7N A;  1R2Y A;  3GLI A;  2KEB A;  2QP9 X;  2QZ4 A;  3IEC A;  1TDH A;  4NL4 H;  4P16 A;  3M6A A;  1GL6 A;  5EXS A;  3HHY A;  3B89 A;  3TWK A;  2QBY B;  2DNA A;  4FWH A;  1MX0 A;  4DV3 M;  3FTE A;  3GO8 A;  1OQY A;  3E9S A;  3Q8G A;  1R2Z A;  3L26 A;  1XNR M;  3SHF A;  4DV7 M;  2F5Q A;  2Q2E B;  2DZL A;  2H1R A;  1OFI A;  3J7B A;  2X4A A;  4L6V 6;  4NRV A;  3W0L B;  4FCW A;  1OTR A;  3T15 A;  3GLI B;  2QPA A;  1WGN A;  3RFW A;  2UUB M;  5FTK A;  2CV1 A;  1WJ7 A;  1K3X A;  4ANR A;  2WSF F;  4GIT A;  3M0E A;  4LJ7 A;  2F5P A;  2DAK A;  2KZU A;  1MJG M;  1T6O A;  4B3S M;  2EJS A;  3I4V A;  2W82 A;  2XZF A;  1IBM M;  1MU5 A;  1V33 A;  3SAV A;  1PJS A;  1X37 A;  2R46 A;  3AV0 A;  3VDP A;  2C5R A;  1HNX M;  4DR6 M;  1GLN A;  1J7K A;  2Y0T A;  3RGP A;  4GC9 A;  2R18 A;  4LF4 M;  2L2D A;  3L27 A;  3FKE A;  1OIP A;  2EO2 A;  3SBJ A;  5ITU A;  3U6L A;  3K9P A;  2MJ5 B;  4CJ6 A;  5EP2 A;  4DV5 M;  1T43 A;  2LXE A;  2NQ8 C;  4S12 A;  2I7P A;  1QZE A;  3HGI A;  4AW4 A;  3M7G A;  1IM2 A;  3IHP A;  1D0M A;  4YY3 M;  4X62 M;  3LQR A;  5LMU M;  4TUW A;  2R6F A;  2R44 A;  3BBZ A;  4MGH A;  1OAO C;  3UMM A;  4JN6 A;  2ZBK B;  3U61 A;  1FNN A;  3GPX A;  3PNY A;  2DWL A;  1AUA A;  4LJ5 A;  4LF6 M;  2K0B X;  3HHX A;  4JV5 M;  4JI2 M;  1G71 A;  3JR4 A;  3U6Q A;  2RGH A;  4JXJ A;  3FYD A;  2F5S A;  3HWS A;  4LRT A;  1QVR A;  4LF9 M;  1G3I A;  1AIP C;  4FWD A;  1NSF A;  4JYA M;  4B7G A;  2GQF A;  1NVM A;  3FYC A;  3AJI B;  2ERC A;  2JY7 A;  3B7Z A;  1SXJ A;  2VQF M;  1W5T A;  3KP0 E;  3EIE A;  3GQ3 A;  3GLH B;  3GQ4 A;  2LNH C;  1C1K A;  2XF3 A;  4B3R M;  2DKL A;  4WW0 A;  4OU7 A;  3C3D A;  1YE9 A;  1TH3 A;  1L2D A;  2C9O A;  2FFJ A;  1SXJ B;  2C99 A;  5EXP A;  2XZU A;  1L1T A;  1PRB A;  4CHT B;  1OKS A;  4FCV A;  5DFL A;  1PJT A;  3KOZ E;  3GLH E;  5H37 D;  1DGH B;  3JR5 A;  5BR8 M;  4G4R A;  4BLC A;  2YQZ A;  3CF6 E;  3K92 A;  4DV6 M;  1E94 E;  1D2N A;  1E9R A;  1WR1 B;  1ZMV A;  4G4Q A;  2JY5 A;  3IG5 A;  3FTC A;  4FCT A;  2KDL A;  1N36 M;  2R4J A;  5KQD A;  4MGZ E;  3RE8 A;  2MH8 A;  5A2Q S;  3GLG A;  1A5T A;  2O25 A;  4R3D A;  2YFQ A;  5FTJ A;  4DR1 M;  3SMS A;  4CGY B;  4IBG A;  1JB0 F;  3DOA A;  3KW6 A;  2APL A;  1OFH A;  3L28 A;  4LGY A;  2Z3X A;  4OW0 A;  4AKG A;  1VEK A;  2DI0 A;  3WHL A;  3VKH A;  4RF1 A;  1DGG A;  4D81 A;  2H5X A;  3KVW A;  3ZH9 B;  3SAS A;  3QYE A;  4HLQ A;  5EP1 A;  3TE6 A;  5F3W A;  2CV0 A;  5EP4 A;  4LFB M;  4I81 A;  3GLG B;  3VKG A;  3LVW A;  4RNA A;  3WHK A;  1IN6 A;  4LF7 M;  4LY6 A;  1NY6 A;  4QNM A;  5KPZ A;  1IN8 A;  5EJC A;  1IXZ A;  4XK8 F;  1Z59 A;  4AI6 A;  1PJQ A;  1WGL A;  1IN4 A;  4MGI E;  1JQJ C;  4D80 A;  5JI2 E;  3AOE C;  1VDL A;  2ZAN A;  2DZN B;  2CEA A;  2DAE A;  1T3T A;  1TR8 A;  4KLN A;  2QBY A;  3K2L A;  2DHY A;  4JI8 M;  3R9X B;  4L8R C;  4IBK A;  4KHP M;  4WUR A;  4FD2 A;  3HJQ A;  3I4Y A;  2DWZ B;  3DFZ A;  3U6E A;  2V6Z M;  2R65 A;  3HZJ A;  4IBE A;  4RF0 A;  2LTU A;  5EXT A;  4YHH M;  1XXH E;  4PCZ A;  2R62 A;  3I51 A;  2VQE M;  2YR0 A;  1FJG M;  1NJG A;  4IBI A;  2D7G A;  4DR7 M;  1OIZ A;  2XSZ D;  3HY5 A;  4FVM A;  2XFT A;  2KZS A;  3VDU A;  1DV0 A;  4GKK M;  1TTE A;  1Q02 A;  3SC3 A;  3HJS A;  1K82 A;  3FTF A;  1ZMW A;  1IXR C;  3K9O A;  1QDT A;  1TGU A;  2Y0Q A;  2XEP A;  1G41 A;  2M60 A;  3KOX E;  4AG6 A;  5C18 A;  3LCU A;  5ITR A;  2G8L A;  4M0D A;  2DVW B;  3J2P B;  4JI4 M;  3LQQ A;  2BNK A;  2KW0 A;  1IBL M;  2JNH A;  1DO2 A;  3SHG B;  3LMM A;  1NHW C;  1IY2 A;  3KDS E;  4IBB A;  1VQ1 A;  2DHR A;  2BJV A;  4D82 A;  4LFC M;  3B74 A;  1R5L A;  2L7H A;  2P5T A;  5C1B A;  2V1C A;  1VEG A;  4JI7 M;  5DYI A;  3DZD A;  4OVZ B;  1GL7 A;  2XLJ A;  2HWJ A;  4X64 M;  4W5W A;  3T1Y M;  2R4E A;  2KRU A;  2L09 A;  3FUW A;  3SAR A;  2CWB A;  1TH2 A;  1DO0 A;  4JI0 M;  3LCV B;  1NV9 A;  3TL4 X;  2QCU A;  5LMN M;  2R45 A;  2Z4R A;  3FUV A;  4RKU F;  1XB2 B;  2G5G X;  3TWL A;  3AOG A;  3GPU A;  1D0L A;  2YNM D;  3T6P A;  3GPP A;  2OPF A;  1L2B A;  5ITT A;  4CIZ A;  2FS1 A;  4M0W A;  3GLH A;  4B08 A;  2K47 A;  4JI5 M;  1QAO A;  4LF8 M;  4LFA M;  2JXN A;  4LRS A;  1XMO M;  1G4A E;  4NOO B;  1L1Z A;  2FOI C;  2QHO B;  3KFU G;  3SAT A;  3FRI A;  3PXG A;  1OJL A;  1Q39 A;  2CRU A;  1NHG C;  3J80 S;  2F4V M;  5E6J A;  1QUS A;  3CF0 A;  1QAM A;  1E9S A;  4GHL A;  7CAT A;  3HKP A;  4LJ9 A;  1DGH A;  2D7E A;  2FH0 A;  2LH0 A;  2DWN A;  3OTO M;  3J7A S;  3HJ8 A;  2KNV A;  1C7Y A;  1IQP A;  4PDG A;  1IXS A;  1R7R A;  4GC5 A;  1J5E M;  3MJ5 A;  3B7Q A;  5KO3 A;  5DNY A;  4G4N A;  3U6O A;  1JR3 E;  4QHT A;  2CP8 A;  3CGW A;  1QUT A;  4PD2 A;  3LW5 F;  4LZJ A;  4ITQ A;  3B7N A;  4MGY E;  3IG8 A;  1EFU B;  3FD9 A;  3T38 A;  2R0I A;  5FSW A;  3KS4 A;  4AZF A;  4G4O A;  3AOE A;  2QEN A;  2CFO A;  4K0K M;  1XNQ M;  1N78 A;  1IXS B;  4M9Z A;  3E21 A;  4KT0 F;  3U60 B;  2JZ1 A;  4GRI A;  1L8Q A;  3FTD A;  4L16 A;  3D8B A;  1TF0 B;  3RGS A;  2A5Y B;  1J09 A;  4KO8 A;  4OX9 M;  4NC6 A;  1IFY A;  2ZM6 M;  1NNU C;  3L25 A;  3CF2 A;  2K6B A;  1XWI A;  3L2A A;  2L4E A;  4LG2 A;  4Z8X A;  4P17 A;  1IN5 A;  3K8Z A;  3BOS A;  3C9P A;  3HHW A;  4DV4 M;  3TWM A;  1QYR A;  1V34 A;  2RGO A;  3MHV C;  4ZPX A;  2CV2 A;  2CHG A;  1HQY E;  5EP3 A;  1KYI A;  2WSC F;  1OAI A;  1TDZ A;  2LHC A;  1XXH A;  1HJP A;  2HKJ A;  2XH9 A;  4B3T M;  3GRY A;  5GKN A;  4HL4 A;  1PGY A;  4L78 A;  3VLF B;  5DYG A;  4F2L A;  2CE7 A;  1PJJ A;  1XHB A;  2N35 A;  3KXE C;  4F1I A;  4DV2 M;  2B3T A;  1E32 A;  2Z7J A;  3SMP A;  4DBG B;  4DR4 M;  2LVP C;  4MB7 A;  3A98 B;  2DAI A;  2OO9 A;  1NY5 A;  3THG A;  1QAQ A;  4MH0 E;  1XXH B;  5BPV A;  3I01 M;  1R6B X;  1TH4 A;  4IJE A;  1MN3 A;  1R4G A;  3A45 A;  3KSJ A;  4B7F A;  4B7H A;  1NNJ A;  1HT2 E;  2OOB A;  1LV7 A;  2LHG A;  3C3E A;  3AKZ A;  4LJ6 A;  4PT5 A;  2QQ8 A;  1QAN A;  2BJW A;  2HAK A;  4G6Z A;  4LGM A;  1I94 M;  4AKH A;  1Y8G A;  2UUA M;  4QOS A;  5L8R F;  4DUY M;  1UM8 A;  3HU1 A;  2ZTD A;  1DGB A;  3PNV A;  1YUB A;  1IY1 A;  4DV1 M;  2K9D A;  3NBX X;  4IBF A;  3UZU A;  1UFZ A;  2LVO C;  1VEJ A;  2UXB M;  5JI3 E;  4IBJ A;  2EA0 A;  2BWE A;  1YSY A;  5EQT A;  3GRV A;  5ITQ A;  1G59 A;  5EXX A;  1CUK A;  2QNJ A;  4LZZ A;  1N33 M;  3HHZ A;  1QQW A;  4IBD A;  1GJT A;  2MGW A;  4L15 A;  3KSX A;  3KOY E;  4NSO B;  1RU3 A;  3KS8 A;  4M9S A;  4JI6 M;  2DAG A;  1EE8 A;  1HT1 E;  3FRH A;  5KPT A;  1PM5 A;  2JY6 B;  4OVZ A;  2FE8 A;  3W68 A;  2WSE F;  2ZAO A;  3CTW B;  4LJ8 A;  4QHS A;  3SYK A;  2CUZ A;  2MRO B;  2C98 A;  4KOD A;  8CAT A;  1EIJ A;  2LBC A;  1WHC A;  1ORY B;  1SXJ D;  2I7N A;  3H4M A;  4JI3 M;  2VF8 A;  1QZM A;  3C58 A;  2RKO A;  2KXE A;  3F92 A;  2KHH A;  4GEW A;  3GLF E;  2UUC M;  2XFS A;  4B3M M;  2F5O A;  3U6D A;  4XGI A;  1KFV A;  2Y20 A;  3UK6 A;  1W5S A;  3SAW A;  2X8A A;  1GVN A;  3B9P A;  5ITX E;  2G3Q A;  1YLA A;  3VFD A;  2O5R A;  2QSF X;  4II7 A;  2LVQ D;  2RRU A;  1IY0 A;  4UN2 B;  4GHA A;  2UXD M;  1GJS A;  5KPR A;  2MR9 A;  3FUX A;  1H6U A;  3GLI E;  4DR5 M;  3E46 A;  3KP1 E;  1JR3 A;  3GRU A;  3UJN A;  4MM3 B;  3GQ5 A;  1I4W A;  1ZMU A;  1HR0 M;  4R7G A;  4NRW A;  3MMP A;  4EIW A;  1KSF X;  2HL7 A;  3KOW E;  3QAU A;  4GIP A;  4Z6Y A;  2JZ0 A;  3FUT A;  4FW9 A;  4G3O A;  2XSZ A;  2C96 A;  1DGF A;  5FTM A;  3A46 A;  4GMQ A;  2FNA A;  2LWX A;  3TQS A;  3U6C A;  2J7O A;  2KRK A;  2OOA A;  3NWL A;  3PFI A;  2UXC M;  4GKJ M;  2BWB A;  1HNW M;  3UGJ A;  2ZTC A;  4WP2 A;  1P3Q Q;  5FLX S;  4DR3 M;  3AL0 C;  2E5L M;  2DZO B;  2M5Z A;  4DV0 M;  2CHQ A;  2L6O A;  2DWM A;  3TPZ A;  5IRE B;  5KQ8 A;  3U6S A;  3U60 A;  4A3V B;  3U5Z A;  2DXI A;  2HHH M;  1Z6T A;  2JY8 A;  3AFH A;  1WIV A;  2GNO A;  3QYB A;  3W67 A;  2J5Y A;  2KNZ A;  3VK7 A;  1XMQ M;  3U61 B;  3BXW A;  1BVS A;  4REZ A;  4IJF A;  4XBO A;  3W0F A;  3L29 A;  2V1U A;  1IN7 A;  2O01 F;  1XC8 A;  4I5S A;  2Y21 A;  1WXQ A;  4MGK E;  2EKF A;  1VDD A;  4LCB A;  3ZCB B;  4LJ4 A;  3U5Z B;  2DAM A;  2HCB A;  5ITY A;  3VK8 A;  3DA1 A;  1ZQ9 A;  4DR2 M;  2CHV A;  3I04 M;  3ILK A;  1Q3C A;  2D7H A;  2UU9 M;  1SG9 A;  4NXM M;  2L4F A;  3R8F A;  3GP1 A;  4AG5 A;  4JI1 M;  5IZ7 D;  1GO5 A;  1VG5 A;  3ZC7 B;  1S3S A;  3PVS A;  5IT9 S;  2X49 A;  1F4I A;  1N77 A;  4CIS A;  1HNZ M;  2JA2 A;  3NBI A;  4Y28 F;  3T1H M;  1Z5A A;  4DUZ M;  1SXJ E;  4LJA A;  4QNR A;  3J81 S;  2KNA A;  2DEN A;  3HU3 A;  3QWL A;  1N32 M;  4Q7J A;  3GPY A;  4HEO A;  5E26 A;  4L4U A;  1K3W A;  1D0K A;  1ZV1 A;  1Q3B A;  2KA6 B;  3JAM S;  1HQC A;  2VII A;  2L7I A;  3J27 B;  2OQ4 A;  5IWA M;  3E4R A;  3ZQJ A;  1N34 M;  1L2C A;  3SYL A;  3H4J A;  3U6P A;  2WZJ A;  1SXJ C;  3A42 A;  3HX3 A;  3Q8X A;  4AQY M;  1IBK M;  1GAB A;  4I4L A;  4R71 A;  3LVV A;  2LVN C;  4GH9 A; 
#chains in the Genus database with same CATH homology
 3GRR A;  4IBC A;  4I8O A;  4PDI A;  4QOZ C;  2C9C A;  1GKI A;  2EUC A;  4BBA A;  4X66 M;  3K1J A;  4BB9 A;  3SFZ A;  3GLF A;  4M9X A;  3SAU A;  4NSR A;  3EIH A;  3U6M A;  1Z5C A;  2XGN A;  3D8L A;  4LF5 M;  2AHM A;  1Z5B A;  3HU2 A;  5ITX A;  1NJF A;  3FUU A;  1PJI A;  5FTN A;  4AKI A;  1ZAE A;  3MK6 A;  5FTL A;  4X65 M;  2Z4S A;  4IIW A;  4NXN M;  1G8P A;  2ZAM A;  1N75 A;  1JR3 D;  4FWG A;  3GLF B;  2J7N A;  1R2Y A;  3GLI A;  2KEB A;  2QP9 X;  2QZ4 A;  4NL4 H;  1TDH A;  4P16 A;  3TWK A;  3M6A A;  1GL6 A;  5EXS A;  3HHY A;  2QBY B;  4FWH A;  4DV3 M;  1MX0 A;  3FTE A;  3GO8 A;  3E9S A;  1R2Z A;  3L26 A;  1XNR M;  3SHF A;  4DV7 M;  2F5Q A;  2Q2E B;  2H1R A;  1OFI A;  3J7B A;  2X4A A;  4NRV A;  3W0L B;  4FCW A;  3T15 A;  3GLI B;  2QPA A;  2UUB M;  3RFW A;  5FTK A;  2CV1 A;  1K3X A;  4GIT A;  3M0E A;  4LJ7 A;  2F5P A;  2KZU A;  4B3S M;  3I4V A;  2W82 A;  2XZF A;  1IBM M;  1MU5 A;  3SAV A;  2C5R A;  1X37 A;  2R46 A;  3AV0 A;  3VDP A;  1HNX M;  4DR6 M;  1GLN A;  1J7K A;  2Y0T A;  3RGP A;  4GC9 A;  2R18 A;  4LF4 M;  3L27 A;  3FKE A;  2EO2 A;  3SBJ A;  5ITU A;  3U6L A;  5EP2 A;  4DV5 M;  2LXE A;  2NQ8 C;  4S12 A;  2I7P A;  3HGI A;  4AW4 A;  3M7G A;  1IM2 A;  4YY3 M;  5LMU M;  4X62 M;  3LQR A;  4TUW A;  4MGH A;  3UMM A;  4JN6 A;  2ZBK B;  3U61 A;  1FNN A;  3GPX A;  3PNY A;  2DWL A;  4LJ5 A;  4JV5 M;  4LF6 M;  3HHX A;  4JI2 M;  3JR4 A;  3U6Q A;  2RGH A;  4JXJ A;  3FYD A;  2F5S A;  3HWS A;  4LRT A;  1QVR A;  4LF9 M;  1G3I A;  4FWD A;  1NSF A;  4JYA M;  4B7G A;  1NVM A;  3FYC A;  3AJI B;  2ERC A;  1SXJ A;  2VQF M;  1W5T A;  3KP0 E;  3EIE A;  3GQ3 A;  3GLH B;  3GQ4 A;  2LNH C;  1C1K A;  2XF3 A;  4B3R M;  4WW0 A;  4OU7 A;  1YE9 A;  1TH3 A;  1L2D A;  2C9O A;  2FFJ A;  1SXJ B;  2C99 A;  5EXP A;  2XZU A;  1L1T A;  4CHT B;  4FCV A;  3KOZ E;  5H37 D;  3JR5 A;  1DGH B;  5BR8 M;  4G4R A;  4BLC A;  2YQZ A;  3CF6 E;  3K92 A;  4DV6 M;  1E94 E;  1D2N A;  1E9R A;  4G4Q A;  3IG5 A;  3FTC A;  4FCT A;  1N36 M;  2R4J A;  5KQD A;  4MGZ E;  3RE8 A;  5A2Q S;  3GLG A;  5FTJ A;  4R3D A;  4DR1 M;  2YFQ A;  3SMS A;  4CGY B;  4IBG A;  3DOA A;  3KW6 A;  1OFH A;  3L28 A;  4LGY A;  2Z3X A;  4OW0 A;  4AKG A;  3VKH A;  3WHL A;  4RF1 A;  1DGG A;  4D81 A;  3KVW A;  3ZH9 B;  3SAS A;  5EP1 A;  4HLQ A;  2CV0 A;  3TE6 A;  5F3W A;  4LFB M;  5EP4 A;  4I81 A;  3GLG B;  3VKG A;  3LVW A;  4RNA A;  3WHK A;  1IN6 A;  4LF7 M;  4LY6 A;  1NY6 A;  4QNM A;  5KPZ A;  1IN8 A;  5EJC A;  1IXZ A;  4AI6 A;  1Z59 A;  1IN4 A;  4MGI E;  1JQJ C;  4D80 A;  5JI2 E;  3AOE C;  2ZAN A;  2DZN B;  2CEA A;  1T3T A;  4KLN A;  2QBY A;  3K2L A;  3R9X B;  4JI8 M;  4L8R C;  4IBK A;  4KHP M;  4WUR A;  4FD2 A;  3HJQ A;  3I4Y A;  2DWZ B;  3DFZ A;  3U6E A;  2V6Z M;  2R65 A;  4IBE A;  4RF0 A;  5EXT A;  4YHH M;  4PCZ A;  2R62 A;  3I51 A;  2VQE M;  2YR0 A;  1FJG M;  1NJG A;  4IBI A;  2D7G A;  4DR7 M;  2XSZ D;  4FVM A;  2XFT A;  2KZS A;  3VDU A;  4GKK M;  3SC3 A;  3HJS A;  1K82 A;  3FTF A;  1IXR C;  1TGU A;  2Y0Q A;  2XEP A;  1G41 A;  2M60 A;  3KOX E;  4AG6 A;  5C18 A;  5ITR A;  2G8L A;  4M0D A;  2DVW B;  3J2P B;  4JI4 M;  3LQQ A;  2BNK A;  2KW0 A;  1IBL M;  1DO2 A;  3SHG B;  3LMM A;  1NHW C;  1IY2 A;  3KDS E;  4IBB A;  2DHR A;  2BJV A;  4D82 A;  4LFC M;  2L7H A;  2P5T A;  5C1B A;  2V1C A;  4JI7 M;  5DYI A;  3DZD A;  4OVZ B;  1GL7 A;  2XLJ A;  4X64 M;  4W5W A;  3T1Y M;  2R4E A;  2KRU A;  2L09 A;  3FUW A;  3SAR A;  1TH2 A;  1DO0 A;  4JI0 M;  3TL4 X;  2QCU A;  5LMN M;  2R45 A;  2Z4R A;  3FUV A;  2G5G X;  3TWL A;  3AOG A;  3GPU A;  2YNM D;  3GPP A;  2OPF A;  1L2B A;  5ITT A;  4M0W A;  3GLH A;  4B08 A;  2K47 A;  4JI5 M;  1QAO A;  4LF8 M;  4LFA M;  4LRS A;  1XMO M;  1G4A E;  4NOO B;  1L1Z A;  2FOI C;  3KFU G;  3SAT A;  3PXG A;  1OJL A;  1Q39 A;  3J80 S;  1NHG C;  2F4V M;  5E6J A;  3CF0 A;  1QAM A;  1E9S A;  4GHL A;  7CAT A;  3HKP A;  4LJ9 A;  1DGH A;  2D7E A;  2LH0 A;  2DWN A;  3OTO M;  3J7A S;  3HJ8 A;  1IQP A;  4PDG A;  4GC5 A;  1R7R A;  1J5E M;  3MJ5 A;  5KO3 A;  5DNY A;  4G4N A;  3U6O A;  4QHT A;  4PD2 A;  4ITQ A;  4LZJ A;  4MGY E;  3T38 A;  3IG8 A;  3FD9 A;  5FSW A;  4G4O A;  3KS4 A;  4AZF A;  3AOE A;  2QEN A;  2CFO A;  4K0K M;  1XNQ M;  1N78 A;  1IXS B;  4M9Z A;  3U60 B;  4GRI A;  1L8Q A;  3FTD A;  4L16 A;  3D8B A;  3RGS A;  2A5Y B;  1J09 A;  4KO8 A;  4OX9 M;  2ZM6 M;  1NNU C;  3L25 A;  3CF2 A;  1XWI A;  3L2A A;  4LG2 A;  4Z8X A;  1IN5 A;  3K8Z A;  3BOS A;  3HHW A;  4DV4 M;  3TWM A;  1QYR A;  2RGO A;  3MHV C;  4ZPX A;  2CV2 A;  2CHG A;  1HQY E;  5EP3 A;  1KYI A;  1TDZ A;  1XXH A;  2HKJ A;  2XH9 A;  4B3T M;  3GRY A;  5GKN A;  4HL4 A;  3VLF B;  4L78 A;  1PJJ A;  5DYG A;  2CE7 A;  1XHB A;  3KXE C;  4DV2 M;  1E32 A;  2Z7J A;  3SMP A;  4DR4 M;  4MB7 A;  3A98 B;  1NY5 A;  3THG A;  1QAQ A;  4MH0 E;  1XXH B;  5BPV A;  1R6B X;  1TH4 A;  4IJE A;  4B7F A;  3A45 A;  3KSJ A;  4B7H A;  1NNJ A;  1HT2 E;  1LV7 A;  3AKZ A;  4LJ6 A;  4PT5 A;  1QAN A;  2BJW A;  4G6Z A;  4LGM A;  1I94 M;  4AKH A;  2UUA M;  4QOS A;  4DUY M;  1UM8 A;  3HU1 A;  1DGB A;  3PNV A;  1YUB A;  1IY1 A;  4DV1 M;  4IBF A;  3UZU A;  2UXB M;  5JI3 E;  4IBJ A;  2EA0 A;  1YSY A;  5EQT A;  3GRV A;  5ITQ A;  1G59 A;  5EXX A;  4LZZ A;  1N33 M;  3HHZ A;  1QQW A;  4IBD A;  4L15 A;  3KSX A;  3KOY E;  4NSO B;  3KS8 A;  4M9S A;  4JI6 M;  1EE8 A;  1HT1 E;  5KPT A;  1PM5 A;  4OVZ A;  2FE8 A;  2ZAO A;  3CTW B;  4LJ8 A;  4QHS A;  3SYK A;  2CUZ A;  2C98 A;  4KOD A;  8CAT A;  4JI3 M;  1ORY B;  1SXJ D;  2I7N A;  3H4M A;  3C58 A;  1QZM A;  2RKO A;  2KXE A;  2UUC M;  2XFS A;  4B3M M;  2F5O A;  3U6D A;  4XGI A;  1KFV A;  2Y20 A;  3UK6 A;  1W5S A;  3SAW A;  2X8A A;  1GVN A;  3B9P A;  5ITX E;  3VFD A;  2O5R A;  4II7 A;  1IY0 A;  4GHA A;  2UXD M;  5KPR A;  3FUX A;  1H6U A;  4DR5 M;  3KP1 E;  1JR3 A;  3GRU A;  3UJN A;  4MM3 B;  3GQ5 A;  1I4W A;  1HR0 M;  4R7G A;  4NRW A;  4EIW A;  1KSF X;  2HL7 A;  3KOW E;  3QAU A;  4GIP A;  4Z6Y A;  3FUT A;  4FW9 A;  2XSZ A;  2C96 A;  1DGF A;  5FTM A;  3A46 A;  4GMQ A;  2FNA A;  2LWX A;  3TQS A;  3U6C A;  2J7O A;  2KRK A;  3NWL A;  3PFI A;  2UXC M;  4GKJ M;  1HNW M;  3UGJ A;  5FLX S;  4DR3 M;  3AL0 C;  2E5L M;  2DZO B;  2M5Z A;  4DV0 M;  2CHQ A;  2L6O A;  2DWM A;  3TPZ A;  5IRE B;  5KQ8 A;  3U6S A;  3U60 A;  4A3V B;  3U5Z A;  2DXI A;  2HHH M;  1Z6T A;  3AFH A;  1XMQ M;  3VK7 A;  3U61 B;  4REZ A;  3W0F A;  4IJF A;  4XBO A;  3L29 A;  2V1U A;  1IN7 A;  1XC8 A;  4I5S A;  2Y21 A;  1WXQ A;  4MGK E;  4LCB A;  1VDD A;  3U5Z B;  3ZCB B;  4LJ4 A;  2HCB A;  5ITY A;  3VK8 A;  3DA1 A;  1ZQ9 A;  4DR2 M;  2CHV A;  3ILK A;  1Q3C A;  2D7H A;  2UU9 M;  4NXM M;  3R8F A;  3GP1 A;  4AG5 A;  4JI1 M;  5IZ7 D;  3ZC7 B;  1S3S A;  3PVS A;  5IT9 S;  2X49 A;  1N77 A;  4CIS A;  1HNZ M;  2JA2 A;  3NBI A;  3T1H M;  1Z5A A;  4DUZ M;  1SXJ E;  4LJA A;  4QNR A;  3J81 S;  3HU3 A;  3QWL A;  1N32 M;  3GPY A;  5E26 A;  4L4U A;  1K3W A;  1Q3B A;  2KA6 B;  3JAM S;  1HQC A;  2VII A;  2L7I A;  3J27 B;  2OQ4 A;  5IWA M;  3E4R A;  1N34 M;  1L2C A;  2F5N A;  3SYL A;  3U6P A;  3A42 A;  1SXJ C;  3Q8X A;  4AQY M;  1IBK M;  4I4L A;  3LVV A;  4GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...